4YECA

Crystal structure of a clostripain (parmer_00083) from parabacteroides merdae atcc 43184 in complex with peptide inhibitor ac-vltk-aomk
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
126
structure length
126
Chain Sequence
b'METPEPRTTRTILVYMMANNSLNSFASKNIESMIEGATSKNLNGGNLIVYYAPAGSPPELLRIKEENGVVKKIHLKDYEKQNSADPDVMRSVIGEVVSQYPADSYGLVLWSHGTAWLPSDYQNKLK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clostripain family
publication title Substrate Profiling and High Resolution Co-complex Crystal Structure of a Secreted C11 Protease Conserved across Commensal Bacteria.
pubmed doi rcsb
source organism Parabacteroides merdae atcc 43184
molecule tags Unknown function/inhibitor
total genus 39
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yecA01
4YECA 3UWSA 5DYNA
chains in the Genus database with same CATH superfamily
4TYYA 2EGUA 2A6PA 3I30X 4UHBA 2X9GA 2AUMA 2I6SA 5AW3A 3DDUA 4HXEB 3RUDA 1CQXA 1L7AA 2BYTA 1BVRA 3B5EA 3KV1A 5DEOA 2R84A 4RMNA 1YA6A 4E4TA 2BE9A 5T67A 1T2NA 1NMXA 2GEBA 3LD9A 1O96B 2B7LA 2CXUA 3BTVA 3PQ2A 1IWBB 3CLUC 5DNEA 3K05A 5ALYA 4YCCA 3TZEA 2JJYA 1TQDA 1NBMD 3NHSA 4DXAA 3USES 4WPGA 5ILOA 1NTRA 3DA8A 4FOSA 3VPBA 1RJDA 1YS7A 2GEVA 2PZMA 3W1VA 1U6JA 1MEJA 1N9ZA 3OLWA 2WD7A 5CJ2A 1OI3A 1HYEA 5LYJF 2FB9A 3VYWA 4OLAA 1GG5A 4X61A 1POXA 1NBMA 3KIPA 1KK3A 4MCAA 5A2GA 4NAUA 2O3SA 2WZDA 1L0BA 4HWOA 4WINA 3MAJA 4CL3A 4LDAA 1NLFA 1UBJS 3BEOA 3DHYA 3LUJA 4DQUA 4MWBA 5CH5A 4IMPA 3WNDA 5FWDA 3FROA 2C00A 3DP7A 2BC9A 3ODPA 2EF1A 1MIHA 3FTNA 3Q3GE 1U90A 4LI3X 5BRJA 3L5OA 4YMGA 5FUQA 4Z99A 4X6UA 4B3MB 1APBA 3H0EA 1C1DA 1LSUA 1H23A 3STUA 3VNVA 4YPOA 4MOWA 3OJWA 3I8XA 3R7WA 3T3PB 4J94A 4I99A 5E6RA 5T4EA 4FZ5A 4A8JB 3U5TA 1KDOA 3RC2A 2VSQA 2XTZA 4TKVB 3QE4A 2V7UA 4J49A 5ALZA 2XAUA 4N49A 2JGJA 2XXJA 2ZTMA 3S40A 4FYIA 4HAOA 4CFZA 2J3HA 2COEA 4FD2A 5JDIC 1Y8AA 2JZNA 1GWNA 1K8RA 4M60A 4M8NE 1JQDA 