4YEBB

Structural characterization of a synaptic adhesion complex
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
321
structure length
321
Chain Sequence
SCPSVCRCDAGFIYCNDRSLTSIPVGIPEDATTLYLQNNQINNVGIPSDLKNLLKVQRIYLYHNSLDEFPTNLPKYVKELHLQENNIRTITYDSLSKIPYLEELHLDDNSVSAVSIEEGAFRDSNYLRLLFLSRNHLSTIPGGLPRTIEELRLDDNRISTISSPSLHGLTSLKRLVLDGNLLNNHGLGDKVFFNLVNLTELSLVRNSLTAAPVNLPGTSLRKLYLQDNHINRVPPNAFSYLRQLYRLDMSNNNLSNLPQGIFDDLDNITQLILRNNPWYCGCKMKWVRDWLQSLPVKVNVRGLMCQAPEKVRGMAIKDLSA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Latrophilin-3
publication title Structural and Mechanistic Insights into the Latrophilin3-FLRT3 Complex that Mediates Glutamatergic Synapse Development.
pubmed doi rcsb
source organism Mus musculus
molecule tags Signaling protein
total genus 74
structure length 321
sequence length 321
ec nomenclature
pdb deposition date 2015-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF13855 LRR_8 Leucine rich repeat
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.80.10.10 Alpha Beta Alpha-Beta Horseshoe Leucine-rich repeat, LRR (right-handed beta-alpha superhelix) Ribonuclease Inhibitor 4yebB00
4XOSA 4QBZA 1O6SA 3KJ4A 4R5DA 1OZNA 3ZYNA 2BNHA 3FXIA 1A9NA 3RFSA 3G04C 5FTTB 3PMHG 2P1QB 2WQXA 3RIZA 4LI2A 5IJBA 4HQ1A 3VQ2A 3W3KA 4FD0A 4CILA 4IM6A 4V2EA 4FMZA 4FCGA 4C2BB 1OTOA 1XEUA 3UN9A 3UL7A 2Z65A 3WPCA 1U0ND 1IO0A 2IFGA 2CA6A 4Y61B 4CC4C 3M19A 3TSRE 4BSUA 4Z61C 4P8SA 5B0TA 4AW4A 4R5CA 2OMWA 2Z7XA 2JQDA 2P1MB 4R08A 5D3IA 4LSXC 4K17A 5IJDA 2ASTB 4B8CD 1P9AG 4QXEA 4BV4R 3ZYJA 3WPEA 4OQTA 1P8TA 3RGXA 1GWBA 3BZ5A 4TZHA 1OTMA 1P8VA 2UZXA 4BSRA 4M7EA 1FQVA 3CVRA 3WPFA 3G39A 1PGVA 4MN8B 3OGMB 4Q3GA 2Z62A 1OOKG 2XWTC 2Z66A 3C6NB 4U08A 4U09A 5CMNA 4PQ8A 1FO1A 3WPIA 1A4YA 5GS0A 4FHOA 3W3MA 1KOOA 2Q4GW 3RFJA 2P1OB 1FT8A 2OMXA 2V70A 4LXRA 5HZLB 2JE0A 2V9SA 4J4LA 5GMHA 1G9UA 1O6TA 4R0AA 4NKGA 2OMUA 5B4PA 1H6UA 1WWLA 3OGLB 3UL9A 4R6AA 3G06A 4Z94G 4I6JB 4LSCA 3WPGA 4R07A 4M7EC 4R6FA 