4YDZA

Stress-induced protein 1 from caenorhabditis elegans
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
135
structure length
135
Chain Sequence
b'FEDMMPYWAQRHSMLNNFNNIVPQQLNEVENTAQKFCVKLDVAAFKPEELKVNLEGHVLTIEGHHEVKTEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAPKTGSNTTVRALPIHTSAGHAVTQKPSS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced protein 1
molecule tags Chaperone
source organism Caenorhabditis elegans
publication title The Chaperone Activity of the Developmental Small Heat Shock Protein Sip1 Is Regulated by pH-Dependent Conformational Changes.
pubmed doi rcsb
total genus 18
structure length 135
sequence length 135
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ydzA00
2XCMC 4RZKA 2KLRA 1RL1A 3VQMA 3QORD 3N3EA 3QORA 4YLCA 4YE0A 2WJ5A 3IGFA 3Q9QA 1GMEA 4FEIA 4YL9A 3L1FA 4PCKA 5LUMA 3AACA 3W1ZA 2Y1ZA 4JUSA 2BOLA 3AABA 4MJHA 1WGVA 3GUFA 4YDZA 3L1GA 4I88A 2Y22A 2MNWA 2K8QA 3VQLA 2N3JA 2KMWA 1WFIA 2JKIS 4M5TA 2CR0A 2CG9X 3J07A 2WJ7A 4ELDA 5DS2A 2Y1YA 4JUTA 1X5MA 3Q9PA 3QORB 2N0KA 2O30A 4M5SA 4PBDA 3EUDA 3GLAA 3L1EA 1SHSA 4ZJ9A 3QORC 2RH0A 3GT6A 1EJFA 1WH0A 4YLBA 5DS1A
chains in the Genus database with same CATH superfamily
2WN2A 1ZOXA 3A3YB 4C83A 4XXWA 4KU1A 1EHNA 2A83B 3VWJD 2DQUH 2IWFA 3VFUB 3QGVA 1A4CA 1BFOB 4UQBA 4WLCA 4UQ3A 4CGUB 1NIEA 2WANA 2SEBA 3QXDB 3PAUA 2J43A 4FXGB 3KBFA 2OSWA 4X4XA 4ORGA 4NHCL 1KYUA 3HC2A 1BZ7B 2NY0B 5D4JA 1SOKA 2Z0UA 2BXYA 3NIFB 2JCCA 3MRCB 2NX5A 4FXKC 4UZGA 3WS6A 3X13A 3PAZA 5AKSA 1JPGA 2BSBA 2A77H 1ML0A 2D3NA 1F4WL 4N0CC 4G5ZL 1RZJH 4WI0B 2VITB 3DSFL 1MCQA 2IQ9H 3DUSB 3PGCB 2QGEA 4M61A 1KPUA 2OK0L 4KNSA 3G5YA 4Z77A 2GSGB 5EZIH 1CMOA 3R0MA 1FFNA 2F19L 2JCCE 4ACTA 5JOFA 5JORA 4JRYB 5JO5A 1I3VA 4HKZA 4O51B 2PKDA 2Y23A 3TN0C 1IGIH 5JW4Q 1PZ5A 2LLGA 4GRLA 3MJGX 4G80B 2CHXA 3AUVA 5F7NC 4WKXA 1BD2A 4G43A 1FNEA 4XVUC 1IAOA 1IKNC 2WZPD 4RGNC 3U82B 5E0QA 4A7SA 1L9RA 2VDRB 3KPLB 4M8QA 4R0LA 1XB8A 1TJIH 2IIJA 4LCCA 4BKLA 4XP6L 5AB0A 3OPZL 4UDTB 1BF2A 1PZBA 2PR4H 5C0IA 1VFMA 5F71A 2W0LA 4XCYB 1JI2A 2BK8A 5GGVH 3JVFC 3SKUD 1YPZF 3UTQA 1V7ML 1BD2E 1DP0A 2WY3B 5DHVA 3KDPB 5DZJA 3KM1A 5JHLL 4RMTA 3LPFA 3FTVA 1FFOB 4G1MA 4K3GA 3ECWA 4JLRB 3DRTA 1A7NL 2HKHH 2R0WH 3KYOB 3WJLA 1N19A 4AQ1B 2V5TA 4XNMA 2BY3A 5CLYA 4G11A 1ZLVK 3S37L 3V0VB 3VXOB 4YSAA 1W72L 3ZHDA 4ADIA 1QO3A 1RZPA 4QYAA 5DJ8B 1WTLA 4X6FB 3MRIB 2H7WA 4PJCE 3KYOA 1OAQH 4J3OD 3VI3E 4ZFGL 3SE3A 4H20L 2DS4A 5E6SB 2IPTH 4LBEA 1GHFH 4OW6A 4RMRA 4KAQH 5T33H 5H94B 4E9WA 5J9PB 2FJHA 4WI4A 5DQ9B 4RIRA 4ELMA 2F53D 1JPEA 3TBWA 2HJFA 4JO4L 3WY4A 2NZ9C 5IFHH 1UYWL 3NJXA 7PAZA 3AC0A 3ATDA 3QEGH 3QG6A 1GZHA 2J2ZB 4KROC 2WLKA 2BHUA 4ONFH 2NY1C 3GIZH 5GRUL 3TVMB 3HLAB 1CF1A 2VMDA 4JE4B 3Q8AA 1E2VA 4PJ7B 4MWFB 2JLLA 2GJRA 4L5FE 4GQ9H 4JE0A 2B0SL 4ZK8A 3ARBB 4P2YA 5MP6H 1KPUB 2SODB 5C2BL 5T1DL 1J1OL 3TO4B 1UACH 3D07A 3NESA 4XI5D 3TT3L 4C57C 1KCUL 5D1XD 2EDNA 2VDNL 5DTFB 1VEMA 4U3SB 4NWUL 3KPNA 3OAYH 4ZUSB 5FYKU 1QOKA 2HRLA 2OXHA 5JHBA 1Q1JH 1L0PA 1NSNH 3ULUE 5MEQB 4IOSA 3SPVA 1WTGT 1B2WH 4EZKA 1BQLL 1S7UB 2IPUG 3MFFA 2CXKA 5FPIA 2EJ1A 2EIZA 2WNXA 1NLBL 2OTUA 1SUJA 1UWXK 4XNUL 4EDXA 4Y2DB 3K5RA 1FP5A 1FZJB 3QDGB 1Z9SB 2RTTA 1G7PA 3MRHB 5BS0D 2O6PA 5E8NB 2G4GA 1KYAA 4AW4A 3R1GH 2JH2A 3QFGA 1S7WA 3PHSA 1E42A 1XGQB 4L29A 4L23A 4R5TA 4ES9A 2GABA 8CGTA 3UTSE 3SKNA 3QHZL 4LOFA 3JWOH 4XPBH 1V3KA 3ES6A 2VQ1B 4JK0D 2P80D 3ZHKA 4LCCB 2K8QA 1TMCB 2IF7A 4UQEA 3VE0A 1ZSDA 1OW0A 1FIGL 1QR4A 4OZ4A 4W9HC 2O61B 4I4WA 1EEUA 4A66A 1JNLH 1KIPB 2HVKA 4RFEB 4K73A 5CF3A 1K4DA 2BVUA 4AWJC 1UQSA 1NUFA 4Z3HA 4Z8FH 1RZIA 1BIHA 3FT4A 3BPCB 5HYSB 2CO6A 3RGVA 2WK2A 4DVBA 3QA3A 4L2LA 3ZMEA 7CGTA 1HYSD 3VFMA 4E9LA 2R69L 2ZTBA 1JRHH 2ADFH 3IU4H 4MRBA 3V0VA 4BQ6A 1KV7A 4IBQA 4MJJA 5LCVL 1PU0A 5HDBF 4BH8A 3A6CL 4A63A 1ADWA 3BT0A 3BZEB 1UWEH 3U0TA 3STZB 4DF9A 5IWLC 1IARB 2FR4B 3H3PH 2XNAB 2W0FA 4FYSA 1NGQL 4KJQC 4DW2H 5EN3A 3BVUA 1SJHB 3I9AA 4KK9C 4WU5A 2UZPA 1VEPA 3ARVA 4KVCH 3L3GA 3AUWB 4BCYA 2ZOKB 5I66B 4K8RL 3EHBB 2DYSB 1JF5A 4XPFL 1Z32X 5DYOA 2JI3A 4PCSA 1CDGA 3BQVA 5G5DB 5HHPB 4LPVA 3H1ZA 3K91A 2WM0A 2G0KA 2WTRB 1N6VA 5AB1A 4I3RH 3NIFE 4M7JH 5HGGS 4KZDL 1J5DA 2KC0A 1ASQA 3K2UL 4QRRD 3UG5A 4DWHA 5DVMA 1CDIA 4Z7NE 3TCLB 3MVSA 3J7HA 5GRJL 2X4OA 4OUUA 1HNYA 5LGYA 1AGCB 3MX0B 5T5FH 5JQ6L 3SGKC 3M1OA 3NIDF 1E6JH 2DQGL 5HDBB 4U3CA 4N6RB 4FQCH 3N50A 1E4XL 4A7GF 3LD8B 2W9LA 1AOZA 4HHGA 1OLLA 4OUOA 1E40A 1RLBA 2PYEB 4JDVB 4KUZL 1ZE3C 2DM7A 2K6YA 2VDOH 4PGEB 1UXWB 2UV3A 2CRMA 3RY4A 5C07B 4U1NA 3DX7A 2GK2A 2DF3A 3M1BB 4P2OD 2HUEA 3CFMA 1O0VA 2E27L 4FI6A 2VSDA 1D5ZA 3A6OA 4QRRE 4R5VA 5D4QA 4L4TA 2Q5BA 3K6DA 1KEGL 3CVHB 2Y7LA 1IAII 3EUUA 3NSFA 1MFVA 5T1KA 4CGTA 1EAPA 1PQZB 1JK8A 5ERWB 1DQLL 1K6QL 1O5PA 3PL6C 3ARFD 3MRGA 5IQ7L 1OAYL 1QACA 5CP7B 4K71C 3PJNA 1L6PA 4Y88A 3AQDA 2G4EA 1PBYA 2E8YA 1AFVH 2H2PD 1HX0A 3FH7A 2P8MA 4GG6A 1H5BA 3FTUA 2D03L 3GSNH 3V4PB 3ZN6A 3LVTA 5L4JA 4YDMA 4EKXA 3DBSA 3LEXA 4W4NA 2ADGA 2EIDA 4RISL 2R8SL 3HHSB 2WC7A 2FLRT 4QAWA 4R4ND 2P80A 3J8F7 5E56A 4B41A 4ZZKA 1LL1A 4H26A 4X8GA 4KBPA 