4YE0A

Stress-induced protein 1 truncation mutant (43 - 140) from caenorhabditis elegans
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
GSLNEVENTAQKFCVKLDVAAFKPEELKVNLEGHVLTIEGHHEVKTEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAPKTGSNTTVRALPIHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Chaperone Activity of the Developmental Small Heat Shock Protein Sip1 Is Regulated by pH-Dependent Conformational Changes.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
molecule keywords Stress-induced protein 1
total genus 16
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ye0A00
4JUTA 4I88A 4YLBA 2CR0A 2Y1YA 2BOLA 2K8QA 4M5SA 3GT6A 4RZKA 4ELDA 1EJFA 1GMEA 1SHSA 2XCMC 2Y22A 2O30A 3IGFA 3L1GA 2CG9X 3EUDA 4PBDA 4ZJ9A 2N3JA 2WJ7A 3Q9QA 5LUMA 3AABA 4YDZA 4JUSA 3L1FA 1WGVA 3J07A 4YL9A 5DS1A 3N3EA 3Q9PA 2KLRA 1WH0A 2RH0A 3GLAA 2MNWA 5DS2A 3VQMA 3W1ZA 3AACA 3QORC 3QORB 4FEIA 4PCKA 4MJHA 2KMWA 1RL1A 2JKIS 3QORD 4YE0A 1WFIA 3GUFA 2WJ5A 3VQLA 4M5TA 3L1EA 4YLCA 2Y1ZA 3QORA 1X5MA 2N0KA
chains in the Genus database with same CATH superfamily
5FUCC 4BEIA 4I2XA 4ZW6A 1F3DH 2A9CA 3AS3A 1HZHH 3CN1A 4XHJC 1XMEB 2VXSH 1JI2A 4E9VA 3MRFB 3U46B 4MNQA 3SQOH 3WU1A 2W59A 1FFQA 4RISH 5GSVB 5TQ2L 1L9SA 3WFCH 4JKWA 4N1CA 1F6LL 4U1IB 5EOTA 1XGPA 1A9BB 1CIUA 2G0KA 2QHLA 5F8RC 4Q2ZA 2WBKA 3TBVB 4X4YA 3AW5A 3EFDL 3UADA 4LSQH 4N3TA 4O2CA 3TF4A 5D7KE 3QUKA 4LCUB 2CDFB 4G9FB 2RJMA 1WSST 5FM5M 3QHZL 3MNMA 4KAQH 4LVEA 5CZXC 1DN2A 4YUEH 3RZCA 1A3LH 3HRZB 3HRZC 5FB8A 2B0SL 3VDBA 1XAUA 5GHWL 3CDFA 1DQDL 3MRQB 4JO2H 1AY1H 2BP3A 5E2JA 5MEQB 3Q9QA 5LBGA 3I2CL 4FQXD 3TEUA 3L5XH 1E5AA 4HUNB 2BFVL 2H6OA 3D3VE 4RNRA 1NKGA 3I75B 4OAWA 4S2SB 4JPWH 3O41A 4ZMTA 5ITFA 2J1XA 1HXYB 2Z31A 3GPEA 4WJG3 1MWOA 2ENYA 2XRAH 1JN6B 1TCMA 4BELD 2EH8H 5DS8B 5E4AA 3K5RA 5I0XA 4PJXF 5AZUA 2JK5B 4Y4HD 4FAAB 3C08L 1KSRA 4LSSL 5KVEE 3K1KC 2WNGA 2ZP0T 2GJ6A 2JF1A 1N6UA 1EDHA 1TF4A 2XA8H 3PWNA 4NJAH 4W68A 3QUZD 4G7YH 5IMOA 3G5YA 3BN9C 4DF9A 3L3OC 3L3OB 3HLAB 3NGBB 3NGBC 1BMWA 2FBRA 5E4OA 2IH1A 2NNCA 1YN7A 4M5ZL 4KJQC 3D85A 3QORD 1YEHH 2ORBH 4U33A 2FO4B 4J3VA 3VFNA 2H26B 2Y7OA 2YC1B 1TITA 1FZJB 5AB2A 1VFOA 1G0DA 4ZOAA 3RFRA 1K72A 1O7SA 2A6JB 5HXMA 3SY0B 3QDGE 2MH4A 4LGPB 3L6FB 2H0JA 1BZOA 1Z5HA 4H25A 1UQSB 3I6LE 5EOQL 5K39B 4LLAA 1QI5A 4QWWC 3UZVA 1AGCA 1QR1B 2RBLA 4CGUB 3SJVB 1E4XL 3ZQWA 2DB8A 7TAAA 2OR8A 4P4KD 3FSWA 1X7QA 2XWEA 2YD4A 3PG2A 3BP5A 1KCRL 1J9TA 1YQVL 3N1QC 4JN2A 5JPMC 5JPMB 1K3ZA 1VEOA 3LPPA 5A2LH 1OGSA 3NFNB 2XVBA 2V2WB 1A3RL 3QJSB 4ZTPH 2B2XL 2GI0A 1S2EA 1NCNA 3T4YB 1Q8MA 1ZV5A 2JNZA 4XB7A 2ADFL 1IVLA 2PTTB 2NY0B 1G5AA 1WQVT 2NY0C 5E8NB 3NIFB 2R1XA 4W9LC 1T89C 1CZ8H 1RUPL 5CJXC 3P4MB 3MJ8A 1CGUA 5KYYA 4ZUWA 4GFXA 3QE5A 3KJ6L 3QFDA 3D39B 1EEYA 2P43B 3SIKA 4F7TA 2FB4L 1YG9A 5LBSH 4DKEL 2DQUH 2F08A 4PJAA 4X6CB 4P2RB 5KSUB 3TV3H 2R0KL 1W9XA 4UINL 5BZDB 3HI5H 3HI1B 1NDGB 4WJKB 4JAMA 5FKAB 4B0MB 3ILQD 3LIZA 4UTCA 4BFRA 4OF6A 4HW6A 3EFOA 3FN0L 4GKNB 4Z7WA 1UB5B 2PTVA 3RVUC 3VXUD 2B0SH 1RJYB 5I73C 5I73B 2BCKA 4MXVF 1VADB 2BNUA 3ZSSA 3PCYA 3VM7A 1JV2B 4JFYB 4UDUA 2D7TL 3K2MC 1BYPA 1QBLH 5LBSA 3N40P 3IDIA 1D5XA 4RMBA 2X4UA 3HNTL 4Y19D 2BIOA 1F4YH 1FO0H 3EKCA 1L7IH 1G9EA 2NYZA 3GBNL 3SYCA 1Z9PA 3QG6B 2P80D 5IHUH 5KYUA 1EEZA 4ZS7H 2OMZA 3C08H 4YSRA 4PCTA 3ES6A 5DS1A 4F7EB 1SMDA 1QNZH 4P07A 4QXTA 2ZYSA 3LIZL 5H37H 1BPLB 3H42H 4XWOC 5KVGE 5CBEA 4KJPD 5D96C 5D96B 3M7FB 2KZBA 5I8CA 4D8PB 4XB8A 2BDNL 1E28A 2AK4A 1TSHA 1BJ1J 1P4BH 3B43A 3OAUL 3OLIA 2AKRA 4ZPTB 4LSSH 2L8AA 4Y1SA 5I6KA 2OBGA 1R3KB 4RA0C 5DJ2A 2WP3O 4K07A 4PSPA 1ET5A 1E6OL 4YFDB 1JGIA 5H4YA 3KL5A 2GSGA 4YHNB 4LPUA 4A6YH 1CR9L 3RWHA 4CNIB 3AS1A 3M17B 4RFOH 3SKMB 3RA7L 2WP3T 1LQBC 2Y25A 3LXCA 4P2AA 2HKHH 2X12A 4KO5A 1F58H 3IN0A 3EJCA 1CG9B 1D5BA 2VZOA 2X1OA 2YJQA 5JDSA 5E23A 3SE8L 3BIKA 4XNUL 4UILH 3BWUF 4E5XA 2E5EA 1B4JL 2MHAB 4LSPL 4TUOA 5EEYA 4X5WA 1NC2B 5FO9A 2EZ0C 1N64L 4JKNA 4FQQB 4HHAB 5T5FL 4GKLA 2RFXB 4FNLH 4JQVA 3GXDA 2JJSC 1SBBA 2CLRA 4NGHL 3GSUA 1IE4A 1ODAA 1NANH 2XXMB 2XWJA 4QKXB 2DEWX 5DR5L 1I4FA 3BKYL 2VDML 1WIUA 4JL2A 2BC4B 2X7LB 1XHHA 4JO4H 5L9DH 1YEJL 1AGDA 2DOCA 2WXKA 2DQHH 1DUZB 2ZOKB 4IK7A 2O5YH 4KTDL 4WV1B 1KBGH 2YAPA 4WV1C 5ANMA 2QQKL 4J3BA 4DP5X 1CT8B 3IXAB 3CFNA 1OY3B 2ZKHH 3MLRL 5EORH 1TKWA 4OR1A 1OAYL 4O02H 4L5FE 3C60D 3IKCB 1A14H 1CDHA 1PDKB 1QZ1A 3ME0B 2K7QA 1U92A 3W0WA 3RHWK 3SDDA 4ODSL 4RWHA 4PWFA 5EF1A 3L2MA 3PDDA 4Z5RA 1GVIA 5EU5B 1BLIA 4NQCA 3L7FA 4ZK8A 4HPOH 4ZW7A 1S9WB 5B39A 2R56L 3S5LA 3LKSB 2JFCA 1UKTA 4C4KT 1H5BA 4R90L 1U8PA 2E46A 1SQ2N 3BCFA 4MAYB 1P6AB 4MAYC 5L0QB 5L0QC 2OP4H 2LFGA 4NX0A 2R0KH 1KGCD 3ZDZF 1TCRB 2NYYC 5I1DA 5DMGC 1GH7A 3JWNC 4MCNA 1NCOA 2ZX9A 1OAZL 2YZ1A 2P7TB 2NY3B 2NY3C 4M03A 4F2FA 3GI8H 1KPRA 3B6SB 1FN4A 1K8DA 3PXHA 4M7ZB 4M7ZC 1TQUA 4XOBA 3RWGB 1H3VA 1UCTA 2VDLB 4WI0A 2EEBA 3BPLB 3BPLC 4LLWA 4PBWD 4HF5H 1KDIA 3NAAL 4Z7VF 1T2QH 2NUPB 3HB3C 2OL3A 3HC0A 3HB3B 1I85A 4HPYH 1DVQA 1THAA 2BVUA 3N91A 5J5EA 4Z23A 5LGJB 4KXCA 1U8KA 3LZNA 2M1KA 3QQXA 4AGLA 1UH2A 5I1DB 1DR9A 1SN0A 