1LTXA 5HDHA 1XCDA 3OJAB 3ZYIA 1XECA 1M0ZA 4L3AA 1YRGA 5B0NA 2O6RA 1K5DC 1H6TA 4PKIG 2Z64A 3RW7A 3ULUA 1OTNA 3VQ1A 4FDWA 3SB4A 3P72A 4BSSA 2JE1A 3G3BA 3RJ0A 3WPBA 5AWDA 4R58A 2UZYA 3C6OB 1Z7XW 2BEXA 2P1PB 4Q62A 3ULAA 5LFNA 4ARNA 1D0BA 5GMFA 3M18A 3E3ZA 4GLPA 1ZIWA 2OMTA 2WQWA 2FT3A 3ZYOA 4V2DA 1XWDC 2Z63A 2O6QA 2R9UA 3W3NA 5A5CA 2O6SA 1SQ0B 4U7LA 1DS9A 5GQRK 1QYYA 4QC0A 5AZ5A 2Z7XB 4U06A 5AWCA 4V2CA 3DZEA 1M9SA 4MQWX 3W3JA 4Z79A 3C6PB 3WN4A 4CP6A 1DCEA 3WPDA 2ID5A 5IYXC 5GMGA 2P1NB 2WQUA 3O53A 4C2AB 4WYKA 3E4GA 4H09A 1JL5A 3OGKB 4P91A 2V9TB 4GT6A 2OMVA 4LSAA 3G3AA 2Z81A 4R6JA 1OGQA 4LXSA 4Q3IA 4PEQB 4RWTC 3JB9j 4NKHA 2Y5QA 5AWAA 4ECOA 2OMYA 4R09A 4KT1A 4LI1A 4ARRA 3W3LA 1K5GC 3RFEA 2XOTA 4YEBB 2WQVA 3UL8A 4UFRA 4CNMA 3CIGA 3A79B 4CNCA 2RA8A 1DFJI 4RCAB 2ASSB 4PERA 1KOHA 3RW6A 2OMZA 3CIYA 4XGOA 4Z64C 2WFHA 4KNGA 4Z8GA 4KXFB 2Z82A 4WP6A 4PSJA 3E6JA 4FS7A 4L3FA 1M9LA 3W3GA 1XKUA 5CMPA 3RGZA 4ECNA 2A0ZA 2ELLA 4J0MA 3OJAA 4EZGA 3O6NA 1FS2A 4CC4A 4R6GA 5IJCA 1O6VA 2RR6A 4RCWA 1M10B 5AWBA 4LSXA 5GS2B 1W8AA 3E2JA 4G8AA 3WPHA 3REZA 4XSQA 4AY9X 3ULVA 3GOZA
chains in the Genus database with same CATH superfamily
4XOSA 4QBZA 1O6SA 3KJ4A 4R5DA 1OZNA 3ZYNA 2BNHA 3FXIA 1A9NA 3RFSA 3G04C 5FTTB 3PMHG 2P1QB 2WQXA 3RIZA 4LI2A 5IJBA 4HQ1A 3VQ2A 3W3KA 4FD0A 4CILA 4IM6A 4V2EA 4FMZA 4FCGA 4C2BB 1OTOA 1XEUA 3UN9A 3UL7A 2Z65A 3WPCA 1U0ND 1IO0A 2IFGA 2CA6A 4Y61B 4CC4C 3M19A 3TSRE 4BSUA 4Z61C 4P8SA 5B0TA 4AW4A 4R5CA 2OMWA 2Z7XA 2JQDA 2P1MB 4R08A 5D3IA 4LSXC 4K17A 5IJDA 2ASTB 4B8CD 1P9AG 4QXEA 4BV4R 3ZYJA 3WPEA 4OQTA 1P8TA 3RGXA 1GWBA 3BZ5A 4TZHA 1OTMA 1P8VA 2UZXA 4BSRA 4M7EA 1FQVA 3CVRA 3WPFA 3G39A 1PGVA 4MN8B 3OGMB 4Q3GA 2Z62A 1OOKG 2XWTC 2Z66A 3C6NB 4U08A 4U09A 5CMNA 4PQ8A 1FO1A 3WPIA 1A4YA 5GS0A 4FHOA 3W3MA 1KOOA 2Q4GW 3RFJA 2P1OB 1FT8A 2OMXA 2V70A 4LXRA 5HZLB 2JE0A 2V9SA 4J4LA 5GMHA 1G9UA 1O6TA 4R0AA 4NKGA 2OMUA 5B4PA 1H6UA 1WWLA 3OGLB 3UL9A 4R6AA 3G06A 4Z94G 4I6JB 4LSCA 3WPGA 4R07A 4M7EC 4R6FA 1LTXA 5HDHA 