4YDZA

Stress-induced protein 1 from caenorhabditis elegans
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
135
structure length
135
Chain Sequence
FEDMMPYWAQRHSMLNNFNNIVPQQLNEVENTAQKFCVKLDVAAFKPEELKVNLEGHVLTIEGHHEVKTEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAPKTGSNTTVRALPIHTSAGHAVTQKPSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced protein 1
publication title The Chaperone Activity of the Developmental Small Heat Shock Protein Sip1 Is Regulated by pH-Dependent Conformational Changes.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
total genus 18
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ydzA00
1GMEA 2MNWA 4PCKA 3VQLA 2JKIS 2BOLA 5DS1A 3Q9QA 3AABA 2WJ7A 1WGVA 3AACA 3QORC 4YLCA 1SHSA 3EUDA 4RZKA 3W1ZA 3L1GA 2KMWA 1EJFA 4I88A 3L1EA 4MJHA 3VQMA 4YDZA 2WJ5A 2Y22A 2KLRA 2N3JA 3GLAA 4JUSA 4JUTA 3Q9PA 4YL9A 1RL1A 3QORB 4M5TA 4FEIA 2CG9X 2CR0A 3QORD 3IGFA 3GT6A 2XCMC 2N0KA 1X5MA 3GUFA 3N3EA 2Y1YA 3QORA 4M5SA 4PBDA 4ZJ9A 2O30A 5DS2A 3L1FA 4ELDA 4YE0A 4YLBA 2K8QA 1WH0A 2Y1ZA 1WFIA 5LUMA 2RH0A 3J07A
chains in the Genus database with same CATH superfamily
4RGMB 4DKFL 1Q9OA 5H94A 4P5RA 3KE0A 5DEZA 5IWLA 3F7RA 4OLVL 3P02A 4FMKA 5HHMB 2XQYG 2X87A 4ONFL 4PJ8C 4P2OB 1N4XL 5MEPB 1ZRUA 2HFEA 3T2LA 1PKOA 1RSYA 5EBMA 1VGEL 3DKHA 3X12A 3X3GH 1OWRM 4RRPM 4YUEH 1HWGB 1U8KB 4PJHF 4TL4A 4Z9KB 2EIMB 1AO7B 4P9ML 1JYNA 3BOVA 4U2ZA 2ED8A 4FQCH 1E90A 3HKZA 5I74B 3N44F 2F8IA 5E6IA 1AKPA 2XN2A 1TZHB 1PL3A 1VHPA 4P06A 4X5WB 2X6VA 2FQEA 4NWTL 5IVXA 3T6XA 1OF2A 1V3LA 3QUXA 3ALWA 3RDJA 1UGNA 3ABKB 2XIDA 1KLUB 4XP9L 2Y3NA 5F7BA 3Q2CA 2V17L 1W72H 4RNRB 4YIQA 4BK4A 4OT1L 1OPGH 2KLRA 4RDBA 5C0EA 1DO5A 1KBVA 1TQBC 3Q01A 4APQC 5ITFA 2F61A 1AXIB 2X4NA 1KCBA 3JUZA 1CIUA 4PUBL 1ZA6B 4UOZA 1U3ZA 1LK3L 3ASNB 1PKQA 3ZRSA 5DEGB 3ATAA 4M56A 3V6BR 3MUZ1 3ARGC 5TK4A 4V2CB 1X5KA 2X4UB 1F1GA 3V8CA 5E03A 3UFIA 2GJRA 2ZOLA 1W0VB 4ENED 1F4XH 3VFPB 1J8HE 2HVJA 2V2TA 2CAKA 2KLSA 2NXYB 3FQNA 1IIKA 3AVEA 4OLXH 3VYNA 4C54A 1ZE3H 3ETSA 3F58L 3QXAA 4U05A 3R8BB 3TBYA 3CFKB 2G5BA 1A25A 2APWA 4R8WH 1JIBA 1EBPA 5HDQH 3SDXA 3IJEB 3ZKMC 9PCYA 2BVOB 4QY8B 3QUHA 2VDRH 1U92A 3L3DB 3MBWB 5KEZA 1S9WA 1YEGH 1U3HA 4S1QH 3G6DH 3ZTEA 1F97A 4M6OH 5FHAH 3NK4A 3QZWG 3VI3E 1SYVB 3DSNB 4TSAH 5TE6L 5FKPA 4O02L 4JAMB 2WLIA 4PJGA 5HI3C 2CKNA 3GLZA 3DRTB 3ML8A 2FB4H 4OJFL 3SZKC 5IBLD 5JLZA 1C1EH 1UD3A 1R0AH 2GY5A 4G2AA 2WWMD 2WB7A 1JL8A 4V11A 4MNQA 5KSAD 3ULUL 2KI6A 4NQDD 3W11C 4WJ5B 1T2QL 5BRZE 3O6LL 1CF1A 1SHXA 2A74A 2NY2D 1OTTD 2E56A 1C7TA 1J5HA 4HGMA 2Z35B 3UBXG 1OM3H 2ZXWB 2JB6B 3RU8L 2AV1A 1U8MA 2J8HA 3OLGA 3AAZB 4TNVF 3OPZL 4EZKA 4I3GA 5HHVH 3M17A 3LIZA 2ZD0A 3FXIC 1N7MH 5C3LD 3JWOC 4GH7B 3IK2A 2IO5A 1FYHB 5T3ZH 4NO2A 3L3OB 1URLA 3AU1A 1NEZA 3A6OA 1O7VA 4MXVE 1NMCB 1ZHNA 4TLSA 2E7HA 4OF7A 2XY1A 4UTBL 3GK8H 1HQRB 2ALWA 2WZ5A 1EFXB 2A5UA 5MP6L 2DYSB 1NDGB 1JGUH 5DMIL 3MCLL 4GLRH 4BZ2L 3QE5A 2LU7A 3TIEA 3GXUB 5E6ZA 3B2VH 1UEMA 4FQJL 1M9SA 1SY6H 2ZX8A 2TAAA 4H26B 3A4FA 3Q5TA 2PWDA 4MSWA 4UT7L 4XN5A 1NAMA 1KCVH 5JR1H 3P77B 2XJLA 1V27A 5IY5B 2JKXA 2VDMB 4AL8L 1NFDA 4LPVA 3MLZL 2C9RA 1Q72L 4TNVK 1S5IH 2JKWA 1A6VH 1BGXL 2J5LC 1ZANL 3MOAL 1U8OA 4LP8A 3BAJA 4KZ0A 2TRYA 4ORZC 5DMKA 3RTQC 4IDJH 2FAUA 4QGYA 3E38A 5D72H 3KL3A 5CEZD 3VWKB 2ZG1A 4OZGB 3VW3L 4Y19A 1U93B 3HZYA 3V4VB 1XH1A 5CIPH 1I3RA 2VN7A 1V05A 3RUGB 1L9OA 1Z3GL 5JHAA 5EU6E 1SEQH 5FX3A 1QSEA 1VRSA 3W56A 1XGPB 3MRLB 3KBHE 1VERA 1RULL 2D31B 3CXHK 3ZU8A 3GZQA 5DZNA 4L2YA 2HKHH 3AUVA 1A3RH 2PYEB 4MMXB 5AW5B 1NCUA 4LRNH 1WFMA 5GGUA 5F7AA 4D7PA 3CDYA 1ZSDB 2K9FB 4IOIA 2K8MA 3I50H 4UM8B 1MHEB 4NN5C 3S98A 3RUGF 3QUZB 4JJOA 3BIKA 32C2A 3MLYL 3IJSB 5IJKA 1KIPB 2VABA 1BMWA 4MDJB 4WNSA 1S9KC 4DCQB 4E42B 4YSQA 1NSNL 1JSYA 1I7RA 3TT3L 1OB0A 4HF5L 5T3ZE 3GWJA 3OL2A 3QULA 2D7MA 3BP5A 2W0FB 2FR4A 5DO8A 3NFSL 4PJAF 4HS6B 2ODIA 1PPIA 3MAWA 2WBJD 2Z65C 1BIHA 2ZXEB 4U1NA 4NGHL 3SPVB 3B6SA 3ARXA 4HUKB 3ATBA 3T1FA 4DKEL 3KBFA 3U2SB 4JJHA 4DQOH 4X7TA 5B4MD 2ESVB 3HLAB 1GS8A 2XN9D 2HLEB 1CXIA 4OGAC 2Z93A 3L13A 4U1GB 1FNLA 3I9IA 3I3DA 1AQHA 5IFJA 3LKRB 4X5XA 4Y4FD 3APFA 2NNAA 1QEWB 1OCOB 3HAEG 1I7ZA 5BZWB 4L5FH 4LVEA 2UY7B 3LY6A 5JW4Q 3GSNA 1RZIB 2ZOUA 1MIEL 3GMPB 4U1LA 3REWB 4RX4A 5D2NA 3V10A 5TQ0H 4XVSH 1BG1A 3JQOB 4QRQA 1V3MA 1A4BA 5C6TL 3I02B 2XWJA 3NJKA 1TCRB 3CX5K 4R7XA 2OTWA 2QKIC 3IGKA 2Q8BL 1QSFE 2ZKHH 2VXTH 4JG0H 2K45A 5DRWA 4FF9A 3IB4A 2OTUA 3EIFA 5KBNC 4JMNA 3TN0D 3U79A 1AZVA 1WIPA 3AW5A 4D94A 2X3BA 4I3RH 4XMPH 4Y5VC 4Y5XA 1T1YA 4Z7VE 3ARED 1UOKA 1BG9A 5KOVC 1J8SA 2AJUH 1ZD6A 4U1JB 3BWSA 2YAPA 2OXGB 3JUYA 4NUGH 4QRRE 2IWKA 4WWID 4XT1C 1RPUA 2E75C 3B34A 3I74A 2IOOA 3KPPB 3LV3B 3V7AE 3VE0B 1JGEA 1TQUA 4P4KC 2ZKMX 4QHUB 4ETQA 5D1ZC 5KVDH 4N2NA 3VRIB 1CZ8H 2RJMA 4UINH 5F9OL 5DD1L 3L4WA 2ZCKH 4NQEB 2YXFA 5F1OB 3UO8B 5JW5B 1RHHA 1UEYA 3GXTA 4PRHB 4Y1AE 5FGCE 5GSRA 3NACH 5HY9B 4OBRA 2NZ9C 3PAVA 4UT9A 2CDFA 2CIIA 5E9DB 2ITCA 4PG9A 5FUOL 3W9EB 5JO5A 1S7VA 3SQRA 3ESOA 3RAJL 1GGUA 4M03A 2GJPA 2DQHH 4H0IA 3HFMH 4AE1A 4JKPL 3LIZL 3RGVA 2FX9H 1JPEA 5DHXB 