4YE0A

Stress-induced protein 1 truncation mutant (43 - 140) from caenorhabditis elegans
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
b'GSLNEVENTAQKFCVKLDVAAFKPEELKVNLEGHVLTIEGHHEVKTEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAPKTGSNTTVRALPIHT'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced protein 1
molecule tags Chaperone
source organism Caenorhabditis elegans
publication title The Chaperone Activity of the Developmental Small Heat Shock Protein Sip1 Is Regulated by pH-Dependent Conformational Changes.
pubmed doi rcsb
total genus 16
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ye0A00
3VQMA 1WFIA 4YL9A 4MJHA 1X5MA 5DS2A 1WGVA 2MNWA 3QORB 3QORD 3QORC 4YE0A 4I88A 4M5TA 3AACA 4YDZA 2KMWA 4RZKA 1SHSA 2CR0A 2N0KA 2Y1ZA 4ELDA 5DS1A 1RL1A 5LUMA 3QORA 1WH0A 2XCMC 2O30A 3Q9PA 3GLAA 4JUTA 3EUDA 2WJ7A 4ZJ9A 4PBDA 3AABA 3L1GA 1GMEA 2N3JA 3L1FA 4FEIA 3L1EA 4YLCA 2KLRA 2WJ5A 4JUSA 3J07A 3N3EA 2JKIS 3Q9QA 2RH0A 3W1ZA 3GUFA 4M5SA 3GT6A 4YLBA 2K8QA 2BOLA 3IGFA 2CG9X 4PCKA 2Y22A 3VQLA 1EJFA 2Y1YA
chains in the Genus database with same CATH superfamily
2ZF9A 5AVXB 1S4IA 2O5NA 5EZLA 4NSKB 1CD9B 4Y7OC 5GS0L 2IV8A 1NBZB 4B3VA 3CK0H 2VMEA 2DQGH 2X4SB 1MCCA 5L8KB 5EU4B 4F8OA 1LEGB 1UJ3C 5CINL 3CZJA 1NL0L 4FFYH 1QBAA 4X4XB 5DVOA 2Z8SA 1G6RB 3UDWC 4XC1L 5EG6C 3QA3A 7FABL 2WYZA 3PNRB 2H3KA 4M3HA 1CFTA 5I75B 3BUTA 1NGZA 2P80D 5F8RC 1VPOL 1NIFA 4ZS7L 2NX5A 3HOGA 4YBLB 3MGTB 4RAVA 4QGYA 5L7XL 3QUZC 5EZIL 4P2RD 2R1WA 3ECUA 3EH3B 1ORQB 4Z7OE 3L3JB 1TVBB 4NQEB 4G7RB 3BHBB 5KOVC 3INOA 2VRAA 4PWGA 4HPHA 4MNGE 3X14A 3ETBJ 4X8JA 4HFWB 4JHWH 4RGNB 4GW5A 2JWYA 1SM3L 3LRSB 4AMWA 1J1OL 2BFVL 4X0KB 3SJVE 7PAZA 2PCPA 5I30L 3O6FC 4HIXH 4NUJB 3AG3B 5HYQB 4N24A 1NGPH 3RQ3A 2PR9A 5DEGA 3B4NA 5C3IA 1RZJC 1V10A 2NZ1A 1KB5B 5L2KB 4GQ9L 5F7YC 1UD3A 4XH2A 1IM9D 3I9GH 3WHE1 1A4KB 4K7FA 4PVMA 2DWEA 5EZJB 2R7EB 2W80C 3ILQD 2VITA 3WU1A 1Z6JT 4LLVA 5H94A 1BPVA 2UVFA 5F71A 2PW2B 2WXQA 4N87A 4P9HC 5HVFB 5DRWA 5HD8D 2ATAA 5G4OA 3EADA 3A5VA 1JSYA 3C08L 4OM0L 1QAWA 3JWNE 4N2LA 2VLJB 1T4KB 3GZOA 3LH2L 4AQEB 4XGZB 5DHYA 1A2YA 1EEYA 1KIRA 2V2WA 3IJ8A 4LPWA 4NQDA 5FYLH 2W0LA 4PHXA 1W72B 2XXCB 2HJLB 1YEGH 3EYQC 2OP4L 4JR9H 1EPFA 1DBKH 4IU3A 3BIBX 3CFKB 4Y1AA 4Y19A 3VXUD 3BAIA 5F1NA 2HLAB 3LN4B 1DBBL 2EE6A 3QXDB 5I1CH 1C12B 2VDNB 5J1SC 4HBCH 5T1KB 3FO2A 1FG2A 2UWEA 4IBUA 1DYZA 1JE6A 4F2MB 5GHWL 5IMKB 3AFLA 3TEUA 2WIIA 4JFXA 2HH0L 3ZQXA 2A1WH 4WHTA 1CL7H 5DJDB 4Z7QB 3WIHH 1D9KB 5FOJA 1QFWL 3V4PL 1FNEB 1CG9A 5IJBC 3TCXA 3MU3A 1P2CB 3O0RL 3ZX1A 1YAIA 1LE5A 2IWFA 1J1PL 2FEDD 2WLLA 1UD5A 5CZRA 3CX2A 1PG7W 2GC7C 2D7OA 5F2FA 4B50A 1AS8A 2VMDA 5E0FA 1ZLUK 25C8L 3JWNG 3QUZB 3VXMD 1MHCB 2A99A 3MOBH 4A7GF 1ZA6A 1MH5B 4O02L 3BXNA 4OFVA 3TBTA 2CRZA 1PZCA 3IMWA 4LEOA 1ZT4A 5DZVA 5GGTA 4XCCL 3ZE0F 3V5KB 4WFED 5DDHA 1JAEA 4UZSA 2E59A 3K72A 2MPAL 2D0GA 4J4PD 3UG3A 1F97A 2AJVH 4XMKL 2PW1A 4FI6A 4NCDA 4GG6F 1RP8A 4M5ZH 2OK0H 5EV7A 1RZGB 4YHPA 2XG5A 3FQWB 3GMPB 4QLRA 4A2HA 4ZG1A 3B7YA 1UOWA 3ARBB 3BP6B 1ZA3B 5ERWB 3NJKA 1WHPA 4PS4L 4ATWA 2NNFA 2BPBA 2EVFA 3QJTB 4ONHA 3NIGB 4P8QA 2H32B 1XF4B 3NSFA 2IANA 3ZDYE 2YXFA 1FLRH 1EFXB 2WQ8A 4X9IA 2DL9A 1KB9J 2OZ4L 4HAFA 2VRKA 4Y2DC 4KNSA 4TSAL 5BVPH 3OJVC 1KNOB 2EC8A 4FNLH 1A3RL 2QT6A 2W38A 4OZIE 4QTHB 4MMXA 5FR3A 1Q94B 1QLRB 3F12A 3WV0A 3L81A 1JGEB 3CZNA 4WZ9A 3Q05A 2RACA 5J12C 1BVZA 2Y23A 4BKSC 2CK2A 1BEYL 4XOCA 5E2WL 4WY7H 3V9EA 4H2AA 1URLA 3ZO0A 1XIWD 1I9RH 4RRPM 5HVGB 4UT9H 3QEQA 4PJXE 2UY6A 4P2RB 1LDPH 4JJ5B 2YAFA 1TYRA 1I85A 5B1CA 5KJ4A 4CKQA 3FUKA 4OZGB 4WFGE 2E6JA 4JGJA 1F1DA 2O6FA 4XP9H 5E4OA 1CU4H 2D4FA 3BQUA 4C83B 4NHUB 2VN4A 2ZXBA 1G7HB 1Z9SA 5FCUH 4WI7A 3O4LA 3O8XB 2PXYD 4NUPA 3TH4T 4E5XG 2JTDA 2JCWA 2JJSC 4G8AC 3RIFK 5ID1A 4I48B 4EI5C 4OQ1A 1U3HB 3LSOA 4J3OH 3F2LA 1U6AH 1HZLA 2Y24A 4U33A 3NP3A 1TZ8A 3DXAD 2GW5A 2MOVA 5C09D 5F7MC 3N1GC 3UABA 1JHKL 2L4OA 4DGYH 1MW1A 4NQEA 4LDOB 5AVYB 2KQMA 4QRPA 3I2CL 4GI8A 4L1LA 3WO4B 3ULVE 4M7ZC 1GGYA 4PRNA 2G0LA 1M71B 1ROCA 1WD9A 3ZIMA 3OKDA 1GY1A 5D4JA 1N6VA 4S1RL 3WG7B 4MMYA 1RMFL 1DQIA 3BP5B 5LBSH 3B6SA 3BKCL 2B1OA 3GXUB 5AVRB 4I3RL 4E41D 5AFAA 3EJSA 3K4ZA 4KXZI 5EBLA 4EUPA 3L16A 3BUDA 5FK9B 3RWIA 1TXKA 4DESA 1CB4A 1NLDH 3EBAA 4FQJL 4AQAA 4YSCA 1LWJA 4CADA 1E5CA 2Y2WA 4JZNA 3FS9A 5SWSD 4Q0XH 3DRQB 4IMKA 4WLCA 5CJ5A 2E7HA 2W60A 2YO3A 3S3BB 3BT0A 2WYTA 2CGZA 1WCBB 4ZD3L 1A0QL 4FN0A 2A4EA 2X38A 2HVJB 3QYCA 5EU6A 1SMDA 3MODL 4KJQD 5KVFH 5HPMB 2GBTA 3KLHD 5C0DA 3WS3A 3J7HA 1IBGL 3BRDA 2NY2C 1E65A 3VB9A 5F3BB 4ZAKC 2E8YA 3S5ZA 2B77A 2DYRB 2L3BA 4JN1H 1HEZB 3TU6A 1WG3A 1IGYB 3VXUA 3G5XA 2VDQL 3MLXL 5D71L 3STZA 4Y16C 2ESVB 1IAII 3ZYIA 5J11B 4J3OD 5FDWA 1OCWH 2GHWB 3EW3B 3GHBL 2BP3A 4ELME 1SFDA 5K1JA 2EDLA 4PJXB 2XG4A 3QULA 4YO0A 2AXGB 1VCAA 3WFDL 5FHBL 5HI5D 4XC1H 4I0PD 2GITA 3SKNB 3ECBB 4CU7A 1N59A 4HJGA 5LCVL 4EUPG 4N0CC 1D7CA 1NM9A 2F74B 2G9HA 3E9TA 1T7ZA 5ALBH 1NKGA 1F3JB 3MJ9A 3SDCB 5H4YA 4PHZA 4I0KA 1CUOA 1ODUA 1H19A 1QPXA 4G8IA 4X99B 3T0EA 3TH3T 4JQVA 1NCJA 2YKKA 3BCDA 4DN4L 4G9FB 4NOBA 2J8OA 3LKQA 