1XCDA 3OJAB 3ZYIA 1XECA 1M0ZA 4L3AA 1YRGA 5B0NA 2O6RA 1K5DC 1H6TA 4PKIG 2Z64A 3RW7A 3ULUA 1OTNA 3VQ1A 4FDWA 3SB4A 3P72A 4BSSA 2JE1A 3G3BA 3RJ0A 3WPBA 5AWDA 4R58A 2UZYA 3C6OB 1Z7XW 2BEXA 2P1PB 4Q62A 3ULAA 5LFNA 4ARNA 1D0BA 5GMFA 3M18A 3E3ZA 4GLPA 1ZIWA 2OMTA 2WQWA 2FT3A 3ZYOA 4V2DA 1XWDC 2Z63A 2O6QA 2R9UA 3W3NA 5A5CA 2O6SA 1SQ0B 4U7LA 1DS9A 5GQRK 1QYYA 4QC0A 5AZ5A 2Z7XB 4U06A 5AWCA 4V2CA 3DZEA 1M9SA 4MQWX 3W3JA 4Z79A 3C6PB 3WN4A 4CP6A 1DCEA 3WPDA 2ID5A 5IYXC 5GMGA 2P1NB 2WQUA 3O53A 4NZTM 4C2AB 4WYKA 3E4GA 4H09A 1JL5A 3OGKB 4P91A 2V9TB 4GT6A 2OMVA 4LSAA 3G3AA 2Z81A 4R6JA 1OGQA 4LXSA 4Q3IA 4PEQB 4RWTC 3JB9j 4NKHA 2Y5QA 5AWAA 4ECOA 2OMYA 4R09A 4KT1A 4LI1A 4ARRA 3W3LA 1K5GC 3RFEA 2XOTA 4YEBB 2WQVA 3UL8A 4UFRA 4CNMA 3CIGA 3A79B 4CNCA 2RA8A 1DFJI 4RCAB 2ASSB 4PERA 1KOHA 3RW6A 2OMZA 4NZRM 3CIYA 4XGOA 4Z64C 2WFHA 4KNGA 4Z8GA 4KXFB 2Z82A 4WP6A 4PSJA 3E6JA 4FS7A 4L3FA 1M9LA 3W3GA 1XKUA 5CMPA 3RGZA 4ECNA 2A0ZA 2ELLA 4J0MA 3OJAA 4EZGA 3O6NA 1FS2A 4CC4A 4R6GA 5IJCA 1O6VA 2RR6A 4RCWA 1M10B 5AWBA 4LSXA 5GS2B 1W8AA 3E2JA 4G8AA 3WPHA 3REZA 4XSQA 4AY9X 3ULVA 3GOZA
chains in the Genus database with same CATH topology
4XOSA 4QBZA 1O6SA 3KJ4A 4R5DA 1OZNA 3ZYNA 2BNHA 3FXIA 1A9NA 3RFSA 3G04C 5FTTB 3PMHG 2P1QB 2WQXA 3RIZA 4LI2A 5IJBA 4HQ1A 3VQ2A 3W3KA 4FD0A 4CILA 4IM6A 4V2EA 4FMZA 4FCGA 4C2BB 1OTOA 1XEUA 3UN9A 3UL7A 2Z65A 3WPCA 1U0ND 1IO0A 2IFGA 2CA6A 4Y61B 4CC4C 3M19A 3TSRE 4BSUA 4Z61C 4P8SA 5B0TA 4AW4A 4R5CA 2OMWA 2Z7XA 2JQDA 2P1MB 4R08A 5D3IA 4LSXC 4K17A 5IJDA 2ASTB 4B8CD 1P9AG 4QXEA 4BV4R 3ZYJA 3WPEA 4OQTA 1P8TA 3RGXA 1GWBA 3BZ5A 4TZHA 1OTMA 1P8VA 2UZXA 4BSRA 4M7EA 1FQVA 3CVRA 3WPFA 3G39A 1PGVA 4MN8B 3OGMB 4Q3GA 2Z62A 1OOKG 2XWTC 2Z66A 3C6NB 4U08A 4U09A 5CMNA 4PQ8A 1FO1A 3WPIA 1A4YA 5GS0A 4FHOA 3W3MA 1KOOA 2Q4GW 3RFJA 2P1OB 1FT8A 2OMXA 2V70A 4LXRA 5HZLB 2JE0A 2V9SA 4J4LA 5GMHA 1G9UA 1O6TA 4R0AA 4NKGA 2OMUA 5B4PA 1H6UA 1WWLA 3OGLB 3UL9A 4R6AA 3G06A 4Z94G 4I6JB 4LSCA 3WPGA 4R07A 4M7EC 4R6FA 1LTXA 5HDHA 1XCDA 