2XWBB 1YY9D 4Z7NB 2BOBB 3DPDA 5DVNA 5DMJB 3W57A 5C97A 1Y6MR 5AL8A 3QZWA 1KGIA 1PLCA 1HHGA 3COOA 3NCMA 2F74A 4LARL 4J3UA 5DVOA 4YSTA 2ZX6A 1I4FB 5J1TC 4GKLA 4AJYV 1H9VA 3S34L 3BH9B 5DU7A 2VLKD 5FYLL 3FDWA 1QNZL 3T0VA 1WCQA 3DA0A 3OJDA 5ICXA 4QOKD 5IB1A 4WTZA 4WDIB 2WCSA 3DWTA 5F7YC 5I1HL 1UXSB 2BSRB 4HOWA 5CN2A 4M4PA 1DBKH 4YXKH 2UYLA 3HG1A 2GJ6D 4NC2B 4X7SH 1XF3A 1FGNH 2IC2A 4N1HB 3FBQA 4OF8A 2P8LA 2A73B 2NYYD 3NEEA 1JV5B 1T3FA 4H8WH 4R2GD 4DOHB 2XWTA 2J8UB 5MENB 4OTXL 3CFBB 1S9WB 3KJ4B 1T1XA 3U7WL 4LLQA 4X7DC 3ZYIA 3HI6L 3QWNA 3MNVA 2DZEA 3Q2VA 3TFKC 3UYOD 4UM9B 5CCHE 1KCVH 2AVGA 4GEIA 3UZQB 4XWGH 3ZSTA 5T5NG 2OCFD 2ZUTA 1MCLA 2EDWA 4WTWA 4MS6A 2QMKA 1VEOA 3X3GH 4YSQA 2PXYD 4GP8B 3OJMB 4HV8B 1JGLL 4IJ3C 5E94B 5H2BA 4RGNE 4RSYA 4AGNA 3MJ6A 1S78C 3U79A 1P69B 4I2XA 1LP9B 5FHAL 1SDYA 4PB9H 1AS6A 5C0GA 1QBML 2XX0A 4K7FB 3I2CH 2E0PA 3BE1H 5EU7C 1VGKA 1LO2L 3ECBA 2KS0A 4XMLL 3PP3H 1LP9E 2DLGA 3GMLB 1PQZA 3AMLA 1RUKL 4HJ1A 1QA9A 4KX9A 4LEBA 2V6HA 1KB5A 4ATWA 4PRHE 1DQTA 4XNZB 5AW5B 1BVLB 1DVUA 4D8PA 2AVFA 3MZGB 2GHZA 5CP7A 3WNLA 3QJOA 4R90L 4D7PA 5L0QB 2ITDB 1HEZA 4BQBA 3MTXA 3LKPB 4DFHA 3QNFA 3CFDB 5KYWA 3ZTNL 4Q56A 4BFRA 5BQDA 3R8QA 1R1CA 2AQQA 3ZK0A 3F05A 1BVLA 2DQ6A 4LVHC 1OAXL 4LHUG 4ZAKD 1NCAH 5IVNA 3S36L 1OAQL 4ZTOH 5BZWA 3NJMA 4CVZA 2DWEA 4R83A 2ICEB 5K33A 5JPNC 2CXGA 4OJDH 4R7XA 1YNTB 1D5BA 2PWGA 4NS0A 3LHAA 4JKPL 4LCWE 4UT6A 1G9EA 2AJZA 2ENYA 1CTMA 1SFDA 3MMEA 1LO3L 1YEGH 1T1ZA 4PJ9B 3UAJC 1S7QB 4XVJL 3II3A 3OAUL 5IW1B 1MJUL 2EIBA 5BRQA 1JZIA 1VA9A 3KPOA 3QUGA 1N5YL 5IY5B 2Y06H 5HYJE 3NCWA 3BO8A 2ZG2A 2J8HA 4MAUL 2GFBB 1I7RB 4PRAB 3SYQA 1NM9A 4AEHH 4BSJA 3HRZB 2HLFD 2A73A 4U0RB 1XBRA 3KWWA 2D2CC 2PP8A 5K9KB 4OT1H 1YMMA 1Y7VA 4JNXA 5D7IA 2QV4A 4M7ZC 5DYOB 5D1ZA 5BZZA 3TEWA 1UB6B 2J6EL 3O6FC 4NZTL 4PGBB 3P3YA 5LLIC 2QSQA 3H9HA 2FGWH 4OV6F 4WHTB 2ZXBA 3DO7B 4S1RL 5ICZB 1BQLH 5BQ7A 5EOQH 4RAHA 4KROD 4X6DE 1AQKH 5DO2D 1YMME 4PGJA 4ILDA 5C07A 4AT6A 5GGRY 3R4RA 4CMHC 3GUFA 3P0VL 1BDYA 1IEAB 1PDKA 2BWIA 1R19A 1W6WA 2D31B 3BUYB 3TONA 1TNNA 2UWEB 2FEEI 4JKNA 1SJMA 5J13B 4UANA 2BIHA 3B6SB 4JFEB 1NMBH 2Y72A 3IDGB 3ROOB 3DK0A 1DQVA 3V0IA 5DO2C 3II2A 2CPUA 1O7SA 4YSEA 4DAGL 3RQ3A 4KQ4H 2G75A 5FFOA 3DARA 3HJEA 4P2RE 3O6LH 3QEUB 3C60C 3ISWA 3R4DA 1BFVL 2BNQE 2P5EB 3MV01 4GG6F 2OZNA 4RFEA 4YLQT 5L6YL 4L29B 3PHOB 3RPKA 2WBJC 4PJ5D 3T2NH 4NERA 3FSWA 4HUXB 4OJCA 5JDSA 3SGEH 1IGTB 2CJTA 3FCSB 1RVFH 3VE0B 1MCEA 4R26L 1WIPA 1AHWA 1IBDA 1J11A 1U95B 3VX1A 2OL3B 2AXJA 3QDJA 3BSGA 3P54A 2IAMD 3D3VD 1BXVA 1N2RB 1GAFH 2DYRB 1WFNA 2AK1H 3OB0K 4OCXL 3E80A 4LCUB 4LAJH 1FL3A 5D6CB 1XBDA 3VQ2C 1LEGA 4PG2A 3X14A 4OI7A 4MMZC 2K45A 3VFTA 4N9GA 2IDUA 3QC6X 3VXPB 1WFIA 2ZX9A 4CDHA 3MRKA 4YZFF 5T8IA 5CCJA 4ZOEA 4P4RB 1HYRC 3ZQWA 1H19A 1PTZA 1ZPUA 3WNOA 1U3HA 1BG1A 2XZQH 4PP1D 4F1SA 3PABB 5F97E 3BUQA 3NCEB 2XRAH 4HKBB 3ETTA 3P4NB 3D87B 2DI8A 4FXKA 5F0MB 3RA7H 3SYAA 1HEJC 3R7RA 3T65A 4WI7A 1X9QA 4YIQA 1N10A 4J1UB 3UGEA 3C5ZD 1EHLL 1ILSA 1KJ3H 4RESB 4TNFA 1PIGA 1W72A 5F9DC 1UENA 3CWGA 4MMYB 3LXUX 3REVB 3L3KB 4YO0A 4Y4KD 4K5PA 1YEIH 2DQGH 2DYPD 1G7IB 4J3TA 4LF3B 1E2ZA 1QP1A 4A2FA 1T66D 1MFMA 3BT2H 1WBYB 2WQXA 4AYMC 1NKRA 1LDPL 3HIZA 2H1XA 4X5RA 4HJUA 2VXTL 4AH2A 1NIDA 1KGCE 2W5PA 5INCA 4Q9RH 4HJJL 4MMZA 1GW0A 2AXGB 1S78D 1UOWA 5ABAA 4Z3EA 3Q6GH 5SWQB 1T5WA 3GSNB 3V4PH 3HAEG 1UA6L 4NSKB 1BBDH 5GSVA 2HYMA 1ZKAA 1SM3L 4LCYA 4AGQA 1KEGH 3H53A 1YEEH 3ZRCC 1NAML 3ZO0A 4B3EA 4L8CB 1NGYA 4QOKE 3ARGB 1HOEA 2PP9A 4NAQA 1MFCL 2WXLA 2F8VA 2PUQT 3FMGH 4AZUA 5IFJA 2BW5A 4H88L 5D7LE 3UO8B 3ILPB 4L1HA 5K39A 1KXVC 4BK5C 3CUPA 1EMTL 4AV4A 4AM0Q 1TJHL 4HEME 3O41B 5DMKB 1CVRA 1MFEL 4OV5A 3FQRA 2I9TA 3II1A 4GKSB 1E9QA 4NHUB 1FH2A 4S2SA 1T89C 4ERSH 2XG4A 4KOCA 2MCPL 4B5ZA 3T0ED 1B88A 1VFOA 1YLBB 2ZX5A 4FABL 3S8GB 4JZJC 1JPST 4ZMZA 1S4IA 4BKLB 4KDWA 4D0BA 5FUZH 1EXGA 5ID1A 4PWKA 2VXSL 2W8CA 3K1DA 2PW2A 3S3CB 1L7IL 2W9DH 4BA8A 4FQQB 3IMUA 5C0BB 5GGUB 5BZDB 2FJHB 3O2VL 5JXEC 2ZKHL 1SLVA 5FK9B 1ZGLM 3P4NA 3TNNA 1JGVH 4AENA 2EYSA 3QIWA 5D96B 2LE9A 5AENA 1E27B 4X6FA 4JG1H 1NBVH 3C08L 2E9JA 4WV1C 1B4JH 3S37X 4IDJH 1RSFA 5AW9B 2DM2A 4LKCA 3VH8A 4WNJA 2ENSA 3DECA 3WNPA 4B50A 2EYSB 1QTSA 4H4NA 3OHXB 4N26A 5T3XL 5JIQA 2DIEA 2YD8A 4BH8B 1A6WH 2YPLD 3FRPA 5KVDE 3HZYA 4U1LB 3AABA 1DVYA 1E43A 1H15B 3ZZ1A 1SY6L 1TZHA 3SY0A 1SEBA 4F8LA 2CMRH 4P5RA 4IBLT 2PPFA 3UBHA 3D39D 2ALAA 3P0GB 4LSRH 3WBDA 4ONHB 3MRNB 1KJVB 2OCJA 3HG5A 4OCRH 4XNUH 4I1PA 2BIQA 3MRBB 4FQXB 5DD6A 4I3SH 1RZKH 2A83A 5D7JB 3NBNA 3D85A 4B9FA 2J88H 4ENEC 1EQWA 4JY6B 1N5AB 3CN3A 1CL7I 4HJ0D 4L1LA 5IK3B 4BXVA 5HGBB 4XT1C 1XIWA 1TYEB 1K4CA 1U8IB 5JYMA 4J3VA 4EPSA 2H26B 3GSOA 1IC7H 5SWSE 4JAMA 1GC1H 4Z7QE 2FJUB 2HTKC 3F58L 3PQYE 1RI8A 4G80A 1F90L 3QHZH 4P07A 3UBXG 3VXSA 4AYID 4P0DA 3GBEA 2HT2C 3EBGA 3RFZB 3PRZA 3RX7A 5JHDE 4H1LH 1TTFA 4XMLH 5AL0A 5IBUG 1SYSA 3F7VB 4P2OB 1FCCA 5DGQA 1TTBA 2G3XA 2X7LB 3WG7B 2YD2A 4YHKH 4U7MA 2NUTB 2XQYK 1DJXA 2AERT 4I0PC 4OIIL 2DQCH 4JFEA 2JKTM 3AGWA 3EYQD 3KPMA 4O02H 5JW4R 5ENWA 3GSQB 4ATTA 2WZ6A 2WYIA 3O8XB 5LQBH 4Z8FL 5FCUH 4JHZA 3QJUB 