4YE0A

Stress-induced protein 1 truncation mutant (43 - 140) from caenorhabditis elegans
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
GSLNEVENTAQKFCVKLDVAAFKPEELKVNLEGHVLTIEGHHEVKTEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAPKTGSNTTVRALPIHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Stress-induced protein 1
publication title The Chaperone Activity of the Developmental Small Heat Shock Protein Sip1 Is Regulated by pH-Dependent Conformational Changes.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
total genus 16
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ye0A00
4RZKA 1EJFA 3Q9QA 3QORB 3GLAA 4M5TA 4ELDA 4YDZA 4FEIA 3IGFA 1WGVA 2Y22A 2KLRA 1WFIA 3Q9PA 4ZJ9A 2Y1YA 3EUDA 3N3EA 4YL9A 3AABA 3QORC 4JUTA 3AACA 4JUSA 2CG9X 4PBDA 3W1ZA 3GUFA 2Y1ZA 1WH0A 2O30A 1SHSA 5DS2A 5DS1A 2KMWA 3L1EA 3QORD 2CR0A 4MJHA 4YLCA 3L1GA 4YLBA 4I88A 2WJ5A 2XCMC 4PCKA 4YE0A 1GMEA 3VQLA 5LUMA 3VQMA 4M5SA 3GT6A 2BOLA 2N3JA 3J07A 1RL1A 2N0KA 3QORA 2MNWA 1X5MA 2JKIS 3L1FA 2K8QA 2WJ7A 2RH0A
chains in the Genus database with same CATH superfamily
1D2OA 2NNFA 4LAJH 4A6YB 1OAJA 5GGTL 2RBLA 1ZT7A 4XE0A 2WCPA 3V0GA 1SJVA 3U0TB 2VITA 2IPUG 2IAMA 4QAWA 5DQ9B 4B9FA 4WU7A 4KUCF 3TCXA 4HXAH 3NMEA 2E7BA 2VABA 3WNOA 4AGQA 4FQXD 4EZJA 1P9MA 1RPQA 3BPLC 3QJVB 4FZEL 4QGYA 2NYKA 2ICWB 3TIDA 3WAJA 1SHXA 1H0DB 4DVBA 1NC4A 1HSAB 1T3FA 4FYRA 3DBXA 2YUZA 3R8QA 4X8JB 3TNMB 3KYOA 3DLQR 4GUOA 1A9EB 2WIIA 4YDKH 2UZIH 1DDHB 1YDPA 3HC3L 2WWMC 4Z3FA 3DX6B 4JQXA 2A6IB 2FZ3A 5HJ3A 5ALBL 3FN9A 1F97A 3H0TB 4R6UA 1QSEB 2H47C 3AS0A 3FL7A 2QR0A 2B5IB 1CG9A 3N85H 2GJ6D 1N7MH 2PCPA 4PJFF 1RPUA 3IDMA 1OAYL 4NXKA 5HI3C 1FI8C 3CDZA 3UTTA 2XDHA 1KGXA 3MNZA 1ACYH 4TQEL 2HTKD 5CEYA 3J8F7 5TFSH 4LLMA 3LHAA 4LXFA 1G43A 2Q0ZX 4JM2F 3QG7L 1I9IH 3I9IA 3QXAB 4PRBA 1KIRB 4F57H 4R7NB 4GRWF 1A6WH 3DJSA 2FX7H 3RHWK 1RUAL 2NOYA 3MSPA 4RFEB 5I74B 1JV2B 2CRMA 2X1OA 4Y4HB 4MNQE 2PCFA 3E8UL 2CDEA 3FHQA 1TQCB 3EYUH 1IILE 5E4EC 3TO4A 1B4RA 3BHBB 3CPLB 2H3NB 5EFIA 3G5ZB 4UM8B 3SDAC 4OD1H 2KMWA 2O61A 3B2DC 2WXNA 2XWJA 2FDBP 5AZUA 1ZSDB 3QDJE 1ZANL 2BNRB 4JRYE 3SYPA 2R9HD 4YFEA 4X4YA 1MJJA 3ULVL 5HYJB 4DK5A 2ITCA 3NEOA 4PBXA 5C3IA 1PZ5B 1A0QL 2HJKB 2Y25A 2ZXWB 3IRPX 1OW0C 3LEYH 3VXUE 4N24A 5HYSA 1CN4A 3KJ6H 4EUPH 3D9AH 5LN8A 4QXGH 2VDRH 5HI5D 4O02B 5DJCA 3T4AA 2PUQT 3POHA 1TZ8A 4KAQL 4XXWA 2AAVA 4QRSA 1WAEA 1DEEB 1EUTA 3SQOH 4IRZL 5FO8A 5IOKA 3LVEA 3RWEB 4JFYB 3UMNA 1RLWA 1T89C 4AYMC 3Q05A 4AYSA 1TVBA 3BEVA 4NT6A 1X5FA 2QSCL 3EO9L 5BQDA 2F5AH 3O6FA 4ODWA 3HAEH 3NDZE 2C3HA 4AQEA 3WIHH 3QDMD 3U4EA 1JG9A 1T1WB 3W11C 4DQOL 4KOCA 4F7TA 3SCMC 3U2IA 3OMNB 4NO2A 3MLXH 2MH4A 3MUGA 3NRPA 5FW6A 3EH3B 5A43C 4YXKL 1TTGA 2ZUXA 4ENEC 5EEXA 1AZUA 3KNBB 5I75C 1E4KA 4RGMC 4Z7VA 3F7KA 3AB0C 2CPCA 3WKQA 5E8PB 4C83A 1PX8A 2AZAA 3OKYA 3L4WA 2DQHH 1MFEH 3ARGD 3B7SA 4RFNC 2R2EA 3PIQB 4HDIB 3AC0A 1OQOA 1CLYL 1V3LA 3MRKB 1BPLB 4X9YA 3T0EC 1ODUA 2EDBA 4ZTOL 3W1ZA 2IF7A 3U7WH 4UANA 4I3RL 2VZ3A 3KCPA 2NSQA 3V0DA 4NQEA 4TULH 3LPFA 3IDXL 2C34A 2GKIA 4F80A 4M62H 3RDTA 4M9OA 4YHIA 1OTTD 3K6SB 2YGOA 5DVPA 1LILA 2UWEE 3QXDB 2ED6A 5A16B 1GL4B 4N0UE 3TXAA 3X1NA 4WK4B 4XX1G 4K55A 5IHBA 4N3UA 3VW3L 1RZJL 2BSSA 4HLZG 3WUWA 1TMCB 5F1KC 3RWDA 2BINA 2JI3A 2Y22A 1NCAH 3QDJB 4W9IC 1DVUA 5E1IA 1K5WA 1ZVHA 1RXLA 4JRYB 2FUTA 5BV7C 2ID5A 4OFDA 4Y1AE 1MW1A 3FO2B 1PLCA 3E2HB 4FD0A 3WEMA 3LKPB 3Q44A 5KOMC 4AQ8A 1AVAA 2VLKE 3II1A 2VR9A 3LIZL 4F92B 3CBKB 1ZXKA 4EIGB 4G83A 4X4KA 1KIQA 1INEL 1DLFH 1XR8B 2DF3A 4W6YB 4J39A 4GSQA 4RAVB 2HB0A 5IB4A 4JRWA 3TJEL 5BZDB 5J9PA 1INDL 1FZJA 1N3NA 2BY1A 1O7SA 3AM8C 1FA4A 4OFPA 3MZTA 4LLAA 3GMOB 3RVTC 4TUJA 4U0RB 5KYUA 4TKWA 4N87A 3JZYA 4G7YL 1RJYB 3WKYA 4KZEH 4OGYL 2L8AA 4OM1H 4XNYL 3TA3B 2C9RA 3MRBA 4HP5A 5E08L 3DDFA 4O00A 2DYPD 3TF4A 1JZJA 1SHWA 4NQSB 1FG9C 5KBPA 3HMWH 3VRJB 1T5XA 4RRPA 3WL9A 3FONB 2D9CA 4PRNA 2OX5A 1HHKA 1WTGT 2P24B 3G08B 2BFVL 3NPZB 1QSFA 1UT9A 2DD8L 1JDDA 2R29A 3GXDA 1SJXA 4U31A 3Q48A 2PN5A 3QE5A 1J11A 3Q1EA 5C3TA 2AEWA 4WHCA 1CPUA 2OP4H 4HKJA 3Q2WA 4H0IA 5DJ8B 3VXNB 1E9PA 3MRQB 4G5ZH 5KW9L 4NWTL 1JCKA 2BC4B 5DEGA 5KN5A 4MHHI 4F15B 4LCUB 2VRAA 1A7OL 2E7CA 4LLUB 1I9JL 4GSXA 3COOA 4J4PC 5PAZA 3A47A 2N7BA 2C3VB 2WD0A 5T1DH 4ZFOA 4IBVA 1OIOA 1W8OA 2QSVA 5E5RB 3EDEA 3ELAT 4FXGC 1AHMA 2Z7YA 4WU5A 1AGBA 2YR3A 5LKNA 1A8JH 4EIZC 3ULUH 4DKDC 3JTTA 5I5IA 5PCYA 4QDGA 2O93L 3CFBB 1Q94B 1MWOA 5KS9A 2G2PA 4XNQB 2W65A 3K71A 4MVBD 4NBYB 3RPIA 3BVXA 3FU9A 1NM9A 2UWEB 3T5WA 5DS8B 2WQWA 4RGOH 4HCRA 5AALA 5KYXB 1TDQA 5F89B 3PWPE 4BK4A 1R5IB 4M61B 3FSWA 4LHUB 4HX1A 1QI5A 3DX1A 3RQ3A 1WPCA 4Y1AB 4L3EA 3DARA 3FHEA 2F8XC 5CGMA 5F88B 2NNRA 2APXA 4QRQA 3ZIYA 1PL3A 7PCYA 3GTTA 3Q9PA 5IESH 2G3XA 3QZNA 2VLKB 4NC2B 5DSCA 3S2CA 3OLEA 4HKZA 5J6SA 3LNGA 5D96C 4Z8FL 1G9MH 1U2YA 1R24A 4UTBL 1BF2A 5AL0A 3DX3A 1G9NL 1UFGA 5J7CC 4G9DB 4ODTL 5GRUH 5DFWH 2M8XA 1A7QH 4XVUD 5EWIH 4LP5A 3MO1A 4TVPE 2AK1H 2QVMA 1RULH 4ECNA 5IQ9B 2EC9T 1HHJB 1U8MA 3O3AA 3UTTD 1RSYA 1VEMA 5J12C 2IH3B 1RZQA 3BAKA 4KK9C 1FVCA 1AD9A 3FRPA 3BO8A 5C0DB 