3OJAB 3ZYIA 1XECA 1M0ZA 4L3AA 1YRGA 5B0NA 2O6RA 1K5DC 1H6TA 4PKIG 2Z64A 3RW7A 3ULUA 1OTNA 3VQ1A 4FDWA 3SB4A 3P72A 4BSSA 2JE1A 3G3BA 3RJ0A 3WPBA 5AWDA 4R58A 2UZYA 3C6OB 1Z7XW 2BEXA 2P1PB 4Q62A 3ULAA 5LFNA 4ARNA 1D0BA 5GMFA 3M18A 3E3ZA 4GLPA 1ZIWA 2OMTA 2WQWA 2FT3A 3ZYOA 4V2DA 1XWDC 2Z63A 2O6QA 2R9UA 3W3NA 5A5CA 2O6SA 1SQ0B 4U7LA 1DS9A 5GQRK 1QYYA 4QC0A 5AZ5A 2Z7XB 4U06A 5AWCA 4V2CA 3DZEA 1M9SA 4MQWX 3W3JA 4Z79A 3C6PB 3WN4A 4CP6A 1DCEA 3WPDA 2ID5A 5IYXC 5GMGA 2P1NB 2WQUA 3O53A 4C2AB 4WYKA 3E4GA 4H09A 1JL5A 3OGKB 4P91A 2V9TB 4GT6A 2OMVA 4LSAA 3G3AA 2Z81A 4R6JA 1OGQA 4LXSA 4Q3IA 4PEQB 4RWTC 3JB9j 4NKHA 2Y5QA 5AWAA 4ECOA 2OMYA 4R09A 4KT1A 4LI1A 4ARRA 3W3LA 1K5GC 3RFEA 2XOTA 4YEBB 2WQVA 3UL8A 4UFRA 4CNMA 3CIGA 3A79B 4CNCA 2RA8A 1DFJI 4RCAB 2ASSB 4PERA 1KOHA 3RW6A 2OMZA 3CIYA 4XGOA 4Z64C 2WFHA 4KNGA 4Z8GA 4KXFB 2Z82A 4WP6A 4PSJA 3E6JA 4FS7A 4L3FA 1M9LA 3W3GA 1XKUA 5CMPA 3RGZA 4ECNA 2A0ZA 2ELLA 4J0MA 3OJAA 4EZGA 3O6NA 1FS2A 4CC4A 4R6GA 5IJCA 1O6VA 2RR6A 4RCWA 1M10B 5AWBA 4LSXA 5GS2B 1W8AA 3E2JA 4G8AA 3WPHA 3REZA 4XSQA 4AY9X 3ULVA 3GOZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XOS A;  4QBZ A;  1O6S A;  3KJ4 A;  4R5D A;  1OZN A;  3ZYN A;  2BNH A;  3FXI A;  1A9N A;  3RFS A;  3G04 C;  5FTT B;  3PMH G;  2P1Q B;  2WQX A;  3RIZ A;  4LI2 A;  5IJB A;  4HQ1 A;  3VQ2 A;  3W3K A;  4FD0 A;  4CIL A;  4IM6 A;  4V2E A;  4FMZ A;  4FCG A;  4C2B B;  1OTO A;  1XEU A;  3UN9 A;  3UL7 A;  2Z65 A;  3WPC A;  1U0N D;  1IO0 A;  2IFG A;  2CA6 A;  4Y61 B;  4CC4 C;  3M19 A;  3TSR E;  4BSU A;  4Z61 C;  4P8S A;  5B0T A;  4AW4 A;  4R5C A;  2OMW A;  2Z7X A;  2JQD A;  2P1M B;  4R08 A;  5D3I A;  4LSX C;  4K17 A;  5IJD A;  2AST B;  4B8C D;  1P9A G;  4QXE A;  4BV4 R;  3ZYJ A;  3WPE A;  4OQT A;  1P8T A;  3RGX A;  1GWB A;  3BZ5 A;  4TZH A;  1OTM A;  1P8V A;  2UZX A;  4BSR A;  4M7E A;  1FQV A;  3CVR A;  3WPF A;  3G39 A;  1PGV A;  4MN8 B;  3OGM B;  4Q3G A;  2Z62 A;  1OOK G;  2XWT C;  2Z66 A;  3C6N B;  4U08 A;  4U09 A;  5CMN