4ENED 4Y2DD 2Y3AA 4YH6A 2YPLB 4YZWA 1G6RH 4UOZA 2Q3AA 2ZJSH 3LRLA 5DHVH 5DWUL 4GIPD 5HHNA 3RL1A 3LNDA 2ESVB 3WNLA 3IM1A 3EJTA 4NO0B 3CWGA 3Q5OA 2Y7NA 1ZXQA 2GSIB 3CLFH 2N7AA 2VR6A 3OAYH 4IKNA 3MLVL 1GMIA 1Z32X 4MQTB 3CMOH 2EE2A 1Z9NA 5K5YA 2LR4A 3JWDH 1YY8B 1YLBB 2Z4QA 3REVA 3V4PL 1QP1A 3ULVE 3WKQA 1QYGH 1SYVB 4LT7A 4MMXC 4MMXB 4D9LH 2JB5H 1X6LA 4P05A 3QI9A 1LDPH 2WYZA 3QP3A 3WXWL 3A21A 4F5CE 2VKXA 1MDAA 1ODUA 4P59H 4NQSB 3BO8B 1A7BA 4ODXB 4GW4B 3D85B 2DLTA 3MUHL 5IQMA 1TXKA 3MACL 3HAEA 3ROOB 3DXAD 3KLAA 4MLIA 4P4RA 4U1HB 1CXKA 3BUYA 4AMWA 3OJVC 3KZ8A 3I84A 4Z95L 5KUMA 1R3IH 1T0OA 4L2YA 3ARTA 4KNQA 1KBGL 1RHFA 1RU9H 2DQTL 5EUKA 3G5VA 3L3IB 4ZMAT 1E9QA 3EIFA 3WSQL 3LRSA 5IBLD 2ZKXA 2DWDB 4AX3A 1OAYH 4MSWB 2ED6A 1A14L 2BO0A 3TO4D 3WY2A 1I3GH 4R97B 3NMEA 4R97C 5LQBL 1Q72L 4H8PA 5F9JA 4LP4A 1LEKB 3QDME 5IF0A 4BKLB 1S3RA 3SPCA 4HOXA 1NAMA 2VLKA 1K5WA 2EYTB 1MEXH 1FVDB 1Z9LA 3CXHJ 1MXDA 4NRZA 2E7MA 1NCBL 3TVMC 3CG8A 3TVMB 3BLKA 4B0MM 1G0YR 1G4MA 2NX5A 4Y4FD 1RZGB 5H35A 4PG2C 5J0BA 1BVOA 4GMSH 3OKOB 3D09A 3T8MA 3GRWA 5I17B 1RPUA 2EIJB 3DX7A 4AGPA 4P5MA 2OV0A 4C83B 2V37A 3WDJA 4BM7A 1KACB 3SE4A 4LARL 3FF7A 5EMYA 5TE6H 2A9DA 5JMOC 4G6JH 2Y36L 2ZXGA 3AWFA 5FV1L 1ZMYA 5HBBA 1P7KA 4YK4C 4YK4B 2YRPA 3VD5A 4KK5C 4PRPB 1LD9B 1FUNA 5DK0A 1NFDE 4ZOBA 3V0VA 3FU0A 4XNXL 3ES6B 4OLXH 4WK0B 4HOMA 5L6YH 2OJEB 4ORZC 2ZX5A 3DECA 3IWUA 3UXFA 4AM0B 4KKRA 1RKRA 2FAUA 3C9NB 1RURH 2I24N 15C8H 1KOAA 4QRFA 4Y1TA 3QZPA 2ITDB 1NDTA 4GRWH 2NT0A 5EU4B 1G0XA 2XPYA 1DSYA 4MKTA 4YXHH 4APQA 1H6UA 3QXAA 4FRWA 5I17A 2FSDA 4UDUB 4B27A 4ES8A 3S35L 5FCSH 5C7XH 4A55A 1OT4A 2DM4A 1U33A 1A3RH 3F85A 3BEWA 4WSGA 3VFGL 4EIZC 4UV7H 4JK0D 4WEUD 5FUCE 4ONFL 3VFOA 5I1CL 1NBCA 3ZYZA 1HZHL 5CZKA 3NDYE 5GJTH 1ONQA 4Z76B 1AZUA 2Z93A 4JGJA 4Y4KD 3UZEC 3L8QA 3BFWA 3CZSA 1J7VR 3O8XA 4GQZA 1MHHA 3VE0B 3OGCB 3BSZA 3AG2B 3I6GA 2JCCE 3CZLA 4XBEL 2M83A 1SXBA 3JV5A 4DO6A 4ZODA 3C5ZD 4ENZA 1YEKL 2GBTA 4V1DB 2V9TA 1A4CA 3ECUA 3PLYA 2WW8A 1FNLA 4ZOCA 3P4OB 1I8MA 2YPKB 4X9BA 5GIRB 2WLYA 4BK4A 4UQIM 4OD3L 4TVPL 5E94A 3RUGA 1VESA 5C0AB 4YSSA 3BC9A 5SWSE 2EYSA 2LT9A 2C1OA 3RGVC 3RGVB 2KS0A 3HTLX 2J5WA 4DVBB 3X3FH 4QTIH 3WS3A 4PLKD 3CVIL 4LCWD 3TEYA 4ZUSB 4YJZL 5EN2B 4H1LH 1CGSL 1HYRC 3CFUA 5D2NE 5J6SA 4DCQA 2ILLA 2WXQA 1CD1A 3O9WB 3O9WC 4FTVA 1NFIB 1S9XB 1TDQA 4QRBA 4NZFA 3FUMA 12E8L 2VERA 4TNWF 4KO9A 3O0LA 3OPUA 2VB5A 4DIXA 4UNUA 1PY4A 1KJ3H 3RX8A 2D2CC 3NQKA 1VGEH 1N18A 5CBEB 5C0AA 3X1EA 1K8IB 4GEIA 3IRZA 4FQIL 5EHFA 4ZFZA 2Q9OA 3A3YB 3UH8A 4KZDH 2YD2A 2VRAA 2W65A 1H3GA 4WO4D 1UKQA 4HX1B 5C0FA 1LEIB 4H1LA 4L1BA 1C1EH 2VMCA 2YK1L 3I9GL 3T0EE 4JLRB 3AFLA 3LKOA 1B0GA 2B59B 3QIBB 3QIBC 2X38A 3VNZA 2AJXL 3PNRB 4NHUB 3TJPA 3E1ZA 2BH0A 5DD0H 1YRKA 3LJ3A 3CHQA 1J5CA 3ARFB 3ARFC 5MEOB 4NUJB 1SVBA 4S1RL 2EIMB 4XBGA 1V8HA 3KYKH 1CGTA 4L4VA 3IJ9A 4OCRL 4TF4A 4G83A 2MKLC 2VJXA 3U7WL 2DYPA 3GC3A 3IVKA 4OAWB 5ITFB 1T1WA 3AXHA 3LH9A 4ZD3H 3IDJB 2H6UA 3JYBA 4U7KA 4L4VB 3QNZB 2DYPD 1OSYA 5IVXF 4AH2B 3KW8A 3OXRA 5CZVL 2B2XH 2QDVA 4WWID 1BWMA 4DQOL 1S7RA 2XBZA 4X6FB 4L4VE 3KJ6H 1B0GB 4P3CH 4PJFE 4R7VA 1T4KA 2CIKA 3CBRA 1F3DJ 1PVHA 3N6YA 3BX7C 3QUKB 5KYYB 2VDKL 1BOYA 4EQ3A 3BESR 4TLSA 2FATL 4PIBA 1YNLH 3O4LB 2HFEB 4OJDH 3ZTNH 5D1QE 2G5BA 1PG7L 1VLXA 2WLJA 3MSPA 3VW3H 3CQPA 2ALAA 1TZGL 1A2YA 2EDJA 2QQNH 1DBBL 3MCG1 1AZCA 2Q1EA 3R0NA 4FP8L 2CGZA 3RX7A 4DAGL 1OB1B 2RB8A 1XR9B 3DX4A 2Z35B 3D6GA 4OGXL 2ZXBA 2HLAA 1QA9B 3SPVB 3S5LB 4QNPE 3QNFA 3EYUH 1ZAGA 1KBBA 3K74B 4JG0L 1KB9K 1HZLA 4JFHD 4N8CL 3BWZA 4J12A 4UYPA 2R2HA 3L13A 4OQ1A 3EJYC 3KYAA 1KTRL 4YXKH 3S48A 3ZO0A 2GK0A 5I30H 1G9MH 2F1EA 4XBPA 3ZTJH 4D3CL 2K6ZA 1UB6A 4G1MB 4U2ZA 1S46A 4HWEL 2EDHA 4WCYL 5IF0B 1LEKA 3FO1B 4KOCA 4ZMZA 4XE5B 2X4RA 1MCJA 2A1WL 3QJQB 4M43L 4PJCE 5DMIL 3RP1A 1D7BA 1NGWA 4LLMB 4X8GA 3RE0A 1JV5B 5F3BA 3MV7D 2HSIA 4P5KA 1SXAA 3X3FL 2OXHA 2FEDD 1L9OA 5AVYB 5AZEH 4UZSA 3ULVD 3K5SA 4X98A 5GGTA 2X2YA 4BKSC 4QXUH 4XNAA 5E51A 3D4CA 2Q8BL 2DJUA 3IF1B 2CRZA 2XFXA 4HWNA 1M4KA 4IMKC 2BRRH 5E2WL 5MERA 4RFEB 3ZHDA 5EFIB 3KG5A 4K15A 4OQTH 3CH1B 4IOFC 5I19L 1PD6A 1KC5L 5DUMH 3VFOB 4QHUB 2C9VA 4XAKE 1PBYA 1T6VN 2E27H 3INUL 3U79A 3RIAF 1MW3A 1QWNA 1G9HA 1BXXA 3FU7A 5AAWA 4UT6H 1VJSA 4L29A 2QMJA 3QXUA 5E8PA 1ET8A 4PJ8C 4PJ8B 3HMXH 5LHDA 1DVZA 3LKQB 1XGZA 3CXFA 5DR5H 1IEAB 4LESA 3QIUD 4M7KH 2WOYA 1F6AB 3CMOL 4PS7A 5C6PB 4LSTL 5KSVA 3M6DA 4PYHA 2QPEB 4PRIB 3QXAB 5I28A 3FO9B 4BFGA 4A38A 2W38A 2FEEL 3SEPA 2A77H 5CKAA 1FNGB 2HPOA 5E9DD 3QDMD 3RGHA 5EOCJ 3TH4T 4H13C 5F7EH 5GGRA 1RULL 2WINB 3BH4A 3QPQD 1F1DA 2BERA 2CO6A 5L2KD 3Q8CA 1ACYH 5DLLA 3CDGA 5KS9B 3FO0L 3H9SB 4PP1D 4S1SH 3OKKA 4M61B 2F58H 4NXKA 2OMTA 4ZPVA 2BP0B 1QFPA 3H9HB 5E0QA 3EO1B 3MLYL 1A6UH 1F4AA 2X6BA 2DQTH 4IS6A 2D4DA 2GK2A 2ZUSA 4GG8B 3A4EA 1CFMA 1WA0X 1EHLL 5BCAA 2VMDA 2EXYC 4Z7VE 5DJ6B 2UXTA 1U8HA 4FMFA 2UY7B 4OIBA 1YMMA 4DGUA 5F93C 1HIML 3NP4A 5C9JA 2XN9D 1OAJA 1NTDA 3HMWH 1FNAA 3L4CA 4IGBC 3BVNA 3PDOB 4IGBB 4NUJA 5AW9B 3TFKC 1YEIH 1J5IA 4IRJA 2NXZC 2NXZB 1TZGH 3RNKA 1JPTH 3QUYC 3QUYB 3TZVD 1KLGB 4UNTA 2Z0UA 