4FFVC 1XGTA 1I9IL 4QUOA 1RURL 4KRLB 3NTCH 2VXSH 3MXVH 4BYHA 3OKLA 3JV5A 3RL1B 4H8UA 1U3HC 3L5WA 3MOQA 2BIMA 2FT6A 4YUEH 4H8WL 3ROOB 3E6HA 3IB4A 1QSFE 1DEDA 1KGXA 3P69A 1QUPA 1BIIA 2IO5A 3FQ2A 2WVSA 5F1IA 5DK0B 4DKFL 3OLGA 5I76A 1AC0A 5KVGE 5E1QA 1L9PA 3TT3H 4EZLA 4JHZA 4ENED 1QHQA 1NOLA 3MLTA 3TZVD 1GSMA 3SE9H 1T4WA 4MAYC 2VH5H 3LV3B 1KCUH 4P59L 4XO8A 1RUAH 1LNUB 3QQDA 1EBPA 4WV1B 4YXHL 3T4AC 3VQLA 3KPLA 3NCYS 1CVSC 1GOHA 5FYLL 1S7VA 4HUMB 4PGDA 2IMNA 2UVEA 1IE5A 2A9AA 5L2KA 2J73A 3F65A 4Q9RH 3GBEA 4OM1L 1MAMH 4OJAA 4ZXBA 2Y1VA 4S1SH 4F5CE 4KKBC 1DQMH 3NZ8B 2FD6H 3DJRA 4IRJA 4ODBD 3LNGA 2R8SL 1U93B 1JG9A 5HD8C 1GXEA 4LGPB 3ZN6A 3F12B 3NFNA 2MWCA 3D50A 1NWPA 1BQLL 2WLNA 4X8GA 1KB3A 1OAUL 1MJJB 2BC4B 2CHXA 3MRNA 5F7UA 1YJDC 3CFCL 1NEZG 1MVUB 1I4FB 5E24E 4JDZA 2VW6A 4TPRL 2NY5L 3QPKA 2JIXA 3WGUB 2IALA 1LE9A 1TKWA 3ZUCA 1KLFA 3HI5H 1U42A 5I15L 1I9EA 2FHBA 4M4PA 2CK0L 4LNRB 2HTKD 2R4SH 1UZ6F 3ERXA 3KYAA 2YFNA 1EEZA 2P80A 2ATPB 2PPDA 5L4IA 1RV6X 2VZVA 5LBSA 1HXMA 2FBJL 1ZHLA 3AQZA 4PJAB 4PFEA 3CDGA 1HVXA 4LZKA 4WEBL 1QI4A 3PQYB 1F8TL 3ARYA 2TSBA 2WXGA 1NOFA 1IGML 12E8H 3PU7A 4BFRA 4XPTH 3RKDC 3II1A 2BNRE 3WNOA 4ETQA 1B0IA 1GR7A 1SJHB 3N41F 3VWKC 2BOCB 4NIKB 2XXMB 2H26A 4F7EB 4TLKA 3AAZA 3UPAA 4RMTA 4JPKH 2Q3XA 4MA1B 3NSXA 5D4QA 2HPOA 1AO7E 1ZE3C 3NCYP 1GYUA 1KPRB 2OMYB 5B21A 1JZ7A 3WLWC 2ZKHL 2O6EA 2AFNA 3KS0H 2JH2A 5HVHB 4X2UA 3IJYB 5JDJA 1CICD 2AABH 2GSIB 1MHCA 5ESQB 3BN3B 1J10A 2C3HA 5MEOA 2JK5A 5LG6A 4H8HA 4Q14A 2A6JA 2VDMH 4RMBA 1OF0A 4U3XA 32C2B 2ZXGA 2VL4A 4HUCA 3DTDA 1BVLA 1EVUA 2ZX7A 1WK0A 1C8PA 5D70H 4GP5B 3GTVA 1J7VR 4X6BA 1Q9LA 2K6WA 1XD0A 2Q86B 2VB5A 4PLOB 3EJRA 3VWJC 3JWOH 3PRZA 3SE8L 1SHSA 4HV8A 3VA2C 5KBLA 3SY0A 2R0WH 4QHUB 2BCMA 2QR0B 1XGTB 3DGDA 3N91A 4AM0Q 4J3OG 1V3MA 2EDXA 3C6SA 2EIBA 3AY2A 2J6EA 3LZLA 4JUSA 4UINL 2VDKL 2IFGA 3FHAA 1INQA 5TH2A 5CU5A 4IBVA 1CXKA 3MRLA 1NGYB 3ROOA 1R3JB 2IGFL 1EAQA 1ZMYA 2Q20A 3GKWH 4NT6B 4FQXB 3SJVB 2IMMA 3WFCL 1XIWC 2YPLA 1A8ZA 4ZO8A 1XF2B 3WFZA 2BLFA 3FQUA 1FZJA 4OI7A 1KJVA 3X11B 4BEIA 1G84A 3PHQB 2VSKB 5KJRL 4UYPA 1JHKH 1RERA 4YZWA 2VJXA 3Q8AA 3QW9A 2ZWKA 4BK5C 1IM3A 4XNQB 1DVFB 5B4MD 5FHAL 3J27A 4Z3EA 5KS9F 3WTXA 3DJTA 5DD0H 3ESPA 3VXNB 3QXAB 4K71C 3S36L 1SXCA 3TWCH 3ZQWA 1G7IB 2MJWA 4NJAH 3FFDB 3W9DB 1UZ8B 4PRPB 3BKYL 2DI9A 1MHPL 3OHXC 5JIDA 1DEEB 3C12A 3IDYC 3KGUA 3KPQA 2FB4H 4X6CA 2QHLA 4GG6B 4G6AD 5F6HJ 4KUZL 4MMXB 4L0ZA 1AZZC 3WL9B 3CFDA 3HHMA 3KDMB 4Y4KC 1LK3H 3FF7A 3WKYA 1F42A 4G8FA 1PMYA 2YWZA 3QC5X 2WPGA 1M42A 4NLAA 3EYUH 1OE2A 4YGVB 4OV6F 3I74A 3SGDI 1QR1A 1AR2A 1F4YL 1GYWA 1SYSB 2R0KH 3OX8A 5DFWH 5L88H 4ZUWA 1T3FB 2C1OB 3WJJC 3BN9D 4TOYH 5IJVA 1SOKA 1E8ZA 4XWGL 3M8OL 4XXWC 3RWJB 3S37H 2V3DA 5I6XB 5F0LB 3MX0B 2JI3A 3ARTA 1I9JL 5F89A 5D1QD 2PO6B 2FBRA 2XJKA 2YARA 1LO0H 3GRBA 3PJNA 3H3BC 4ZW8A 3J2PA 1G5AA 1HSBB 3WHXA 5A6IA 1BAFL 3L3GA 2J1ZA 3BMVA 5B3NA 4ZO9A 3H54A 2OTWA 1A4JA 2NXYD 5FGCE 1FC2D 3QRLA 4NO5A 5TQ2H 3FQTB 3K8LA 5DD5L 4Y4KD 3TF7C 4IBWA 4XPHL 2YUVA 2KZ1B 1D6VH 2B9BA 1SZNA 3IMBA 1IO4C 4P4RA 2XN9D 4D9RD 2DYPD 2H26B 2ZSVA 4F7EA 3ZHFA 3MUJA 1V3LA 1Q9WA 1IGFL 1YJDH 5IQNA 4AJVA 5FF6A 1FYTD 4AOFA 2V4LA 4FS0A 1TQCB 1UWYA 2PYEE 4PW4A 5GIRB 1YAZA 2XLLA 3PGCB 3EOAA 2IH3A 2O1AA 1M7IB 4OZFB 4UU9A 2XWTA 3QRGL 3NIDF 3RPBA 2PWEA 1YMMA 1AOZA 4M1CD 2J2ZA 3WNNA 2ARJQ 2YGVA 3MXVL 4PSRA 1JV5B 2X89D 3LIZH 5JUEL 4OCLC 3ZTNH 2IFFH 4KV5F 3IE9A 2EDDA 1CZ8H 2VZ3A 5DHDA 1EANA 3IGKA 4XO9A 3AW5A 4X5RA 1YEEL 2KZWA 1YPZE 5AVSB 4IHBA 3NJVA 4P3CL 1JHLL 1FO0A 1EMTH 1F6AA 1L9OA 6FABL 2GY7B 5CHNA 3WEOA 4PTUA 5JHLL 4G42A 3VFPB 2E86A 3QJSB 2VL5A 3HN3A 4X6BB 4GG6E 5E99H 4Z8FL 5DSCA 3I75B 1KEGL 3O81A 2WUCL 5AENA 1NCNA 3OZLA 1KCUL 1P7QB 2HTLC 4AVKA 4ZMAT 1GGTA 1JXGA 1IJ9A 1MFBL 1QASA 4NZUH 3UZVA 1N5YH 3E80A 5IK3A 1KFGA 2OQJB 5D7IA 3V4VB 3ZO9A 5FYJL 4TULH 1XH1A 1M6OB 3QO1A 3AROA 5T5FH 3UTTA 4GKZA 1IQWL 1JPSH 3HBZA 3E8UH 1O7DE 3FB6B 3ARGB 1ACZA 3GLEA 4MZIA 1H3PH 2FX8L 4PD4J 2LE9A 1L9MA 1R19A 5T1MB 1U3NA 1EXUB 1Z0MA 2ICEB 3K7UA 2D7QA 5IQ7H 3R06A 2F74A 1GOGA 1DSFH 1K5NB 2NYYD 4JREB 5CIPB 4ZODA 5HGHA 1M3IA 1KYDA 1PPIA 5I1IL 5J5EA 4K5LA 5ITBH 1EEUA 1E28A 1MCIA 2QADD 4MNQD 3CFUA 4WAFA 4M7LH 1NPUA 1IGTB 1J5CA 5J7CC 2NXYC 3RZWA 3UC0L 2DI8A 4AMKH 1YN7B 4HJJL 2DTMH 4MB4A 4IOSA 3PV6A 5F1KC 1UZGA 3IJHB 4UWQB 3AY4A 4PUBL 3NEEA 5EEYA 1P84J 4PRPA 3D7PA 1BBJB 5EOTB 4Y16B 2GT9B 4L4TB 2Y6TE 2CBTA 4P46B 5F9AC 4BFIB 3QJQB 4NQVB 4QRBA 5BJTA 3QARA 4KMQA 4V1DA 1JPFA 2Y1YA 1YUHA 1JXJA 4I5BA 4LOEA 1X7QB 3AGWA 2BVEA 3FRUB 1NGQH 4IBQA 4WDIB 3RU8H 5DJ2A 4F1ZA 1E9QB 1BZ7B 4OJFH 3L3KB 5DZ9A 2XXFA 3ES6A 4HT1H 5D7JC 4L2YA 3VNYA 1GPOH 3QAQA 4RGMB 4LLAA 4NRXB 4TQ8A 2G2RA 1UD8A 4OU3A 4WUUE 4I4WB 5D1ZD 2Q8BH 5HI5C 1ES0B 2E7MA 3ARBC 3FFCE 3K2UH 4A39A 4XP6L 1EIBA 4HUWA 4JQIH 2J88L 4XB3A 1AKPA 2Y4SA 3N1FC 5C92A 1PZ5B 1SLUA 2EEBA 4Q9QL 1IEBB 4GKNB 1LO5B 1KCBA 3W9DA 3VXRB 5D7KD 2XPGB 3MLWH 4E0RA 2BW5A 3LRMA 5B22A 3CVHA 3GMLA 4H1LB 3MLRL 2ZKYA 4E42B 1KBKA 1UXSB 2CJSA 1N8ZA 4KJWC 3M88A 1Q1JH 4MXWL 1P5UC 2DBJA 1VFAA 3FUNA 1Y6NR 5C0CE 4OV5B 3UJTL 1DQKA 