A;  4PQ8 A;  1FO1 A;  3WPI A;  1A4Y A;  5GS0 A;  4FHO A;  3W3M A;  1KOO A;  2Q4G W;  3RFJ A;  2P1O B;  1FT8 A;  2OMX A;  2V70 A;  4LXR A;  5HZL B;  2JE0 A;  2V9S A;  4J4L A;  5GMH A;  1G9U A;  1O6T A;  4R0A A;  4NKG A;  2OMU A;  5B4P A;  1H6U A;  1WWL A;  3OGL B;  3UL9 A;  4R6A A;  3G06 A;  4Z94 G;  4I6J B;  4LSC A;  3WPG A;  4R07 A;  4M7E C;  4R6F A;  1LTX A;  5HDH A;  1XCD A;  3OJA B;  3ZYI A;  1XEC A;  1M0Z A;  4L3A A;  1YRG A;  5B0N A;  2O6R A;  1K5D C;  1H6T A;  4PKI G;  2Z64 A;  3RW7 A;  3ULU A;  1OTN A;  3VQ1 A;  4FDW A;  3SB4 A;  3P72 A;  4BSS A;  2JE1 A;  3G3B A;  3RJ0 A;  3WPB A;  5AWD A;  4R58 A;  2UZY A;  3C6O B;  1Z7X W;  2BEX A;  2P1P B;  4Q62 A;  3ULA A;  5LFN A;  4ARN A;  1D0B A;  5GMF A;  3M18 A;  3E3Z A;  4GLP A;  1ZIW A;  2OMT A;  2WQW A;  2FT3 A;  3ZYO A;  4V2D A;  1XWD C;  2Z63 A;  2O6Q A;  2R9U A;  3W3N A;  5A5C A;  2O6S A;  1SQ0 B;  4U7L A;  1DS9 A;  5GQR K;  1QYY A;  4QC0 A;  5AZ5 A;  2Z7X B;  4U06 A;  5AWC A;  4V2C A;  3DZE A;  1M9S A;  4MQW X;  3W3J A;  4Z79 A;  3C6P B;  3WN4 A;  4CP6 A;  1DCE A;  3WPD A;  2ID5 A;  5IYX C;  5GMG A;  2P1N B;  2WQU A;  3O53 A;  4C2A B;  4WYK A;  3E4G A;  4H09 A;  1JL5 A;  3OGK B;  4P91 A;  2V9T B;  4GT6 A;  2OMV A;  4LSA A;  3G3A A;  2Z81 A;  4R6J A;  1OGQ A;  4LXS A;  4Q3I A;  4PEQ B;  4RWT C;  3JB9 j;  4NKH A;  2Y5Q A;  5AWA A;  4ECO A;  2OMY A;  4R09 A;  4KT1 A;  4LI1 A;  4ARR A;  3W3L A;  1K5G C;  3RFE A;  2XOT A;  4YEB B;  2WQV A;  3UL8 A;  4UFR A;  4CNM A;  3CIG A;  3A79 B;  4CNC A;  2RA8 A;  1DFJ I;  4RCA B;  2ASS B;  4PER A;  1KOH A;  3RW6 A;  2OMZ A;  3CIY A;  4XGO A;  4Z64 C;  2WFH A;  4KNG A;  4Z8G A;  4KXF B;  2Z82 A;  4WP6 A;  4PSJ A;  3E6J A;  4FS7 A;  4L3F A;  1M9L A;  3W3G A;  1XKU A;  5CMP A;  3RGZ A;  4ECN A;  2A0Z A;  2ELL A;  4J0M A;  3OJA A;  4EZG A;  3O6N A;  1FS2 A;  4CC4 A;  4R6G A;  5IJC A;  1O6V A;  2RR6 A;  4RCW A;  1M10 B;  5AWB A;  4LSX A;  5GS2 B;  1W8A A;  3E2J A;  4G8A A;  3WPH A;  3REZ A;  4XSQ A;  4AY9 X;  3ULV A;  3GOZ A; 