1UASA 4W9CC 2BW4A 4TUJA 4MJ4A 3FQTA 2ZKWA 3S5LB 1CC3A 4MGXA 3UTOA 4FEIA 4QI3A 2AK4D 2XFGB 3KWWB 5EOQH 1DQVA 4LSDA 5HHPA 4NPYA 1N8OE 3LXUX 3QRLA 3IKCA 1CLZL 2OQJB 2CO3A 3PWPD 4H25B 4NQXA 3VU2A 1CE1H 5KVGE 1B2WH 3ECUA 4XB8A 2XJKA 3HUJA 3HZMB 4PJXE 2XIIA 4G7VH 3MLVL 5F7EH 4Y4KB 5SWSD 3TV8A 4ADJA 1E3FA 5EO9B 2VJ0A 1KPUB 3D8MA 3ETBJ 3GMLB 3US0A 4KKLD 3Q8BA 1HOCA 1OD7A 4N20A 5E5MA 1NAML 5A16A 4RWYL 4FQHB 1CLYH 2R15A 4FLSA 2AXGA 3Q5YA 1QABA 3I6GB 4I3SH 2QPUA 4HC1H 3FONA 1P1VA 3U7YH 1XR8A 1D5BB 3SE4A 4NOBA 5TE7H 4XCFL 3WLWD 4IBUA 3BD5A 4ZW7A 2F5AH 5IB2A 4WWNA 1F11A 4UF7C 4YO0B 5F1IA 3RNKA 3NCEB 3ZDZF 4HWZB 1L5GB 2HTKC 3IRPX 3LQZA 1Z1WA 3AWGA 4Y4HD 2Y23A 3JBG7 4HWEL 4AENB 1QFWH 3RVXC 4XMXA 4MCYA 4H44C 4BQCA 1DZBA 2IEPA 1D5ZB 3QZOA 1IC1A 5GGRA 5KVDE 2ATKB 2E9JA 2EVGA 4JFXA 4AYSA 4OLZH 4PRAA 5I15L 3CZUB 4MD4B 1YUHB 1MFDL 4KGLA 1JAEA 4JM0A 5HD8D 1GCFA 3U9PH 3AM8A 2EO7A 3HC3H 3Q8AA 3CZEA 1U8JA 2BLFA 1GC1H 1MUJB 1S7UA 3MR9B 4LCWD 1H6FA 2FJUB 1BQRA 3GMQA 3H0TB 1D2OA 3DMMA 5IKCA 2ZAIA 4IK7A 4PJFA 4N1CA 3QNXB 1WBZB 4NAQA 4YSCA 3PDDA 4YL9A 4G8GE 5K9JH 3CH1A 1VEOA 5AVZB 1QI5A 4FQPA 4FNTA 1UXLA 4ELME 4YDKL 2VR9A 1IEBA 1IC4H 1DVQA 1K6QL 3BH9A 5EEZA 4MNHA 2PW1A 4PGBA 2R0LL 4XP5H 4ZPTB 4CN1A 4F92B 5TQ2H 1SDDA 2C3WA 3WUWB 3Q2WA 4N2KA 2X7LA 1XSJA 3U36B 4FP8L 2N01B 5J8OA 1NBZB 2AJZA 2GT9B 3ARDB 2X70B 3BLBA 2OMXA 4MYWB 2IG2L 3DA0A 3FQ1A 1XEUA 4IHOA 3JWDL 3G6AB 4POUB 4LSQL 4JGUA 4JRXD 4ZZKA 2XG4A 1DHKA 3GSNL 4OJYA 3VH8G 4KTYA 5TDPB 4GUOA 5KS9E 3GGWB 1Z3RA 3ZL1A 4NKDA 3LQAH 4UAOC 1AKJB 3H42L 2X4OA 1PG7H 5GISL 5BO1H 5KSAA 2UZYA 1VEMA 4OF0A 4NQDA 1RP8A 2BNRE 2F2HA 1OANA 4DK6A 1AZZC 5CS7A 3RGBA 4NQTA 3SKJH 1VFAB 3MGOB 4CVUA 2YXVA 2HFFA 1JPFA 2ERJC 3F12A 3PDGA 1IM9A 2ZG3A 3HZVB 3VQ2C 3RX9A 2HJFA 4WUKH 1K2DB 5JPMC 3QDJD 1IGIH 4PVNA 4QUOA 3P3YA 4MA3A 5DK0B 4NJAH 4PJ8D 1OTUC 3EYUL 5A43C 2CBTA 5CGBA 1GGTA 5E8EA 4B0MB 2M26A 3LSOB 4XWGH 5JXAH 4G6FB 3ZIMA 3CFCL 1KBBA 3ASOB 4QTFA 3GMOA 4OCSL 4E9WA 1A5FL 3ZE1E 4EDXB 3QQ9C 4EIUA 1BFVL 2O26U 3O3AB 4AQ1A 2XWZA 3IGAA 1MZYA 4A55A 1UM5L 4L4TD 4GW5B 4YGAB 4PJ6A 3F7PC 3NPZB 3OPUA 1DBKL 4ZAKB 4Q9QL 2JMRA 2WZAA 1JGDB 4MKMA 4HKXA 1QKZH 1H0DA 1UT1A 4K23L 4UT9L 1HT6A 4HH8A 5ESVB 5GS1B 5DJ6B 3Q6GH 5IFHH 3IMBA 4IKLA 2ZPKH 3I75B 4L9LA 1ZLSL 3S36L 3IN2A 4M1GH 5C08A 4PRDB 3QJTB 4S1DD 4LARL 4APQD 1WAEA 1E9PA 2V37A 3H4HA 3Q9QA 4HFUL 5KYUA 4ICXA 1D7DA 3BQUD 3X1FA 4KU1A 3DPBB 4ZUUA 4X80H 3ZE2F 2FJFA 2W0LA 3QIWD 5F9JA 4AM0A 3ARGD 3CXHJ 3NUKA 2CCLA 4JVWA 2BVYA 4QO1A 1N0XH 3OGOE 1CFBA 1TTFA 1YC8A 3ILEA 4R96A 5D1ZB 4TQIA 2BWDA 4UQ3B 4BCXA 3ASWA 3OC5A 4HUVA 2AXHA 5D1XC 3GSXA 1U8IB 3WY4A 1J8RA 3WN5A 1AZUA 4M7ZB 1CPUA 4YHPA 2NNFA 3B37A 4ZX5A 1SGKA 4Z8FH 1XL4A 3DIVA 1JWMB 4HIIA 4U0QB 2APXA 3Q8FA 4WEBL 3ZKMD 3K72A 2YAFA 43C9B 4TTGA 2R8SL 4FNQA 5C09E 3NH7L 5EIQA 1UT2A 2EDLA 1WWWX 3B5TA 5IV2B 4P46A 1G7JA 4FA7B 2FX8H 4ZMAT 2HYMA 5CBAB 2IJ0C 3S4SB 1FNHA 5HI3D 3QH3B 2E7DA 3VD1A 1YEFH 3DV6A 3GS7A 5FYLE 2XY2A 4HWBA 2YSSA 5B8CA 2K7QA 4MDIB 4Z0XB 5IVNA 1T20A 2GK0B 1VF5C 5K59F 3NQKA 3OMNB 3M6DA 4DZBB 4POZC 4M6NL 2ZONA 3QDGE 4HKBA 2GABA 3W11D 5EZJA 2XN9A 1TG8A 5AAWC 5EA0L 4AIEA 5BW7C 5B39A 2OMZA 1KGIA 3SIKA 4H8WC 1NWOA 5CGYC 3A22A 4AW4A 1L9PA 3RFZC 3OKNA 4BZ1H 5E1HB 1A65A 3RB7A 1AYOA 3MV11 1RKRA 3CX5J 1F8TL 1LDPH 2UWEB 3CBJB 1CO1A 1MLCB 4X6CB 2WTOA 1BZ9B 2DQ6A 3S5ZA 2C9PA 3ABMB 4MD5A 4N3UA 4HWNA 1B88A 4EUPA 1KTKE 4NQCE 2W95A 3ZPDA 3O3UN 1IUZA 1J9SA 4EZJA 2IC2A 3KW8A 1LE5A 1M6OB 2BW5A 5KBLA 1FVEB 1DQML 2JCWA 1CYWA 3O2DA 4ZD3L 4DTGL 4O2EB 4CN4A 3GJFB 1T21A 1GGBL 4P8QA 5C0BB 1RMFH 4YDZA 3G9VA 3CIQA 3TN0A 5CN3A 1IM3A 3CVIH 3VVVA 2CCVA 4F2MB 1ZWIB 4YSOA 1HCFX 2UWEF 4AJVA 5JZ7D 5LGJA 5DS2A 2BVPB 2G60L 1Q9OB 4LAQL 4YE4H 5H94B 3KNBA 4EEEA 1SVBA 2Y36H 1P0SE 4N0CC 4NM4L 3UYRL 1MEXL 4JFQB 1BIIA 3M7FB 1GMEA 4FX5A 3KMDA 2AJXH 2WXOA 5IEHA 3IJYB 4BA8A 2EIEA 4Q0XH 5KSBE 3AXHA 5LHDA 4KKZA 2Z7WA 1KMGA 4FQIH 5EBMB 1L6PA 2G9HA 3L1GA 3MU3A 3X12B 2EILB 3D2TA 2EKSA 4K8RL 4P2RE 3K6OA 1SF3A 1KEGH 3HNTL 4MJ6A 1F3DH 5AZ2H 3UEZA 4EN3C 3FAXA 4Z7NE 5E6IB 1A14L 5E6RB 2E47A 4AYID 2I5YL 1WS7A 3VI4A 3ZE0B 2E4FA 5IVXB 3VD2A 1E4WH 5FF6B 4ANXA 4P0DA 1IKOP 1OF2B 8FABA 2K8QA 4NO3A 4K9JA 2JJTA 4KQ3L 1MJ7H 2N7AA 4CKQA 4F37F 4Z7WB 4YIQB 3P0YL 3DO3A 3SOTA 3THMH 5C0EB 3WO4C 1NGXA 3UG3A 5ITFB 4WI3A 2PCFA 2X4NB 4OLYH 1E6OH 2BFGA 5I82A 4PGEB 5ACLA 1PKQB 4OB5L 3CZNA 5IBUG 1MFAL 5AKVA 3FTYA 4GSDL 1AANA 3BT2H 1TCMA 5JHLH 1G0DA 4JM4L 4YGVB 1DBBH 2OBGA 4XP4L 3UIYA 4O51B 1NCDL 3NJXA 4BFOA 3MSPA 3EYSH 3PWPA 2CE6A 4FERA 4JVUA 4M8VA 1BZQK 4D0CA 1REIA 2HVJB 4RGNE 3FO1A 2V2TB 1H3PH 4NYLA 2O61A 4NP4H 5BPPA 1KENH 3QUKB 1JFQL 2X28A 2KS0A 3L7EB 3CFBB 1Q94A 3A6CH 5LWYL 3QC6X 4MNGA 1JMXA 1N18A 4UOW1 4JM2C 4Y16C 4JEGB 3SDXB 4F37K 3RVVC 5CJ8A 3TZVA 1U92B 4C56E 1IC5H 4OGAD 5GS0C 5JHDB 1T6VN 1U3HB 1MPAH 3NA9H 4E9SA 3PHQA 4F93B 1HSAA 1ICTA 1XR9A 4WWKA 2M8XA 3QCUL 4MMZC 2WLIB 3LN4A 1XF4A 4PJGB 2AVFA 3RG1C 2P5ED 4GAGL 1CR9L 1NCWH 4OGXL 4OZHB 5DD6A 1L7TH 3K4DA 3POCA 4GKLA 4N3TA 5JLZB 1UA6H 3RBGA 2YIHA 1J5OL 3BFQG 1A1OB 3MMEA 4KXZH 2XZCH 4DFIA 