1AGEA 4OLUL 4WTZA 2J8UF 1V55B 2EECA 1Q0XL 3LQAL 3QO1A 1T5XA 3RPIA 1RLBA 5IBTL 2C3XA 2K9UA 2QL1A 3SDDB 3SDDC 4EKJA 3GUFA 3MNZA 4NKMA 4K73A 2VO5A 4OTXH 5BOJA 5GZOC 3IFOB 1CI5A 5JHDD 1BWWA 5BMFH 2XBTA 5IZ7A 2AITA 5DTFA 5D7SL 3SCMD 5EEVA 3GBLA 1OCZB 1ZHBB 2VDNH 5T1KB 1OO2A 2D7TH 1QRNA 1YEEL 3RVTC 1QG3A 3W37A 1U8JA 4HIQA 4M6ML 4KK8D 2VLME 2VDMB 1AD0B 5EBMA 4XN9A 4UQCA 1CGXA 1KV3A 3TS8A 4AIZA 5DDHB 3WJJC 4RAVB 3CFIC 3Q3GA 4XMKH 3WS3B 1YEGH 1OB0A 2BM3A 3JWNG 1XTLA 3QHTC 4XAKD 1NM9A 2A73A 2O5ZL 3Q48A 4HEMA 3VB9A 2AEQH 3FCBA 5EU3A 4PJ9D 5DD1H 2I27N 1ZCRA 4LSUH 1IGTB 3RGVA 1PLCA 2CBOA 2QKIA 1HHGA 1ZE3H 5CM1A 1TTUA 3QGVA 3SDAA 1MDTA 4S2SA 1KEMH 3P4OA 2DMBA 3W0WE 2OL3B 4UM8A 2F7IA 2IH8A 1WHPA 1R75A 3BJ91 1R0AL 3MROB 3WEAA 5CEXB 3R0MA 5LGJA 1NWOA 5H2BA 1YNTB 1EVTC 1CR9H 3UO8B 2PCPA 4EBQH 25C8L 3H2QA 1Z0MA 5JO5B 1ADQH 4Q4IA 3RWGA 3GSVB 1BVZA 1FLTX 1KTKE 3OL2A 3APMA 3BGAA 2CO7B 3O6KH 2GTQA 4O2CB 3B2UD 3BSGA 2ITFA 2AI0L 4TVPH 5HI3D 1MW2A 4LK4A 2BIMA 1NSNL 2ZD0A 4TVUA 5GISL 1JXFA 3VXUE 2E7LC 2MCAA 2EDKA 5ESAB 1RK1B 1TZAA 1KIUB 2VUOA 1DVFA 5I71B 5I71C 1J5DA 1GIGL 1YEFL 3ILDA 3I50H 5IMKB 1P1VA 1PMYA 4LEOB 4HH9A 2JQZA 4OKVB 4UZGA 1ZTMA 3BT2L 3L54A 4DKFH 2Z7UA 5B38A 4LBAA 1QSEB 5C07A 3SPJA 5CFHA 2Q87A 5T1JA 1E3XA 3NSCA 2X88A 2ROXA 2F8IA 4Z7WB 1KLFA 3KCWA 4YSEA 4HSQA 4XXDB 4X4XA 3FQ4A 1BAFL 4X5XA 3IE4A 1N70A 4TV3A 3OSVA 2UWEA 1CYWA 1Q0XH 4HISA 3R4RA 4IRZA 1U41A 4R7NB 1K4CA 1WICA 4G9DA 1F3JA 5C70A 2E6QA 1OOAA 2XT1B 4WVRA 3DYOA 4Z3HA 1T20A 2DQEH 2H2SC 1ZLWH 4QRPE 3H55A 3QCUH 1AD9A 2D0GA 4PVLA 1FZMB 3CU7A 2OMVB 1WZ1L 1SEQH 5EWIH 2OKMA 5JIPA 1H19A 1QO3A 3OKMA 4OFDA 2VXQA 4ZS6D 1KGWA 4JM2B 4JM2C 4NLAA 4MNGE 1OM9A 3TNNA 4ZMVA 1NEZA 2WIMA 4BA8A 3LNFA 4NZTL 4OUOA 5SWZD 1KENH 2C4XA 3N50A 4OZFG 3MZTA 4ZZKA 1JHKH 3VJ6A 5CD3A 3DSFL 4PJ5A 4KPHH 2I32A 1I9IH 3DGDA 5EEUA 1KXVA 2Z7ZA 4JDZA 4CKVX 5G4NA 4GT7A 4DW2H 5EUKB 5F6HI 4WK2B 3CPLA 1F90H 3LRSB 2PWFA 3S3JA 3RWHB 1VFUA 1ZRUA 4ODBD 4YDIH 4CNIA 2XX0A 1HEZB 3HA0A 1NCAL 1A64A 2JJWA 4NPKA 4U1HA 4HKJA 3MVSA 4Q56A 5JOPD 2XN0A 5CN2A 3D0VB 1MVUB 1R3JB 5F9DC 2WKLA 1DQTA 3SQOL 3BYTA 5J7CC 1JAEA 3DROA 3OLGA 3RURA 1VGKB 4TL5A 4LLQA 4U0QB 4C55A 2BRQA 2H26A 2YC1A 3B2UC 4NFBA 3WAKA 4GNKB 1Z3RA 3ZQXA 1R5WA 3TGXA 2O6DA 3MJ7B 2W81C 3D3VB 3RNQA 4MRBA 2N59A 2XWTB 3MNVA 3ZDWA 4TUKL 1RZFL 5GGSB 5HDBB 3REVB 4X6CF 4Z77B 2EC8A 3L08A 3FSVA 2VTFA 1NGPH 3NIGB 1MRCL 1PNCA 1KTJA 1YYCA 2H3NB 3EYUL 4IQHA 4UQ3B 1HCYA 1SOXA 3RWIA 2V5MA 5FYJL 4JVUA 1VIWA 5AOZA 2BCKB 1T0MA 1X5MA 2R0WL 3T3PF 3MJGX 3MRNB 2Q5BA 2F2HA 3MODH 4NO0A 1J8SA 1G9NL 2VXVH 5DFVD 2X0UA 1FC2D 3C6LC 3C6LB 3TEXA 1JF6A 3UG3A 4D3CH 4HT1H 3V4LA 4OM1H 2EDWA 1OHZA 3O41B 4BXSV 5EZLB 2EEFA 1IC7H 4YHML 3DIFA 1P7KB 4FFVC 5GSRA 1G9MC 3QFDB 3VAEA 2JCWA 4TNVK 4EIBA 4LHUA 1Q1JH 1PJ9A 3HG4A 4NNPL 3WE6A 4ALAL 4DP0X 1HH6A 5DVOA 2Q6WB 1C1EL 3QISA 4UBDC 5CEYA 2XYCA 5T1KD 4BXVA 2AXJA 3RWEB 3OZLA 2WINA 2A9NH 3H4HA 3KH3A 1RERA 3O0RL 1V05A 4A7SA 5T8IA 4F37K 3PHQB 1Y07A 3X1NA 2ZCZA 4LIQE 1KFAH 5GRVL 4PV8B 4M8VA 5B4MD 1OANA 3BP5B 3SGJA 3GEWB 1HHHB 3ZE1F 1BG1A 5IJDC 4D9RD 1UWGL 3CUPA 3EFFB 4P2QD 3S5LG 5F7MC 5HHOB 1RPQA 1KXQA 3DTXA 4XTRD 1CDCA 1O0VA 1N4XL 1NBQA 1XFPA 3HNSL 3O3EA 4WHTA 5BRQA 4AIZB 2QVIA 1BGXH 2YQ3A 3TV8A 1FFPA 3PIQB 5IW3A 3Q8BA 3SO3B 3NIFF 3SO3C 1L0PA 4FEMA 5FEBA 3C8DA 2EAEA 1GGTA 5I8EA 2ZUTA 4CJ0A 3KLKA 3T0EA 3F83A 4KK6C 3FSAA 5LG1A 3MYJA 4OD2A 2P4AB 4XI5D 4PGJA 2YN5A 1UXLA 1A1OB 4TMPA 2F1BA 1YYMH 2ZCLL 1S9XA 2CR3A 5IFAH 1CYGA 2Y24A 3DVNB 1E2VA 3LQMA 4FTVE 4PS4H 4X5LA 4ONOA 1U8OA 4APXB 2BINA 2CLRB 2BVOA 1GYAA 1A7RH 2G9KA 2J3SA 4O9HH 2B8OT 2XWJB 3H9SD 1S7VA 1KLGA 4NM8L 2VXUL 3L5HA 3F6LA 3NCEB 1IFRA 5SWSB 5TTRA 2NSMA 1I3VA 3QEGL 1TUPA 1D5BB 4BZ1A 5E6IA 4LNRB 4QTHB 1OCCB 3WJLC 1W0VB 2NPLX 2Y0SA 2Q76A 5D9SA 1SGKA 1EO7A 3BUPA 3QEHB 5J56B 3BQUD 1I8MB 1R47A 3S5ZA 4M5YH 4HK3N 4FZEL 4QCIA 4A37A 5C0CA 1Z9SB 2KLTA 4KV5E 5GRUL 3RZCC 3RZCB 2X28A 1FZMA 3S3CB 5EU4A 1YVLA 1Q72H 2P5EB 4LCYB 5EBLB 2ICWJ 2AQ1A 5TDPB 1OV8A 1PS3A 5LN4A 5GGVL 2YRZA 1U36A 5D1QA 3N2JA 2EDOA 1G7IA 3SODB 3UZEA 1NCBH 2CDFA 2NCEA 3GDCA 3MA9H 3OKNA 1JHLH 2P8PA 3MODL 3DGGA 2OMZB 2EINB 2AV1A 1RUQH 3D0LA 4QXTB 4AW4A 4FOMA 4JQXC 2MWCA 3L4VA 3WY4A 3WUWA 1URIA 2F7PA 2CHNA 3IDXH 3JVGC 3PJLA 3DV6B 2VABB 4LFHD 3EZJB 1KELL 5EO1B 3QUHA 2DW5A 3BPOB 1PFCA 3BPOC 4KUZL 3FHEA 5SX4H 2FEDC 3ESNA 2Z34A 1JI1A 1WBXB 3HG1D 4LGRB 3OXRB 4MA8H 1KNOB 2I9LB 4Z3EA 1CFBA 3BLBA 2AJ3B 3UGUA 4XP4L 5CIPH 1RJYA 3VRJB 3QQ9D 3TTSA 4JFZL 2GJZA 5T3ZH 3SGKA 2EVHA 1IVTA 2CLVA 2BNUB 2BSEA 5C86A 5EA0L 4S1DD 2NXYD 4YSCA 3L2NA 3UPAA 2LU3A 3A6BH 2J73A 4ZT1A 1DN0B 1CTNA 5IY5B 1PEZA 1B4JH 2WWOA 3BZ4A 2FJFB 4LSPH 4PRPA 4MS8D 1A3QA 1J5OL 1MFNA 1PSKH 1B4LA 4HBCL 3ZU8A 2PO6A 3LZOA 1XXFC 2BC4A 1KV7A 2X7LA 3FULA 4D9QD 3FH7A 1M7IB 5IKCB 4B7IA 4N5ED 1GL4B 4FQLH 4UV7L 4DPAX 3CFMA 3MYZA 5KS9E 3DPDA 1AXSB 1EHKB 3KYOB 4WNQA 3DARA 4LL1A 3HEIB 3U0WH 1IARB 2X3BA 4GLRH 1WS7A 3CVDA 2HT4C 1I8KB 3NUKA 3MOAL 4PVMA 3QQDB 3TIEB 2ZCLH 2B1AH 1OGTB 3IRPX 3O4LD 4BIKA 1WO2A 1XCQA 4GO8A 2NY4C 2NY4B 5GGUB 2MQGA 4YR6A 3RJDA 