#chains in the Genus database with same CATH topology
 4XOS A;  4QBZ A;  1O6S A;  3KJ4 A;  4R5D A;  1OZN A;  3ZYN A;  2BNH A;  3FXI A;  1A9N A;  3RFS A;  3G04 C;  5FTT B;  3PMH G;  2P1Q B;  2WQX A;  3RIZ A;  4LI2 A;  5IJB A;  4HQ1 A;  3VQ2 A;  3W3K A;  4FD0 A;  4CIL A;  4IM6 A;  4V2E A;  4FMZ A;  4FCG A;  4C2B B;  1OTO A;  1XEU A;  3UN9 A;  3UL7 A;  2Z65 A;  3WPC A;  1U0N D;  1IO0 A;  2IFG A;  2CA6 A;  4Y61 B;  4CC4 C;  3M19 A;  3TSR E;  4BSU A;  4Z61 C;  4P8S A;  5B0T A;  4AW4 A;  4R5C A;  2OMW A;  2Z7X A;  2JQD A;  2P1M B;  4R08 A;  5D3I A;  4LSX C;  4K17 A;  5IJD A;  2AST B;  4B8C D;  1P9A G;  4QXE A;  4BV4 R;  3ZYJ A;  3WPE A;  4OQT A;  1P8T A;  3RGX A;  1GWB A;  3BZ5 A;  4TZH A;  1OTM A;  1P8V A;  2UZX A;  4BSR A;  4M7E A;  1FQV A;  3CVR A;  3WPF A;  3G39 A;  1PGV A;  4MN8 B;  3OGM B;  4Q3G A;  2Z62 A;  1OOK G;  2XWT C;  2Z66 A;  3C6N B;  4U08 A;  4U09 A;  5CMN A;  4PQ8 A;  1FO1 A;  3WPI A;  1A4Y A;  5GS0 A;  4FHO A;  3W3M A;  1KOO A;  2Q4G W;  3RFJ A;  2P1O B;  1FT8 A;  2OMX A;  2V70 A;  4LXR A;  5HZL B;  2JE0 A;  2V9S A;  4J4L A;  5GMH A;  1G9U A;  1O6T A;  4R0A A;  4NKG A;  2OMU A;  5B4P A;  1H6U A;  1WWL A;  3OGL B;  3UL9 A;  4R6A A;  3G06 A;  4Z94 G;  4I6J B;  4LSC A;  3WPG A;  4R07 A;  4M7E C;  4R6F A;  1LTX A;  5HDH A;  1XCD A;  3OJA B;  3ZYI A;  1XEC A;  1M0Z A;  4L3A A;  1YRG A;  5B0N A;  2O6R A;  1K5D C;  1H6T A;  4PKI G;  2Z64 A;  3RW7 A;  3ULU A;  1OTN A;  3VQ1 A;  4FDW A;  3SB4 A;  3P72 A;  4BSS A;  2JE1 A;  3G3B A;  3RJ0 A;  3WPB A;  5AWD A;  4R58 A;  2UZY A;  3C6O B;  1Z7X W;  2BEX A;  2P1P B;  4Q62 A;  3ULA A;  5LFN A;  4ARN A;  1D0B A;  5GMF A;  3M18 A;  3E3Z A;  4GLP A;  1ZIW A;  2OMT A;  2WQW A;  2FT3 A;  3ZYO A;  4V2D A;  1XWD C;  2Z63 A;  2O6Q A;  2R9U A;  3W3N A;  5A5C A;  2O6S A;  1SQ0 B;  4U7L A;  1DS9 A;  5GQR K;  1QYY A;  4QC0 A;  5AZ5 A;  2Z7X B;  4U06 A;  5AWC A;  4V2C A;  3DZE A;  1M9S A;  4MQW X;  3W3J A;  4Z79 A;  3C6P