4Z23A 3WDHA 1O7VA 1JZIA 5G5DA 1WLHA 3GIZL 1JWSB 1MFNA 1IM9B 4OCRL 4OLVL 5A2AA 1WFJA 3BDYL 4FMFA 1S7UA 3AU1B 5E2UH 2EDNA 2NR6D 1FP5A 2E7DA 2WTRA 1ZLVK 4JHAL 3QQ4B 3ABGA 5FECB 4NUJA 2GSIA 2IG2L 3MCLH 2IADB 2CIKA 3PWUA 4UT6L 4APQC 1ZTXE 3NJGA 2VN3A 5DMIH 4F9LC 2FHFA 2DQUH 5FUCE 4F80A 2OZNA 3O3BB 1L6XA 4JFQB 5KSAB 1USZA 4ODUA 1U21A 4JFED 3TPKA 2FYYB 3UTSE 3V0JA 5JHDA 2CCLA 1MWAB 1IQDB 4G2AA 1CPUA 4K5MA 5TF0A 1JNHA 1FO0B 4ONGH 3IU4H 2CM6A 3VFSA 1LTXA 4HJ0D 1CDGA 3BZFA 3X2QB 2PW2A 4JO1L 1H3UA 5DZPA 3MZGB 3VH8A 4NQSB 3EO9L 1CE6A 2XV3A 3GGWB 4CVXA 3EJZC 1P7QA 4FTVB 1QR4A 3HNTL 3VAEA 5DZJA 3GMOA 2Y36H 1OCZB 3DOIA 3D51A 4PJ9C 4AQEA 3NH7L 1WFNA 4OZIF 1L7TH 1EZUA 3DHUA 4FFWC 1S9VA 3NA4A 5EC1B 3MMEB 5C0BD 4OZFA 4UU9B 3ZL4H 5J1TC 3JYCA 1XH3B 4FZ8H 2RQ8A 3QFDA 4HWUA 3HKZA 1S46A 1K8DB 3T0AA 4GKOA 3MAWA 2EUZA 1OOAA 5CCKH 3EF4A 2AV7A 4MX7B 4YHNB 4MCMA 5D7LB 2JJTC 3D18B 4NO0A 3FT3A 4YWGL 4CDHA 2HA1A 3CZLA 3TBCA 2XC8A 4RMVA 4GLRH 3MUGB 1R47A 5DJCB 3UACA 3HE6B 3RY5A 2WXNA 1FZOB 4YK4B 1LEIA 2BNQA 1BCIA 1D5MA 4OZGE 3L2LA 1E28B 1E4XH 2IVFC 4LEBA 4N0FA 3A21A 2ZNXA 1MHEB 2ZTBA 3KW8A 1I7RA 3HZYA 4J3OC 1SLWA 1MJUL 2GIXA 2BFVH 3WUWB 4A7GA 2VISB 4NZ8A 3SDYH 1KGYE 5KSVA 5E8OB 3B9EA 1CXFA 2EH7L 4JZJB 3AT9A 2EXWC 2HRPH 4W4NA 3PNWB 1BREA 2V8LA 3VGAB 4KROC 4JM2D 2HT4C 1ZAGA 5GGSB 1Z5LA 4RFNB 4EIZC 3DVNA 3B9KB 2FJGB 2H3NB 3ESMA 4WGVB 5AOMA 5CLWA 4Z7NB 3QQ3A 1OEZW 4LPXA 3VCLB 4YN3A 5JYLA 3OAYK 3D39E 4I1NB 1N19A 3B1TA 4KTGA 4BBWA 4UV4L 1QR1B 1XGYL 3VSVA 4OD3L 1UUSA 4MCZB 5T8IA 3T0XA 1YZZA 1BX2B 3GLZA 1XCXA 1TNMA 3T6XA 4BSJA 2WWMD 1GC1H 3HPJB 1JD7A 4LLWB 4NNYB 5E1AB 1U91B 2GTWA 1ZPLA 4CAGA 5BRZA 3TV3H 2YEQA 1HESA 3L4UA 4OGXH 4HJIA 4PMEA 3G5WA 5CZXC 3O41A 2V2XB 3L9YA 1UACL 3I9GL 1PLAA 3JZYA 3GUFA 1HYSC 3BQUB 4C83A 4KFZC 4AQ8A 2HFTA 1E4XI 1XL6A 2DQIH 3H9ZA 1UM5H 1Z0NA 1DBBH 3O3EA 2Y5QA 2V5MA 3LPFA 3W9EB 5T5FA 4Q2ZA 2I07B 5E8EA 1BJ8A 4PJCE 5E8PA 3GNMH 3BRFA 3IFLL 2MSPA 4W9IC 4YSDA 3GHEH 4Z7WB 1EGJL 1YA5A 4AVHA 4DZBA 2CUMA 4Y4HD 5JHLH 4FQXC 1F13A 1KXQE 5LWYL 2IOMA 1YN6A 2XN9E 5T1LB 4K94C 5FYKU 4KK6C 3HBGA 1UEMA 2HWZH 3GMQA 3DUSA 1NMAH 1JWSA 1V54B 3FHQA 4TV3A 1U58B 4RWYL 3P9MB 3TJEL 1D5RA 1CICC 4P9ML 4XHJC 2QKIB 1X44A 4TULL 2BIPA 5ETUA 4ZNEA 1U8IB 4IU3B 1B9KA 2Z91B 1USQA 3E8UL 4M8VA 3LRHA 3V95A 2Y9RT 3QPXL 3WHXB 3FU6A 4W68A 3VXRA 2PMZA 3MOBL 3HFML 2E9JA 3L6FA 4LESA 4HWBL 4M7JH 3OF6D 2DLFH 2OPCA 5CILH 3GEWB 4NQCD 4Q56A 3E9UA 2JXMB 4PJAE 5DJYA 3PGDB 1VSCA 2WHVA 2AK4A 3H7LA 1LVEA 1W0YT 4JM2C 1B6DA 2R83A 5DRWB 3APFA 3FTXA 3S96B 4DERA 4B53A 4J28A 4N8VB 1IV8A 4KHXL 5J89A 5LGJB 3GSXB 1GKEA 2BP8A 3WFEH 4U49A 3PDDA 2AI0L 3L9RB 4A2LA 3VXUB 2YGQA 3KEHA 3QUZA 3RB7A 4MD4B 4GIAA 2ZWNA 1F3DJ 4XBPB 1ACXA 1MFDH 1OAQL 25C8H 1JMZA 5B8CC 3MNZB 4O02H 3TM6A 1KUMA 2I24N 1PTZA 1QFPA 2ITCA 3VRJA 3DIVA 3UTPE 5DMYA 3T1WA 3C2SA 4XVOA 2HVKB 1KXQA 1HINL 4LKXA 5E8NA 3IMUA 3ZW3A 1PSKL 1ANUA 5ALCH 5DJXB 3O6FA 2YLKA 4EUPH 1H9DA 5CIPA 5HGHB 3Q5YA 4NBZB 3II2A 3U4KA 4PJCA 5D1QC 3VD3A 1MXDA 1R3IL 5F6IC 5B1AB 3DECA 2Z7YA 3LVTA 4D7BA 3MRQA 2C9UA 5HPMA 3NIDB 1RXLA 1ZXKA 2HG5A 2XIIA 4V2CB 1T89C 2OCCB 4FNSA 2OZ4H 4TSAH 5GGRA 1JK8B 4UOZA 3NIFF 1E6JL 4F3FA 2EKJA 1HHJA 1RD6A 3EJZD 5K39A 3WFHA 4NPYA 2XA3A 1S9VB 5CMAA 5BRZE 1RJLA 5IVXE 5KVEL 5AW2B 1SN0A 4NC1C 4P4KA 4AUYA 4KUCF 3S88H 1VFBB 5D72H 1FFQA 5CS7A 1SN5A 4LCWB 4UZGA 4UCFA 4HCGA 1FCCA 4A7QA 1HYRC 3QPQD 5GISH 2Z0BA 1V7NH 2OW7A 4RGOL 1EO8H 4U1LA 4NKOA 2JJWA 4O4YH 1QWUA 5A16A 2WO2B 2DQCL 2YUWA 5IB4A 4YXLH 4O2FB 1ZGLB 4OFQA 4V1DD 3IDJA 3X3GL 4P04A 2AEQL 4BSVB 4I0PB 4IBZA 4DPCX 5LBGA 3HLAA 3FB8B 3MRJB 4D0DA 1ZEAL 3BWZA 2H6PB 3EJJX 5E2UL 3V5HA 1QVOA 3BOVA 4S1RH 1L3WA 3DX7A 1AHWC 4KUCD 1S7RA 2XX0A 3C6LD 4Y9CA 3RY4A 2LFGA 2YMOA 2VDQB 5DUMH 3TH2T 1U8KA 4OUUA 2EDMA 5AD0B 3PAVA 4OD1L 1N8ZB 4B9CA 1TCRB 5EA0H 1I1YA 4D0CB 5IROD 2A38A 2QSCH 2X88A 2CKBL 4KK5D 1CVRA 3FTGB 3QIUB 5I6OA 1Q0YH 1UKSA 2B5IB 4HH8A 2XWJA 3WS6C 4AEIH 4F15B 5I76B 1KXVA 2IXQB 2ZCLL 4N9GB 3D12B 3WGVB 2CJUH 4JRXA 3F85A 3UP6A 4JN1L 3FN3A 3T2NH 1PD6A 4FE9A 5DFVD 4QJ4B 3MV8B 4PG9B 5CZVH 4H20H 2WLIA 1AR1D 3APNA 1PZ5A 5HGBB 2BCKB 4N3TA 1Z32X 3TURA 1T2QL 2W9DH 3OBAA 4FFWD 5EU5B 2DLHA 4HMDA 1ADQL 3B8YA 1G43A 1EX0A 3FTYA 2DS4A 4AJ0A 3BPLB 3IDYB 3HA0A 1KG0B 3H2PA 1UXSA 3MYJA 3KXFD 4OSUL 3UC2A 2JB5H 4AXWB 1IAIH 4GSQA 1EGJA 4X7EC 5FKPB 3DBSA 4HU8A 4OD2B 1PFOA 1KN4L 1KEML 7PCYA 5CJQH 5KSBE 3EFOB 4UAOC 1TG8A 2WAQA 3UTSA 2ED8A 4XWOD 1FORL 3VSUA 1S7XB 2PXYB 4JRLA 5GJSH 2G60L 3TZVA 2VDQH 1M7UA 3ARDC 2NY3B 4K8RC 1WC7A 4HKXA 1OSYA 2VMJA 2Y22A 1RK0B 1S9WB 2BRRH 2CM5A 2XG4B 3OTTA 4Q4IA 2B1HL 4KO7A 4X9BA 2OJZH 3AXLB 4GQRA 3O4OC 4LAQL 2CO2A 3GSVB 4FOMA 3WFDH 4LSTL 1PY9A 3GK8H 3GZPA 1ZHNA 5IHZB 4W81A 1WWBX 1RY7B 4BH7B 1ZPUA 2GITB 4Z77B 2QGDA 4P5MA 3VMOA 2R1YA 4QYOA 3L1GA 1ZHLB 3DI2B 3FK3A 3QJOA 3SYQA 2A9BA 1UH3A 2CRMA 2X2IA 2AAAA 1JMXA 2AV1B 4LCWD 2NSXA 3F05A 4PV9B 2KLTA 1E2VA 2HVJA 2X4QA 1NIAA 5IVZA 3TCLA 2KKQA 5EO0A 4R0LC 3MFGB 2OM5A 2VAAA 4B9IA 3JWNH 4GBXC 3UG5A 3IGUA 2D7TL 5DC0A 4RFEB 2TRYA 3VFGL 4A68A 4QIRA 2JJSA 3GMOB 4D9QD 5AWNH 4PCSA 