5ENDA 2JFOA 3GP3A 4DSUA 5F5NA 2G9QA 4DWWA 4EB6B 5I45A 1ZCFA 2SCUB 4QPJC 1T26A 2LP4Y 2OVBA 3G49A 4DYHA 3IEVA 5L3SA 5B7NA 2C3YA 1G0OA 1BOOA 1UMBA 2QD4A 4Z8YA 3ZZMA 5JZBA 1ZMBA 3UMJA 1X13A 3L1KA 3PXXA 5DSXA 3TTTA 4CKCA 4LDZA 1W88B 2CE2X 3TIIA 2B8TA 1JHQA 2HSEA 1SU6A 4ZYWA 1HE5A 2P40A 3BUSA 4C0KA 4TXHA 2YWXA 4ZIRB 5MFPA 5KSPA 1DX6A 3DEKA 4FI3F 1S96A 3TE6A 5EXPA 1YULA 4AO8A 3HY3A 4DCOA 2BLNA 4FKBA 4V24A 4RVGA 1BE8A 3HVKA 2YIDA 3LUDA 1SBHA 1HQDA 2D59A 4R84A 3MA0A 2NIPA 3A6PC 3EK2A 1QV6A 1TJNA 1AQUA 1MFPA 5KYNA 3OICA 2AR7A 4WVLA 2RIPA 4EJMA 3JQ7B 2ONYA 1NFFA 4OX9Y 4E1AA 1LLQA 5CA1A 3THXB 3I73A 4N5HX 2CE7A 3D4LA 4LMRA 1FTGA 2JBAA 1ENYA 1WZNA 4EG1A 3WRYC 4BNYA 4DDVA 5I48A 3GDOA 3QI7A 3H1GA 3JAMA 1J2RA 3I12A 3MAGA 1G5QA 2G76A 3FW1A 1O89A 2PJDA 4ALNA 3D7MA 4UE3S 1MTOA 1NHWA 1E1RA 4WY2A 4DLKA 4QDXA 3OCWA 5AT1A 4EYGA 3UPTA 1QHNA 2WTXA 3INGA 2IUFA 2Q0SA 3SSAA 1L7NA 4D9KA 4MWGA 5FWAA 3BWXA 5CX4A 1UAGA 2W8BA 3FFXA 3IVRA 2FSGA 4BMOB 2HLNA 5D5QA 2BKVA 1H8EA 3DR3A 3OX3A 4H7HA 1K06A 1L5WA 2JK0A 4XH9B 2F4VB 2PJZA 3UT5A 2YQ5A 1JB9A 2IEAA 3G0CA 4OXXA 4DMLA 4NCAA 2XMGA 2YDYA 3W7VA 4G07A 3WBBA 1KH2A 4Y2RA 4M1MA 3RTAA 4NZPA 3QBJA 1OLUA 2C98A 3H1PA 3IBTA 2X4LA 1U3GA 3QWIA 5CIWA 4I66A 5KEIA 2HU8A 4G2TA 1V47A 2ZT6A 4AJNA 3SF0A 1E2QA 3AGQA 2QX7A 3DOHA 5DK6A 1Z13A 4ZFNA 1FX0B 4U00A 4EFKA 5JPDA 1G5FA 2JD2A 3ETLA 1QIEA 1WIWA 3H1FA 4IO0A 4M37A 3D2AA 5SYNA 1E4OA 4AC9A 4NG4A 4PC2A 1N32B 1C7FA 1TZBA 4EDFA 1K97A 5FLKA 3RWBA 4XD7A 4GOLD 3OF2A 1ZFNA 3PJDA 3M34A 1GO2A 4OGLA 1CUXA 2O7SA 3I6QA 3CINA 2O2IA 4QARA 1X3LA 3U7IA 1Y3IA 2QRPA 5EJEA 4G85A 4RA9A 3PCRB 4HGRA 2ZAYA 5JRZA 4I1SA 3KUXA 4KGDA 2ZTUA 2KPOA 2FVYA 3PKJA 4RKYA 3EAGA 1JI3A 1L4YA 1QVRA 4MROA 4O2LA 1QFSA 5BRAA 2DWCA 5IDXA 5G4KA 9ATCA 3UBMA 4UUMA 4DV6B 4CMIB 1SVMA 1ISIA 2OO7A 3NDIA 1FUKA 1PUJA 2P4SA 4NJMA 1RDFA 3C3EA 4CKZA 4PZZA 3DXFA 1TM5E 1N5RA 1UMCB 3AETB 3GFOA 4OLFA 3WHPA 4IG9A 3FCAA 