B;  3WN4 A;  4CP6 A;  1DCE A;  3WPD A;  2ID5 A;  5IYX C;  5GMG A;  2P1N B;  2WQU A;  3O53 A;  4NZT M;  4C2A B;  4WYK A;  3E4G A;  4H09 A;  1JL5 A;  3OGK B;  4P91 A;  2V9T B;  4GT6 A;  2OMV A;  4LSA A;  3G3A A;  2Z81 A;  4R6J A;  1OGQ A;  4LXS A;  4Q3I A;  4PEQ B;  4RWT C;  3JB9 j;  4NKH A;  2Y5Q A;  5AWA A;  4ECO A;  2OMY A;  4R09 A;  4KT1 A;  4LI1 A;  4ARR A;  3W3L A;  1K5G C;  3RFE A;  2XOT A;  4YEB B;  2WQV A;  3UL8 A;  4UFR A;  4CNM A;  3CIG A;  3A79 B;  4CNC A;  2RA8 A;  1DFJ I;  4RCA B;  2ASS B;  4PER A;  1KOH A;  3RW6 A;  2OMZ A;  4NZR M;  3CIY A;  4XGO A;  4Z64 C;  2WFH A;  4KNG A;  4Z8G A;  4KXF B;  2Z82 A;  4WP6 A;  4PSJ A;  3E6J A;  4FS7 A;  4L3F A;  1M9L A;  3W3G A;  1XKU A;  5CMP A;  3RGZ A;  4ECN A;  2A0Z A;  2ELL A;  4J0M A;  3OJA A;  4EZG A;  3O6N A;  1FS2 A;  4CC4 A;  4R6G A;  5IJC A;  1O6V A;  2RR6 A;  4RCW A;  1M10 B;  5AWB A;  4LSX A;  5GS2 B;  1W8A A;  3E2J A;  4G8A A;  3WPH A;  3REZ A;  4XSQ A;  4AY9 X;  3ULV A;  3GOZ A; 
#chains in the Genus database with same CATH homology
 4XOS A;  4QBZ A;  1O6S A;  3KJ4 A;  4R5D A;  1OZN A;  3ZYN A;  2BNH A;  3FXI A;  1A9N A;  3RFS A;  3G04 C;  5FTT B;  3PMH G;  2P1Q B;  2WQX A;  3RIZ A;  4LI2 A;  5IJB A;  4HQ1 A;  3VQ2 A;  3W3K A;  4FD0 A;  4CIL A;  4IM6 A;  4V2E A;  4FMZ A;  4FCG A;  4C2B B;  1OTO A;  1XEU A;  3UN9 A;  3UL7 A;  2Z65 A;  3WPC A;  1U0N D;  1IO0 A;  2IFG A;  2CA6 A;  4Y61 B;  4CC4 C;  3M19 A;  3TSR E;  4BSU A;  4Z61 C;  4P8S A;  5B0T A;  4AW4 A;  4R5C A;  2OMW A;  2Z7X A;  2JQD A;  2P1M B;  4R08 A;  5D3I A;  4LSX C;  4K17 A;  5IJD A;  2AST B;  4B8C D;  1P9A G;  4QXE A;  4BV4 R;  3ZYJ A;  3WPE A;  4OQT A;  1P8T A;  3RGX A;  1GWB A;  3BZ5 A;  4TZH A;  1OTM A;  1P8V A;  2UZX A;  4BSR A;  4M7E A;  1FQV A;  3CVR A;  3WPF A;  3G39 A;  1PGV A;  4MN8 B;  3OGM B;  4Q3G A;  2Z62 A;  1OOK G;  2XWT C;  2Z66 A;  3C6N B;  4U08 A;  4U09 A;  5CMN A;  4PQ8 A;  1FO1 A;  3WPI A;  1A4Y A;  5GS0 A;  4FHO A;  3W3M A;  1KOO A;  2Q4G