4YE0A

Stress-induced protein 1 truncation mutant (43 - 140) from caenorhabditis elegans
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
100
structure length
100
Chain Sequence
GSLNEVENTAQKFCVKLDVAAFKPEELKVNLEGHVLTIEGHHEVKTEHGFSKRSFTRQFTLPKDVDLAHIHTVINKEGQMTIDAPKTGSNTTVRALPIHT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Chaperone Activity of the Developmental Small Heat Shock Protein Sip1 Is Regulated by pH-Dependent Conformational Changes.
pubmed doi rcsb
source organism Caenorhabditis elegans
molecule tags Chaperone
molecule keywords Stress-induced protein 1
total genus 16
structure length 100
sequence length 100
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00011 HSP20 Hsp20/alpha crystallin family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ye0A00
2N0KA 2RH0A 3L1FA 4PBDA 3L1EA 4YL9A 2MNWA 1WGVA 2N3JA 5DS1A 2CG9X 3Q9PA 2Y1ZA 2KLRA 3AABA 4RZKA 2Y22A 4YDZA 3VQLA 5DS2A 1WFIA 4MJHA 4M5SA 2O30A 2WJ7A 3EUDA 3QORC 1SHSA 2WJ5A 4JUTA 1EJFA 4YE0A 4ELDA 3J07A 2KMWA 2Y1YA 3GUFA 3QORA 4I88A 3W1ZA 3Q9QA 2K8QA 3QORD 3QORB 4M5TA 2CR0A 4YLCA 1GMEA 1WH0A 3VQMA 2JKIS 1RL1A 3L1GA 3GT6A 4JUSA 3IGFA 2BOLA 3AACA 4ZJ9A 2XCMC 3GLAA 1X5MA 4PCKA 4FEIA 5LUMA 3N3EA 4YLBA
chains in the Genus database with same CATH superfamily
4G6FD 3GXDA 1D7BA 3DV6A 3TIDA 4ZW3A 5H37A 1TCMA 2DQDH 1R0AH 3BAEL 3CTTA 3UPAA 4MAYB 2YEQA 2CDFA 3HBQA 3WEXA 1QLEH 4G43A 3BZDA 4KAQH 3ZTDC 1F3DH 1A1MA 2EUVA 3ULVE 3BCFA 4G7SB 3MYZA 3DX3A 2F53E 3CVHA 4OKVA 2CSPA 4ZAKC 4E9YA 4WFED 1MHPH 3FT2B 3N85H 3FTVA 2BSTB 5C0FA 4FQCH 3FH7A 1EWHA 5G4NA 3P73B 4A7GA 4OTXH 5JW3H 1SJHB 4NPYA 4RCAA 2WVTA 1JGDB 3BDYH 4OFYD 1QKZL 1YPZF 5HI5C 3O4LE 4TVPD 5TFSH 3DI3B 4NKMB 1U8CB 2GAZB 1WLHA 4PUBH 2AMUA 4C56A 1BD2B 1QSFE 4KI1A 2X88A 5IVZA 1HHKA 4OI9A 3V6BR 2AVGA 1U3YA 4NHCH 1Q1JH 3DVNA 3IJSB 2W91A 1ITCA 3NJHA 4IK6A 3KM2A 3SGEI 4P06A 5KJRH 3DX1A 3BDXA 2GJ6B 4ZMOA 4EQ2A 4X5XB 1NLDL 4GRWE 5FYKH 1ZVSA 1HAUA 3WLBA 1OQXA 3MVSA 5HPMA 1TUPA 3IJ7A 3TJHC 3VFWB 3ULSA 3RX8A 1U41A 4KH9A 1NDTA 4JPKH 4JX0A 4XT1C 3MYJB 4PJGA 1QHQA 2BOCA 1U8HA 5DVNA 4KKCC 4JKMA 4FYRA 4LFHG 1ZLWK 3VACA 4OF7A 3EH4B 3BSGA 3D1MC 1DJZA 2BZ7A 9PCYA 4NX0A 5F7DB 3NAAL 5JA8B 4AW4A 1G1YA 3GMPA 5T5NG 3DMMC 2OTWA 3GBML 1KYUA 3UTQA 2YQBA 5IBTL 5FYKD 5DD1L 1H3GA 3QEUA 3ARWA 3UAJD 2FIRT 2NR6D 4F2MA 1CFNB 1TYRA 2DH3A 2IF7A 3KAAA 3U9UB 3HPLA 3P1VA 4U1GC 4AEFA 2N0KA 1YAZA 3PDGA 2JB5H 3Q3GA 5FUCC 4HS6A 1M2OA 4XC3H 4RFOL 2ZD0A 1XF3A 2WGXA 3EH2A 3GSRB 4I5BA 4DETA 2Y4SA 5FO8B 4YIQA 4LIQH 2OLDA 3PPEA 3II3A 4PGBB 3HLAB 2ISDA 4AJWA 3P2TA 1T1YA 1IZJA 4IK7A 4OGXL 3CBRA 1CFVL 4X9HA 3MBEC 3HCVA 3O0LA 4RRPM 1YA5A 1QKZH 2Y7MA 1BQRA 2JXMA 3OMAB 1TEYA 3L4TA 4HYTB 4OTXL 4CNIA 3B9KA 3RVWC 2X44D 3EO1B 5DJZB 2ZWSA 1F2QA 4MZ2A 3LN4B 4WUUD 4XC1L 3VFUA 2X2UA 1HT6A 1KY6A 1TSRA 3GFUA 3U36A 4PGCB 4TSBH 4JDTL 4GXVL 2YFOA 3MRNA 3NJGA 4FKKA 2EDOA 5CKGA 3STLA 3KZ8A 4QTHB 4K7PH 4B50A 2UWEF 3WTWA 4LLMB 3ZDZE 3QB7C 5F7HA 3BD5A 4Z77B 25C8H 2GK0A 2EIDA 4R5TA 4MJJA 3WD5H 1W0VA 1QW8A 5GJSH 1GYAA 1J10A 5JQ6L 1OAKH 3H1ZA 1MFNA 4WWKC 4V2CB 4W70A 5GHWH 3ULUC 1E28B 5E6SB 3ROOB 5C0JA 1OE3A 3UBXA 3WS3B 35C8H 3O2DL 5E6YA 2OMZB 1HH9A 3QYMA 2MCPH 3NIGF 4A68A 2FT7A 4OIIH 2OL3B 1SM3H 5DDHA 5I8CB 2ZT9C 4F15C 1L5GA 3MRRB 2VWEE 4RMUA 1H3PH 4KU1A 2JI1A 3CN0A 1NWOA 4HUKB 4URKA 5KSAC 3ERXA 4K9EL 2ZONA 3QXDB 5GRZA 1A65A 3UGXA 4X6CB 1PZCA 1Q0YL 3HPJB 2KPWA 2VE6B 2VERA 3V6FA 3HG2A 4ZYKA 2DD8L 2XJKA 4Z3HA 3GO1H 3NFPA 5I74B 1TTRA 4XCEA 3SYAA 5E08L 1AR1D 2A9MH 2AEPL 2PTTB 1C08B 12E8L 3CIAA 3ETSA 3VE0B 1N67A 4Z7OE 3RWDB 5TE6H 2Z35B 3VXME 2A4CA 1XB6A 4FLSA 5GGRB 1SYVB 5FUCE 3K91A 4QRAA 4QYOA 3TURA 3H2WA 1AHKA 3EGDB 1RZJH 1YPZE 1JVKA 2H3NB 2C4FT 3NCWA 3KR3H 3O4OB 4I77H 5DFVC 5ILTL 3C8KB 1YN7B 4L4TA 3BAYA 4TNFA 3G5YB 4Q0XH 1SQMA 5G2NA 2WY3B 7FABL 2ZUVA 1CDUA 4AYDC 4Z7UB 3P77A 2MOGA 2NY3B 1E5UI 5F21B 1NDMB 3N40F 1ZRUA 3SGDI 1J8SA 2X2JA 1GGBH 2GEQA 3OHMB 4I4WA 1CPUA 4PGJA 2FR4A 4UOW0 3QDMB 2VQ1B 2B5IB 5E5RB 2GKIA 4J28A 3NDZE 1DHKA 2ETWA 3HCVB 4YOKA 4AYSA 4JFWA 1I82A 3NAAH 1ETZB 1NJ9A 5EEZA 2F68X 5FYLH 1BXXA 1OARH 4MWFA 1PEWA 3KYOA 4RZKA 1DE4B 3BUDA 1S9YA 4DNLA 4AG4L 1ADQA 4JZOA 1S6NA 1WIOA 4NKOB 2P8LA 2QV2A 3IFLL 3V7MA 3TZVC 4F2FA 2HUEA 1Q9KB 3VVVA 4M7LH 1T7ZA 1KY7A 2XWJA 3HE7A 3ZDXB 4M4RA 5JORA 2ZWLT 4NAMA 1II4E 5L4IA 4RMRA 4A67A 2IXQB 1LE5B 4DK3A 4PBDA 3LQZB 1G9NC 5D4IA 3E2HC 4HUVB 4BKLB 3I84A 1KEGH 5EN3A 2AQRA 1YUHA 1FRGH 3NFNA 1AAJA 3L9RB 4L3EA 1WWWX 3UYRL 3ROOA 5C0JB 2PETA 3MLSH 4NERA 1XWVA 5DMYA 3AREC 2X4RB 3KWUA 1T2XA 4E9QA 2BRQA 2CKNA 3SDDD 1MUJA 2BVUA 3DJ9A 4OJDH 2E7LA 1G7MB 4U2ZA 1QNIA 4BFBD 3QNZB 2Y06H 2FWOB 5DJDB 5E03A 3LEXB 3F5WA 5CP3A 3B83A 4F58L 4LCVA 4BXVA 4GRLC 4BKLA 5K1NA 1S7SB 4QRTB 4PJ7B 3I50H 2VZ3A 1T0PB 3WG7B 1R0AL 3EJSA 5J6GB 4ESKA 1C08A 2Z7ZA 2HTLD 3QK0A 3BIKA 1NPUA 2R2EA 2PPEA 4FTDA 4IMKA 3VWKA 3IJHB 1I1AB 3KD4A 2EEAA 4X42A 4IBTA 3W81A 3J8F7 4RA0C 4MMXB 3B5HA 1Z9OA 2CU9A 2VM9A 4P2RA 1IM3A 3HBPA 3F7LA 2A6KA 4OZHB 1OLLA 3EH5B 3X1BA 2H8PA 3WUWA 3K7UA 2BLFA 5DMIH 3F7KA 5HGDB 1FE8H 2WINB 5KSBB 2ZSVA 5MENA 