1L9PA 5GGRB 2O6CA 4JN1L 1AHKA 1F4WH 5H8DA 4F9LC 1W80A 3QRFM 3BKJH 1XD1A 3VXMD 4L48A 5AOJA 2MTAA 1PY0A 1DUZA 1VF5C 3FT3B 3K2KA 4P4RB 5D2LE 5J13B 2WLNA 2TSBA 5KVFH 2Y07H 3MV8A 3T04D 3OHXB 2MOGA 4FXKA 3TO4D 1ZGLA 3RKPA 2VLRE 4FMVA 1Z5HA 3DMMC 3KYNA 1WAPA 2Y3AA 4JQIH 4P2OB 4WSKA 4YK4B 2ADFL 3L3GA 2Q3XA 3ECBA 2NXZD 4PIBA 2EO1A 5DVNA 3BUBA 4L4VD 4FHKA 3KWWA 4N2FA 1IGCH 2O5NA 4ORZC 2WHVA 3IETA 5ANME 1FE8H 5D1ZI 1GC1H 2G9KA 2FLRT 3FH5A 3KLDA 1OB1B 1UGKA 3DOSB 5DCCA 5CCHE 3DPBA 1KCVH 1DBAH 4K3JL 2ZUQB 3QQ3A 2ZZUT 4LSDA 3VX0A 5JYLA 2AHIA 1G6RA 1MFNA 4P2QE 4RAUA 3WDHA 4W4OC 1OARH 1AZNA 3D3VB 1YNLH 4RGNE 1E0OB 2IWGA 5A3ID 1G1KA 1XEUA 2J25A 3WN5C 1IGTB 1HOEA 1BZEA 2GAZA 1BFOB 4TRPL 5JW4Q 1SFHA 1X5JA 3CH8A 3QIBB 4JFHE 2DQEL 4G8GE 3PWNB 3O6FD 1DLHB 1H3GA 2BRRL 1OF2B 2VISA 3OR7B 4U6VH 4GAYB 1HDMA 2VM9A 5SWQB 3BVDB 3VFTB 4F93B 1BJ1H 2CJ3A 3O9WC 1N70A 3QRLA 3ULUD 1W6WA 2HFEB 4FQCH 2WY3B 3MUUA 3ALPA 5F93C 4AZ8A 2Q2EB 2QHLA 4GUPB 4X99B 3AITA 2WVSA 4BZYA 3FN0H 3U4KA 4Y5VC 3NZSA 1DJIA 3TM6A 4A68A 5IW1B 1TYRA 2DLFL 2B16A 2A9MH 1GOHA 3IMUA 3EYSH 4PJDB 1J7VR 2X1PA 4EAEA 1T2XA 2AITA 4HJJH 1RZIA 5D8JH 1OGTA 4LVOC 4N2HA 5B38G 3RB7A 3VAEA 4PWHA 2UWEF 1WF5A 5ESVA 1EUUA 1VKXA 1GGTA 4LPTA 2ZUTA 4PWKA 1AP2A 3UG3A 2A77L 2I9LB 3RVXC 1ZWIA 1J0IA 3BDXA 1RK0A 1JPEA 3HC0B 2A0LD 3BUYA 4HZ1A 1JBJA 5IHZA 1SF5A 3C5ZB 3RLSA 2F1BA 1KN2H 3FQRB 1XGPB 3QA3A 4PMFA 5D71H 1DN0B 2JTYA 3A23A 4JANB 3W2DH 3RDTD 2ZSVB 5D2LB 5D1XB 4FHJA 3WTSA 1FNEA 3V8OA 5GS1A 4OI8A 3WS3A 4M5YH 2A83A 2VLRB 3WIFB 1L9RA 2YAHA 3Q8AA 4OIIL 4BJLA 2ED7A 2UXFA 4M43L 3D34A 5MHSE 1PX4A 1IC7L 2VZ1A 5CP3H 2AJYL 2QVKA 5EUOE 5FKAB 1DJSA 4KPHH 1KZQA 1L4IA 5HHXL 3ARDB 1GZQA 2AGJH 4FKEA 3STLB 1DANT 3GM0A 2FL5A 1DJZA 4LNRA 1KJ2L 1GAFL 3QYCA 2CKNA 3L3OC 1R5VA 4IIQC 2D3NA 5IBUB 5DHVH 1HH6B 2FLMA 1BM3L 4J6RL 4XGZB 1UB5B 2YAOA 4P2QB 3MV11 4P5TA 3S0PA 3NSCA 2H6OA 2QFPA 2IO5A 3QFGA 3W56A 4QRBA 5IJVA 4IRSB 4RGNB 3CZFA 2DW5A 4MQTB 2CHZA 4BA0A 5BZZA 1PY9A 2EJ1A 4X7SL 1D7BA 4JDVB 1EFQA 4MMYA 2PCYA 4JX0A 5IFHH 4G8GB 4YDJB 4N6QA 2ZOLA 3TONA 2HLAA 1UKTA 4MAYB 4PI0A 4R2GB 2Z31B 1QTSA 2OJ1A 5FFGA 3FSZA 4NKIL 3VFRA 2DS4A 4UDTA 4Y4KB 4J3OF 2ZXGA 3RY5A 5AQ0A 4WW2C 2VMFA 4DEUA 3CQPA 2XQ0A 2G75A 2I7SA 1KLUB 2WLZA 3FU8A 1A6AB 1BG9A 2UX7A 1U2CA 3BPNC 4WEBH 3K6FA 5KVGE 4K71B 2X28A 5AZEL 1N12A 3HE6B 5KVEH 3L4VA 1JXFA 1MRFL 4GQZA 1XXFC 3EFDL 5DFVC 4NQXB 1GZHC 2JV6A 4PRIE 1G0XA 1AGEB 1JUFB 3AS3A 4LPVA 1R3LB 4YIQB 5C6WH 1G87A 1S5HA 1GYAA 1I1RA 2Z65C 3FCSA 4AENB 1CQYA 4LCWD 2BNQB 5LWYH 4I87A 5FA4A 3D69A 1I7RA 2P5ED 5EO9B 1NGXA 2OCCB 3V0FA 3AU0A 1YECH 2WTRB 4WI4A 4GMTL 1O0VA 1EGJH 2D3JA 4PWIA 4ZJ9A 4X4MA 2CBPA 1OZUA 2EECA 2GTQA 4W9JC 4ZAKA 3ERXA 2AP2A 3P11L 4MRCA 3DSNB 1ECYA 1Q72L 3DRTA 2QSQA 4JAMB 4XN4A 2ZWSA 5EUOB 3EW3B 2BERA 2Z91B 2JF1A 3VXRD 3BX7C 5HVHC 1I8LA 3EYQC 4P49A 4GQQA 4W9CC 1EEZA 1Q38A 5GS2H 1OL0A 2P8PA 4PCYA 1HH9B 3U1SH 1HNFA 4S1DD 3MOQA 4WI6A 1AJ7L 2X7LB 4LSRH 2UY6B 1EAOA 4K0OA 2RALA 2CK0L 1MCCA 2D7NA 3OZ9H 2HKAA 3CFEB 2X89A 4HPYL 3BT0A 4F7KA 3FOLB 2X6CA 1QFHA 2ZT9C 3H7LA 2BSDA 2NY2C 3ZYJA 2C7UA 4FTVD 5D2LF 4KTGA 1OAQH 1AOHA 2R27A 2XCMC 4PM1A 5F7MC 4MJJA 3HE7A 3KXFD 4FG4A 1HYSC 5H4ZA 2ISDA 3TU6A 4Y19D 4GW1B 1Q0XL 4YL4A 3V55A 5D1ZB 1XSJA 5BQ7B 5DURD 3KYKH 1E42A 4I48A 1JGVH 1A1NA 4O58H 3MXWH 4ABUA 4NO5B 4ZXBC 1NAKH 1IJNA 2N0MA 4XHJD 3JTSB 4KFZC 5SX5H 2UXVA 1GKOA 4ZUVA 5I1HL 2OMUA 1I7UB 2JMRA 4K5OA 5CR1A 3GSVA 1DBBH 2PLTA 1AZZC 1UWGH 2KKQA 2ZCHL 4G59C 5F44A 1HN1A 3MV8D 3KJ4B 3D2UA 3AT8A 4LT7A 3MOAL 2FR4B 3MRDA 1HESA 2L7QA 1ND0B 2WP3O 1KJ2B 1JHLL 2E6PA 4RLDA 1CK0L 3CC5B 4YSCA 2R69H 1VZGA 4OJEH 5GS0C 4KTEH 2HT3D 5HJDA 3N6YA 1F3DH 2OYKA 4ZW8A 2YA1A 1KV3A 3WE6A 4F8NA 4PRIB 2K1MA 3BPLB 2X70A 2FIKB 4K94L 3KVPA 5CIPB 3MLPA 4D7BA 2AEQH 3GDBA 3HZVA 3PP4H 4OT1H 3IJSB 1CS6A 4EF3A 5DVOA 4JW3A 3TNNB 4HZLB 1IBZA 5AW5B 4CBPA 5BXFB 3TCLB 3SE9H 2ZX7A 2OMWA 3HR5A 1UXWB 2JKLA 3MV7E 4HPOL 3QCTH 4YPGA 4NAMA 5BV7L 1L9TA 4N0YL 4BDVA 1BX2A 1EZVY 3CAFA 5K39B 4PWEA 2VC2L 2YGPA 2EEXA 4I1RA 5E23A 4FQ1L 1JAEA 2FYVA 2FO4A 3VFVA 2VLME 2VQUA 4DZBB 5JR1H 2AK4E 5C9JA 2Z64C 4R26L 2AJVL 4KQ3H 2LHAA 2Y1AA 3T2NH 4MNHB 5DHYA 4MNQA 3T0EE 1G9HA 4KO7A 1AY1H 3G6JA 3MA7B 4UQIM 3LZPA 1ZHKA 1HWGB 5F7DA 1JNNL 1JGDB 3BP5A 3UZVA 4CGUB 5ISZA 3T65B 4MD4A 3IXTA 5DJXA 5IF0B 3GHEL 4F7PB 2P8MA 4QRPE 1NCIA 5F0MB 1DQJA 1CDCA 2XV3A 4MDIA 3T4YA 4ZS6D 2XN1A 3IRCA 3NG5A 3F12B 4AIOA 3SDAB 4LKXB 1UTDA 1OCRB 2V2WB 2Y23A 4QWWC 1WO2A 3B2UD 4GAJL 4P5KB 2NY4B 4HG4J 1QTYT 3SDDB 3GJFB 2HZHA 4BD4A 2CLRA 4Z1PA 5FF6A 5EUOF 5IHUH 3HZ3A 2FQDA 3RVVD 5T1KB 1Q0YH 2AXGB 3L4CA 4IJ3B 1USQA 2C3WA 1M7IA 4PJIA 1MVUB 1MFBH 3B3IB 3I6LD 5MENE 2OXGB 2YMOA 4KVPA 3RL2A 2FWOA 2H3KA 3CSFA 2C9XA 3V0WL 5I9QC 2R1WA 1N6QL 4BSWB 1NKOA 2E75C 1FYTD 4GKNA 5AUMA 4NRYA 4XMKH 5JOFB 2ODHA 3PAYA 4IQHA 1ZLUH 1VFAA 5GGUA 1W16A 3F01A 2IPTH 1EZUA 2W8CA 1LDPL 2YXFA 3EYVA 3GBML 3NJNA 3PHOA 5E9DA 5INDB 1ZY9A 4OQTA 4NCC2 4GRLB 1JWMA 3R4RA 3OD3A 3MRPA 4KNTA 1T04A 3AFLA 1U8IB 2APTA 3I2CL 4XC1L 2V8MA 3DKHA 1QRNE 4AZUA 2HFFA 3OHMB 1AS6A 5LQBL 2CKBL 2DDQL 3CLFL 