4WDRA 2E82A 4OJKA 1EFDN 2Q7DA 2AFIE 4DG8A 4Q3LA 4V0OA 2HMAA 1PL6A 1B8PA 3PUWA 2QSZA 5EP1A 1H0RA 3DPSA 4L57A 1QG0A 1DDOA 2WYHA 2O6LA 2K7FA 3NIFB 4LXGA 4Z6KA 3G7NA 1KMQA 1Q2XA 4FINA 1K4MA 1WMAA 5CYOA 4DKXA 4M9SA 2C4HA 4MS3B 1SCUB 2XOXA 2G04A 4OXIA 4AXBA 4DCTA 5KVAA 4KR0A 4IHQA 3TAHA 1BKDR 5TLSA 3MILA 1N5JA 3C3WA 4IIBA 2CL6X 4Q05A 2Q4DA 3GDFA 5F2EA 1WD5A 2C8KA 3R6TA 5KJEA 4LA4A 4FFBA 1YE5A 2ISCA 1UXJA 3EXAA 4QXOA 2VP3A 3BWBA 3PXCX 3RH0A 4YMWA 2V6BA 3G2LA 5J23A 1NRJB 3GVHA 3MQFA 4PV7A 1RWBA 4LJAA 3SSNA 4N54A 3HGMA 3JQEA 2YFYA 2GK4A 3E84A 2JJ1D 4MA0A 4OKSA 1AE1A 1YI0A 2JGKA 2NG1A 3BB3A 3I83A 2W2OA 2GWHA 2VP0A 2HMWA 2IU4A 3AF5A 3CNBA 1EFCA 3IQHX 1RBZA 4DCNA 2JLWA 3AKDA 3Q3EA 5FR2A 2IOFK 1SZPA 3ROQA 3FWYA 4QPDA 4ROTA 1RPTA 3H3XA 3Q85A 4HNRA 5AOAA 5D6NA 1K0FA 1JR3D 1L8XA 2A5JA 2HSGA 2PLRA 3P9SA 4HEA1 3HBLA 2ACKA 2OVFA 3IUPA 3BORA 3ROXA 4AROA 1WBBA 2QG4A 1EUYA 1XP5A 3I1YA 1PO7A 4BNFA 1Y3AA 1Y3DE 4G56A 5LMUB 3C43A 2ZWIA 1TIPA 3PJRA 3AUTA 2JCBA 1PV4A 4BKQA 4K9KA 3VAZA 4Z4GA 5K51A 3AJDA 4QVIA 4GMDA 1Z2DA 4A91A 1JKJA 4H7KA 1ZX1A 4Q9HA 1ZH4A 5ILGA 3KD2A 3F9RA 2M1XA 2NU9B 4DM4A 2Y05A 3DONA 3EWIA 1HV8A 2V9CA 4FXOA 2DM6A 5CCXA 2XZOA 3E3LA 4IXMA 5BN5B 3P9QA 2GCIA 1AT1A 1D0IA 1P3DA 1NVVQ 2JBHA 5BW8A 3K0AA 3W3AD 4QUAA 1SZDA 1TZ2A 2ZBQA 4D3YA 2WUGA 4J0DA 4B33A 5DN6A 3MGAA 2HAEA 4WRRA 1UK8A 2L18A 4M6WA 2ZSAA 4G0XA 5ERXA 2XA9A 1LPPA 1FTSA 4DDWA 2IUUA 1CFJA 4WEOA 1WNTA 3DE2X 3EIXA 4PCAA 1AV6A 3T61A 3N6VA 2QP9X 5KJ6A 2WSSA 3HV2A 5GP1A 2XZLA 4YPFA 2IK8A 3PUKA 4B4DA 2J3EA 4NZYA 1TL7C 3ITNA 3QNMA 4GUDA 2Y2VA 2XRZA 1F4LA 2RMKA 4DMMA 5AM2A 1EUCB 4RTLA 1FMFA 2OHVA 3KPJA 2JFNA 3HB9A 1E6UA 4HYQA 2V9PA 1J39A 3TRHA 2I5PO 4RD2A 4LG1A 5IPFA 5CD1A 1W581 5FL7D 2NNWB 1L6RA 1K8ZB 2GXQA 4MULA 4QG7A 2BGRA 1WDLA 4GRAA 1ZK4A 4DQLA 2EBHX 1EP9A 3ZPXA 2GNOA 1KSFX 2E5FA 4DJJA 1Q5PA 5KQLA 5EMNA 1Q57A 3SKYA 1RNLA 3WLMA 1MJHA 1B1AA 4KB5A 5TMEA 4EJFA 3TQSA 