4X7EC 5DURB 1AS6A 1DVTA 2MPVA 2AKRB 1T7YA 5B1KA 1XAKA 3BQUB 2CXKA 3E6FB 3T04D 1HSAB 2M1KA 1SJMA 5CO1A 3DDGA 4YGVA 3N44F 3TBSB 3C2SA 5AG8A 5I1IH 1CFSA 3LQAC 3ZQ9A 4U4BA 3U4EB 3AU1B 3VCLB 2AF2A 2YA0A 3U4KA 5EEUA 3BEVB 3VDBA 4FE9A 4XP5H 1QWNA 5AVUB 1NDGA 5DYOA 1U42A 4KDTC 2BWIA 1FDLL 3PWPD 1J9TA 2EO1A 5IB4B 4CU6A 4C57C 2HPOA 1WT5C 3LKOB 4GEIA 1IBHA 1RUPH 1MY7A 3C5ZB 5CGMA 4M29A 5DGQA 1OHQA 1BSIA 1AE6H 3R7QA 3KGUA 4WI0B 1Y6KR 3VWJC 2VDNL 1CXEA 3VD1A 3QNYB 2VLLB 3QCUH 2O6DA 2F8IA 2X6BA 5I1DA 5IR1A 2PKDA 3T09A 4AZUA 3EH3B 1QI4A 1H5BB 4M4RB 3MLZH 7TAAA 3RL1A 3QJUB 3GIZH 4G6AD 4X6BB 3C60A 1W0WB 4PV9B 4LNRB 4NUGL 3Q8AA 5K1JA 3E80A 2Z91A 1ZLDA 5TK2A 3I50L 3WTSA 2EDBA 4H44C 1JYXA 5D55A 3D12B 1OAJA 4KRPB 4L2LA 4ZXBB 4F9PA 5IFJB 1GS7A 1YECL 3ABZA 3FTWA 1T4KB 4J4PD 3L4UA 2DYSB 3VFTB 5EN2A 3T3PB 3VI4E 3LPGA 3BSZH 2P52A 5KS9B 1MW0A 4PJBA 4NSKB 1D7DA 4ONGL 3CV5A 4WW2C 1M53A 3WV0A 4MQ7B 2C34A 3Q8FA 4OKVB 4G8FB 1V7NL 3WU1A 2QSQA 2JQZA 4OJCA 3UYRH 3FT2A 3EYSH 4PJCB 4M8UA 1IGTB 3L1OL 5E4EC 3LIZH 3BZ5A 4ZAKD 3O81A 3UTPD 4NQDB 2QVMA 1A7OL 3BIKB 5DEGA 4C56D 1FYHB 4M6ML 3W11D 5ACMA 5DC2A 3FHAA 3EOAB 3N04A 3QULA 1CD1A 5HHXH 3AT0A 3GC3A 4GINA 5EUKA 4DHLA 4H8HA 4XRCB 4J3OC 1NSNH 5K9JL 4NOBA 4I89A 1ADWA 1S7WB 5FECA 4XNXL 5AW4B 3LZNA 1R3LA 1HE7A 3CSTA 3P69A 4IHOB 1WZ1H 2UY7A 1I1CA 1P4BL 3M07A 3SE4A 1EH9A 3FUMA 5C08E 2XIDA 2PWGA 2O1AA 1UA7A 4FG6D 4HLZG 5LBSA 3UP6A 1DCEA 3EOAA 3QULB 2YRBA 3BEVA 3IGLA 4B9GA 5EUKB 3RY6C 4GG6F 1M7DB 3FT9A 3PHSA 3ASNB 2F5AH 2GUOB 2EUWA 4LCUA 1RUQH 4BZ1H 1JMXA 4LE8A 3QEUB 4OZIE 7FABH 1QRND 3FO2B 2BIQA 3PGFL 4GB9A 4IKKA 1ZLVH 2AV7A 1IM9D 3TYGH 3DMMD 2BZCA 2HJFA 3HE6B 4GW5A 5ILTH 5E9NA 3QR1A 3C60C 5JPMB 2AERT 4FTVE 4E68A 1QX1A 4S10A 5CEZE 2PWFA 1MIMH 2NYYD 1RUPL 1CFTB 3AWEA 1OTUD 3DETC 3IDYC 4JFHE 2ZXCA 4OLVH 5FGSA 1DQDH 3FO1A 2VC2H 5PAZA 2NOYA 2H6PA 2OYPA 3TZVB 1XGTA 5E94A 2V7NA 3NK4A 2H6UA 2F18A 5FM4A 5LG1A 2QT6A 2FEEL 5KAQG 5D96B 3FKUS 3V0IA 2GT9A 2KLTA 1OPGH 2GTWA 3QZMA 2VR9A 3AABA 1YNKH 5JMRA 2Q6WA 1BEYL 4QF1A 1L9OA 5CSBA 1LM8V 3T5WA 4CKQA 1XTMA 4CSSA 1CDBA 4KDTA 4AOFA 4CNIB 1ERNA 3QDJD 1MJ8L 3PLYA 5CILL 4WCYH 1MJ7L 1OZTG 3ARTA 1LJMA 3GSWB 3FN0L 1K6QL 2EH7L 2IBGA 3WFDH 3NIFE 3VMNA 1SXNA 3UG4A 4GRWH 1QRNB 2E76C 3QIUA 1NFDE 4AEIH 4UV4L 1SQ2N 4NT6A 4JVWA 4ABVA 1DJWA 3PHQB 1AS8A 1J0JA 1G6VK 3FFOA 3N91A 4FCAA 1XGPB 4HWZB 5GHWL 1LK3H 4N0UB 5DJXB 5GPRA 1MHEB 1H6EA 2IAAC 4G7YL 1L9TA 2FGZA 1N6UA 2NY5C 3F12A 5KVGE 3EDKA 1A6VL 4NZDA 1LWHA 1S2EA 1Q1PA 1U3JA 2E9BA 3IN2A 5AVQB 2EDQA 1BV8A 1Q0XH 3MACL 5DUML 2HH0L 2JKRM 3ARZA 3CDGB 3VXTB 2VN5A 3DX6A 3SDAC 3IFOA 4YLBA 5DDHB 5I1HH 2KYIA 1J11A 4BSWA 2OTWB 2XV3A 4L8DB 1IV8A 4Y4HD 1CBVH 4FNSA 3PCYA 4ZDHB 3FOMA 2YAHA 3I3EA 3SYOA 3VI4F 3GMOA 4E9SA 5A6IA 4CN1A 4Y16C 2DYRB 2F54A 2OMYB 3IK2A 3BVNA 3OQ3B 2P8MB 4IHBA 1GZHC 3CPLA 3TFBA 3X3GH 4MB1A 2OK0L 4XODA 3FQUA 1AKPA 3VGFA 4ZMYA 2HFEB 1CF8L 3DVGB 3SBRA 4GMSH 4TOYH 2AJYH 4MNQE 3DX8A 2FX7L 4YC2C 2DEXX 4UQ9A 4XOBA 2J57A 5BRZE 3STLB 3IMWA 4U6YB 3MCKA 2BIHA 3FU5A 1KMGA 2H3NA 4XE5B 5I16A 3DUHA 4L4TB 5MEQB 1RJYA 5D7LA 1CFQA 3CHQA 2Z4TA 1SDDA 2YD6A 1RHHA 5JHAA 1RVFL 1KFGA 2O93L 2ILLA 1OARL 4KPHL 2UZIL 4KK8C 3X11A 1A4JA 5T3ZL 4M3KB 1FHGA 3DYMA 3TZVA 1FCCA 2DQIL 3H85A 4KRPD 2Y9RT 4K9JA 5H94B 1KPVA 2AXWA 3RDTB 4HLZH 4TLSA 3IB4A 3L16A 1IUZA 1JZDC 3G6JF 1BJMA 5B3SB 3QIWB 4WSGA 5F7LB 2YRLA 2VW4A 4DPBX 1CYWA 1QVOA 2VMCA 3QXTA 3BWAA 3N0PB 3HPJA 5D70H 1S5HA 5CINH 2DQGL 1E5ZA 1INEL 3MDJA 5HDLA 4NCDA 5CCHE 3V52L 4LVEA 2X4UA 5IJCC 1CQKA 1ORSA 3RIAF 5FFLA 5CZVL 3O9WA 1BFOA 4WAFA 5DK3A 1QSZA 3GYRA 3LB6C 3MGOA 1TDQA 5C09B 3FJTA 2BX5A 2RGSA 5D2LE 5IGXL 3WCYA 5C0DB 2KZ1B 1L5GB 3D05A 5B7MA 3SBQA 1OM9A 2I5YL 4YHZH 3OPZL 3ECQA 1U91A 1TJIH 4OCMC 3X13A 4UTAL 2CGZA 1NFIA 1JUFA 3B7UX 3MRDA 4MAZA 3BESR 4ELDA 2AEQH 4DP9X 4Z78A 4I13B 3WHXB 4U3CA 2CDEA 4H88L 2F7OA 4AEHH 4RNRA 1LNUB 1PG7H 1VGEL 5E0FA 2GYSA 4PBXA 1A7PH 1RZ7H 2DY2A 4R97B 3LRLA 4HIIA 1RV6X 5F97E 4NGHL 5KOMC 4FA6A 5I1AB 2XWXA 1UADC 4KNUA 1M56B 3MRNB 4HUMB 2IH3A 5B7EA 5J89A 4W9EC 4AC2A 1TITA 2M8XA 3EBAA 1U6AH 1I1YB 3OAZH 1HHGA 3A21A 2JVUA 3QUZD 1K2DB 3ULVC 35C8L 2C9PA 3WHXA 3S0PA 3CPLB 3UTTE 3UTTA 3IEAA 5FX3A 2WMPA 3QUZA 1T0NA 3X3FL 5LNDA 4H20H 1JPTH 4HU2A 1CR9H 1OAKL 1HC1A 4YEEA 1OP9A 3RRQA 2LHAA 5C9JA 2CR3A 2VXQA 3RU8L 1FVCB 3RUGB 4QHKI 1GZHA 4CRPA 5T1DH 2BVEA 4KHXL 3G9AB 4WU5A 5IJBC 5IB2B 4J23A 4UAHA 4Y16A 5CFAA 5FHAH 5IOPB 3U2SB 1VSCA 5MENB 1AXSA 4LEEA 4DJMA 1ESOA 1OD9A 3CJJA 1RZPA 2A6JA 5SWQA 3ZSSA 4EO5A 4BM7A 3F6JA 5SX4H 3IJEB 1UWYA 5FOBB 2AJXH 5KVFH 2C1OB 1ILUA 2AW2A 1F11B 3MV8B 1MH5A 4MCZB 3DIFA 4WZ9A 3RL2A 5KJ7E 4PJHA 2E86A 4F3FA 2HKHH 3HG5A 5KBMA 5IROC 3RIFF 5I1JL 5I76B 4IRJB 1DSFH 5J57B 5DD6A 1BQHG 4Y5XA 4HWBH 1AY1H 1JAEA 5EPMA 3RX9A 4HGMA 5CSZA 3L3IA 1PW3A 2WLJA 4NQXA 4ETQA 2WVVB 1LVEA 8FABA 1TR7A 4XX1E 1YEDB 3HI1A 3QEGL 3RNQB 3C6LB 3GS4A 4LPWA 5EG6C 4AQZA 2D7TL 3WNOA 5AZ2L 4QO1A 4GP4B 2EDXA 5C0CB 4QXUH 2DRUA 3UC2A 1FI8C 2X4RA 3ABLB 4HJ0C 4L9LB 5DEFA 3TO4B 3VWJD 4AQ1C 2WTRB 1D6EA 3EIFA 2QDVA 1P5VA 4B9JA 4OIFA 2VXSH 4MJHA 4R7DB 2O30A 3DECA 4TPRH 