4P5TD 5C0RH 3HUJE 4RGMB 3HG0A 3AB0B 1M7DB 3JT0A 5I0XA 2H6UA 5BW7C 1QPPA 5IB3B 1A14H 1KFAH 4PG9B 1AE6H 2IGTA 4QHKJ 2AK4B 3T2OA 1RIVL 4K7PL 2IGLA 3WY4A 1BAGA 4DP8X 1IARB 4JFZH 1NLBL 1KLGA 4MS8D 3O8XA 4J3VA 3T0EB 4EIUA 1JXKA 1D5ZA 1F11B 2DQJL 3QPQC 3RIAK 4FLHA 4OM0L 5JPMA 3MRHB 4HXBH 4DETA 2QDVA 3VM7A 3ZTJH 3ZX1A 3FO1A 2DWYA 4JLRA 4LLVB 1PNDA 4QRPB 3G3LA 2A9NH 5F7UA 1XCTB 3ISWA 4B9YA 3KEHA 5DJYA 5FOJA 3IDYC 5CJQL 5E8OB 3I9AA 1UH4A 1WWWX 2WBXA 4JG0L 4LPWA 2EDDA 3ZRSA 4BE5A 3DTXA 2JWYA 3PG2A 5CCKH 1UD4A 3QC6X 2IJ0C 3QUKB 4N8VB 4HKBB 4OU3A 4APQA 1BCIA 2UX6A 4B53A 1FPTL 1LO0L 1TQVA 5BV7B 1BJMA 2Q76B 3F6IA 5CD3B 4PUBL 4WEMB 3AGVA 4R4BB 4ZFZA 1O9ZA 2R4RL 1FL6A 2VC2B 2Y1VA 4Q9BA 1P5VA 1O9VA 4B95C 1S78D 5I1CL 1UC6A 4XVJH 4YDMA 3ZL2A 4FFYA 3KPSB 4GW4B 4MZIA 5MENB 2OFQA 2B08A 4M6AA 2VXUH 3JWNG 1D5BA 4Z0XB 3G5XA 1ORSA 5E4IA 5DO2D 1A7NL 1KBWA 1YMMB 3KPRB 1DQLL 4RWYH 1EVTC 3BZDA 4I8DA 3Q6GH 5H37A 1LO5B 2WQVA 3ZDYE 3W3BA 4AWJC 3RI5K 1OD7A 4ZW5A 3MLVL 3BCFA 1T0MB 2RCSH 3QO0B 4Y1TA 4JFFE 1M71A 5EU3A 1ZOXA 2YK1L 3DXAB 1AR1C 3SOBL 3TT1L 2ALWA 2D31A 1WV7T 3UYOD 3BAYA 5GISL 2YUXA 1FVDA 5HHPA 1C8QA 4NGHL 4ZMYA 4EUPG 1QRNB 3UAFA 2NMSA 2ESVA 4HUVA 5GZOC 3H85A 5LXGH 2KBGA 3VFPB 4U1MB 2ZOUA 2WN2A 4DGIL 4ZPTB 5EUKA 1RK7A 4MDJB 2EH7H 3D39E 4CC4C 5LGJB 1OT2A 5IW3A 4IBUA 2F9BT 3EGDB 4GQ9H 1EEUA 3UERA 2EYTB 4J1UA 3LIUA 1LK2A 5FOBB 2BIHA 3LKNB 4PJ8B 4K7FA 1WFOA 3CSBA 1BQLL 3RZCC 4FXGB 5DWPA 3MCKA 4XBMA 3OPUA 3K2IA 3WO3B 3JVFC 1A6TA 6CGTA 5B22A 2VE6A 4OZFH 5HDWA 4XWGH 1N5AA 4RMVA 4F8LA 5IY5B 4QRUB 3U7YH 2PWFA 1XGQA 2V2XA 3IGFA 2CO7A 2W94A 4BIKA 5FEBA 3DVGA 2Y36L 2GJJA 1A6ZB 3Q06A 3O6KH 4UMGA 2WGXA 4R7VA 2PR4L 3DECA 4LE8A 4RMBA 4D3CL 5T3ZH 1HHIB 2WBJA 5CEZH 1T66D 1JNLH 2CKBB 4LQFH 5CJBA 5DZOA 2EACA 3D85A 3IWVA 4HT1L 1EPFA 2AEIT 3GSXA 1CGTA 1XWVA 1EZVX 2R7EB 5E5MA 4CBZA 1BXVA 1HCVA 3I74A 3UBXA 4NQCA 3X17A 2VH5H 4ZDHB 2VR6A 2OAAA 4IMKC 3ZXAC 3ES6B 4UT6H 1P7KB 5GRXG 3SKMA 1HXYA 4DKEL 2F53E 1JK9A 4HISA 2NW2A 5GIRB 3RKDC 2ADIB 4JZOB 4PHZA 1UH2A 3L7EA 4OCSH 1IT9L 3LHPL 4GAAA 5T3XH 1B2WL 1P2CB 3ZDYB 5J57B 4U3SB 5ITFB 1SEBB 1UH3A 1F58L 2JKSA 4FMKA 4Y16D 3OQ3B 4JFFB 3STBA 2AAAA 3HOGA 3VVVA 3MMEA 4UUJA 2P5PA 3BW9A 1V7MH 3OWEA 5F3HB 5FHBH 5J12B 4DKAA 1QKZL 4KFMA 1MN4A 1UGNA 2WJ7A 3I75B 3WHE1 4MCZB 1OSPH 3HI1B 4DWHA 3HB3C 2EDRA 3KBEA 2EIDA 4P2RE 5I8CA 1XF2B 3QNZB 1OLZA 2EDNA 2WXQA 3NYKA 2IOIA 4IEFA 3FB8B 1KCBA 4ZW6A 4D7PA 1MRDL 2DQCH 3OPZL 4NPKA 1W2KT 3MYJB 2XZQL 1A4KA 4H88L 1FGVL 2OL3H 3I02A 4CVXB 3L95B 1U3HC 1WBXA 5EBLA 2CD0A 1T80A 1FAIH 1J5IA 4YC2C 3KGRA 5I18H 2J6EH 3K1KC 4KMTH 5GJTL 4XOEA 1CZ8L 1NPUA 2NNXA 2HKFL 4N2GA 2FWUA 3B7YA 3LPOA 2QVTA 3CVHL 1MCDA 1N0LA 5BUPA 4RZCA 1TTRA 1WJ3A 2A74A 3LYRA 3WBDA 3TT3L 1E90A 2EIMB 2H5UA 1D5MA 3GKWL 1C5CH 4PJCE 3E1F1 2FNWA 5ID0A 5AZ2H 4OW6A 3GTVA 2AEOA 5T33L 2M1KA 4HK3J 4AH2B 1VACB 4JREC 4LCCC 4E0RA 5LAXB 3REWB 2OK0L 4L8BA 5KSAC 2KPNA 1FSKB 5KSBB 4UQ3A 2EEDA 1CLZL 3EGXA 4MS6A 2V3FA 4XPGL 3EG9A 2VIRA 5LCVL 1KBPA 3WN5B 5D5MA 3DHMA 3QIUA 4UIKH 1P7QB 2LLGA 1CJYA 3IJEB 1JZ5A 4YO0B 3PY9A 1CICA 3LKOB 5TQ0H 5AB9A 4FE9A 1N64H 3CSYB 5DI8B 4DP0X 3B1UA 2DN7A 1ED3A 2FATL 3V4PH 4ZX6A 1TVDA 5AW7B 1S9KC 4PRAB 3QQ4B 3ZYZA 1YEJH 2F53B 1DZ0A 2YEVB 1PNCA 4PJHE 5E2VH 3ARPA 4KROB 5DO8A 4Y5VB 1O9WA 2IV8A 1QHQA 4LBEA 3II2A 1U91A 3DVNB 3ARTA 2IGFL 1KLFA 1HINH 2NY1C 3JSSA 1DFBL 1TJIL 4JKWA 3M1CA 3U30C 5C0CA 4JKPL 5IZ7A 2X41A 1W15A 5E99L 4QI3A 2CK2A 5CEZD 5I5JA 4PI2A 5DJAB 2F19H 4ICXA 4L29A 1PVHA 1KJMB 3LJ3A 3ZKSD 3O8XD 3U83A 3VQMA 2NDFA 4YMPA 4F5CE 1SN0A 5MEQA 3UEQA 1IGIL 2XBDA 3IGAA 5JOPD 1OT1A 2FSEB 5ADOH 5I1DB 2WP3T 4MA1C 5L8JB 1HEZA 3W39B 1MIEH 2V7HA 3MRFA 2A6KB 5FM4A 1E27A 4WHTA 3DJZA 2CDGB 4ZMWA 5KZCB 2EUVA 3AQDA 5AVSB 3D2TA 2N4IA 4WFHE 1WDAA 1X7QB 2YPLA 2ZPKH 3QZPA 4DZ8B 5CGBA 1AKPA 3VXPB 1OSZA 3X14B 1K5NA 5T3XD 1S7XA 4H26B 4HXAL 1EFXD 4OAWA 4AMKH 1BWWA 2ZKHL 4LDOB 3OKDA 2V0AA 2YEQA 1MCFA 3H2PA 3C08H 5GSVA 1Z9LA 3UYPB 4YQXL 4WWKC 3VQ1C 3FPXA 5F6HJ 1T21B 2OSLB 4PS4L 5TDNA 3ZDYF 4ONGH 1JZHA 3OXRB 4PU2A 2NYYD 3H3KA 5I2IA 1E9OB 4PHXA 5AVYB 4C54A 3T6QC 4ZZKA 5ETUA 3IDUA 3UL4A 5CN2A 1I8KA 4NJAH 1TZHA 2CMRH 1GIGH 4HS3B 4NENB 1R1CA 1TKWA 3GGWA 3H6JA 3V4UH 5GS0L 3UAJA 3S5ZA 2GK0B 2DBJA 3N85L 3AJ7A 1N7ML 3FQUB 4JFQB 3G04B 5AG8A 3D51A 3OB0H 2EUZA 3FQTB 4UV4H 3TWCH 4WNQB 4D8PA 2BP0B 4G71B 2VLJA 3IJHA 5EO1B 3EF7A 1ZD6A 4U6TA 1DJWA 2NCEA 3QCUH 5ERWB 4D9RD 4PGDB 3N40F 4K9EC 1I9IL 1EERB 2YFOA 5T1MB 2YRBA 2G2RB 3TFBA 3VYPA 4A1RA 1X5KA 5HGHA 3PQYB 2YD6A 3IRZA 3CZEA 1PQZA 4RBPH 1F4HA 3D0VA 3VI3E 2DV6A 1IAOA 2WLIB 2OMTA 3CVHB 3UPRA 1TVHA 3I50H 3L1EA 1SOSA 2ESVD 3HI5H 4PJHB 4U1HB 5M7QA 4WW2B 4OD1L 1CD9B 2CDFA 1KC5L 3QEQB 4FFZA 3GI8L 5JYMA 1HZLA 3IWUA 3G6DH 3PP3H 3IFNH 2QQKL 1RFDH 1M1SA 3VRIA 4UM9B 3BPNB 2ZXDA 1RK1B 3GZPA 3UP1A 1G7JA 3V0VB 2CCVA 4B9KC 5H2BA 3VI4E 5I6KA 2WXHA 5KSBF 3V0JA 4TTGA 1RURH 4ZNEA 1QZ1A 5D2NB 3LEYL 3W5MA 32C2A 2DM2A 4MJ6B 4CU6A 4ONHB 5IMMB 2WPGA 4DK3A 3KJ6L 1TUPA 4FA8A 3D12B 3VWKC 1JHKH 4CSSA 3HLAA 1W0YT 5AKRA 4J5VA 4ODSL 4HUWA 1DJXA 1F8TL 4UOW1 4OLVH 3JWOC 