4DCQB 1WICA 5CGBA 4GSRA 4NQQA 1XEDA 4R84A 1JHKH 2A9BA 3MNZA 3M7FB 5EO9A 3V6ZA 2V17H 2QADB 4WI2A 4F2MA 4ZO8A 1F3DH 1JN6B 1PYWB 4KV5E 2VR9A 4NC0B 5EF1A 3TJEL 1M6UA 5FYJD 3H0TA 4XCYA 5DK0A 2IMNA 4WV1B 3CNKA 1YNTF 1WDAA 3BUIA 4N0UB 5DWUH 3P40A 1E7UA 1CGYA 3HC4H 3VFGH 4HJIA 3QDHA 4UQIM 3CN0A 1HCFX 4J3WA 2XWXA 2Z64C 1BV8A 4KDVA 3OTTA 3MLSH 4Y4FA 1MFNA 4MMXA 2ZPKL 4DVRL 4UQ9A 3QUKB 3BWSA 1B4TA 4G6FD 3T0EE 2H6OA 3FQWA 5HHNA 3TCXA 3ZJAA 2FL5B 1A25A 1P9MC 1X7QB 2VH5H 2YAHA 3D69A 4TLKA 4W70A 3WKYA 4PJAE 3TT1H 3B1UA 4FXKB 3CFKB 4QT5A 1IILE 2E46A 5ITFB 4OZIA 2NY0C 4QRUB 4KKAD 5FXCH 5F7BA 2ATKB 2Q7YA 3DURB 4OAWA 1M1SA 1IGMH 4CMMA 3B9KB 5JR1H 3DX8A 1ZVNA 3SE8L 4ZMWA 5J9PA 1J1XH 1YYCA 5FS5A 1KWKA 1EVUA 1J88A 4J2QA 5T5FL 3L3JB 4POUB 4R7DA 3OLGA 4TTDD 1FZOA 4JO8A 2GJ6B 5A6LA 2LV4A 2KDGA 1QSFE 2VLJB 1GY2A 4HUCA 4U1SB 3FCGA 2X42A 2EEBA 3CZLA 5DJCA 2J5LB 2A9MH 1QKZH 4P4KA 4XHQA 4XHJD 3QUHA 4P5TC 3QXDA 1P5VA 5C8JA 3RL2B 2ADYA 2OMUB 4S1DC 3GI8L 3UYPB 2G2RA 5EOCJ 4F91B 4OCYL 1ORQA 1CBVH 2ZXAA 1IAIL 1BBJA 2KL6A 4KTDL 3KL3A 3RUGB 4XN4A 2B39A 1AXSB 5MHSE 3LZQA 2XTSA 3WHXA 3QJHA 5HP5A 4Q2ZA 4D0DB 6FABL 5DCCA 3QEQA 1SBSL 4RFNC 5FA4B 1ZCRA 3OZ9H 4YE4H 3OB8A 2CJSA 2NR6C 1B9ZA 2WGXA 3KS0H 4K07A 5TDOB 3L7EB 1FAKT 5DJ0B 1MJJB 5E6IA 3VXMA 1EEZA 4IYKA 4EOWH 1KGYE 4FHBD 3LRSB 1VCBC 3IDGA 3ROOA 3T2NL 4LOUC 1WE5A 3S88L 1PZ5B 2D03H 5CIPB 1QBAA 4KOBA 2WXMA 5ETUA 1R3JB 4Y4FD 2GCYA 4M7ZB 4L9LC 3N42B 1QWUA 5E5MA 1H6UA 2V8LA 2GTQA 2N1TE 4MJ4A 4F3FB 2R1YA 4GKNB 5D1XB 3LNHA 4KVNL 5IKCA 4HC1L 1JJUA 2IFFH 4OLXH 5L88L 4MVBC 3MRLB 3MJWA 4WTZG 2XWEA 5GGVY 4HT1L 2HP4A 3TPUB 4UAHA 3UOAB 2ADIB 1B6UA 4X6BA 2ITDA 3V9CA 1CGVA 4E0RB 1QNZH 2DBLL 5ISZA 3NIGE 3OKOA 4J3OC 1G0YR 1A2YA 4YDVB 1U2CA 2IPUK 5DEFB 4KX8A 3T4AA 3OMZA 5CEYB 1J1PH 4P46A 5IB4A 3VJ6B 5IM7A 1ZGLB 1HZLA 1ITCA 3ARYA 3CHSA 4GXUN 3MZTA 3DMMC 1DJYA 4U1GC 3VFSB 1JVKA 2CBMA 1NDGA 1MCKA 3TURA 2YS4A 4GY4A 1AGFB 3T2QA 3V52H 5IHLB 1U0QA 2E6JA 3IFLH 4EI6B 3MCG1 4KDTC 4JDZB 4ABVA 2FJFB 3GRWH 4WW2C 4F2EA 2WOBA 1AD0B 4HA1A 1NGPL 4BSVB 1F4YL 5AVWB 5FW6A 4QTIH 4HJJH 4DGVH 4FNTA 5H4ZA 5B1JA 1U8OA 3U2IA 1J18A 3FZUC 4KKBC 2NNFA 1T0PB 4Y4KC 1BOGA 2HXAA 1A47A 4XXCA 5AWNL 1KFAL 3RUGA 1RP8A 4JFDD 4LHUB 3RWDA 1TZIA 3UZEA 5HHVH 3ZL1A 4Z76A 4G7VL 3WS3B 4FNQA 3I6KA 1TZIB 5C0AE 5DI8B 4CMHB 3EH4B 5EUOB 3WAKA 1CD1B 1WA2X 1ZHLB 4XVSH 3GSWA 3ILQC 5AKVA 3H2PA 3AXHA 3RVUD 4GAYB 1NIFA 1SVBA 2KYIA 4PJFF 3GC3A 1B3IA 5MEOB 5DURD 4ZW6A 32C2B 4PWHA 3DX7B 2DWTA 4HWBA 1J9TA 1BVKA 2NSQA 2PYEA 2ZSVA 2EXYD 3GXDA 1R3JA 2ZX8A 3BGMA 1OAXH 2G60H 3KYMB 4WHDA 4Y1AB 5I30L 5E2TL 3ZDXF 3W9DA 2JB5H 3OC5A 3G5WA 4WJG3 4TSAH 2Q3AA 1QRNA 2K0RA 3Q1SL 1I9JH 4LASL 5AOMA 3FUKA 4WFGD 3TA4D 5D70L 1A65A 1O75A 5J6HA 1XH2A 2I5YL 1ZANH 3LS5L 1ULVA 1OGAD 1RIUL 2IAMC 2EZ0C 4MKTA 1UJ3A 3QQ4B 2AJYH 3WO4B 4HCFA 2WZPA 3BWAA 5HD8C 1DLFH 4HIXH 1TQCC 5JTWA 5DJDB 4IRZH 3C87A 5D7HA 4IHOB 4XP9L 5FYJL 3W39B 4L2YA 4OKVA 4Q6KA 2VKXA 1IE4A 3MV9A 4KC3B 1S9YA 3DIFB 3PNWA 1CS6A 4JRFA 1J5IA 4PV8B 1UM6H 3QWOA 2VDPB 2GJPA 1P7KB 1YEFL 4JJ5B 4XVOA 1DCLA 3SHSA 1XH3B 3GHBH 5J57B 1U3HD 4DEPB 3DHJA 5JPNB 2VISA 1NPNA 3CJJA 5I15H 1TLMA 1BREA 2O72A 3HS0B 3T6QC 4OT1L 4Z3GA 1IV8A 1AQMA 3GDBA 3U9PH 4RFOH 1R3IH 1Y6KR 1JPSL 5FDYA 2YSSB 2RHEA 1JD9A 2BNRA 3C5JA 2F5BL 5DJZB 1KIQA 4JFFA 1GGYA 4OM1H 3HR6A 1L3NA 2A6JA 4M5SA 4NOFA 3WO4C 2HKAA 3PHQA 1BFTA 5EBMB 4PRAA 1N8OE 1U8OB 3ZT6A 5IB5B 1SHXA 1EO8H 2FT8A 3IGFA 1QSEA 3OMAB 5KJRH 4JMXA 3SDCD 2VWEC 5GJSL 3RIFK 3GK8H 4APQB 5CLTA 4UTBH 2BMKB 2DQHL 4NKQB 4O9HL 4ZX5A 2V2WB 1AGCA 1VZGA 3MX0A 5HGDA 2ILLA 4L8BB 4Y0GA 1FFTB 4XBEH 5MERA 1ECZA 2BFVL 3VRJB 3FCBA 3TJPA 4NZUL 4X6DA 1Q9LA 4PREA 4BE6A 1CD0A 9PCYA 1F8TH 3E1F1 3K8KA 3T6VA 3NJNA 4MS8C 2YFNA 5HHPA 3E2HC 3QORD 5CD5D 5IMKA 3U25A 3UTZB 1RZ7L 5CR8A 2IVFC 1S9WA 1NCUA 1RY7B 3ESPA 4PY7A 5TK4A 4B27A 3IXTB 4UT9A 1A14L 4O4YH 1VERA 3JWDC 2W81C 2PPDA 5T3ZL 5FCUL 4XB3A 4J3OG 3CN1A 2VZSA 3LNEA 4HS3B 3WFEL 5JLZB 3L5XH 4FA6A 5T3XE 1W0YT 2WSKA 5HY9A 1FG2B 4D9RE 2P46B 1YQVH 5BV7B 2XFXA 1N8ZB 5D7IE 5AZ2H 4FA8A 1EX0A 1AR1D 3C8KB 2V17L 1XF1A 3WE1A 4JO3H 2RAMA 5HXMA 4DCQA 5DZNA 4UU9B 1AMXA 2DQTH 5ANHA 3ULUD 3NSYA 3GXNA 5AZEH 5J11B 1MCFA 1MVFA 1ONQA 1IIKA 3BHBA 5C3LD 4BEIA 2Y24A 3FU0A 2JELL 1QI4A 3LZLA 4K8RC 3CSFA 5KJ4A 1JVOA 3I75A 3BPCA 5HYSA 3OHMB 1NCCH 3HB3D 3IRPX 3W9EA 3D08A 3BP5B 4QRPD 5ETUB 4H5SB 5KSAB 3WIAA 4I77H 3D6GA 4AGLA 4TUOB 2FJGA 1V10A 2X38A 5GZNA 5LNGA 4JG0L 4I4WB 4KKLD 4FG6C 2WTPA 2AKRA 3O4LB 2GB2A 3DTXB 2EKSA 4YR6B 4FTVD 4TVSa 4LMQE 4FNUA 2EH7H 3UBGA 4KXDA 2JI1A 5F3BB 3SDXF 1F4AA 4JEGB 5JR1L 1WG3A 1SQ2N 5K9QG 5LWYH 1URZA 25C8H 3AS1A 4IOFC 4M1DH 5AYUH 5FO2A 4DIXA 3D4ZA 1MSPA 1R5IB 4M6ML 1BA9A 4N8CH 4QWWD 4PGZA 1EHXA 2NY7H 2HWZH 1WYJA 4E0RA 4HUWA 5GQBA 2XNAA 1YA5A 4P2RD 3NABL 3WTVA 2Y4SA 3UBXB 2VN3A 4AV5A 1NBQA 1HCZA 1EH9A 2A9ML 3OKEA 5D8JL 2BSED 1BM3H 3LN9A 4RRPA 2APSA 43C9A 5KYUA 4TSBH 3GMMB 4ZNCD 1FLRL 4UOZA 2AFNA 1NINA 3CD4A 5AW6B 2FYYB 4ZAKB 5GS1B 1II4E 2FNBA 3VI3F 3MA7B 5BUGA 2WAHA 3VGAB 1MCSA 2BZCA 1AE6L 2DYPA 4FULA 4PJDF 5I6OA 1PY9A 2BC4A 1XD1A 3EAKA 