4XNUH 4OCXL 5GGVL 1AACA 4OGZA 5CJXA 2XZAH 2ZX6A 4FD0A 3WYRA 3NG5A 2FQFA 2E9WA 1NLBL 1HIML 1BVOA 2WBKA 2X1OA 3T0XA 1T0MA 2A74B 1EXUB 4ONOA 1KSRA 1HESA 2JIXD 2KDGA 1QSVA 3WFBL 3BGAA 2Q76A 4A2EA 4PJGF 2AV1B 1TQVA 2F54D 3MRNB 1Y6NR 2VW6A 3FJTA 2XPZA 3SE8H 3ZIYA 5HHNA 2N0MA 1ZE3C 5AOJA 1U42A 4WFFE 2VWEC 4LCWA 2W38A 1DZ0A 5IJDC 3FS9A 4LVOC 4Z77A 2ZUVA 5HDBB 3AU1B 4M43L 4LAJH 2B1AH 1BEYL 1NEZB 1T89A 5I71C 1ZHNB 1WAAE 3SQBB 3UAJC 1I1CA 4JFDD 4P4KD 1Z9LA 3NZHL 4CMHC 4HWBL 5I1IH 2IAAC 1NCHA 1SOSA 4PEEA 5INDA 4I0PC 2XG5B 3VXRE 3TIEB 1F90H 3BKYH 4KO9A 1AMYA 4N0YH 1EHLL 5FYKD 5K9QG 1IC7L 4UZUA 4M00A 3QI9A 2FEEI 1Z7JA 4MSWB 4LCCA 2CQVA 2NZ9D 1NAMB 2FHBA 1CDCA 4YC2C 5DZ9A 3KLLA 4ZTPL 5HDBF 1NFDB 3E2HC 4IM8A 2MKLC 4XPAL 5BNXD 1I85C 3LNEA 3L7FB 2DQIH 4NAMA 1ZLDA 4LCIL 4N1EA 3KH4A 2QV2A 2F53D 2C1PA 5AW2B 3AMKA 4XPFL 1QBAA 5L7XL 3UACA 1FG9C 4JRXA 4QYAA 3HNSH 3IDXL 3IJHA 4Y19B 3NJIA 4JZOA 1I3RB 5LGHH 3BGFB 4ESKA 4ZS7L 1CU4H 1KDIA 2V5RA 2NX5A 5K9KA 2WOBA 2DKUA 4MJHA 2EICA 1IBHA 4FS0A 2BZ7A 3QR0A 4EN2A 2FWSA 1JXKA 3QEUA 4PLKC 4QAWA 4NHUB 5FO7A 5GGUB 3QDJA 3GBNH 3NSCA 5FGRA 4IOIB 5F3FA 1HH6A 3UYRH 1YRKA 2VW7A 2MHAA 4YZFF 2R2EA 3WKNA 3FW6A 1AXTH 1RZ8A 1X9QA 4IKIA 2FYVA 5IMLA 3FOLA 5DJXB 2BINA 5IQLA 3KR3L 3SDDB 1BYPA 1DVZA 4IEFB 3TBBA 4WV1C 1Q8MA 5PCYA 1SN0A 2D4FA 5JIKA 5HGGS 2Q8AL 3O6KH 3BAEL 4M61B 2HTKD 4Y9FA 1BOGA 1A7NL 1NDMA 3BP5B 1ZTXH 4YSTA 3UPCA 2BS71 4JKMA 4U1NB 2ZSVA 1KJMA 3O6FC 3T1FB 4X7TB 1LQSR 3OX8A 3SOBH 1T7YA 2Z93B 4PWEA 2YWZA 3KWXA 4I77L 1IGCL 2G5RA 4GRMA 4L3CA 4X5XB 5MI0B 5T1LD 2NNAB 3IE4A 1NC4D 4RZCA 1ZLWH 4CKVX 1WIOA 3BQUA 1WFOA 2HRPL 3HE7C 4KK8C 1LGVA 4HJTA 4HHWA 3TCTA 4AQ8A 2OAAA 2J4WH 3DGDA 3QIWA 4WGVB 5D7LE 1AIZA 3L9BA 4U1LB 1TITA 1PTZA 2UVFA 3MV7E 3MVSA 1KTRL 1AXSA 1NCGA 2B77A 2XWJB 3PAYA 2OTWB 3HPJA 4PWGA 5EH1A 4HEPA 2GBUA 4XNQA 4B95C 5CKGA 4OFIA 4AYEC 1T1ZA 4WI4A 5DRWB 1W8EA 1KBGH 2OTUB 4QXUH 3HG3A 2CCWA 1BYOA 4I1PA 4HSCX 5FM8A 5ALBL 3CN3A 2ZP0T 5L8LB 1JZ6A 3VUAA 2XTSA 3D6GA 4S0HA 4Y5XB 2OL3A 3CHRA 5HP5A 1LEGA 4I2XB 4ABUA 1EXHA 3W39A 2PP7A 4YXKH 2FGZA 3OHMB 3FSWA 3STZA 2XQBH 2NY7H 1RUKH 1OGTB 2CUHA 4YFEA 5C0NC 3C5JB 3D05A 3ML9A 4PMFA 4KHTH 3V6OE 5AAPA 5IEKA 3EGSA 3S3BB 4JN1H 3VGGA 3C2SA 4FCHA 1EO7A 1JGEB 5TPWL 5FC9A 5GS3A 1R17A 3CZFA 3WCYA 4JDEA 1OVZA 1INDH 1RVFL 4LSVH 5FFOA 3VYPA 4HW6A 2NY5C 5IQNA 1NPJA 1U41A 4TOYH 1RZGA 3HMWL 1F4WL 1QOKA 3MTXA 5GGQH 1RHHB 4HXAH 4KNUA 1G5GA 2BX5A 3OAWA 2Y3AA 5D7JA 2CDFB 5JHMA 4PG9B 4JZJA 5AOIA 5JO5B 4FQXC 1S7VB 1MWAA 2VLRB 5HYJE 3MO1A 3FCTB 4XP1L 2NY6C 3OZ9H 3SDCD 2E59A 4WTZG 3FFCE 3TEXA 2KZ1B 2O5YL 4IKJA 4JE4B 1A7BA 3FT1A 3JWNC 3QZMA 3N1GC 3FQTB 2WLYA 2PNDA 3FNKA 4PBXA 4WWOA 1YY9C 3O0LA 1K8DB 4GG6B 3RZCC 2VB5A 3MRDA 1CFQA 2FRGP 4DEPC 5HHPB 2C3XA 3DUHA 3NIGB 4FTVD 4NQXB 1PJWA 3D08A 2CJ3A 3A23A 3QDMA 1ILUA 3EJPA 3MA7A 3MRHA 5GZOC 4PJCF 3FDWA 2UYLA 3HUJB 4ZO6A 3VD7A 4E5XG 4LSSL 3ZZQA 1E4KC 2BIIA 5FK9A 1F86A 1S9YA 3CSBA 3NJLA 4KKAC 2BNQD 1HOCB 5A16B 5E5MB 2N1KA 1EEYB 1BAFL 3EDEA 2YQGA 4O00A 2OJZH 2I27N 1BQHB 3ZTJG 3T4AC 2OP4H 4GRWH 2HJKA 4X0NA 4AGPA 1HAWA 1YEHL 4V33A 4DEUA 3Q6FB 4AGOA 4J4PC 2X1QA 4QRTB 4KGJA 1HKFA 3NIGF 4NT6B 5HI5C 1KPVB 3BW9A 1F6FB 3AUWB 4F24A 5IB2B 1F11B 3T08A 1SJXA 5EG6C 2UXFA 1V3KA 3DECA 2BJMH 3TCLA 5BVPL 4UIKH 2BHUA 5FO2A 2GJ6E 5D1XD 4B3EA 2VDOL 4D8PA 1E2ZA 1QNZL 4HUMB 4JPWL 4YH6A 4XI5C 3DHJA 4JY6B 4JFXB 4M7KL 3EYFA 4RAVA 2BS9A 4PRAB 4U6YA 4DO5A 1QPXA 4P48A 2NXZB 1R5WB 3V5DA 2E27L 2P42B 1EO8H 2AJVH 3DX1A 3PJSB 1ASQA 1A4AA 1GS6X 1U6AL 2ILLA 4KDTA 4R5XA 1U8HB 2Y2TA 3GS0A 1U8JB 4PJHE 4YHOL 3EUUA 1S7UB 2I85A 1JNLL 2KL6A 1Y18B 2FL5A 4EI0A 6TAAA 1JI2A 3MRPA 3BRDA 4EOWH 2DQTH 3DMMB 4XNBA 4GUQA 2L4OA 4I85A 1E5BA 3KYNA 4FYQA 5EZIL 1YLBB 2WP3O 1MHPL 4F7KA 4DEWA 1FIGH 3CH1B 4N90E 4GYBA 1THAA 2AC0A 2CXKA 5AOMA 2GTWA 3V4PA 2VDQH 1IEBB 2ZXDA 1AGBA 5IT2L 3CC5A 4M5TA 4POZD 4A6YH 4MNHB 2PW1B 4XTRC 4D9QE 2JCCB 1SDDB 1AO7E 2WNGA 4PV9A 4R90L 2Y07L 4PWJA 1TPXB 3KVDD 4JRYE 4WK4B 5E99H 3UJIL 4BELD 1OAQL 1X5YA 5CGYD 5E1IA 1LQBC 4PJFF 4TUOA 5E8PA 3WAJA 3MV01 3RPIA 4J12A 2IFFL 2OMXB 1MFNA 3NTCL 2VXQH 5D7IF 2GFBA 3PP4H 4IHOB 3IWUA 1BBDL 1ZS8A 4F2FA 5T3XD 1CQKA 3DJTA 3FB5A 4G71B 3BZDA 5D6DC 3ZKXC 1OLZA 3RWGA 2Q5BA 1CDUA 3FU6A 1VADB 4NKDB 3N0AA 2VDKB 3GKWH 2X4OB 1GC1C 5FB8A 2OYKA 2UZYB 2J25A 2WTPA 1RZJL 2X1WL 5D7KE 2JIXA 5T1JA 2HFFB 3F12B 1IM9B 4Y5VA 3F64A 1S3RA 2F54A 2OL3L 3QUMA 5J1SC 2Z31C 4N0CD 1XQ4A 1N9PA 1A4CA 2VN6A 4XE0A 1B6DA 3KPRE 1J1OH 3PABA 4HJSA 4XBEL 1IVTA 1XGQA 1RUML 3D9AH 3KM2A 1ZOXA 2DKMA 2VSKB 3JTBA 1OGSA 2DH3A 4S1RL 3CN2A 1FDLH 1RJZA 1IAIM 3BUPA 4HK0B 5HHXL 2XUWA 4EN3D 5HYIA 2PYFB 4AQ1B 1DCEA 3IGAB 3MRFB 3O4OC 1E9OB 1IAMA 2VC2L 3QEGH 1UACH 2EDQA 1MQKL 1PFOA 1EGJA 3BH4A 4AQAB 3IS1X 1QBLH 1NA8A 3E80A 4HKXB 3QRGH 4MXWL 4GEJA 4L9LB 4K7PX 1MWAL 1HL8A 2DQUL 7TAAA 5C08B 4DVRL 4WTWA 3FHQA 1MRFH 4Z23A 1E9PB 1YDPA 4W9FC 5KYUB 5CILH 4P3CH 3MV9A 3UABA 3MYJA 1M05B 5D7HA 5F9JB 3GUTA 5LG6A 1UJ3A 1QTYT 4GNKB 4QO1B 1M7IB 3IFNH 1CLVA 2EP6A 1D9KB 1OF0A 1O7DC 1FNFA 1TQTA 2ZUYA 3WN5B 1HILB 1FZMA 1A9BA 4FLOA 2B7DT 3GIVA 