1OAKH 2XA8L 3D05A 4XCNB 4W9ZA 4P8QA 4HK0B 4I4WB 3ZT7A 3GSRA 2HJLB 5IGXH 1G4MA 3QZMA 4D0BB 2YQ2A 4AJWA 2A99A 2YPKA 3IVKA 5K9OA 3VGDA 1VGKB 4KK5C 4Q8BA 2R56H 1RU9H 4KRPD 1JGLH 4Q6IA 1E4HA 4N0RA 2FCBA 1J8SA 3SKJH 4P99A 3WIHL 1M2VB 2JJSC 3T08A 2D0FA 4WJG3 3MLXL 4NQCD 2QVFB 2A4EA 3SE3A 3MDJA 4JFXB 1L6PA 4GG8A 2A6DB 3MRNA 1SXAA 1L9MA 1WHPA 2XJKA 4YGAB 1RKRA 5DRWB 1UEYA 1Q9LB 3O3BA 5F0JB 1XF4B 1EDHA 2J1ZA 5AD0B 3A6CL 4X8XA 1OXYA 4P5RA 1XD0A 2YPVH 3WTUA 2I60H 4HWBL 4WY7H 2GTWA 4H8PA 1BXUA 1OTUD 1P6AB 2G4GA 2OZ4H 3F6LA 1UZ8A 1KXQE 4WK2B 3UZQA 4A04A 1WZKA 3L3JB 3QJQB 3S88L 2JIXD 3C9NB 5D7LB 1OW0A 4JZJB 3BSGA 4AQ1B 3F05A 3TO2B 4NNXA 4M3KB 3B2VH 4M62L 3TVMA 3J2PA 5FYJH 2R23A 3P4LA 1MUJB 1MZYA 4KTYA 2E86A 1MCIA 4Y0GA 1GHFL 1U8QA 4M6MH 3TS8A 3MFFA 2C8NA 2JELL 4PJCF 5IJDC 4I85A 2XQYA 5B3JE 1T89A 3WNIA 1NCAL 1UOVA 3K5RA 3BZ4B 3FJTA 3I9PA 2W59A 1T20A 1E5CA 5I82A 5AOMA 2PO6C 5CN3A 3UCRA 2MQGA 4R0LC 2OXHB 1MW3A 1FFNB 3VH8B 3FB6A 3DK0A 1C1EH 1YMHA 1EWHA 3DGCR 4OVUA 2X4OB 3I6KA 4HC1A 4MJ5A 1WS7A 3PL6D 3ECVA 5EIIA 1BSIA 1QEWB 3MQIA 3KW8A 1DLFL 1X9LA 1JZGA 1ZJBA 2BP8B 3IF1B 1WICA 2F58H 2XIDA 1R3IH 2RQ8A 4PTTA 5E2JA 4DFIA 4EI6B 1FH5L 2F74A 3B9KD 5AYUH 5TQ2L 3U48A 4LAQH 1SJEA 4C58B 8FABA 4XPFH 4GXVL 2WCGA 1HILA 4WZ9A 2K3HA 4W1TA 5FGBA 4HJGB 4PJHF 3MNVB 1WG3A 4JY6A 3NJHA 4WW2F 4G6AD 4MMXA 4YSDA 3ELQA 2Z0BA 4UQ2A 1E7UA 3QIUD 2WXOA 5C7ZA 4OF6A 2EVIA 3QZWG 1Z6JT 1GR7A 1H3PH 1NCDH 5TJWK 1FNGB 2VDOL 2ZUVA 3LXUX 2LVCA 2OQJB 1S7QB 2JKTM 3FUEA 4PP2B 3S5LA 4NZUL 4G7RB 3GUFA 3BDBA 2W92A 4Y2LA 1DE4A 1IBGH 3ZVVA 4WKXA 3GXPA 1WFUA 1A4BA 4CKQA 3MX0B 4G5ZL 4EUPB 2BDNH 2HPTA 4QOKE 3BXNA 2WUBL 2HPOA 4XB7A 2G5UA 2QKIB 3NJMA 2BJMH 3NN8B 4N0FB 3QP3A 3IXAB 3L3IA 4OZHB 3V4VH 4HPHA 3K80A 1DUYB 1WC7B 1KB9J 1MCOH 1X6NA 2WSDA 4X7EC 4I18C 4H0HB 4WWPA 4E2OA 2Z92B 3WY3A 4NZTL 5CCGE 2F54A 1FYHB 2GFBB 3NZ8A 4ZSOA 3P9MB 3HAEB 4Y7OC 2J20A 4YE0A 3Q6FB 4CW1A 4GKZB 1BIHA 4RGOL 4YHNB 3AM8A 1NGYA 3DO3A 4YDIL 5ENWB 5B1JA 2NNCA 3GEWB 3O4LE 4I1NB 3HBPA 1J1PH 3JVGA 4AM0B 4KKCC 1VB9A 5F21B 5I9QB 5C0BE 4L8DA 4XCEB 1DBKH 4KK8D 1WAAA 5CJ8A 4I77L 2JVUA 4RFOH 2Q87A 5E8DL 1LL1A 1NOFA 1GMIA 1UA6H 3PREA 1OO2A 2NW3B 1LYQA 1LM8V 3QUGA 4CSZA 1BYNA 4YHLH 1G7HB 4MMZC 1OPGH 5CMAA 2DM3A 4XBPA 1KENL 1I9RH 5LGHH 2AABH 3EAKA 1ZPLA 3HUJA 5TGBB 3QS2A 4AQZA 4B5ZA 2MFNA 2TRYA 1A7QL 1Z3RA 2V4LA 4Q56A 4NHCL 3VI3F 5C0EB 4IU3B 4G70B 2FGZA 3RHWF 3O2WH 1TQWA 3ARSA 4J4PA 4QF1A 4RSYA 3NJJA 2VM3A 3B34A 1SJHB 1CF8L 4YEFA 3CDYA 4X9GA 4F7CB 1YEDB 5T5FA 3CFKA 3WDJA 1F4WL 5LLIC 5AFAA 3K1DA 4LMQE 3GXIA 3GHPA 2B59A 3BKJL 3AT0A 4XH2B 1D9KD 4J3WA 3VI4F 2R8SH 2BFGA 1IE5A 3OJDA 1TF4A 2Z1PA 1QYGL 4UTAH 1U8CB 3RUGA 2GEQA 2Y07L 1E6JH 2HX9A 1NGPH 2YGVA 1NTDA 5DK0A 1JGEA 3MNWA 3VWJD 3APFA 4JQIL 3MBEA 3MRMB 4QOKB 4C47A 3C2AH 3H2QA 4XMWA 1P4UA 1DQDH 2R2HA 1JFQH 2Q2LA 3SJVE 2XV2A 3EO1A 2ROYA 4WI0A 1FE8L 4S0SD 2E9BA 4IJTA 2HH0L 5EOTA 5GJSH 3SGJA 5EU6A 4TS6A 3CDCA 2UXGA 1D5IL 4HVBA 3CCHB 2A73A 3PJSB 1XX9C 4RZKA 1KCVL 1KG0B 2H9GB 1DBAL 4NKDB 4MA3A 5K9JH 1MHHA 3FKUS 3KDMB 3KLHD 3JXAA 3A67H 4PV9B 1EAPA 1SXSA 1UOWA 1HEHC 3BSZA 3MRLB 1I3RA 4M6OH 3RP1A 1OTSC 3RVWD 3O4LB 4ZMPA 2VDOB 3LKQB 1YNLL 1XIWA 4NYLB 5C0GA 5HGAB 4HBCL 5EO0A 4D9LH 4Z0BH 1E3ZA 1CTNA 5AW8B 1LMIA 5C0BB 4U7MA 3VCLA 4G2AA 1CDUA 5DC4B 5AAMC 3HEIB 1P7BA 3H7BB 3NZHH 2X4NB 3IPFA 2EEAA 2MMXA 1XVSA 5IKCA 5SWZD 4WV1C 5FYKH 1VZHA 4OZHF 5D4QA 3D52A 3U6XS 3AG2B 2XZCL 2ATPA 2IOMA 3UIYA 1AC6A 1JIBA 2X09A 5IHHA 2F7IA 1HZHL 1YEFL 3FN0L 3PRZA 2Z3FA 1CLOH 1EEYB 7FABH 2VYRE 4BWWA 1I1AA 25C8H 3B8SA 3DMMA 3TEUA 1D7CA 2DQUL 3GQFA 3EYSL 4P46A 4J27A 5MI0B 4HJJL 3FC8A 3M46A 3HG5A 2GSIB 4F3FA 5DZNA 3VFGH 2ZNWA 1RJLB 2BK8A 3WFEH 5B3JF 1TEFA 4J23A 1MNUH 3RNKB 3ILPB 2YWYA 3O0RH 2DMGA 2KQNA 2X2YA 2GITA 2X2JA 1JZ2A 4D9QD 4YSRA 1U8LB 1R47A 3BKML 1TTBA 1MJUH 2ZAGA 4WDIA 3E6HB 1DJGA 1OV8A 2EIZA 2JKWA 3C6SB 3RZCB 4WCYH 3W2DL 3MA9H 5D7JD 3T6ZA 3TVMD 3BKYH 3MV9A 4XZUA 5HDBE 3LXAA 4UNTA 5D1QA 1XSOA 3ZJAA 1ZK5A 4Z3TA 3PABB 4JM4H 1EVUA 1ZGLP 2Y5EA 3NSDA 2EEFA 1YO4A 2XY1A 1P84J 4YR6B 2DLTA 5E5LA 1DL7H 3M17B 5CZXC 3KGSA 3OX8A 4KPHL 2CUMA 4LLQB 5EORH 3SJVB 3WNKA 4BQ6A 4Y4FD 5E6ID 1RCYA 1JWSB 3AABA 3BKCH 1S9VB 1FCCA 4KK6C 5IQ7H 3F58H 1LO3H 3OLDA 3IMRA 4S1QH 1QVOB 3KGTA 3CFNA 3MLWL 1SOKA 1J86A 1KOAA 1S7WB 3LD8B 3NJKA 3C8HA 1J9TA 6FABH 2N7AA 2VDLH 3KPLB 4IGBA 4Z9KB 5EBMA 1WUZA 5LBVA 3T3MB 2OR9L 4RDBA 4PWGA 3ZTJG 5I1EL 5IW6A 4YFDB 2EH8L 1DN2A 3SB3A 3N50A 1OGAA 2OMXA 2RIKA 2E5EA 3NCWA 2O6DA 3SDCD 1OP4A 3E3QC 2VAAA 1GSMA 3MROA 1PKOA 4Z3IA 5CWSB 2GVYA 4HU8A 1JI1A 1U92B 3QPXH 4P2RA 2WXMA 2WAHA 4M4PA 1GGBH 2UYLB 3MN8A 4FXTA 3FTZA 3NJFA 3QHTC 3QEUA 4HMCA 2QHRH 4X5WA 3WFHB 5CGYC 4KY1H 3O41B 5JHBA 3HB3B 4WI7A 3ZTCC 1XEDA 4JFEA 4AQAA 3MBWB 4W81A 1A1MB 1AHWC 4TPRH 1MCHA 4KUZL 5JW3H 3UXFA 3VFNA 1MLCA 3MHZA 1F4YL 2DQMA 4HS8L 5F72S 2E4FA 4R7XA 2VXTH 5F8RC 3N9GL 1RP9A 4KH9A 1UQSA 2WGNB 4K9EL 4PMEA 1XCQA 1TYJA 3IS0X 2Q3AA 4HJ0D 5JIKA 4YC2B 5JXAH 1IEHA 3F62A 1NANI 1T7ZA 1ES0B 4CJ1A 4OGAC 4B9ZA 3CLWA 4Z95H 3IBOA 5AAWA 3EBIA 5DD6A 3KPOA 2N0KA 1EHLH 2QV4A 2WXLA 