4YE0A

Stress-induced protein 1 truncation mutant (43 - 140) from caenorhabditis elegans
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
GSLNEVENTAQKFCVKLDVAAFKPEELKVNLEGHVLTIEGHHEVKTEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAPKTGSNTTVRALPIHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced protein 1
publication title The Chaperone Activity of the Developmental Small Heat Shock Protein Sip1 Is Regulated by pH-Dependent Conformational Changes.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
total genus 16
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ye0A00
4JUTA 1WFIA 4M5SA 4RZKA 1WGVA 1WH0A 2WJ5A 2CR0A 2CG9X 3Q9PA 4PBDA 3N3EA 4PCKA 4YL9A 3VQLA 1RL1A 4M5TA 4YE0A 4YLBA 2N3JA 2RH0A 4I88A 2JKIS 3J07A 2KMWA 5DS2A 2Y22A 3L1GA 3QORD 1GMEA 3L1EA 3VQMA 4JUSA 2BOLA 1SHSA 4FEIA 5DS1A 4YLCA 1X5MA 2XCMC 3L1FA 3W1ZA 2N0KA 2WJ7A 3Q9QA 4ZJ9A 3QORB 5LUMA 3AABA 2Y1YA 2MNWA 4MJHA 2KLRA 3GT6A 4ELDA 3AACA 4YDZA 2O30A 3IGFA 3GLAA 1EJFA 2K8QA 3EUDA 3QORA 3QORC 3GUFA 2Y1ZA
chains in the Genus database with same CATH superfamily
5PAZA 3ARBB 2R15A 2FAUA 3MKKA 2EDNA 3QFJB 4KX8A 2CBTA 3FUKA 1JYXA 4XRCA 2R39A 3E6HA 3BPCB 4LDEB 1N64H 2A6DA 3QQDB 4HS3A 4LVNC 1Q9WA 3KYKL 5HDWA 3L48A 1W0YT 2SODB 2GI0A 3TPKA 1X5JA 4KKZA 2Z3FA 4IKLA 3U36A 1MFDH 4GW4B 3PPSA 1E7UA 4P59H 3WAJA 1HL4A 4WNQB 1FFNB 2WINB 3I6KA 3FYEB 3DV4B 1CFSB 2VDNB 3TASA 5AW2B 1JPST 1VFMA 5DZJA 3UO8B 3UTZA 2V37A 5IHUL 3FB6A 3GPSA 1ORQB 2LVCA 3P9MB 5EO1B 1CDYA 2BIMA 1CO1A 3ILEA 3CAFA 1OAJA 1FCCA 1RUQL 1BGXL 2R69H 3FRPG 4L0ZA 5IFJA 2OMVA 5IMOA 3AY4A 5I8KL 3LKPB 2K45A 1RK1A 3GDBA 3OXRA 1T5XA 4HBQA 2I9TB 3WG7B 4JHZA 1KZQA 3AJ7A 2VMDA 3GSRA 3N9GL 4XMPH 2ARJQ 3MNVB 2FECL 1RZKC 4OAWA 4ONFH 3WEMA 5CCKL 2GIXA 4P2OD 2NNRA 4M6OH 1NTDA 2FATL 3ESPA 1OTSD 3LOWA 4XVJL 3TPUA 3IK2A 1YEIL 4AEHL 3OJDB 3B2MA 2C9RA 4FKKA 3F8UB 2FD6L 2JE8A 3ULUF 4HV8B 2J73A 4F8PA 1QOKA 3GMOB 1JWSA 1J48A 3QC5X 3M1CA 3QFJE 2Y36L 4PV9B 4KY2A 4Z3GA 1TQCB 1MHEA 3VXSD 4UTBL 4D9RD 5GZOC 4BKLB 3FFDA 3MRCB 1KB9K 1YNLL 1CYWA 1LO0L 4G9FA 1VPOL 2AEIT 1GOHA 3ZUCA 5IQ9B 1QEWB 3IMWA 1PKQA 2DH2A 4S1QH 2QFRA 4JFDD 3B1TA 1U21A 2X9WA 1S9XA 3L1EA 3KPRD 1A14L 4J3SA 4PU2A 4J6RL 2OK0H 2O5NA 1FF5A 5HYJD 3ULVE 2ZOLB 4C56A 2W9DL 3TA3A 3O8XD 3ZL4H 2XIIA 4ZSOA 3UAFA 5I28A 4PREA 5A7BA 3SY0B 5FFOA 1HHJB 3C5ZD 3QFDA 4L3AA 3OKNA 1BQRA 5CP3H 2WJ5A 4KGLA 5E00B 3VXRD 1MH5A 1CD1A 5ICZA 2D31B 3PHOA 4OI9A 3D39B 4YSCA 3ARQA 3CDZB 1M7IB 2I60H 4PRDA 3NA9L 3OHXC 3OGOE 5AOIA 1JXKA 4F3FB 5H8DA 3GSNH 5DSCA 2EEDA 1E9PA 5LAXA 4ZMQA 1MFCL 3H9SA 3TVMD 4ELDA 5GGTA 1SM3H 4ZS7L 4QHKI 1GZHA 2F53B 1U8LB 3P30L 5LBSA 5K39A 5KAQF 5FPIA 2EDKA 2BOBA 4XN9A 1E50A 1ZS8B 3U9PH 2UZIL 2R7EB 3RBSA 2WO4A 3WCYA 4A67A 5J12B 2VKWA 4J3OF 4OZFA 5LLIC 1B2WH 3MO1A 3PDDA 3RDJA 1OT1A 3OZKA 5A6MA 2CIKA 4PLJD 3G9VA 3ZZ1A 1T22A 1KN4H 4XNYL 1I1AA 5BMFL 1D3CA 4OLYH 2A4ZA 3GM8A 4UQBA 5BUAA 4UQ2B 3CPLA 3SCMC 4WI8A 2IBZX 3SE3A 2AJ3A 4DKAA 4HKBA 5B1CA 4D0DB 1UVQA 2AVFA 1X5GA 2IV9A 4OV5B 1SQMA 1YEDA 2E9JA 2YMXH 3TO2A 4BSVA 2X41A 4JFYA 5DHVB 3ARBC 4Z7QF 3MLYL 3TNNA 1J5OH 2F1AA 3OKEA 1RP8A 3LRLA 2GYSA 2HYMA 3F7VA 2Y3NA 4LOUD 3WE6B 2LU3A 1XMWA 4I18A 4UB0H 4MLSA 4GQ9L 4PJ5A 5F44A 3LTVA 3HC3H 1LTXA 1JI2A 3GGWB 4HLZH 4LEOB 3D39E 2CO6B 3WTUA 4CADA 4PJHB 1MEXL 5DGRA 5DK2B 3MREB 2AXGB 4F15C 1XGRB 1CQYA 4Z3JA 4OR1A 2WCGA 3ISYA 2YEQA 1NIBA 4APQD 3ESMA 2Q7YB 3I6LE 1NANH 1YEGH 3BAYA 1IE4A 2BRRL 3D51A 2F53E 2IGFH 1AXTL 1WWAX 3ULVC 3JT0A 1WUNT 4WHTB 3P54A 3M46A 2NX5B 5C9JB 2AVGA 2EAEA 4LPUA 1JRHL 2PXYA 1TCMA 1ZIBA 4Z7NE 2FSEA 4F8LA 3S4SG 4PPTA 3VU2A 3G04B 5D6CA 3S3BB 3BGAA 3HI5H 3L81A 3QS3A 3ABGA 5EFIA 3FN0H 4NLHA 2RACA 3IETB 4P23D 5M7QA 3MV9B 5DJAB 3A4EA 4M7JL 4MAYB 4JDEB 5H37G 3EGDA 1T6BX 2W0FA 5F9OH 4KHXH 1Y6NR 1P6WA 3J07A 3O11B 2PWEA 1E9OA 1CE6B 5CUSL 5LWYL 1RUMH 2W1NA 1EH9A 3CHRA 3FT1A 1NGWA 3QWQB 2IH9A 3MJ9H 4QKTA 1MVUB 3U4AA 5ACLA 4GBXA 1YMMB 5A2LH 2Y7QA 2J8UA 3DO4A 3BKML 1S7VA 1TQCC 3NP3A 4NZRL 5AUMB 5BJTB 3SKNB 3G5VB 1S9KC 2Y1ZA 5KN5A 3TT3L 4HG4J 3CDCA 4KGJA 4G42A 2DIBA 3K5RA 2Y7NA 2WTRA 1D5XA 4NKOB 2ATPA 3NJKA 3WEBA 5ICYA 4B9KC 4PJHE 4NQCB 4MS6A 2JKJA 3QRFM 1PQZB 3DHMA 1DVZA 2ALWA 4WDIB 3LAFA 4OBSA 3V6ZA 3EF7A 3QIBA 4ZUWA 3OAUL 1G7PA 5LGKA 2B59B 3H56A 4L1HA 1F4WL 4ZXBB 3QCVL 5FECB 2DI9A 2DWYA 2YPLA 3P2TA 4GRWB 4F5CA 4FYTA 4P05A 4MA3B 3VH8B 1FWXA 5FDWA 4GS7B 1N8ZA 2NX5E 4ZMOA 1BAFL 1JIBA 4U1KA 2FQGA 2GI7A 3DTXB 5KVEH 4DO5A 1OP3K 3FU3A 4JHAH 3NCJL 3CVHL 5T3XH 3WUWA 4HUKB 1HCYA 4ADJA 1OGSA 1KIUB 2WSDA 3F64A 2XU9A 3OX8A 3P2BA 1Q9OA 4XC3H 4QJ4B 1G0XA 3CC5B 5BPPA 3MV9E 3DMMA 2K6ZA 3QULA 4LNVA 4NO2B 3E3QE 3UZQB 2YSTA 4ELMA 1A1MA 5HHNB 2VDPL 5KUMA 3C9NB 4FKEA 4ZW3A 4Y1AE 2V2XA 2R4SL 2ZG2A 1IE5A 1DTUA 1ZEAL 1ZRUA 3MJGX 4JO4L 1E5AA 1U4EA 3MACH 1QYGH 1A2YA 2ZOKB 3FH8A 2OCJA 1JDCA 3DOIA 5MI0C 5J12C 5KVFL 1EO5A 3WKMH 1SOQA 2CLZA 5C0RL 3RWIA 2EIDA 4HVBA 2GTQA 5D9SA 3N1PC 5HVHB 4QRPA 1JV5B 2V2WB 5DRNA 3SKUD 4Y2DD 1DQJB 1QPXA 4WHCA 5BVPL 5DMKA 3CFKA 3X1GA 2GJ6B 1EAPB 4OJAA 3DSNB 3VD0A 3FU6A 4L4VD 2HVJA 4ANWA 4NQCE 