3E6FB 2KPNA 3W82A 3AT8A 4OCMC 1YEKH 3QHFH 4YWGH 5GZND 1S7VB 1T5KA 2H1PH 3A67L 3PGFL 1MI5B 3QDME 1ACCA 2H26A 2I60H 3ENEA 3GSOB 4D7BA 4EIBA 1TKWA 5D5MF 3HFMH 3VXMB 1WFMA 4KQ3H 2JJSA 4LRNL 2QKIB 1OF2A 3ZKNC 3IDXH 1SDDB 6PAZA 2QKIA 3Q2WA 1M53A 3AMKA 3UIYA 2GYSA 3QUXD 1EFXB 3U1SH 1PNCA 4MDJB 5C0FA 5HYJB 3ARXA 1S7WB 3NJVA 3MLZH 2GI0A 5D7LA 4Z0XB 1FNLA 1XF4A 5BW7C 4PJFB 1W6LA 2DWDB 3WJLC 1EBPA 3CVBA 1CL7L 2AQ3A 1U3YA 1HE7A 1RV6X 5FUZL 4EXKA 4HD5A 1DTUA 5L88H 5DRXB 3H0TB 5SX4I 4N1EA 3F8UB 4HDIA 5CBAA 3ZDXB 4YHZH 2CA3A 1ZWIB 4AYEC 2KHAA 4F2MB 1OSPL 2ZOUA 2IOMA 3CDCA 4PJBE 2EXWD 5I1EL 3LKRB 2AJVL 4KROB 1FNHA 3BQUD 1ZT7A 2EUZA 3B2VL 3J07A 5HDOA 2V33A 5E51A 1CVSC 1FFOA 1LEGB 3QUZD 2NTSP 1JTPA 5EC1B 4EBQH 3RWHA 3PL6D 2W94A 2Z1PA 4LCUA 4BSWB 1IMHC 4KI5C 2PW2B 3H9YA 3BAJA 4HCRA 5J12C 5I8OL 4GQRA 4BFGA 1ZDSA 1UOLA 2WP3O 3T6XA 1EUTA 1IGFH 2G9HA 3O9WB 5I28A 3OG6B 4I7ZC 5A6MA 1I9RL 3LIUA 3WIHH 4TUUA 2O6DA 3WIFB 3BEWB 5EU6B 1CYWA 4XX5A 1QLEH 1LK2B 4CAGA 1E9PA 1RUQL 3ZTJH 3C9NA 2CLVB 4J27A 2V9QA 4LPYA 1E0OB 1F56A 1F4YH 4NNPL 4JQIA 5JPMC 1HQ4B 5BRPA 3L3GB 3D2UB 4PR5A 3TA3B 3Q5OA 4CW1A 2DEYX 3NCJL 4LZKA 2GY5A 4WU5B 2WV3A 1G87A 5CGYD 1KSRA 5KYUB 5FGBA 2NUPA 5LG1A 5MENE 1AQDA 1QUPA 4HJSA 4U4IA 4ZQKA 2PPAA 2JQMA 5AVYB 2A9AA 1AQDB 4AT6B 4A37A 1R3HA 4JGMA 3OHXC 1U8KA 4NENB 3TASA 2YGNA 3ZR6A 4HS3A 3SD2A 2BJMH 3CX5K 2VZOA 3BWUC 2YQGA 3J27A 3VO0A 3FCUB 3ZE2B 1R34A 2R56H 2B3IA 4MDIA 3K6FA 3QQXA 2ZD0A 3PV7A 5DUMH 3VGFA 4DP4X 2VAAA 3DSNB 4R7LA 5D1XE 1JZ2A 3EOBA 4PJFA 5KSVB 2WNGA 2YAFA 3UYRL 4BA0A 2JB5L 4POZC 1OTTC 2VDLB 4I1NB 1ZGLP 2VGLM 3C5ZB 5D7JC 5IMOB 4HKXA 3NMEA 2W1NA 4O58H 5HVFB 3H9ZA 1IGYA 2C9RA 4ABWA 5JIDA 2FX9H 2V5MA 5I1GH 1MNUL 1G7HA 2YC1B 1R47A 1KY7A 2L8AA 2NY1B 3KHOA 3LCYA 4L3FA 5AVZB 3TVMC 1U6AH 3DC0A 3LN5B 5E08L 2A4ZA 5FFLA 2ZPKH 4YXHH 3KGTA 4S2SB 4QR7A 4NZJA 2Y07H 3W2DH 4ZQTA 1EJOH 1NKOA 1SN2A 3MRHA 3HUJF 2ESVA 2F5AL 4JX0A 3G5XB 5A2AA 1BJ8A 5DQDL 3KWTA 3SBWA 1BZDA 2BERA 1FVEB 3O41A 2ZUQB 1UM4L 5KUKA 4JN2A 3P3UA 2CCWA 1TVHB 2AI0H 2EADA 4L4VE 3CDGB 5J1SC 1KIUA 1OM3H 3MXWL 1Q0XL 2XTJE 4ORZC 2BDNH 2XXFA 4Y2NA 4FNLL 3QCVH 4AGOA 3H54A 5TQ0H 4UBDC 2OTPA 4PHZA 4ALAH 4DGUA 2ZOWA 3NGBC 4B6ZA 1EFQA 3WJJA 1I3UA 3P4OB 1H0DB 2A4CA 3GLZA 2BCKA 4NP4L 4RZCB 1P7KA 3D18A 3U46B 1CFTA 3OD3A 4EN3C 5C6TL 1Q9WA 1MFUA 1IFHH 1WA1X 5ECGA 3LJ3A 1T22B 1WT5A 1S9YB 4F2FA 3UTTE 4ZDHB 3ZUNC 4CKVX 4WFHD 4QXUH 3N44B 2QSTA 2F54D 5DSCA 3WFBH 1WBZB 3TVMA 3LZOA 4O9HH 1F6FB 3D8MA 3QW9A 4HOXA 4X9GA 4HZAA 5ABDE 5IVOA 4KTDH 1Z5YD 3CDYA 3JTSA 2HCZX 3UC0L 5CZRA 4J7RA 1J5HA 1S7QA 1ZT4B 5IW1A 1MI5A 1QUNA 1AS8A 2H9GA 1PLGL 4ZUWA 5BOPA 1Y18A 1JGUL 3E6FA 3NOIA 1MCJA 3C2AL 1HXYA 2QVTA 4YBLC 1RZ7H 4N0YH 1E6OL 3KEHA 2DH3A 2FCBA 2NNXA 3CAFA 3RX5A 3WLWD 3D85D 1XGYH 4Q6IA 1TQBB 3GSUB 1OCWH 1A14H 5EUOE 1BQHG 4M6NL 4U49A 4FF9A 3HBGA 2MCAA 4Q52A 4MB4A 2VZUA 3BZDA 1T3FB 4IIQC 5DLML 4P04A 1PS3A 3HA0A 4WI0A 4MYPA 2UYLB 4G6KH 4XX1G 2ICCA 3MR9B 1FAIL 4Y5VA 1JYVA 3QFDB 1A0QL 1A9BA 5I1CL 4KJYB 5DHYB 4GQQA 1QSFA 4HC1H 4K3JL 5DS8A 2J6EA 3EFFB 1MIML 3T0XA 4C54A 4FNPA 4OGZA 4WFED 3RTQA 4NQXB 3VX0A 3IXTA 2FUQA 5DUBB 4AYDC 4LL4A 5E99L 2IDCA 2GT9B 3NPSC 5F7DA 4YDKH 2AEOA 2PETA 5HI4C 3FCSA 3GXUB 1MHHA 1E4WL 2F7OA 5DRNB 3FTSA 1ZLWK 2NXZC 3PWUA 1SOXA 1FV1A 5K59F 5D7JD 3VG0H 4ADJA 2Z93A 5F0PB 3S4SG 5IHHA 4EUPG 1KGJA 2RGSA 1HI6A 5GZOC 4DSYA 4RGMB 4L3CA 2X87A 2Z8VC 1TXKA 1SEQL 3CU1A 4XN7A 1D5BB 1PL3A 3C6SB 4XP5L 5J11C 3NT0A 1QHOA 2HTLC 3H6JA 2CCVA 4GNKB 5IBLD 4GG8B 3CCHA 5IOPA 1L9OA 5CEYA 5ISZE 1ZGLA 1S7SA 4N8CL 5MI0C 3QJQB 4K3DL 4UMGA 3C8DA 3TESA 2PWFA 3SGJC 1WWWX 4JFHD 4YFLI 4BGLA 3ABMB 3OPZH 3ULUH 2IGFL 2VW6A 1IAKB 3OKKB 3FB5A 3HG2A 4N2DA 3KPRD 5I9QC 1NCHA 2DMGA 2YSSA 3HZ3A 4P06A 4GKOA 1RZJC 4M48L 2FIKA 5IMMB 3EYUH 3UL4A 1TU2A 4QTHA 5JHLH 2D0HA 4XNYH 3DI2B 2IAND 4DP8X 3RVXD 4FS0A 2G3ZA 5KOVC 1R24B 1SMOA 3NIGB 2R0WL 2XCMC 3P02A 4IRJA 5EO0B 2CDGB 4UV4H 1B0GB 4XP4H 2YR3A 3BAXA 3HC0A 2XWRA 1N59B 1W72H 3DETC 3PGFH 2QTVA 1WWCA 2MQGA 4HC1A 4LEOA 4KZEL 5CD3B 1RK0B 3ZTJG 1NCTA 4QNPF 2YD6A 3KXFE 3GYRA 4NO5A 4BZ2H 2H8PA 5HYSG 1TENA 5BRZE 3CPUA 4NN5C 2H41A 3RVWD 5L2KA 2Z4QB 2WKOF 4PV9A 2F68X 4KMLB 1YHPA 1CGXA 1LK3L 4V33A 2MOVA 3LKNA 5J13C 4MA1B 3SGDH 1A8JH 3ARBD 4RVBA 1IAMA 1AAJA 3BSZA 4P46C 5EBWB 3B9KD 2FD6H 2ZSVB 1XF3B 1HXMA 2EDKA 1HIML 1JERA 2VDKL 3BUDA 2FZ3B 2ODHA 1OV8A 3ETBF 2ZT9C 3FCTA 4HIHB 1ORQB 1MY5A 1GXEA 3K2IA 3QFDA 2E7MA 4LVEA 3RDJA 4EO5A 4WEBL 1DLFL 4HIXL 5TE6H 4DEPC 1ZV5A 1SF3A 1MH5B 5EUKB 1J1OH 3IEAA 5F96H 2AJVH 4XCFH 4AX3A 2NW2A 1P5UB 1BZ8A 4LT7A 3K8LA 5C86A 4OD3H 4XOAA 3RWGA 4FKKA 4Y2DD 5HDQH 2F8XC 2CM5A 1CGSH 4F3FA 5ILTH 3LDBB 1YEFH 3SDAA 2EILB 3QS3A 1Q0YH 4OKVB 2IXQA 3FQNA 2RD0A 2AJXL 43CAB 2Y6SD 3T4YA 1AHWC 4NO0B 4GFXA 4IBUA 2Y5QA 3BZ5A 1NIBA 1PAZA 4Z7VA 1UH4A 4CU8A 5LAXA 3MRDA 3V95A 4L1DA 2NPLX 4OIBA 5IOPB 1FVDB 1HKFA 4LPUA 4Q0XL 5AVRB 1M9SA 2X4TA 4GI9A 5SX5K 2F5BH 5A2JH 3LH8A 1YYML 4L3EB 4OZGE 2B1OA 4DKAA 5GS0C 1KN2H 1XFPA 4N90E 3W37A 2ZWLT 2PYEE 2D4DA 5D71H 2DIAA 5DSCB 4JGJA 1ET8A 4WQOA 2HJKA 1DR9A 1IBBA 1IGJB 2VSMB 2YIHA 3STLB 5D2LE 