4HOMA 4MYWB 4EI5A 2ZOLA 3Q13A 3EFFB 1QFHA 1EFXD 1ZVSA 3QSKB 4L1TA 4H5SB 3RZCC 3VGEA 4FFYA 5C0GB 1TZIB 3GPEA 5B3JE 3SKMA 4Q9RL 4UZUA 3SCMB 2ORBH 3AZUA 4GT0A 4LRIA 2F5BL 2DQIL 1MLCB 4MQXC 5IJCC 1BFVH 4HETA 3RY6C 5DQDH 4KDWA 5EIIA 1G9MC 5E6ZA 1NCGA 1R3JA 4OUOA 4TUKL 1AYRA 3FT4B 2CDEB 3LEVH 3V0GA 1G0XA 1ZVNA 4I7ZC 2CPCA 5KSAC 3T3PF 4G9DA 4HLZH 5IUCA 2XQYG 3II3A 1BOGB 4PI0A 5C0ND 4ZW3A 1UA6H 3I6SA 3BCFA 3TEYA 4V1DE 2J5LC 4UQDA 2YQBA 3INUH 5F3HA 3FB8A 1QLFB 3MRJA 4N2AA 3NK3A 4MXVF 3SYPA 4OF8A 1JVKA 4EDWH 3EYSH 2X40A 4LLDA 4PBXA 1ACYL 2OTUA 1ZOXA 1R5IA 4MDJB 5LDUA 1F0LA 3A24A 4D2NA 2WZ5A 4L4VD 1AANA 3EGXB 4G70B 1J18A 4WIQA 2X41A 4KHTL 4NQXB 3K5SA 3WTSA 4RIRA 4MDIB 4NGHH 3DUUA 2XACC 3ATEA 3GSQB 3GBML 4KVNH 5DQJA 1KV7A 2DWDB 4KI1A 5GGTL 4JUTA 4WEBH 1U8LB 1WZ1H 1UB5B 1CFNB 4DPRA 3MGTA 3Q8FA 1N6QH 4LF3B 4UM9A 4YE4H 2NUPA 1ZS8A 3BUYA 3CZGA 1A6ZB 4HIIB 2IPUK 2D3JA 5IJKA 2FGWH 1FNSL 2WLZA 1ID5I 4YH6A 2HRLA 5EU7C 2NY3C 3DC0A 2DEYX 3RUGE 4H4NA 4RDBA 3BRGC 2NNXA 3CC5A 3PJLA 1ECZA 1UKTA 2XKSA 3LKNA 5KBNC 1OT2A 1SFHA 2N0KA 1BVOA 4LVNB 2MCPL 3PY9A 3QYMA 4N2FA 4ALAL 1W80A 1O0VA 4PJ8C 1IKFH 4CJ0A 4WUKL 5EO9A 1VENA 2F53D 4M62L 1AKJA 3C9NB 1WFOA 3B7TA 2OSWA 3O4LD 4LL4A 2RFXB 1EWHA 3CVIH 1RI8A 3ZE1B 1I3VA 3CD4A 3L3DA 3VGAC 4ONFH 3QBTB 4NI3A 3FH5A 4FLHA 1HC1A 4D94A 4GG6A 3ZGHA 2VM9A 4DN3H 5I5IA 2W65B 5IBTH 4RFNC 3AB0B 1I1YB 2NX5B 4HOZA 2FO1A 2XNAA 3RGVD 3QIBC 5JDSA 1JFHA 3HN5A 4MXVE 3ZHLA 2B4CC 2JVUA 2LLNA 4U6TA 5ABDE 3FZUC 1UM6L 2IV9A 2Q3ZA 2YQ2A 5GS2D 2GEQA 5GZOC 4H8WC 3ZYOA 2NDFA 1FE8H 1O9WA 3DMMA 4X98A 4XMWA 5T3ZD 1O9VA 5GSVA 2R69L 1Q0XH 1R3LA 3ZJAA 1NCTA 2AJUH 4K9EC 3T6ZA 5INDB 4MD4A 3KBEA 4ZUTB 1P1VA 3RNKA 4OLUH 5BUPA 1E6JH 3CXFA 1EEZB 4JKWA 3HIZA 4AQ1A 2PYEA 4HX1B 3FCUB 1MJ8H 2N7AA 3P3TA 1AGBB 3IPFA 4MA8H 3BAEH 1A14H 2ROXA 3GXDA 3Q2WA 4AV4A 1R9FA 4DGIH 1QTPA 1BYOA 2EC9U 3ELQA 3EHBC 4WWNA 3VM5A 2EINB 2DLGA 4F2MA 2CKBB 5EZJA 1DJHA 1A6PA 4IM8A 6PCYA 2ZE0A 4XN4A 4FULA 4A6YB 4MJ5A 5KJRH 3LDBC 5B1BB 4RQQB 3RE0A 5ES4B 2EXTA 3CHRA 3DHJA 1D9KA 4GXUN 2W5PA 1MVFA 4F8NA 2C8NA 2MTAA 3DK0A 2DMCA 2V9UA 4S0TD 2QZQA 4JNXA 4ZFGH 5DD0L 1PZAA 3C6SB 3S36H 2FEEL 4PW9A 5F9WC 4L0PB 4DVBA 2GJJA 4GH7B 4QO1B 3NJMA 4U7SA 2R2BA 5EC2B 2YMTA 2B3IA 4BH7A 3CFKA 4Y1AB 2FVNA 3V0WH 1HNYA 3N0PB 1CLYH 4XOBA 5D7LD 2M1KA 3GIVA 3BAYA 3GRWH 1I1AD 2QSCL 5DRXB 4HS3B 3DGCR 1EZSA 2XT1B 3IU3B 1XGPA 1EXHA 3THML 4ZX4A 4F92B 1A6AA 3WEXB 3DJ9A 4HSCX 4X6CE 3UAFA 1NPNA 5FGBA 2E5EA 4J23A 3S37L 1JD9A 1XF3B 2NY2B 1PCSA 2C9SA 4PJ8B 4PLKC 3T2NL 3CHXA 2YAEA 1HILA 4M1DH 4Z7QF 4ZAKB 3RVVC 3HC0A 3SIKA 5AKTA 4AM0A 5EWIH 5CINH 5GGRB 4FQQA 4S2SA 1JZ4A 4NJ9L 3IDNB 1T5WA 1A6VL 4PLJD 3AQYA 1FA4A 4J1UA 1VAHA 3MRIA 2J8UA 4RA0C 3VE0A 1FZMB 1NEPA 4KBPA 3WSQH 3H3PH 1KTJA 1FI8C 1KYOK 1L9NA 4I18A 5IVOA 5IWLA 4XXDA 3MACH 5IB5B 3OQ3B 3FU3A 1FBIL 4AYGA 5HJGA 4Q6KA 3PHSA 4HIHA 4UOJA 1YYLL 2AZUA 1JDCA 2XTLA 3LPOA 1KN4H 4XWGH 2C5DC 2H1PL 4EO5A 4FFZA 4PV8A 3LRSA 4FQCL 1QWHA 1ZHBA 3OKEB 5IY5B 2JTYA 1A1MA 3ZHDA 2ZT9C 5I0YA 3P4NA 3ULSA 2Y69B 2BRRL 2ENSA 1EAPB 3ARDD 3VW3L 2V8MA 4WO4D 3NIGF 3LQMA 1R3HB 2E6PA 2OR9H 2EC9T 4FXKC 1YPZB 3OGOE 1JPTH 3BSHA 3WJMA 2IFFL 4P07A 3QA3B 2DKSA 4AVJA 2X6BA 3ZQ9A 4XCNB 1HEHC 4MDRA 3BO8A 3P0YL 4IGBB 3RNQB 1B0GA 2DWDA 4KVCL 5E2TL 3TO2B 2A6KB 5DFTA 1EUUA 3SGKC 4L37A 1WBZA 3FTGA 3TESA 1PZ2A 4LASL 2ADIB 4MS8C 3HS0A 3CU1A 2D7MA 2X6CA 3MRKA 3AMLA 4L8SB 3VFGH 4L8DA 2YPKB 3KYKL 1R24B 1RAMA 4K3EL 1L0QA 3ZRCC 1HCVA 5BV7L 5JW3H 1CI5A 2VZUA 1F41A 5EO1B 2Z7ZA 5T5FL 3F64A 5G4NA 4F37K 2KLRA 3Q5OA 4L4JA 5T1KA 5GS0C 5I1CL 2E75C 4L4VA 1PZDA 1AO7A 1IARB 2EIKB 2V5TA 3IN0A 3ZE2F 1FUNA 4HJUA 5H37G 4Z76B 1QABA 4IIQB 3C8KA 3WNIA 2HMIC 5T3ZL 4HWZB 1F6AB 2BWQA 5F7DB 3X1BA 1A66A 4JO8A 2BNRA 4XXCC 2KBGA 5E99L 4Z8FH 4JFXB 4KMTH 5I1HH 2BHYA 4CGTA 4OI9A 3RKPA 1P1ZB 3E6FB 4NKMA 5F7FA 2H6UA 2K3HA 2XVBA 5JQHC 1Y6KR 5JORA 1JZ3A 4FTVA 1NMBH 4H25A 4E9LA 5A1AA 1FSKB 2PUQT 3RGVC 4AMKL 5FO9B 4X98B 1BXXA 3TS8A 3EOAB 5HGDB 4U1KA 1T0OA 1KCSL 4RSYA 3GSVA 1NEZA 3JVGC 2CBQA 5CN2A 2HT2C 3NCJH 1ML0A 1ASOA 1CXEA 1GCYA 2F5AH 5CU9A 4DVRH 4FQHB 1TFPA 5CP7B 4UQAA 2FX9H 3AACA 3FTUA 1TENA 4LT7A 3KCPB 2X70B 4XXWA 3QFJA 4PY8J 5CEYA 2IQAA 3WY4A 1MFCH 4NRYB 2XG5B 1O5DT 3JVFC 1BJMA 1N6QL 2RTTA 2FWOB 4WUUD 3BH9B 2WJ5A 5H8DA 3HG2A 4ISVA 1C5BH 1MIEH 1WCBA 3VYPA 5FEBA 2KLSA 3ETTA 4WU7A 1KT2B 5C0AE 1BECA 1QZNA 3CH1B 1JGVL 3MUHL 4N0FB 4R7DB 3ZKMD 4V11A 1Y1DA 2GKIA 3QUXB 1YY9D 4LXFA 5TF1L 1PD1A 3TYGL 4F5CA 3CLFH 3KPOA 5B7EA 3QIWB 4XBGB 3B5HA 1H3TA 2ICWI 1KIQA 3WEAA 1X9RA 4ALAH 5BJTB 5JLZA 4ZQKB 3S3JA 2ILLA 4E2OA 4WUKH 3L2NA 3BEVA 1NBVL 3CFJB 1D5IH 1KXTB 2B2XH 4GAAA 5JA8B 1NTDA 1MELA 3DVNB 4PB0L 3CVIL 4A04A 1BJ1H 1ZIBA 2ZCZA 2XBTA 1Z66A 3L95A 1EXUA 1K9TA 1TPXC 1BEYH 5E2WH 1TO5A 4NO0B 1MW3A 1A47A 4LL9A 4CBZA 1JWMA 4HUWB 4PJIE 5MEQA 3P4MA 4S1DC 1BM3L 3SDCA 2H8PA 4I4WA 3CFBA 5J6SA 3SODB 3OR7A 2UZXA 4HK0A 4OLVH 1I1FB 3QQDB 2MCMA 4ONHB 2R69H 5TDNA 5ICYB 4GMTL 1F02I 1T0NB 3KWWA 5FA3B 3SBPA 3UBFA 3NJHA 4N20A 3PV6B 4AH2A 4DHLA 2AJ3A 4M6ML 4N5ED 1B9ZA 5AAMA 1RZKC 4EIGB 4NQXA 2AVFA 3T3PB 