5DZVA 4GUPA 4IOIA 4QNPF 2BIQA 1I85A 3LQAC 1P9MC 4Y19E 3TH2T 4YDVA 3O41B 5AW8B 2V2TA 1W0WB 5FGRA 5BOPA 2FZ3B 2PCYA 3GQFA 2DQTL 1MFBH 1Y1UA 4WK2B 2BY0A 5IMMA 1ETJA 4Z23A 3FB7B 1MJJA 4U2YA 2X9YA 3ROOA 2VR3A 1G1OA 3LKOA 4BQ9A 3MOAH 3PL6B 2H6PA 3PNWB 5DDHA 4UT6L 1OARH 4I0PA 5CU9A 5AAMC 3RWHA 1J10A 1JZEA 3SPIA 3WXWH 1CU4L 1IGJA 2RQEA 3FQTA 3MHZA 3SE9H 2L0DA 4PJBB 4DQOH 2G4GA 5FYKH 3NIGE 5E08L 1GSKA 3B7RL 4R97B 2OQJA 3R0MA 4EN3A 1WS7A 5AYUL 3C6SA 5DUJA 5J6HB 1T5KA 2WXNA 3GZPA 3FRPB 4DZ8B 1PZAA 2XVLA 4X5RA 2WC7A 2Z31D 1OAXL 1Q0YL 5DQJA 1AHWB 5IT2H 3ABKB 5H2BA 4QJ5B 2R2CA 5IV2B 1EDHA 3GWJA 2ATAA 1MCBA 2B5IC 5F1IA 3FUJA 3RZCD 2JQZA 3OKKB 5MENA 1AGEB 2EXTA 4TUOA 5IB4B 3WL9B 2DAVA 3D85D 1OWWA 3O9WD 1QATA 2IALA 4QD2E 5EOCL 5ID0A 3FUMA 4NOBA 3TBWA 2ZCLH 2DB8A 3NAAL 3AVEA 1O6TA 1MVYA 3EH4B 3L3DB 5HPMA 4I88A 3W81A 1A6AA 2GJ6E 4F27A 3L4TA 4MAYC 5HI3D 1NSNH 3RNKA 5CJBA 3ORJA 3E3QC 3ZE1B 5L4MA 2AS5M 4YH6A 1BWWA 3UG3A 5BXFA 1YYML 1ZIAA 3O6FA 4PRAA 5E5RB 3GT6A 3NJLA 4NNXB 3BVNA 2QQLL 1NZRA 2ADGB 3GJFA 1KV3A 2OS7A 3Q3GB 4FCHA 4HWUA 1AGDA 4F7TA 1JF5A 4KQ4H 5E0FA 5K59E 1BFTA 5C0NC 4LSTH 1HDMB 3BIKA 2VN5A 3EYVA 1F4AA 4ENZA 4FQLL 1DLHA 1A1OA 1F1DA 3RVVD 3E9UA 4JVUA 3K71A 2Y1VA 3PJLA 1UKQA 1Z66A 3GMPB 4PJBE 1C5CH 2EIKB 4WY7L 1ZGLA 2C3WA 1JSYA 4OZ4A 4KWUA 1NBYB 1QLEB 4DGWC 4BUHA 1VEPA 1A6TB 1HHIA 3C5SB 3UTSB 4DP9X 3AREC 3MPCA 4ZXBC 5E5MB 3INUH 1HEZB 3AWFA 3VRIB 2BVOA 5AZ2H 1PDKA 1UUNA 2BXYA 3RVWD 4EIGB 4GS7C 4XNUH 1FVEB 3ASWA 1BP3B 5JW5A 4GW5B 5FDYA 1XF3B 2B9AA 5D2LE 1IC4L 4BZYA 4Z7AA 3MRQB 3GC3A 3P9WB 2ZKWA 3VXUE 1H0DB 2JK5A 4O02B 4Y5XB 1O6SA 3I2CH 3RPBA 3IDIB 2MWCA 4PG2C 1NKRA 4WI2A 4BFJA 4F20A 4JRYD 1IQWH 1YNKL 3QEHA 3UERA 2MSPA 2OSXA 4HWNA 3WNIA 2Z0BA 5GS1C 1UM6H 1B6UA 1G6VK 2FWOB 4NQEA 4X6BA 4H26B 2JJUA 2VDLL 4HIIA 4IS6B 3RJOA 4CBZA 2AABH 2E9GA 1X9QA 5C0IB 2NW3A 3JWNE 4ATWA 2OBGA 3KLHD 1WAEA 2GFBA 2DTML 1CGSL 2ZXBA 5T3ZL 4DVRL 4TVUA 3RIKA 1MJ7H 1DQMH 3SPJA 4IIQB 5HHPB 3BEWB 3QT2A 4EN3C 1L9TA 2BSEA 1MZZA 2IAMB 2VL4A 4F58L 2QR0A 1OV8A 5HVHC 4OCRL 2ILLA 5IVXB 4KITB 4XBEL 2J44A 3QUXA 4HJGB 5C70A 1HQRB 2HVKB 4WWID 3CLEL 2FT7A 3MZGB 2N3JA 1UXWB 5ADOL 1KEGH 1O5PA 5CJOH 3RWJA 5HSFA 3UTSE 5F7EL 5E6IA 4CRPA 2HZHA 3L3OB 3NQKA 3VQMA 3TCLA 1S5IL 3AS0A 2NY5C 1SVBA 8CGTA 2GVYA 5CZVH 1ZLSH 3B9EA 4U1IA 1F8TH 3PABA 5D8JL 1PZ5B 2GAZA 1OTUC 3K4ZA 4PJCE 2HKAA 3DX3A 4ZUSB 1SVCP 5A1AA 1YUKB 3SGJA 1IEAB 4UCFA 5T5NF 1SBBA 3VXOB 4X6CF 3R7QA 4NGHH 4Q14A 1HZLA 2I25N 4IQHA 4CNIB 4NP4L 4NSKA 1EERB 4OIIL 4HPYL 3IJ9A 4HK3J 3V0AC 2PUQT 3TN0D 4KROB 3EO0B 2GSIA 3WJJA 3CX2A 2HLAA 4R97C 1NBQA 3GJEB 3TBVA 5HTSA 1N5YH 2R59A 3S96A 4RGMC 5B8CB 2Z8WC 3BP6A 4LF3B 3BIBX 4LCWD 4HLJA 3EJUA 4X5XB 3DJSA 1CL7I 3POHA 1G9NH 3SB3A 1AHWC 3HHRB 5D1XD 4LQFL 4MCMA 4GIOA 1FO0H 3KXFD 4RFNB 5EUKA 1FDLH 3A23A 4OF7A 3S4SB 1JPFA 4FQ1H 3VQLA 5I76A 2E7CA 4XBMA 5CINL 2BZ7A 3MBEB 1G6RH 1NC4B 1EEYB 2JKIS 3MLXH 4ZMVA 5IVXE 1BQKA 1WCBA 1V7MH 1JV2A 2IH1A 2WQVA 2QGDA 2BVTA 2X4TB 3K2UL 4HMCA 5KANG 2VZUA 4P5KB 3VGGA 4BZ2H 3DYPA 4X8CA 2OP4H 1IJ9A 5J6SA 3QJSB 3RURA 5I17A 1GC1H 1DJHA 4LHUG 3JWNC 4FFZH 4I9WD 4XMKH 1EXHA 4A7TA 4ATTA 1J8HA 4F2FA 4RCAA 5BNXD 3AAZB 4FTVE 2A3TA 4JRWA 4O2CA 1QWUA 1OLLA 5CIPB 2F5BL 3N42F 1JZ3A 2GKIA 3T0WA 3V4PB 5JXEC 5I1HL 1KTLA 2NR6C 4YX2L 5J5EA 3P3TA 2XA8H 2ZOTA 3L3GB 4Q9BA 4XWGH 3HC4L 4YO0A 5CSZB 1DVFB 3APFA 5FYLH 1Q1JH 4YBQD 1AFVL 1BECA 2K3HA 4WWKA 5ITFB 1N67A 3ZHLA 3GSXB 1KENH 3CN1A 3FCTA 3FAWA 4XVSH 1VZIA 2P9RA 2ZD0A 3REWA 3ZGIA 3BUQA 1NUGA 4XZUA 1F1GA 4XO4A 5IOPA 3US9A 1AOHA 1RK0A 3B43A 1A3LH 15C8L 3HNVH 3K6FA 4JFZH 5ISZD 3MX0A 4OZHB 2R0WL 4H20H 4N0UB 2QGEA 4YPGB 3RGVB 5I1AA 4R3SB 3F12A 1MCHA 5H35B 1D7BA 3UZVB 3OKDA 1R3IH 1KJ2B 4OIAA 3QNYB 4IK7A 4PM1A 3SDCD 3U79A 2ZCHL 3D18A 3Q7JA 4KOBA 4LFHG 4LLAA 5K9KB 4MMYB 4GEJA 1FZKA 1FO0B 2AK4D 3PJSB 1TZAA 1CFQB 4M5YL 2OL3L 4MJ5A 3V4VA 1NEUA 5KSAB 4Y5XC 1JZ2A 1RZJL 4FXKB 3X3FL 3NOIA 1CT8B 2VDOL 1MHCB 3GXFA 1ETZA 2BOCB 2ZJSL 4TOYL 5E1QA 3JWOL 4L29B 3TA4D 4JVPA 3AU1A 1JNNL 4ZFFA 1BOGB 1J87A 4GSDL 1IC5L 2UZXB 2ZYSA 5DVMA 1O9VA 3APDA 4GSQA 4P3CL 3NCCB 5D1QD 5FO8A 4NB7A 1OSEA 1E9QB 1SBSH 1N7MH 1UCBL 1ZWIA 3F04A 4JG9A 1JN6B 2M1KA 3BSHA 3S3PA 4BZ1L 3NJGA 3BD5A 2IIJA 3DVIA 4PUBL 4IIQC 3MV8D 5I1KH 3DK0A 3JWDL 2IAMC 1KGYE 1XR9A 2OXGA 4PRPD 3G08A 1AYRA 4HW6A 3TYGH 2Y25A 5FGBA 4YHZL 1L6XA 1DLFL 3NZUA 5F7MC 4HS6B 4TXVB 5FV2A 1YYLL 3QP3A 4PD4K 3TT1L 4DP8X 2VXSH 2R0KH 3IJHB 5TDOA 1S3RA 1IT9H 1HL5A 2ERJB 4Z7VF 7FABL 4JKWA 1C8PA 4P06A 4OZHE 3L3OC 1VZHA 4KO5A 4LLUB 5DJYB 1LWJA 1QI5A 4HUUA 3P0VH 1ROCA 3DK2A 3F5WA 4MX7B 2NY6D 3EOAA 3O3DB 4AXWB 4XN1A 1H3WM 1NDTA 1FBIL 3LKRB 3QEGH 2YKKA 1GAFH 3FQXA 4ODVH 5GZND 3ZT5A 4AUJA 2YMTA 2JIXA 1UJ3A 1W72B 3BFOA 2OMNA 3NDZE 4H13C 1JGUL 3A47A 3U1SL 2IFFH 4GMTL 3VJ6A 1Y18B 3Q0HA 5F3BA 4ODUA 1A4CA 2WN2A 2I32A 5C09B 3MRBB 1I7TA 4ELKA 5KJRL 5KSAA 1A1NA 1AGCB 3PWPD 3IGLA 1LP9A 5AKVA 1WDAA 3QZWA 4NENA 4R0LA 4EMZA 4Q7DA 1PLBA 2WPGA 3AXHA 3UJIL 4Y1AA 5DU7A 5GGSA 3JVFC 1A9VA 2YD2A 4GOSA 1L3WA 5JZ7D 4BCZA 5B8CC 3WS3A 1QAWA 4TUKH 2OMUA 3M8OL 1JK8B 2RALA 