2OYPA 4XN5A 1IBHA 2F54D 1RVFH 2RMNA 1NBZA 2DL9A 1XGUB 2N59A 2NUPB 3D07A 4IIQA 5LWYL 4JPVH 2AQPA 5FYKD 1XSIA 5HDBB 1KN4L 3NABH 4MQ7B 3U2SB 3TBYA 1WIOA 3NK4A 1BFTA 2ADJB 2VDQL 3V6BR 3US1A 1WBYB 4IS6A 4MQXC 3QUYC 2FJSA 4FOMA 4R7DA 3ZQXA 4F2ME 2OSYA 4JY5L 4DGWC 5I76A 4K2UH 1R3KB 1RHHB 3EBAA 4MBOA 4C56A 5KSAB 4C4BA 1N18A 1LNUA 1SUJA 4X5QA 4ZNCD 1T83C 4AYFB 4HWZB 3HHRB 2ZUYA 3JWOL 4X5LA 3BAIA 2W07A 1BOYA 1SHMA 4W9EC 5D7KD 4MNGA 5JDSA 1PLAA 1RUKH 4LSRL 4IBQA 3SHSA 2X6UA 4FQJH 1XF3A 1M6OA 3CBJB 4JFPB 1KFGA 5HHOB 2J3SA 3DGGB 5EBWA 4OZFG 5C08E 2X0VA 5JHLA 4TLKA 4C4KT 2NY0D 3HS8A 4I9XA 4OD3L 1GMEA 1U6AH 1HSBA 2VRKA 3BFQG 3LN5A 5FUCC 1OAQL 4P4KA 2B20A 3WLBB 3AZUA 3HG1E 4H1LG 5IK3A 5GRVK 3HPLA 3INOA 4PP1D 5AVRB 3BRFA 3H9HB 3UMTA 1B4TA 3VB9A 3TBVB 1KPVA 1ZVYA 5JTWA 2FB4H 4NHUA 2GBTA 2NY1B 2BVPA 2VMJA 4U2ZA 3T3PB 4RMQA 5E0QA 1LO2L 3MXWL 3U30B 5JHDA 1NAKL 4FQXC 4UAHA 1IFGA 5MEPA 3T0AA 3UTSB 1TMQA 3U46A 4U1JA 2QGDA 1IMHC 4CDHA 1DBBL 3R8BB 3O3UN 5H35A 2WBKA 4TSBL 1V3MA 1YLBB 3EDJA 1QLEH 3LOWA 4PJ9A 5FYJU 2MHAB 4JL1A 1IAII 35C8L 3E7JA 5GSRA 1MI5B 3LNDA 4IRJD 4HLEA 5CF3A 3MBED 2HRPH 5MEOB 3T3MF 5DHVB 2XQBL 4XP1H 4KVCL 5E8NB 2BW5A 1A5FH 2EILB 2D7TH 2WZ6A 4XNMA 4KTDL 3SPCA 1Y18A 5IHWA 1Z3GH 4EQ3A 1LWJA 5EU6D 1D5XB 3PP4L 2L04A 1XGYL 4QXTB 4NRXA 3MRGA 5F97E 5I1GL 3O0LA 3NCEB 3PE9A 3W9DA 4AVIA 2XXFA 1AIZA 1CFSB 5F7BA 1LJMA 2GQHA 3WY1A 4NP9A 2I5YL 5DYFA 1ML0A 2R1YA 1H15A 1QO3A 1YUKB 5GGRY 3EHBB 4GW5B 3FQYA 1UM5H 1F6FB 3INUL 5IVZB 3HNSH 5KTEH 4NFBA 1XIWD 1D6VH 4APXB 1HE8A 2DTMH 2I24N 4K8RC 4UQBA 3F7LA 1H6FA 4KDTC 1KJVB 1BZ7A 2OKMA 1ZA6A 2EXYD 2R83A 4XOBA 2XFXB 5JR1L 2GTZA 5FYLL 1YY8B 4YFLF 5CHNB 3UADA 2ZWZA 2YFNA 2R9HC 4I88A 3TNMA 4ESKA 3VXQA 1FF5A 2ILLA 4PS3A 43C9B 2VXQH 2ZP9A 1EH9A 3LNFA 1RJZA 1JXJA 2EZ0C 4TSCH 3QZWB 5C0AE 1BQHA 2ZF8A 4HIEB 3T1FB 4HSAC 2DOCA 4KQ0A 5J89A 1E5BA 3AROA 3BWUC 1U36A 3M7FB 4E9QA 3DRQB 2W9EH 5C08B 1NOAA 2HAZA 3TJHC 3T3ME 1I1AD 4F20A 5DRZB 4GRWH 5HDBF 1ZKAA 2VJ8A 2BZCA 4QXVA 3CMOH 3OVUB 1EO8L 1PY4A 2OS7A 2QEJA 3K81A 1NJ9A 1GZPB 1NMCC 2VDQB 4G9FE 3I84A 4JY4B 5CR8A 3BUIA 3QXAA 3FQXA 5ILTH 2PPAA 3RRQA 1IAIL 4Q4IA 5IHUL 2FGWH 3F2LA 3OJ2C 4RFEA 4FQQB 2FBRA 3EYFB 1MCEA 3EADA 3WFZA 3KBHE 2IBBA 3VWKB 2EP6A 3ME0B 1MFBL 1CGWA 3MV9D 5FYLE 3WIIH 3ZBMA 4AXWA 3WEOA 4BFFA 5EZJA 1T22A 3GUTB 1E4XI 4HMEA 2JI2A 1YVLA 3FU5A 3QUMA 5I8KL 4QKTA 4UINL 1PLGL 1KB5H 2ZCKL 1OCCB 2ZE0A 4XMKL 1TITA 1J1OL 1PAMA 3TZVC 4LF3A 3FOMB 2ZG3A 5BRZE 1AO7A 4BKSC 1KBGH 1ZLWK 2BIOA 3OKOB 6TAAA 4LHJB 5DWUL 1WA0X 5DHMC 4NIYE 4N9GB 2TAAA 1L5GA 1L9QA 4F27A 4J3UA 1XAKA 2P45B 4YUEL 3HFML 1DEEA 1FZMA 4KNUA 2NXYD 1I1YA 4R8WH 3T9WA 4WVRA 4IGBD 2HG0A 3WTYA 4GBXB 4MLIA 5C0RL 1OTTC 1P4IH 2Z4QB 3C5SB 2DQFB 2X3BA 4V11A 5HGDB 5T1LA 1OGAD 3MJ7B 4F24A 3SY0A 2OULB 4YAQB 2IDFA 1KFAL 3UGXA 4P05A 2KT6A 2VR7A 3ULSB 1DBML 1CE6A 3HG4A 1JPFB 2GJZA 4Y9EA 1KTJA 2X1WL 1T1WA 3D4GA 1TETL 1I1FB 2ENSA 1T6WA 4MJIE 5HDLA 4Q97A 4DP2X 1JGUH 2W1NA 4MASA 5HSFA 2YUWA 2J2ZA 1EO5A 1JN6A 4ZUTA 2FK9A 2UUDH 1TG8A 5C0AB 4DW2H 2UZXB 1NGWA 2FNBA 2E74C 1PIGA 2H0EA 5EPMA 3GMLB 4FCAA 4A6YH 4PY8I 5DJ2A 3RB5A 3PPEA 1G1OA 3QFJD 4H13C 4WLCA 3QAZC 1BFSA 5F2FA 2I07A 3U0WH 1KT2B 5IEHA 1A2YB 4HULB 4KDWA 3X11B 3JWNC 4FP8H 4OV6F 5F1NB 3PIQA 1JHTB 1OPOA 5IUSA 2P8LB 3QDHA 1UWYA 4F7EA 4FKKA 3A3YB 4G8FA 4H44C 3UTOA 1HI6A 4FJYA 4UILH 1NFDA 4KO6A 5L2KE 1E4XL 2PO6B 3BZEB 4BZ1A 2ATAA 1U8PB 1VPOH 3BVNA 4NC1C 4R0LB 2OBGA 2JI1A 5EZIH 3BQUD 1Q9OA 2XWDA 2Q7NA 3MJWA 5KSUA 3K6SA 1PKQB 2CLVA 4QHUB 5KYNA 4CU8A 5BVPL 3SKNB 4F33B 2E7LC 4EN2A 3QXDA 3H9SB 4ZG1A 4HFUL 2JXMB 4DAGH 1QQDB 5FV2A 4P9MH 1F42A 4ZOAA 4KKBD 5M95B 5ADPL 4OCMC 5F8QC 2BVUA 5DD5H 2BZDA 4L8CB 4C56D 3PGDB 1H8SA 2PXYD 2QT6A 2EDJA 3FCTA 5BRZB 2RCSL 4LSUL 3GMQB 3IN0A 4AQOA 3PWUB 4X0NA 3LKPA 4YDVB 1PFOA 4L37A 4HOZA 3NCYP 4WO4A 3W0WE 3HVNA 3DJRA 3CZJA 4G42B 3UABA 2C5DC 4HUUB 2K3TA 3MREB 3B83A 4NUJB 2CNYA 1QHOA 3SDXB 5FYKU 4AG4H 4EOWH 3GXFA 5E6RB 4X6DE 4U05A 4ELDA 4F1ZA 5EHFA 4X8CA 4F58L 2C9PA 5LXGL 5F1IA 2JCCE 1F4XH 3NFNA 4MVBC 3L45A 2WNGA 2GC7C 2IG2L 4OSUH 5FWQA 2CO1A 3U9PL 5JW5B 1KXTB 2NY5H 1H5BC 2TSAA 5DJDA 3PJLA 1M05B 3KPPA 1WUNT 4OVVA 3FNKA 4GQ9L 2FHBA 4CKVX 3WFBH 1J8HD 4YSOA 3UOAB 4DOHB 2IAMC 2P24A 4R96B 2Z7ZA 4MJIB 5I17B 3PHAA 4JFDD 4O02H 2WUCL 1P9MC 2QSTA 1B0WA 4I18B 1BD2E 1U41A 4PN6A 3G5VB 3JV4B 1PS3A 1JF6A 2AQ2A 3MC0A 3ARBD 4GRMB 3VD9A 4AGMA 5DVLA 3ECUA 3U7YL 2W60A 4FG0A 15C8L 5EOCH 1LEIB 1XSKA 2WYIA 2YAMA 3RYMA 4PJ9D 1SOQA 3O6KL 4JQXC 1UB6B 2X88A 4PRPB 4XP5H 4UOQA 4MXWH 2AJ3B 4DP5X 1WITA 4Y2DD 5F96H 1JNLL 3HZKB 3GEFA 4ANVA 5EU5B 4X6EB 1ODAA 2APWA 5FGSA 4XC3H 5BZWA 4UIMB 1M9SA 2CM6A 4U6YB 2EVFA 1M4KA 3ZMNA 3O45B 1CT8B 1U93B 1SYVB 4MMZB 3VJ6A 5E24E 2OYMA 1MCJA 3BSHA 2ZSWB 3FFDA 5DS8A 5E94B 5GHWH 1WH0A 1NBVH 1T1YB 1W6LA 1I7ZB 2FJFB 3HI6H 4TQPA 3ARXA 3ESNA 4UT9L 5GZOA 5I8OH 2PYEA 4ZO6A 4M7ZB 4U2YA 5JW4M 2EQDA 1PTZA 4M61A 4U6XB 4NSKB 1W0WB 2HVKA 3MI6A 5DZJA 4JDEB 4HU2A 2FJHA 1AZRA 3IJYA 3TO4C 4NEHB 2WWOA 5GGTH 3K8MA 2F15A 4G82A 5CD5D 1EZLA 5GGSB 2BNUA 4BZ2A 3B5HA 4I2XE 1S8DA 3MNDA 1INQB 