4YHPB 4M5ZH 5D1QA 3MJGX 1EIBA 5CZVL 5IW3A 2I32A 4TVSa 1CXEA 2X2UA 5HBBA 1CDBA 2RGSA 3LZFH 3VA6A 4Y2DC 2BIHA 1LO4H 5BS0D 1AG6A 4HIIB 2GSIA 3RA7H 4LFHD 4M93C 4YN3A 2NR6A 4JM2D 1UH2A 4Y16D 4XNZC 3K72B 3RVVD 2WBWB 1WITA 3B2XA 4DAGL 4UV7L 5DF0A 3U4KA 5GS0D 1LP9A 2P80A 4RFOH 4JPVL 1UCBL 2UVEA 1AOHA 5DJYA 4P46B 3TJPA 1G7JB 5HHOE 3BLKA 3SGDH 1KGJA 3WNLA 2Q10A 3DX8A 5I6PA 3T1WA 4JFFD 3D52A 3A4AA 4AV0A 4AYFA 1PBYA 3DV6B 1G0YR 2BIPA 2CGZA 2YSSB 4Q56A 5B8CB 3W0WD 4OUUB 1IKFL 1HINH 4HIHB 3ULSA 4F7PB 1HC1A 4HPYL 4IBSA 2G2RB 4OLUL 4ZO8A 1FWXA 1YYMH 4JO8A 5C0JA 3ES6A 4IRZH 4HKBB 5D1ZI 1BA9A 5EZJB 4DESA 2J6EA 3QCTH 5B39B 2OMZB 2WWOA 3QFJA 4B9PA 4CU7A 1FG2A 4XO4A 1ZY9A 1OGPA 4PB9L 4WFGE 5C97A 3F62A 3OKNB 4YHNA 3RUGE 5T1LA 3NCJH 1VZGA 1Y0LA 4ZFQA 4P5SA 5GGVY 4YXHH 2XKUA 2NW2A 1G9MH 4EUPB 2Z7ZA 3RL1A 4J5VA 3RWDA 3ZHNA 5IB1A 3GRBA 2PYEE 3UAJD 1BMZA 1Z9OA 1LE5B 5AVQB 4M8UA 4PJAE 2ZWZA 2XA3A 2VR3A 4X4MA 4EF3A 3O45B 2IMNA 4HJ0D 2LLLA 2EUZA 2VGLM 2C9VA 4I0PD 2IBBA 3V4PL 2Y2WA 2HN7A 1ZDQA 1IM3B 4G6MH 2WXPA 1J5IA 2YARA 1EZVY 3HW7A 2WWNA 2DWEA 3Q9PA 4PRIA 4AXWB 2VZSA 5LGJB 2VQ1A 4U0RB 4EIBA 3A6BL 4OV5A 5KVFH 3KNBB 3D48R 2XQYA 4JO2H 1K4DB 3T2OA 4PJ5A 4QHLB 1WFTA 1GW6A 3GEFA 2W1NA 4C58B 3DHUA 1X4ZA 4WHCA 2LE9A 4UTAA 4NM8H 1GL4B 4S2SB 1EV2E 2G9HB 3AADB 1FYTB 1F02I 3IJ8A 5HJBA 3EXJA 2EKSB 2H0FA 4FA6A 2UX6A 1VDGA 2XV2A 3MRCA 3P3TA 4GO8A 4IU2A 4UBDC 4L3EA 3CLFH 3DX7A 3GIZH 4MJ6B 1A1NA 4X8JB 5TFSH 4R3SB 1CI5A 2DW5A 3KDMA 4HS8L 3TYFB 2HPTA 1BZEA 3CFMA 4F1ZA 3VI4B 3BKCL 1MFEL 2WW8A 2ATPA 8FABB 2NUPA 3P0VL 2P26A 2RR3A 1JZ5A 1IAKA 4NO3B 1X5MA 3S35H 5E2TL 7CGTA 2XLLA 3U4EA 1V10A 4R97B 1NCAH 3WNJA 2I07A 2H3NB 4I18A 4WJKB 1PY9A 3U9UB 4IBYA 5EOCL 4HGKC 4X9YA 4PLKD 3SDCA 5EF2A 1NGXB 3E3QE 5LG1A 3QUML 4J3WA 2PCFB 4X0KB 3SD2A 5JPMA 1FFNB 1ERNA 4LKCB 4XCCL 3CVHL 1KTDA 4P07A 1IBGH 4HHAA 4NQVA 1JHKL 3VI4F 1A21A 2XVLA 4ODSH 1X44A 5DO2C 2DMKA 5GSVA 3X13B 1V8HA 2ARJQ 4LB8A 4BHUI 1CXLA 4B9KC 3LVEA 1BVLB 1M42A 1GYVA 3GF8A 3FO1B 2HFGH 4O58H 4NYLB 4XBGB 1KV3A 5AYQA 5IHBA 2P4AB 1EGJL 2FEDC 3VXPA 1B0RB 2GJZB 1NKGA 1Q94B 4X6EA 2BNQA 3WL9A 3O6FD 4N8CH 4NUJA 1TMQA 3DJRA 1BZ7B 4DUXA 5CLWA 4A7GA 2OJ1A 3N1FC 3TZVB 1RPQA 2ZXGA 3H9ZA 4G7YH 1TZOA 3BDXA 1BCIA 3QZWA 3PHQB 4N0UA 3L1OH 3MCG1 4YFLI 1HSAB 4WWKB 1ET7A 1MCFA 4ZG1A 1N5YL 2NCEA 3B1TA 4KK8D 3RLSA 3HE7D 1ID5I 1NUGA 3LN4B 4ELDA 3HMXA 1IBYA 3P9WB 5E9DE 1KJ3L 1XTMA 2L7QA 2I26N 2ORBH 4DKDC 5L2JA 4NN7C 3MMEB 3QQ4B 4G8AC 3DDGA 2OZ4A 1N5AA 3ESUF 2XYBA 3GHPA 1OAZL 3FUEA 2IPUK 2JKLA 3QJZA 1HFUA 2ID5A 3LZNA 3TJEL 2RFXB 4HKJA 1BJ1H 2ZX9A 1FN4A 4UTCA 5H37H 5L88L 1T0MB 5T1DH 3UBXA 4AYMC 2IDQA 1U91A 3E6HA 5KUMA 2Q76B 3WFCH 4N9GA 4M6AA 2DMGA 1UD5A 4R7VA 1MKFA 2BVQA 2GTZA 2YUVA 5AW9B 2BRRH 1IGFL 5AB1A 2XHNA 2HT3C 3QUYB 3AZUA 4XMKL 1OY3B 1JV2A 4XNXH 4HCIA 5C0ND 4M48H 2HCZX 3ZDZE 4RBPK 1BX2A 1ZGLP 2BIMA 2YSTA 1MW3A 4RISH 3ZZLA 2DYPD 3J27A 4OCRL 4XAWL 1IAII 2WLHA 2YRBA 1YN7A 5F7FA 5C8JA 3GXIA 2DY2A 3VGAC 5DC9B 5C0FA 3JVGC 4E9LA 5BRQA 4RMRA 2FATH 1FORH 1AE6L 1AP2A 3QI9B 2KZBA 3VU1A 5BW7A 4LCCB 2J6EL 2FJSA 2FSDA 5LJYH 4FQXD 4M93B 1PFCA 4FKEA 3NCWA 1I9RH 2AKRA 4ZMQA 3B2UD 5E4AA 1QTPA 3M07A 2C1PB 1BDYA 1CBVH 4LF3A 2CJUH 3RL2B 4CU6A 3Q2NA 1IE4A 1FL6B 1CURA 1JS4A 3ZY7A 1YY9D 4QLWA 4CGUB 4U1HA 4WVRA 3U1PA 4JZOB 3RZCD 1WICA 1XH2A 4GKZB 2XTJC 3FHEA 2VCOA 1PDKA 4ODXB 4OM1H 4HWUA 2HPOA 5IMKA 2NX5B 5K9KB 3CN4A 4AK1A 4FL4B 1MRDL 5GZOD 4LLVA 2F58L 2MTPA 3NQIA 4N8UA 1U8QA 4MLSA 4QMEA 2WHVA 3RBSA 3SYAA 1FFPA 1PF3A 4K9EH 2DM4A 3WXVL 5I18H 3ECBA 2WLLB 3LNFA 3SPCA 4OF3A 5FO7B 1N3NB 4OZFH 4UYPA 3EYOB 4TYUA 1HH6B 4GKSA 4E41D 2RD0A 5I23A 2VH5L 2NY3C 4FHBD 2R2EB 4Y9EA 3T77B 1RZ8B 1ZV9A 5DS8A 3UTTB 1XCTA 4J4PD 1G5AA 1FO0H 4UTAL 5FECA 1HSBA 5IMLB 3FOLB 3NRQA 5HI5D 1KYAA 4A7UA 4N2GA 2YLHA 3U6XA 3NIFB 4TLUA 1WHOA 2HG5B 5I1HH 1BXVA 2WKLA 4EN3A 1H8NA 3MLSH 4QOKD 3ROLA 3SCMA 5KYWB 3JTTB 1UUSA 4DK3A 3PFUA 1BOGB 1DE4A 1KZQA 5SX5K 3WY3A 5DVLA 2Z3FA 3UZVA 2ZSVB 3KEDA 4BH8A 2N7BA 3P54A 4EXKA 1CLOL 1MCNA 4XI5D 4AMKH 2KZKA 4XVTH 4D9LH 3CC1A 4Z0BL 5FO8A 1NLDL 5TGBA 2DWSA 4K94L 4L3CB 3ALXA 4M8RA 3B9VA 4P23C 1SNRA 3HAEA 3OJDB 3WV0A 3BQUB 3LEYH 3FT4A 1MFBL 3D0LB 1UG9A 2XVKA 3VI3A 1OV8A 2P1YA 1U36A 3CFDA 4GXVL 4XPTH 2E0PA 4B96A 4OJEH 2QSVA 2C26A 2CNYA 2FX7L 4KROB 1W8OA 2D7PA 1BQSA 2I9LA 5I30L 4OIIH 2IBZX 4XNQB 3EFFA 4LCUA 1E27B 5L4IA 3ULVL 5IHHA 1TEYA 3O8XC 4BSVB 1WP6A 1G6RH 2O6PA 4L2LA 3WTVA 1F13A 1D7CA 1XVSA 2YBRA 5BS0A 4XTRD 2X89D 3OG4B 4LOUC 5BRZA 1F3JA 1AGEA 3GD1C 4Y16A 2OL3B 3P4NA 3BH8B 5C0GA 3U82B 1CK0L 1LEGB 3KPLA 1UWXK 5KVEE 3AU0A 1N68A 1IFHH 2PPCA 3W39B 3ZE2E 1J05B 1XF2A 3STZB 4U6VL 4HK3J 4HU2A 3C5ZC 4PGCA 3LQMA 1WJ3A 4KQ4H 4KVCH 3GO1H 2NLJA 4JFFA 3DVGB 3BDYL 3QVAA 4NBZB 3UZQA 5E9NA 4DGWC 5IEKB 2K3TA 1W72A 2K7PA 3DXAE 3FFDA 5DHVH 5ILTL 5LXGH 1P6WA 3FTVA 3N42F 1D5IH 3LS5H 4NUPA 3C8DA 3W0WA 4CDHA 4GAJL 1PS3A 1W16A 5KG9A 5DHMC 2VC2B 2OZ4L 4F91B 2PW2A 3HC0A 3JZYA 4N2AA 4PRNA 4PTUA 4KJQD 1LDSA 3U0PB 5E2UL 4F7TA 5C0RL 2YEZA 1THCA 2AJYH 2HAZA 1QRNB 3QJFB 1KIQB 4Q14A 5D7JB 2DJSA 2QHLA 5ADOL 2E6JA 2BK8A 4JZJB 