4APXA 2VB5A 5AW1B 1Z5LB 2VUYA 4XCEB 4O5LH 5D5MA 4A2MA 2MHAA 2OMZA 1KBKA 5CF3A 2ZF9A 1PL3A 4RFNC 1T4KA 1YQVH 2LT9A 3OVUB 1NGXA 1ETB1 1UH4A 5EBWA 4UQAA 5F88A 2BFVL 5I19H 4BGDA 4PS3A 5KSBF 4UQDA 3ATEA 4PJ6A 2WXGA 5FUOH 3U83A 1H6EA 1JDDA 1R34A 1TVDA 2E9IA 4GRLC 4HMEA 1EA9C 4RGOH 1MOEA 4PJEE 5GGTH 4DK6A 4MD5A 5SWSD 4E42A 3MJ8A 3HAEG 5LBSH 3L2MA 1WTGT 4Y19A 2ZSWB 4G43A 4JHUA 5DD0L 4C83B 4GP8B 3DJZA 4OZFH 3Q01A 2DV6A 4F8QA 3ILQD 1JHLL 2MQ0A 1PF3A 4ZT1A 2NY4B 1YNTB 2HG0A 3IT8D 4OLUH 4FFVC 4NQTA 1M05B 2CKBL 3GSOA 1J9CT 2BSTB 2O1AA 4MQTB 2W60A 2X7LB 2MH4A 4Y4KA 1QQDA 4AMKH 1DVFC 2HWZH 4K8RH 2DQCH 4LOEA 1PNCA 2O5YL 1QNIA 2ICWB 5C09E 2PW2B 1RD6A 5GS1A 1ILSA 2Z8VC 4YXKL 5PCYA 5E99L 1K8IA 1QSEB 1AH1A 2EYSB 4AUYA 3A4DA 3QUZB 1XX9C 3A5VA 3RUGB 3HG2A 4NKMB 4JY6B 4P8QA 4HD9A 5ELIA 4EZMA 4TSAH 5T3ZD 3T1WA 4KMLB 1NBZA 1F6AB 2EYRB 3PAYA 4LSUL 3RGVC 3NSFA 2BINA 2YC1A 1S7QB 3QYCA 3LKSA 3U7WL 4YHKH 1IMHC 4DERA 3BDYL 1OSPL 4N0RA 2B77A 4P5TB 5ITBH 1HESA 4RMVA 5C0AA 1PG7L 4RNRA 1MHHB 4JZJB 2WP3T 1EJFA 3P4LA 4Z7WA 3VGAC 1MIMH 3IU3A 3TJEH 3GZOA 3T3PF 1RVFH 2Z92A 1BHGA 2IG2L 3N55A 5I30H 1TDQA 1AGBB 2AZUA 2W59A 3ZDXE 1DSWA 3LPPA 4FAAB 4XAWH 5F21B 2LE9A 2EP6A 4S0HA 1U42A 4KKLC 1A0QH 1MCPH 1OOAA 3HG1B 3QQNA 5CZXD 3SE8L 4YXLL 2YOCA 5LVEA 4XP4H 4AGQA 3VQ2C 2XY2A 1KY6A 4OGAC 5GRVK 4PRNA 4YZWA 4PLNC 1XGYL 3LZQA 2WNXA 3TH4T 4A39A 1DL7L 2YD5A 1EZSA 2WOBA 1CR9L 3NJMA 1C08A 1H6TA 4UM9A 5FCUH 3ZXAC 2VIRB 5J1AA 3L1OL 3IGAB 1JGLL 2XBDA 3DGCR 1AZVA 5DRXA 4F57L 3OF6D 1NM4A 2BP8A 2GC4C 1QSEE 4HKBB 5HHXH 3H7BA 3Q5YA 4N90D 3RUGE 3BWAA 4AG4L 4BK8A 3PG2A 2RIKA 4B60A 2ERJC 3SBWC 3QGVA 1IEBA 3SDXB 1NDGB 1D6VL 5GRJH 5K9QG 4BXVA 2A74C 4G8GE 5D2LA 3WEAA 4JJ5B 3LS5H 3VXUA 3K0WA 4G1EA 1S6NA 3ABLB 1XGUA 4L2LA 1ITCA 4QCIB 1CFTA 1RULH 3KPOA 3NJFA 4P2OA 1MFMA 4J3TA 3NFPA 5C86A 4XCNB 5E6YA 1R5VB 2DLFL 2OZ4L 3UGEA 1CDUA 3MOQA 4M03A 3FT2A 2ZCKL 3ASNB 1V3MA 4ZO7A 4Q74A 3GO1H 3NIDF 2VRAA 5D7IB 3HG1E 4RWHA 2FX8L 2APWA 3VXMB 4G59C 5HHOB 3VXSA 4K71B 1ONQA 4CN6A 3MLTA 1E42A 1QKZH 2XQBL 1A7NL 4CU7A 1HWWA 1BBJA 1CD0A 2BVUA 5D7LD 2WQSA 1VZGA 3JV4A 1UB6A 4FQJH 2DJ4A 4LESA 3BE1H 4L5FH 3NVQA 5F7WC 2XPYA 2FSEB 3V6OA 5DR5H 1PZDA 5DWUH 1CUOA 1JXGA 2B1HH 3FCSB 4NQDD 1KDJA 1VFBA 3K4DA 1KB5B 5EN2A 2XC8A 2JF1A 1JGEA 3BP7A 4ECNA 3KPRA 4Y0GA 2LR4A 1PG7W 4JCWA 4PH8A 4UOW1 5EZPA 4R7XA 1XH3B 5K9OA 2HFEB 4LHUB 4M8VA 2LLLA 5HYJA 2PPEA 2WQXA 4GH7B 3RGBA 1CICB 3ECBA 3O8XA 5CBAB 1VF5C 1DBKL 2AJXL 5C0EA 1AO7B 5IW6A 1X5HA 4ZMZA 1PG7X 3N1GC 3SDXE 3P11L 4DOHB 2V3DA 3C5ZA 4PJCA 3CVHB 1NJ9B 5DGQA 3UMNA 5I1IH 4X5LA 3TJHD 1S7WA 1XF4A 3WHXB 2P5PA 3UBXA 3VXRA 4J6IA 3ABZA 2O30A 1RXLA 5FYJD 4NKDB 3BAKA 3VXTA 5KG9B 4XN2A 3DDGA 4FERA 5C0FA 1G7QB 1ZA6B 1N8OE 1EEQA 3GS4A 4AK1A 1U3ZA 2XWTB 3KS0J 1SYSB 3WOVA 4OCLC 3K72A 2VDPB 4JFHD 3GK8H 4EBQH 4YHML 4AZUA 3EFFB 3U0TB 4AI7A 3HE7B 4YSQA 2ADIB 3V9FA 1T7ZA 1XR8A 3WY4A 1GZQB 4MA1B 3BPLB 3QUZC 2NNXA 5D7IE 4ZUWB 4IMLA 1MCNA 4OSUH 3GI8L 3VXME 4FHBD 5HHOE 1FC1A 3L9YA 1IFHL 4MDJB 2DQGH 3GS7A 4MA8H 4UOQA 1MELA 3D12B 4QXUL 1OK0A 3HC0A 4NUQA 2SEBB 4HWZA 2ZYIA 3L5HA 4MWFA 1C16B 2V9TA 1K5NB 3FO9B 4P5TC 3PGCA 3E6FB 4MNQB 4OD1H 4F92B 5KVDH 1U95A 2YPVA 1HEHC 2OTWB 4R7NB 4H44C 4X8XA 4M6NH 4NUGH 4YL9A 2A73B 3CN3A 5IQMA 4X8GA 4LPCA 4H2AA 3CMOL 4H8WL 2IPKA 3GEFA 1YY9D 3GIVB 2A0LD 2GTZA 2EE9A 3T6QC 4OZGE 2BHFA 1EHLL 2JI1A 3A4AA 5FM8A 5C0CD 2A1WH 4F8OA 3JVGC 1Z9SA 2HB0A 2J1YA 3RWDA 4A2HA 1F02I 3HZVB 4QRTB 2HFGH 3DX2A 3KVQA 2Q76B 3ZSSA 2H1LM 4DKTA 1WEJH 4FTVA 1IB5A 1RAMA 1NCUA 1AE6H 2Z65C 2QJDA 4DOHE 2WLYA 4BFKA 4N0YL 3V0VB 4KI5E 4NQXB 4KO7A 3VFGH 3ZK0A 2YD4A 4N2BA 5I6NA 3QQXA 3QRGH 4N8VA 2OJZH 1E7VA 2O26U 1XFPA 3Q13A 1EO7A 5I5RA 1MJ8H 2WQUA 5IGXL 2F9BT 4S1DC 1ID5I 3B8YA 4APQA 2AI0H 3CZKA 4LT7A 3P4OB 2HPOA 3IDYB 1LNUA 3FH5A 5JIMA 4I3RH 4QRUB 3T65A 1ACXA 1AGFB 3GFUA 1D5RA 5EOCJ 2FQDA 1Q0XH 1E5YA 3HPJA 3OLEA 5KVFE 3T08A 3IN2A 4KKPA 4ZDHA 1NLDL 2XIDA 3GJFH 4X5WB 3MR9B 2HG5A 4HF5H 4YDVB 4IKKA 3FCBA 1QMUA 5C07B 4PJ8B 4L4TE 4FQHA 2YBRB 4PJXB 4HWBL 5IMMB 1M57B 2ZNXA 3BMWA 5TDPB 4MNQE 1XGZA 1GGUA 1MRCL 4P23A 1FL6B 1Z3GH 2R1XA 1IC1A 3TF4A 3OR7B 1HIMH 2CSPA 5F1KC 1EJ8A 2APSA 5SX4H 3TBTA 1DQQA 1OSYA 4GRLA 4PJ9C 2VDKL 2Y5TB 1P7QB 3AWGA 4X9YA 5INDB 4TN9A 2JKRM 2COVD 4RH4A 4FYRA 4JRFA 4CVWA 5JHDD 3FSOA 1XCTA 3PWJA 4LDOB 3MUUA 1WZ1H 2G2PA 4G9DA 1J9SA 3N0PB 1NUNB 3CSTA 1E4XH 1LO2L 4K71C 4N6QA 5FWQA 2P7TA 5FO7A 3FUNA 2HT2D 2OZNA 1ETA1 3IN0A 3UTTB 4YHNB 4JN2A 2F19L 2FO4B 3IB4A 4X6EB 3BUYA 4K5OA 4G3YH 4I2XA 1FNGA 3MLSH 5MP6L 3QXDB 3MLRH 5FGCB 1Q72H 3PWVB 3BZEB 5IB1A 5EF2A 1Q94A 2IJ0C 1CZ8H 4PWEA 3MMEA 1ET7A 5I73B 4P2QB 1I9RL 4HCGA 4PJGF 3HHSA 2YQBA 3UAJC 1N6QL 3DKHA 3VRLF 2E3VA 2P49B 2Z1PA 2PR9A 2H26B 1JGIA 2GITA 3HKZA 3P0YH 5GRZA 3VFWB 1BREA 2VXQL 1OB1B 4ANKA 5JR1H 4M56A 2VABA 2BLFA 4N68A 4I1PA 1CICC 5BRZD 3DXAD 2VDQH 2NPLX 3WGVB 5IOKA 1D7CA 2ICWI 3WDHA 5CD3B 4KI5C 5C07E 3KJ4C 2WLIB 4EI0A 3IMVA 1UFGA 3GHBL 5DEGB 2VN3A 3DVNB 1A7PH 4PJXE 4OGXL 3F6LA 2Y3AA 3ZTCC 1XF5A 4YFEA 5BS0D 5ILTL 4J3WA 1GYWA 2DS4A 1TEYA 4LSQL 4XN8A 1QR1B 2VDLB 1T83A 2O93L 