1T1XB 3H7BA 4HMCA 4PV9A 1AG0A 2IVFC 3WI9A 3NSYA 4AY0A 3GI9L 4OV6F 3BZEA 4K7PX 3TO2B 4MSWA 4WTWA 4JFTA 4OLUH 3IAPA 4IRSB 4IRSC 1IM9A 4KHXH 2CUMA 1Z5YD 4EN3A 3DVGA 3WTTA 3WBDA 1L0XA 3L4XA 4U1JB 4N9GB 1RK7A 4U3SA 3P73A 3NTCH 4JFFA 5IB4A 4M4PA 2WCSA 3J2PA 4PAZA 1MKFA 2MQCA 2V7HB 5IESL 2A6JA 1HK6A 3MV9A 2Z9TA 3EOAA 1RZQA 3LQAH 4GRMB 4N0UA 4HUVA 2EIKB 4RETB 1KXHA 1AS7A 4KKCC 4OBRA 4HGMA 3F7YA 4XN7A 1MN4A 3B9AA 2YPKA 2YMOA 4PIRF 5I5IA 1ADQA 3CXDH 5TGBB 4HPHA 2KPWA 4OIFA 1AFVL 3VRLE 1MXGA 2JV6A 3EJZD 4CW1B 4ELMF 5C3TA 3EH5B 3VFVB 2WCPA 4OZ4A 1P1ZA 2R4RH 3IMWA 3OR6B 4RBPK 3WXVL 2DI7A 3IDIB 4G8AC 1YEEH 3S88H 4BH8A 5AQ0A 2DLGA 4NQEA 1T2QL 2WQVA 1M05A 4WO4B 2XX1A 4WO4C 5IK3A 5E99H 2PWGA 2FNWA 3CLEH 3QFGA 3BUIA 3DVFA 1LQSR 1UM4L 4E0RA 1IT9H 1U3HD 5C9JB 3O11B 5F0PB 4N6QA 2QVKA 3GLDA 1EUTA 5LN8A 4NDMB 4D94A 1D7CA 4RESB 2ZE0A 3ZMNA 1KYOJ 1I7UB 5CWSB 5KSAB 1ASPA 5F89B 4ODTL 2WSKA 4OZHF 4PI0A 1PFOA 3U2SB 4EZJA 2VN5A 3UAFA 1DJWA 4JANB 3L95A 2GCYA 4JVWA 2JIXA 1YMHB 4HJ0D 2CGYA 3U7WH 3WE6B 4P46A 4DUWA 1OTSD 2BIIA 1U8QB 3LKOB 4MJIB 4PPTA 4RRPG 5D1XA 5BQ7B 2CRYA 4UB0H 3U4BH 2Y2TA 3Q1EA 2D4FA 3TXAA 5BS0E 4F2MA 1AAJA 3GKWL 4PJHA 3PL6A 3CZJA 4HD5A 4UUJA 3T4AA 4DP6X 3GUTB 1AO7B 2XZZA 1EXHA 1J18A 3BH8A 2BOBB 4N2AA 1WT5C 1WAAA 2DLHA 3O6LL 4ATWA 1QRND 1C5CH 1YEJH 1ZJBA 2Y69B 4QXVA 4HJEA 2YAEA 1AXTL 3W82A 3HPJA 1DJZA 1A7QH 1M57B 1I3RA 1PJWA 4H88L 2ZKHL 3EYSH 3MLRH 3F7VA 4S1QL 4JM4H 4XNMB 2PR9A 4O5LH 5EORL 5C8JB 5F44A 2QT6A 2X9ZA 3RPKA 5F9AC 2B4CL 1ES0A 5JIHA 1DBML 2VE6A 1QW9A 3STBA 5DUPL 4CVUA 4KTYA 5B3JF 1JGVH 4NKIH 3WENA 4XNYH 4FG4A 3X11B 4PWJA 4PHXA 3LS5H 4HK3J 3G5XA 1NC4D 3WHE0 4G8IA 1E0OB 2D9QB 1NH6A 5I1EL 5CJQH 3FTSA 5AVTB 3QWRD 1MJUH 2YSSA 3DOHA 4NKDA 3FB7B 2Y3NA 2J8UE 4QHLA 4BWTA 4MMYA 3FFDB 4MWFA 3B3IB 1LWHA 2ADGA 4NEHB 4GAAA 3UTQA 4F8TA 1MRFH 1IAIH 3M45A 3ZIYA 1ZPUA 2DPKA 2I07B 2KERA 3QDHA 5ILTL 2VJ0A 5CR8A 5F7WC 3QA3A 1XF5B 1DQDH 2Q3XA 1ED3B 1MHHB 2ADGB 2HJFA 4G6JL 3IFPA 1SJMA 4B41A 1UH3A 4TUOB 5AW2B 4G8EB 1S5HB 2K3TA 3C2AL 1G6RA 1NCJA 3D69B 2BPBA 4XNXH 4O2FA 1YYLL 1HH9B 4G8IB 4HEPG 1W0VA 1XCXA 2APTA 2CALA 2J71A 1UEYA 5L2KA 4JFQB 5AWNH 3F84A 1N0LB 4K71C 2AZAA 4K71B 1YC8A 1D5IH 4G8EA 4JKKA 2A83B 4OV5B 3JWNH 2X9WA 4ZW5A 4PR5A 1KGIA 4JGUA 5TF0A 4PRDA 1FYHB 3MRMB 4FI6A 1ZJAA 2I07A 3BYYA 4OLEA 3KXFD 2J4WL 3JWDC 3EGXA 1C7SA 2KT6A 1A6PA 1SRDA 1CFSB 1XD1A 3MUJA 5DGRA 3S7GA 4DESA 1KXTB 3RLSA 2UWEB 3SGEH 2W88A 4OM0H 2OA9A 4NZ8A 3TO4B 3TO4C 4OD1H 4NAMA 5GSVA 4Q9RH 4DO5A 3KPNB 5C0IA 4N0FB 2W0LA 3FRPG 4F7CA 5ID1A 3N41B 4QF1B 2NRDA 2D9CA 4NKOB 5C07E 3P3YA 4N2LA 3UERA 4MB4A 1A5FH 2IJ0C 5DEGA 4OT1H 5FO7A 5ACZA 3QQ4B 4BFKA 2VERN 4XCYB 4HUKB 4I3GA 3QEGH 2VDLH 4N8VB 2GBUA 3IDJA 5F2FA 1ZPLA 2VW7A 1GGCL 2XUWA 3T3PB 3MV11 1DTUA 4RRPA 3RZWA 4FQ2H 3IWVA 3N42F 2IAND 4KKBD 1TVDA 5L2KE 4I9WE 3EYQD 4FQXA 3CSFA 2DWXA 4L2LA 1FPTH 4QRPA 2UV3A 2J6EH 3T65A 1HWWA 3HG1E 1Q9OB 43C9A 1MCWM 5DD5H 1BHGA 5LCVA 1Z5LA 3R19A 4LCIL 5IVZA 1VFBB 4TS6A 5HGBA 2NOYA 4P06A 3ENEA 3QCTL 1KCSL 3RL2B 2NTSP 3ZOAA 2G2RA 2PW1B 5EN3A 4KQ3H 2P5WD 3ROOA 2FH6A 4HX1A 5C0FB 3I9IA 1UUSA 2N56A 5HHQA 2BNRA 1XCWA 3I85A 3KPRD 2ZG3A 1A4KB 2WWMC 3HHSA 3RYMA 3WE1A 3GK8L 1ZLEA 3U2JA 5D70L 4EVNB 1D9KB 1D9KC 1MJ7L 2YBRA 2ATAA 5TDOA 4XN1A 2EVFA 1Q1PA 3PNWB 4K94C 3KCPA 3SBWC 1LE5A 4YE0A 2GPZA 4A6YB 3KS0H 1B6DA 2TSBA 6PAZA 2YMTA 3RWFB 1VFAA 2GC7C 5EIQA 4HIXL 2NW3A 4N9GA 1WE5A 2NY3D 3TBCA 1N67A 1QUNA 1H3PH 1JWSB 1J1PL 1BA9A 3KWTA 4QT5B 2NYYD 2CK0L 2H1PH 5HHPA 5KSBB 1LK3L 2YPLA 4PV9B 2R7EB 3AM8A 1BVLB 1D9KA 4NC2B 5ALCL 2CHDA 4JY5L 1NFDA 1AC0A 1DVXA 3FUDA 4AG4H 1YYLH 1FL6A 2QR0B 2FT7A 3KBEA 3KDMA 1YO4A 4MB1A 4NYLB 4OFQA 4YDLC 1LP9F 5DC4B 2AK1H 3K71A 1JXJA 3GHEH 2CO1A 2G0LA 4ADGA 2JJVA 4RMVA 3BP7B 3RY6A 2DQDH 3US9A 2WLIA 2B16A 1XB3A 3EO9H 1NC4B 1X9QA 3M07A 4LASL 3JTTA 3T65B 5CCJA 1BBJA 2UX6A 1QX1A 3HZ3A 2ZOTA 1JGEB 1MPAH 2ENJA 2L0DA 1NUNB 3QIWB 2QLVB 3L81A 3O8XC 3O8XB 3QIWC 4J3OF 4XBEH 5SV3A 3U0WL 1KEGL 4IDJH 1N5YH 1Q9WB 3T9WA 4RFOL 2HX9A 1KWGA 2EYRB 1SYSB 2DMCA 1RV6X 3B1UA 3DOSA 5EZPA 1BMZA 4P2OA 2PYED 1AGBB 4FZEH 4PW4A 1X5ZA 3K3QA 3LVEA 2EE9A 2R4SH 3FOLB 3RY5A 4LKCB 3B7UX 3ZR6A 2X70B 4DEWA 4FLRA 4AMXA 1BV8A 1E5YA 4CDHA 5ADPH 1IM3A 1RHHA 5E2UH 3FRPA 2VLKE 5K69A 3KLQA 2ATPB 5E6UB 4XP9L 5CS7A 1F42A 2CQVA 4L4JA 4BJLA 3HE6C 3HE6B 3NOIA 5LAPA 5KS9A 4HJ0C 1AQMA 1C5BL 2ATKB 3RWDB 5F1NB 4WQOA 4ISVA 1F5WA 5C71A 2IQAB 5ICYA 2H32A 4L8DB 3V7AE 1CGYA 1UYWH 4EEEA 1CL7H 3ZZQA 1RZFH 2EDLA 3GUTA 2P8PB 2GTZB 5KZCD 4NQDA 5D6DA 2F15A 3K91A 1R3IL 5DO8A 5JR1H 1KELH 1FNGA 1IFGA 1FFRA 1T04B 5M94B 2YRBA 4FI7A 3MRNA 4Y5YB 4Y5YC 3SB3A 4R4ND 4H5SB 3L4WA 3S96A 2LU4A 2I26N 3BVXA 3LPWA 1YEWA 4WKZB 2QGEA 1GYUA 3QS2A 2NSXA 2XZAH 2FEEI 4HH9B 4JHWH 4AYGA 4IBWA 3MLTA 4JQVC 4AEFA 2YPVA 2HVKB 2WVTA 4TNWK 3HJEA 3EO9L 5E2TH 3BAYA 1ORQB 2C3VB 1TEFA 2AMGA 2C9SA 2XWTA 3MNVB 4HU2A 4TNEA 4XNQB 3QVAA 3HN3A 4NDMA 4LMQI 4UM9B 1S5HA 2JB6B 1DVUA 4BKLA 2Y06H 4YHIB 1C8QA 3EYOA 2CHWA 3EJZC 3K0YA 1GZPA 2AV7A 4K7FB 4OIIL 1L9NA 3OKNB 4I48A 3ZRFC 3Q2NA 3CVHB 2Y5EA 3QWOA 1OOWA 1JXGA 2BJMH 