1U3HA 1DEEB 1MW1A 3WUWB 2PYEE 3NP3A 4X6CF 3TXAA 4RSYA 4FQJL 4IGBB 4MQTB 3LPOA 4Z3EA 1RVFH 2PW1B 4G6AC 4D9RD 2UXVA 4WKZB 3DA0A 5D7LE 4DW2L 5MENE 4NXSA 5BNXD 4W4OA 2EVFA 5AWNH 3GXNA 4XP9H 2FSEB 3B8YA 2DQEH 4WNJA 2BHFA 5D6DA 1PCSA 1YN6B 2PCYA 5TDOB 4X8GA 5JOFB 5EZLB 1GY2A 1BM3H 3BJ91 4JHWH 4J4PC 4ACPA 5ABDE 4XO3A 1JF1A 4RMSA 3ULUH 5A2BA 4MNQA 2E5EA 1CF8H 1BZEA 4D0CA 1NEZG 2CJUL 2PO6C 4AH2A 1X3DA 1DVZA 4PUBL 4YHIB 1KCRL 2OYKA 3UTTB 5F7MC 4YUEL 1H3VA 3WNMA 4PP2B 5ISZB 3BQUD 1T1WA 4NN5C 2LV4A 3FQRB 3RP1A 2ZUUA 4DQOH 3OGOE 3WAKA 4J3OG 1MOEA 2IGFL 4Y4HA 5BV7B 1EFQA 1HI6A 5FYJE 1V8HA 1RY7B 3U7YL 1MY5A 5GGVY 1IKFL 4FXKB 2D3NA 4UTBL 1RSFA 4LDLB 5FGCE 1L7IL 3FBQA 2R2HA 2B1OA 4E9TA 3OKYA 5EF0A 3QDJB 4H8QA 1WFNA 4WK4B 1UT2A 4WW2F 4L3EE 5TTRA 2XC8A 4R7LA 1RK0A 1ZT4A 4BCXA 4RFEB 1OSPL 1C5DB 4OUUA 3IKCA 2IALA 2DQHL 3BN3B 3K5RA 1GYVA 1F3JA 3QIBD 1MH5B 4MCZA 4XHQA 4FQIL 1UEMA 4GO8A 3S37H 4CMMA 1DVFD 2YA1A 5C09D 3L48A 3HMWL 3MAWA 3TO2A 4L23A 3SDYL 5CCGE 5IVZB 1A2YB 2HRPH 4MMYA 2OL3L 4ERSL 1GTNA 1AS7A 4HCGA 4NKDA 1HEHC 4IKLA 3SDDB 1BGXH 2BVQB 3U1SH 3VRIB 3T0DA 1IB5A 1BIIB 4RRPG 3UC0L 1QUPA 1WO2A 4PWFA 3OKEA 5CLTA 1JHTA 2X1OA 3Q7JA 3FQWA 3L5WA 2G9KA 1I8AA 3VFGH 4DKFL 1F4XL 1IM9B 4KDVA 4ZD3L 1C9SA 3VFNB 2XZCL 4UNTA 4YHKL 3RVVC 3HOGA 1P1ZB 2YAMA 1FZMA 3ZDYF 1A3QA 3K80A 3LKSB 3RI5K 2V5TA 5F7EL 1ZANH 4HUXA 1AO7B 4BBWA 4HC1H 1B0WA 5I15H 1OTUC 1UOKA 3DSFL 5AZEL 2DV6A 5J3HC 3BGMB 1GOFA 2I26N 4U1JB 3HR5B 5DQ9B 4HAKA 3BRGC 1F1DA 3LKPB 4LARL 5HHNA 3J27A 1UYWL 4QRPD 2DB8A 3QEQE 3T0BA 3VNYA 1URLA 1AQKH 1E3ZA 2IO5A 4G1EA 1XBRA 1FL6B 3LS5L 3MV7E 5D4JA 1G7JB 2JNZA 1BBDH 3CCHB 1GGUA 2WLNA 2ORBH 2GCYA 4L4TE 5I18L 1O5DT 1P9MC 1WUNT 2H7WA 5KUMA 3LZOA 3ISYA 2HKAA 1S7UA 2WQVA 3C87A 5DZOA 3L4ZA 5MERA 2H5UA 5DHVB 1MXGA 1U36A 2QVIA 4HUXB 4OT1L 4KGLA 4PJIF 4IBWA 4QGTA 5HJBA 3GSVA 2YS4A 2F58H 3HUJF 1P84J 4A7VA 3X1FA 3KHQA 3P4OA 4G80B 4ES8A 2I60H 2FSDA 4HJSA 1AZCA 1TJGH 2OMWB 1DLHB 1VPOH 3IFNL 4BKTC 1SEQH 1GH7A 1OGSA 4X7DC 1ETB1 4BFJA 2V2WA 2VITA 1SYSB 4NN5B 4CC0A 5SWSE 1ZTXH 3DTUB 4FJZA 2K0RA 4KMTL 1MJUL 2IDSA 4K0OA 5DQDL 4FLRA 1CFBA 3STBA 4WSKA 1BX2A 2BVYA 2WXHA 1MFEL 2ZYRA 4WFEE 5HGAB 2FX9H 3BKYL 3HBGA 3FMGH 4XCCL 2IGTA 2QGBA 4XWOD 1L6XA 3ARED 4YX2H 1HXYB 4LLMA 5J9PB 1MCRA 4E0RB 3LN9A 5EWIL 4U3HA 4TVPL 2VSMB 1RK0B 1S9WB 3HZKA 2PCPB 3WE6A 2OXGA 1YDPA 2OSXA 4UIMA 1XZWA 4K73A 2PTVA 2XN9B 2W9LA 4JAMB 2CR6A 4K4KA 4F8OA 5J11C 1UQSA 1V7NH 2R0WL 3GSNB 4TVPE 2K1MA 1KELL 2A6IB 3F65A 3GHEL 3PWLB 5FM5M 3V4PA 5AVTB 1X5AA 4DCQB 3NIFB 3TEWA 1NZRA 3LQAH 4OW6A 3D4CA 3CE1A 1OGPA 3SOBL 3TEZA 4QF1B 4XBMA 5FB8B 4OIAA 2BY3A 1AMYA 4UF7C 4G2AA 4UU9A 3KYKL 2YZ8A 3VFSA 2EADA 2EC9T 4HH8A 4OLEA 1HKFA 4ZFFA 2PCPA 4LVOC 5DJCB 5J12C 3VXSD 2IPTL 3MXWL 4HHGA 1YDPB 5JW5B 4ODTH 1JYWA 2FO8A 1J5IA 1A1OA 1BQKA 2OR9L 4FG4A 1HS6A 1LEGB 1Q9OB 1SXBA 2A4ZA 5EO1A 2C9VA 2D03H 4JQIL 2IMNA 1RU9L 2ED6A 4JQVC 5IF0A 1ES0B 4C8XA 3UACA 1G9HA 3HNTL 2E4TA 3RX5A 1BQHA 3GS7A 4KNQA 4LLYB 4YZWA 4GXFA 3U0PB 1WD9A 1W6WA 3MXVH 4LZKA 4Z95H 2CHNA 3OXRA 2FJSA 4L0PB 4X8JA 3CHPA 1I7TB 4JRXD 1JHLH 4OZIB 2W07B 1JGVL 2VSKB 5D7KE 3SZKC 3N9GH 5DK0A 4CC4A 2PF6A 2EZ0C 3A24A 4R4BB 3IFOB 5C70A 4NZUL 4IQHA 3MLWL 4YHML 5AAMA 2J3SA 3MJ6A 1LMKA 2WN3A 2VQ1A 5FKPB 3IGAA 3EYOA 3BT2L 2R0ZH 3B2PA 5DS8A 2V9RA 1NL0L 1F6AB 5FYJU 4GUOA 5IMMB 3UL4A 2OZ4A 2FATL 5T3XE 5JUEL 1F2XK 1I9IL 2NXYB 1A3LL 5C2BH 1U8PB 5LBSH 1CYGA 3EO9L 3MV7A 1RFDL 5FDWA 1BMGA 1XH3A 2E56A 3FQUB 3Q8CA 5F3BB 2P5ED 3CFDB 3QEQA 5LN4A 1E4XI 1F18A 5A6MA 3CQFA 3DV4B 2G0LA 1ZXKA 3SQRA 1HZHL 2AABH 2ZX8A 1PIFA 3MRFB 4IU3A 4MJ5A 5IP4A 4RMWA 4NM8L 4OGAD 4Y8AA 1CT8A 1EAPA 2CBOA 2VDOB 4NQDD 4ZAKB 5EZOL 1RSYA 1GHFH 4PRDA 1M2VB 2UXGA 4M6OH 3SDXB 3UDWA 4NP9A 3BWAB 2O5ZH 2QSVA 1G7HB 1OAUL 4P59H 3LHPL 1TVBB 1CD9B 2DLGA 4YO0B 1YMMD 2C5DC 3T3PF 5K59F 5FCUH 5L0QC 3FFCB 3KS0H 3QFJE 2VZOA 1UKQA 3PABA 4XTRC 5GS3A 3AWFA 4ORGB 4YR6B 3ZR6A 4ZMXA 4JRYA 1RZQA 2A2QT 3MNVB 3P9LB 2X2YA 3CFKB 5IQLA 5C0AE 3FB5B 3L54A 4XPFH 3RZWA 3TL5A 1OT2A 1KN4L 4ZPTA 5BQ7A 4LQFH 3SDAB 4J3OD 2YWZA 3U82B 4DT2A 4M8VA 3M45A 1NBQA 3V4VL 4GI6A 1NC4D 3EFOA 4HW6A 1JZ5A 4AYFB 3HBZA 2FBRA 1PKQB 5EU7C 3WJLC 3I6KA 4EAEA 5A2JH 5BVJA 5D93B 3QDMD 1KDJA 5C7XL 1J88A 1KLUA 4JZNA 1VKXB 2ZXBA 4XWGH 5INCB 2VLKD 4RDQG 4NM4H 1OL0A 4NO5A 4LBEB 4Z78B 2B2XL 5TGBA 3RY4A 1N5YL 5IG7A 5J1AA 5IROD 3VW3H 2GABA 4D7BA 2KLSA 1WGVA 2VQTA 4K71C 4HIEB 5GGVL 3UZQB 4LFHD 4LLWA 1DQIA 3LRKA 2E27H 2PTTA 1HL8A 4J12A 2PYEB 3MROA 3WELA 2XXFA 4QRBA 4J8QA 4XPTL 3GZQA 3IF1B 1J9SA 3KBEA 5ACZB 3NGBB 2G3MA 3DC0A 4YPGA 1HEJC 2OYMA 1AZRA 1XBDA 3IT8D 2QTEA 4P2OC 4MDJB 4EI5A 1RIUH 1TZOA 2NYYC 4A04A 1NDGB 2V33A 5C0ND 2F1EA 2XN2A 3QJXA 4NRZA 3LSOA 4XCFL 4K3JL 5IB2A 4NRYA 4I1RA 3VB8A 3GMQB 3KLKA 1PZUB 1WQVT 2PW1A 1EEYB 5T3XH 1V7MH 4FYQA 4WKZA 1YEKL 1JTOA 2Q10A 4H25B 3IJYB 4DGIH 4ZO7A 5C9JB 3A6CH 3FB7A 4RIRB 3O3UN 1SY6H 5C8JB 1T5KA 3FULA 1RZJL 3Q5TA 2XTJB 5IM7B 1DBMH 3MA7A 5TPWH 1BA9A 1QBML 2NY0B 5CZRA 2APTA 1AO7D 3ZY7A 3NZ8B 2B59B 5MHSE 3OKLA 3VXMA 1INQA 3RB5A 5CBEA 5D6CB 3DSNB 2PWEA 4YL9A 1KBBA 4HGWB 1MAML 3HUJE 5I1LA 4ABUA 2W94A 