4CC0A 1KCBA 1AGEA 1R3LA 2DLIA 2JKIS 3JQOB 4RGOL 1CFTB 4PV1C 2AJ3A 3CVIL 2JKXA 1CWVA 3TIEB 3UPCA 3ZW3A 5J7CC 5IP4A 1R24A 2BHZA 2X3AA 3IF1A 4WSGA 4TRPL 2BFVH 1E90A 1DVTA 4XCNB 3RDTB 3PDOA 3ZLQC 4ODSH 4AM0B 4KI5D 3F7QA 2D7TH 2Q87A 4HPOL 1YSOA 2JK5B 3KR3L 4DN4L 1PG7H 3OR7A 3WXWL 1C5DA 4MA8H 4M5ZL 5EBLB 5H37G 3ZL2A 1BHGA 3OGCA 1GTFA 1NANH 1OE1A 3U0TB 4Y9FA 2X6VA 3IU3B 3TBVA 1NCIA 3IKCB 3WIHA 4QKXB 1RJZB 2Z35A 3P69A 2XDHA 2EXWC 2W91A 5LB1A 1XZWA 4XH2A 4WW2B 4IMKA 1WA0X 2WCPA 2OXHB 3UJJL 3GRBA 5KZCB 3SGDI 1IKOP 4JQXA 3BAYA 2AV1A 1EGJH 4M6OL 2PN5A 4G9FB 1NAMB 4OH2A 1CE1H 5DF0A 1SYSB 1X3DA 3F7VA 3LRHA 3E0GA 5EBWA 2XIIA 3PREA 3HTLX 3P0YL 5C3TA 1FFRA 4HKXB 4UZSA 5D2LB 1A6TA 1GOGA 5HJ3A 1NKGA 1GGTA 4CNIB 5IHWA 5DRNA 1TUPA 2VAAB 1GPOH 1IC1A 3D06A 3O3AB 4OF5A 1F6AA 1J7VR 5DUBA 2NY4D 4O2EA 5I82A 3W2DL 3CH1B 5E1HB 4P59L 3QEQB 3TIDB 1B4LA 5GRJH 2HFFB 1AI1H 1PVHA 2VDRL 1JN6A 4IQHA 2AAVA 3IMBA 1S7TA 1AR1C 3MXVL 3PXHA 4KO9A 2J21A 4Q58C 1T04B 4ZFZA 4BFOA 3KGSA 3ZDXE 1HHHA 4Z7AA 3B37A 1E50A 5ACLA 3U2SA 1ZS8A 2BP3A 2DEWX 3QDMD 1L7TH 4UTCA 1QWHA 4WJ5A 5T1KB 3RVVC 3SJVB 3VXRE 3CMOL 3QIBA 5F7KC 4F58L 4HOZA 4UOQA 4M6MH 4L4TB 1RURH 5IKCB 4FA7B 4AJ0A 3CK0L 3QT2A 4L9LB 5C0BE 2E4FA 3NABH 1FE8L 2CLZA 1MCWW 3O9WD 5J3HD 3ARFB 4FTVA 1AY1L 3O45A 2HFEA 5I18L 5E70A 5DURB 2YLKA 2YPVH 2BP0A 1RZIB 3QUMB 5EORL 2Q6WA 5L4MA 3B9KA 2Z7WA 3BPNC 4I85A 1H3PL 1MFBL 2C3VB 2MNWA 2CZNA 5GS0D 3LQAH 1A22B 1N0LB 3O6FA 4WI8A 4ELDA 2VCOA 3F7PC 4E36A 2BX5A 3A4DA 3A22A 2B8OT 3PHAA 4YHOH 3G04A 4L1TA 1KCSH 2O5YL 5DHVH 3P30L 4WFFD 2XBTA 3L9EA 4PJ6A 2VC2L 3RKDD 3RZCB 2OSLA 3IMTA 1NCGA 4N85A 4N28A 1K8IA 1XCWA 1E6OH 1VCAA 4NBYB 3HFML 2TSBA 2DAVA 3NZSA 2E7DA 5A1AA 2YA2A 3F6JA 2WMPB 3FRUB 3GJFB 3GBMH 3HE7A 4JN1H 4LCWB 3LMJL 4FHKA 1AJ7L 5I66A 3L3DA 4F15C 2WQRA 1GCYA 2YN5A 3CZSA 4JDEA 3PG2A 4CN4A 4ZW5A 5C8JB 5L8LB 3GSXA 2C4FU 2GJZA 5DJXB 1Q94A 3FB7B 3QZOA 2HT4C 4NIYE 4WU7B 1FAIH 1XT5A 4QXTA 1MCCA 2GJ6A 5D6DA 3B7UX 1Z0MA 2YD1A 2B5IB 4LCYB 1NFIB 3D1MC 3P11L 3VTTA 4H0IA 5B7MA 4JDVA 3L54A 1IO4C 1YYLH 3MV7A 4RLDA 2B1AL 4F8NA 3QO0A 4TOYL 5SWZB 3DGGA 4I9XA 1BVNP 4KITB 3QQ3B 5HD8D 1IJNA 4PCYA 5D7LB 1KTBA 5E99H 4Z0XA 3VFNA 5EU7E 4N6RA 4PLOB 3GZOA 4YX2L 2NUTA 1LMKA 2WD0A 5BV7L 4UM9D 3P4MB 4EQ3A 4PJHA 3SDCB 1JWSB 3VSVA 1MWOA 3CDFA 2UVFA 4XP6H 1I7ZA 4EVNA 1HWGB 3QORC 5CD5C 4LRIA 3VXSB 1SRDA 2V37A 5EU4A 3G5ZB 2DQDH 4B9KC 1DEDA 3GKWH 1QHQA 3GBLA 5D6DC 2OSXA 1BD2B 2IGLA 4ZFFB 2V5SA 2N59A 3L6FB 5EU4B 1VLXA 5A2IH 4JHWH 5AAWA 3K74B 3EDFA 5LXGH 4OV5B 1A3RL 3BKMH 4UNUA 4YSSA 5GRZA 4PH8A 1ZVSB 3CUPB 4NKOB 4WUKH 4PJIE 2ZZUT 1L9PA 5D4HA 2FAUA 4ELME 4UNTA 4K9JA 3SDCC 4NO2A 1HOCA 1OGSA 2IGFH 5FO8B 3GHPA 3MJ7B 1R0AL 3BDYL 4X98B 4AQAA 3ARDC 4YFLF 2HPTA 1H0DA 3RL1A 3WN5C 3L3OC 1MRCL 2P5WE 2R0ZL 4IOIA 3EH2A 3MREA 4FLSA 4JRYE 4P2QA 1RZKC 3T04D 4HCRL 5TPWL 3S35L 5F3HB 4PFEA 5E7BA 4AITA 1OALA 1G6RH 2EIEA 3B7SA 2Y7NA 1GC1C 3CH8A 3B5HA 1TPXB 4GT7A 3VTAA 4PMFA 4TUJB 3V0HA 1BAGA 3FQYA 3G08B 1KXQA 4MASA 3TNNB 3HR5A 4WWID 3WEXB 3GJFA 4Y19B 4IU3B 4OSUH 4Y9GA 1AXTH 2GW5A 2YMXH 1IM3B 3CG8A 4K9EC 4M62H 3REVA 4P57B 2BNRE 3S5LB 4PGDA 4JRXA 1JZ3A 1LEKB 3FF7A 4G83A 4JFHE 4M4RA 5C2BH 4XZ4A 2NY5C 2EYRB 3CVHL 2RQ8A 1UACL 3D85B 3L08A 5DEGA 3U0PB 1D5XA 5HTSA 4U2YA 3RWIA 4LSSH 3S9DB 2VDNH 1UCBH 4AW7A 4BIKA 3OZLA 4HKBA 4GSDL 2IANE 4O2CB 3ALPA 4Y16C 4RMSA 4I0CC 1HHKA 5KS9B 2ZONA 3QQ3A 3GINA 4GEJA 1E67A 4AIZB 3D0LA 3AU1B 1NZRA 1P1VA 4NM4L 1B2WL 3HNVL 2WZAA 2UVEA 5D7KE 2FX9L 2KLRA 1CI5A 2OTUB 4EDXB 4U6VL 2DH2A 2VN6A 2MPAH 4YZWA 1SYVB 4P49A 1U6AL 4YHYB 5K1NA 5I24A 5TQ2H 3AXLA 1F42A 1S7UA 1DVXA 3T8XB 2Y7MA 3E7JA 5FDWA 4WWKA 1CPUA 3BN3B 3BYYA 3QQDB 1UA3A 4KY1H 4AIEA 3BGFC 5DQDH 1N7ML 1G9NH 3RAJL 2F7RA 2CCLA 3CQPA 3IS0X 4LLAA 3WLWC 4G3YL 1RUPH 3EDDA 4BZ1A 2CLRA 3LKSB 4FLOA 2COVD 4S1RH 5DFVC 5L2KD 1AH1A 3LV3B 4AQ1C 3BVVA 3KLAB 3X1BA 3P2BA 4KPHL 5H37A 4BQ8A 5JIMA 4JFVA 1EDYA 3O4OB 4GW1B 3WXVH 5K1JA 4MA3B 2KI6A 4XMKL 1KC5L 4XXDA 2WLHA 5F7EH 3TOPA 4P9HL 5CEZD 4A6YH 2XUWA 4DP0X 3LZRA 5J6GB 2HN7A 2NR6D 5ITBH 2HTLD 3RU8H 1IKFL 1IFHL 1IL1A 2G75B 4AIXA 2GIXA 1OQXA 1RZ8A 3BC9A 3NPZB 3SBPA 4UDUB 3VFWB 1NC4B 3ZX1A 3BWZA 4NRZB 2PO6C 3RY5A 2WQ8A 3FRPG 3V9FA 5IMLA 4AYFA 2O4EA 5F1OB 1OE3A 2XHNA 3LY6A 2OA9A 4ZODA 1BAFL 1JL8A 3HR5B 4HWUA 3O45B 3BAEH 3IDYB 3UTPD 2BNRB 3C5JB 1JAEA 1UOVA 3D3VB 3K5SA 3H3PL 3T08A 3PV6A 2DWEB 4XCCL 3APDA 3DMMA 1TJGL 4FQLH 4IKIA 5DC9B 3VXOA 1A9VA 1D9KD 3KGRA 4N0UE 1HH6A 4DGIH 4OQTH 3EYSL 3OJVC 5FYLE 2IO5A 3VYOA 4AQ1A 1F58H 4BWTA 3HBQA 3OJ2C 5I76B 2BY0A 3FB8A 3H6AA 1U8CA 3OAZH 2OAAA 3OXRA 1BZ7A 2P5WB 1X6LA 5LGHH 4ALAC 3I02A 4XMZA 3B2UD 1JHLH 1QX1A 5F6HJ 2NY0D 3K2UH 4MVBD 3IF1B 2GFBA 4G6KL 2KLTA 4OLYH 3KPSE 2BNQA 3MJ8A 5EZIL 3LS4L 1G7IA 3QIWD 1PSKL 2DKSA 4TNWF 1M05B 4X9BA 5E8DL 5HHOD 2A74B 2APFA 4KO5A 2E47A 1W72B 2ZWZA 3MRQA 1DQQA 1MIMH 5HVHC 1TJMA 5ANMB 2FO4B 4POZD 3JZ7A 1BEXA 3BKCH 3UPAA 3P2TA 5EU6D 2YPKB 4TLSA 1ZT1A 4F93B 1SY6A 1SDDA 5F1NA 4HKZB 1CG9A 1GGBL 4JRYD 2E56A 4X4MA 3E38A 1SF5A 4G9DB 1D6VH 2KLSA 3NK4A 2P24A 3KGUA 4YDZA 2MTPA 2UZYA 2BPBA 3KMDA 2AK4B 1JFQH 