4HJTA 1RPKA 5CU9A 3KH4A 5JQ6L 3VXRE 1E6JL 4DT2A 3O0RH 4M56A 3P1VA 4KY1H 1NIEA 3A23A 4AQZA 2JCCB 2VNCA 4TSCL 3GMQB 3OPZH 4APQD 4OVUA 2VRQA 4UM8B 3IJEB 1MFEL 2HLEB 2VDKB 4PJEA 4Z1PA 5DRZA 2ADIA 3FC8A 3FZUD 5DURB 4NKDB 4H0GA 1DL7L 1LO2L 4P2RD 2W91A 4G80B 2Y7MA 4HAKA 5JHLA 2X4OA 1ZT1B 2EDTA 4RRPM 4LNRA 2JJTC 2JWYA 4QTHA 4U1KB 1PG7H 2N01B 4XXCC 1FFPB 4F8NA 4AT6A 3WIIH 4O5LL 1FNSL 2R8SH 3Q1SL 1TQSA 4ORGA 2OMWB 3ZE0E 4DJMA 3WHE1 1U2CA 4MD4A 1BJ1H 4UM9D 1AKPA 1QZNA 4PJIE 3QNYB 3CFDA 3DPBA 1UKSA 1TNMA 3NK4A 1VKXA 3DVNA 1MPAL 2N7BA 1PTZA 5FK9B 4DERA 3WTVA 1A1OA 1YA5A 5A16B 4M8QA 1KCUH 1U4EA 3LMJH 4OSUL 1UZ8B 3PHQA 4O58H 1NGPL 1G87A 4YPGB 1K5NA 3CFKA 4BH7B 1OSZA 2RCSL 1GTNA 2BFVH 5SX5H 3MA7A 1JPTL 3BKJH 3P0GB 5E2UL 4KJWD 1KLFB 4NKMB 1JPFB 2NNFA 4P4KB 4P4KC 1YMHA 3BZDA 1EQWA 3PWPB 3SJVD 4ZFOL 1N5AA 1NEPA 4FQCH 4PY8J 7FABH 2FIRT 2EH8L 5KZCB 1A6WH 4QWWD 3WFBH 2A5UA 5T5NG 4YPJA 3QO1B 4U31A 4MZIA 5GGTL 2YD7A 3NG5A 4PGEB 5GGVY 3GMNA 1M1SA 3H2PA 2J21A 2HJLB 5EIIB 1WBZA 3IGAB 4ACTA 2CDEB 2O4EA 1S9VB 2ESVE 3HC4L 3S37L 3QW9A 2Y7SA 1I3GL 2XACC 4PRBB 5I5MA 4EI5A 5ESAA 1J87A 5DD3L 4A66A 3GXTA 2IBGA 3DX0A 2DAVA 5DI8A 1V7ML 3D48R 1MF2L 4FABH 1UGNA 5EBGA 1CDIA 4EI0A 1KIQA 4OJFL 5CUSL 1JNHA 4U4IA 5INDB 4AUUA 4XCYA 1AIFB 4JRWA 2PYEB 3NFPA 5T1MB 3WEXA 2F5AH 4UB0L 3HAEG 5JW3L 3II3A 2BXYA 1UXMA 1I7RA 3UJIH 5CAYB 1PCXA 3O3BB 3H9YA 1WAEA 1KCWA 1IGYB 1MZZA 5D4JA 3OJDA 4KZDL 2JQAA 3T0DA 4NT6A 3LEVL 1WJ3A 2PR4L 2NW2A 3VTMA 3QIWD 3QEQE 3WFEH 4EIGB 1B2YA 1MCOH 3V4VA 5MP6H 5ID0A 4FJYA 1UFUA 5T5NF 1XV8A 1PLBA 1MH5A 4NO5A 3DO4A 3D08A 4YGVA 2BOLA 4N2FA 1GKOA 5FF6B 4KY1L 1XH3A 1OPGL 2XQYK 5ISZD 2FQDA 1FGNH 3LV3A 5JXEC 1OGAE 3G6JB 9CGTA 2X89A 1S7UA 4U05A 5JUEH 5HD8D 3BKYH 2VR7A 3JWOL 3PV6B 1IM9B 2VLLA 5DQ9B 4AJ0A 2F53D 5I6OA 1BAWA 2PP8A 2V3EA 4L29B 2OTUA 3HLKA 4KXDA 3G04A 5C0ND 5F9WB 2B3IA 4TQ8A 5F9WC 3NRPA 4WUUD 1J05B 5F7BA 1X7TA 3MJ7A 2SEBA 4HBCH 4E2OA 2J44A 5L7XL 4LKXB 4QPEA 4U1LB 3U36A 5DUPH 1QSFA 1SHSA 3FUJA 4IBSA 3FU8A 4XHJD 3WS6C 2HRPL 1OW0A 3VFRA 2HVKA 1ZGLA 3KPMB 3T8VA 3AGWA 4PYGA 3CSYA 2YR3A 4U6TA 4NQCE 5E4IA 5JIMA 4YFLF 3ZL4L 3P0VH 1SMOA 2DZEA 4N6RB 1DQLL 4XBMA 4ECNA 3IU4H 4UZUA 4ZAKD 4HIJA 4U0RB 4U0RC 4HXAH 2JXMA 5D93B 5D93C 4F2ME 4ZFFA 4U1MB 5MEPA 5IFJB 2R69H 3QC6X 3FQXB 1XMWA 1TJHL 1JXDA 5J4MA 4R7DA 3CPLB 5CKGA 1AGEB 5I2IB 5FYKU 3GZOA 2P5WB 1UWXK 3FO1A 4OB5H 2JB6A 4P2QB 4HV8B 1T66C 2WQ8A 3IBOA 3JV4B 5D7IF 4FXLA 1KB5L 1CFQA 1I8IA 1J8RA 5FHAH 1T03L 4HXBL 2YD5A 1WLHA 2C9XA 4U2YA 5DCCA 1J0ZA 1LK2B 2GJ6E 4G8GE 5JHAA 1FLRL 1B6UA 1JZ5A 4JJ5A 1C16A 1KPUB 2XTLA 5FO7B 4L8BB 4WU5A 2NY2B 2NY2C 3VWKB 3VWKC 1NCDL 3KWWB 2G4GA 3IMBA 5T1DH 1JV2A 4JFYA 4KI1A 5DT1L 1NCUA 2AJUH 4ZFOB 4G82A 2VITA 5J6HB 1TEGA 4ES9A 5IVXB 3SGJC 1J9SA 5D2NA 4HULB 1CFVH 3KPTA 3OB0K 2WUCL 4QHKJ 2JI1A 4Z7AA 3AABA 3JVGA 3AGVA 2EXSA 3SKOA 1JOIA 1I9IL 1PG7X 4L0YA 1SUJA 2WK2A 2WTOA 5L4MA 3A47A 3DC0A 3RI5F 4C4BA 1CICD 1L3NA 1XSOA 4NQCD 4AW7A 4FFVD 3SYPA 1K2DA 4V1DE 2QHRL 5I26A 2OL3L 1HHJB 2WMPB 1IM3B 1GSKA 4JW3A 4O4YH 1GOGA 1T2XA 8PAZA 1N64H 1C12B 3NCYS 3QUMB 1DJHA 1JDDA 2MOQA 4P2YA 3VI3E 3NACL 1NCHA 3VSQA 3NZHH 2IOMA 4JFDE 4ODHH 3KPPA 4ODUB 2Y23A 1V5JA 1WH0A 2BWDA 4JN1H 1KIRB 2LE9A 4KK9D 3FUFA 2AJSL 3MBED 4GAGL 5J57B 2Y1VA 5EU3B 4GI9A 4M7JH 2WUBL 3UOAB 4LLUA 1MG3C 3PHSA 1UURA 3JV6B 1U8IB 1YJDH 1LO0L 5IB1B 1JGDA 2R23A 5I18H 4E41D 1DEEA 3MQIA 3BP7A 4BUHA 3V6ZA 4HKXA 1BFSA 3VU2A 3CZGA 4XPBL 1IMHC 1BIHA 5DZJA 3GJEB 5AW0B 3MROA 1NFDB 2RTTA 4LIQH 2XVLA 5TDNA 2XN9A 4JFXA 2P8MA 2X9YA 5I0WA 1YMMD 1V7NH 3S36H 3NH7L 2RR3A 4DZ8B 2YZ8A 2BY0A 2R2BA 2V6HA 1H8OA 4NZRL 5EULV 4DHLA 3MXWH 2QQNL 3MJWA 5IB4B 2B4CH 1OTTD 1ACCA 2EVJA 3GK8H 2YD9A 3O3AB 2V7HA 5LBSL 2OMXA 2KZ1B 4O2EB 2R23B 3OAZH 5DZLA 1BZEA 3P30L 4I48B 3AXLA 1T80A 2A7BA 3NTCL 3H4FA 3VVVA 5EO0B 4F93B 3V5DA 4FQ1L 4KO6A 3L9YA 1TQCC 1TQCB 3TCTA 4MXWH 3T09A 1K85A 2F7QA 4HS3A 1QHOA 5JORA 3VB8A 3B56A 1BYNA 4JHBA 1KIRA 3K80A 1M3JA 2K1MA 3VD3A 4PRBA 2IDUA 4NO2A 3ATEA 2HFFB 3ELAT 5G5DA 1T7YA 5AW4B 1QEXA 2YFNA 4J8QA 1XZ0A 2MCPH 3A67L 1I53A 4MDIB 4KX8A 4YIQA 4PN6A 5IG7A 1U21A 4L0ZA 5AVZB 3SBPA 2MOVA 1WP6A 4HBQA 4YNYB 4S10A 3BAEL 2UZYB 3BD3A 2C9UA 1Q9OA 4NI3A 3VWJD 3KAAA 4HC1H 2XQBH 3NJNA 5F3FA 2X6AA 3HZYA 3MFFA 4U6XB 2KBGA 3MRPA 3L9EA 4QO1B 3T6ZA 1JPFA 4P4KA 3UEZA 4RVBA 4N2BA 4YHKH 1P6FA 4LSRH 3QFJA 2YQBA 2BVPB 5CWSA 4MBRA 3FPXA 4MJID 4MAZA 1A6ZA 3PAZA 1M3IA 3NZ8B 5FDWB 2UZIH 4AGNA 2VDPL 5CHNB 2B4CC 1UXSB 4CC0A 2F6AA 3MRFA 3N5AA 1DQML 1R3HA 4GBXC 3NP3A 4GBXB 1E6OH 2EQDA 1JZ8A 2J56A 4K7PY 2ZWLT 3SGKC 3FT4B 3Q2CA 2P24A 4L4TB 4TSAL 5ADPL 4MD4B 2JVUA 4R3SB 1CGWA 3FMGL 4EPSA 3I6KB 3K72B 3W3BA 1A21A 1P1ZB 3JVFC 2C1PA 2Q86A 3C09B 1LO4L 3C09C 3DV6A 2YQGA 4K5PA 1EEUA 4OZHA 1HL5A 5BRZD 3UROR 4UU9A 4YWGL 1MHCA 5BNXD 3Q2VA 3FU7B 5AAWC 3DURA 4AC4A 1EZSA 4AIOA 1NBVL 1VGKA 4JJOA 5KSAA 4H4NA 3T77B 2R0WH 1P9MC 1WWCA 5BRZA 1O7VA 4GIAA 4HJUA 2VMEA 3FCTB 4PJHF 4OT1L 3O2VL 4NRXB 3NN8B 2OK0H 4HLZG 2MEJB 3NABH 3DBXB 3BKCL 3K8LA 5FHBL 3WHXB 3HHRB 4NIKB 4HIJB 3DJTA 5AKRA 4BHUA 5FDYA 1UWYA 1ZEAL 2CCWA 2BVQB 4X0KA 