1W15A 3ROLB 2MMXA 43CAA 1OO2A 2C8NA 1T83C 5KYUB 3MSPA 5CZXD 3O6FA 1AP2B 4M5ZL 5CP3H 3RVTD 5GJTL 5TF1L 2FO4A 5I1AA 3BUQA 4N6RA 1UGKA 2ALAA 2P9RA 3Q0HA 4AL8H 1GVIA 1CXIA 2IH1B 3K2UL 5KYNA 3LEVL 5FV1L 5DK2A 1LO4H 1TVDA 2V37A 3RA7L 4FXKA 5I6MA 4GQPH 3VD9A 1QSEA 1WWBX 2HX8A 2QGCA 2B59A 3MCLL 3N06B 3MFFA 4AIZA 3FUFA 1N3NA 5M7QA 4TRPH 3FTXA 4EPSA 2R69H 5ICXA 4N4YB 3AITA 5DJAB 1HZLA 1BXVA 3KJ6L 4GQ9L 2WXFA 4NPKA 4JY6B 5BZWB 1VADA 2DQUL 5GRXG 3S3SA 4ZFOB 3NDYE 4XI5C 2R56L 4GAGL 2CM5A 2Y1VA 2E7CA 5EZLA 3ZKXB 1MQ8A 1V54B 2FK9A 5HDQL 4BFEA 2FWUA 2GSGA 5EO9A 4G6KH 1A8ZA 2V7HA 2X6UA 3ZUNC 2WXLA 3WIAA 4IGBA 4ABWA 1OWRM 2ALWA 3VGEA 3M86A 4XC1H 3VMOA 4O02H 4L9LC 4GUCA 3NCCB 4QMEA 1ADQH 4YNYB 4FOMA 1KOAA 4H0LC 1V3MA 2WWKO 5EU3A 4ZSOA 4XVOA 2R15A 5FLVA 1GJUA 1PYWA 1XTLA 3NOIA 2CAKA 3AB0B 3AT9A 3KEHA 1CFVH 3GRWH 4HALA 4OGXH 3O2WH 1X7QA 2J55A 4H26B 1E8WA 1FVEA 1P7QD 2V0AA 2DWSA 2ZIDA 2NUTB 2ZJSL 3ZVVA 4KK6D 2Y2WA 4YHOL 4ZFZA 5LQBH 4AYGA 1U2HA 4NHUA 3LS4H 3L7FB 4NNYA 1QEWB 1UWGL 3JWOC 1SGKA 5T33L 2Y2TA 5H35B 1D5BB 5CLZA 4IGBD 1QBLH 2QR0B 3T4YA 3GI9L 2HCZX 4A2FA 4M5TA 2QLVB 1QSVA 2GJ6D 2IDUA 4H8WH 4YBLC 4YSRA 3U4EA 3U7WL 2VJ0A 4LCYA 3FO1B 3GXFA 3GBMH 4V33A 2FLMA 2G2RA 4IRSA 1BLNA 1DJYA 2VAAA 5HVHC 2ZOLB 3NEEA 3VD4A 3C6SA 1F58L 2WNKA 4JJOA 5AZUA 2D9CA 2UZPA 1XGRB 32C2B 4FFYH 1H15B 1UJ3A 3JUYA 2O6CA 5F6IB 4LSQH 3OAZK 3S34H 1N0LB 3SSGA 5E24E 1X5LA 1H8NA 4M1DH 5AYTA 1ET7A 1TMQA 5AVVB 1NEZA 2BSSA 3ZIMA 3H7BA 5GSVB 4XP6L 3CZFB 4G8IA 4MJ6B 4U6HA 5K1VA 4ZZFA 4MAYA 3ULVH 4YDVB 5JOFA 2OTUB 1T3FA 1SN0A 2HVKA 4GS7B 4ODHH 2VLKA 4OLUH 4BH8B 5BMFH 3VRIA 5IBUB 1S9XB 2ZX7A 3L9EA 4BEIA 3MFFB 4ZRGA 5JR1H 3TBTA 1CL7I 2IPUG 3MO1B 4WW2B 4X6EA 3QNXB 2E9WA 2Y7SA 3EFFA 4MMXC 2KL6A 4Y89A 1L3NA 1QLFB 1U8NA 4TUUA 4FNQA 5ICXB 2E0PA 5J6GA 5FUOH 4FG0A 1G4RA 1VZHA 1NCAH 1UT1A 1JFQH 3IU4H 4HH9A 4PRNA 3T6QC 1N5AB 2GB2A 4RGOL 2NY6B 5MEND 4I7ZC 3QDGE 3O3AA 2EDMA 3ZDZB 1VF5C 1BMZA 5DD5H 1OZUA 4CA4A 4ZTOH 5I2IA 4YHPB 3EDEA 2R29L 2BERA 3B2MA 3EJZD 4UDUA 3U83A 4N8UA 5T3ZD 3OAUL 3PF2A 3P3UA 3UEZA 3NCEB 4PJCA 3NEXA 5EBWA 1QUNA 4PMFA 3RBSA 2EXWC 2AQTA 1PLBA 2H1LM 4JFEE 2VZVA 4HWEL 2F54E 4J3OF 2P80D 1ZIAA 1ZEAL 3CLEH 4DTGL 3IMTA 2HSIA 4NS0A 1MAKA 1NCWL 3MLPA 1XGTB 3C5SA 1UFGA 1CE1H 2XSKA 4JCWA 2LFGA 5DZAA 2IG2H 2GVYA 2X0UA 3K2MC 1KENL 4XX1G 1WRFA 4PG2A 1A4KB 5HYSA 4W9GC 4BH7B 2R7EA 2WUCH 4P23B 5E1GA 4X9BA 2IAMA 4NLHA 1IGJB 1JK8A 1BZDA 3MREB 3AXHA 3HI5H 1AOZA 3KYNA 3RILA 1D6VL 3UIYA 1BP3B 5DO2C 3AQZA 3OJ2C 4PJEA 3T4AA 5AENA 2D31B 2N7SA 4ZUWB 5GISL 4U0QB 4KK9C 4LRIC 4OD3H 4WTQA 3WFBH 2WXPA 2XVKA 4PJ5E 5CM1A 2K6ZA 1FZOA 3DURB 3ESNA 1H5BA 4Y7OC 1E4KA 2JJVA 4XE0A 4LSUL 5H94A 1N2RA 3UO1L 2VUOA 5B22A 2ZOKB 1MF2L 1QRKA 5IBLD 5EOTB 5C0EA 4KY1L 4KO7A 5GGUA 5HHNB 1THCA 1ROWA 5LBVA 1OCRB 2PR4L 3G6AB 4HJ0D 1PFCA 1S8DA 3GSXB 4QXTA 3GJEB 5HGHB 3US1A 4G1EB 2IQ9L 3K3QA 4GAJH 1NMCB 1ICTA 3OJDA 3BZ4A 1ZDSA 1PU0A 1SJEA 2MOQA 3F2LA 3NACH 4FFZL 1XH3B 4BFNA 1A6WH 4Y19A 5JYLA 2WWMC 1L9PA 5EU4A 4YDVA 3D0VA 1DQLH 2BM3A 3D85B 3APDA 4X83A 4XPBH 1KBPA 1KCUL 5GGTL 4D8OA 2DMGA 5AOIA 3N43F 2Y69B 4Z3IA 4JFZL 2J6EL 3PHOA 1BD2E 3MZTA 3O6FD 3SPVB 2ENPA 5GGUB 5C1MB 5KW9L 1T21B 2DWDA 3NZHL 4WHCA 2NRDA 3WFEL 2KDYA 1T1XA 3AREB 5CUSL 4P4KC 5C6TH 3ATDA 4UOZA 4XNAA 1TTBA 1DUYA 1RZKC 3A67H 4X8JB 1U3HD 4QWWC 2PO6D 5I74C 2F53B 3E2HB 1DJXA 5C0IB 1JG9A 5FYJL 4ANKA 4QXVA 4AYID 4G8GD 3CVHH 2HFGH 1LO3H 2WUBL 2WXOA 3FUEA 3QXVA 4M7KL 1J5OL 4NZRH 4AQEA 4XTRD 2RQ8A 5AB2A 2EE0A 4YSEA 3C5JB 5ES4B 4N0UA 3ZE2E 3HPLB 1JNNL 4MB4A 4ZMNA 5C08A 2QQNL 5D72L 5GS1C 3VNZA 1ZS8A 4DKDC 2RA1A 3N43B 5ANHA 4IRJC 4YQXL 2IV9A 4XBGB 2FJHB 3EO1A 1RPQA 5DJZA 3X11B 3PS6A 4AGMA 3BP6A 5ID1A 5IOKA 2QKIC 3CFDA 5SWSD 2JCWA 4Y1AD 4NFCA 2AJSH 3E1F1 5T5FH 4PJXE 1YEHL 2KBGA 1A3RL 3TVMD 2K3HA 4FQ1L 1HSBB 4NP4H 1RZFL 3RJQB 1EJOL 3T3PE 1P7HL 1AQ8A 4NO5B 4X80L 4P9ML 2HVJA 3D9AL 1Q0EA 2PPCA 3MV7B 3B9KB 1AQHA 5CJQH 5GRUH 2WWOA 4QXWA 2K6YA 2E6QA 1EA9C 3KEDA 1JPSH 4ZX4A 1NCTA 1C5CL 3E9TA 2YKLH 2EINB 3U0TB 3NP4A 2ZOOA 4NWUL 2GUYA 2NXYC 3MC0A 4G3YL 1JVOA 1AYRA 4OQTH 3RVVD 4PREA 3OL2A 4N0FB 3P9MB 5B39B 4JKPL 2LAAA 2ITCB 1XX9C 3MNVA 1J8HE 3PQYB 1AH1A 5F6HI 4JO2L 2ICWA 4TSCH 4NN7B 3CFUA 1NC4A 3BSHA 1NUFA 2VDRB 4XVSL 1DFBH 2Y6SC 3EYUL 2QKIA 5K93A 1UTDA 1XF4B 2IFGA 2AMGA 3JWNG 1U2CA 5EIIB 3TLRA 4ZJ9A 1JZ3A 4GSUA 3VD0A 1VFAA 3P02A 1PDKA 1DFXA 4GSDL 4WHDA 5GS1A 3M6DA 1P84K 2DS4A 2Y72A 1G7IB 3FB8B 4UTBA 4URTB 2XKUA 1A9EB 1KBGH 4HXBH 3FYIB 1YJDL 4OZ4B 1O75A 4HWZA 4JL2A 5BZXA 2X9XA 4RVBA 3O8XC 2HKFH 5CBEB 4FLQA 1WBXA 2I85A 4YS4A 1UENA 2B8OT 1N26A 2WBJD 1UM4H 2MCG1 2P3YA 3UZQA 3RIAK 3X14A 4EJ1C 1B4JL 4XMLH 3VXNA 2QQQA 4EN3C 2VR4A 3S96A 4MQXC 3C5XA 1SYVA 3V4UL 4AT6B 4RGNE 1TJHH 5ADOH 4FL4B 1DTUA 4OZHE 2XRAL 2OQJA 1R1CA 3MJ7B 3UZEA 4EUPH 4OCWH 2R2BB 1Z0NA 2WQAA 3QUKA 3VDCA 1FGVH 1B6UA 1E50A 3D07A 1QBBA 4ZDHA 2XA8H 1PTZA 5MEOA 1PAMA 5LDUA 1H0DB 2ZKMX 3RPIA 2ZG1A 2FD6L 1GMEA 1OF2A 3ARFD 1JN6A 3KXFB 3U9PL 3B2XA 4XWOC 1TZGH 1GYUA 4N2AA 2HWZL 1B0RA 5DVMA 3W39A 3LJ3A 4K5OA 1U8QB 1DVYA 1CLZL 4AGLA 2QGDA 3BFQG 5F2FA 4APXA 5DUPL 4CU8A 3HZYB 