1A3ZA 1MWAL 3FQTB 4M61B 2OMYB 2J8UA 1VACB 3B2PA 2LR4A 1MEXH 4PW9A 1P6AB 5KSBF 4KH2A 2C5DC 3FT9A 5FKPB 2E9WA 2NY6C 4XBMA 1M71A 1IC4H 2ICWJ 3DBXA 1HEZB 4YPGA 5A3IC 1LO5A 3FJTA 3GBNH 3WTSA 1QD0A 2WXRA 4RMUA 3D39A 3CK0H 1ZXQA 3ATBA 4KXZI 2VW7A 3BX7C 5DZOA 5G2NA 4ZTPH 3SJVA 4UBDD 3O81A 4N2FA 4Z7WF 5DZAA 5I17A 5I18H 1NWPA 2H2SC 1Z5LA 2GUOA 4XNAA 5DFTA 2CD0A 3G9AB 1R6VA 1CXKA 1XZ0B 1Q9OA 3Q9PA 1VFAB 3BQUA 4QRTB 5INDB 3AQZA 4H20H 2H45A 2D0GA 3C60B 1J8HA 1MFBH 5IF0A 1MAKA 3EFOA 4YSDA 5TDNB 1K3ZA 1JGDA 2QFPA 3VDCA 3QRFM 2IG2L 4ENED 2CK2A 3G04B 4JO4H 1KCSL 1PZUB 5DXWA 2X4NB 4PBXA 2HT3C 4LARH 1J9SA 4AMXA 1UH2A 1F2QA 2K7QA 2M26A 2VXUH 5IBTH 2W60B 1Q9KB 2QGDA 4X7CC 4ZPVA 4OFDA 4QGTA 3KBEA 1XGTA 5DHXB 1ZLSH 3U9UA 4BK4A 4NAMA 4YDVA 4IDLA 2ALWA 3UPRB 4WO4A 5C0BD 2BP0B 2E8ZA 4DP7X 4XBGA 2F53A 4I5BB 1TEYA 1FPTL 2G5BB 2HRPL 3BQUC 1URLA 5H4YA 5HI5C 2X89D 1P1ZA 3G9VA 4WW2A 4NCC1 4H2AA 3T2PA 4JO1H 3GLEA 1V05A 2IEPA 2GTWA 5AKRA 1ADQH 3ZQ9A 5ICZA 3D4CA 3GMNA 1HH9A 1J0KA 1NSNL 1X4YA 2VUYA 3HI6H 4XO4A 5KS9F 4XZUB 4XE0A 1NBVL 2VQ4A 2B1AH 4UIMB 3OR7B 3PQYD 1XH0A 4MFHA 4YZFE 4IKLA 3EGSA 5K9OA 3ZL4H 3CSYB 5CZKA 4WO4C 4X8XA 2BY2A 2OL3L 1DVSA 3GMPB 1UVQA 4UAOC 5AQ0A 1W0VB 1T6BX 4PY7B 5M95B 2QHRL 3KCPA 4OD3L 4ZS7L 4DPRA 3VM5A 2X4PA 3T0EB 1LO0L 1NFDE 3CU7A 3JZYA 4JW3A 4XPBL 3W38A 2EC9U 3AW5A 2G3MA 3GKWL 4LSRL 3RNKA 3NRPA 1YNKH 4K23H 5IESL 5H2BB 1RUML 3DHMA 3KPPB 1H6TA 3HUJA 3QJHB 2Z91B 1F11A 3BKML 4IBTA 3EOTH 4BHUI 4CDGC 1XAUA 4R90H 3IYLW 2QQNL 3BPOC 2DWYA 4XN1A 3BYTA 3FOMB 4KFMA 3MBEA 5SX5H 1QLRB 1MUJB 2IH1B 3TYGH 3O11A 2FB4H 1HZHH 4N68A 2RQEA 2A74C 4OZHE 5HDLA 5I17B 2YBRB 3BDBA 2QKSA 1ZHBB 3B7TA 4JFQB 5FAAA 3U48A 3PIQA 4J3XA 3BJ91 3MLTB 2NY6B 3HUJE 2PCXA 3GXIA 1WIUA 4U3XA 5JMOC 3VI4F 4JGNA 1YN6A 3PPEA 1QFWM 2EUXA 5IHUH 2Q86B 4HCRH 1IAKA 3IFOB 3OKKA 5TPWH 5B3JF 5I8EA 4TRPH 5MEPA 1RIHH 3D9AH 4JFUA 3MCYA 4ODSL 3Q2NA 4X80H 4PJXE 3Q8EA 2X2JA 4ZSOB 1INQB 5AZUA 2FEDC 12E8L 1JHKL 2BVPB 3PGDB 3QH3A 1EDQA 1AZUA 5DYFA 4EI5C 4PJEF 1AIZA 2J1YA 3VWJA 5SWSA 1NGZA 1JG9A 4KGLA 4H0LC 4NUGH 4OGYL 3RJQB 2IQAA 2BSSA 3DJ9A 3AXIA 4G6FB 4PJ5A 3TGXA 1HT6A 5DJ2A 4OCSL 4PLJC 1P2CB 3SEPA 4PJXF 2A6IA 5EOCH 2IV8A 4H44C 3X3FL 1W16A 3ZHNA 4K7PX 3RI5K 2N0MA 5IFAL 3FONA 4AI7A 4GBXB 1MQKH 5IM7B 3VJ6A 4FP8L 5B3SB 4NBZB 3WEOA 4EQ2A 3GMRA 3NFPB 1RK0A 4K7PY 3PFUA 1JV5A 2VUKA 1UWXH 4OVUA 3VD7A 4OGQC 3DOSA 4A2EA 1P4BL 2UXVA 3QRLA 1AQKL 3TO2B 3WFHA 1HN1A 1ZA6A 1AGDA 2NDFA 4KTYA 4XNXL 3UDWC 3I50L 4QNPE 2VLJD 3MR9A 2YZ8A 1V7NL 3DX9B 3KPRB 3SE8H 3RL2A 3GMNB 1OAUH 5T5NF 4EN3B 4Y7OC 1XF2B 1XTLA 3ZBMA 5GRYA 3B8YA 4GAJL 5EUOA 4PI0A 2IADB 1I8KA 5KVFH 4G3YH 3OMIB 1BCIA 3GMOA 4S1SH 3I6KB 1P0SE 2ZXGA 1M71B 4CJ1A 1NLDL 4X5PA 3E9TA 1UASA 2GBAA 4HXAH 3BP6A 3OKDA 4S0SD 2EAEA 1OCZB 3DV6B 4GW5B 1JRHI 4KRPD 1I8MB 3CMOH 1CO1A 2OMWA 4PTUB 3SE6A 4PIBA 2FQEA 1BD2D 2OMYA 2EVJA 5I26A 3GI8H 2WQSA 4LMQI 3RHWK 4A6YL 3NJHA 4DKEL 5HYEA 4OCYH 4NQTA 5I6MA 1WS7A 2EDOA 2NQCA 2H0FA 2KZKA 5BO1L 1EV2E 2X89A 1K5NA 1DEEB 1URIA 3L7EA 3CZGA 1AXIB 4BK5A 4ZUTB 2Y5TA 2P1YA 5E5RB 1QWNA 3MA9L 4UV7H 3ZE1F 5E2WL 2CUHA 4TV3A 3WJMB 1NEZA 1CDYA 1TSHA 3VI3B 4Y4FB 4QRTA 5INDA 5AW1B 1RH8A 1PZSA 5FKAA 2X2YA 4XCCH 1KNOB 3P30H 2NX5D 4TKWA 4GIOA 4Y2OA 4UQAA 4S0HA 3VM7A 1GGUA 1L9QA 1XGRB 1ZXKA 4DGIL 1U3HC 3ETSA 2AK4E 4FI7A 4WKZA 3QWRD 1XD0A 1TOXA 4FOMA 4M7KH 5F6HI 5LJYH 1TPXC 1PKQA 4L48A 2DQIL 2FR4A 4MB1A 5I76A 3CDGA 3VGBA 1ESOA 5CCGE 3DXAB 3LAFA 4KVNH 1BPVA 3UXFA 4MNQB 1CXFA 5G4NA 1V55B 1HNFA 1YNLL 1PD0A 1GA2A 3LD8C 4I5BA 2R59A 2M1KA 1N4XL 4HWZA 4PN6A 3GTNA 3WN5B 5ANME 4D94A 3DX8B 5DJAB 3OKMB 1FBIL 5KVDL 4IK7A 3PV6B 4LU5L 1O6VA 3D2UA 3TA3A 4CW1B 1U21A 1S3KL 2MTAA 1USZA 3MNWA 4LHQB 1LO4L 4JRWA 3NZHH 3P11H 3CFKA 4QT5B 2GSIA 5BXFB 1BG9A 3FFCE 3I3EA 3FSZA 4A2DA 3U0PA 3MGOA 1KJ2H 1Y18B 3DX2A 4ZW7A 3VGDA 2YMTA 1QSVA 3F7YA 1F1DA 4QMEA 1ODUA 1OLZA 1SGKA 3SOTA 3VWKA 4Q9RL 1DQQB 3TBWB 3VMNA 3O2DA 1QEWA 5EO1B 3GTVA 4DZBB 1L9TA 3LRLA 4H1LG 3N9GH 1YJDH 4PPTA 5AAMC 5DZLA 2ZCLH 1G9MH 1QRND 5KOMC 4IJTA 4XWOD 5I8CA 1L0QA 4LSTL 1KCWA 4L8SB 4OD1L 3O3UN 3QXUA 3VMPA 2VR8A 4TLTA 4F8OA 1BBJB 4NQVB 1Z2KA 1ASOA 4H88H 2Y1ZA 1G7PB 5J12B 4JFDB 4WUUB 2P45B 2EE9A 3VD2A 4L8CA 3ARDB 3H3BC 1MFEH 3ARDA 2BIPA 1YMMD 3LZFH 4BWWA 3M86A 3QQDA 5CJ8A 3S8FB 2BNUA 4XO9A 5ENWB 1S9VA 2B5IC 4A2MA 2OK0H 1U8JA 1OGAE 5C0AA 1P7QD 3TBBA 3K2KA 2OFQA 3IDIA 3O2WH 5JOPE 1G84A 4BDVA 1DFBH 5KSUA 2Y7SA 5AOJA 1D7CA 1MRCH 4FFVD 3T1WA 1E9OA 2EIJB 1U58A 4UOW0 3VSTA 4FFYA 1YCSA 2GI7A 1QTYT 3MV7E 3VFRB 1L0XA 2JXMB 2QR0B 1QFUL 4LCCC 2P48B 1JK9B 3TLRA 2VR6A 1NPUA 2H32B 3ISRA 2HLFC 3QUMH 5F89A 5I6XC 1JYXA 5DR5H 4DP9X 1P6FA 1JPTL 4PRPE 4D0BB 1IL1B 4V2BA 2ZKHH 3CVDA 5CLXA 3X1GA 4A1RA 4B9GA 5CNHA 2BS71 4NQCB 4LSUL 1X7QA 5DQJA 4Y8AA 3C8HA 1OARH 4R2GC 2NYYC 4MBOA 3KYNA 4RMBA 1D9KB 1JK9A 3B2XA 4HK0A 5F2FA 4F20A 4K9EL 3LH2H 1LE9A 4L9DA 5E2UL 3O6KH 5EC1A 1ZVYA 1U8CB 4G59C 2JJTA 4AG4H 2R2CA 3DTUB 3ARZA 2HFEB 3OHXA 3ZMRA 4ANXA 4BWUA 4P9MH 2BRRL 1A6WL 2WB7A 1OK0A 1ITBB 1KLFB 4LKCB 3ALWA 5KS9E 4MQSB 3AFLA 4JPKL 1E5AA 3MKGA 4ESKA 2OW6A 5LBGA 3WFCL 1NC2B 3V8OA 