1G84A 4N2DA 1CDIA 4PREB 2VN4A 3W0WB 4Q2ZA 4P3DA 2IANE 4K3DL 3Q1SL 3GSOB 2RFXA 2ZX9A 1CXLA 3VDCA 4X0KA 2DQCL 4JHBA 1KYAA 5DFTA 4BFJA 1YEEL 4X6DB 2OL3L 1QSED 3KR3L 1ECZA 2ERJC 3KW7A 4TUKH 3HC3H 2JCCB 3O2DA 4P3CL 3B4NA 3QVAA 3T4AC 1HE7A 4XXWC 5KWYC 3C60B 4LEXL 4Z78A 2J6EL 4KMTL 4L8SA 3OKMA 1V7NL 1C16B 1UJ3B 2XUWA 1XTMA 2XPYA 3X1EA 1K9TA 1OAYH 1WCQA 1P6WA 2BSEA 5A3IC 2BSRA 1MLBA 4PLNC 4LLDA 4JO2H 3V5HB 5J56B 4OB5L 4TQEH 5CZKA 2EDFA 3QFDA 4XN1A 3O6FC 3L4XA 3L16A 2QELA 1PYWB 2YA2A 5LGYA 3EOAB 3FT3A 2D4FA 4Y4HD 5AZ2L 3V5DA 1U8NA 2E8ZA 2NUTB 3OAYK 4GS7C 5HYQA 3QORA 4TNFA 2WWNA 1UZGA 4P2OA 5E5UB 3AXHA 4BFIB 3P4OA 3E8UH 5HJBA 3JWDH 2XWEA 1B4LA 4PJEE 1E4KC 3PNWB 5BOPA 1MCWW 4LCYA 2FHCA 3QRGL 5CJ5A 3H6AA 3QNXB 1R3HA 4UIKL 5HYJD 1KIUA 1AO7D 1DO6A 3AREA 4NO0A 3QIWA 1ZANH 2ZX6A 3E3QE 5KG9B 2Y9RT 2ZOKB 2PP8A 5DC0A 3VD3A 2BP5M 2CLZA 4LDEB 4WV1B 2G9HB 1A0QH 4Z77A 1L9SA 3N0PB 2A0LC 3KPNB 1ZHBB 4E5XG 4O51A 2H45A 4JN2B 1UWXK 4TUOB 2IWFA 3D3VA 3WHXA 4A2GA 3RDTC 2CR6A 4KAQH 1ZS2A 2J1KA 1A25A 5E95B 4IRZH 4CILA 3EFOB 3LDBB 2Y2YA 1AXSA 4H8WC 4ZQKB 3RIAF 3VFSB 2PABA 4JJ5B 5KUKA 3UZEA 2JK5B 3HW7A 2O6PA 4Z7OE 4I2XB 3IU3A 3OR7A 1SMAA 4QRRB 3T0WA 3GMMA 4FFWC 4GAYA 3WHE0 1IGJA 2QSCH 3MPCA 1NIEA 2IANB 2YBRB 2WNKA 3MLTB 5HD8C 2AVGA 3C5JB 2G2NA 1NA8A 2G3ZA 2HFEA 5KOVC 4FG6D 5IBLD 5E6UB 3S4SA 3BD4A 4DQOH 4X99A 5DJ6B 2YA0A 2EIBA 2RAMA 1S7SA 4LPCA 2PW2B 1HOCB 5G5DA 4YXKH 2PNDA 2OR7A 4PJDA 3DURA 2Y24A 3D18A 1A64A 1X4ZA 5LNEA 4XNDA 4Z7IA 4JFOA 1W0VA 4AMKL 2ZOWA 4TMPA 1N59B 2I9LA 4HIQA 1WHOA 4I3GA 1EMTH 4G7VL 1I8MB 2AMUA 5JORA 3RBSA 5F3BB 1ZS8B 1UATA 2ZKWA 4ONGL 4ZD3L 1GGCL 4NERA 2QQQA 3TESA 1FZOA 4P2AA 1CLYH 2LFGA 3LZNA 2HT2C 4ZTOH 3GF8A 2CIIA 2ZSVA 3FUFA 4I3RH 2Z93B 5F7AA 4Z3JA 5D1XA 1E67A 2GY5A 4HK3N 3RI5F 2Q6WA 2Y5QA 3VXSE 2HSIA 5FUOL 3WAKA 3V4UL 3JV5A 3IDXH 1NICA 3D08A 3WIFA 3I3BA 2YD8A 1U58A 1XB3A 4MA7L 4PJEB 3CG8A 1WCBB 3QDJD 1PLBA 3TWCL 4HWUA 2R0KH 4X6DF 4JRYD 4X6CE 5FKAA 1YQVL 1U8HB 1RZJH 5FUCE 3VW3H 5B1CA 2JCCF 3Q01A 2OL3B 4A7QA 4QEGA 1N67A 3BQVA 3QCUL 1F6LL 1AI1L 2C3GA 2F1EA 1MF2L 3V7MA 2NLJA 2YMXL 3QR2A 3R1GL 1RZGB 4DEPC 2DYRB 1MWAL 3V4LA 3JZ7A 5F1OB 4WO4D 2AKRB 1NCWL 4XO9A 4ZOCA 3K5SA 4AUYA 1L0YA 3WYRA 3LIZH 4K8RL 3VXOB 3L7FA 3HI5L 3NRFA 1I8AA 4JJOA 4ZMLA 3VGBA 5F6IC 3GI9H 4GUQA 5F9OH 1MCNA 4BFNA 2ZXBA 1AS8A 3TJEH 5IFJB 4JDVA 5FK9A 1INDH 4PV1C 1Q9WA 3TA3D 5EV7A 3RA7H 3G6DL 1VIWA 4P48A 1RFDL 4J3OH 4QPEA 1Y1DA 2CCLA 3LSOA 1I85A 1VCAA 3PHQB 3IFOB 4B9PA 2EXWD 3O3EA 5SWSB 4G7YH 2DWXA 1DHKA 2D03H 2V17H 1E5UI 2YQ3A 2GJ6E 5E08H 2WQAA 3EJUA 3BMWA 1EZSA 4OLXL 4QTHB 1KPUA 3I3EA 4Y4KA 3MODH 1T4KA 1XF1A 5JW4R 1HZKA 4OLVL 3VFOB 3ULVD 3L81A 3B5TA 4F2MA 4S1DC 2BVQB 2DD8H 2DTSA 2VDPH 3L54A 1S9WA 4Q52A 5I71B 4X5XB 4L9LA 5EC2B 3GRGA 3RNQA 4N20A 2AQ1A 3AVEA 2WVTA 3QEHA 1NCBL 5E2UH 4EI5B 3ILEA 1LLAA 3S97C 2XWRA 3MXVH 1FHGA 5KW9H 4NWTH 4XCCL 2E6JA 2R15A 5DJ0A 4UMSA 4EDWL 3X12B 3SKJL 1A7OH 1NUFA 3CNKA 1I9JH 4QLRA 1Z66A 3BEWB 2YD3A 4AENA 1UCBH 4IU2A 3RG1C 2P3YA 4M93C 2A6JA 5EO9A 1HEJC 2D8KA 1NDGB 1CD1A 4P04A 1S7TB 1CDBA 5KYYA 2WTRA 1RERA 4TVPH 2PMZA 2I9TB 1YEKH 2PYED 1K72A 3BP6A 3C8KA 3KLAA 4S0HA 4X98A 4WY7L 4FS0A 5FHAL 2BIMA 3HBQA 3S3JA 4LHUD 1HJCA 5B4MD 1AFVH 1R3JB 3LKRA 2XT1B 4FXKC 4Y1AD 3AWEA 4J2QA 3DO7A 4HIXL 3OGCB 1F00I 4PCKA 1X5ZA 4R84A 2LT9A 2FX9L 2WINB 5E8EB 2XKNA 2OA9A 3BESR 3QHFL 4MZRA 5D9SB 3DIFA 1FV1B 5DF0A 2C1OB 4WJ5B 2XICA 4KHXH 4UTCA 2O5XH 1ZVNA 4KJWD 2YD9A 4LGPB 3D33A 3BIKA 1P69B 3CFEA 1BJ1J 2QZ5A 2CH8A 4I0PB 3BWSA 4PLJD 1NL0L 3F04A 4MD0B 4HJEA 4UTBH 2NZ9D 5JA8B 2ZXAA 5J6HA 1KTLB 3V95A 1Z9OA 4ODTH 4HHAA 3AQYA 1S7RB 2WJ5A 3LS5L 1Q9KB 2Q1EA 3BGFB 1U3ZA 3MR9B 4K7PY 4XWOD 4PJEF 3SPIA 1YG9A 2ARJQ 2ZOTA 3DVIA 3FW6A 4NO5A 1T2QL 1AGFB 3BN9D 3KL5A 5FM5M 3BT2L 5I1LA 4AL8C 1AXTL 2W0PA 1FRGL 4PJ5B 3EJZD 1GSKA 3CHSA 4FNSA 2K70A 3MGTB 3KDPB 1KTBA 1ILUA 4WFFE 2FR4A 4PIRF 3RJQB 5TE7H 4P2OD 4PD4J 5D93B 1MWAB 1PJ9A 1R5WB 3EJTA 3MGOB 1XL6A 4TN9A 1KYFA 3GINA 2XN9E 1Z9NA 1QI4A 3FRUA 1XZWA 1QR4A 2BIPA 5CIPA 4N25A 1H3PL 1GVIA 3B2UC 4F9PA 1IL1B 1NSNL 1HHGB 3QWOB 1FDLL 1IVLA 4JZNB 4X7FC 3ZTEA 4DKTA 4Z7OF 1NUGA 4DCQA 2PWGA 3REVB 1MFMA 3CZGA 4A7GA 2V7NB 3SKOB 3UPAA 5C2UB 3RVVC 3VD7A 1EXGA 2ZTBA 4LVNC 3GIVA 3D3VD 2G4EA 2BDNL 1UACH 2XTJB 3CN0A 4G9FA 1BZ8A 2DM7A 1TQTA 2IOOA 5LBSA 4XPTH 4ZRGA 5GS1C 3DX8A 2N1KA 4B3VA 5CINL 3QIBD 1YNTB 5DQDL 2BJML 3JWNE 2OMNA 1MREH 4OZ4A 3D25A 3FBQA 5DRXB 1MOEA 1ERNA 2DEXX 3GMPB 4TRPH 1HC1A 3GXMA 5K9KA 2F0CA 3MU3A 2Q7YB 1V5JA 1AD0B 2DQEH 4GSRA 3H9YA 4X9BA 2I27N 4NC1E 4PJGE 1RJCA 3DUUB 4M4RB 4WEEA 1K3IA 5E1AB 3WTTA 4LVHB 2CGZA 3R06B 4N6RA 3I6GA 1LEGB 1XF5A 1K8IA 3F12A 1MFDL 1UEMA 3DO4A 3QG6B 4HOWA 4QUOA 4DGYL 4FABL 3MUZ1 3CIAA 2B9AA 2E46A 4P5TC 4UU9B 1FVEA 4X9FA 3QQDB 1DBKL 3UJTL 2DLFH 2NY7H 5D6CB 2XFGB 2CNZA 1VHPA 1B4JH 4XTRD 3DJTA 1NC2B 2NNAA 3ESOA 4ERSL 3SDDA 3GSQB 2QADC 1RZFL 2Z8WC 3MRCB 3TZVB 1G7IB 4QT5A 4X6CF 3UGEA 2R0ZL 4MD5B 2A77H 1VERA 4YHLL 3C5ZD 3VRLF 4N2MA 5KANG 1I9RL 2AABL 2H8PB 4IOIB 1KCRH 1OK8A 1ZE3C 5D1XD 3LXBA 4NRZA 3MAWA 3BGAA 1LQSR 2WSKA 1BV8A 5ABDE 3JQOB 