3F8UB 4Y5YB 2YC1B 3LHAA 3VDAA 2GJ6B 4I48A 3MLUH 2VXQH 1V8HA 3CCHA 5J6HA 3LZOA 1MHHB 4FD0A 1UB5A 5CXPA 3C60D 4QRPB 1F4AA 1QPPA 2ZUYA 3FHEA 5AUMA 5IFJB 1AKJD 5D2NC 3LB6C 3VI4A 1M71A 3HJ0A 4LSPH 2CJTA 4DZBB 3B9AA 2X4NB 4CW1A 2QVMA 3DBXB 3HMXH 3ARQA 3BH8B 3D0LA 5IMLA 4U2YA 2I60H 3L7EB 4XZUB 4RISH 1KJMB 1OW0C 3K8KA 2YAPA 4KGLA 4X4ZA 3VGGA 4JJOA 2IADA 3PWUB 3BD4A 4ZK8A 5D4HA 3BKCH 1AZCA 2J5LB 3QUKB 4LHQB 5ADOL 1WUNT 4Z3IA 1J5IA 3SZ6A 3G6JF 2F9BT 2XKNB 1KENH 4KTYA 4JZNB 4PJ9D 4ALAC 5BOJA 1U8IA 3VXUE 4PGEA 2V2XA 2ZKXA 1RP9A 1J0YA 1DVXA 3ZZSA 1KYOJ 3MVSA 3PL6B 2VC2L 4LDCA 4NM8H 4PS3A 4MCNA 1A0QH 3MGAA 1OV8A 2F7QA 1BQHB 4KQ4H 4M9PA 1CE6B 3GGWA 1JYWA 5AB2A 2SEBB 1A02N 4G8GB 3GRWL 4EI6A 2WXLA 4Q8BA 1JXFA 1AIFA 2IAMD 2BHUA 2I9TA 1RZIA 1MCDA 1U8HB 2DF3A 2APTA 3RDTB 2BFGA 2XXGA 4MZRA 5I71B 2YSTA 4AGOA 5HJ3B 1VFMA 2BVTA 1HEZA 5KSBB 4DZ8A 2VLME 1KCLA 3KH3A 1KIPB 1D5XB 1TZOA 4JG0H 2P46B 1OCWL 1MCSA 2TSAA 2F68X 3WIFB 2WBKA 2FCBA 3ATBA 2CLVA 3MXWL 3FUHA 3U9UB 4M8QA 2YD2A 5PAZA 2VWEC 3WN5C 4TVUA 4MX7A 1DSWA 2FJUB 5DF0A 4GRLD 4N26A 5ISZE 3VD2A 2VABB 3KEDA 4HKZB 4WO4A 4X5PA 5T3XE 1S7QA 1YECH 1MI5B 1TPXB 3DOSB 1WV7T 4OLYL 4QRPE 1DUYA 1MNUL 1IMHC 2Z4QA 3ARBA 4NQEE 4FQXD 3SJVD 5DK3A 3NCWA 1HNFA 3P9LA 4BZ2H 5FAAA 4FNUA 3BSZH 3QCTL 5LGHH 4LLQB 4QWWC 2LU5A 3S34H 3MR9A 1FJ1A 2ALWA 2EXWD 4F58H 1BDYA 5K9QI 5GJTL 5TDPA 1T1XA 4K15A 4R4FH 3NOIA 2PXYC 3QHZH 4GXVL 4FQLH 5F88A 5DHXB 5M95B 3LKSA 1JZ6A 1WAAE 2EYRA 4ODTL 2AANA 1MCWM 3H9SE 4L5FE 1TQSA 2N56A 3FT2B 4GW1B 1SDDB 3GWJA 2P5PA 3GTTA 4QO1A 4PJXA 3OC5A 2IQ9L 3QEQE 2W59A 1KIUB 3CVCA 5BV7C 2V9TA 5D2NB 4F8TA 5CCGE 1CGWA 4XPGL 4ZUUB 1JS4A 4QHPA 5ID0B 4X4YB 3CFNA 2VLRA 3IFLH 3VXQB 4PJBB 3GHEL 4ODWB 4ABVA 2ZCKL 3MKKA 4QHMA 4XTRC 3UTSD 4QKTA 1EHAA 2BNRD 1ZCRA 3DVFA 2VDMB 3ESOA 4P23A 4OZIA 1B2YA 2QVKA 4WCYH 1DQLH 5I8EA 5F93C 4R7DA 1HIMH 3Q43A 2XQYA 1UACH 1GJWA 4PJIB 4U1GB 4HD9A 2YMXH 3VXSB 1MAML 3VXNA 3FBQA 2XCMC 4S2SB 1Y18A 1N64H 3KW7A 5C6PB 1VADB 2IANE 1K72A 4RETB 3B34A 3D4CA 4YZFE 4KO5A 2NY6B 4FLQA 3RHWK 2R2HB 3NA9L 2H1XA 2X9ZA 5DHVB 3QXTA 4X0NA 4DO5A 5I24A 4PS7A 2Z93B 1AXTL 3AADB 4Z7UF 3ZTJH 3WIHA 5KUKA 3UGUA 4JFYA 3UXFA 4Z7UA 2BNQD 1ET5A 1BQLH 2OMUA 4JY6B 2YBRB 4TMPA 2UUDK 4DW2L 2Y3AA 1U8JA 4DCQB 5GXBB 1YN6B 4DP9X 4MHHI 2BXZA 2NW2B 2ESVE 3LCYA 3P3UA 4Y4FA 5D5MF 4CW1B 5JMRA 2PLTA 1PX3A 1SMAA 3N85L 4LEEA 3KPSD 2K8MA 1RJYA 2WAHA 3GSRB 4RCAA 2M8XA 3BKML 3TGXA 2H8PB 3QRBA 5LDSA 2HFGH 2AI0H 2DQHH 2ZXAA 3DURA 2H6PA 3QVAA 3PDOB 2PP9A 4FZEL 4GSXA 3QAZB 1FIEA 1QTSA 1J8SA 2R51A 4WTXA 2AJ3B 1XR8A 5MHSD 4N8VG 5I16B 3UTZB 4HHWA 2WWKT 2F54A 4Y5VA 2BP0A 4LCIL 5BRQA 1ETZB 1L5GB 2FNWA 5F7WC 5HHOB 3R1GH 4MLIA 2B9AA 1F2QA 4GQPH 1UVQA 3VACA 1N5AA 3PAYA 4POUB 4KHXH 1ORQA 1JGLL 5KYNA 2A9NL 1X5AA 5AL8A 3ZOAA 1U8NB 1JGIA 1HT6A 2VKXA 5D7JB 5E6SB 1ZRUA 3LB6D 3T8XB 4Y1AE 3L9RA 1SDYA 4CMMA 1BGXH 1OAKH 2P4AB 3ZMRA 1YPZF 1QBMH 1RK0A 4M6OL 2O5YL 3NN8A 2DQJL 4R4NC 3ZMNA 3AWEA 1JGUL 1W0VB 2ITCB 1ZTMA 3QGVA 3CFTA 5IHLB 1Y7VA 2P5WD 3NJLA 3FN0L 3X3FL 4PJFE 4Q58C 3QEQD 4G6JL 2WN2A 4KO9A 4X9FA 3UO1L 1SGKA 2A6JB 2AGJH 4M48H 3DOSA 3I02B 4PB0H 5FYKD 5D72L 3FUFA 4O51A 3H9SD 4F7CA 2HTLD 1KG0A 2WO4A 5I66B 4R7NB 4DKEH 1XCQB 1GZQA 2J3SA 5IEKB 4JGUA 5IW1B 1K3ZA 3KDPB 4UDUB 3CFQA 3AB0C 2R29H 3CC1A 3L2MA 4ORGB 4QRSB 5ILTL 4DEWA 3DROA 3JWOL 3O45A 4HJSA 3SE8H 2VQ1B 4HKJB 4R96B 3TXAA 1G6RL 2DQMA 5TDOB 4ZO6A 1WIOA 2J8UF 3HC3H 1OARL 3WFBH 3BD5A 4QHUA 3E8VA 1ZVYA 3HI1A 3TO4D 1S5IH 5JW4M 3CFJA 4FQXA 3SJVA 3N55A 2HT4D 2B8OT 3MRLB 5DUML 1NDMB 1PYWA 1IBYA 1DQJB 1G0YR 2X70A 2K7QA 3TJHC 4NI6A 1V7NL 2V7HB 3W0WB 1F11B 5FC9A 2Z4QB 4GRLC 1I1RA 3FO2B 2VE6B 4M7LT 1MF2H 1PEZA 3MHZA 2DPKA 3R0MA 4MB1A 3N44B 1ZEAH 3VXPA 4Z7WF 1LL1A 3LJ3A 3Q8EA 4TSBL 4LLMB 1DVFA 4D9LH 4EXKA 2Q86A 2CJUL 4NQUA 3FMGH 3UJJL 5HHQA 3ZE1E 2X09A 1KSRA 5C0JB 4Z78B 3RHWF 3O9WB 1UH4A 4M7ZB 2FQEA 1I8LC 2GJZA 1KF9B 1OF2A 2ZOLB 2Z92A 2NMSA 4H20L 5DC4B 1B90A 3QORB 3X1EA 4OFPA 4FNTA 4JBSA 5IROC 1M6OA 4JM2A 4OUUB 3HCVA 1KY7A 4EI0A 3L3IA 4E9YA 4F7TB 3O6KL 3CCHB 5J6HB 3EJYD 3M45A 2HVBA 1RZPA 1WSST 4JANA 1OP5H 4X7DC 2QHRH 5E5UB 5IKCB 1WDAA 1H8OA 3KLQA 4ZUUA 3TJHD 4AEIL 4JFDE 3IDIA 3ZZ1A 4C56B 1HYSD 1E9QA 1P53A 1KEMH 5CJQL 2VZTA 4I0PA 2F19L 2JI1A 4OZHA 5JO5B 2WQRA 3MOAH 2UZXB 4HK0B 4W1TA 4Z7VF 5CZVL 2D3VA 3FH8A 4LSQL 1T1YB 4MB5A 4OLEA 3V7MA 4Y2OA 1CS6A 2VDNL 5LCVA 3N1QC 5JOPE 3IXTB 3TIDB 4R7VA 3DX7B 1T21B 2J20A 2X9YA 1FVCB 1ADQH 3WXVH 3IJHA 3PXHA 1TETH 1PG7L 2J6WA 4LCUB 3K2MC 1QW9A 4R90H 4XBMA 5D1XE 5C09B 3C2AH 3DXAB 4QRRA 4AW7A 4JFFD 5AOIA 4NCC1 4IOFC 5DD5H 4OLYH 1R1CA 4HXBL 1E4JA 3RKDD 1FNHA 5AL0A 1MCPH 1WCQA 3NQKA 3QORD 3F3HA 5IGXH 4BZ2L 4YGVA 3GI9H 4WRLA 2P28B 1ZXQA 1INDL 3EDKA 5CJOL 2BOBA 3S98A 4P9HH 3KLDA 1Z9NA 4J3XA 2WSPA 2VLJE 5GJTH 5J0BA 4LAQH 3WIFA 1IKNA 1I8MA 3CSPA 2IAMA 1JCKA 4MCYB 1KBPA 5GGSY 3L3HB 4LSTH 5CJXA 4K3GA 1RSFA 5D1ZB 2LW3A 5DD6B 1I1AB 3ESVF 3QISA 2FJFA 1VERA 4H2CA 1X9QA 2D3LA 3FUMA 3NIFB 1MZZA 5SX4I 1UGKA 4Y1AD 5E03A 3D2TA 1AI1L 4FXKB 1BFVL 3MUY1 5DQDL 3BFWA 2AQPA 2A83A 4U4IA 3ULUE 4UI2A 3EDJA 4GBXD 5DO8A 2BX5A 