1OCWL 3FDWA 3HE7C 3V4UL 4PW3A 4MA1C 3BPLC 3BH9A 4G7SB 1HXKA 2COQA 2NNCA 3K7UA 2XPZA 1SEBB 1S4IA 3OB0K 5BO1L 3DGDA 1AQKH 4X6DB 3SDCC 2UUDK 3QWOB 1QHOA 2VXVL 2YD3A 1TZGL 4GIAA 3V2AR 2F68X 2NDFA 1FIEA 5DJCB 3UTTE 4OLZL 1WAAE 3VFRB 3W39A 1KPUA 3DX9A 4Y2DA 5AB0A 2KI6A 4OKVA 1KELL 1VGKB 3FK3A 4OM0L 4X98A 1T6VN 3QXVA 1ZT7A 2AXJA 4JW3A 4MLIA 4YZFE 3ULSB 1IKOP 4JFPB 1RJZA 1GKOA 4B9FA 1J12A 4PJEA 5JQ6L 2YA2A 4P2QE 2O5ZL 1AR1B 4QHNB 4AT6B 2J1ZA 3PY9A 4N5UA 1KB3A 4NC1E 4GW1A 5CLWA 2DEXX 5IQNA 2G2RB 1DQKA 3V5HB 1I9EA 2A74A 3C6LD 1GZPA 1DBJL 4HHAA 1OIOA 2A5UA 3BZ4A 3OXSB 4TVSa 3CX5J 3CZSA 3SQOH 3VDCA 1NBCA 4EDXB 2CDEB 3MYZA 5IUCA 1QSFB 1B9KA 1KT2A 2GBAA 3FH7A 4AQ1B 3RKDD 4KXDA 5A40E 3ARTA 1U92A 2IPTH 3EHBB 3MUJA 4U1GC 5IBLC 3FMGL 3KWTA 1MFEL 4Z7IA 4WAFA 1A9EA 1JRHI 4X0KA 5IBUG 3PDOA 4PGCB 3ALPA 1V27A 2C1PA 1LM8V 4WFFE 4FP8L 4CN4A 4L3FA 4J23A 4QXTB 4UTBA 1WGOA 2Q0ZX 5T3ZE 2FHBA 4FA7B 4YNYB 2WYZA 4U1MA 5E4EB 5TGBB 4XMVA 3BP5B 2ZKHH 5F97E 1JI1A 2FH6A 2J8UF 1R3KA 3D87B 3SODB 2OX5A 3RZCA 4FQIH 4OIBA 1MKFA 3BESR 4Z8FL 4DIXA 4WF7A 4X6DE 3D85A 3O9WA 4QRQA 4MCYA 4JRXB 3CVDA 1ZHBA 1E4HA 2NDGA 4Y16D 2IBBA 5MERB 1L0XA 3SKOB 5AALA 4MMXB 1KN2L 1KLGA 3FN3A 4Y5VC 4Y5YA 4LLWA 4NM4H 2VQTA 3IPFA 1JVLA 5IIEA 4HJEA 5B1KA 1FNLA 2WKGA 1BLNB 3OZ9L 2DRUA 4Q9QH 4RRPA 1FVDA 1L5GB 1QBAA 2DQHL 5JZ7C 3ZE2E 5DWPA 5IHHA 5AWNH 2ZIDA 1WF5A 1XEDA 5JHLL 3V55A 2W07B 1DCEA 3LH2L 2B1OA 1XCXA 3QDJB 4AYDC 3L4UA 5KANI 2BO0A 2EIEA 2VLRE 3L4CA 3G5XA 3V4VH 1G7MA 1QSFE 3UTPD 5KYWA 4NQSB 3STZA 4A7QA 4RISL 1FL3B 1CDCA 3DX8B 3NQIA 2EC8A 5B1JA 3ULUD 2NTSP 3FQUB 3CSBA 1X7QA 4P9HL 3K46A 1E8XA 4YWGL 1U8MB 1NCOA 1PZBA 5I73C 4KOCA 5JIIA 4JM2B 5HHMB 4ELMF 5IHZA 3ZMRA 1GHFH 3GNML 4BIKA 4DPCX 4UAOC 3CV5A 1UASA 3DBXB 4NC1C 4XXDB 5E0QA 3SSGA 3VD3A 1LK2A 1CBJA 3W0WB 4JQVC 4OIFA 1D9KD 4PGJA 2DD8L 3QHFH 3FZUD 4O4YH 2DN7A 1DVYA 3LD8B 4G8GA 4ZO6A 2YPKB 3KYOA 3UROR 1I7RB 1NIDA 2YJQA 1X4XA 2WSKA 1FVCA 3ZYJA 2O72A 3QO0A 4BH8B 5JO5B 1RIHL 1QPKA 2VZOA 1BD2B 3OR6B 4GXUN 4JRXE 1MCSA 4XPBL 4JRYA 4DGUA 1HINL 3DOSB 2XTJD 4NPJA 4ODTL 1CFVL 4CW1A 4P07A 1KIPB 4HFWA 4FG6C 3QA3B 1TMQA 4JAMA 3MCG1 3MCKB 4MRBA 1OPGL 4PRID 3WIFA 5BVJA 5I6XB 5DJDB 1KGIA 4KY1H 3QIWD 1REIA 1N12A 2YUWA 1ED3B 4FI6A 2CO7B 4EKXA 2A6JA 2CO1A 1MI5D 2XZCL 5CMAB 5AENA 1XEUA 3GLZA 4M6ML 3OV6A 4TQPA 5KVGE 2G2NA 1KC5L 4TUJA 3S8GB 2DM3A 3I9GL 3QDJE 3BC9A 5FR3A 2D0FA 2MKLC 3QG7L 1F6LL 1GVIA 2J57A 1HQ4A 4KKBD 3KVPA 2LGNA 3MLVH 5I71C 2F1BA 3QAZB 2BCKB 1EJOL 1ULVA 3GMQB 3GBNL 5DJ2A 1HH9B 3I75B 2CNYA 4U1NB 5I8CB 4LP8A 4LVOC 5GGVH 1DZBA 2DQFA 3QJXA 2CM6A 1FGVL 2XG4A 4AKQA 5JHBA 3GZQA 1FG2B 3UBGA 5F96L 4NJAH 1AR1C 3CCHA 3BRDA 2Z4QA 3D0VA 1UUSA 3WN5A 2VDRH 2XFGB 4YHPB 1XCQB 2E76C 4ZFOB 1H8LA 2CUAA 4MQXC 1YHPA 1OALA 3W0WE 2R1YB 3CFTA 4R5VA 4HBCL 1N70A 5GGQH 5FEBA 1B0IA 5TK2A 1MG2C 1YPZB 3F65A 4LEEA 4X7DC 2BC4B 2H32B 4MVBC 1FJ1A 3HC2A 2BIOA 1NICA 3QE5A 5EU5A 4PY7A 1BD2E 2E86A 6FABL 4N8CH 1S8DB 3TN0A 3EHBC 5HVGB 4PJ9A 5HGBA 5D2NB 1BM7A 1Z9PA 1Q9LA 4FG0A 1OGAB 2F7PA 4HK0B 4KU1A 1KJ3L 4JFQB 4KVCL 4Y1TA 4XHJC 5ESAB 5FHAL 1KEML 1RJLB 2H8PB 1INQA 4LCWA 1JTPA 5EHFA 3S36H 1XZ0A 3V5DA 2QGCA 2VXUL 3P9LB 4QRSB 2ID5A 5DA4A 4I87A 2Q2EB 5E4EC 5D1XA 5HHQA 1I7ZB 1YEFL 3KXFA 1RPUA 3SGEI 3IBEA 4U6VL 3LHPH 1A7BA 3QG6A 5I18H 3EADA 3X2QB 3B9DA 2AEPH 1EMTH 1FNFA 1G9HA 3G5YA 3WO3B 4R4ND 4JUSA 1KGWA 3TCTA 4C4BA 3RG1C 3CFJB 1FYTB 1TOXA 2VZTA 3RX8A 5T1DL 1DN0B 1XIWD 5MEPB 4HFUH 2P24A 5F7LB 4OZGA 3NJJA 4XCFH 1SXAA 4WI4A 2AMGA 3R18A 1AIFA 1B4LA 2EZ0D 2BNRD 4PJDE 1BW8A 2HKHL 2ZAHA 5E6RB 5JOFB 5DURB 1TJIH 5DYOB 4U1HB 3L2LA 5EOQL 1NFDE 2CKBB 1H15A 4XP5H 4AYBA 5LGJB 3O6ML 4J28A 4E9RA 2R0ZL 4LASL 1YPZE 1ZHKA 1RSFA 2YHGA 1UWGL 3MV7B 5F6IB 4DEUA 1HOCB 4KJWC 1Z9MA 3TV3H 2BMKB 3NACL 2G9KA 4FNUA 4IOFC 4RMSA 1S7XB 4Q9RL 2QPEB 5I66B 3WBDA 1PLGH 1MREL 1MAMH 1C1EL 3BT0A 1ZLWH 3PV6B 5D2NE 1BIIA 2X44D 5E9DB 3HN5A 2XWBB 3ZTNL 2AJUH 1UA6L 1P84K 1OL0A 5ISZA 2JJSC 3RHWK 4FN0A 3LH8A 4ENEC 2PKDA 4JZNA 1TVBB 5CEZD 4ODXA 2DKMA 4MCZA 3FU7A 1QBMH 2XQYG 1OAQL 2Y06H 3SDCA 3RWGA 4IW4C 4ZMNA 3LD8C 4RZCA 3LNHA 3WKPA 4L4TA 4IU2A 1KPRB 4DSYA 1RZJC 4J1UB 3TX4A 2EO7A 1G7IA 2EQDA 3C60D 5KW9L 5ESQA 4E41B 1E2WA 3HLAA 2Y1AA 2ENQA 4JGMA 5E8DH 2NZ1A 2Y07L 5E4IA 3BN3B 4Q2ZB 2WO3B 4K5NA 2H0FA 4WJG3 3O4LD 1I1YB 4PSPA 1K4CB 1SY6A 3CC1A 3D9AL 4EI5B 5I6XC 1BVLA 3GXUB 3IEAA 1R5IB 3PGDB 1E28A 5D1QA 4XCCL 4PIBA 1FC2D 3APMA 4XPTH 1HYSC 3KPQB 2HH0L 2XZAL 5KYUA 1A7OH 1S9YB 5EU4A 4JG0H 1XVSA 4WK4B 3BRFA 3BAEL 4FI7A 4Y7OC 1FN4B 1IM9B 1UHVA 3JWDC 3MV8A 1JZ4A 4UT6A 1INDL 5TQ0H 2JTYA 3PGFL 4PCYA 4LCIH 1ECZA 1Z0NA 2DL2A 3MV7E 2WZ0A 5E9AA 4ONGL 3W1ZA 4LPVA 2XWZA 4MS8D 2ITDA 2MEJB 1NOLA 2QSTA 3D34A 2EIZA 2KZ1B 5K93A 5ETUB 3SQBA 2UX7A 1KCSH 5IW1A 2F15A 4N2KA 1G4RA 5E9DE 5JNYB 3JWNH 2ALAA 1X7SA 3EYSH 4N0CC 3L6FA 3OL2A 4K4KA 5B4MC 3CVCA 2DBLH 2CCLA 3BWSA 1T1ZA 3BQUC 3L4XA 2GB2A 2JB5H 1UD5A 3OQRA 1UGKA 2VITB 5DUMH 4I1NB 3FCUB 1CGUA 3HW7A 5CEXB 5GZNA 3S5LA 3ESVF 1VGEH 1UWYA 3Q9QA 2LABA 1BVZA 5EH1A 2CO2A 4P57B 1G7LA 2WP3O 3T2NL 1YY8A 3PHSA 4KTGA 4E41E 3PWPA 4Y5VA 