4LHJB 2QGDA 2IANE 4CJ1A 5B3JF 1MWAB 1SM3L 5JXEC 4G83A 2DQEH 3MO1B 2FJGA 5I1LB 4P2CG 5D4JA 1JPSH 4G72B 2XIBA 3PQYD 4KX7A 2Z31D 2QJDA 3WKYA 1UUNA 4MAZA 3PS6A 2E74C 1KCUL 2Y5TA 4WO0A 1I7TB 4PV1C 1D3CA 1XFPA 5K59E 5D4HA 1OGAD 1ZAGA 1R33A 3WLBB 1C16A 3QDMB 4PY7B 3K2UH 1KELL 1NPUA 1WD8A 5CD5C 3OF6D 4N26A 4KI1A 1P7BA 1Q4NX 2ZT9C 4JN2A 1DQKA 3TWCH 1S9YB 1ID2A 3N3EA 1XGYL 5KWYC 4FYRA 2AQ2A 1DJSA 4HGWA 5EF3A 4YK4B 4DWHA 1JTTA 3WS3A 5FOBA 2W92A 2P8PA 4W9DC 1T22A 3QBTB 1AIFB 2HJKB 4B7IA 4MQSB 4O5LL 3IF1B 5D9SB 1K8IA 3UAAA 4PIRF 3RRQA 5I0XA 4H88L 2D3LA 3BW9B 3OKLB 5H37G 1QW9A 5E8DH 1DL7L 1XBDA 3U7WL 3RFRA 2WUCH 3SBWA 3M46A 4G9DA 4L29B 5F7MC 4DQAA 3IM1A 5MHSD 1UD4A 4ZUWA 4D8OA 3QORA 1RFDH 3KJ6H 2IWGA 1F5WA 2UWEE 3EHBB 2EDEA 1L9TA 5IOPB 1MHHA 2PCXA 2R39A 3EYFB 4RAVB 5F89A 2RCSL 4U6YB 1OCWH 4P9HH 4Y2DD 2A9ML 5AALA 3DIDA 4YEEA 4G8EA 1BJMA 1ND0A 4WHYH 5LCVH 3CIAA 4NO5A 5AZEL 12E8L 3UO1L 4QJ4B 1J8KA 2AK1H 2CO1A 1FH5L 3V0VA 3MXWL 4PVLA 5I28A 2FL5B 1SY6A 3MXVH 3R1GL 2DWYA 4GIPD 4CW1B 4DP9X 3BPCA 5FO9A 1A7RL 2MEJB 3KH3A 4UV4H 1WZAA 4XXCC 5E4EC 1YEIL 2LLNA 2CH8A 2IDCA 1PX4A 2CR6A 1J10A 4X7CC 1KCWA 1M1XA 1MNUH 3DHMA 2XTJB 4YFDB 3B9DA 1AGBB 2J71A 2XV6B 3CC5B 3LNDA 1FNSH 1AQ8A 3KPQB 4JHAH 1FNEA 2WJ5A 4LMQE 4GXUM 4PV9B 5CIPA 2H8PA 4JY5L 1WZ1L 4TUOB 1N19A 5CLZA 2X5PA 3ZTNL 5E8PB 4A37A 1MCEA 2G2NA 5BV7L 3T0AA 3GSUB 2OJEA 5HDRA 3UTZB 1XT5A 5DRZA 1U2HA 2AITA 2AQPA 5ACMA 2W9DH 1CGVA 4QEGA 1JD7A 1G7PA 3FB5B 3VH8A 3VNZA 4F20A 1ZIAA 3RWGB 3K80A 2A77H 1T6WA 4OZFG 3A47A 3L3KA 4XHQA 4EI6B 3GPSA 3US1A 1JPGA 5FB8B 1TJGH 4E68A 3H3PH 3X3GL 4FZEH 1SOXA 3WIIH 1NPNA 4YUEL 4QHNA 2BPBA 3OHXC 2JIXB 4WFED 5IW6A 1JZEA 2CM5A 1X5ZA 3U6RA 4YHYB 3VXUB 4FQCL 1GYAA 4DP4X 4PWKA 2CK0H 3PP3H 3QUMB 3VQLA 1QZ1A 1J0JA 3ZT5A 1BXUA 1EO5A 3CVHB 3RJOA 3SQOL 3UTSD 1N8ZB 1SHSA 1WISA 3RX7A 3MRIA 3PABB 4MRBA 1XGQB 3D25A 5IIEA 5JMOC 2COQA 1A66A 1XB3A 1Q0YH 4I7ZC 2X4TB 4R5VA 4IRJC 1W72L 2IWFA 5DVOA 4LEBA 2DYPA 1OPGL 4FLQA 5LN4A 4UBDD 1X5GA 2PLTA 4E0RB 2YD0A 1LO0H 3IETA 2ZXQA 2J8UB 2X6BA 4MMYA 2WCPA 3SBPA 3SPGA 4MJIE 3FTGA 1JXDA 4PJGE 4EAEA 4TS6A 1W0YT 2ED9A 4PAZA 4FQXA 3FN0L 1F4XL 1BVZA 2VIRA 2PWGA 1YY8B 1HH9B 3EO1A 1GTNA 1HJCA 5GRJH 1W6LA 4OLXL 5FLUA 1YDPB 4WDIB 4MNQE 1D7BA 2IGTA 4Y5YC 3S35X 3MV9B 3MYJB 1PW3A 3IDYC 4FNSA 5F7WC 1UJ3B 4R8WL 4JR9H 5HDQL 3RZCA 2JLPA 5DO2D 3WHE1 1EERB 1R46A 2VDRL 4L1DA 1VA9A 4X5LA 1YEGL 4W1TA 4KITB 4S1QL 5EBGA 2G30A 2WTRA 3G6DL 1M3JA 4AVKA 5LGKA 4M6OL 5FHAL 4F9PA 3GSOA 4Z5RA 1F2QA 4TSAL 3GIVB 3P73B 5D1QB 5JOPE 1M53A 2I7OA 2R1YA 5HDBE 1R4XA 3JVFC 4GQZA 4L37A 1KWGA 2FB4L 4MWFA 3C6LB 2GSIB 5I6LA 3DK0A 1CICC 1R0AL 3DGGB 4HQQH 4L4VA 3T4AA 1WQVT 5CF3A 3VXMD 1LP9B 4HIXH 2R4RH 3ARRA 4ZX4A 3DX8B 3PJLA 2Z4QB 2X9XA 4P3DA 2LAAA 3NP4A 4AYFB 5BMFH 2NY0B 3QHZH 2B39A 1MXGA 1OM3L 5CZKA 5IG7A 3RIKA 3FT3B 5HHVL 1GHFH 1WUZA 1N64H 3Q1EA 4GJTB 3RX5A 1N7ML 3ULSB 5DD3H 4KUCD 1D6VH 2WXLA 4XVUC 4G8GA 5T3ZL 2YRLA 1TYEB 3BD3A 2WWKT 4YDVA 3ES6B 1CGTA 4FKHA 5E5RB 1HZKA 1DJGA 1T0OA 1Q9WA 2GHZA 3GK8L 2MJWA 3QFJB 2EYTB 1BF5A 4Y19E 4H2CA 1JGUL 1DBAH 4MAYA 1JN6A 4J2QA 1XF5A 4YZFE 1G94A 3LRLA 3EW3B 4YHNB 1AGFA 1I75A 1Y0LB 2EECA 2VJ8A 2ZUQC 1JHLH 5DLLA 3TIDB 1ZPUA 3B2VL 2BMKB 4MZ2A 1QSEE 3D5OF 2ETWA 2HT3D 5LLIC 1JGVH 2Z8WC 5J56B 1SY6L 3POHA 3ABZA 3GBEA 2GIYA 4TQHA 1KCVL 1C5DA 3RWDB 5IB1B 5JR1L 2R1WB 4X2UA 1SFDA 2L8AA 4HC1A 1S5IL 1A6VL 3VGEA 5KW9H 1ZK9A 2VDNH 3I9GH 3HS0A 3NN8A 3PGDA 3WJMA 5DD5H 3IRZA 3T0WA 4XZ4A 4DFHA 2WINB 1GR7A 3FULA 2HN7B 5E00A 4IDJL 1J0IA 5D72L 1WZKA 2GSGB 3CQPA 2BNRA 3UG5A 4L8SA 2Y6SC 3VMOA 4WUUE 1QPKA 2X9ZA 2DWEB 4JO5A 4G3YH 4PRIB 4XOCA 5DVNA 2VQ1B 3CN1A 4OV5B 3V4UH 1KGUA 4YXLH 3PGCA 4R7NB 3ELQA 1YYCA 1HEZA 4E2OA 2VO8A 4PJ5B 1SEQL 1P9MC 3BIAX 3S3JA 3ZDYB 1L3NA 4NOFA 1UQSA 3G5ZA 3KM1A 3CMGA 5C07B 4KI5C 4L3FA 4DGIL 2HKHL 3MLWH 1A3RL 1AQKH 3MRCB 5D55A 3SY6A 4YDIH 4L3EB 2MNWA 4LRNL 3X11B 4WHYG 4AZUA 3HBPA 2V5SA 3I50L 2G4EA 2EDNA 4XO3A 2ATPB 3G04A 2NUPB 1E4JA 4AUJA 5DR5L 5KZCB 2EH7H 3UX9B 2JLLA 2V3FA 1IV8A 3VWJA 4DP7X 3WHXA 3UDWC 3MBEB 4I18B 4QWWC 5D2NE 3KDPB 5EO0A 5B1CA 2YAEA 3GMNA 4B41A 1LK2A 1SXNA 1DUYA 4HZLA 1SMAA 2NCMA 3TF7C 2MIZA 2NY3D 4HAGA 1KTDB 5FYJD 4FXKC 4YHZH 1I7UA 4HHAB 4ZTOH 4BWWA 4LEXL 4NDMA 4DQOL 3MUJA 2J1XA 4FJYA 2KQMA 2J5WA 1IVLA 4OJCA 4Z3IA 1R3HB 4FQQB 3SGJA 3EDFA 4JDZA 4QJ5B 2PWEA 3N04A 4JDVA 2L0DA 4D0DB 1ASPA 2QADD 1G1CA 1GY2A 1K4CB 3OF6A 3GUFA 2XQYK 3M8OH 4HDIA 4L5FL 2GITB 3JYBA 3VXPB 3VXQA 3K3QA 1M56B 3CLEH 4X6EB 3U9WA 5ALCH 2EIZB 4TULH 4EDWH 4J1UB 5JORA 1QLEH 5TQ0L 4NUJB 4XVSL 5LBVA 4AZ8A 2QGEA 4QTHA 1KWKA 2DAVA 2IAMA 5JOFB 4S10A 2OMBA 2FLMA 5L0QB 2ZKHL 3C8KA 1DVFC 2VXTL 4JG0L 1QACA 4B5ZA 4N0UB 5EU7C 4P23D 5I1GL 1ZJAA 1G9NC 4KUZH 3ULVF 3LZOA 1YMMD 2ADGB 4I3RL 2KQNA 3K4AA 4XMPL 1QP1A 1TFHA 3KLAA 1KBWA 2WYZA 1YJDC 3P4LA 1UC6A 3DX0A 5L2JB 2AJUL 1A0QH 4PJCE 1DQDH 3AY4A 1X5LA 2MRYA 4HK3N 4XXWA 1N5AB 4NUGL 1U58A 4A7GF 3U0TA 3QPQC 4PJEB 3VB8A 4HKJB 5HHQA 3O8XD 2CO7A 1FN4B 2W80C 3UBXB 4MD0A 2BSED 4Y2DA 1U91B 4LOUD 4KOCA 2OLDA 5KVDL 1OO2A 1CZ8L 2OFQA 4V2BA 4UINL 1E4XI 5EWIH 4Y9GA 3P30H 2HX8A 