W;  3RFJ A;  2P1O B;  1FT8 A;  2OMX A;  2V70 A;  4LXR A;  5HZL B;  2JE0 A;  2V9S A;  4J4L A;  5GMH A;  1G9U A;  1O6T A;  4R0A A;  4NKG A;  2OMU A;  5B4P A;  1H6U A;  1WWL A;  3OGL B;  3UL9 A;  4R6A A;  3G06 A;  4Z94 G;  4I6J B;  4LSC A;  3WPG A;  4R07 A;  4M7E C;  4R6F A;  1LTX A;  5HDH A;  1XCD A;  3OJA B;  3ZYI A;  1XEC A;  1M0Z A;  4L3A A;  1YRG A;  5B0N A;  2O6R A;  1K5D C;  1H6T A;  4PKI G;  2Z64 A;  3RW7 A;  3ULU A;  1OTN A;  3VQ1 A;  4FDW A;  3SB4 A;  3P72 A;  4BSS A;  2JE1 A;  3G3B A;  3RJ0 A;  3WPB A;  5AWD A;  4R58 A;  2UZY A;  3C6O B;  1Z7X W;  2BEX A;  2P1P B;  4Q62 A;  3ULA A;  5LFN A;  4ARN A;  1D0B A;  5GMF A;  3M18 A;  3E3Z A;  4GLP A;  1ZIW A;  2OMT A;  2WQW A;  2FT3 A;  3ZYO A;  4V2D A;  1XWD C;  2Z63 A;  2O6Q A;  2R9U A;  3W3N A;  5A5C A;  2O6S A;  1SQ0 B;  4U7L A;  1DS9 A;  5GQR K;  1QYY A;  4QC0 A;  5AZ5 A;  2Z7X B;  4U06 A;  5AWC A;  4V2C A;  3DZE A;  1M9S A;  4MQW X;  3W3J A;  4Z79 A;  3C6P B;  3WN4 A;  4CP6 A;  1DCE A;  3WPD A;  2ID5 A;  5IYX C;  5GMG A;  2P1N B;  2WQU A;  3O53 A;  4C2A B;  4WYK A;  3E4G A;  4H09 A;  1JL5 A;  3OGK B;  4P91 A;  2V9T B;  4GT6 A;  2OMV A;  4LSA A;  3G3A A;  2Z81 A;  4R6J A;  1OGQ A;  4LXS A;  4Q3I A;  4PEQ B;  4RWT C;  3JB9 j;  4NKH A;  2Y5Q A;  5AWA A;  4ECO A;  2OMY A;  4R09 A;  4KT1 A;  4LI1 A;  4ARR A;  3W3L A;  1K5G C;  3RFE A;  2XOT A;  4YEB B;  2WQV A;  3UL8 A;  4UFR A;  4CNM A;  3CIG A;  3A79 B;  4CNC A;  2RA8 A;  1DFJ I;  4RCA B;  2ASS B;  4PER A;  1KOH A;  3RW6 A;  2OMZ A;  3CIY A;  4XGO A;  4Z64 C;  2WFH A;  4KNG A;  4Z8G A;  4KXF B;  2Z82 A;  4WP6 A;  4PSJ A;  3E6J A;  4FS7 A;  4L3F A;  1M9L A;  3W3G A;  1XKU A;  5CMP A;  3RGZ A;  4ECN A;  2A0Z A;  2ELL A;  4J0M A;  3OJA A;  4EZG A;  3O6N A;  1FS2 A;  4CC4 A;  4R6G A;  5IJC A;  1O6V A;  2RR6 A;  4RCW A;  1M10 B;  5AWB A;  4LSX A;  5GS2 B;  1W8A A;  3E2J A;  4G8A A;  3WPH A;  3REZ A;  4XSQ A;  4AY9 X;  3ULV A;  3GOZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...