4ZO8A 5EU7E 2BJML 5IBUB 4JL2A 1G0YR 1QBBA 4GG8A 3L95A 2FJSA 5K9QI 4JG1L 5D2NC 1QA9B 1YN6B 2XRAH 5JLZA 1S9WA 1I1RA 4AGOA 2VN6A 4DGIH 3EJCA 5DRWB 1KJMB 3P4MA 2I24N 4E9QA 1JFHA 1M56B 5DRZB 2DQ6A 1BBDL 1KNOB 3S8WA 5TE6L 1P53A 1L3NA 4FXTA 5C08D 2UXVA 32C2B 5E6UB 1HKLH 2OMWA 2V5RA 5EBMA 3IMBA 1RZIA 1FIGH 5AD0A 1ZE3C 4OGQC 3BLKA 4HIPA 2FO8A 2FIRT 4X4XA 4AZ8A 1IVLA 5IB5A 2FRGP 4HS8H 3FUFA 2D7MA 2BS9A 5SWSA 1HHKA 3HAEA 3ZKQD 2D3LA 3GB7B 4NBYB 2E9WA 1YAZA 1Z9OA 1R24A 3L7FB 2FT8A 2YEVB 4YUEH 4A7SA 5FFLA 5I1DA 3JYBA 4F2EA 2DQUH 3HIZA 4JQVA 35C8H 3ROLB 1LEIA 1MCEA 1OCRB 3UBFA 1NGYA 3T8XA 5BV7H 4HSQA 1TT6A 2HT2C 1QI4A 1AC0A 4YJZL 4AYEC 3W9EB 5ICUA 2N1KA 3HCVA 4Z7NF 4FKHA 4XO9A 2YPVH 3IJYA 5I2IB 5E24E 5F6IC 1KDIA 2DH3A 2HUHA 2VR8A 5GIRB 5FB8B 5LNDA 3TFKD 4DP4X 2YK1H 1SLUA 1W9XA 3WO4C 4HCRL 4B9ZA 2GBVA 4JFDB 4WI6A 4KV5E 4X4MA 2BY1A 1UM5H 3NCYP 4B53A 2ZCZA 1R0AL 3VAEA 2K70A 4EUPA 2NXYD 1DUYA 3MGOA 3NYKA 4Y2OA 1JGDA 1A5FH 4IRSD 2WCSA 4M9PA 5FGSA 3RX7A 1LEGB 4ZS6C 1QHQA 4NDMA 1N5AA 1NCBH 4DW2H 1MRFL 1OGTB 3F7YB 2G75A 5C6TL 4AQEB 2HN7A 2CZNA 2R2HA 2D3NA 2VR9A 3II3A 1I9JH 1VDGA 1IBYA 1M3IA 4OFQA 3WXVL 4A2EA 1T0MB 5D1ZC 4MSWB 3E80A 3GTTA 3KPLA 5EU7C 5FKAB 3MCLL 1RZ8B 4PJHF 2O5XL 3SYQA 2VISA 3EO1B 1A8JH 4KMTH 5I15L 3CFEB 4EI5C 3TVMB 4QRBA 5FAAA 1NPJA 3NIFF 1AKJD 3IXAA 3F3HA 3DPBB 4S2SB 3GTNA 3LSOB 4JZOA 1M2OA 2QVMA 1QWHA 2VLRA 1PYWB 1NGQH 3WFDL 4IBUA 4JM4L 2A9NH 2D3VA 2NW2B 2FYYB 3BD4A 2D3JA 4AENA 4IHOB 3CZGA 4LGSB 3VFUA 2CK0H 3DUHA 4J3UA 5FOJA 3TWCL 1IBDA 5I0WA 2CH8A 5FUZL 1NWPA 3GUFA 4JX0A 4XP1L 1HSAA 2NZ9C 3OF6A 1LP9F 2FEJA 3BEVB 3QJHA 1G87A 4YAQB 3ZKMC 3QQ3B 2NTFA 1OAUL 1GYAA 3MRNA 5CD5C 4WFGD 3L5JA 3LRGA 3C6EA 5INCA 3MRDB 3HZYA 1J9QA 5F8RC 1U2CA 1AHMA 3B8SA 3VFNB 5DJ8B 2EEBA 4G1MA 2J6EL 1V3KA 1DSYA 2JXMA 5D5MF 1RUPL 2E6PA 1A3QA 2YA1A 1TETL 4H4NA 2KQMA 2ZX7A 4P2RB 3CFMA 4W6XB 4OQTA 4JKPL 2R56L 5JIQA 4LARH 2AQQA 3I9PA 4OLWH 3VTMA 2H9GB 3G6JA 3TBYA 4E2OA 2PW1B 3ES6B 2GY7B 3FT0A 4IKJA 3MUY1 3RP1A 3F05A 3QWRD 4YSSA 1FE8H 2DWEA 4LKXB 2PTVA 3CWGA 3QUYD 4ZUUB 2CRMA 3T4YA 2M26A 2BNQD 1CYXA 4WWNA 3DV6A 3QI9C 2GSGA 3U2SA 1TCRB 5F89B 3DARA 4UV4L 3HB3D 2A38A 4WSJA 4Z7UE 5DFVD 3Q1SH 3T65B 4ABVA 5M94B 2F2HA 4HX1A 4MJHA 1YUHA 4EIZC 4TS6A 2MNJB 1TEGA 5D7LA 3MRMA 1MW3A 4JPQA 5EDXA 4L8BA 3V0WL 1RHHA 3QQ4A 5TE7L 3R4DA 4DPAX 4OJFL 3RL1A 3T0VA 4G7QB 2TSBA 4FF9A 4NQDA 2WZPD 2YRZA 2DLHA 3B56A 1QBLH 3D0LA 3H7LA 5AB2A 3NIGF 1CN4A 3KE0A 3UPRB 3A67L 4M9OA 2GT9B 2KHAA 3EJRA 5IHBA 1U91B 3GBML 5D7KE 2YQ3A 1GJIA 2FUQA 3C2AL 3DRQB 2V9UA 3LEXA 5CU5A 3X14B 4F1SA 3UTQA 4C8XA 5E4AA 1R17A 1M2VB 2C3HA 3KYKH 2DM7A 1EVUA 2EDYA 4ZTOH 3IDXH 4QT5A 4XNZB 2V7HA 1N2RB 1AR2A 3SKMA 1KSRA 1UJTA 2OL3A 1DJWA 3QUGA 4HETA 3C12A 4FNRA 1PEZA 5E8NA 1T1YB 5AVTB 1XH0A 3L9RB 4P2RE 1LO3H 4KKAC 4LCCB 2P42B 2BX5A 2XTLA 4Z7WF 3GSQB 2XKNA 4ZYKA 5I0YA 2QQKL 3DOHA 3F7KA 3QO1A 4QOKB 2Q6WB 1RUQH 1BGXH 4FQCH 4V1DB 1UD3A 5KS9B 4FXGA 4OF3A 2G60L 1JAEA 4ZW5A 3C87A 4WUKL 5EZOL 2TRYA 3IMUA 4AEFA 3LV3A 1FL5B 3MLWH 5D1ZI 2H6OA 1XF2B 2A9BA 3DYOA 4XP9H 4RQQA 5I82A 3JUZA 3JTTB 4MFHA 4D9LH 1V05A 1ND0A 2N56A 2CRYA 4LL9A 4PWIA 5CCHE 2DOCA 2J2ZA 3STLB 5CCKH 2Z8SA 4M43H 4WKZA 3DVGB 3LCYA 1T1XB 2FATH 1R9FA 2X1PA 1YEIH 4QF1A 4AEHH 3HBGA 4H8WC 1BZ9A 5HI5D 5FF6A 1ZTXH 2X2UA 4N2DA 4QYOA 3ZYZA 3HUJA 3GKWH 1BA9A 3QXAB 1M1XB 4Z3FA 1EV2E 1VFAA 3HE6D 2Y36H 1BFOB 1L9SA 3QEUA 1JGVL 4UTBH 5EBLA 5DJ6A 1PCXA 4N2MA 3H9HB 3MLZL 1EO8H 2UVFA 3LN9A 4K7PL 3NTCL 4G8IA 3TNMB 2ZWLT 3L5WA 4BRVA 5DD3L 1YNLH 1S78C 1AMXA 1NFDA 2K9FB 3VI4B 1NMAH 1VPOH 3NN8B 3CHSA 5T3XD 1I4FA 5D2LF 5ESVB 5CBEB 5E51A 1CXIA 4KK5D 1F4YL 5SWQA 1ACCA 3CLFL 3L5XL 3RVUD 3SO3C 1KLUA 2KL6A 1HH6A 4U6YB 2Q3AA 5KBMA 2HJFA 3C2SA 3B6SA 5K5YA 5G2NA 3VWKD 4LQ1A 1CLVA 1UENA 5ADPL 1MFAL 2B9BA 1AP2A 1D5ZA 1GGIL 2NY1D 3L7EA 4J6RH 4L4VB 4S0SD 2VL5B 3O0LA 3G6DH 5BRQA 4QOKE 4AYFA 1XBRA 4V1DE 2W9DH 3MQIA 2Y6TE 4PB0L 4OKDA 2E7LC 2H45A 2UXGA 4CL7A 4AV5A 3KAAA 2JJTA 2VLKB 2ZX9A 4Q6IB 3V0EA 2DQJL 2JSFA 4WU5A 5IEHA 5L2KD 3EYOB 4ONHA 4G8EB 3NA9H 3ELQA 4G7VL 3ARFD 3HHMA 2GCYA 1XDTT 4PBDA 1DDHA 3MBWA 3DIFB 5IESL 1XT5A 2L8AA 3QIUD 4QHLA 4ZS7H 3OKOA 3P30H 4NJ9H 4WQOA 2XHNA 5C0JB 1E6OL 5JHDA 4NO5A 1XL4A 4ZODA 5F1NB 1CJYA 4AQOA 4LSVL 2Z31B 1FFQA 2XWJA 2DMCA 4KTDH 4PJCF 3VI4E 3VFOA 5BMFH 1U3HB 3OMZA 4NZJA 4Y9CA 3V0IA 3WKQA 1HEJC 4MJ6B 2Z6FA 3RX9A 5M95B 4Q58C 4BCYA 2P4AB 3EYQD 3MA9L 4Z7OB 4TTGA 5F0JB 3FQWA 5FYKD 4FLQA 3KGTA 1D2OA 1MHPH 1TPXB 4CVXA 1Q9KB 3AROA 3T9WA 2DQDL 1Z5HA 2FJGB 3D3VB 3ESOA 3G7TA 4R2GD 2R2EA 3NZSA 2VWEE 3OJVC 2B20A 3H1ZA 4FQXD 2KH2B 2ZP9A 1JYVA 5JTWA 3IU4L 4M1GL 1NEZA 1ZT4B 1N0XH 1MCDA 4N0FB 3GMMA 2WVVA 4LB8A 1U36A 2WLLA 3CNKA 3RRQA 2VLKE 5HDOA 4L3CB 5BRZA 3VA6A 3DXAA 1HJBC 1F2XK 4FMVA 4M7ZB 3MYJB 5DS8A 1RSYA 4LCUB 4TNWK 5MHSE 3WY3A 5KZCB 1SJEA 4K23L 5BS0A 4O2FB 5D1ZA 4H1LA 4HUWA 5BO0D 5IM7A 1WS8A 4LCCC 3LIUA 4A7UA 3K6OA 1CDHA 1TZHB 4GMSH 4YIQA 3BUDA 6PCYA 2P44B 1AXTH 2G5BB 4K7PX 1BFVL 5E2UL 3CZLA 3FONA 4X9FA 1NMBH 4OGYL 5FLUA 4XB7A 5AVXB 1G4MA 2VC2B 2WYIA 3DHPA 2EYTB 3VRJB 4HEPA 2X42A 1OE2A 2AKRA 