5I82A 4U1NB 5BVJA 4AI7A 3EDEA 3ASWA 1UM5L 3B9KA 1T5WB 3RBSA 4PP2B 5HYQB 4EN3D 4PJIA 5K1NA 4W9FC 4GFTB 1FVDA 2AQ3A 5DMKB 4C4UA 3BHBB 1FL3B 4FFYL 1IAIL 4MQXD 3S0PA 3I6LD 3X11A 1QBMH 1CDJA 4FD0A 4R83A 1C5DB 1YC7A 4RWYL 4PP2A 5HYQA 4NJ9L 3KPSA 4OJFH 5CUSH 1JNLL 1BXUA 3CFBB 1FIGH 5I8OL 3QA3B 4BSVB 3SYQA 4IMKA 5DZ9A 3MREB 3PV6A 5MERB 5MEND 4FQ1H 3ZE2E 3F7VB 1FNHA 4X6BA 5T3XH 1BQSA 3QDJE 3ZE0F 2UWEE 3C5JA 4R0LC 4R0LB 5F6HJ 3X13B 3TBSA 2HT4D 5AWNL 4WWKA 2Y07L 2FX8H 1KIPA 5C0EB 1JK8A 1G7QB 3ELQA 4GSXA 4HCFA 1EXUA 4XXDA 2KDYA 5AUMA 1JGLL 3BKML 1Q9LB 3IJYB 1TTGA 4OFYD 5HSFA 4IOSD 2LOEA 2WXMA 4P46B 1ICTA 4P46C 4AM0Q 5D72L 4RDQG 5IHWA 4JFEA 5DA4A 2VIRB 4MS8C 3O3EB 4HCGA 4I3RL 2EP6A 5BW7A 1JFQL 1XT5A 2X70A 4HKBA 1JNHB 4BZ2L 1MLCA 3CXHK 5DFAA 4UOW1 3DX3A 2WN3A 1MFDL 4Y8AA 1HHHA 1WA1X 4O00A 5KG9A 2WIIA 1A7RL 1P7QB 1O7DE 2APVA 1U8CA 3GMMB 3EOBB 5HYSG 1EFXB 1GS7A 3ZDZB 4R26L 5A6MA 4X9FA 4PV1C 4DSYA 1WV7T 1HXMA 5DEGB 2XN1A 4CL7A 1BF2A 4OJYA 5C0JA 3IU4L 3PU7A 2NDGA 4K7PH 5GRJL 2CLZB 2ZSWB 1C8PA 2GITA 4LRIC 2Z3FA 4H8VA 4WI9A 3M1BB 1P7BA 4X7SH 2JB5L 2YHGA 5I1LB 1PZ5B 2VKWA 1LMKA 4AV0A 3VD0A 2IG2H 4OF5A 2XWCA 4PREB 4MB5A 1EGJL 4MDRA 1P53A 2QQKH 3DIFB 1KXTA 5JIKA 4N8CH 2WXJA 3I02A 4TUKH 4ZMWA 3CZUB 3EUUA 2P5ED 3I2CH 4NUMA 4ZDHB 1RD6A 2EDEA 4YX2L 4QJ4B 4AL8L 1CN4A 4HHWA 1IGFH 1IFHL 1XGTB 5IK3B 3SE3C 5E95B 2R15A 5IHHA 1ZHLA 3BQUC 3BQUB 3GIZL 3O9WA 3S88L 1VHPA 5HGDA 3UEQA 1YY9D 3CZFB 2DL9A 1KPVB 1J88A 3ORJA 3BWAB 4O2EA 5EU6B 3WN6A 2HVJA 4RX4A 1U92B 3W0WB 1I8LA 5IIEA 3RJQB 3SDCA 4YHZH 5LXGL 1BM3L 1BYOA 5HHME 2ENSA 2QGCA 3IDMB 1U8JB 4K23H 1OAKH 1QR4A 1DLHA 2X4NA 1KCVL 5EZOL 5DRZB 4TUJA 3QEQA 3SDXE 3MV8E 5FYLE 3II1A 4Y1AA 4OZIF 4X80L 4OGAC 2EACA 1H15A 3CVHH 4R2GB 4R2GC 4G43A 1AYRA 3TTYA 4N0RA 3KNBA 2VISA 1GZQB 2BVEA 4KHTH 2FX7H 5ACLA 2XG5A 1RXLA 1CU4L 1N2RB 4UT9H 4WI6A 5C2UB 4AQAA 1MCDA 3WNOA 1E4WL 2C4FU 1KPVA 43C9B 5K9KB 3NACH 3JT0A 2PO6B 2PO6C 3EJYD 2RFXA 3FH8A 3V6FA 2VAJA 3MHZA 3NQIA 1JMZA 3OLEA 2JELL 1OP3H 4M1DL 5I1KH 1W80A 2X4RB 1AJ7L 4P46D 4DVBA 3ULUL 4FEIA 4L9DA 5ICZA 5DZOA 1DSFL 3WELA 1S7WA 5IB2A 4K3DH 1INDH 3ZDZE 4ZW3A 2CGRL 2WKOF 5F0JB 2OZ4A 2ZT9C 3QULB 3ZYIA 1R17A 3MRIA 4OZGA 3MUGB 4PJ7A 4PUBH 4TOYL 3HUJF 5DWPA 5FUOH 3LQZA 4MLSA 4DVRL 2CU9A 3B9DA 1VSCA 5IM7B 4BFFA 3ZR5A 4Q74A 5DO2D 1A4JA 3QDJD 5EIVA 4IK6A 5DJDA 3DHPA 1F13A 4QEGA 1IIIA 4AJVA 4AK1A 4Q9BA 5AAMC 1SEBA 1H8NA 1FVCA 2AV1B 2BLFA 5G4OA 3LXAA 5T1LB 5EOTB 1GYVA 4HS6B 3IXTA 1U4FA 4G72B 2VQ4A 4I5BB 5C09E 5IFAL 2FO1A 1KFGA 2G5BB 1YEIL 4WFFD 5HPOA 1SEBB 2MPAL 1U8NB 2AXFA 2FWUA 3ESUF 4HFWA 5ENWA 4DPRA 5AD0B 3GHBH 3AY4C 4PRIA 2EUXA 3FRPB 1OK0A 2TRYA 4N20A 4KZCA 2F9BT 4GUPB 2RGSA 4PJDE 1T6BX 5FM5O 5FW6A 1EHXA 2I9LA 3OG6B 4X6DE 4PCSA 4ETQA 2GG1A 1JF1B 4P5TA 3VFPB 3LQZB 3T2NH 2P24B 4L4TA 3ZTCC 5DGQA 2H2PD 2UZXB 1JZ3A 1TJGH 4WFHD 3C6LD 1CTMA 3A4FA 5DVKA 2OMYA 4XCFL 4DGYL 2A74B 2A74C 4M29A 2FYYB 3TVMA 2LTQC 1QBLL 2LTQB 3F04A 3ULVF 1A7OL 3GMRA 3H42L 3BD4A 5EUOB 5E2WH 4XN4A 2DMGA 1RUML 2HX8A 4LVNC 4LVNB 4Z7NE 1X5JA 3V0WL 4ZYKB 2KDGA 3RDTB 3RDTC 5IBUG 1HSAA 2CO4A 3NCBB 4UIMB 4BE5A 4HOWA 1MIMH 2IC2A 3LN9A 2AMUA 4HD9A 2Y1ZA 1T89A 1VEPA 1CDBA 1A8JH 1UHVA 3ARDA 5CP3A 4CVZB 2WSDA 3QG7L 5EB9A 1IAKA 3MLXH 4EI5D 1LEIA 1I9JL 3IAGC 3UPCA 3HBQA 1ZGLB 1J0IA 4JPQA 2GEEA 4OCWH 2H6PA 1ZVSB 4NOBA 4JZOA 2X0VA 3SE8H 1Y6NR 1OWWA 3S2CA 1BBDH 2ZXWB 4QOKB 2WLMA 3DMMD 4IKLA 2OFQA 2SEBB 3GINA 4H8UA 4G1MA 1FGVL 2FT8A 4WHCA 1HNYA 1TLMA 3LZLA 4QXWA 4DKEH 3LH2L 5IJCC 5JYMA 1IE5A 4W4NA 1E30A 3PWLA 4CADA 4LSUL 4X80H 4UTBA 15C8L 4ONGH 2Q7YA 3KBPA 1UWGH 2ODHA 2YKKA 3ZMRA 1P4IH 4RQQB 1XD0A 3A24A 2X6VA 1X5GA 2HKAA 4A6YA 3FFCE 1U42A 1E5ZA 2WUBH 1PYWB 4PTTB 3F65A 3PWLB 3QHFH 1LTXA 3K0WA 3KYMA 4Z7WE 3FTZA 4QRTB 1VA9A 2R29H 3C5ZB 3C5ZC 2ZOLB 3DHUA 3GMPB 3SY0A 5IHBA 3QYMA 4UQ2B 1JCKA 4PRHB 5TDNB 3FAXA 2ZF9A 3D2UD 1FSKB 1FSKC 3X1GA 2QKSA 2RHEA 4F2MB 3OJDB 3TT1H 1J86A 2CO2A 2HJKB 2WQUA 5C0BD 1ZLUH 4W70A 1T5XB 3QDGD 1JHTA 1FNSH 2R8SL 1MJJB 4WI3A 5EU6A 4ATTA 1ZD6A 2XBDA 4PLOB 2EDBA 1FNEB 2K8MA 5HDWA 3L3HB 4POYA 2AJZB 2DQIL 2EIZA 5I15L 3P30H 5CLTA 1XF4B 1ZOXA 1J11A 3OJMB 1Y6MR 4JB9H 4OTXL 3KBFA 5AOKA 4KAQL 5EU6E 3PWUB 4HWZB 3A67H 4WY7L 1YMMB 4DK6A 2AK4D 4LHQB 2CR6A 2RCSH 1BQLL 4PBXA 4NUPA 1YMME 3KPQB 4MJ4A 4G8FB 4QTIL 5SX5K 3RWIB 1MJJA 4HC1L 3CFTA 4Z7UB 1ZY9A 2X10A 1JHTB 3GJFK 2O26U 4GKSB 3LH8A 1WFJA 4WI7A 4ZPVB 3ZUNC 3A6OA 4DK3A 4LVHC 4LVHB 1N5AB 1HOCB 3P9MB 3APDA 3U82B 1TETH 2VLRD 2CO6B 2GKIA 5BS0A 1KB5H 5IEHA 3UTPD 1ZSDA 5INCB 1VZHA 4ETYA 3QCUL 3K6SA 1JNNH 4DGYH 1QASA 3TJEL 4GUCA 5BUGA 4AGQA 4HS8H 4E9YA 2XA8L 4LPYA 4M8QB 4W1TA 3ZVVA 4OI8A 1I7ZB 3GZQA 3WAJA 2DWSA 4CU6A 4QXUL 5AAMA 1AGDB 2V5YA 3Q44A 2FIKA 2ZYRA 5IVXA 1T83C 5D1XE 2R1WA 1U91B 4PGCB 5JPMA 3F7PC 3VFWB 2B1HH 4FYSA 2P46B 4OF8A 1MVYA 1JZ2A 1SOQA 3CQFA 3PGFL 2HA1A 4MD0B 4OQTL 5D1ZI 3ZKSD 1JFQH 5IEKA 3ULUF 5DVPA 1ILUA 5HJBA 1P69B 5LNDA 1WAAE 2OQJB 4OV5A 4Z3FA 1TZHB 3DUSA 5I1JL 5IQ9B 3E3QC 1NC2A 2XWDA 5I66A 2QV4A 1D6VL 1I9JH 4WFEE 3D30A 4P2QA 1DDHB 4DN4H 5KVMC 2Z8RA 3LAFA 3QJTB 3A6BL 3DXAB 5T3ZE 