4YSUA 2H8PB 1MRCL 3ISRA 3PGCB 5INDA 5I71B 1K8DB 4FMKA 1QATA 4G6ML 5I0ZA 4TLKA 4JKLA 5HSFA 1IFHH 3T6ZA 4IW4C 1MPAL 4L8BB 4WNQB 4HUWA 2XG4A 1OSZB 1XSIA 3NPZB 1QSED 4FP8L 1JDCA 5CIPA 2EUZA 3KPOB 4F93B 5AFAA 5E99H 3IYLW 2F8XC 4WI5A 1KGUA 3QFJD 1V10A 3ZHFA 1ZWIA 4XMVA 4Z0XB 1RJLA 1Y0LB 2WD0A 4NBXB 4OCRH 3UBXI 3ZT6A 1RZGB 5JHDD 2ZP0T 3KLAA 4Z1PA 5D1XD 4IRZA 5BPPA 4NZTH 2HFFA 1TQBB 3LMJH 1FFPB 1P4LA 4NJ9H 3G5YA 2GG1A 2BNUA 1JP5A 5SX5K 4TQEL 3MRMB 5CCKH 2FEJA 4K2UL 4K3EL 1JPST 3D25B 4QNPF 1N64H 4WJG3 4BSJA 1Q9WA 1HDMA 1G7IA 1EERB 1TCRA 5D1QB 2O5YL 4QLRA 2GBTA 1B0IA 1FNSL 2DQJH 3H0TA 3MV8D 1HKLL 2WP3O 3QDME 1DBJH 3CVDA 3EGXA 1JZ8A 1DVFA 2GSGB 5EO9B 1JGEB 1M7XA 4AVKA 3BWUF 1E9QB 3AG4B 2BFVH 1ZLWH 1EJ6A 2WWKT 5DJ6A 2WINA 2XACC 4FI7A 3HC4L 5JDSA 4M7ZC 4DN4H 2WLIA 3DX9B 4FRWA 4H7VA 3IGFA 4NWTL 1D5IH 1IO4C 4RAHA 1B4TA 4L5FH 1JHKH 1TG8A 4PW9A 2CUHA 4Z5RB 5L9DL 3DI2B 4Y5VA 4MA8H 1SDAB 2GJZA 2VW7A 4OQ1A 5KS9A 1PZ5A 2COVD 1BZ7B 2R23B 4MMXA 4U1LB 3S36H 3TO4A 4ZQTA 3Q48A 2PYFA 5B4MD 1B4LA 2W88A 3AXIA 1FNHA 5HYQA 4ZS7H 4HWNA 4KITB 4PGDA 2ICES 4ZNEE 4HKJB 2XG5A 2XV2A 1A6TA 3Q2NA 2VH5L 4I3GA 2BJMH 5E1IA 4O4YH 3KLHD 4JREB 4MAYC 4OSUH 3SJVD 4KI5D 5CN3A 2VDQH 2FB4L 2AXJA 1A21A 1UGNA 4V11A 3KBPA 5FFOA 2EIEA 1M05B 3DJTA 5E1HB 2V2XA 3PRZA 1EXUA 2B3IA 5D1ZB 2IOOA 4H26A 4ODSL 1MUJB 4XB7A 4Q9RH 3V4VA 2D3VA 3OAYK 1CUOA 1N59B 4V1DD 3FSZA 2B15A 3QRLA 3WSQL 3BKCH 4MXWL 2NZIA 4XP4H 4UIKL 4BUHA 3PFQA 5ESQB 1AXSB 1TJXA 3Q13A 2IDFA 1G9EA 2IANE 1KT2B 4LP8A 2A6JB 5SWQB 4DKEL 1NBYA 5IWLA 3H9SD 1IM9A 1Z1WA 2IBZX 2OMVA 2X9YA 2OJZL 3I6LD 3UCQA 2J21A 5A2LH 4F7TA 4XCYB 2H0PA 5EOQL 5DYFA 1NANI 5FV2A 5BZWA 3M1OA 4EIGB 2EXWD 3E8UH 3ILPA 3QFDB 1CGWA 3L5HA 3U30C 1LK2A 1EEZA 1OK8A 5J7CC 2JWYA 3J07A 5C09E 1EGJA 3S4SA 1Z9NA 4P2QD 4P23A 2RQEA 1B2WL 1FORH 4XVTL 2ZTBA 4ZXBA 4TQ8A 3OM3B 2ZP8A 2XWDA 5I1CL 5I9QC 3TESA 1F41A 3MZGB 3T2NL 5TQ0L 5F0JB 3KNBA 3DUUA 4U6VL 1OSYA 3WUWG 4L9LA 3KLSA 4Q4IA 4X5WB 4HSQA 1BEXA 2EEXA 3HG1D 2C9AA 5DO2D 4XXDA 4IEFB 3KLLA 1CLCA 4AQOA 2NYZA 3FU3A 2WB1A 4ZFZB 2FCBA 1G7LA 5FW6A 2Q7YA 4MJIA 1R33A 2G60L 3ARVA 3K8LA 4NHUB 1MCHA 3L95A 3ZL4L 2VMEA 1IAKB 3OJDB 4ZOEA 1W91A 4PRNB 4FZEL 4QRPE 2WXNA 3DHJA 4WI0A 1MFDL 2PMZA 3A23A 3O3AB 4OCSH 2DYPB 3B7YA 4B7IA 3WKQA 5I5IA 3EAKA 4JG1L 5IBUG 3W2DH 3ZW3A 1VFBB 2PPAA 2H2SC 3UJTL 1FHNA 1E9PB 1I7UB 1KXHA 2WWMD 3MV9B 4JY5L 1JNHA 2BY0A 1ZGLP 4GUQA 3AY4A 1HAWA 3RGVC 1F4YL 5AOKA 4EIBA 1UB6A 2EE6A 1G6RB 1AXTH 2EKJA 3HHSB 5BUGA 3QQ3A 4XO4A 3SKOB 2CIIA 2ZCLH 5IMLB 4CU7A 1Z9MA 1VENA 1PPIA 1YEGH 2BSCA 3BAWA 4AL8C 2PABA 1NCCL 3QXUA 3O6FC 1NMBH 1PL3A 4XN9A 1YC8A 2HX9A 2WQSA 3RWIA 1JNLH 1AKJD 3LHAA 5I8KH 1KGCE 4Z7WF 5D7JB 1QNZL 2L7EA 2NQ3A 4I87A 3LD8B 15C8H 3QUMB 4A1RA 1N59A 3KWXA 1EVUA 2O5XL 3MRFA 1I7UA 4NIKB 5I75C 1EUUA 4R3SB 4JO4H 1M7IB 3S5YA 4AYMC 3HN5A 1UWXH 2BIMA 2JIXA 5CWSA 4HX1B 1EO8H 2YPLB 2EC8A 3CXDL 3ZE0E 5HPMB 5F9OL 5KZCB 3QRBA 3O4LB 1U93B 2Z31B 3F7YA 1OTSC 4WIQA 2A77L 4HEMA 4IIQC 4M7LT 4YVNA 1U8HB 4JFXA 1BOGA 2MPAH 2W65A 4LCWB 4X7CC 3WGUB 3THMH 3ZE0B 3U6RB 1SHXA 3QEHA 2BMKA 1RUMH 4G82A 1WTGT 5DEZA 1J1OL 5CP7B 2AGJL 1NFDB 4V1DE 2DI8A 5ABZA 4OV5B 2RJMA 2J8UA 4X6DA 4G9DB 4OIBA 1QSFA 1BCIA 3MJWA 2EVIA 3FH8A 3FB5A 3WL9A 1G5GA 1FFTB 3KGSA 5BQ7B 4QHUA 5IK3B 4PJFA 3VFMA 4MNHB 2FNBA 1B3IA 1QFOA 3C9NB 3KNBB 3B4NA 4Z7QB 5LGKA 2VWEC 2XKNB 1JE6A 3BPOB 4TS6A 3D6GA 2XFXA 4EI6A 1P69B 5AVWB 5JIHA 3NG5A 2AZUA 3LZLA 3DX6B 3JWOH 4AIOA 2NZ9D 1T83A 4PREB 3KYAA 2KUTA 1ZVYA 2CKBL 4HDIA 4KXCA 5J13C 3VJ6A 5TDPB 2LT9A 3DBXB 2Y24A 1FZKB 4N1CA 3DMMB 3UG5A 4H8WC 3C12A 3MMEB 4P4RA 4FTVB 1UT9A 5B7FA 3WJLA 4TQPA 4YL4A 5D7SL 1LP9B 4D8PA 4EXKA 3ZE2F 5E2UL 5DJCA 1MREL 2XQBH 5AW6B 3UPRA 2NY2B 1KJ3L 4XMKL 5EUOE 3UYOD 4DP4X 1IAOA 1JZ7A 4B9IA 5MERB 1FL3A 5LNEA 4KJWD 4RAVA 5DVKA 4PRIE 3Q1EA 3QS3A 3GMPB 3F7PC 1KLFA 3VTMA 5CKAA 1WA1X 1GY1A 1KTLB 5DHVH 4FNLL 4HJUA 3PJNA 2CKBB 1WBXB 1UXSA 1P5UB 5C08B 4ZS6D 4OF3A 3TJEH 5HXMA 3RX7A 3IMUA 2AQPA 4FERA 4BK8A 1IC5H 4LNVA 1DBKL 3HG3A 2DLFL 4Z3JA 4KZEH 2EXYD 2GY7B 3KGTA 1TETH 5GSRA 4OY9A 1MAJA 4G5ZH 3D51A 4Q97A 3IDXH 4OGYL 1R24B 5E51A 3EOTH 4N5EC 1NICA 1UM5L 5D2NA 4GKLA 4XPAL 5HDRA 5F1IA 1MCWM 1QI5A 4NCC1 1WWCA 4OCYH 1TZIB 2DM3A 2J1ZA 4S1SL 1AGBA 1Q94B 4EDWH 2PXYA 5KN5A 3G5VB 4UZGA 4KUZH 1XZ0B 2V4LA 4EZLA 3WAJA 3VRJA 1BFOB 2JKWA 4TL5A 2QQKL 3B9VA 3BJLA 3GHBL 3OF6A 3BSZA 3VQ2C 2ZWNA 3AQYA 4JG0H 4LHUD 3MTRA 4OLYL 3QIWA 2APSA 1U8IA 5E2TH 2R1YB 3L5XH 4Z18A 4PYGA 2O72A 4X50A 3LIUA 4UU9B 2MCAA 3VFSB 3GMRB 2RH0A 2R2CA 4N2DA 5ERWB 4PLNC 2AV1A 3BT0A 5I66A 1S7XB 1MRFH 1E9OB 1V5JA 4U3SA 5HYJE 4XMXA 2KLRA 4YWGL 1MJJA 2OP4L 4PWIA 4QHLB 4NO2A 4X9YA 1SUJA 1JZEA 2WOYA 4IOSA 2DIEA 2D7OA 3ILDA 1AFVL 3LZPA 4HMDA 1G6RH 4W9ZA 3UGEA 3GNMH 1PNDA 3KPQA 4HIPA 2VLMD 3NABH 1COBA 4LSVH 5E8PB 3TBWA 3ARDB 1AD0B 4JQVA 4OZGF 4M9OA 4GT7A 3FQTB 2Q8AH 1C8QA 1JV2A 3N0AA 4IOIA 4LL4A 3I2CL 4X4KA 1LP9A 4GLRH 2IQAA 3IDJB 3WNNA 1LNUA 1OAZH 3E6FA 4HZ1A 5DA4A 3MJ8A 3B2UD 1G7QA 1YVLA 2GIXA 3IAQA 4R0LB 5EU3B 2MFNA 3TBSA 2CNYA 3MFGB 3CFJB 1ZS2A 4R4BA 1ZPLA 2CIKA 1T2QH 4LP4A 4EE2A 3BP7A 3AG3B 4P46D 1KZQA 