3OKKA 4O2CB 4X8CA 2KL6A 4BRJA 2FJSA 5FKPA 4JPVH 2AK4D 2VL5B 2YFOA 2HUHA 3QDAA 4KOCA 4PJEE 1AHWA 1WZAA 4N2EA 4P46D 3VFUA 1V5JA 3S3SA 4L4TD 3EBHA 3IMSA 3R4DA 1G7QB 4N85A 1XBDA 3BQVA 3FT1A 4W4OA 4J3SA 4KK6D 5DK2B 3ZTDC 4OR1A 4M3JA 4HAKA 4BHUI 5BVJA 3OLEA 1VEMA 1O75A 5C0GA 4QXTA 1N0LB 3CUPB 4JPWL 4TSCH 1J87A 1JNJA 3ZRFC 1FN4B 4EKJA 5FECA 2QKIC 4WI0B 1G9ML 1YNTA 4ZW5A 1OO2A 2WQAA 4ZT1A 1AGBA 5BZXA 2DV6A 4MJ6B 1IM3B 4KPHL 5F9JA 2FYYA 1OPGH 5F3HB 1WEJH 4YVNA 4PV9A 5KSBF 1IGIH 1FAIL 1IC4H 4KITB 2ADJB 4PJDE 4GSDH 3ARGD 4UILL 2KZKA 5H37A 1HI6B 1SMOA 4J6RL 4BUQA 1B88A 2VDLH 5C6TL 4K9EL 2NR6C 4HK3N 2H0PA 2FATL 5D7JD 4QHNB 5FKAA 4I13B 5K59F 3I3EA 4AUJA 1QI3A 1VADA 4LDEB 3N9GL 1XDTT 2IBBA 4Q97A 5J6GB 2XV2A 2NX5D 1V55B 2Z92B 3ARZA 3PWVA 4QTHA 4XVSH 5EPMA 4WW2A 5IVXF 1WE5A 5CBEA 1LD9A 4ZTOH 1QQDA 3LEXA 1QRND 5GGTH 5C8JA 3RWEB 3ATFA 2NY4D 4TTGA 2W95A 3V0IA 3TZVC 1IKOP 5C08A 5ACLA 4N5UA 3GZQA 3VCLA 5LN4A 2V17L 4EVNB 3OSVA 3SDAD 2APVA 2ZYIA 4B0MM 1N59B 4DP1X 2Y1AA 1BQUA 1DJSA 3KL3A 2X05A 3QJUB 3SOBL 5TPWH 1E6OL 4P2AA 4YHPB 3HRZB 2PO6A 4PJDA 1A7RH 3NCMA 2AQRA 1KB5A 1I1AC 3MRDA 3N42B 2C1PA 4G5ZH 4TTDC 4WFEE 3P4NB 4F93B 3KR3L 4KV5E 2O5YH 5IESL 3PLYA 3TONA 3ETSA 2ZUUA 3NFPA 1H6FA 2R15A 2X4OB 1XFPA 1L7IL 4D0BB 3QWNA 2BP0B 2XPGA 2W65A 2IWEA 4GP8B 1N67A 4ONFL 5EOTA 1JJUA 4G80B 5J3HD 4OF5A 2VR5A 3U0TB 3ISWA 2DQDH 2W88A 3B1UA 5I6LA 1RHFA 4NFDA 2LU7A 2ISDA 4F37F 4B41A 1A7OH 4DGIL 2HP4A 4I18B 4QF1B 4TNWK 4BWWA 4UQCA 4X6DE 4IDJL 3BGFC 2DH3A 1AS7A 3M17A 4GRMB 2UX7A 4QYAA 5EF0A 2BDNH 4WQOA 4PLKD 5SX5H 4NO2B 4LQFH 2NY7H 4LRIC 4PJHB 4A2MA 3MV9B 1DFBH 4Z5RB 4IBLT 4XN9A 5KVDL 3GXIA 5FYLE 3CVDA 3GZKA 4Y2NA 4PREA 2R59A 3B6SB 4YS4A 4MQ7B 1TJHH 4MAYD 5KSAA 2KQNA 2JKJA 4L8BA 4LLYA 4MA8L 4ZMVA 4Q9CA 2J1KA 2IAND 2NY1C 1IBDA 2B59A 1FYHB 2BZ7A 2NXZD 4G42B 4N2BA 1M1XA 3O2VH 4KX7A 4NZDA 3AT0A 1RIHH 3B3BA 2XKUA 3IU4L 4NC0B 5MEND 4PWKA 4KX9A 3IPBA 1PU0A 4TUOB 5E08L 4B9YA 4WHCA 4P2YA 5E8PB 2VLJA 1X9LA 3K6DA 3DTXA 5D2LA 1J05B 3GXFA 4QPEA 4L37B 2XPYA 2N1KA 4GKZB 1U8CB 3U7WL 5T1LA 3NH7H 1NGXA 3Q2CA 4YLBA 5I1JL 3GMQB 3QFDB 1XR9B 1BIHA 3MJ7B 3TA4D 4JMXA 3MV8E 1WP6A 2XN0A 2FO4B 1FN4A 5F97E 3KJ4B 4QOKE 3HZVA 3NRFA 1DQJA 4ZOBA 1CLYL 1UXMA 3C5XA 5H35B 5E8DH 3UPRA 3WNKA 3P77B 1XZ0B 5EUOB 3NCCB 2BVPA 4ZBJA 3MNWA 4R8WL 2Y7MA 3SDXB 3FFCB 3O6FB 5DEJA 1D5BB 1Z9LA 1D7DA 1L6PA 3WIIL 3V4UL 1MHEA 1YEJH 3D09A 3ZZLA 1CMOA 1XF4A 4HAGA 1E4XL 4OZHE 1VFUA 1R17A 3W39A 4G9FA 2R4RH 4M29A 3IVKA 5DURB 2J6EL 3MLPA 3N5AA 3PNWA 4J8RA 4XP1H 4XAWH 4JFDA 5DK2A 3KPOB 4NJ9H 3IN2A 2ZPKH 3TBVB 2VDNH 4FKKA 3EJYC 3PPEA 3NGBC 4YBLC 3OKLB 4NPYB 3VO0A 3O4OB 4CNIA 3H3PL 1KCKA 5J1AB 2DQEL 3L3KA 4ZYKB 4G1MA 2FJGA 1JPTL 2H3NA 3MACL 4HIHB 3QC6X 2EH8H 4WFHE 3AQDA 1N0XH 1AD9A 1HAWA 3DMMC 1TQCC 3IGFA 4GQQA 5AW4B 3VX0A 5GS1A 1TDQA 3L95B 1YHPA 5IV2A 4MCZA 5E2TH 3MV7D 3CZFB 4N1EA 3QFGA 5DJXA 3IU3A 2ALAA 3W2DL 5DRZB 5L6YH 4F33B 5HDQL 4KQ3H 1TF4A 4A7TA 1CGUA 3MRDB 1NJ9A 1K4DA 5TGBB 1EAPA 2NY5C 1GGUA 4M4RB 3M07A 4MJID 5DLMH 1FO0H 3LSOB 4KI5D 5F9DC 3RNQA 3C60B 4P5TA 1OALA 4J8QA 1AQKL 3OAWA 1KXTA 4LOFA 3CK0L 4KVCH 2OXHB 2OV0A 5AAWC 5C0AD 3UZQB 4JZOA 2J1XA 3IWVA 3Q9PA 4O00A 3L9EA 5IB5A 1HQ4A 2NYZA 5TQ0L 2BSRA 4FFYL 4W9EC 1HWWA 4LKCB 1GC1C 2Y7LA 4Y5XC 4OF6A 2WXKA 5A3IC 1NM4A 3MV7E 2UZIL 1JXKA 4MMYB 3KNBA 3T71A 3HKFA 2L04A 4O58L 4R7LA 1FNLA 2CU9A 4ZS7H 2DKUA 1T1ZB 4Y0GA 5L7XH 1I7UA 1AXSA 2APFA 4WWKB 4RA3A 1G4MA 4UTAL 4LCCC 4MNHB 4AQAB 1DTUA 1Z9SB 2C3XA 1SUHA 4J3UA 3H0TA 3WKNA 4ZMPA 2ICEC 5FO8B 1TJIL 3BVDB 4W9ZA 4RMWA 3WE6B 4GAJH 2Z91A 3FB5A 4FHBD 2VSCA 4AK2A 1SM3H 4LCUA 5DJYB 2YEVB 4BIKA 4JFOA 4PJFA 4DVRL 3U2SA 4ELKA 1PW3A 5KJ7E 3GF8A 2A83B 4ZOAA 3OJDA 1EDYA 3U83A 1MRCL 2ZG2A 4AIZA 2Q7YA 5AD0A 1J9RA 3U4EA 3P4LA 4KPHH 5FWRA 3U30C 1M05B 2QL1A 1OPGL 2DJSA 5DUPL 2WYIA 1DO5A 4Z7VB 3ROLB 4P57A 3BI9X 3VI3B 4AL8C 4EI6B 2OAAA 4LMQI 4ZS6D 3QIUA 1Q9OA 5I23A 3HS0B 1JWUA 4KZDL 1GIGH 5GRUH 3IJYA 5HHPA 3W5NA 3GTNA 3RWDB 1A65A 1MCEA 1YRKA 3HG1D 5AZEH 3WMQA 1OE3A 4LVHC 4P49A 4XNMA 3T3ME 2QFPA 3JV6B 4YHLL 1U8QB 3K2KA 1HQRB 4UTBH 1ETJA 2F54E 3TLRA 4LKXB 3QAZC 1NBVH 1IAMA 2E4FA 4G6KL 1AO7B 2LQRA 3VRJB 1LEIB 3KLAA 4J2XA 4LP5A 2WWKO 4F9PC 4BQ8A 3BZDA 2BM3A 2JKTM 1C5BL 1MIEL 5EOCJ 4A6YL 2VJ0A 5I75C 4A66A 1KDJA 4HGWA 1FPTL 2X1PA 1JGVH 5I18H 5EO0B 1CL7I 3UBXB 4YLCA 2DD8L 4PJ7E 5DMJB 2ESVA 1E27B 1ASPA 4IRJC 4L8CA 2YXMA 3FCSA 3VD5A 3TVMA 4BFEA 3V6OE 4MQXD 1HH9A 1NCAH 2NY4B 2KPWA 3KR3H 4Z7UE 4EI5B 5EEVA 2HH0H 4JK0D 3OB8A 4ZFQA 4X7TA 4PTTA 1HX0A 1CL7L 4YNYB 2R69A 2W8CA 2IH3B 1QQDB 3B2VL 4P0DA 2AMUA 1C08A 1L7IH 4XNXL 1JL8A 5AW0B 4PU2A 2NYYC 3QNYB 3QG7L 2VLKE 1TVHB 5DHEA 3BAWA 5GISL 2VLKD 3OB0K 2I7OA 5MI0B 2NRDA 2FX7H 3VRLF 2FWOA 3K4AA 3EHBB 3BPNC 4HF5H 3P9LB 2LOEA 3HRZA 4MRBA 1MCBA 4FG6C 4TVPD 1O9ZA 3JUYA 3EZ8A 1YYCA 2BDNL 2IOOA 1HU8A 1N8OE 1JTTA 1IM3D 2OL3H 2ZX5A 4JY4A 5DUBB 2VLRE 4YXKH 2D03H 4WFFD 1IAIM 3VFTA 1UM4H 3TBVA 3KPRD 1A6UL 2Y7OA 3UZVB 1N7ML 4OCWL 1TZIA 2I69A 2X1QA 4K73A 3SKOA 5EA0L 4RIRB 3ISYA 3EXJA 2IBZY 3I50H 2VC2H 5JPMB 1EHLL 2Z93A 5ICZA 3H9SA 1CBJA 3ZE2B 1WAAA 