4ADGA 2GTZB 3NIGE 1BPVA 3I3BA 2QDVA 4XGZA 3ATDA 1A47A 1BZ8A 3Q3GA 1QUPA 3NACL 3C5ZD 5E08H 4BKTC 4TNWF 4IIQA 1DBJH 2NYKA 5F6HJ 3TVMA 3WKQA 4BFJA 4LLQA 1OXYA 2H32H 3BHBA 3PWLA 5CP3H 4NQCA 5IB3A 4Y0GA 1XTLA 3ARZA 2DQHL 3HFML 5C8JB 4RRPG 2V3EA 5C0FB 4LEOA 3QEQA 3NBNA 4P04A 2VITA 3JYCA 4QRPA 2OR7A 1R3JA 3SGKC 1AP2B 3EG9A 3H6AA 3RWHA 3HB3C 3HG1B 1WCBB 1CJYA 2FD6L 1CE1L 1OAUH 3UOAB 3IDJA 3DUSB 1B2WL 5E23A 15C8H 5EIIB 5JIQA 3MCKA 2DB8A 2Y1AA 3ZBMA 1K85A 1LE9A 3D0VA 4R4NC 4G7VL 5F7EL 5KSBA 4LF3B 5CR1A 4TNWK 1TTBA 1IEAA 1BD2D 5I73C 2NQ3A 2ZP8A 3IAGC 4U1HB 3DTDA 1CLYL 5C0CA 5IROC 4BGDA 5I76A 4I3SL 3JSSA 4HC1L 1PDKB 4WKXA 3BT0A 2V2WA 3U7YL 2VLMD 2NYYC 5TE7L 5LNGA 1AHMA 5IP4A 1J0KA 4LLVB 5CD5D 1N12A 4LT7A 2OMNA 1U8QB 1X5JA 1BVNP 2F5AL 4UM9D 4PJFE 1JWSB 3K71B 1RERA 3RWJB 3L5HA 4WY7H 1FFPB 4YR6A 1PD0A 4FEMA 2DIEA 4R0LC 5D7IE 4ZW8A 1NC2A 3Q43A 4UZSA 5AW0B 3UTSA 5ITBH 3M86A 1QFWL 2G75A 2OS7A 4F8NA 1CTMA 3FT9A 5DS8B 2DKSA 1XCTB 1HSBB 1KLFA 4N5EC 4MA8H 4OLZL 4TVUA 4Y2OA 5B38G 5DQ9A 3M88A 5CEZH 4JMXA 1OARH 2JNZA 2Q7YB 2N1TE 4BZ1A 1AI1H 2B1HH 1O5PA 3ROLB 3U9PL 3SCMB 1C7SA 1B3JA 2ZUUA 3HC3L 3OJVC 2VAAB 4PCKA 3UTPE 1J8HB 1KTJA 2WNXA 3MLUH 1WA2X 4HX1A 3UZVB 4PS8A 4H1LH 4BH8B 1BFOA 4JFPA 1JFHA 2ENYA 2WLZA 3AWFA 1JZ2A 4N2IA 2DLGA 2EIJB 4JG1H 4Q6IB 1CFSA 1KOAA 3MRKA 3ZJAA 3DGCR 5I0WA 3LZQA 5BV7B 3BJLA 4RGOH 4CILA 4JHBA 4NB7A 4TLKA 5FA3A 1TQSA 3HAEB 1IC4L 5IESH 1H6EA 3FT4B 4NQDE 5EOCJ 4XP5L 4U49A 3VI3B 3OLIA 3OV6A 5ESAA 3VXSA 1I4FA 1CS6A 2EKJA 3NJNA 5TQ2L 5C86A 3WIHH 4FGMA 4WFHD 1CL7I 2GI7A 2I9LB 1S7QA 1MCRA 4AVJA 4LCUB 3A21A 4IS6B 4IGBC 3S37X 2G4GA 3QJUB 1GTFA 2Y4SA 3QSKB 5HGBA 3DX9A 3RE0A 5IQOA 2YBRB 4FE9A 3S34H 5BRZB 3LDBB 5I1AA 4YZWA 4XBPA 5C0GB 5I1EH 3FO2A 2BP0A 1MFCH 3K6SB 3LQAL 3VXMA 3KPLB 5BO1L 1PG7L 1ACCA 5G2NA 1XF2B 1QWHA 5C0DB 3O4LA 1MVUA 2NLJB 1AGDA 3OMIB 1WWCA 1Z9NA 3UZQB 3LN9A 1MAKA 5EV7A 5I1CH 3C6SB 3MJ7A 1W72B 3KVPA 4O2FA 5F0PB 4GT0A 1AR1B 2NMSA 2P43B 5E8OA 5GJTH 5A2FA 3LRSB 1WAAA 2CIKA 4WUKL 1UYWH 1UA7A 3PHOA 1CUOA 4WI5A 1IGIL 4JM2F 4NJAL 2QFPA 2Y25A 4PRNB 2Q9OA 3IFPA 5J12B 5D70H 3VXRA 4K3EH 4DN3H 2YEZB 4F7TB 3QHFH 3WS6A 5JHLA 1I1AA 3OLDA 1QPPA 4XWGL 2WGNB 3AABA 1QUNA 3QEHA 5L4JA 2NPLX 1BQLH 3KG5A 3WNKA 1I9JH 2WSPA 4APXA 2CALA 2FJGB 3B2MA 3MLTA 3MODH 3UIZA 1HEHC 4WTZA 2ICWI 3IDGA 4WO4A 3FTXA 3EXLA 2CLZA 1RLWA 3FUIA 4UQ2A 4Z3GA 2VLJA 3AB0B 4PV8B 5K93A 3G08B 4AVIA 3V0EA 1QKZL 4M8QA 1UD2A 2Y5TB 5IFHL 1SUJA 2JKNA 2AQQA 2ZPKL 3D39A 3R06A 4IRJD 1JZ4A 2XV3A 3HTLX 1AHKA 3T0EC 4Z6AT 2A6KA 4D0BA 4LSTH 3FO0H 2D03H 1E5ZA 1DJYA 5I75B 3SKNB 2ALAA 4M4RA 4RIRB 2NUTA 3JVGA 1KBKA 3BPLC 3DVNA 1DJWA 3DI2B 3IDNA 4UQAA 5GGTH 1H9VA 1Z66A 2HUEA 3KPTA 4NENA 1OIOA 4UOQA 4X80L 4XOEA 1H3WM 1WA1X 3WY2A 5JDJA 3UPRA 1N0XL 1N6UA 4YQXH 1LXMA 1JRHI 2EUVA 1UGKA 1QVOA 4UOW0 3HRZA 3GNMH 3IDMA 1PEZA 1U8PA 4MB1A 4Z8FL 1KYUA 1F42A 3W2DH 4AH2A 3P3SA 2EVJA 3EGXA 2XN9E 3VNYA 4DO4A 1Z0NA 2BSSA 4G9DB 1E0OB 3VSQA 4HPHA 3CHXA 1NOLA 1KB5B 1B2YA 2QGBA 3QJHA 3QORB 4GKOA 2FWOA 2Z8VC 3EBHA 3E6FA 2FX8L 3DROA 5G5DB 1BM7A 4EZMA 1MHHB 4XN1A 5LDUA 2G3NA 2GYSA 5F89B 3KPOA 3RWCB 4RMUA 1ND0B 4ZO7A 2WAHA 4AOFA 2WQAA 1GGCH 1UWGH 3QA3A 1YQ2A 4I89A 2KHAA 3OJ2C 3V95A 1PCSA 3OVUB 3V0VB 4AIZB 2MKWA 2M83A 4WI7A 2C4XA 2QEJA 3BPCB 4FYTA 5FO9B 2OX5A 4FQ1H 1U3NA 4OZIA 4BZ1L 3MV7A 4ZOEA 5HGAA 3H2PA 3OTTA 1M1XB 2PPEA 1LDPL 2BY2A 3S5YA 3KPNB 4P2QA 2ZXCA 4XVUD 1RPKA 4M5YH 3LXCA 4RFEA 2BOBB 1GA2A 1DFBH 1FNEB 2PO6C 5CIPB 4U1KB 1A4JA 1UFUA 4CNIA 4A04A 5EZLA 1J48A 3FU0A 1B4JH 4KKPA 1RMFL 1TQCC 3I6LE 3RIAF 2OJEB 4P23A 3VI4E 2IXQA 2WY3B 5BZZA 3PUCA 4FABH 4JQXC 4QRRB 3CVIL 3PGFH 5F1KC 5SV4A 3IN0A 3MJ8A 3MRRA 4FRWA 2VUYA 4Q58C 3HC2A 1KLGA 4YE4L 3MQIA 1J0YA 2Y36L 5JQHC 4ANVA 5FGBC 5MENA 2WJ7A 35C8H 1L9MA 1FV1A 1XH3A 2AJXL 1UXWA 3GZPA 5KBDA 4Q0XL 1JPGB 3BEVA 3O8XA 4FQIL 2IPTL 4FXGC 1I82A 2EYRA 4U7KA 3EH3B 4QHNB 1KBPA 4ILDA 3GRGA 4GQRA 5FGCB 1GGIH 2AK4E 2Y6SD 3U6RB 1KEGL 1T03H 5AZ2L 4LVNC 4U7SA 2IQ9H 3PWPE 2CWRA 5F70A 4F9LC 4ZT1A 1Z9MA 5SX5H 3Q06A 5GHWH 1DQTA 1C8QA 1LWHA 1Z0MA 4IKKA 2FT8A 3D69B 3MRIB 2QQNH 4K71B 1COBA 5IIEB 2EVIA 1VKXB 1IGYA 3QWOB 1QR1A 4WW2C 5DJDB 2ZWSA 4NJ9H 1MJ7L 4KI5D 2YD8A 2D7QA 2BZCA 4LLAA 4MNGE 4XRCB 3T0BA 5CLTA 5F71A 3THML 3CWGA 4M6MH 2ZWNA 3MJ6A 3IETB 1J87A 1PSKH 3N1QC 4XH2A 4OLYL 2ZOKA 1E6OL 5CSGA 1J0ZA 3S8FB 2P46B 3HEIB 1XAKA 4LGSB 4JANB 3FTGB 3BT2L 3NMEA 5JHLL 2Z1PA 3EOYG 4GKNA 1DBBL 2XX0A 4NNXA 3EYSL 3GKZA 2H45A 2YD3A 4QWWD 5H35A 2VIRB 4JFED 4Z18A 3EO1B 3EZ8A 4NAJA 2BO0A 3D07A 1H3PL 1QI3A 4MCMA 1VFMA 4NP4L 1I8IA 4KNSA 1KENL 3SN6N 4FG0A 3E9UA 3A6CL 4TXVB 3HHSA 5DJCA 3W38A 2NYZA 2P8LB 4JHZA 3ZL4H 2NTSP 5B21A 2COVD 5DXWA 1IC5L 2V8MA 3HHRB 3ZMRA 5DQDH 4KPHH 1UWXH 2X0VA 3TPKA 3S97C 1MPAL 3NA9L 2WTRB 3RNQA 1TEGA 4Z5RB 1RXLA 4Y9BA 1PZ5A 3QXVA 4LCWE 4X9FA 3RVWC 5CD3A 4UQDA 4UM9A 3GBMH 1VEPA 1ZKAA 1NCWL 4L37B 2ZICA 4QXTA 4QCIB 1L7TL 4FFYH 3F3HA 5I8EA 3B3BA 5EZPA 1U8CA 5IMOA 1KCSH 1MW2A 2C9AA 2XZCL 1JUFB 4L4VB 2LTQC 4WLCA 4XNUL 1ZDSA 2NSMA 2X41A 2XZAL 5IQ7H 5D5MA 1K5WA 1DVFD 2YD2A 4YSEA 2JB5H 4HBCH 4PJHA 1RU9H 4JBSA 