5B39B 3WNMA 1CFVL 3EH5B 1QA9B 1Z7JA 3DVFA 3QQXA 3ALWA 4XP9H 2XN9B 2OTWA 5DUMH 4EE2A 5C07A 5JOFA 4HIHA 3K72A 4OIIH 4LPUA 1F13A 2NTFA 4PSRA 4HFWA 4XCYA 3ARDD 1H8NA 1QUNB 4M43H 4QJ3B 5E1GA 4YHYC 4JG5A 2AJYH 3MYZA 3IU4L 3ZU8A 1TQBB 4JG1H 1MHCB 3MJ8B 5JZ7D 4GRLA 5HHXH 1J5OL 3K3QA 1U8IA 3T77A 3F5WB 3UTZB 2AXHA 4M1CD 4UTAL 2FWSA 1C5DA 4P2QD 3IFLL 2KZ1B 2AI0L 4XPAL 2XIIA 3HRZC 5KVGH 1PJWA 1S78C 3WMPA 4XMLH 4N0CD 5A1AA 1SDDA 4IRSD 4RGND 1E3XA 2APVA 5J1TC 2VQ4A 1FFOB 1BM3H 3O3DA 4FFZH 5I0ZA 3C2AL 4Y2OA 3GMRA 4C4UA 2FAUA 4FULA 1PF3A 3V9FA 5C8JB 1JFQL 4G8GD 4GXUM 3O11A 4OTXH 4GAGH 4X7SH 4HIIB 4UB0H 4E41A 3OKLB 5IIEA 2EO7A 3HPJB 3M1BB 1T5WB 4R2GD 3ZQWA 1G6VK 1XXDC 4NPJA 3CXDL 2Z31D 4H5SA 1DVXA 3UTTE 3VX1A 3ZUCA 2XN0A 4Y4KD 1I8LC 2XWBA 4PJBB 4NKOA 2WLYA 3NK3A 5E51A 2B1OA 2J44A 4H20H 3QZLA 4LLVA 1ITCA 4PLOB 4R83A 4QY8B 5CSBA 4DO5A 2X4UB 3HKZA 3A67L 3BWAB 4MWFA 1XR9B 1EBAA 2JQAA 3ROOA 1NEZB 5JLZB 4Z0BL 5FXCH 3HE6D 3KS0H 4TTDD 3DWTA 4BH7B 3LRSB 4YNYB 3EF4A 1IAMA 5EG6C 2X0WA 3UG5A 5CD3A 2P5WB 1G7QB 2Q76A 1UVQB 4CNIB 1VJSA 4R4BA 2C1PA 2WOBA 2ZIDA 2HFTA 1F3DJ 5FGRA 1MRFH 1GW0A 1R19A 3EFDH 1YNTF 1G7LB 1Z0NA 5TPWL 3P4MB 2BNQD 2AJXH 2W81C 2GIMA 3V4VB 3KPSA 4U1LB 1CD8A 3ZKMC 3BPCA 1YMMA 3EOBA 3KPRA 4Z23A 2Y3NA 2ITDB 1OP5K 5CILL 3DV4A 5MHSD 1IAIM 1WYJA 3EYOA 4GMTH 1BBJB 2B2XL 4GP8B 2QV2A 3GJFH 2GI0A 4LSTL 3FTUA 1CYWA 1KNOB 3GSUA 5FFOA 1YJDC 3TURA 2E9JA 1BFVH 1H5BB 5D7IB 4AYDC 3O0RL 1BD2A 1S6NA 2DH3A 3DXAA 1Q72H 1ZT7B 5DEFA 4M8RA 3LQZA 3SZ6A 2VITB 2A9CA 1T66C 5FO2A 1U8OA 2IAMB 1JDAA 4WU7B 4Q74A 4K7PX 3WI9A 5J1AA 2P7TA 1ZLDA 4CDGC 4DVBB 1NC4B 1AJ7H 4H8WL 1T3FB 2JKRM 1X5MA 3RFZA 3DBXB 1EHKB 2WIIB 4MX7A 4RA3A 1YDPB 2VUYA 4YEEA 4HPYH 4OZGA 3EGDA 2PWHA 5CFAA 2FZ3B 5HJ3B 5D1ZD 3C2SA 3NIFB 5B38A 2X6VA 1TJMA 4Z7VE 4H7VA 4JK0D 2QR0B 3I6SA 1CG9B 4GLRI 2GSGA 2PCPB 3LTVA 5IQ7L 4Y16C 3F58L 1VDGA 1LO3L 3UO8B 3CDZB 1JTTA 2YJLA 4K07A 5HYFA 4S1QL 1UYWL 3IDJA 5CEYB 2OZNA 3U9UA 5KBNC 1D3CA 2ETWA 2VDLL 3VGAC 1JVKA 3EO0A 4NQDA 4FYTA 5I1HH 2HJFA 2V9UA 4PYHA 3FO9A 2GB2A 4NQEE 1UM4H 1S9XA 1KPRA 3CVCA 5IBTL 1ICTA 3V2AR 4UQAA 2O30A 2XQYK 3MOAH 2PCFB 1PZCA 2CKBA 2VRQA 4QTIL 2J7LA 4OLEA 3PUCA 1JHLH 4Y8AA 3UDWA 5ICUA 4PRID 2WAQA 3CFJA 5EFIB 3CZNA 2O61B 1XMWA 2XWJB 4JKKA 1WSST 2CXGA 1GGBL 4S2SA 1OP3H 5M94B 3IE9A 3ES6A 3RWHA 1AGCA 2O6FA 2R29L 3C09C 5IROA 3H8NA 5EF0A 3D1MC 4QRTB 4X4YB 1MJJB 5BNXD 4JZOA 2ZCLL 2IBZY 4KOBA 2ITCB 5JW3L 4PJGF 1VFOA 3NPSC 5HYSB 4CUCA 2ERJB 3TPUB 2VXTL 4XO8A 3SE6A 1ORQA 4R5VA 2NDGA 4H8UA 4U3SA 4JR9L 5DJCB 3T4AB 4HPOH 5BV7H 4KXBA 2P1YA 4QRSB 2JLLA 2GIYA 5FO8B 4ZFOL 1I4FA 2X5PA 3VFWB 4Z95L 4PTUA 3I75A 1TTCA 4FQ1H 3DSFL 5DMYA 4P06A 1SMOA 4BUHA 4HEPG 3X3FH 4BKLA 3NCCB 3QNZA 4F2EA 1J9CT 1RVFL 1TVBB 4QCIA 3BEVB 4JDTH 4NT6B 2AJVH 4R26H 5MP6H 1ZTMA 3RE0A 2WOYA 4B60A 4WRLA 4EN3B 3O6FB 4ODWB 1XO8A 3MKGA 1SBBA 1RUPH 4AJYV 4AQEB 3CN4A 3L2LA 4HCRL 1TOXA 3U4EB 4LQ1A 3KPQA 5GRVL 1JNNH 5IQMA 5D7SL 3O6ML 4GS7B 1QSFE 3EZ8A 4NO2B 1B0RA 1I8IA 4K2UL 3SDAD 3HA0A 4HIJB 3GHEH 1IBYA 3GSWB 3CFIC 4ISVA 1CGYA 4FRWA 2NY4D 1YN7B 3J27A 3SDDD 4BHUA 4GAJH 3OF6A 2MRYA 3ZZ1A 4HUKB 3S36H 2R2EB 4M1GH 5D7IF 5IG7A 3D7PA 4OFVA 4Z7NE 1D5RA 5EN2B 1WD8A 2FSDA 3ZKND 3O8XC 1AHWA 4K3EL 4UBDD 1VACA 1NMBL 1GY1A 5CJXA 2EKSA 3T8VA 3L3HA 5JPMC 1U6AL 4LOFA 4NQEB 3BLPX 2NX5B 3RGVA 4LCWE 5KS9E 3IJ8A 4ZQTA 1EJFA 3GBLA 3ARFB 4Q7DA 2Q8BH 4G8AC 4IDJL 1CDGA 2BSSB 2ZWYA 1QHPA 5DI8A 2I32A 2GJPA 3KM2A 3RWDB 3WUWB 3TBTA 1LE5A 2A9BA 2FQFA 3ULAB 4LLYA 2RACA 4PRAA 4GRLD 3SDYL 4CL7A 2EE6A 4JRXB 4L3EE 1F1GA 4Z76A 1XH2A 4G8IA 4CJ0A 4HIPA 2NYYC 3ZHDA 2GBVA 3QB7C 3BOVA 1AMYA 3QUYA 4FA7B 3OSKA 3BAWA 3L5HA 3I2CH 4XC1H 4W93A 3DVNA 5GGVH 5LQBH 1IUZA 4F37K 2DDQH 3HCVA 1CI3M 3KPMA 4AVHA 4LSSL 1FFPB 5J9PB 2CU9A 2VDLB 4PJXA 1FZJB 1N3NB 1UOKA 2VB5A 3KBFA 5I28A 1RUQL 1A21A 1KJMA 4PRHB 3T0ED 4TUJB 5KYUB 2GUOA 2YKLL 1UT2A 1GYCA 1GXEA 1O5PA 1OKEA 3VXSA 2WYZA 4K7PH 1NFAA 3VFMA 3MRBB 4U0QB 2I69A 2SEBB 1NLBH 4D8OA 1NZRA 1B0IA 2A6KA 1L0XA 4QRPD 4F2FA 2OX5B 2DQJH 1G6RL 4OM0H 1JPGA 1QSFB 4NJ9L 4J3SA 4DZ8A 2YAQA 5CP7A 4QO1A 1UD5A 4KI5C 1Z2KA 3S96A 3X14A 4YHML 4U6HA 4XXDA 4XN9A 1NUDA 2CPUA 1S5IH 2PWEA 1T5KA 1T0NA 3CUPB 4AL8L 3MLZL 4HKJB 5CJQH 4KXZI 2EINB 4ADIA 4AYEC 3MV8E 2A3TA 3N5AA 4JG0H 1E9PB 1JZ7A 2XJLA 3OXRA 4FADA 5ACLA 5KN5B 3SPVA 1FPTH 1LO0H 1KTRL 2G0LA 4NN5B 4Z7NB 4PUBH 3W9EA 4ZFOB 4DEPB 2ZKMX 4HS3A 4NENA 3N42F 3KPSD 4BK5A 5MEND 4WU5B 4GSDH 2GK0A 3VGGA 5I1CH 3FQUA 2YD4A 1IM3B 1YMMD 2IDCA 3AXLA 3G04A 3JTTB 3K7UA 3KPRD 2JKNA 3O4OC 5L6YL 5DS2A 5DMGD 4WNQA 3TEXA 3RVTD 2MCG1 2W65B 3HMXA 1A7NH 5HHVH 4WI2A 3RPIB 4I5BA 1YCSA 1DQLH 1PD0A 5E03A 2YQBA 2G30A 4QAMB 4ODUA 5ECJE 1VENA 3DXAD 2G2RA 2WBJC 3MLVH 3PQYA 2FGWL 2JKXA 4FLRA 4Z7VF 4HX1B 4XE5B 2JJWA 1MY7A 3CHQA 1UURA 4U3HA 4Z3EA 2YK1H 4L3EB 1QRND 3CVHA 3TT1H 4QRQB 3WIIL 4X50A 4CMHC 1YN6B 4Q9RH 2J8UA 5GISH 5DSCB 3SO3C 4NGHH 4HKZB 5AW3B 4HGMA 3JV6B 1KB5L 3PAUA 1WZ1L 5I73C 1TZIA 5DQJA 1KF9B 2E9GA 4P23B 1ASQA 2RGSA 1RK1A 3CH1A 1DZBA 1YHPA 2Y5TB 3FTVA 5DEZA 2WKOA 4ZOEA 4LEBA 4DERA 2DEYX 4DGIH 1KBGL 3B56A 1WVZA 