4IEFB 3W11D 2CHDA 2IMMA 3CFDB 1X44A 2QLYA 4J2XA 1IGYA 3PAZA 3WKNA 4F7MA 5HJ3B 4X7SH 1U8QA 3IFLH 3QPXL 2IOOA 4RMBA 5SWZB 5C0DB 2DQEH 1JXDA 4OB5H 2QSCL 5FIEA 3FKUS 4Z7OE 2FL5B 5DD1L 2GSMB 2BSRA 5LWYH 5CUSH 3CE1A 2I9LB 3ECUA 4QR7A 4ZPTB 4KK8C 5DK0B 3DUSA 1RJYB 3GMRA 3D3VE 1S9VB 1SNRA 2PCFB 3THMH 2W65B 4FI8A 2KQNA 5IF0A 3VCLB 2GJZB 2IFGA 3BKMH 4GQZA 2XXCB 4K9EL 4EQ2A 4HKJB 5LO7A 4M48L 4A6YL 2ZTBA 2D9CA 1RIVH 4F7CB 4W68A 1EUTA 3C6LA 3B9VA 4QTHA 3UC2A 1A6WL 2J1XA 5CGBA 1W0VA 3O3BA 1IAIM 5KYXB 4GKNB 1OTTD 1NGZA 5CZKA 3T5WA 4QGYA 4LLQA 4QDGA 2FJHA 2OZ4A 1P4LA 4YFLF 1TIUA 1YYCA 4PJFB 2F54B 1GY2A 4M62H 1AQ8A 2Z7WA 3ZIYA 1VENA 2PLTA 2NYYC 3QCVH 4MB5A 5ENWA 4QAWA 1BMZA 3ZQ9A 2VWEC 1ZV2A 4JO2H 1LE5B 2IC2A 3QI9A 3VFSA 1QUPA 3MGTA 2NNAA 1ZT1A 4AQZA 5ALCL 3SPHA 3VXNA 5E5LA 1BAFH 4W9CC 1UACH 3GMLA 2ETWA 4E9SA 2EXYC 1IBGH 4WJ5B 2BP0B 4HUXA 3T0BA 1RU9H 4JLRB 4XNMB 4TQIA 4XOBA 2QMKA 3CXHJ 1DANU 3LKQB 3WNKA 4WCYL 2LFGA 2CGYA 4Y16A 2BFGA 5SWZE 4ZFGH 2D9QB 4GKSA 4FCAA 2Y22A 2RCSL 3JZ7A 4OT1H 4L9DA 3FOMA 4GFTB 3RTLA 4D9QE 2X12A 3OAYH 5FK9B 3MRRA 3VW3H 5DJ0A 5AZEL 3P4NA 2X4RA 2R4SH 3CZUB 4ZW6A 4KK9C 5E8EB 2NY2B 2X88A 3SJVB 3B2UC 3IWVA 3HMWH 4NM8H 3UYPA 2GTWB 3QVAA 3IBOA 2YN3A 3HKFA 4DEPB 4FX5A 3PIQA 3WS6C 4JPVL 3M1BA 1I8KA 4P46D 4LL1A 5EZLB 5C0RH 5I74B 4HIXL 1ZAGA 4BE6A 4WO4D 4PTUB 4NXSA 3AW5A 3UACA 4FYSA 4HJ1A 5ACZB 4M61A 3ZL2A 5CCJA 1U3HC 5BVPH 2KS0A 2ED9A 3E8UL 2J4WL 2IOIA 3EFOA 3GI9L 4P9HC 2FEDD 1OY3B 4PJFE 4WFED 1NCTA 4RMRA 2UYLB 2Q2LA 1IM3D 1OEZW 4MD0A 1TPXC 4YDNA 1MG3C 1WWCA 2F54E 1DDTA 2A9ML 2X2JA 1CF8L 2VR7A 1SY6H 2RFXA 5T8IA 1YDPB 4O58L 4NN7B 3ME0A 4GLRH 4DZBA 2CAKA 3EJSA 2IDQA 4MYWB 5T1MB 1B4RA 2DQTH 43CAA 1KWGA 3U9WA 2WGNB 1D9KA 3SN6N 5JW4R 5EU6B 3V8CA 1IC0A 4EEEA 3EH3B 5EC1B 1T4WA 3U2IA 1ADWA 2WIIB 4UT6H 4I4WB 1CU4H 4NAQA 2XN9B 2C4FU 2KPWA 4K5MA 2VZSA 3FFOA 5IHWA 1MSPA 3HBZA 1USQA 1NFIB 2CLVB 2LU5A 2EXWD 1PPIA 4GRMB 5AYUH 4PRIA 2EVHA 5DZLA 4CILA 4PJEF 2FEEI 1ZTMA 7PAZA 1FAIL 4ODWA 3ZOAA 3SJVE 3QIWA 4MXWH 3GXPA 2BNQE 3GSVA 3VU1A 1KGCE 2EDMA 4YGAB 4YHIB 4AYSA 2PWDA 3U46A 5CILL 4Z7UA 3MFFB 1KGXA 1MLCB 1EFXD 3A3YB 5EOCH 3RY4A 2K9UA 3VNZA 5AW3B 5GS0L 4FYQA 2CDGB 2V9RA 1U58B 4JO3H 5ALBL 3EYUL 3K2IA 3WGUB 4GSXA 5AVVB 2NXZD 2ZNWA 3QZPA 4YDLC 1DO5A 3QYNA 4ZFZB 2AK4B 3IKCB 5MEOB 3RDTB 3DETC 3DUUB 4AVKA 4LCYA 1FH5L 3EG9B 4DWHA 3BKCL 3MOBL 3MLUL 3UJJL 4D2NA 1T5WB 3WV0A 1C12A 3UYRH 2PO6D 1VCBC 3P73A 4PRHD 4TNFA 4AVHA 3DGGB 3BAXA 3M88A 3O0RL 4I5BA 3KNBA 4GAGL 2I26N 5EU6E 4ACPA 5EF3A 1MCJA 4N8PA 5E8OA 1YJDH 2EEFA 5C6WH 1SN0A 1IAIL 5DZAA 1MLBA 4JANB 1JK9B 4XHQA 4WY7H 2XN9E 5DEJA 2VSKB 3K6SA 2LLNA 2IXQB 1R3JA 2OSWA 4G80A 4PRPB 4TQHA 1K9TA 4UU9A 5I1EL 4PG9B 3ZDXF 1SJMA 5HI4D 1OP9A 3HAEH 2OXHB 1S7SB 3KWWA 4XNQB 3WSQH 2WMPB 4O00A 3FRUB 5E2VL 5AG8A 4BV1A 2CCVA 3CSPA 4KKCC 1ZVSB 1QLRA 3V0JA 1E6JL 3H53A 4R4BA 3ZTJG 2VRQA 1G7JA 4XWOC 1DQIA 5EIIG 2AV7A 1YMHB 2JMRA 2X4OA 3HG0A 3O81A 1EEUA 5DVKA 1I3RB 3KBHE 1T21A 4D7BA 4X8JB 1YNKH 1VCAA 2DWSA 3BD3A 4IRJB 1XB3A 2WBJC 1I8UA 4RLDA 2X70A 3BW9A 2A9DA 2AQSA 2AJZA 2XJLA 5T1LA 4G6KH 3QORB 2QTEA 3NK4A 2J88L 2C3VA 1AMYA 1B0GA 1NC2D 2NY2C 2DTSA 2VXQA 4ETYA 4EUPH 1CGSH 4PGBA 5T3ZH 4RGND 4DVRH 4FDWA 5LXGL 1Y0LA 5CP7B 4WO0A 5EUOB 5HHVH 2MCPL 2BIIA 3EYFA 3S6CA 4DEPC 4HH8A 4NNPH 3WFZA 4DPRA 4OCNC 2QV2A 1JXFA 5I74C 1YEKL 1NGPL 3DX7A 4F58H 4OCRH 1CGTA 5CGTA 2JNZA 3LIZA 2PABA 5CGYC 2OA9A 3P69A 1K2DB 4XBEH 3W5NA 3LNEA 4PB9L 5IMKB 1IARB 1VACB 3MUGA 1X5FA 1IL1A 1I3GL 4DKFL 4F2MB 2VDMH 4QIRA 3F85A 5LN4A 2VSMB 3VVWA 5ADOH 5GGUA 3QNXA 5BZWA 2A6IA 2Z91B 3KCPA 1OB0A 3QHZL 1EHNA 2QGBA 2YRPA 4PGDA 5EPMB 5FO9A 4C56D 1PBYA 4G5AA 3QDMD 5D8JH 3C08L 2HX8A 4OD3H 4L23A 1IAOB 4IRZA 3SYOA 4N2NA 2VCOA 4QTFA 4UNVA 3G6AA 4N2CA 2VW6A 2EH8L 1P2CA 1BAGA 4IOSD 1JNJA 1KPVA 3BVXA 3FO0L 1YEHH 4OIIH 3C60A 4NS0A 4ICWA 1KB9J 3QEQB 4JEGB 2BH0A 1ZLUH 2OTUA 4E9YA 2ZUQC 4CVUA 4NQVB 2HCZX 4NZUL 2DWDB 1UZ8B 4EPSA 3U48A 3U2JA 1DBBL 4KXZH 2OAAA 3ETTA 4M29A 2JKXA 4TNEA 4ZOAA 1FZJA 4XBGB 4YQXL 5FKPA 5DLML 3H3BC 2ODIA 2Y6SC 3VI3A 4HMDA 1E27A 1TEFA 2BW4A 2PTUA 1JGDB 4N2FA 3T0ED 4BQ6A 4BFIA 4JB9L 4ZMPA 3WNNA 3H42L 4NT6B 2HJLA 4HJJL 4NKIL 4AEIL 1A47A 2OSYA 4Z0XB 3RVXD 3UO1L 5BZXA 4OQTH 2CG9X 2CBMA 4K8RD 3K2UH 4CMMA 1SYVA 1F3JA 1FRGL 5B39G 4F2ME 2H0PA 3EIFA 4XXWA 4N5EC 1QEXA 1EXGA 3RDTC 1ECYA 3FB8B 3LQZB 4UT7H 1N0LB 1QP1A 4HJ0D 1CD9B 4XPHL 4K3JL 3ZRCC 4A63A 4MNHA 2EUZA 3VFVA 1E4JA 3GTVA 1TLMA 5D7IF 5GSRA 2NUTA 2CUHA 5JYMA 4IBTA 4LOVA 4G6JL 1Z5YD 1U8HA 1TZIB 1KYOK 2XNAB 4P4RB 4KTEL 4YX2H 1IKNA 2WUBH 3KL5A 5F72S 1RURL 4Y1SA 4PR5A 1W6WA 3GXTA 2BNUA 3IM1A 4PVLA 2LTQB 4G72B 1AFVH 2OYKA 2XUWA 2VJXA 3M7OA 1J88A 5DJZA 1X5KA 4O2EB 1RZFL 3QEQE 3X3GL 4DO4A 2Y72A 3FU9A 4FJ6A 3QJFB 2VDNL 4V2BA 3N41B 3NFSL 1UXSA 1BM3H 4K5LA 3ARGC 4QRAA 5IEKB 15C8H 2Y2TA 3AQXA 2VXTH 4B96A 2EIMB 3KDPB 5DUPL 1KJVA 1WFNA 4OZGF 1ADQL 2DYPB 1T20A 1URLA 2CJUL 1NLBH 4GYBA 5JHLA 3ULVL 3WS6A 5EB9A 1IGFL 3D08A 2IANB 4XXCA 2D2OA 1QVOB 2ZCHH 3NJIA 4HT1L 5C08A 3MU3A 3MRLB 2DI7A 3RYMA 3ARDD 5A2JH 2OL3H 1QFUH 3G9AB 4GG6A 5JPNA 3ZGHA 