3RGHA 1J18A 2HKAA 3V8OA 3O3EA 1VLXA 4ZUVB 3QZBA 1OP5K 1GYCA 1F2XK 3HCVB 1OSYA 3RKDC 2XACC 2ZKYA 2BH0A 5EB9A 3SE8L 2FIKB 5CFHA 4M02A 2R4SL 2V5YA 4G8GB 5T1KA 5D93C 2GKIA 5EU6D 1T83A 3TBTB 3QPQD 4YDVB 4ELMB 5IF0A 2B1AL 3AQDA 3UYOD 4JRXE 1Q9WB 4NNPL 3NRPA 4FLHA 1G84A 4PBDA 1SJEA 4FG6C 3BKMH 4IKNA 4MAYB 5ENWB 3JV6B 5I1IL 1JN6B 1QBBA 1XF5B 2X12A 3O3BA 4AIOA 1AGFB 2DH2A 4F15C 2CLVA 3HNVH 2HLAA 1A6ZA 2X3AA 1F90L 3BKYL 4N0YL 4LU5H 2VKWA 4NS0A 3NCCB 3RWFA 2NX5E 2R0WH 3L4VA 1MZZA 5EZOH 2YUZA 3B3IA 3K5RA 5I0DA 3KGUA 4PG2C 1ZT7A 4MASA 3KS0H 1RCYA 5T1MA 2DN7A 2BY3A 3LXBA 3B56A 4PLJC 3P4OA 4OM0H 1I9EA 2DIAA 1R5VB 2DQIL 5AVTB 3NESA 3QDJE 3H7BA 3NN8B 3HS0B 2FO4A 4U4BA 3VGDA 3WJMB 4EI5C 2IPUG 5C70A 2EC8A 4ZJ9A 2MQ3A 4RGNC 2ARJA 2D3VA 1G1KA 4LBEA 5E00B 2IF7A 4CRPA 2ZZUT 1L0QA 2BNRB 3GJEA 4L8SB 4W4OC 3HNSL 2YHGA 3H54A 4RA3A 4NUQA 4PS4H 3ME0A 3HB3D 3NJGA 5LGHL 2QZQA 1HEZB 4YDNA 5DD0H 5F93C 1CU4L 1VACA 2CKBH 3BAYA 1TTGA 2X4SB 3QZLA 1T66C 1ECZA 2JSFA 3CDGA 4MRCA 4PRPD 2X88A 3VM7A 2YPVH 4F1SA 1B0WA 4MA1B 1SJVA 4R4ND 3SDAC 4K5PA 5CZXC 1T1XA 5IUSA 1H8OA 1MFMA 2WO2B 4WIQA 3V52H 1MJJB 1OW0A 3NJJA 2C8NA 4FC3E 4PCTA 3QNZA 3D85D 3GBNL 5IROD 5CEXB 2FNBA 1N6VA 2P45B 4KKQA 5DEFA 3ZE1B 1R6VA 2ZOWA 1AXTL 1GSMA 3EJQA 3G04B 1NBQA 4J3UA 5BJTA 1TSRA 1QSFD 1TIUA 4OI7A 2NYYD 5BCAA 1DEDA 4OY9A 4IRSC 3VWJB 3FO9A 3KXFA 3GI8H 1E8YA 1SDYA 3NIDF 1JERA 1OLLA 5ANMA 2NY4B 3LS4H 3PE9A 4E9YA 5L4FA 3WEXA 5EO0B 1XCQB 3MBXH 2HX9A 5E0FA 4GO6B 1NL0H 3S96A 1ZTXL 1DUYB 4A6YA 4I13B 5LNDA 4OFQA 4QKTA 3ZZSA 1CDJA 1KJ2B 4NIYE 1NANH 1U0QA 2F8OA 2PF6A 3HZ3A 4NDMB 1NCCH 1NFIB 4N5ED 2HVKA 1NGZA 3MFGB 4Q9CA 2BSTA 3SOBL 5BO0D 4JDZB 2W0KA 5IK3A 2XWCA 1OB1A 1GKOA 3VXTA 1RIHH 5A1AA 4JDVB 4LGRB 4HOXA 2VXQA 4NKIH 3VD4A 4Z1PA 4XN2A 4F8QA 2Q3AA 4NWUH 2J4WL 2L3BA 4HDIB 3VXQB 5B3JE 3T09A 1FJ1A 4Y1AD 1JV5A 2R29L 3NT0A 4PRBB 5JORB 1KT2B 4AZ8B 3RWIB 3RDTC 2IAMB 1PZBA 4LVNB 5HYEA 5JYLA 1EAPA 3VDAA 3N6YA 2Y0SA 4GQ9H 2FH8A 4M3KB 5HJDA 5C09B 4ONFH 5JA9A 1KBGL 4QXUL 2Z9TA 1T0NA 1LTXA 5IVZA 2C4FT 3B8SA 3CVDA 3CXFA 3LVTA 5HHOA 2EDMA 4IJTA 3PNRB 5MEOA 3ZYIA 1NINA 4WW2B 1I8LC 3KLAB 4XCEB 1PZ3A 1SBSH 1KGXA 1P5VB 5I5JA 3VFOA 5DJZA 4DNLA 3H9HA 2KDYA 5A7BA 1ETA1 4G6JH 4CA4A 4KX9A 4YXKL 1R1CA 1U58B 1Z9SA 4HLJA 2XQBL 4ZXBC 3WKPA 2NY7L 1RUKL 3U0TB 1JPST 2F15A 4KHTL 4IGBD 4JZNA 3IDIB 3T3MF 5HHQB 5PAZA 4PGJA 5KUKA 1O6VA 2VUKA 4JN1L 4HHGA 3QDGB 4MD0B 1D5XA 5DC2A 5KN5A 1I9IH 2DQJH 2BWIA 2B59A 3F84A 1INDL 1MJ8H 2IH8A 4LSVL 4H40A 3EJTA 5KJRH 3BP7B 4AJYV 4TOYL 3QDME 3WIFA 2MNJB 4HXAL 4N68A 4KRMB 3Q3GB 1XB6A 3MRQA 2KC0A 1BVKA 4LDLB 4XMUA 3GMRA 4IIQB 4TRPH 1SZNA 3KPSD 4NNYA 4LLWA 3TVMB 4GMSH 4UNTA 3UPAA 3LRKA 4KAQH 4LLQB 3PWLB 2B20A 4NQCB 1JK8A 2BC4B 2X0WA 1BHGA 5G4OA 3RZWA 5IB3B 3QIUC 2AGJH 2N59A 3OZ9L 5E9AA 5F1NA 2X4PA 4PJAA 1VSCA 4X4ZA 3TO4A 1CFVH 1QW8A 3BSHA 4LEOB 3QEQB 4BFKA 1SXZA 3BP6B 2VITB 3NCBB 5DFAA 1PLAA 5E6YA 4QRPB 1TO5A 3GM0A 1E50A 4LL4A 4PS3A 1R3JB 3TFKC 3BVNB 3H8NA 3CN0A 2HB0A 2FLRT 1FIEA 3F58H 3EG9B 4MHHI 5A3IC 5I16A 1C9SA 1OOWA 3PF2A 5EDSA 4XAKE 1DLHB 3GSWA 3LAFA 2B3IA 5CGTA 1WG3A 5CP7A 1F18A 3MROA 3L1FA 1NICA 5B3SB 4Z7IA 2FJHA 5ISZA 4KXBA 3US9A 5KSBB 3DWTA 4OZ4B 4ZYKB 1EHAA 4ZPVA 4J3SA 3WENA 1IEAB 4CL7A 4MB3A 4YHLH 3B4NA 3MRBA 5C0CB 2OJZL 2LLGA 1KXHA 5I76B 2OP4L 4ABWA 4NFCA 3BWUC 3T0ED 4HUUB 2V2WB 2IPKA 2OMVA 3KHOA 1IGTA 3BFWA 3O2WH 4KKBC 4NZFA 2N0KA 3BPOB 3ULUH 5FYKH 1O9VA 3BD4A 5EN2A 4YR6B 2K3HA 5DFTA 5CFAA 4PJ9B 2XWTA 2IDSA 5DZLA 1NC2B 4UIKL 4LDOB 4IRZA 3TS8A 1TF4A 2HVBA 2FGWH 1LMKA 1KLFB 2AAVA 4P3WA 3F7YA 3V6OC 1TVHA 4H8HA 1P7QA 4Y2OB 5FS5A 4XCYB 5DQ9B 1H5BC 1TFPA 4OD1H 1GSKA 2APTA 1EO8L 2AJVL 4QTIL 3UERA 4ZMWA 5BVJA 5F7NC 5EU5A 4BK5C 4HX1B 3L6FA 4UCFA 2CO6A 4RGNB 5DWPA 3SD5A 4B7LA 2XWRA 4EOWL 2DQTL 1PCXA 1BFOB 3PDOA 4JFPB 3UDWA 4CVWA 5AW3B 4DP0X 3S5LG 4DHLA 2AJ3A 4UT7H 4ZFZB 4JFEA 4X7EC 2H2PC 4ZMTA 3H1ZA 4NRXA 5J57B 1FIGL 4X5QA 4AL8H 4DP1X 1WT5C 1PD6A 3MLZH 3RVTC 4C56B 3OR6A 1HZLA 4U33A 3NFNA 2VDQL 5FA3B 3ARFD 5D2LA 5SWZD 4A6YL 2L7UA 1XL6A 3IMWA 4FXKA 3VFUA 4BXSV 3VXSB 1I4FB 4J3XA 4PWHA 5E99L 3UROR 2X42A 1X4YA 2CUIA 2BXYA 2EINB 3IPEA 3MRJA 2F54E 3DYPA 3SE6A 1S7QB 2OW6A 5BXFA 1CCZA 2CRMA 4H13C 3FCGA 3ORJA 1MF2H 2VXQL 2PUQT 1OALA 2LFEA 4DO6A 3PP4L 5JYMA 1W15A 3GJFH 3VQMA 2IVFC 5C9JA 5HGBB 2NY1C 3DX9B 4QLRA 3QXWA 2PMZA 4JFDE 4ABQA 2PO6D 1AMXA 2WKOA 3BGMB 1BW8A 3VJ6A 3T2NH 1NMAH 2BP0B 4KTDH 3OB8A 3GKWL 1FLRL 3EAKA 4AK2A 3LJ3A 3KEHA 4FCAA 4Z76B 5I0VA 4JFZH 5C2BH 3C09B 3O4LB 5JDSB 3UTQB 3V5KB 5KANI 1AGDB 1WBYA 3D33A 1XEDA 3GRWH 4HSQA 3MJ7B 4NERA 4O2FB 5IMMB 4ES8A 5EUOA 1DUZB 1E5AA 5CCHE 2CIKB 4J27A 1OHZA 1TZGH 2W60A 3MNZA 3PHOB 2ADFH 1NSNH 2F53E 3AT9A 3H3BC 4PB0H 5C6WH 1U30A 1J1OL 3IFPB 4R26H 4ZNEE 3VXRB 3AMLA 3DURA 1DYZA 2PXYC 3T6WA 1I1AB 2K70A 3QS2A 4IU3A 5E56A 2MOVA 5CWSB 1QUNB 4X4XB 5ID1A 3Q2LA 2XWDA 5DC4B 1FDLL 4BFIA 2D0FA 3ARBC 4APXB 4HU8A 1XIWC 4HUXB 4CADA 1QBMH 3MLTB 2JTYA 1JZGA 3NCYP 3QEGL 4WO4B 4XNYH 3JV4A 1UACL 2CLZB 2KMWA 4I48A 4UQ2B 1NCIA 2VLJB 4GRLA 3S88H 2YD1A 5D1QE 3BUBA 2F5BH 4KUCF 5IHLB 4M8QB 4DUWA 3TH4T 2EDFA 