5I0WA 4L4TD 3HMWL 1I1CA 1T0NA 3QIWB 3EJYD 1BFOA 4U6VH 4HGKC 1IBYA 3PAVA 5F9OH 4DN3L 1NUDA 4PRPB 2IPTL 1RUAH 2ZWNA 4L4VB 3TYFB 5I5RA 5GIRA 2FBRA 3SODB 4XB7A 5KS9A 3F85A 3H42L 3QPQD 3QRGL 1DVFD 4HALA 4KKBD 4U1MB 4APQD 3TH2T 2O6CA 3HNTH 4LLDA 3TNMA 4JM2C 5EFIA 5HHQA 5BUAA 4RQQB 5HI3C 1JE6A 3H56A 4JY5L 4K7PH 4U6XB 3WENA 2EXTA 1OGAB 2VLRD 4MMYA 1TVDA 2Y3NA 2W07A 3P77A 5D2LA 1CJYA 1KBPA 1C7SA 2A5UA 4OIIH 2B0SH 1K4CB 1U8IA 3NA4A 4H1LB 1RZGA 4K94C 2C9QA 1GZQA 1P7HL 2OMWB 4PTUA 4XN8A 3TYGL 4AUUA 1UT2A 3RU8L 1FG9C 5KSUB 3BP6B 2NR6A 1O5DT 5JORB 1YEHL 3ILPA 1TVBB 1CBJA 4Z7OB 1N68A 4NX0A 2Q7NA 1W0WB 2AK1L 4OCXH 4B9CA 4CBPA 4X4YA 2XTJD 4TTDC 3E8UL 4XC3H 1R5WB 1ZS8B 2P49B 5IHUL 3BAEL 2A0LD 3CBKB 4PTTA 5AD0A 1RJYA 4WW1B 1N8ZA 4G1MB 3TC9A 3EIFA 2ED7A 1D7FA 2YD7A 5T3ZH 4X80L 3HFFA 5EMYA 1GMIA 2OR9H 4Z7VF 5EU6E 4NO2B 3IDMB 3CLFL 1LE9B 2OPCA 3V4LA 1MIEH 3IE4A 12E8H 4EE2A 4GBXC 2DQMA 4DTGH 2ZG1A 4WEEA 1KZQA 1GZPB 1FL5B 3RIAK 2XXGA 3DYMA 3TT1L 1DQJB 1KEML 2CUMA 4FNRA 4NUGL 3RGVD 1KG0A 3WGVB 4U33A 4WO4D 5C0BA 4HUXA 5JDSB 1FIGH 5F44A 4N2CA 5F89B 2VJ0A 3TZVC 3IFPA 5GISL 3RX8A 5T3ZD 5ID1B 1IGML 2UXTA 5EU3B 4DGYL 2D9CA 3KDMB 2H0PA 1EHKB 1ZRUA 4OLYL 1BF5A 4R5XA 3I9GH 3JBG7 3SKJL 5JDJA 1NMAL 3K4DA 3FO0H 5SWSB 3PS6A 1ZHKA 3PABA 4KK9D 3U1PA 2WYZA 5F3HA 1AHKA 1BLNB 1KWGA 3HS9A 4ANVA 2VXTH 4JFPB 2X70B 1CLOH 4ZO7A 2C9AA 3IDNB 4ZFQA 1V7NH 2DYPB 4C8XA 1JGEB 5K5YA 4NUQA 4G8IB 4F5CE 4CJ0A 1JFQL 1MWAH 3BAWA 3FB7A 5KEZA 1YEEL 3EO0A 4UNIA 1CURA 1MEXL 4NQSA 4JDEB 5DD3H 3KS0J 3VI4E 2CO7B 4ABUA 3WU1A 1EUUA 1EANA 4P4KC 3DX0A 3HI5L 2DV6A 1IC4L 2R7EB 3POCA 3IETA 4E9VA 1JZ8A 3FTGB 3TO2A 2EE3A 1GGIH 1FLRH 4IRSB 3VFPB 2MKWA 4U31A 5INCB 3QE5A 4LOEA 1WGVA 5F7UA 1EEYA 4IGBD 1AE6H 4L18A 5EEZA 2IBZY 1ZLEA 1I7ZB 5F21B 3U7YL 3CZFA 4ELMF 3EYOA 3QHFL 4YWGL 4PJ7E 1WZKA 2H1PL 5JW3L 4HEPG 5CBEA 2K70A 4U1HB 3O3EA 3PJLA 3U30C 3FN3A 5CHNA 2EC8A 3NSDA 4LPWA 1KENL 3BGMB 1IBGL 1MF2H 1G7LA 4LSVH 5HHOA 3ET9F 43CAA 1I8MA 3T6WA 2XQBH 3LN4B 2B77A 3OAWA 1AHMA 1PGRB 5D7EA 4CN6A 2VIRA 3WAJA 4UB0H 5AVVB 1Y6NR 3NAAH 2W92A 3H9SB 3D4YA 3C5XA 4Z95L 1DSWA 4HH9B 3NIDB 4UT6L 1XAKA 4GXVH 5FO9A 4Y5YC 3FN0H 4QXWA 5IROD 1ODAA 4PVNA 3CFJB 3FUIA 4HUWB 5I1AA 1TTUA 3L3HB 3FB5B 2IFGA 2VZTA 1OSPH 1HVXA 4MA1C 2CHZA 4JANA 4AM0A 4M02A 2ICWB 4ZYKA 2Q8AL 3TIEA 1BQUA 4M93B 1WS8A 1V3MA 4IRZA 2EKSB 4LDCA 1KTLB 2WHVA 4L3AA 3B2UC 2W65A 2XQYG 2YPLB 1MRFH 3HCVB 3A4FA 2MQCA 3BIBX 4I3SL 5J5EA 5GHWL 1XF5A 2JJUA 2OL3H 1I1AA 5JA9A 3K2MC 4FNSA 4NN6C 4PRNA 4Z7OF 2PCFB 3Q06A 1M7XA 1U8MB 3ABZA 1I82A 1YJDL 2NLJB 3HPJA 1WO2A 4G9FA 1CDUA 1F90H 5FOBB 1MZYA 2VSKB 2A74A 5IVZA 4NEHB 1E5CA 1FC1A 4X8JA 4CUCA 5GGSA 1AZBA 4PJ8A 3L45A 2N1KA 1BVNT 2VDQB 3HLKA 3IGAA 3HZMA 4OD1H 5C09E 2PWDA 1RULL 4K23L 5IB5A 4QJ4B 2EEFA 1UXMA 3NSJA 3VWKD 5IOKA 4NQDA 1FGVL 1ZHLA 4I48A 4AVJA 2TAAA 4FG4A 3HG1B 2NTFA 1VHPA 3QCUH 1Y0LB 3C12A 2DI7A 5F9WC 2QQNH 4CVXA 5HGHA 1MHPL 3IVKA 1ZEAL 4AK2A 5T3ZE 1L6ZA 3AT0A 4RRPG 2E7LA 2JCWA 5TGBA 4PGEA 1S3RA 4QXGL 2X5PA 1GS8A 1T0MB 3OV6A 1FGNL 1THCA 3LNIA 4DEUA 1AKJB 1KXQE 2WXHA 1CGTA 2H3KA 5E2TH 1GR7A 4JHUA 5IHZB 3FTWA 5EB9A 3GMLA 3FQ2A 4PJHF 4Y5XA 1XR8A 3KD4A 4HIHA 1NDMB 5F6IC 2J44A 3BSZL 4G9DA 3O0LA 2XY1A 2D9QB 4RGND 1HXMB 1X5IA 5D1XC 2W0KA 5HJ3B 2GCYB 3D9AL 1SN5A 2YD9A 1G4RA 3HN8A 1NGWA 2QADD 3KYKH 4HQQL 5HHOB 5IV2B 3M88A 3MODL 4JRXD 4JKMA 1N64L 3F65A 3ULSA 1UCTA 3QYNA 3DVGA 3REWA 4QHPA 4J6RL 1X4XA 1L6XA 1EEZB 2HKFL 1A6VH 4L3EA 5E8OB 4KK5D 1A1MB 1YUHA 4PP1C 5E24E 4LL1A 5F7DB 4C56E 1ES0B 2K6ZA 4OLZL 1OB0A 2P8MB 5DUPH 4JPIB 5BO0D 1W9XA 2XZAL 3SO3B 1PW3A 4HK3J 5PCYA 2ZWKA 3IFOA 5F8RC 3U9PL 3TV8A 1R3IL 2BRRH 4GW4B 4I0KA 3T3PE 2AEIT 3MUZ1 4QRQA 4DUVA 2I7SA 1U9KA 3OSKA 3DPBB 5BS0B 1DUYB 2NQ3A 4KRLB 2C1OB 1EJOL 2IWGA 5D2LF 4XPGL 3FHEA 1FVCA 5JPNA 5K9QI 2VAJA 1TQBC 3D7PA 4PJBF 4P23B 1JFHA 4HLZG 3EJTA 3V4VH 4NT6A 5KW9L 4NUJA 4PJFE 4XNXH 3BWUF 4DVBB 3N6YA 2B16A 2JKJA 3ZKSD 2WLIA 4AC4A 3STLA 2X70A 3SKOA 1HXYB 3UDWA 1QW9A 1YPZA 2P8PB 2C7FA 3LH9A 1WWAX 4GAJH 4TUKH 1BLNA 3LHPL 4CVWA 3UZEC 4WWNA 1NGXB 1BOYA 1UD6A 4R7NA 1GCFA 4S1SL 4PJ8B 1F8TL 6FABH 5T1LA 1PIFA 1NLDH 4MX7A 3T77B 2ENPA 4U1JA 4IMKC 3PWPA 2ZAHA 3ZIYA 3QDJE 1Z0NA 3EG9A 1D5XB 3QXAB 5ALBH 3VI4B 4G6MH 1SJEA 3OSVA 4MAUH 4QXUL 5E03A 3LPPA 4N22A 5EF3A 3UO1L 2AS5M 1RPUA 3F62A 2DM4A 3GS7A 4PJ5E 4URKA 4L4VA 1N3NA 1RJCA 1XCTA 5BPPA 4DO6A 1M05A 3C5ZC 2R7EA 4AZ8A 3LX9A 1A4AA 1CDCA 3ZU8A 1D5MA 3FSVA 3MA9H 5E6ZA 3ZTEA 4X4ME 1FZMB 1WFTA 5E2WH 3L2MA 3P9WB 1XO8A 4Z78A 4KK5C 4ETQA 1DLHA 4GXFA 4JVWA 4NHCH 3SPVB 2IFFL 2KUTA 4OLXL 4QCIB 1A7OL 1ZSHA 2FWUA 1DQML 3MNZB 3GM0A 3TZVB 4M6NH 2AAAA 2CGYA 1KF9B 3HI1B 1PZCA 5CJOL 5FUCE 2X6UA 5EN2A 4K55A 3QJZA 3DHPA 4XOEA 1TCRA 1JNHB 3DSFH 1IT9L 3GSQA 4I77L 4QGYA 1TQVA 3K3QA 4TULH 2F8IA 3W56A 5FO8A 2JKWA 4YUEH 1GJWA 4K94L 2AJSL 2BVEA 1TVBA 5C70A 1E5ZA 1NIAA 4DPBX 2F19H 5CLZA 2IALB 1KCRL 2CO6B 1HWHB 3F12A 5GISH 4BKTC 5C7XL 1UQSB 4L3CB 5IMLB 5FLUA 2Z7UA 5KBKA 2ATPA 4NZ8A 2YEQA 2YD3A 1DSFL 5KBMA 4R96B 5AYUL 3SCMB 1NMAH 1J8HE 2ZP0T 5T1MB 2EXSA 2NY7L 5TF1L 2OJZL 4TQHA 3FQXB 3EDJA 3WEAA 3X2QB 