4FC3E 1SLVA 1U8QA 4ORZC 3QCVL 5KANG 3WS6C 4F57H 2FBJL 1XMEB 5AEAA 1PF3A 4RISH 5D1XA 5HHOE 3HMXL 2YK1L 4LCCB 3TN0C 4EBQH 2E4FA 3G6JA 2VXTH 3O6KH 5E2VL 1ZK5A 4L1SA 5ENWB 4ATTA 1KZYA 3A6BL 1I7RA 3DVFA 1JN6B 3GXTA 5FLUA 3SN6N 3DPBA 1BF2A 1SXSA 3I02A 1I8KB 1T0OA 2ARJB 1GAFH 2K45A 2V17H 1O9WA 2JI3A 1N9PA 3UCRA 2QZ5A 4A7UA 3OKDA 4UYPA 2Y7OA 1T4WA 4PJ9D 5I1DB 2ZG3A 5LAXB 3PL6A 3CGTA 4HS3A 3HI6H 4BZ2A 1CT8B 1EAPB 4XBPA 1SN5A 1ZLEA 4WV1B 5CU5A 5D7IE 3S2CA 4QTIH 4BDVA 1KULA 3UZVA 3WEMA 4APQA 2RHEA 5JXAL 3JQOB 2J8UF 4X6DF 4LLQB 1IC7L 3OGCB 2AQ1A 2HFFB 4JM0A 5B4MC 2OPCA 1EHLH 1UVQB 3ARXA 4J5VA 4B53A 3WIIL 4PJ7E 1ETJA 1KJVB 4OLXL 4JO3H 4GRMB 5DZ9A 4PYHA 3PJLA 5B38A 4QOKA 2ZXAA 4J1UA 4U1HB 3SE6A 2M83A 1P4UA 2FJFB 2V2XB 1MRDL 3NK3A 4HIXH 4OZGE 4YSPA 5HHMD 3REVA 3RGHA 2YAPA 1XSKA 2WQRA 2ZOTA 1YEFL 5L88L 2JB6A 2M26A 1I4FA 1UOVA 3B9EA 3R19A 2HLAA 3VWKD 1WP6A 4Q8BA 3X2QB 4EOWL 2NNXA 4WV1A 3CSYA 5I8EB 4M62L 4G9FE 4QRQA 5CR8A 2BZDA 4S0TD 4OKDA 4WJKB 2E7BA 4J3XA 3I85A 1NOFA 3B56A 3NCBB 3CH1B 4HUCA 3LPFA 3LZRA 5FUZH 4EUPG 4F24A 5AD0A 3KXFE 3QI9D 3G08B 3B3BA 3P0YH 5JNYB 2AQ2A 3HZMB 4YGVB 5LXGL 4KKAC 1PYWB 2B14A 5D1XE 2ZXWB 2FYYB 1D6EB 2R9HD 3OXSB 3OLDA 4H8UA 4B0MB 1A1NA 3L4VA 1R17A 3CSPA 3V5HA 3VGHA 3B6SB 4KKBC 2FH6A 1NGQL 3TV8A 3WN5B 3KH3A 5F1SA 2ZICA 1E9QA 4ABQA 4C59B 3UERA 3JYCA 1B9ZA 2NY2D 2CRMA 4P9HL 7PAZA 1ID5I 1JGUH 5I30H 3ZKSD 2X1PA 4JR9L 1GSMA 1FVDA 1VAHA 2H0EA 4AGOA 4MD5A 1NGYB 1TO4A 2FLBT 4M56A 3U2JA 4ZMPA 4FTVD 3TVMC 4WI2A 4E9VA 1Z6JT 1WYJA 5TK4A 4PRHB 3BIAX 3BPNC 2WBJB 4RQQB 5DRWB 2OSLA 1E67A 3K74B 4X5WA 4BK5C 1YUKB 3ZE0F 2ZPKH 3OLIA 4JFOA 3OAWA 4AMKL 5FHBH 4PG9B 4ODVH 4QR7A 3BWZA 5A16A 1MLBA 1QTSA 4UV7H 3MA9H 2WXJA 5I76A 1J12A 4MS8D 3HR5A 3ILEA 4WW1A 4D0CB 3DK2A 5DRNB 2CNZA 3ZLQC 1QR4A 5ALBH 5IVOA 4YHIA 5AYUH 4Y88A 1XGUB 3G6DL 4U2YA 3MCG1 3T8MA 2NUPA 1MCOH 4CMHB 1IL1A 4N9GA 2X4TA 2Z8WC 4JUTA 1RURH 1M6OA 1WZAA 1ZA6B 3H7BB 5TE4H 1ZIBA 1CFSB 4WY7H 5JQIB 2NY4D 1R3IL 3CC1A 3KPRD 1EEUA 3ILPB 3QFDA 1LO0L 3D2UB 1MNUH 3MBWA 2EICA 4TULL 1X5KA 1U30A 3VXMB 3OB8A 2W5PA 3Q6FA 5I0YA 5JOEA 3CVIH 3V6ZA 2W9DL 1IQDB 2H2SD 1QEXA 2KERA 3L13A 4HK0B 4Q9QL 3BP5B 4RDQF 2MTPA 4N8VB 4M1GL 2W0LA 3OLEA 3V95A 3KVQA 4JDZB 2GBUA 3UEQA 1N8OE 1CU4L 2BDNL 2ATKB 1QFUH 3ZYIA 2WBJC 3TBYB 4PH8A 4AC4A 3WN6A 4ZODA 4XNUH 3SD5A 3HRZC 4EN3D 4KMQA 3C09B 3ZKQD 4MQXD 4KI5F 5CBAB 1FH5H 5ALCL 2V3FA 3IMSA 3R1GH 2DI9A 3TNMB 4RGMC 2Q7YB 1EXGA 2CGRL 2OFQA 4J4PA 2PR9A 3T77A 1GCFA 1X5IA 4O5LL 2FUTA 3HJEA 3GMNA 4HAGA 2WJ7A 3L4XA 4IIZA 2Z31A 5HJDA 4W4OC 4HD9A 4NQVA 2DMCA 5E56A 3N1FC 1KYFA 2IADB 3QQ4B 4BE5A 5GGQL 2WLYA 4EI0A 2YQGA 5C6WH 4NQEA 5E8NB 1JF6A 2WXIA 4OLZH 4BV1A 3UJJL 2VXVL 1OLZA 4IIQB 2DLTA 4U1JA 3AM8C 5A7BA 1NAMA 4P5TA 4G8GB 5HYFA 4L3CA 4GSQA 4AQ1A 3GTTA 3ZMNA 5KYXB 5TDNA 3T77B 4HCRA 4OZHF 3B1UA 3NJNA 1SLUA 3EXLA 1DDHA 1WAAE 1EANA 2IBBA 3APMA 1IIKA 3AT8A 3KYNB 3MRQB 4O2CA 5FK9B 3VX0A 4FABH 1OGTA 1PSKL 3SJVE 2HT3D 5KVGL 1GS6X 4F7KA 1TENA 2GITB 3P4MA 1KB5A 3BEWA 1WC7A 3QCTH 4MYPA 4DH2A 1A2YA 4G43B 4KKNA 4DVBA 3ZTNH 4Y5XC 2JK5A 2WKLA 1NAKH 4H5SA 5ETUA 4N0CC 4NKIH 3WIFB 2H1PL 4DN3L 4K15A 1BWWA 2P5WE 3G04B 1I9RH 2OMWA 5E2WH 3T8VA 4PS8A 4FD0A 2NUPB 1XGYH 3L3DB 5F6HJ 3M8OH 3D39B 1JGLH 4FI6A 1RJYB 1YQVL 3NSDA 4KGJA 4X5RA 1BYNA 1XSJA 4CADB 1QD0A 5A7EA 3VQMA 5CEXB 2N56A 4NQSB 4NZFA 4HKZA 2YSSA 5GZOA 4M61A 2HN7B 2DQ6A 2VKWA 3NIGB 1XIWC 5LCVA 2IAMD 4GEJA 4X6BA 2VDKH 2Y5TB 3DOSA 2Z8VC 4L0ZA 5CD5D 4E0RA 3TONA 4IBQA 4KX7A 1YMHB 3CZEA 4JKNA 4P2QE 4OFYA 1AIFB 1R3KB 2HRGA 1UXSB 4LVHB 3VXPA 3ZDXF 4ONHB 3F04A 5DRZA 3ZTCC 1WE5A 3BLKA 3D39A 3DJRA 5E6IB 3AQDA 5I6KA 5I1GH 2VR3A 4LASH 4UIMB 2Z7WA 4CADA 4UQBA 3R06A 1ZSHA 3MRJA 2NY3C 2OMTB 5DJ8A 3BH8B 4FXTA 1HXMA 3O9WB 3D39D 4MGXA 2J72A 2E8ZA 3L3OB 3QC5X 4QKTA 5AG9A 4V1DB 4O00A 4BSWB 2J2ZA 1HN1A 5FXCH 4HV8A 4O9HL 2B0SH 3K6OA 4N24A 3BPLC 5DHEA 1S4IA 4IRZL 5D71L 5TDPA 2Z0BA 3PDOB 3MUJA 4MB3A 3T71A 3TEXA 5BO1H 1SBSL 3JTSA 1FG9C 4P4RB 3SJVB 3N1QC 5A2FA 3HC0B 3QP3A 4HCRH 5GZOD 3GUFA 1RIHH 1LILA 3KJ4C 2OMBA 4YLCA 1NKOA 2YPLE 2YN3A 3Q3GB 1FLRL 3CMOH 4KTDL 1XZ0A 4K8RD 4XPGL 1TZ8A 3UBXB 1KPRB 3I9GH 3QZWG 4JGNA 3SGJA 4NRXA 1USQA 4MAYD 3JWDH 1UCBH 3QUYD 5T1KB 1QRNA 4OFVA 1P6WA 3QT2A 4DGYH 3PHQA 3Q2LA 3PGDA 1I3GH 2YXMA 3FU9A 3QDGB 4MRCA 3OB0K 4KTDH 1N0XH 2AJ3A 2ENSA 1A6AB 4I18A 1WEJL 3O9WC 4FQLL 2NY6D 3PJSB 4OM1H 4UQ2B 1IBGH 2ED7A 4LRNH 1J86A 1NGWA 1PNCA 4UQ3B 1GJIA 5F1KC 5LVEA 1J1XH 3MV9E 4BZ2L 1VCBC 3IJSA 4KKPA 1IAMA 4QYOB 3IGAB 4XZ4A 4YH6A 5H37G 1KGIA 1J1PH 1KLFB 1N7MH 4XAKD 4LK4A 1A4CA 4HHWA 5KAQF 2NW3B 2NQDA 4GO6B 4OGQC 2QKIB 4N9OB 2CBQA 3VGGA 1WV7T 5JIMA 3BVNB 2BW4A 1A0QH 3S88L 4MMZB 2EH8H 1P7QA 3TJPA 5ITBL 4ZW5A 1PDKB 1VCAA 3DTXA 5C09A 2BOBA 2AAAA 3QZLA 2CALA 2XZAH 4KJYA 4M93C 1GGTA 3GMMA 3NEOA 5LBGA 3PIQA 4F91B 2R4SH 2PP8A 4LGSB 4ENEC 5KSUA 2A83A 3TBCA 3K6IA 3LSOB 5L7XL 4AV0A 1YNTF 2QV4A 3P3RA 1P5UC 4XVUD 1CFNA 5KBDA 3KPRB 2BNUB 1AVAA 2K8MA 4FN0A 3G5VA 1GOHA 5GRJL 1TSHA 2EDJA 2I27N 5F9JB 5E2WL 3MRJB 3AG1B 5DZPA 3FBKA 4HJ1A 1IGCH 2P42B 3PXHA 3OHXB 4MAUH 5TE7L 5E6RB 3ZTNL 4DGVL 1UWEH 1UD4A 3NJKA 