3C5SA 3FFOA 4XZUB 3EGDB 4J4PA 3SN6N 5HI4D 3BXNA 2ZCKL 4BSJA 3OKMB 2HJFB 5GJSL 1T2JA 4KK8C 1F2QA 2ZNWA 1DVSA 1KBWA 1D5MB 4BZ1H 3BMVA 5I6MA 4XP5H 1OT1A 4XP6H 3D34A 2XXCB 4NERA 4XVOA 3MRKA 4NQXA 1QSVA 3BXNB 3LS4H 4NNXA 3BUYB 3MAWA 3P9LA 2CUHA 3P77B 4GG6E 1UCBH 4TLTA 4L3ED 3LRKA 3HS8A 4Z18A 1OW0C 5E5LA 3VFRB 5JHLH 4TUJB 1CTOA 2JK5A 3ZK0A 1DQLH 2W5PA 4RWYH 4W9EC 1G84A 1J05A 3AT8A 4GO6B 4AUJA 1IJ9A 1XB8A 3BAKA 2HMIC 1SLVA 1ZS8B 3MO1A 4KMTH 2OMUA 1MQ8A 1VZGA 2WQXA 1P6WA 2Z8SA 4KROC 4KROB 2COVD 4HUUB 3ARGD 3I9PA 2BSRA 5GGSY 1LEGB 5CCHE 5IVXE 2FQFA 3V6OE 2WKGA 3S2AA 3BDXA 4GUPA 2C8NA 2GSIA 5KVGL 1MG2C 1NGXB 4P5TC 4P5TB 5TK2A 1QFUL 4DO4A 5FUZH 1KMGA 5CILL 3NN8A 4E9SA 4IBZA 3RTQB 3RTQC 3WUWB 3LIUA 4FA6A 2HVBA 5ABAA 3TBVA 4X4YB 4LSVH 2BNRE 3BUQA 4H0LC 3FT3A 4NPYA 3U6RA 1JZFA 4NUQA 1W6LA 3EH1A 4PLJC 4WZ9A 4DUVA 5AAPA 5HDRA 3EH4B 1P9MA 2DQCL 4G70B 3CPUA 1ACXA 5FA4B 4TPRH 4FFZA 4AL8C 4KHTL 4LZKA 4K8RC 1I8AA 4NQTA 4XH2B 2VDRH 3L4TA 3GBNH 5J6GA 2XG4A 1CQKA 1XIWD 2BY1A 2WBJA 5D7IA 1M9SA 3ULAB 4POUB 4J39A 3TA3B 3BW9A 3TA3C 4NN5B 4NN5C 4XMLH 4MFHA 3VCLB 2K78A 3FT4A 5HHVH 5J11C 3CNKA 5EZLA 5IT2L 5J11B 4JO3L 5KW9L 1ZVNA 3FB6A 1I1FA 2E8YA 4K5NA 2BOCB 1WGOA 1J12A 1IGTA 2CIIB 4AYMC 4P3DB 4XBGB 4BCZA 3QIUC 1FRGH 3QIUB 1XX9C 3GS7A 3D4ZA 3DETD 3ULVH 2BVPA 2EJ1A 3DLQR 2DLFH 2YPVL 4UQ3A 4Y1AE 3ZTJG 1SOKA 4HSAC 1T1ZA 5EEXA 4C57C 3SKNB 2IANA 3GS0A 3EXLA 3APCA 1AQ8A 4PJCB 4L5FL 4ERSL 3F00A 4PD4K 1PF3A 5ETUB 2NY1C 2NY1B 5KYWA 4NSKB 4B60A 1SQMA 4N6RA 3W5MA 1DJYA 4MDIA 4R5VA 1YQ2A 4NENB 5IG7B 4M7JL 1NWPA 3HAEB 4LLQB 5JOFA 1W6WA 2QSQA 4UOQA 3ZRCC 1ZLSH 4FQHB 2V5RA 4MQSB 2VL5B 4U3CA 4ESKA 3U36B 1R24B 5F7HA 4NSKA 3BKJL 2AQPA 4F7KA 4CJ1A 5HPMB 1MLBB 3K8KA 3EFDH 5JLZB 2H8PB 5JDJA 4NQUA 1YN7B 1F00I 2DTSA 2YAOA 4XVTH 1MWAL 2O72A 4F1ZA 1A6WL 1QABA 3GMOA 4FLOA 2NZIA 5GHWH 1CD1B 2EIDA 1GW0A 2AFNA 1U8IA 4AYSA 4KRPC 4KRPB 4QRUA 5HGDB 1I9EA 4K23L 3ZJAA 3THMH 3BVNB 3PDOA 2EUWA 1P5VA 5I0DA 3L6FA 2DICA 5DHDA 3T8XA 3FBQA 4GSQA 3AQXA 1IKNC 1EA9C 1I1FB 2BSBA 5K1JA 4AYID 5IJVA 1KDJA 5E2TL 4G7VL 1NFAA 3B9EA 1JZ4A 3NFSL 3QFJE 3GLAA 1AOHA 1MREH 3HZKA 4BCXA 4U1NA 5BVJB 2AC0A 5B1CA 2GSGB 5BOZG 1I1RA 1HNFA 3EO1A 4YSQA 1OF2A 4F15B 1NQBA 4L3EA 4F15C 4G7RB 2VR3A 2MNUA 3OGCA 5I1LA 4O51B 4NC1E 3VXSB 1TNNA 3QG7H 4JKLA 3TASA 5T1MA 5IB1A 3OD3A 3WKYA 1UA6L 2OXGB 2BNQA 5KBPA 1N0XL 4Y7OC 2AJYL 3LNIA 3VE0A 4FJ6A 5KVDH 1TENA 3SOBL 1VZIA 5D1QD 3V4UL 1ZGLP 3RB5A 5J1AB 4C56D 4JGNA 2EKSB 5KN5B 1AR1D 5CF3A 3UZQA 2VLRE 3GDBA 1CK0L 1GKEA 2L4OA 2OMYB 4J4PD 3ARWA 2V2XA 1TCRA 4Z3GA 3Q2LA 4U1GC 4U1GB 5E08L 1TEYA 2ED8A 5D8JL 1KBPA 2JI3A 1U8LA 4KO7A 3FZUC 5JXAL 3GMMA 3VXUB 4HGWB 2JTDA 3MLTB 3PJNA 4L4VD 4NWUL 4APQB 4APQC 1AXIB 1RJZB 4MJ5B 2BFGA 3K6FA 1KJVA 4LQFL 3V0GA 1GMEA 4L8BA 4WU5B 3VWKA 1URLA 2BW5A 2QZQA 3KS0J 3VXUA 3E0GA 4JNXA 2NNAA 2HAZA 1OZUA 2NR6C 3LKNA 3QZBA 3IJYA 5JQHC 1KWKA 1FRGL 5BZWB 5T33L 4WEBL 5ECJE 1A22B 5KBMA 5HJDA 2IAMD 1U8MA 1K2DB 2CWRA 3ME0A 1QD0A 3NSFA 4PRHA 2F74B 5AW6B 2LGNA 3RIFF 2WXIA 3CFJB 3WDHA 1XF2A 3LRMA 4QGYA 1GY1A 4E68A 1CT8A 3IXAA 1GJIA 4IBVA 3VQ1C 5IHZB 1M42A 5JO5A 1BQUA 1MVUA 1R3JA 1ZTXE 4NCDA 4R7DB 4TYUA 4PS8A 2CRIA 3DX7B 1PLGL 3T0ED 4ZO7A 2C9RA 3CZKA 4LGSB 3MKKA 4K4KA 1LNUB 4FQQA 4TSBL 3MLPA 1RIVL 1ZA6A 1PIGA 1JDCA 4WW2F 4AQ8C 3IPFA 1U3JA 4MNGB 1H3WM 1IBFA 3W11D 3ESPA 2Q76B 5D9SB 1JTOA 1X5YA 5FHAL 1EANA 3V5HB 2HUEA 3RUGB 3D69A 3KM1A 3WJLA 3OAZK 1TZHA 4MNGA 5I0VA 4PLKC 4YHNA 4OCXH 2N1TE 5ABDE 5K9KA 2IDFA 1QTYT 5JHDE 3U4EB 3FQNB 1ED3A 4NWTL 5EZJA 4ZNCD 3I74A 3U1SH 3O2VH 1UZGA 4X98B 2HT3C 2VISB 1UA3A 5HHMB 2WAHA 1MCNA 2VZTA 3ABLB 3QORC 1XTMA 3QORB 4FL4B 4FL4C 2CCLA 3WJMB 3TC9A 4LL4A 5I0YA 2RD0A 5D6CA 5SV4A 3SKJH 3L1EA 4Y89A 2GUOB 2XTJE 5DHVA 3NEOA 4C56A 2XPGB 2YAMA 4LQ1A 4XO3A 5DFWH 4PHZA 3QUZB 3QUZC 1FIGL 1MCFA 1W16A 3RJOA 3FS9A 1F4WL 1I31A 5BVPL 5T3ZL 1ZS2A 4NUGL 3VXNA 4JFDB 4PGDA 5IIEB 4EZMA 1HYSC 4FI8A 3GJEA 1QBML 2QADB 2QADC 2V5TA 3PHOA 4L8CB 5C0CE 3NFSH 4GKZA 4IYKA 5IB5B 1CJYA 1KYUA 1OP9A 1GS6X 4KGJA 1XGUA 3FT1A 5LXGH 4N2KA 2CD0A 4FXTA 4N2GA 5DEJA 3U9PH 1N6VA 4Z7UF 3EBHA 4XAWL 3U4BL 3X1FA 3RX5A 1HOEA 4POZD 4WHDA 3GSXA 5HYJB 1XR9A 4G8GA 3VX0A 5CHNA 1WISA 3IDNB 3SE3A 1JERA 3G6DL 1NJ9B 2WO3B 2ADFH 1FBIH 5DK0B 3IS1X 5JHLL 2OPCA 5D4QA 5T1LA 1SBSH 5INCA 1FVCB 1WAPA 4H0HB 4J6RL 1IBDA 4CILA 3IETA 4H8HA 4ADJA 5A2FA 2AK1L 4JFSA 3DRTA 4GXUN 2UZYA 3KVQA 3KWVA 2DIBA 2AEPH 3WD5H 1U30A 4S0TD 1GGYA 2J1KA 5FA4A 1AIZA 1DDTA 5H2BB 4KI5E 2MFNA 4S1SL 4GI6A 5D7JB 5D7JC 2VM4A 2SODB 4UINH 1UD3A 3MRCB 4NKQB 1MVFA 2YGNA 3QULA 2ZP9A 1K6QL 1GXEA 2FBJH 1AQHA 1AS6A 3CC1A 4XCCL 5DI8B 2AJZA 5F9JB 1RZ7H 2GQHA 1EFXA 4X7SL 3H85A 2VLKD 3E2HB 3E2HC 3KPRB 1X5AA 5GJTL 3QJUB 4G6FD 3V5DB 3KPRE 3TVMD 3M1OA 3KWWA 4BH8B 4YO0B 1KCLA 4Z95H 3UAJC 3BE1L 1UOKA 2HRLA 3RVXD 2C9PA 5ISZA 3WLBA 2HJKA 1CFNB 5HYSA 1QR1A 1PCSA 3ARED 4C58B 2W9EH 4UNIA 4GW1B 1A7PH 4Q0XH 2DQMA 4GMTH 5DTFB 5IMLA 3H9SE 3CLEL 4OW6A 3TBSB 2AJVL 2Z8WC 3V4VH 3H54A 4PTTA 5TQ0L 2XN9E 3SKJL 3FFCA 3X13A 5IQ7L 2V7NB 2FE0A 4Y2OA 2EIBA 3DUUA 3VUAA 2W0FB 4U3SB 1G7PA 43CAA 