1QYGH 1A8ZA 2P8MB 3QRGL 5J13B 3D39B 3R06B 3L2LA 5EC2A 2HT4D 2ZYIA 4RGMC 3WUWG 4KC3B 2A6KB 5ABAA 4W9JC 2OSWA 3AQXA 4NXSA 5DK2A 5EEVA 1MRFL 2Y1ZA 4MZ3A 3WFDH 4EVNB 4P2OC 2NUTB 5K5YA 3T8XB 5CILL 3IDNB 3P4MA 4P3CL 4CMMA 4E5XB 1IARB 2BHYA 3QZPA 4NENB 2CR3A 1ORQB 2ZWKA 4QPEA 5F9WB 4LIQH 3IFNL 1T1WA 4DGYH 5EBWA 4N2DA 3X1BA 1OE2A 5I74C 3ZLQC 1QVOB 3EFDH 5EMYA 3OB0H 4G6KH 2XN1A 4YDJA 3HPLA 3HRZB 3DJSA 1WVZA 4M5ZL 3IDMB 1KG0A 1CVRA 5H37A 3C60A 1U8PB 4RMTA 2IH1B 5CEYA 3OD3A 4WU7A 1IAIH 3LZFL 1LO4L 3R4DA 2BSSB 3QFJE 3RA7L 4F3FA 1SJMA 4Q9RH 1ETB1 3QIUB 3QJHB 4RFOL 1U2CA 2J8OA 3CPLA 4GUPA 4F7MA 5DD1H 4K07A 3E6FB 3TEWA 4XPGH 4PMEA 2DWTA 2VZOA 5C0AD 1MI5D 5CN2A 3RVWD 4X98A 3KPOB 3QO0B 3DV4B 4J8RA 4NQSA 4NRZB 1RK7A 4KNTA 4HJGA 3OBAA 5DUBA 3BZEA 4JFHD 4RCAA 1HINL 4RSYA 4IBQA 5I8CA 4NBXB 4X4ME 1WFIA 4A1RA 5IW1A 1YYML 4ICWA 4MYPA 2ZE0A 5K33A 2V7HA 2NXYC 4ISVA 3NCXA 5JW4N 4RDQG 4BK8A 3QCTL 4HKZA 1KCRH 1NGWB 3CFTA 4NKOA 4P2RD 4OZIB 2ICEA 1DVXA 5LB1A 3HMXH 3MV7B 3NCJL 5HGAB 3SO5A 2MFNA 2YGPA 3L8QA 2QADB 2JVUA 1MIMH 5A6LA 3MYZA 3S3PA 1ZMYA 4P2QB 4YXHL 4AV4A 4F7CA 1G9ML 3SSGA 3VD9A 4RFEB 4KK9C 2F7IA 4JFWA 3H56A 4PCSA 4B9YA 4JQVA 2BNUA 1DN0A 2DMCA 4L3EE 1U8NB 1QR4A 4FG6D 3NCYS 5EZLB 2Q20A 2IMMA 4NN6C 5F9AC 1I31A 4H8UA 4C83A 4Q8BA 2FNWA 4K7FB 4OZIF 2FT7A 2IXQB 3BP4A 3ARSA 5BQ7A 3S2AA 5AG9A 2X53A 2A6IA 4LIQE 1NGQH 3JT0A 4G6ML 4TVPD 1KV7A 1ZHKA 1ZVSB 4GLRI 4F80A 2XX1A 1KNOA 1TVBB 2WANA 5FFLA 5IHZB 1RUQH 3LPGA 5KVFL 3PY9A 4OZFA 4PLJD 3BWAA 4JO2L 5MENB 2VRKA 2YPKB 2RH0A 1NGYA 3S3DB 5FDYA 1D5RA 4EI5D 5A40E 3BEVB 1FO0A 4NM8L 4IBVA 2AQTA 4AUUA 2EE2A 3OMZA 5FW7A 2EYRB 1UA3A 3EUDA 2BP8A 3II1A 3L3OC 4L0PB 5LDSA 1B3IA 3ESVF 3MLXH 2H41A 1NMCC 3CLFL 4TQEH 2EDBA 3S4SG 5TFSL 4H2AA 4OQTH 2RIKA 2IANA 5F0MB 3A67H 5HYJB 4H8WH 3ULVE 1X5AA 1WZLA 1R24A 4MXQD 4S11A 1T66D 2LABA 3KPSA 1IGYB 1EBAA 1NCAL 3SDAD 1OOAA 2BNQE 3ROOA 1AHWA 3B8YA 5CZXD 5T3XH 4JKWA 2HMIC 4BQ6A 3CBKB 3O3DA 3IRCA 4M3HA 2FVNA 2ZOKB 1OWWA 2GEEA 1O6TA 4PREA 1P6AB 4G7QB 1SXCA 5L6YH 4A2GA 1IBGL 4EPSA 3H9SD 3V0JA 1RZKC 2X2JA 3GXMA 4ODSL 1ZLUH 4GKNB 1VIWA 2DYRB 3VWKC 1SJHA 4GSUA 4IRSD 4QNPF 4X7SH 4NNXB 1WYJA 3GQFA 5H35B 5D71H 2XA8L 3O11A 4FP8H 1HE8A 5C0IA 4XN8A 5D1XE 2HFGL 1YNTA 1G43A 1G6RA 2YUWA 4O58L 4JHUA 3NZSA 2QLVB 4JFOA 4M9PA 3HHSB 3G3LA 3DBSA 4N8CL 3NPSB 4OCNC 3T6ZA 1UATA 3VFRA 5I0YA 1BZOA 1CTOA 4N28A 3HS8A 4MMXC 2NRDA 3L4XA 4G7YL 5L4MA 3T0EA 4QYOA 3TL5A 5IB5A 1KEMH 5AVYB 3RTLA 4NC0B 1DFXA 3L1OL 2R1XB 3MJ9H 1OCZB 1UCTA 5DHVA 4UM9B 3FU3A 1QI4A 2PXYB 2XETA 4QXTB 1QHOA 4HAFA 1P84K 1EEQA 2FSEA 2GQHA 2ORBL 2LVEA 3GI9H 3A4EA 4FFZL 1U8CB 5B7FA 1LLAA 1F0LA 2YXMA 2FK9A 2I7SA 3R18A 3RDTD 1FLTX 2EDJA 4OSUH 5L2KD 4NZTH 2JJUA 2B2XH 3PWVA 3QPXH 1N6QH 4EIGB 4PJHB 4HJJH 2WXHA 1SRDA 2WNWA 4JQIH 4LXFA 5T1DL 1VENA 3EJRA 1XGUA 1JCVA 2AQSA 1FGNH 3KCPA 3NAAH 5J9PA 4RMVA 3TBSA 1ACXA 1VAHA 3N44B 2W07A 3NFPA 3QIBA 4A67A 3HRPA 1UXSA 3MV8A 2YMXH 4U1GC 3ZW3A 3X3FH 2BRRL 4YWGH 2F1BA 4ZSOE 5T1KB 3UGEA 1HHIB 3MRMB 4XNXL 4ZXBD 4M48L 5IF0B 2B4CC 5T3XE 1M4KA 5C7XH 4PH8A 3SE3C 5EUKB 5D5MF 4EBQH 1DBKH 2D3JA 4L1BA 5IHUL 1DSYA 4OD2A 1ETZA 4RISL 1DBMH 1SJEB 1T7ZA 1N0LB 3I2CH 4LLYB 4JRYB 3O3BB 3NDZE 4P2AA 7FABH 3MUY1 2CLVB 4M5SA 3E3QC 3ARFA 4KTEH 4KRPB 5GRWA 3RWFB 1G4MA 2YFOA 5SWZA 2FATL 1FORL 5GS0H 2HWZH 3ETTA 1ZT7B 3NZ8A 4JW3A 2C7UA 1LWRA 5T1MB 1C12A 3L4YA 4PJ7A 2GK2A 4AEIH 1A7QH 2VLKD 1XGTA 4LOFA 3CDFA 2WSDA 4GRWB 1I9RL 3H7BB 2D4DA 2FO4B 3U0WL 3A4DA 2V8LA 5T5FH 4P4RA 2WXFA 1CBVL 2WQ8A 1EJOH 2CJUL 2BVEA 3NJVA 1N59A 5JQ6L 1J9RA 3JV5A 3TFKD 2EDHA 3ISYA 4MX7B 5A3ID 1ZHLB 3ME0B 4K4KA 3VB9A 3HVDA 1EDHA 4W81A 4XX5A 3DX6A 4OM1L 1NEPA 1RK0A 1VACB 1EEZA 2AXFB 2C9XA 3FQWB 3HR5A 4GRWF 3NH7H 5DJ0A 5KVEL 4PSRA 2OMTA 2J7LA 1CE6A 1OM9A 3CSYA 3CFNA 3KPRB 3MRGA 6FABL 4DK5A 1XF1A 3O9WA 3L5JA 3LH2H 4OFYD 4K9EL 5D7LD 5I18L 3MLPA 3WNPA 5LCVA 1G87A 3TNNB 3ZT7A 3D2UD 1A6WH 3TNMA 4KRNA 2AZAA 3PNWB 1IAOA 2XZQH 3I9PA 3UAFA 5JPNB 2YJLA 3AJ7A 1QHQA 5BJTB 3X1NA 1FO0L 1XX9C 1HCZA 4GBXC 2ATAA 3EOBA 4KK5C 4MJIA 2BERA 4KKBD 4TMPA 3KXFB 4PYGA 3FMGL 2EIKB 1NEZG 4WCYH 5I1HL 1FUNA 2B08A 1MELA 2AEQH 2XU9A 5EA0H 1L7IH 3MLSL 4V1DD 5E7BA 3WEXB 1KULA 2R2CA 4F33B 2J43A 4NN6B 3S96B 2VDQB 2O6DA 2P5WD 1TKWA 1F3DJ 1P5UB 4HSAC 2ADIB 3V0HA 4HZ1A 2I69A 1W0WA 2A4EA 4TV3A 2K6WA 4Y4KC 5BS0E 1PG7W 2HVKB 2ITDB 4AMKL 1NGZB 2TSBA 4WNJA 1QFWI 2GIMA 3U2JA 4XVTL 43CAB 4D9LL 4P5TA 2QELA 2YPLA 5IK3B 1I1RA 5ABZA 3VXTB 3G9AB 1S9XA 2JXMB 3AACA 4YSSA 4AYBA 4LP5A 4DTGH 3LEYL 3TEZA 1OP3H 2AF2A 3W3BA 3FB7A 4JFFE 4NKMB 4HIPA 5KJ4A 1FJ1B 1M2VA 1RJLA 3D3VD 1JV5B 1MHCB 1KF9B 2XWXA 4KY1H 4XPTL 2NW3A 1E2WA 3CFIC 3CX2A 5HGDB 3L48A 5ERWA 2YR3A 3W0WE 4OIIL 3K6DA 2RTTA 2X05A 2G60H 4Z3EA 5TDOA 2H2PD 1OP4A 3U1QA 5EU4A 1HXYA 1G6RL 2D7OA 1T0NB 5E7FA 3TT1H 3KZ8A 2NNCA 1GZQA 4FJZA 3FFCD 4NZUH 4B9FA 5HHOB 2G3XA 5MEOB 5L9DH 4IMKC 1M57B 5JW3H 5AYUH 2GAZB 3VFOB 1HL5A 1ZT4B 3H9HB 2HX7A 2BDNH 3HE6B 4LRIC 4ALAL 1IFHL 2GPZA 1S5HB 1Z9SB 3U1SH 3JV0A 4BEIA 2VDKH 2I5YH 4KQ4L 2A9DA 1T0PB 2VQTA 2Y9RT 3GO1L 4KVCL 1I3GH 4A63A 4JZNB 2C4FU 3PUUA 5LXGL 4KVNH