5AG9A 5I1DA 1RPQA 1ZANH 1CFNA 1FLTX 5JIKA 4GNKB 4JM0A 3VXOA 3FQUB 3T04D 1TKWB 1U2CA 1Z3GH 4Y8DC 2W9EL 2QGEA 3RILA 2ZXWB 4JVUA 3UIYA 4IRSB 2CWRA 2OR8A 4U6VH 4PGDB 3U7WH 1QA9A 2ZCHH 1WWAX 4XNDA 3U4AA 4PRHE 3RVWD 4XTRD 3LDBB 3MBEA 3HZKA 1ZIAA 4MSWA 4XH2B 2WZ0A 3IMRA 3QR0A 2G5BA 1T2QH 2W9DL 3CLWA 4OIAA 3UZEC 3WE6A 4PJ7B 4TYUA 3HG0A 1U93A 3UAJC 3VXSA 5I1GH 3NIFE 2OFQA 5CCJA 4AC4A 1XR8B 2YWYA 4LVEA 5ISZA 2CHZA 4D3CL 3L1OH 1LDPL 4ELMF 3V6FA 3BDBA 3AREB 2HJKA 2CIIA 3QH3B 3GSWA 4R26L 1C5DA 1CDUA 1JVLA 2JI2A 2XZCL 3LIUA 3LS4L 3WY2A 5KEZA 4JZOB 5KBDA 1CCZA 3N42F 4NBYB 1QX1A 3NSDA 3V4UH 1IAKB 1KB9K 5GJSL 1OKEA 2XWBB 2UXFA 5I0DA 5AOZA 2ICCA 2NW2A 1MREL 4NIYE 1NGXB 1QSZA 5H37H 1EERB 2FQDA 5IBUB 4MAUL 3FO1A 3MXWH 5INDA 2P5WE 4IKJA 4MVBC 2IBGA 4N25A 3MBXH 5AOKA 4ZUTA 3NDYE 1YEFL 4P3DA 4ODSL 3RX8A 3OR6B 5DEGB 1F90L 3D25B 3M1BB 4P5MB 4BFJA 3D08A 5KAQF 4YX2H 2DQEH 1P4BL 5FX3A 3L3GB 5E95B 1SJVA 1LJMA 3FAWA 2EIMB 4JRYE 4L3CA 1YLBB 3MYJB 4NZTL 1RIVH 3VGFA 3F7QA 1AOHA 4IGBC 3ZE1F 2DLEA 2VXQA 2WV3A 2OI9B 4IRSD 4BXSV 4AMXA 2XFGB 4MJJA 4CSZA 1QEXA 4PJDF 4GXUM 4R4FL 3CZSA 2I5YH 3OHXA 2K7PA 3DSNB 4AEHH 5E4AA 4Y4FD 2Q9OA 2VIRA 4O2EB 4PRHB 5L0QC 5B39A 1AJ7H 4TLTA 3VI4E 2PETA 4L8CB 1A7PL 1S7WB 1TR7A 3UYRH 3ZDWA 4S0HA 2ORBL 2ATKA 5D2NA 1ZTXH 4OJCA 4M8RA 2X6UA 1AS6A 1WA2X 1DBJL 2NSQA 4PWEA 3V5DA 3ARSA 3AUVA 3WJJA 3D34A 3O9WD 2Y06L 4N2OA 3ARRA 3MLXH 4NKDA 5D71H 2OMWA 4EMZA 5KS9E 1PNCA 4UIMB 3MNWB 2YZ8A 3DDFA 1OZTG 1BZ9B 2EDJA 3ZDZF 1DVYA 3A6OA 1PLGL 3MR9B 4KXZH 4PJIA 2F7OA 1FRGH 2EDFA 1IUZA 3WEXA 3EJQA 3NACH 3RVXD 1NINA 1A6TB 2E3VA 4Z3JA 2Y07L 3NQIA 2HFGL 3RGVB 4B5EA 3MRHA 2PTVA 2WSKA 4XP5H 5C0EB 3NJFA 3F7VB 3BWUF 3SDXF 4MMZB 4M9OA 3G6JB 1UZ6E 4RNRA 3DUUB 4UNIA 2YBRA 2VXVL 3RX5A 1FFOB 1WAPA 3K81A 2XWJB 1KZYA 1LO3H 2Z8RA 2IDTA 4AL8L 1PCXA 3LKPB 3VG0H 2YEZA 1DDHA 3MRBA 1RURH 4JY6A 3BZ5A 2P43B 2CCWA 2H2PC 1RIUH 3F7YA 1TIUA 1TSHA 1NAMB 4EAEA 4C54A 4GS7C 5DUPH 4JPSA 1UA3A 3VGBA 2DH2A 1JI2A 2NNCA 1Z9PA 3I85A 4IEFA 1MY7A 1A8JH 1P6WA 4CC1A 1ZGLP 4JFFA 5C0AA 2QLYA 3RFZA 5E5MB 1R6VA 5JXEC 3B7SA 1JF1A 4KZDH 1H5BC 1MZYA 2GTZB 3WAJA 1BG9A 3FONB 1H3VA 3AWFA 4M43L 4BKLA 3PAZA 4M7KH 1MRDL 3MNVB 5DTFA 3UEQA 2J72A 3ILPB 2WWNA 4HS6B 3QFJE 4XZ4A 1PIFA 1U9KA 3HFFA 5F6HI 1TVDA 4YOKA 2LLGA 4TQEL 2WCPA 2RFXA 4MS6A 3FUDA 3R8QA 3OV6A 1GHFL 3MI6A 4P5RA 3VWKB 3LZPA 4A67A 1HHGA 4BFIA 1N6UA 2X7LA 5IBTL 4PVLA 3MYZA 3NABH 4OCYL 3EG9A 4X8JB 2AQQA 3QHTC 4KKAD 2D2CC 4FTVE 1CLCA 1LWRA 4H26A 5I73C 1WWCA 4QOKB 5ILTH 1Q38A 3CFMA 4NNPL 4IJTA 4PSPA 1Q0XL 1MEXH 3Q8CA 5CGMA 3S3CB 3UYPB 1OCOB 2QVFB 2X89A 2WXMA 4LSDA 4L8DB 4OLUL 2D9QB 1CD1A 1NCAL 3OKMA 1C5CH 5BRZB 1HQRA 1H6TA 1FGVH 1QKZL 1Q9KA 1QBLL 4H13C 1KJ2H 3KYMA 2A6IB 4G6JH 2GFBA 3RAJL 1G9HA 4L4VE 5EBWB 2VLMD 1EJOH 2HKAA 1XEUA 4GINA 2X4RB 1KC5L 5I15H 4KKLD 1NCOA 4MWFA 4UDUA 2BSSB 2E7CA 3FQYA 4L3CB 5AOLA 2XTJC 1J8HD 1XCQA 4H1LG 1ZT7B 4NQSA 4CVXB 1BVNP 1QOKA 2FX7L 3TBYA 3ULVH 4Z7VA 4LEXH 3H7BA 1AYOA 4OFYA 3UO8B 5L4FA 1FNFA 4PBVC 3RVWC 2ITEA 1P7QD 1WGVA 4DP0X 1JYVA 4JFSA 1ND0A 1JTPA 4B95C 4NYLB 2OMNA 4Y19B 1IC0A 2WVVA 3NDZE 1ZT4B 2D0FA 2GYSA 1FH5H 4WWKC 1BZ8A 2WNXA 4UF7C 2F15A 1NIBA 1ZSHA 1A9BB 5A2BA 1B4JH 2D31A 1OWRM 4AGPA 1AH1A 3GIVB 2R2BB 3RBGA 3FJTA 3VXSD 4MJIB 4TLSA 3ULUL 5CEXB 4DPBX 2WKLA 2YPLD 3VYNA 4NAQA 3QZPA 1F11A 4LRNL 4IK6A 1IVTA 3MGOA 1KTRL 4L3EA 5HXMA 2GTQA 2HXAA 4ZTPL 2APSA 4G8GE 3HG1A 4N90D 3MTRA 2BNRB 4HLEA 1T0PB 3RRQA 3WAKA 4LLUB 5IK3B 4J2QA 4K55A 2FRGP 1G7QA 3PP4H 4QJ5B 5DUBA 1KPUA 1T80A 1UCBL 5EWIL 2FIKB 1F1AA 5DVNA 2GJZB 3ME0B 3GMMB 5DJ8B 1QBBA 4XNZB 3V0DA 4QHLA 1NBYA 1QSED 2VXUH 2LFEA 5TTRA 4Y4KB 3S5LG 3D30A 3E6HB 3CUPA 2A9MH 2O61B 2A77H 2J8UE 4LIQL 5F72S 3GMNA 4M3KB 5BXFB 4RNRB 1ZV2A 4D3CH 1KBGH 3BPOB 4LSRH 1TVHA 3ZDYF 3S4SA 3AM8C 1GGIH 1UEYA 3KPSE 4NKDB 3ZE0B 2BVQB 1R5VB 3LS4H 5D7HA 2KUTA 5SWZB 1NAMA 3HPJA 5PCYA 2WCSA 3A4AA 2AJZB 4YIQA 3LS5L 5DEFB 2F19H 3MLYH 5ITFB 3BLKA 4IRSA 4WU5B 5CJOH 2OSLB 5F9OL 1UATA 4H0LC 4F9LA 5EEXA 4CC4A 1OAXH 3OMAB 1G7HA 4C56D 4UAOB 2VISA 5KSVB 3WXVL 3L4VA 4A38A 1WTGT 4BFKA 3MBXL 4AWJC 3AS2A 5I1AB 1Q94A 3QR2A 2WKOA 2ZXQA 4PJGA 1EV2E 5DEZA 1OAJA 4QRRB 2A6KA 4JPQA 4ZOEA 3KLHC 1B6UA 2XV6B 1WA1X 5DJ2B 1P4BH 1RJLB 4B27A 5JYMA 2B1AL 3MRGB 2YKLH 1M56B 5IGXL 3KPRB 2C34A 3UIZA 4DTGL 2V9QA 1P69B 1JZ2A 5AKSA 3A6BH 1INDH 2XI9A 4JQXA 1CLOH 2K9FB 3OM3B 4FA7B 5CGBA 4LPCA 1UYWL 1RSYA 4RX4A 1KWKA 2IAMB 3RNKB 4HLJA 4XCEB 4LBAA 5EBMA 4E68A 4XHJD 5C0IB 4JJHA 2YAMA 5EZIH 4K2UH 5FK9A 1AJ7L 5BV7H 3N06B 3MJ8A 5KOMC 1KYUA 4F2ME 1MWAL 4C4KT 3FL7A 4F8QA 2JJTA 3DX2A 5I1KL 3TBSB 1VRSA 4WKZB 3MRFB 5IEHB 4U1GC 3L6FB 2AKRB 2EEFA 3I6GA 4FABH 1BD2D 1AI1H 4LPUA 1R3HA 1NCCH 4W6XB 3BZFB 5T3ZH 3SDDB 2Y06H 1DE4A 1DVFC 1X5LA 2VUOA 3H6AA 4AV0A 2VYRE 2ZONA 3GSWB 2V5YA 5GGUA 2QQKL 3PGDA 4Q2ZB 5LKNA 3MV9D 2O93L 4XGZA 1X6LA 3EG9B 3HC4H 4N0UA 5DXWA 4URKA 5CD5D 4MBOA 3SDAA 2EIZA 4ZXBD 5E1GA 1GYAA 1KTDA 1TOXA 1P7KA 4U1KB 4N2NA 2VTFA 5BPPA 3SO5A 3QQ4A 5TQ2L 3LZRA 1CQYA 1KCSH 4EUPB 1OQOA 3MV9E 4WI0A 5HGDA 1WBYB 3ARVA 4BELD 4NYLA 4U3CA 4Z3TA 3K0WA 4G5AA 3HR6A 2HT3C 