4N1HB 3P30H 1Y18A 3WI9A 1CVSC 3ZTJG 1VKXA 1GYWA 1W72L 5E8PA 1A6ZB 3APCA 4RMQA 5L6YH 2A5UA 4PS4L 1HYSD 1KEMH 4KVCL 3SGJC 2LU7A 5CMAB 5JIQA 3ROLA 3RGVD 1MFCL 4WGWB 4Z76A 2X4QB 1R5WB 3T0XA 5KVDE 4N86A 1IGFH 4O02A 2I25N 2KHAA 1KC5H 1KYDA 2JF1A 1BZ9B 2CLRA 4TLUA 2DW5A 3UROR 2VLRD 5CJ5A 2C1PB 2QSTA 1XCTB 3TEUA 2MNJB 1T7WA 1OAYL 4W9JC 4ZT1A 4J8RB 2W0FB 1OSEA 1O6TA 3GMQA 3INUH 4Y2OA 3QJFB 4DP1X 1IFGA 1BFVH 1OHZA 2D4FA 2EDLA 2FL5A 3TBVA 4MHHI 1BQLH 3CFQA 2C26A 2BIIA 3FFCA 3FAXA 1FH5L 2A1WL 1VADB 1S7RA 2DIJA 2Z92A 1YYLH 2B08A 3L1EA 1J05A 2APXA 4UZUA 1OB1A 1I85C 3OKMA 3CVBA 3SOTA 3QUKB 4DK5A 1CI5A 4ELKB 1AGCA 2B77A 2J4WH 3QARA 1XCTA 4M6NH 4N1EA 5I0VA 1F3RB 2BWDA 3L5IA 4OZGB 4GMTH 5HGDA 2OSWA 3T3MB 2ODIA 3QI9A 1GTFA 4IS6A 1R46A 4F8NA 3BKJL 4Q9BA 3OGCA 3GDCA 2VSCA 1KNOA 1MIEH 1SXAA 2D4DA 4HPYH 1KFAL 4UILL 1ASOA 1MQKL 2IV8A 1LO5A 4FZ8L 4QHLA 1KB5L 2CUMA 2YGNA 3AU0A 3LD8C 5JHDA 5BVJB 4TULH 5D7IB 3MJ9A 1ROCA 3BN9C 3P3SA 4TF4A 2DJUA 2NNAB 4ZFGL 3Q5YA 2DMKA 2BVTA 1C8PA 4G6JH 1SOKA 4EMZA 1J8RA 5IT2H 1U3ZA 2PW2A 4G7RB 3QWOA 3UTOA 4L8CA 1OGAE 1RURL 3GLDA 3EHBC 5EFIB 3TFKD 1FIGH 2H32H 3BPOC 1X4XA 4MCYA 2CBTA 2YR3A 2HUHA 1W9XA 3UTSE 4A2MA 2Y23A 5ALBL 1S7VB 4Y5VB 5TJWK 3WTXA 3EG9B 3TVMB 1YYML 1W8EA 3RWJA 1LTXA 1YNLH 2EDFA 5C0DA 1FZJA 1BZ7A 2R23A 2PWHA 3C75A 4UCFA 1H9DA 2F19H 2NY1B 2QMKA 5HHOB 1YG9A 3LPPA 4E9RA 5C0RH 6FABH 1S78D 2FVNA 2Z7YA 3GUTA 4U6XA 1IM3B 3JXAA 1SN2A 1LD9B 4AQ8A 4GS7C 1UOLA 4NRYB 3UJIH 6TAAA 4GI8A 4U31A 2VLRA 1OE2A 2ZYHA 2WNGA 2F6AA 4LCIL 4JEGB 3FB6A 5B1CA 4PJ6A 4DZ8A 4LOEA 3L3GA 3F01A 4YK4B 4MRBA 2CLZA 4ZX5A 1JRHL 2CO6A 1CZ8H 3NIDB 1Q9WB 1SOSA 4JPVL 4HS8L 4UT6H 3DX0A 5BZDB 3DBSA 5I19H 2R2BA 2NY7L 4HZAA 4D9LL 1HJCA 2CK0L 3MV9A 4TVSa 4WDIB 5L8KB 4GKSB 4NQCB 1PKQE 1U3HB 1QP1A 4LSPH 4O51A 4WU7A 3MRLA 4ODWB 2O61A 4Y4KC 1KCVH 2B1HL 4PRHD 1UVQA 5A3IC 3MGTB 1K3IA 3EFDH 3L45A 3ZK0A 5EIVA 4UT9A 1NPJA 3U4BL 3O6FB 3H4HA 3MLVH 1S7RB 4M62H 5DFVD 3EBHA 3SHSA 1A7RH 1BAFH 2MKWA 2GIMA 2F1BA 1NGXA 1SJXA 1UG9A 2Q7NA 1OALA 3RGVB 4RGNB 5DR5H 4Z0BL 1CTNA 2BC4A 5TQ2H 2KQNA 4JHUA 4P05A 4FX5A 3W9EA 2WKOF 3QORB 3CLFL 3MLTB 1QFWH 1MCKA 1VLXA 1H15A 4X0NA 4U1MA 1XXDC 3MUY1 1SJHA 2E8YA 3EJYC 1D7CA 1FLTX 1QLRB 2B1HH 3FU8A 1P2CA 4GIOA 4P9HC 5HJ3B 3MRPB 5EU5A 4R2GB 2G3ZA 3FQNB 3VWJA 4PJDA 4MASA 1E6JH 1KGJA 3UAEA 3I6GB 1J8HA 3O2DA 2QHLA 5EORH 3ARRA 5GSVA 1XB3A 3CFBB 3VFTA 3V5KA 4KWUA 1M1SA 3PWPE 3D2UA 5KG9B 3A3YB 4IRSB 5K9OA 4DUVA 5SV3A 2Y07H 3T0AA 1FNEB 4Z7VB 4AQ8C 1IGYA 2HLEB 4JFSA 4RA3A 1CZ8L 3MV01 1B6DA 2W92A 3H42H 3S5LG 2OX5B 2WZ5A 4XCNB 3TS8A 1F13A 32C2A 4R7NA 1G5AA 3AY2A 5IJVA 4LCIH 2X4PA 3RNKA 1FAIH 4LLUA 4DOHB 3NFSH 1ZT7A 1UD8A 3C2AL 3FCGA 4HETA 4ZFFB 2VQUA 3IU3B 2ICWJ 2CHZA 5DD0H 3TA3B 3IMRA 2VDKB 1S7UB 2PXYD 4YDKH 2YUVA 1U8OB 3PV6A 5BW7A 2ZWZA 3LX9A 6FABL 1T03H 1BVLA 1W0YT 3DURA 4PJXA 2QFPA 1FVEB 1U33A 2OCFD 4UB0L 2ZCKL 4D94A 5E8DH 2VIRA 3DOSB 4CVWA 2YPVH 4F9PC 1RIVH 3TH4T 2P24B 3UH8A 2MOVA 4P46C 1XIWD 4JRWA 4QHNB 1ZV9A 1CE6B 1C1EH 1OAZL 4TLTA 2N1TE 3HNSH 1LP9E 4S1QH 4N25A 1LQSR 4HHAB 1IEBB 4WK2B 1LE9B 3VFNA 1KJ2B 3PWJA 4KXZI 2DBLL 1CIDA 2YFNA 3HNSL 1XR9B 4LSVL 3GHPA 1J18A 5C0BA 4WWOA 1I8IA 3H2PA 2XQ0A 2VL4A 2RIKA 1EJFA 2YXVA 3IBOA 5DTFA 1PQZA 3TT1H 2R0LL 3JUZA 5B3NA 3MBXH 2AEIT 3MLXH 3OZ9L 4YSTA 3WYRA 4BFGA 1EAJA 4PJ9C 4R83A 4TTDD 1WT5A 4Z7QE 4NNXB 2WZPA 3HKFA 1M3JA 2LLLA 5AW1B 1BFTA 3AREA 3WY2A 4CSZA 2R0KH 4CGUB 2KI6A 2HJKA 3FO9B 3GSUB 3RWCB 4LMQI 3PWJB 5AW7B 2J88L 3MHZA 4IDJL 1TEFA 3QRGL 1UFUA 2V5MA 4YXHL 3V4VB 1X9QA 3MR9A 4HISA 3HIZA 3FDWA 1MCCA 4K8RC 1FFNB 3VG0L 4XGZB 4Y9CA 4OLWH 3FCTA 4ADIA 3GEWB 4RLDA 4QTHA 1IBYA 2Y5TA 1WFMA 3HE7C 4R9HA 4K3DL 4P2OB 1AZBA 1KT2A 5GIRB 2EDRA 1EV2E 3N2JA 2WKGA 1QLFA 3AXLA 1OCCB 2DKSA 4FI8A 4OJEH 3R7RA 1KIPA 1XQ4A 2G75B 2Q76B 2PPDA 2WK2A 4H0GA 5PCYA 4YK4C 1AC6A 1N5AA 1QO3B 2GHWB 2OM5A 4GQZA 5J6HA 3BP6B 5ID1B 4P3CL 1DQJB 1NGPL 4BCZA 1FPTH 4ZZKA 2I7OA 3LEYL 3O9WD 2NY6C 2AJVH 4KX9A 3VI3B 3GK8L 2EIBA 1L0YA 2VDOH 3KPMA 4G5ZL 4YE4H 2GT9B 4XCNA 4YFDB 3TN0A 1F4WH 5ID0B 3DGCR 5BJTB 2X4PB 3QXDA 3IVKB 4JGMA 3V5DB 3I3DA 3P73A 2RFXB 5E5MB 3V8OA 3MLVL 2HZHA 2AFNA 3AMLA 4Q6KA 4R7VA 1YEEL 3U4BH 3HRZB 1IILE 5KS9F 1P1ZA 1DUYB 2NY2C 4HMCA 4E9LA 4IU2A 1I9JH 4PTUB 4RMTA 5AQ0A 1OKEA 4PB9L 2WZAA 3US0A 1AZUA 4GXUN 4QCIA 1KCWA 3QG7L 2J2ZB 5DUJA 1XV8A 2WSDA 3EYFA 4OFPA 3LOWA 3VI3A 5T1LB 2R1XB 2WXKA 3SO3C 1MCIA 3TT3H 3PAZA 4NKQB 2FX8H 5DRXB 1PZAA 3ATFA 5I19L 1I3UA 2X1XR 3QUMH 3T0EA 1IC4H 2XN0A 5D9SB 4DQAA 2FZ3A 4G72B 2IPUK 1JV2B 5KVMC 1NCJA 1LE9A 1IJNA 3ZTEA 4TV3A 2NX5B 4PJGB 1Y1UA 1NIAA 5DWUH 2AITA 4XVUC 5FDYA 1QA9A 4NQSA 1V05A 1JZFA 5KBNC 3RFZC 3LQMA 3DOIA 1NGWB 5FC9A 2EYRA 4X7SL 1TPXB 2XNAB 1IKOP 3V9CA 4RX4D 1K3ZA 1T0MB 3BLBA 4QJ3B 4CMHC 1U58B 1TVHB 3ABKB 1F8TL 2NY4C 1CURA 2HLFC 3D33A 4ONFL 2JMRA 4NN7C 4XO8A 3KW8A 5FA4A 2AJUH 4PJFE 5HDBB 1P0SE 4DP5X 4IJTA 2CDEB 3WKMH 4F5CA 1KBWA 3GSUA 3VSTA 1KJ2H 4EIZC 5FS5A 4ZUVB 5FO8A 1PS3A 2J8UE 4X6DE 5C2UB 1N4XH 1UB5B 3B7SA 5JYMA 4XOAA 4UQCA 2F8OA 2WOBA 1Z2KA 3OF6D 1T1YB 2AGJH 3WHE0 3UADA 3EYOB 3PIQB 2BNQA 4G7VH 4KO5A 2J1KA 4PWGA 1S3KH 3FN9A 