3D6GA 4PJ8D 3DBSA 4K5NA 3MO1B 5D2NA 5IMMA 4HUMB 5T5NF 4W9KC 1KYUA 1CWVA 2X6AA 2COVD 3TBSB 1FVCB 2PW1A 2YRPA 1KYOJ 1BQLH 4XCNA 3FRPB 1IGFH 3BO8B 3K0WA 4J8RA 2AFNA 4I4WA 5GQBA 4OZIA 2H2PD 2NY3D 3TBCA 4D0BA 4Z3HA 4NN7B 2DI8A 1GJIA 4OKVA 3US0A 4XODA 4LHUG 4IOFD 1DUZB 2XI9A 3NEEA 2IBZX 3ATBA 2VQ1A 3SOTA 4Z7WA 4FXKB 2Q86A 3NCFB 2BIIA 5TE6H 4D3CH 3NFSL 1NIBA 4HWEL 4ES9A 3EJQA 5IR1A 5B1KA 4HT1H 1NUNB 2ATKA 3STZA 3CVIH 4AUJA 3QDMA 3KWWB 1J5CA 3SQBA 1BF5A 1J9RA 1HXMA 5LB1A 5DRWA 3IETB 1NAMH 1Q9LA 1CFMA 2ZXQA 1XF4A 3FZUD 3WIAA 2PTUA 9CGTA 2R0WL 3FFCA 2M83A 4JG9A 4QIRA 3K46A 7CGTA 4N8PA 3U0WL 1ETZA 4DKEH 3D0AA 1A9BA 1FHNA 3DPBB 3S8GB 4JFTA 2DJUA 2LR4A 5HHNA 1BXXA 4EPSA 1CR9L 2ICEA 2MEJB 4YJZL 2QFRA 1IT9H 2Y1YA 3LHPH 3QQ3B 4JFFD 1B2WH 3RX7A 1G6RB 4RAUB 4FA6A 1ADQH 3ARGA 3L9EA 1TTFA 5D7LA 1TSRA 4JZJA 3Q2LA 4O2EB 1F58H 2WN3A 2V6HA 4AQ1A 2CA4A 4G6AC 2GAZB 4MSWA 3QIUC 3GSNH 1QKZH 1MUJA 3MTRA 1CICC 2VISB 4YWGH 1HDMB 4FNUA 4NO3A 2ZNXA 4PJFB 4Z7NF 3I3DA 2XWZA 3OPZH 2HVJA 4UNUA 2H32A 2XZQH 4S1RL 4H88H 2W9DL 1FGVH 4S0TD 3S6CA 5DD5L 4X6FA 2DMKA 4AZ8B 3FU3A 1UUSA 4GIOA 4TYUA 4JM2B 5J0BA 4J3OG 1MQKH 3C5XA 4MLSA 5GJTH 5KS9F 3RWCB 5ICYB 1Z5LB 3U1PA 1RZIB 1IIIA 4PSPA 1OGTB 1PX3A 4JGUA 4YLQT 5ESVB 1BGXL 3OF6D 1TTAA 1AP2B 5CSZA 2BP8A 2EE0A 3RL1B 4HUXB 3BAXA 1F90H 1DFXA 2ITEA 5DD3L 1RK0B 3GKWH 1N0XH 2XKSA 3BUYB 4WTZG 1F4XL 2AF2A 5IHZB 2E7HA 5T33H 2IIJA 2V5SA 3QA3B 2BSTA 3NJLA 2NY5L 3SYQA 3NA9L 4M7KH 4E9TA 5F3FA 2OK0H 1FNEB 3A5VA 3GS0A 3GT6A 3WFBL 1P7QD 1JF1B 1WEJL 1CLZH 3WS3B 1E9QB 2A83B 2F18A 5GS1B 3ABMB 3LQAC 4RDQF 5I0WA 4X4ME 2DYPA 4XPGH 1KB5B 4KWUA 5C0IB 5LCVH 2AV1A 5A2IH 3AU1A 3Q2VA 3T2PA 4UWQB 3ET9F 1S7QA 3PWVA 3G5YA 4PP2A 4ODBD 3S3DB 2F53D 4KZ0A 2VR5A 4LB8A 3AG1B 2FATH 5EOCL 4U4IA 2FL5B 4KROD 3APDA 4EUPA 1C12A 4LNRB 3TL5A 2NPLX 4WSJA 4AGPA 4MXWL 1R5VB 4F7MB 3UAJC 2HN7A 1LD9A 2QKIA 2WO4A 5F96L 4AW7A 3IXAA 5DR5L 3CFUA 5ALCL 1P1VA 3OC5A 4NNYA 4M7LT 1WTLA 2IGFH 4XC3L 3PDGA 5IJVB 1DFBH 1TJIH 3CZFB 4WUUA 2DWEB 2E6QA 1NCGA 1A1OA 2QADB 4MMYB 5E99H 5FW8A 2GFBA 5I6MA 4YE4H 5ABAA 2XSKA 4HW6A 2XC8A 1JERA 4KJYA 4P2CG 4OKDA 4RH4A 5DS1A 3D06A 1BVZA 2EUWA 4FF9A 5C2BL 5B8CC 2HLAB 2YC1A 3HI6L 4NC0B 1IGIH 5KZCD 1D9KC 1A3RL 3PGFL 4E9RA 2ODIA 2IQ9L 4BINA 3IDNB 3WD5L 1HL4A 4AM0A 5KBLA 1U3JA 4HJIA 4UDTB 4XO4A 3UTPD 1BF8A 2IFFL 5I23A 1FL3A 2ZOOA 1CLVA 2G75B 1RV6X 5I8EA 1JYWA 3WLWC 2NW3A 3X13B 5J4MA 2ZKHH 1QLFB 4IKNA 4JB9H 1G7HA 3FU0A 1DBJH 3C12A 4N28A 4YHYB 4ABVA 2L0DA 4YQXH 3VGFA 4Q9CA 5AOZA 1I9EA 2LAAA 4PS4H 5IBUG 2IV9A 5JPNC 4XVOA 2YRLA 5FDWA 5I0VA 4BFKA 4TUKL 3WJMB 1M7UA 2ZP8A 4MHHG 4UZSA 3IKCB 5C0EA 3N2JA 3FCSB 2WBWB 3KLHC 3QUXB 5GS0H 1PGRB 2WLLA 4G80B 5FA4B 3D69B 3E6FA 1I7RB 1BA9A 3RVWC 1X7TA 1NGXB 5FV1L 4C59B 4L4TA 4W68A 2ZG2A 3OL2A 3VMOA 1TPXB 5CLTA 3N0AA 1CGSH 1UG9A 4JO2L 4ZAKB 3ZSSA 3M6DA 2D2OA 4WI8A 3ZSTA 3PQYD 2VZUA 4Q6IC 2LQRA 4HG4K 3DRTB 1L7IL 1BQ5A 3SGDI 3FS9A 2NSXA 4ANKA 4OLWH 4ELKB 3NSJA 3QDGA 2X1QA 3VXMA 3M88A 3SE3C 1KWGA 1S3KL 4ZUSA 5DHXB 2DMCA 4WFED 3QEQD 3JWDL 2J1YA 3ZE2E 4AV4A 3G6JE 5DHDA 5B1BB 2XXGA 4UM9D 3BP4B 5IMKB 1MCSA 5ISZE 1KC5H 1RZ8A 3GI8H 3P2DA 1NCJA 4L4VA 4E42A 1F02I 2QQKH 4PJ6A 2C7UB 5E1HB 5HPMA 3PJSA 1VFUA 3HE7B 1X9QA 5E7BA 5A2AA 4RSVA 4OQTL 4NKDA 1K6QL 5JDJA 4IBZA 4KKPA 3VDBA 2E0PA 2C4FT 4MKTA 2RD0A 2BCMA 1DEDA 3BWZA 4I48B 4XP6L 4L23A 3MRLA 5DC2A 2UY7B 1OCOB 3QUZA 1BXAA 4B96A 3MACL 1N4XL 2HT4D 4ODSH 3TVMC 3ZR5A 1F8TH 3OV6A 5HGAA 3MRRA 1VFBA 2XA8H 3F84A 2AV7A 2KZBA 5INCB 3SPHA 3RDJA 2OMUB 1F2QA 1IAKA 4XB3A 1OSEA 1N2RA 2OR8A 2IBGA 3GSVB 4PJIE 3LZOA 4GG6A 2WNXA 4ELME 2R4SH 1NBQA 2V5MA 3D2UB 4WGWB 5EF2A 4FFVD 3MRDB 3HS9A 4ETYA 1B3IA 2D3LA 5A6IA 3EYQD 2BW4A 1CDYA 2C26A 3OKNA 5C3LD 4HSQA 4JVPA 2DEWX 5DA4A 1SLWA 3IKKA 1Z5YD 1UD2A 4D0CA 1BVLA 1JCVA 2DBLL 4M1DL 3FFCD 1RIUH 2X70B 4HGWA 5I0DA 3DROB 1O5DT 3B5GA 3HZVB 3VACA 5E9DE 4NZFA 3U0PB 2EYSB 2GSIA 5GS3A 1ZTXL 5DU7A 3A6CH 3B7RL 4WGVB 4G3YL 2GG1A 3HR5B 1EMTL 4HWBH 1QFUH 3VSVA 4YPGB 1JI2A 5HHQA 3BVVA 5D7LD 5FGBC 3NCXA 1YC8A 3SDCC 4BDVB 5EEZA 3E6HA 3OGOE 4MMXC 3C6SA 3NIDE 2DIBA 3S88H 2FO4B 3VFVB 4FG2A 3E8VA 1P4BL 2EIJB 5C9JB 4FFYL 2EDTA 3QO1A 3OTTA 4PW9A 5DHYB 4MNQB 5JXEA 2PP9A 5G4NA 2JJVA 1WGOA 3G6JB 4TUUA 3N43B 5JOPE 1GHFH 1ZHKB 2MPVA 3AADB 3ARYA 3UBXI 2R0KL 5F7DB 1MCLA 3CSGA 3BP5B 3UZVB 2JELH 5ISZB 4MD4B 5GS0D 1BQUA 1JWSA 2P8MB 4JVUA 4KJPD 3LZLA 1YNKL 1E40A 4MDIB 1MSPA 3ATEA 3T4YB 4HJ0C 4QHLB 2FJUB 5DVMA 5TF0A 2KZKA 4CAGA 3VGEA 1ZTXE 3OKKA 3RTQB 4U1IA 3VXUB 5JNYA 3C09B 1N6VA 3AWFA 1JZDC 2AEPH 5FF6B 3GI9L 1OD9A 3N91A 5F9OL 1BQRA 2WQ8A 4KKQA 4ACPA 2BOBA 3RA7L 1FH5H 5TQ2H 3CHPA 1B9ZA 4OGZA 5B1JC 1M7IB 5EEUA 4YPJA 3WEXB 3DI3B 1U92A 4LHQB 5I6PA 3RL2B 4GXVH 3JVGC 2FWOB 3GPSA 4JQIA 2D03L 3MLYL 1CXFA 2V17L 4XVSL 1W72H 2R1WB 1SBSL 1SQ2N 2CR3A 4KZDH 4ALAC 4GKNB 2VDKL 2CZNA 5AUMB 1BVKA 4NRYB 2DRUA 3MCLH 4YSSA 3MODL 2Z8RA 4JVWA 4RISL 4NNPH 5D72L 4TQIA 2QPFA 5I16A 2AXFA 2VDOH 1VFAB 5GGUB 1HKLH 3WNPA 1PD1A 2VDPL 3POCA 4RMSA 3WFCH 3PHOB 1N8ZA 5E9DB 4DUXA 4NZUH 2JNZA 4J7RA 1JWMB 2NY6C 3MRPB 1VA9A 5HDQL 1T04B 3GK8H 5E2UL 4OV5