2YXMA 2EEXA 5HSFA 3AWFA 1A9EB 4UF7C 4FXTA 5I16B 2LU5A 2YA1A 1MHEB 5LCVA 4JZJA 1AO7E 4HETA 1VGEL 4OFVA 3EJZD 4EAEA 1MOEA 4CN1A 1CLZL 4JJOA 4TSBL 2KZ1B 3QDMA 3L4YA 2OULB 4GS7B 2FIKB 1T89A 2X1PA 3DRQB 4MXQD 3UBXI 1L4IA 4WI6A 4Z1PA 4XO8A 4QF1B 5CJXA 5CU5A 3QWRA 1Y07A 4HJEA 1OXYA 4PW3A 4EEEA 1MW3A 3QJRB 2HX9A 1AO7A 1I8AA 4WU7A 3S37H 1J0ZA 1X4ZA 5D2NA 3A67H 4QUOA 1KUMA 3AAZA 5ESAA 3W0WD 4M48H 1FZOB 2OR8A 3RWEA 5JHDD 1WD9A 1YEWA 4A2LA 2NX5E 3CTTA 4XOBA 4AQ8C 4G6JL 2CBPA 1IZKA 2YPKA 3SZ6A 3LEYL 4TSCH 4NPKA 3UZVA 1G1KA 3S7GA 3SE3C 4QOKA 2AEPH 2PXYC 1HHKB 2C3GA 3BGFB 2VMEA 3V2AR 3HE6C 5ANMA 3V9EA 4UT9L 4FQJL 4K0OA 5I30H 5IJKC 2AV7A 3GZPA 3P9LB 4P5MA 1UYWH 5IK3A 2QQLH 3BXNA 4MNHB 1AVAA 4EVNB 4WVRA 1EERB 2WINB 2NW3A 1CFNB 1Z3GL 3T0BA 5GRVL 1OF2B 4HJTA 1THAA 4PJHB 1K9TA 3SDCA 2X3BA 4HIIA 1MJ8H 1UWGH 2E6PA 5IMOA 1MWAA 1U4EA 3NH7H 1QFUH 4PS3A 2J1XA 3AGVA 2AJYL 1T21B 1LWJA 2XTJB 3AG1B 2E59A 3FO2B 4X6CE 3RWFB 5DR5L 4KJYA 5DHYA 2EDRA 4HHAB 1IM9B 4Y5VB 3BZ4B 2NCMA 1OGTB 2ZICA 3L5WA 3TN0A 4PWIA 3H9SE 3B34A 4XBPA 4LCVA 5E4EB 4APXA 4TNVF 2NY4C 2WJ5A 4QXVA 5K59E 4FKHA 3VWKC 4GUQA 4K9EH 4ODWA 4MCYB 2EDHA 2R0KL 3RJOA 4ZAKC 2WLMA 4YSRA 5DJYA 5GS1C 3PWVA 4DEWA 4MSWB 2HH0L 3G6DL 4WW1A 1U2HA 2BY1A 5IEKB 1TVHA 1EMTH 2EH8L 1AQ8A 4FRWA 4OLUL 1F2XK 5LBVA 1CFVH 2LQRA 5ACZB 2VZVA 1UEMA 2VDMB 4A7GA 1RMFL 5DHVB 5AALA 4NN7B 1HOCB 1S9XA 1X5YA 5C0DA 3QG7H 2VMFA 1P4LB 3VXNA 4JG5A 4J3OF 1U92A 3APFA 4MGXA 5FYKD 4NKOA 4QRUA 5ILTL 1C1EH 4N2AA 1MHEA 4DN3H 4O02B 4RDBA 5FO7A 2J56A 4RX4A 3L9RA 1K4DB 4G8AC 4M4RB 1IFGA 2XETA 4MMXB 4RIRB 4KHXL 4ZDHA 4BKSC 3FQ4A 3UTTD 3ZDWA 1O6SB 1KN2L 3LKQA 4Z7IA 1MW2A 2IWKA 4WENB 4X99B 3QPXH 5D55A 4R4FL 2I26N 4ZAKA 5GS1A 1IRAY 2GAZB 4PHXA 4XTRC 4N2MA 2E6QA 4CSZA 1GRWA 3C08H 2R69H 3MRPB 4MJHA 5D9SB 4U0QB 1M7DA 5LN8A 5E00B 4IDJL 2GUYA 1AO7B 3IMRA 4JO2L 4R3SA 2Y25A 4LPXA 3PQYA 2R83A 2ERJB 1ZVHA 3OKEB 1FO0L 2OP4H 4MCZB 3CVIH 5IROA 5IVXB 3DX9A 3U6RB 1KB9J 4HP5A 1JPGB 2R1WA 2DJUA 2P5PA 3BN9D 3WNMA 1AGDB 2Y7QA 5IGXL 1ETB1 2D7TL 5E00A 1T7XA 1KIRB 3QI9B 4MMZB 3B83A 2EP6A 2XZCH 4FXGA 3N3EA 3IXAA 5EZPA 2AQRA 5J56B 4FL4C 3TH3T 3FUEA 2WO2B 3NFSL 1TSRA 1INDL 4X5LA 1E65A 4JM4L 3MLRL 1QQDB 2M83A 2HLAA 4G9FD 3LSOA 1OZUA 3TS8A 2JELH 4IS6B 1XXFC 3STBA 4JS7A 2XKNB 3KYKL 2D4FA 2R2HB 3CLFH 2PLTA 5B4MD 5HJGA 4OIAA 1FZKA 4G43B 2X2IA 3G5ZA 4KV5F 3S4SB 1XDTT 4F80A 2Q7AA 2Y2YA 1HINH 1I1FB 2WXPA 1AIFA 1HZKA 1JZHA 5A16B 3P0YH 1UM4H 5AVQB 3ZO9A 1E6JL 4C47A 5DJ6A 3TV3H 4PW4A 1DBBL 1XGZA 2QR0A 4BSWA 2QQKL 1S9XB 5HI5D 4MB3A 5LAXB 3RDTD 5JNYA 4TQEL 4GKSA 1D6EA 1OEZW 5LQBL 2JCCF 4M1DL 3CGTA 1U41A 1MCHA 1S5HA 4OFYD 2QSCL 5HPOA 4MCNA 4BDVB 3Q3GA 4FTVB 4PLKD 3VB9A 4W93A 5AVXB 3ZHFA 4M8RA 1AGBB 1LHZA 1DL7H 2EE0A 4JHVA 4MMXC 4C55A 2CIKA 3L81A 4CU7A 3IKKA 5I19H 4ZUVB 3MJ7A 3R8BB 3K72B 3MXVH 3D4GA 5D8JH 3RVWC 3RWCB 5I75C 2VISB 3GD1C 2FSEB 1I7UA 4ODHH 3OB0H 3HS0C 5SX4H 3QUZA 3QDJB 1TIUA 5CINL 3HC4L 4V1DB 4Y4HB 3VFGL 4F24A 1PKQE 1T20B 3DIFA 3C9NB 5CN1A 3V0AC 4AE1A 4ZMOA 3INUH 2NNRA 5CP3A 2OTWA 3Q44A 2F15A 2H1LM 2NT1A 5TE4H 3V5KB 5FYKE 5EU6A 4A68A 3PP4L 2FTAA 5DD3L 3CN2A 3SYPA 1YEKL 1NL0L 3AB0B 3RGVC 1A3LL 4IK6A 4U1IB 2VH5L 2H3NA 4FG2A 4X42A 5ALBL 3NFNB 3RVXC 2R1XB 2YKKA 1FORL 3VRIA 4KQ3L 3MNWB 1WFOA 2YAMA 4MX7B 4MBRA 2IAMB 2LLNA 3UO1H 3VWKB 1P2CA 3T0AA 2NY4B 4KZCA 1J8HD 2QVKA 2Q8BL 4PRIB 5E9DB 3CX5J 3QNZB 3DX4A 4UYQA 5DLMH 3FT2B 4Y5VC 2PYFB 2XA8H 5GJTH 2QZQA 1NAMA 4AKPA 3GQFA 1AZVA 1DVQA 1P5UC 3GO1L 3QS2A 3F6LA 4Z5RA 3SN6N 5I6KA 1HKLL 4P2AA 4GT0A 2DQJH 1BEYH 1O6TA 3PGCA 1X7TA 3PE9A 1BWWA 3GJEA 4E41A 3GSXB 3GSWB 1G9MC 5IEHB 2EQDA 1JXKA 1XR9B 5F88A 3HC3L 3PDGA 5E6IC 3VH8G 5DI8A 2LT9A 1NC2D 5TGBB 4ZPTB 1NOFA 1SN0A 1Y1UA 5JHMA 2OI9C 5SWQA 2G3NA 1E4WH 1OPGL 3QAZB 3B2VH 2E9IA 3MHZA 2FZ3A 5HJDA 5EDSA 2OX5B 3IBEA 1MLCB 2AJSH 4QRRA 2VKWA 2WIIA 1SBSH 3KL0A 3FL7A 4Z0BH 2F2HA 5HI3D 2Y5TB 1EWHA 4D9QD 2CHNA 4TNWK 4L0ZA 1QPKA 3NA9L 1KCVL 1HDMB 1DDTA 3GKZA 4I2XB 4PJCF 5IJBC 5CP3H 4PRBB 2YJQA 1HFUA 3B4NA 5F7LB 2HB0A 2AC0A 2DN7A 3U4BL 1X5MA 2APXA 3QQNA 4PB9L 4BD4A 4FKEA 1OP9A 4WNQA 4B9IA 3L17A 3FO1A 1FVDA 1LWHA 1LO2H 2WXGA 5IB4B 4LCWD 4DQOL 3EGDA 1CLZH 1EAOA 1BPLB 1R5VA 3T4AC 4DETA 5C09B 4DZ8A 4IBVA 1FVCB 1EZVX 3VXPA 3B1TA 4I88A 1DE4B 5DD0L 2X28A 1KYOK 4Q97A 3US0A 3VMOA 2PO6D 1U8LB 4GW4A 2WYHA 1NCBL 1UZ6F 5D6CA 1Z9PA 1A7RH 1RU9L 2JSFA 2Y36H 5D1QB 4ICWA 5SWZD 2B7DT 3V10A 1HHIB 2GTZA 1MNNA 1NCAL 1O7DE 3QZPA 3IGAB 1IUZA 3DJRA 3IJSA 3SDDA 3ZY7A 5LN4A 1LTXA 3IBOA 3JTBA 5DEJA 3JV5A 5IVZB 3MGTA 5ABZA 4N0FB 3VRLE 3S35H 3QZWB 3L7FA 3HRZA 3GHEL 2V4LA 1ZPLA 5MERB 2V2TB 4J8QA 2MHAA 4GKZB 2BSTB 4E2OA 3JUZA 5HGDB 1NOAA 4ZXBB 3NPSB 1FYTD 4J6IA 1R46A 1W15A 4M9OA 4NFCA 1JWUB 1QASA 2E74C 2I27N 5CMAA 5E4AA 5E7FA 3WMPA 4M62L 1HE8A 2VABA 3B5TA 3PP3K 1JIBA 5T1LB 5CEXB 2FLBT 5TDOA 2IDSA 1KT2A 2YEZB 3NQKA 5SWZE 3KW8A 3BUBA 4HS6A 1E5UI 3GMPA 4AEHL 1N64H 3BH8B 2NZ9D 4MXVE 3NCBB 3BKYL 4JCWA 5E6YA 3EGSB 1GGCL 3MYJA 4GI6A 1EZLA 1JZJA 4DKFL 3PPSA 4HBQA 2F5AH 1NDMA 1G9NC 2XFXB 3ZDYE 2WLNA 4HUUB 4YH6A 4OLZH 2VLRE 4HF5L 2KQMA 2NW2B 4NM4H 1XR9A 2GJJA 1X5AA 3HNVH