4R5XA 3BP4A 4DP6X 5I30H 1DSYA 1SF3A 2CLZA 4K3JL 2AXJA 3IJ7A 4WVRA 1IC7L 3CWGA 1Q0EA 1A7BA 1LO3L 5I74C 4AL8H 5KZCB 3OAZH 1Z5YD 1FF5A 3L3OA 5I8CA 3TFKD 2A6DB 1DN0B 1SRDA 5F7DA 1BQHA 2OULB 2XBZA 3MLSL 2AVGA 4LVNC 3QEUB 1JNNL 1AE6H 3HG1B 5JQ6L 4XP4H 3MUZ1 1EAJA 2DLIA 3SOBH 5AYQA 3RUGA 3TYGH 2B5IC 4QRQA 1S9XB 2NW3A 4HBCL 1MAKA 4Y2DB 3DX1A 1JHLH 1C8QA 1P4LA 1X4XA 2DYPA 3P11H 3C08H 5F88B 2OX5A 1H3XA 5GS3A 3TBTB 1SOSA 2XX1A 3K8MA 4PM1A 1YNKH 3BEVB 3QZLA 1TQBC 4LQ1A 4XMTA 4A7SA 4FKEA 4HD5A 3PQYD 2QVIA 4IS6A 4PJXF 5E9DB 3V5DB 5KVEE 5DJ6A 2YEZB 1T2XA 3LPGA 5EUKB 3UFIA 2XU9A 5AW1B 1RZGA 1JN6A 2EEXA 3S2CA 4MJIA 2NT1A 1CR9H 1EDQA 3AXHA 5KVFE 4ZZKA 3QUXD 4MZ2A 1IKNC 2DIBA 2ID5A 2RCSH 4JCMA 2IAMC 4YHKL 1FAKT 1ZHBB 3OKEA 8PAZA 2GJPA 4BA0A 2GJ6E 1IQWH 1JPSL 1IFGA 4Z7WE 3L8QA 3H42H 1I7RB 3HZYB 4Q6YA 1A7RL 2CNYA 2EYSB 4ETYA 3BVVA 3FU7B 5DRZA 3FTZA 5EEZA 2M83A 4RMQA 1GMEA 5KZCD 4BWUA 4GMTH 4C4BA 4D9RE 1I8IB 2H0EA 2QSTA 3C6LC 3RI5F 5IQ7L 1BQHG 4DGUA 4ZW7A 1EDHA 5T1LD 3HBQA 4S0SD 3BW9B 3WIHL 4XCNA 1JHTA 4MLSA 3NFPB 5EPMB 4F3FB 1Z9MA 5ITBL 1NGZB 2D8KA 3KYOB 3HNVL 4IMLB 1ZV9A 2HRHA 2EO9A 2IH8A 5F7BA 5DJ0A 1KTKE 3ZDZB 1ZE3H 3LEYL 4FXGB 5JW5A 4B9PA 4ACPA 2HX9A 3CPLB 1R5WA 2IH9A 3W0WE 3X14B 3I6LE 5E08H 3RIAF 5I8OL 4Y4HC 1E0OB 4OLWH 1UB6B 2I60L 2ODIA 4Z95H 2WXPA 2E74C 3GB7B 4LNRA 4XE5B 3DO7A 2X4PA 1I3UA 3KVPA 4AW4A 4ZMWA 1E5YA 4O02A 3O2DH 5TE7L 4D8PB 1X4YA 2C1PB 2J1WA 3JV0A 1XT5A 2VQTA 4WI4A 2FQGA 3UMNA 4Z76A 3CDGB 5I9QB 4PIBA 2MEJB 5HGBA 4RZCA 1QFWI 2WBJB 3IRPX 1BFSA 4JREC 3L4XA 1S8DB 2OTUB 3FRPA 1QLEL 1BOYA 1UZ8A 3ML9A 4MA7L 3LPPA 1FLRL 4YK4C 4IRZL 4N22A 5DR5L 2J88H 4DFHA 5F9WB 3SQBB 3NAAL 4OCSH 2Q7YB 3GSQA 4XP9L 4IHOA 2ZXDA 4TNWF 4PRNB 4AZ8A 3KDMA 1Q9WB 4H25B 1AZNA 4XMZA 1NC4D 4Z7UB 3U4BH 3D6GA 2R56H 3WENA 1T6WA 3IM1A 4CN1A 1H9VA 2G5UA 5FCUL 3C5ZD 2VR3A 4HCFA 4OW6A 2R4RL 3OAYH 4AGQA 3WD5L 2XRAH 5KSBA 4JG0L 3MO1A 2AJXH 5IW6B 1U8PA 1S7SA 1ZHNB 5IHZA 3GSOA 4XAWL 1AXSB 1PY0A 1A1NA 2OJEB 4OY9A 2YQ3A 3LVEA 43C9B 4GXFA 4I3SL 3BP4B 3QDJE 5IHUL 1E8WA 5INCB 1Q90A 5EF1A 3PV7A 2B59B 4C4UA 1GJUA 3M1OA 4H88H 2K45A 4AYEC 3L4WA 3QORC 5HYFA 3WMPA 3SDDA 3MRQB 2Y2YA 3WIIH 1V7MH 3OQRA 2A6DA 5LGHL 4I3RH 1QO3B 1RLBA 2K9UA 4L3AA 4X5WB 3ARFA 3MCKB 1E7UA 4GUOA 1XGRB 1JFQH 4JRXE 4OIBA 4LU5L 3MLYL 4ANUA 1OSPL 4N0UB 1JK8A 5KWYC 1B2WH 1UJ3A 5ANHA 2XQBH 2VZOA 3RL2B 5IOPB 2P26A 4FTVD 4LARH 1U8NA 2JELH 1DBAH 1TNNA 2EYRB 3ZE2E 2ZIDA 4NUQA 4NN7B 3T0VA 4FERA 4J3TA 3VFVA 4NN6B 1QSEB 3IJSB 2ZG3A 3CZEA 4B9GA 1DVZA 5F7EH 2OYMA 4XO5A 5B39G 2EH8L 1E3ZA 3HNTH 1E7VA 1O6SB 4NRZA 4DUWA 4GKLA 4JDEB 4XPGH 2X9XA 4P2OC 1L9QA 1OSZA 2BY2A 1NGWA 5ADPL 4MAYB 5BRPA 5LXGL 2BP5M 1VACB 1H0DB 4JM4H 2CAKA 1HE8A 2IH1A 3RWHA 2HYMA 1WWWX 1T0NA 3KWWB 1DQLL 2R0LL 4ZD3H 3WUZA 4RH4A 1G7IA 1CBVH 2C7UB 2Q7NA 2E9WA 1GCFA 1U30A 2VN7A 5E00B 1T6BX 4ZMTA 2YRLA 2YMXL 1XV8A 1KB5L 2I9LB 1BBJA 2C3VA 1HCFX 3VFMA 4E9SA 3PWLB 2MHAB 2GIYA 1HH9B 3MCG1 1OF2B 8FABB 3AVEA 2V7NB 4GW1A 1YUHB 1FH2A 1KN2H 5IVXA 2HKFH 5J1AA 4IMLA 5B38A 3PHQA 5IB2A 3TOPA 3GHBH 1JP5A 5EIIB 1HOCB 2GQHA 4PEEA 2IXQA 3ZSSA 4O2FA 1OE1A 3CN0A 4LF3A 5LJYH 2ZOUA 4MJ2A 4JRXB 5GZNA 5TFSH 3U1QA 2WWOA 2VLLA 3FUEA 1AGEB 4DT2A 2FNBA 2I25N 1HS6A 1UXWB 3OWRA 4HEME 3UMTA 4JJ5A 2WLIB 2B4CL 4M1CC 4A37A 1JUFA 1XGPB 3EGSB 2JIXD 2FR4B 5ALBL 1GIGL 5GRUL 4EKXA 4G6FB 4XB7A 2P8MB 1YQ2A 1W72L 3G6DH 3OZ9L 3PL6A 3WKML 3IS0X 3EDEA 3H0TB 3FQXB 2XA8H 3MV11 2GCYB 2DL2A 3ZK0A 3PABA 1GMIA 4KNUA 3O2DA 1Y18B 1B0RA 3MJ6A 3ZDYB 3CVHB 3GMLB 4H1LA 2DDQH 5AEAA 1KACB 4LLVB 5H94B 3LXUX 1I53A 1RUAL 1WAEA 2ICWJ 2VDRH 3VFWA 1YEWA 4AENA 1RVFL 3OJDB 3UBXG 5DHVA 2MNUA 5LAXB 3MLVL 3B2UC 3CIQA 1DVTA 1T03H 1FYTA 1HQ4B 1YEHL 1KBVA 5EUOF 3MNDA 2DRUA 1NC2B 2YA2A 3CX5J 2ZSWA 2HN7A 1F2XK 2UY7B 4OCXH 4ZFOL 3BSGA 4FLSA 1DZ0A 4U3SB 5J11C 1UM5L 4LFHG 1IGCL 1P6FA 3O3AB 4JHUA 3IFNL 4POYA 3LKOB 1FL6B 2P42B 1T1ZA 4KJQC 2VMCA 2AK4E 3CPUA 3NCEB 2AQTA 4YDVB 3T0BA 1CFBA 2X6VA 2C9AA 4FNPA 1CYGA 2VH5L 3AJ7A 3N43B 1VZHA 3P11L 4PJAA 4P5TD 3TN0C 5LUMA 1N3NA 4LHUA 4OIIL 3ALXA 4G6KH 3VXRE 4YAQA 1G1CA 2HWZL 2AKRA 4U6HB 2CO4A 3DA0A 4UT6A 4R7NA 2C3GA 3DJSA 4RWYH 1AZRA 3BP7A 3PHOB 4ZNEE 4OM1H 1NSNL 2CK0H 3MCYA 1KGJA 4P4RB 2ZAIA 2JKNA 1FPTH 1ZLSH 3BWAB 4OGAC 5FM4A 1GYVA 3UJIH 2R8SH 1BPLB 4QRSA 4K0OA 1QHPA 4IRJD 5EIVA 4TUJB 5CSZB 3CLEH 1M53A 5GIRA 1CD0A 1P7BA 1ZT1A 1NCDL 5HY9A 4EDXA 3K4DA 4HWBH 1P7KB 3AXLA 1E27A 2XN9A 2BIHA 2F6AA 3IDXL 4P5TC 4TVPH 3S5YA 4HP5A 3K71B 3VTTA 5E4IA 1D9KD 2VIRB 4O2EA 4WHDA 4U4BA 2EO1A 3W1ZA 2GJRA 3HR5B 1OM9A 2J12B 4G72B 3R4RA 4PTTB 3GS4A 5ICXA 3VXME 2EYTA 3HB3B 3V0EA 2ROYA 2NY5H 3Q0HA 3FUJA 3ZIYA 5HYJB 5HYEA 5FGSA 5CEZD 1A7NL 3X13A 1N7MH 4WI6A 3GS7A 5DDHB 1FG2B 3FTWA 3L17A 5JW4Q 1CC3A 5INCA 4K8RH 5T3ZE 1WQVT 1GTFA 3DJZA 3VTAA 1MCKA 1XBRA 5JNYA 1X5XA 3PG2A 2CBOA 2FBJH 4JCLA 3MN8A 3BLBA 1F1GA 4OI8A 5BOZG 2PYFA 5HYSB 2ZKMX 5ICUA 3REVB 1LP9E 1IBZA 3HEIB 4BJLA 1QRNA 1F8TH 1UUNA 2OTPA 1AD0B 4PJ8A 4D9LL 3EYFA 4C55A 4NDMB 3IS1X 2XY1A 2WLLB 4HULB 1J0JA 4NPKA 5IMOA 3VH8B 4L9LB 1Y6MR 3O2DL 1RZ7H 3ENEA 2R2HA 1MQKL 5BZDA 2DYPB 1THCA 1VFOA