3G5YB 1F4WH 1UOLA 2VDQH 2O6CA 5BVPH 2WLLB 3G6JE 1WWWX 5EC2A 3W39A 5KW9H 3KPMA 4JDZB 1R3LA 1Q94B 4FTDA 2Z31B 2Z31C 4X9YA 4GG6F 1IGCH 2EE6A 5JW5A 5CJOL 1FV1B 2ZCHL 2UY7A 2IQ9L 3BHBA 5AYUH 3RI5K 3BP4B 4NRYA 4Y2DA 4DKAA 4MA8L 4AQ8A 1W72H 2JKRM 1OIOA 4PJIB 4N0CD 1DQQB 3AUVA 3BDYL 4MJJA 1KCKA 2FJHB 1XF5A 2J1ZA 2GTWB 4V1DA 5FW7A 5A6LA 5K9OA 3OHXC 3OHXB 1QO3B 4OCSL 4DFIA 1N59A 4GAGH 2ZF8A 2WBJD 3D4YA 1DBAL 1NIAA 3ECWA 1A7QL 3E6FA 1YUHA 4JRXA 2Z91A 4AXWA 4B95C 2G4EA 3C9NA 2HRHA 2VDLL 3MCKA 1UT2A 1T04A 3MFGB 5EF0A 5FYKE 2P7TA 4FNTA 3WMPA 3FCTA 4PWGA 5E8DL 3FQYA 3VXTA 5E8OB 1QTPA 1T1YB 1ADQL 4P9HL 3K6SB 5EUOA 2IH3A 4ONFH 5I1CH 4BA0A 3FBKA 4G59C 4M6OH 4OKDA 2R1YA 3BZFA 2GY7B 3NJFA 2RQ8A 2H41A 4F7PA 3ZYOA 3SE4C 3HZVB 5DJYB 2W92A 1L0QA 3IDYC 3IDYB 3NABL 1PZSA 4QTFA 5E00B 3HUJE 1P84K 3NT0A 5E2VH 3D7PA 3UJTL 2DKSA 1HSBA 3H1ZA 3OKOA 3DJZA 3QXTA 2X42A 4KNTA 1F8TH 1MI5D 3GZPA 1IZJA 2C3WA 3L3KB 3WFCL 2E6PA 4LOUC 3TBYA 1WD9A 4KRMB 3GF8A 2ZSVB 1XZWA 3E1F1 3JV4A 4KKAD 2V2XB 5KVGH 2UUDH 1HE7A 1M2OA 4P57B 1T1YA 5C0DB 3CK0L 4JKPL 1Q9WA 1V3KA 3G3LA 3T71A 3J8F7 3MCLH 2XTJB 2XTJC 5BQ7A 2FLRT 1DJIA 2FX9L 4GSDL 4F8PA 4NQXB 2VSCA 3TOPA 4OZGB 4PJ7B 1CLZL 1AQKH 1MHEB 2X4SB 4UNVA 1NAML 3QRGL 1H15B 4FFYA 5CEXA 2IFFL 3BO8A 4ODXA 1OAXH 1ORSA 4GRLD 4XC3H 5CLWA 2WWKT 1TJGL 3LQAC 3EGDA 4JRLA 4R5XA 1BFVL 3GSQB 2AW2A 3NK3A 5ALCH 2HLFC 3V9CA 1SUHA 4GXUM 3ZYJA 1P4LA 4EXPX 3Q5TA 4JN2B 4YHKL 5D8JH 3KJ4B 3KJ4C 3KWXA 1Q38A 1RI8A 1T5WA 2BK8A 4PCYA 3F7LA 1VDGA 1AACA 2VXQL 3NA4A 5DMIH 3ZX1A 4ELMA 3ASNB 3CZFA 4ZMYA 4JY5H 3V55A 5CMAA 1Z2KA 4JJHA 4AQAB 5I5RA 1VCAA 3LZFL 1JZ6A 3FU9A 3DJSA 3JTSB 3UYRH 4YSPA 1DANU 4U7SA 5IUCA 1TIUA 2ZCHH 2LFEA 1N7MH 5KVEH 1YSOA 4Y1AB 1DANT 1OSPL 1SXNA 3A6CH 1HE8A 4IMLB 3GD1C 5DHYB 5EOQH 4F7MA 1JD9A 1B0RB 4RA3A 1BD2B 2IGLA 1U3YA 1PZDA 5B38G 1G5GA 3VD4A 4CA4A 3IK2A 4P48A 4B97A 2F68X 1U3HB 1U3HC 2B77A 3NCYP 4KI5D 5AYUL 3MV9E 4PJGF 2ICEA 2QPFA 5L88L 4WHTB 1NFKA 3DX2A 3SE6A 1VFBA 4GH7B 1DQIA 3T6WA 1SF3A 1QFWI 4GKSA 3GIVA 5I24A 4MA1C 1VACB 4MA1B 4LMQE 1QQDA 2VN3A 4JRXE 2NY5H 3JWOH 5LQBH 4G6AD 2IG2L 4PY7A 5B7EA 4HAFA 3U0PA 1P2CB 1UJ3C 1UJ3B 4Y19B 3EBGA 3KLLA 4RGOH 1ZT4A 3KPSD 2H47C 3H0TA 2ZAHA 3J27A 3U7AA 3G6AA 4M02A 4RGNC 4RGNB 1AHKA 4JDVB 1ZIAA 3GMNB 3ULUD 2ZG2A 5EIIG 4QO1A 4ZJ9A 2CBMA 3BIAX 3HRZA 3OG4B 3PPEA 1WCBA 2Q7AA 2XFGB 1JZDC 3DJ9A 3QQ3B 3B9KD 4GT0A 3H9HA 3HVDA 3L9RA 2QZ5A 4OLVL 4PVNA 1IEBB 32C2A 5FYJE 8FABB 1EUUA 5I8OH 4OJEH 4FG6D 1KJ3L 3DKHA 4PWHA 3RFZB 3RFZC 4L8SA 2AS5M 2DWEA 2R0ZL 4WO0A 1EHLH 1HQ4B 1H3PL 2PXYB 2PXYC 4PLNC 2FD6H 2FX9H 4X4ZA 3IMTA 1MFCL 4F8LA 2YBGA 5EBWB 2QBWA 4TQHA 3WTWA 4TRPL 1RJLA 4F2EA 3ERXA 4IU3B 5LAXB 4NP9A 1E7VA 3OSKA 1MUJB 2NY0D 3Q6GH 1EO5A 2OI9C 1L3WA 2OI9B 4PJXE 3O3DB 3T2OA 4P99A 3STZA 1BM7A 4ZS7L 1M56B 1TVHA 2O5XH 1GHFH 4GSDH 3BISA 4WI2A 1RZJC 2W60B 1EVUA 3K4DA 4QXGL 1OAQL 2Z8VC 1S7SB 4HJ1A 4OF3A 4CADB 3MV01 4OZ4B 3IJHA 4O02A 5D4HA 1NAMB 1J1XL 2VLKB 2IPTH 3JV0A 4P23C 4P23B 4TNGA 5DFTA 1QFHA 3KGTA 2IH3B 1E5CA 2EE3A 5TGBA 1I1AA 3IKKA 1TQVA 2TRHA 2BNRD 3PGFH 1TFHA 3G9VA 5EFIA 4YL4A 1FVEA 3UP6A 3FPYA 2P5WA 4S1DC 4X7TA 3SSGA 4R0LA 3W38A 3BEVB 3QJOA 1I1AD 1E65A 3QORA 2BNQE 5FYLH 1BBJB 4KKLD 4HKJB 1PZCA 4LLDA 3OAUH 1M7XA 3U0TB 1KYFA 1N59B 3D07A 2WLIB 4FF9A 4KY2A 4LU5H 3EG9A 1IBYA 1AKJB 1FO0B 1AKJD 3RDTA 5HGAB 3R1GL 3CDCA 2UY6B 4YHIA 4KBPA 4BD4A 4ZNEA 1L9MA 3C5SB 3HW7A 3US0A 2ZCKH 3CSYB 1XEDA 4RMQA 3VA2C 6FABL 4O9HL 3BVTA 1I1AC 1I1AB 1SYVA 4MMXA 2VQ1A 2F54B 4LSDA 4HG4J 2YN3A 3AU1A 3QJFB 1WS8A 1E40A 3UYPA 3OXSA 3U2IA 3MGTB 1JWUA 1A1MB 1AP2A 4Y8DC 4ZX6A 3JZYA 5CSBA 5GJSH 3AADB 4BFEA 4KXAA 1CWVA 2BIQA 1MHEA 4ETQB 3STZB 4XNDA 3OF6A 4J3UA 4IKJA 4WW1A 5I1GH 4JG9A 1EEQA 2ZIDA 4AMKH 3MA9L 3QYCA 4XRCB 3RZCD 3B7YA 2PETA 4H26B 3FT0A 4YE4H 5SWQA 4MMYB 5EC1B 1N68A 5D5MB 1ZWIB 2BS71 1HYSD 1WT5A 3R8QA 4NQDB 5D6DC 3JXAA 2OMNA 3T77A 5A43C 2F74A 3SKOB 2G3XA 4HDIA 3V8OA 2EVIA 4L1DA 5HY9A 4UYQA 4U6VH 5BS0B 5IEHB 3W57A 3D5OF 3DX8A 2OSXA 4WJ5A 5HVWA 2X4TB 1RUQL 4I2XB 1C9SA 1PZ2A 4DGWC 4JFUA 2C5DC 2R1XB 3VI3B 1BPVA 2AJ3A 3ZZ1A 4MJ5A 1YPZF 2I60L 3E6HA 3ISWA 5E5UB 2ZICA 2VXTH 1WG3A 1J8HE 4PV8A 3JBG7 1OAZH 4ALAC 2BS9A 1PZUB 2KH2B 3E3QE 5F89A 1FBIL 3QJHA 5DUML 3VGHA 2HTKD 4JRYB 1FAKT 4MQ7B 4PG9A 4U49A 4X9HA 4XI5C 2JQMA 3AS0A 1F56A 3C6EA 3NCFB 3ULUC 4PGZA 3QUGA 3G5ZA 4E0RB 4F33A 4FX5A 5GS1C 5GS1B 2P80A 3U0PB 5GGRY 3P3RA 1Q0YL 4DQOH 2CRMA 4Y16A 4AQEA 4F9LC 4M8RA 3UTSE 2MPVA 2VC2B 5CEYB 5TK4A 35C8H 5FWRA 2D73A 1J0KA 2Y7QB 3HJ0A 4JO3H 4MDJA 3MRDB 4G8GD 4V2CB 5AVXB 5KYXB 5AENA 3MCKB 1ZHNA 5IHZA 4MJHA 1U58B 5GPRA 4XTRC 1YNTA 2EEXA 2P5EA 2EE0A 4JANA 4NYLA 4PUBL 5CEZL 1RK0B 1FIEA 2N0KA 2IIJA 1ILSA 4HF5L 3KPNA 2HFFA 5BZZA 2VAAB 4FQLL 3IJ7A 5D71H 5FA3B 1HU8A 1I7UA 1UD2A 3E9UA 3U6XS 1OSZB 1FF5A 4NP4H 2A6KA 3QRFM 2PCXA 3GFUA 4KI5C 1D6EA 1CICA 3KVPA 2VH5L 1EBAA 4FCHA 4FZ8L 2IAMC 2IAMB 5E6IB 5E6IC 3WOVA 4RMTA 1FJ1A 1INQB 4XN2A 4F57L 4AITA 2B9AA 4Q9QH 4DCQB 4N87A 3Q2WA 2J8HA 1IUZA 1MNUL 2OMXB 3QJRB 2IMNA 4W6WB 3PGDB 4PRAA 4BFIB 3DVGB 1NDMA 5FKPA 5C7ZA 3U9UA 1JZIA 3L5JA 3KMDA 5C0BE