1DJSA 3UPCA 2IPKB 4Y0GA 3RHWF 4AM0B 4HEME 2GJJA 2ZUYA 4O58H 5HHVL 4UQDA 1IFRA 3KL3A 2X87A 4J3OH 4IM8A 2UY6B 4FZ8H 4MMZA 3PUUA 1F3DJ 1R47A 2AK4E 5GRVL 1ACYH 3GXIA 1A4JB 1D2OA 2RCSH 3QDJE 4H1LG 4DGYL 2P4AB 3DJSA 5CNHA 3O6LL 3RWEB 2MRYA 1BF8A 3DV4A 4XVJH 3HG0A 1XF2B 2NY0D 1MWAL 4N2GA 2RCSL 4C83B 5DGRA 4BD4A 1U8JB 3GBNL 1E2ZA 3C60D 5D2NB 4AQAA 3MJGX 2L0DA 4F27A 3OKOB 2EO9A 5TGBB 4BWUA 4TXVB 2H32A 3O8XB 2VXUH 1OM3L 4BWTA 4L8SB 2R4RH 3BMWA 2OCJA 3O41A 2DDQL 3RJDA 5IW6B 1KN2H 1MELA 2IJ0C 3LTVA 2XG4B 1GC1L 2ZCLL 5J12B 1R3JA 1GIGH 1QI3A 3OKKA 4I2XA 4L3FA 4CVZA 4O9HH 4Y5YA 3KJ4B 1ED3A 2WANA 2OYLA 4X6FA 5GS2D 4ODXB 2GJRA 3G9VA 4HP5A 1XF2A 5D7IA 4KDWA 3RVUD 1Y18B 2XWEA 3BHBA 3QA3B 3RURA 2VUYA 1U92B 4F8TA 3RVXC 1TTGA 3P9LA 3BPLB 3WKML 2VISB 5JPNB 1KB9J 3TF4A 2P49B 4FZEH 1CB4A 3KPSA 1E65A 2VR5A 4FNRA 4AK2A 4ILDA 3D52A 2K78A 3VA2C 4TNWK 4HK3N 5HY9B 4FCHA 5GRYA 3TA3C 1XFPA 2FL5B 3FOLB 1OP4A 1BJ8A 4AZ8B 3EUUA 3GJFK 1BDYA 3GMLB 1UZ6F 3HRPA 5DLLA 4HPOL 4GOSA 1P7BA 3CNKA 4HBCH 3RDTA 4Q4EA 5HGGS 3WEOA 3GMMB 4A2DA 3DKHA 3T2PA 3TX4A 3B9KC 2C9SA 5CF3A 5D1QE 4N68A 4DGVH 1UH4A 2A0LD 3WMQA 3ZQWA 5E8OB 1NC4B 2A9NL 5I1CH 3QJFA 1S78C 2A74A 1IGCL 2ZNWA 3F7QA 2EYTB 4BQBA 2FEDD 3SDAD 1KJVA 2H26B 1I9RL 1K5NB 3DROB 5CJOL 4C4KT 1FORL 1J9QA 3OLGA 4QOKB 2VLRE 3O3DA 1CXFA 1WISA 1AHMA 1S7TA 4MA3A 3K2IA 1A5FL 3G5XB 4GO9A 4HKBA 1NQBA 3KPSD 5GS0C 1E5YA 4X4XB 4YAQA 2APFA 4Y16D 1RJLB 3ARSA 3CVCA 4HBCL 3LV3B 3RHWK 3LH8A 5CIPH 4X4YA 2GK0B 2BVOB 4DKAA 2CLVB 3MV8E 4CJ1A 3V10A 4AYBA 1QTYT 1G43A 3WXWH 4L8BA 4WNQA 3HUJA 3HR6A 4B3EA 1A3ZA 1BVOA 2IANA 2WLKA 4QXGL 1MEXH 2YBRB 2PCFB 2X70B 3GK8H 5A3ID 4DAGL 1HU8A 5IVXA 3D18B 1NC2D 3MLYL 4GSRA 5C8JA 3MNWA 2C3HA 4K3HA 2WBXA 1DQML 2OMUB 1JD7A 2OBGA 1IBDA 2WGNB 3MA7B 3NTCL 2E6JA 3OQRA 5CJXC 3V0HA 5F7WC 2ZCHH 4G7QB 1OV8A 1F90H 4GIPD 5GQBA 3RTQD 2A6DA 5DMKB 5T1JA 3LYRA 4K7FA 5LO7A 3QH3A 2H9GB 1J1XL 5DXWA 2UZYA 4XZUA 3AS3A 3QUYC 4LSTL 4HSCX 3VGAC 4A39A 1OF2B 3B5TA 5KTEL 2VH5H 2OMVB 1O9VA 3OTTA 1RI8A 3SPJA 4QRFA 1YMME 1HDMB 3KXFD 1NMCC 4XNUL 4TQHA 4HFUL 3M46A 5JXEC 5F7UA 3NSYA 4IDJH 1P53A 2AQ3A 3O3BA 4XAWH 1VEOA 1I3GL 2ODHA 4HA1A 1JZIA 4I3SH 4RGMB 4ANWA 4DK6A 4W9LC 4MA7L 1X9LA 3ARBD 3ARDA 3HS8A 3WJJA 4BQCA 2GTZB 5DMKA 4HOWA 1JZ2A 3GKWL 1Y6MR 4KQ3L 5C0AD 5J1AB 5HHQB 2JLPA 1OY3B 1F5WA 2NY1C 1Z5LB 3K71A 3ZSTA 2WB7A 2NXZC 1NM4A 4UT9H 1GPOH 4N2BA 1CMOA 1CGUA 1RKRA 4HJGB 3NCJL 3F7VA 4KVNH 1IAIM 5EC1A 1ZWIB 2DIBA 3GI8H 4B41A 1F86A 4PRIA 1A7QH 5DMGD 1JZ4A 4X9GA 3SPHA 3WMPA 4D9RE 1B3JA 2GC4C 5EZJA 4Y5XB 1N4XL 4DP2X 5TF0A 1CDYA 1N18A 3LKPA 2XG5B 2YGOA 1SEBB 2VDLL 5DVOA 2DQTL 2P46B 1SOXA 3B43A 3QR2A 2BXYA 2DM2A 2XWZA 3MREA 4WO0A 3K4AA 1I8MA 3HE6A 3JT2A 1RIVL 2ARJA 4GW5B 4ZFQA 4ONOA 4LVNC 4DP0X 1WIUA 2NW2A 4MXQD 3UIZA 4ZSOB 3FQNA 3EG9A 4PJEB 3TVMA 5D4HA 5HHPB 3O6MH 4DEPB 1BZQK 1J8HB 3PQYE 5IM7A 4P5RA 3IAPA 1I8IB 3OZKA 3LH2H 5E4OA 5MP6H 5DD3H 4F8QA 1HHJB 2I9TB 2BC4B 1JGEA 3KVDD 2CJSA 4JN1L 3WO3B 4W93A 5AYQA 3NH7L 5DJ6B 4NIYE 3QJQB 4HKXB 2QADD 4KTEH 4U3XA 3NA9H 4XCYA 3WFCH 5I1KL 4TTDC 2WCGA 1XCWA 2FJFA 3NSFA 3M8OL 3F8UB 4KXDA 3D18A 1HYSC 2JB6B 1WAPA 2WLLB 5E8NA 1AIZA 4LPUA 5F9WB 1NBZB 2YO3A 4XRCA 4V1DA 4BFRA 5C3LD 1BPVA 4FNTA 3QIUB 5D7JD 1VRSA 1UUSA 3QFJB 1OF0A 3QG7H 1JDAA 1E6OL 1G7LB 2XOTA 1BVNT 1HINL 3R4DA 3TO4C 1RULH 4C4KO 2FO1A 2R1WB 1RUAH 2WQXA 4R26H 1G0DA 1KIPB 2NSMA 1H8OA 3SDXE 2QHRH 3IXTB 3ZE2B 4FABL 5ICZB 4BA0A 3QAZC 3U4AA 1LP9F 3QEHB 1A7RL 3BPCB 3MRGA 1NMAH 3JV4B 5F6IC 3BMVA 4PJGF 3FTZA 3L3KB 4CILA 1KBKA 2QHRL 2W9EH 1UACH 3DXAB 4GBXC 5KBLA 2NZ1A 4WI9A 2DQFB 4HIXL 1KTDA 3BE1H 1JXFA 4POYA 2D7NA 4JO1L 5F8RC 3EFDL 5I17B 4JO3L 1L3WA 2JELL 3BH9A 3ULUF 4UMGA 4JPIA 2I07A 3MODL 4U1MB 1E2VA 2FQEA 1CK0L 1IC7H 4PJDF 1WHPA 5C6PB 3US9A 4QHMB 2Q3XA 4NC0B 4E2OA 2K4AA 4CMMB 2HJLB 5C92A 5G4OA 3LAFA 1OOAA 5AL8A 2CA3A 2Z93B 2CDFB 4JCLA 2C4XA 3R1GL 4KO9A 2NPLX 1QRNE 3GRGA 3K6SB 5DJ0A 5HVFB 5IF0B 3CZLA 4HZLB 3D0LB 1OCZB 2ICEC 4YHLL 2BCKA 2JJTA 4DO6A 2ZOWA 1EEQA 3GJEA 4MBRA 2NW3A 1QEWA 5F3HB 3BN9D 4JFHD 3KBFA 2A99A 3QORC 2IWKA 3BZ4B 1UA6H 1XCQB 4GFTB 4M48L 3HG4A 1NCOA 4AXWA 4XNQA 1SDDB 3NCYP 2QR0A 3FO0L 3T4YB 1MFMA 3OSVA 3BZFB 2ZSWB 3MODH 1C12B 2GAZA 3TFKC 3D34A 3DYOA 1G9MH 4PJAA 3U0WL 2UZXB 1YYMH 3IWVA 4PP1C 3TT1L 4LF3A 2Q3AA 1T2QL 4ZUUB 4LKXB 5HTSA 2H0FA 1DBAL 3I9AA 5FKPA 1OAQL 3PWLA 3BQUC 3BVXA 5C0FB 1MNUL 2VR7A 1FIGL 3AXLB 1PZBA 4JB9L 4Q2ZB 5CJQL 1O7DC 2OMNA 3SKJL 2EVHA 1MHHA 1JWUA 1MHCB 4G6JL 5F88A 1UUNA 4MSWB 4J39A 4LL1A 3OKNB 3MLUH 1U8CA 2QGEA 1MCOL 4S1DC 4S2SA 4U4IA 5ADPL 1OAQH 4PY7A 5GS1B 4NSKA 4M7JL 2N0MA 1J0HA 2LAGB 1YEHH 2D8KA 5EC2B 4PJEF 1CDHA 4BZ1A 3QHFL 1GMIA 3L3JB 3U0WH 1M6UA 5CD3B 2X12A 4JNXA 3CHRA 5ITFB 4DEWA 1MIEL 4AMKH 4LLVB 4J6RH 3IS1X 3UZEC 4N3TA 4KQ3H 5ISZD 3PWVA 5DD0L 3NSCA 4I3RH 2FHBA 4ONHA 2BK8A 2X9WA 1G7HA 3MX0B 5CMAA 3GSNL 4JM4L 2G30A 4Q6YA 3TPUA 3BZEA 4IU2B 4PTUA 1JDDA 4HIHA 4L37A 4E41D 4EIUA 4AEEA 4NAQA 3MRGB 2QMJA 4PQXA 5JXEA 2E59A 2YRPA 1ZTXE 1PZ2A 1F6FB 1GC1C 4JN1H 4P9HH 1V3JA 4D2NA 1OXYA 5ABAA 1DCLA 1MZZA 1MI5B 3N40P 4CAGA 1HSBA 4LSTH 3FTSA 5CN2A 4FQQB 5K69A 5D2NC