5FYJH 2VLJD 3IXTA 4MXQC 4BRJA 3X3FH 1BG9A 2VM4A 3IJEB 5LG6A 2ZJSH 4TOYH 1JERA 3IDNA 3JWOH 4G6FD 4X9GA 1E4KA 1JWMA 1JNNH 4FNQA 2I5YL 4IRJC 4K15A 1N59A 3MRFA 4UUJB 2PR4L 3MV11 4S1SL 1GW0A 1IC5H 4OUOA 3WTSA 1UEMA 3M17A 5I8EA 1OW0C 3QORC 4P3CH 1J1PH 1U6AL 5GRVL 4LSDA 3ZHKA 2ATKB 4TTDC 4H0IA 4U1SB 1GIGL 5B7MA 5ICXA 2HX9A 1P1ZA 3M07A 4TQEH 4A7GF 2BRQA 5EF1A 3UEQA 1IAKB 2AC0A 2L7QA 3DNKA 1BX2B 4XPGL 3GSUB 4CVZB 1LD9A 4B9GA 1A4BA 3U4EB 3Q2LA 2CJ3A 4W6WB 1U8PB 3VE0B 3WFCL 4Q6KA 1N64L 2FK9A 5D7JC 4AM0B 5BZDB 5J6GA 4YHZH 1OM3H 4P4KD 3RL1B 1XGTA 2CU9A 4P59L 2QFPA 2X4UA 3QUKA 3MGAA 4W9KC 4DN4H 3ALWA 3SGKA 3T8VA 4W9DC 1BQUA 1ZLVK 7FABH 2ZPKL 2QVFB 4J4PC 2WXOA 1D5BA 2XV2A 3II1A 4P5RA 5TE4H 1WC7B 4AQAB 4IRSA 4XB3A 1ZA3A 4HOMA 1M6OA 3LB6C 2IANE 2VGLM 3S3DB 5GS0D 1EAOA 2HTLD 3UJTL 3MRKB 3GXMA 5B38A 3BSGA 1JGUH 3NEEA 4BQBA 2G5RA 5GJTH 4AL8L 3VG0H 5KJRH 5BZZA 3NJNA 3L3JA 3QQ9D 1J0YA 2CLRB 1CGXA 3TBSB 2G9HB 2X4NA 5F7FA 1QZ1A 4FA8A 3PHQA 1CXFA 1FFPA 4RAUA 4WI3A 1N4XH 5FA3A 1ZHLB 2IWGA 4M6OL 4DNLA 1EANA 2L4OA 2X4SA 3AG3B 3KYNA 4KFMA 5ERWA 3Q5OA 4UTCA 4DP6X 4ZPVA 3DURB 5J11B 3OGCA 1YRKA 3OD3A 4JY4B 4Y8AA 5CHNA 5DHMC 1AKJA 3QJUB 4LGPB 2OV0A 4GUOA 4KNQA 3W9DB 3REVB 1K3IA 4TVPL 4F8NA 4D8PA 4DF9A 1FLTX 4YXHL 4CJ1A 3GMNA 1UKSA 3DLQR 4NO0B 2UWEB 2OULB 3R4RA 1HL8A 4L8CB 1XB6A 4BDVB 3BRGC 2P47B 2XWEA 2MPAH 4XO8A 2ZQKA 1KTDA 1LK3H 2YMOA 4HJTA 1BG1A 3RNQA 3IFPB 3MJ7A 2VUOA 1MWAB 3PNRB 4KJQD 3Q43A 5EC2A 2ZUTA 5DD0H 2XJKA 3VM5A 4JY5L 5KAQG 1JHLH 1A4KA 2YEZA 1O9WA 5C0CB 2HVBA 3ETBJ 3T6WA 4J3OG 5I5IA 2W9EH 3NCFB 1DE4B 3KPSB 3QH3A 2NY7L 1BQHG 4W9GC 4FZEH 3ZL4L 3WFBH 4LXFA 1HCZA 2H6UA 3N44F 5D96B 4MBRA 1OF2B 2WBJA 3PRZA 2LTQC 1ID2A 3VD7A 1SDYA 5E99H 1U8NB 5C6PB 3ISWA 3CMGA 3FHAA 3DO7A 2ICEB 3PAVA 4YZFF 4NIKB 4XOCA 4J8RA 2I60L 3JTSB 1MRDH 1WBYB 4X4YA 3QWRA 4XMWA 2F74B 1A4JB 3QUYA 4TQ8A 3ZHFA 2BNQA 2DYRB 5GZOD 1NAMB 3U9UA 1B0RA 4B9IA 4OLEA 4UILH 2EECA 4FRWA 3BAWA 1SM3L 4H8QA 3U7WH 1OXYA 3BDYH 1OSPH 3P77B 4X9BA 5EIIB 1JNHA 5JOPD 3UP6A 1ZHNB 3QDGB 4PJIE 4X6CA 1PG7H 4X99B 1KOAA 2ITCB 3I9AA 1G0DA 2GK0A 1U4FA 1B2WL 4Z0BL 2UWEE 5IK3B 2J55A 1IGTB 4QRRD 4UIKL 3TP4A 2IG2H 2VQUA 4JFFD 1DBMH 3FCGA 4H1LH 2WZPA 1KWKA 2XQYK 1YA5A 3VTAA 1KN4L 3BZFB 1LE9B 3DRTA 3EUDA 2V33A 4OLYL 1KG0A 4U1LB 3RIFF 3KBPA 2YAFA 4WW2C 1DVXA 3B2PA 3AADB 4YXLH 3SE8H 3SYAA 2XTSA 2FB4H 2WB1A 3ZO0A 1M71A 3KG5A 4YR6A 1DJGA 3D8MA 3RWFB 3CFNA 4IDJL 4N9GA 4B9JA 3B2DC 3ISRA 2YMXL 2EE0A 3KPPA 2YO3A 3I6GA 3KPSE 4K07A 4M8QB 1J5OL 3KL3A 3HS0B 1AD9B 5I1LB 2Q7NA 2WXPA 1RZ7L 3L1OH 1U8CB 2JQAA 4UB0L 2Y7MA 4PGZA 4F57H 1ASPA 5TFSH 2W38A 5DTFB 3OC5A 4UAHA 3B3IA 4JCMA 4M93B 2EADA 2QADC 2JCCA 4NZDA 3R8QA 4AG4H 5F3HB 4YDJA 1UURA 2P8MA 3TIDB 1QFWI 3ZQWA 4GP5B 1U3YA 3ZE2F 4UQCA 1D6VH 4X6FA 5T1JA 5F7NC 1YEGL 2C9XA 2YXFA 2WM0A 4ILDA 4MNGB 2IGFL 2WHVA 4LPTA 4P3DB 4XH2B 3CH8A 3SOBH 5J13B 1AQMA 3QDGE 1VERA 43C9A 4K3DH 3P3YA 5C0BB 5C8JB 3LKNA 1WIOA 2FDBP 4GXFA 3LN4B 5TH2A 3U82B 1A7RL 3SCMD 2OZ4H 4X7TA 5CSGA 3SDDB 4I1RA 3T2QA 4HAGA 3MNMA 1K8DB 1QW8A 1EGJL 2EDTA 2H2SD 4IBLT 4I9XA 3FN0L 4Y9GA 1SF3A 2ENSA 2W5PA 4UQIM 3HE6A 4KHXL 3ARBD 2ADFL 3QFJD 4KRMB 5HGHA 4A6YB 4NRXB 5K69A 5HGAB 3BP4B 5DQDH 3TYFA 2BDNL 3D25B 3KGUA 5J11C 2G0KA 2FIKA 3L4ZA 4WHYG 3PUUA 5CR1A 4Z78A 3MJ9L 3HNSL 3BPOC 3V7AG 4FHJA 2BSED 2QV4A 3RGHA 4M5TA 3O3AB 5E94A 1T80A 1E5ZA 3TESA 1UOWA 1XGPB 2N7BA 4LLDB 3L45A 3BO8B 4NHUA 4LCVA 3Q2VA 4WI0A 1NKOA 4X9IA 1KYAA 3ARRA 5B39B 1EBPA 5GISL 3ARGA 3G6JF 2LV4A 3WFHA 3K8MA 1SUHA 2BP3A 3QRBA 3ULVD 5IR1A 2V7NA 4GFXA 1DBKH 3TL5A 4D0BA 4GJTB 4JR9L 2AJXH 2NY5L 3NGBC 2XX0A 3CFBA 4HIEB 1P69B 1A9BB 3B83A 1I1FB 1AXSA 1F6FB 2FR4A 3NFNB 3RB7A 5E2WL 4MNGE 3AQYA 1IVTA 2XN2A 4ZUTB 3ZR5A 5C0BE 5KBDA 3MA7A 3ARFA 4HPOH 4QHMB 2ROYA 4KRLB 4PLKC 4MTMA 3VXPB 5KVEL 1IKFH 3NUKA 3Q2CA 2A9CA 1T66C 4JHAL 3CFCH 1CK0L 4WEBH 4B3EA 3RU8L 3T1FB 3QIUA 5EULV 1E3ZA 4LLMB 3ELAT 1CPUA 2ICEC 3O6KL 4LSPH 3GI8H 3VXQB 1MFUA 3H2WA 4BA8A 3QPQC 4GKOA 4DFHA 1T89C 3MGTB 1HC1A 4KAQL 1WISA 2VZ3A 1NOFA 3X1EA 1QYGL 2XWXA 5D7JA 1SZNA 2O61B 3QZMA 1L9QA 3IF1B 5CJQL 4MMZB 2FQFA 4H8WH 1OZTG 4YGVB 4HCRA 2H41A 5K33A 2GIMA 4OCWL 1YC7A 4YLBA 3FC8A 2L7UA 3VYPA 2OMYB 2XZQH 2PPCA 4B7IA 1M1SA 4MQ7A 1JUFB 1T0NA 3T71A 3U0WH 2E7MA 1L7IH 5L0QB 2A6KB 1UA7A 4XCYA 1F58H 4HQQH 1ORSB 4NFCA 3NJVA 2CJSA 2W0PA 1ILUA 1HI6A 1MFBL 1I9IH 3D39D 4EI6B 5G5DB 4O51A 3HS0C 5IGXH 4PCSA 3UABA 5I6OA 4QRFA 5DFWH 4KVPA 3O2VH 1ODUA 4GB9A 3L1GA 1DVSA 2UZYA 4W4NA 5A16A 3I6LD 4WFHE 4WIQA 3OAZH 3SE9L 5E6SB 3JV5A 1QLEL 1GRWA 4JFOA 3HUJF 3S3CB 4HEMA 2F53D 1T3FB 3PWLB 4M02A 2A4EA 1NLDH 2QKSA 2EVGA 2WQ8A 3IRZA 4QMEA 4PJDF 4TVPD 3ZT7A 1GW6A 3NCBB 1SN2A 3KW8A 1VADA 4KDWA 1SEQH 2IH3B 3IMSA 4KH9A 3VFMA 1DUZB 4HGWB 1NFDF 1I82A 5J13C 5IT2L 1BZEA 5KTEH 3LXBA 2DQMA 4FD0A 4JRLA 1OHZA 1T2XA 3PAUA 4WV1B 2VLJE 1OAYL 3L3KA 8FABA 5D72L 4JQXA 3OBAA 5DFAA 1JZDC 1KBGH 4PS4H 3OKLA 2QVIA 2VDKH 2WB7A 4I3SL 3HI6H 1YQ2A 3SDDC 1S3KL 2ZCLL 1CFNB 1U9KA 3MRPA 1CLYL 3TEYA 2X4PB 2XTJB 2X1OA 1ERNA 1FZOA 1UB5A 1WBXA 4B6ZA 1IZJA 1XHHA 1XSOA 1NSNL 3QZLA 4K9EC 4U1JA 3PWUB 2C26A 2VQ1B 4GAYB 4LNRB 1E43A 1LO2H 1JZFA 3MXWH 2EO1A 4M4RA 2NUPB 3SE4A 2J6EA 3GZKA 4LAQH 4NZTH 4GSRA 3RB5A 4BYHA 2B4CH 3X11B 1MI5B 4BXSV 1T7VA 5DD6B 2VR5A 5T1KB 2BXZA 4I89A 5MP6H 3IDMB 1ASQA 3MNWA 4AKOA 4Z3IA 4EF3A 4KQ4L 2AXFA 1FQ9C 2WXQA 3D69A 5H94A 1IIIA 3T4AB 5IQ7L 3D2TA 2V17L 3ZZSA 4DHLA 1I9RH 4CJ0A 4M7KL 2YAHA 4LEXL 4W81A 1JPSL 2X89D 5IP4A 1F13A 4BINA 2EO9A 1W8OA 4QTIH 2VXQH 1C5CL 3NSJA 4HJ0C 4M5SA 4LCYB 2LOEA 3HG5A 3OJ2C 3GUTB 1TQSA 4HKZA 2CA4A 2F5AH 1L9MA 3JXAA 2NX5D 4DQAA 4FFWC 1TU2B 2BY2A 2Q86A 4W9LC 4OLVL 5EO0A 1BQHB 3OKYA 3N43F 3INUL 3GHBH 3A6BL 1TSRA 3LIZH 4W4OC 4OGXH 3IRCA 4XGZB 5F7DB 5F9WB 3RY6A 2YD9A 3S5YA 1KCWA 2ZZUT 4HA1A 2X3CA 5LHDA 5ILTH 4NN5C 4UIMA 4XE0A 4BHUI 1BVKB 2J8HA 3JYCA 4YMPA 4EO5A 3MV9D 3OPUA 4MAYD 1VAHA 5E7FA 3VFPB 1UZ6E 3LPGA 3TO4C 3WI9A 1KCKA 3NESA 3EBAA 4Y1AD 3FT3B 4WW2A 3V4UH 1IQWL 4F7KA 1JPTH 1FFOB 5B22A 4HK3N 5B1BB 4NYLA 2P5EB 2OR8A 2C3GA 4E9LA 5EWIL 3SQRA 1YMMD 2PTTB 4FQPA 2MTAA 5CEZH 2ADYA 3ZE0B 4Z7QB 1Z1WA 3JV0A 4PD4J 4JO5A 4P46A 5BO1H 4IRZH 3WLBB 1KFAH 4N6RA 1HHGB 1SLVA 2JB6A 2JLLA 3C8KB 4WO4A 5C0ND 3FOLA 5I8OL 5C7XH 3IFOB 4BQ8A 1HCFX 3NSDA 5BCAA 5T5NG 2VE6A 5ANMB 3HMXL 4OM0H 1MJ7L 1DQML 1C5BH 2BIPA 2YSSA 4WUUB 5IMLA 4Q0XH 3FO1B 2XICA 3KHOA 4MMZC 4NQCD 1U8OB 4HLZG 2Z1KA 5JDSA 1IM3A 1JWUA 5H4ZA 3IVKA 4FNPA 4D0CB 3ARED 4E0RA 4Y19D 4ZXBD 4WU7A 3BKJL 1OANA 4FQ2L 1L9PA 1XIWB 2BVPB 1FNEB 2DLTA 4FNTA 4ZJ9A 4DUXA 1KGJA 1KEGL 5JORA 1JNLH 3GBDA 1M7XA 2BNRB 4PJ7A 5L0QC 3H0TB 4MASA 2FWSA 2Z35B 5I6KA 4EVNA 4RWYH 1QO3A 3HOGA 4BUQA 4P48A 5CZVL 3UADA 3V6FB 2FNBA 3B5TA 3V4PL 1DVUA 3O45B 2Z93A 4ERSL 3FMGH 4ICXA 1E8YA 1B4JL 3V9EA 3ENEA 3EXLA 4CC4C 5DYFA 3BGMA 4HZLA 2YLHA 4FP8H 4ISVB 2JI3A 1JYWA 1ES0B 1R5WA 4RDQF 4BGLA 2YZ8A 3TC9A 1R3HA 3EJPA 4UQ3B 1KXVC 1QPPA 4K7FA 3BISA 3UAAA 1E65A 2BVQA 4R26L 1TMCB 3C09B 4HKXB 4OCSH 3WJMA 3ZE0E 5JOPE 2XY1A 4PJIA 2KT6A 1KJ2L 4FQQB 3ILPB 3U0PB 5J9PA 5CKGA 4F33B 2IH8A 2YWZA 3BKYH 3TZVB 2MOQA 2R23A 3SGDI 5ANME 5IG7A 1TG8A 1GGTA 1FO0L 5EU3A 3MROB 2EDXA 3RL2A 2NRDA 1PIGA 2GJ6D 1MAJA 2Z7ZA 4FQ1L 4HIHB 3TXAA 1VSCA 2F7OA 4ZW8A 3WIIL 4Z77A 1G6RL 1V7ML 1WFMA 1YLBB 3CDGA 3ARXA 4W9ZA 4JPIA 3B2XA 3O4LB 3NZ8B 3FB5B 1D5IL 4L8SA 5JHLH 3HRZC 2WNWA 4ZMXA 2PO6A 3FT4A 3LH2H 4PRHA 1OTUD 2HP4A 3KW7A 3X13B 1LMKA 5KBLA 1GC1L 4GAJL 1SLXA 4M4PA 1HFUA 3AT0A 4XMKL 3DROA 3JV6B 4UWQB 5TQ2H 4HUMB 4UNIA 1PFCA 2K4AA 3EJJX 2R1WA 2X2HA 1QSZA 4UM9D 1K3ZA 2F8OA 3HI1A 2VZ1A 2VW7A 3R7RA 1P5VA 2WNKA 4KDTA 3T4AC 1SJXA 1TXKA 4ACTA 1HSBA 3EGSB 5I0VA 4L3EB 1AAJA 3GNMH 5FYLL 1SXSA 4KJQC 3ZSTA 4PJAB 4BHUA 2HT4C 3ZIMA 4F7EA 2ESVE 2YWYA 4UDTA 2ITFA 2E46A 1EK3A 2H3NA 3K91A 2XV0A 3VD5A 4LDLB 1WT5C 3KPMB 3HNVL 4J3OC 4JFZL 2PYEB 4AW7A 4PVMA 3LRSA 3EDFA 4H20L 3VXUD 4OFIA 4LLVA 5KSUA 3HZMB 1RIHH 5SV3A 3AWEA 2GUOB 4XPBH 1OE3A 5F9WC 1W72L 3KPNB 3ZDYE 1HINH 3FQNA 2DWTA 1ZJAA 1CFVH 1T7YA 2VH5L 3QDAA 1EQWA 3FBKA 2ICCA 3SO5A 1ZVHA 4NWUH 1F90L 4PV8B 1OPGH 1DANT 1TVHA 3FNKA 3GBLA 3HR5B 2FJFA 5IB2B 1NC2A 1S7UA 4JGJA 2MIZA 5JPMA 2VTFA 5IB3B 4MA7H 2VLME 3LEVH 4AK2A 4FEIA 3EGXA 3FQ2A 3FQRB 3QXUA 4HP5A 4QY8A 1KC5H 1RQ5A 4LE8A 3V0HA 5KSVB 3RWEA 3INOA 3KM1A 4WW1A 4AIZB 4HUVA 3UCRA 1RMFL 1INEL 1F11B 2D4FA 2JH2A 3V7AE 3QG7H 2ZSVB 5JXED 5DF0A 3FSVA 1EEZB 2NR6D 1RLBA 1XD1A 3BT2L 3L3HB 3EZ8A 1SBSL 1N7ML 4PYHA 1EJOH 5EO9A 3AGVA 1S5HA 2E27H 4NNYA 5C0GA 3U4BL 3O3EA 3GBNH 4F7PB 4WWPA 2C34A 1C7TA 1HHHA 2RH0A 1NCDH 3BHBA 4LLYB 3WIAA 5I1KL 1FGVH 4HOXA 5IJKA 4RAVB 4R7VA 4HZ1A 4L3EE 4LRIA 3UTSD 1BXVA 3QCTH 1PD1A 4P5MB 1SMDA 3FXIC 2HJKB 2OMXA 3TYGL 3VDBA 3SDAB 1BZ7A 1Y7VA 3H9YA 4PJAE 4QAMB 5B3JF 2OR7A 1C5DA 3QDMA 5L8JB 5HY9B 4FMFA 3BH8B 4HBCH 4U6XA 4XN4A 3D05A 4Z7UF 1NCIA 1U8JA 2R0KL 5AG9A 1IT9L 4ONOA 2QKIB 2CBPA 4JHBA 2DI8A 1WGVA 2PYEE 4OUUA 3D52A 4IOSA 2IADB 4CGTA 1KXTA 1I8IA 3P0VL 2XYBA 5IHLB 3WTYA 1PY9A 4WNJA 4NFDA 2ENYA 1I8AA 5IWLC 2VSCA 2XACC 4PJGA 3B34A 4U6HA 4KVCH 4M8RA 1KJ3H 1USZA 3RIAF 2YA0A 1OSZB 4MXVE 4UOZA 5L7XH 3AG2B 2C4FT 3KDMB 4D3CH 3CUPB 3PQYB 4MD4A 3TOPA 4ETQA 5DI8B 3FO2A 5B3NA 4F37K 1AQDB 1XBDA 4RFOL 3KLQA 3QZOA 3EW3B 4U6VH 3C09C 1ZLUK 3T0EA 5FOBB 3AMKA 1A6ZA 3U7YH 4TUKL 3LN5A 2IAMD 4ZAKB 2W0KA 4BH7B 1V54B 1K85A 2FHCA 4HD5A 4O5LL 2P5WB 3TZVC 5A2IH 1U8KA 3OG6B 3D2UB 5J4MA 3VFTA 1OP5K 1JHTA 1J05B 3L3JB 5BQ7B 2H2SC 4N87A 4J5VA 5IQOA 2PNDA 3LZOA 3S34L 4Y89A 1IAII 3F6JA 5C1MB 4B41A 2DF3A 3CLWA 1HXMB 1HILA 3CZEA 2JJVA 1TTCA 3OB8A 4RGOL 2HFTA 3AT9A 1T1WA 4FTVD 3NRQA 1J18A 4BFNA 3FFCB 5EOQH 3PF2A 2C3XA 1J1OL 3WELA 3O6MH 1AI1H 5DZOA 1NCCL 4MGXA 3F7PC 5ECJE 1J5DA 4R96A 4LASH 1IBBA 2UY6A 3MRIB 4HH9A 2GIYA 4POZC 4YSEA 1FZMB 2HFFA 4W4OA 4BK5C 2BSBA 2UXTA 1OLZA 4AH2A 1KCVL 3NACH 4QJ3B 2ZX8A 5FM4A 2X4QB 5AAWA 4Q9RH 2EKSB 4D8OA 3G5WA 2P48B 1CLZL 3H54A 2NSXA 2FGWL 1S7RB 1QACA 2ED6A 1MREH 1C1EH 1KIQA 1CG9B 3TO4A 2APVA 3GSNB 1U93B 4KROD 3GRWA 4UT9L 3ATBA 4AMKL 3D30A 3AZUA 3L4YA 1L7TL 1ET5A 4MDIB 1PSKL 1FGNL 1E2ZA 2BVYA 3DX6A 3X12B 3PQYE 3HVDA 2UX6A 4GKZB 1CYGA 3MV01 4ZOBA 2H4EA 4TVPE 3SBPA 3ZUNC 1FA4A 1OAQH 1QFPA 4JMXA 3DSFH 2IQAA 4E5XA 1FV1A 3QNZA 1KCUL 1T04B 3ARD