4C2BA 1JA0A 1WDKA 4BMCA 3TSWA 2BD0A 1KJNA 3V8BA 1K6IA 5JNTA 1EVYA 2PVPA 1H85A 1QJCA 1YQTA 2WNSA 1Q14A 2X7JA 4P3OA 5LJIA 1WUYA 2XWPA 4IL5A 1W87A 2JDID 3H4VA 3SIRA 3HZHA 1EP1B 1HDZA 3H2IA 3ZIAA 4W5QA 1G8GA 1ODCA 1CR4A 2FPXA 4L4RA 4E94A 1VE6A 2QQ0A 4FEEA 4L6CA 3VSBA 4UM9B 1FE8A 1KYWA 4YT2A 4X8LA 3E3MA 3A8TA 2WMNB 3QKRA 1YA8A 5EMJA 3DZ8A 1WHSA 1JSCA 4YHHB 1XTJA 3OOEA 3PEEA 1P9WA 4EWLA 3H18A 2VHZA 3HEAA 4FDVA 1UKVY 3QV1A 5AXCA 3CSSA 3ZD9A 1GPKA 5G2OA 4QLOA 1W1IA 2YMLA 1F14A 1UAYA 3AX6A 3IT2A 3OOSA 5TQ2A 4ZZ1A 2QVZX 2JAXA 4NFSA 1SUEA 1NC3A 4N41A 3WMFA 1J7JA 1UBKS 2ADMA 1ISRA 2ODNA 3VVBA 3WDSA 1A7KA 2JL1A 2CMHA 2YJ4A 2I9PA 3CNOA 4MCIA 1NLZA 3SG0A 5DTJA 4B3XA 4YV0A 2ODAA 2AUNA 4OK5A 4UHCA 4B3JA 1AKNA 1EESA 2PS0A 1P9OA 4HLDA 3UXEA 1AIPA 2H1HA 1TCBA 1U1IA 3U1TA 4LF6B 4EO4A 3UATA 2QTVA 4ZO4A 3VDXA 2AN4A 4UVDA 2BUAA 1M2KA 4WEQA 4YCBA 4GXTA 2ZVPX 2NW6A 2VJNA 3LT1A 3NBZC 2W0MA 4HQFA 4MYRA 5F1PA 2H1WA 3SZMA 1VJTA 5FAXA 3GQVA 4LVOA 1K5PA 5K3FB 3SDSA 4D3SA 2KI5A 5E1MA 3B89A 4M0CA 3H5OA 3T41A 1Z5ZA 4KXYA 3ZNQA 3S8YA 2YINC 1P6UA 2VATA 4OQ4A 4YA6A 3IUNA 1EUDB 2AN9A 2PGXA 1Z73A 3QHPA 4WLOA 1AKUA 3RASA 3RU2A 3TLCA 5BN3A 2RSLA 3N39C 2YZMA 4RPGA 3VAYA 2P6NA 4A36A 3IQIX 2J3QA 3MVEA 3CKYA 4PX2A 3VYVA 3AESA 5KDLA 7AT1A 4JB0A 1LU9A 2PZJA 1YZUA 2D5CA 3P4XA 5FTLA 2IYLD 5C8VA 1T5OA 4HP8A 1MU0A 2XVMA 3H4MA 3MWEB 3O8OA 1OFUX 1VKOA 2E4VA 2RGYA 5EZSA 5T57A 4KN9S 3FI9A 4L74A 5CBPA 4AQ7A 2P1DA 3MWJA 3R3HA 1IATA 1SD1A 3CUVA 4HNSA 4WZ6A 2HWYA 1HDXA 1R6BX 1CUSA 1T0BA 3BMCB 2WKPA 1T29A 3HA3A 4OHWA 3PICA 3ME5A 3CUTA 3TRDA 3Q98A 1B00A 2CYAA 3R7LA 1Z36A 1YZYA 1R8YA 1T5LA 2HWKA 2OQVA 1V11A 4BIMA 3G1UA 3TJRA 3LYUA 3JARA 2PYZA 1ILEA 4EY8A 1JMKC 1U7DA 3UPDA 4ENPA 2WV9A 1BCSB 2FQXA 1UOOA 4OP1A 2QTZA 3V33A 1MAVA 1QDLB 4ZYXA 1JXMA 3NHWA 2IHZA 2HCRA 4IIDA 4REOA 5ALKA 3MCUA 3CKMA 1T9ZA 5CG1A 4MV3A 2WJYA 4I9NA 4ZVRA 3WQSB 4EQ6B 1Z45A 4FFMA 3VFDA 5KCZA 1XCBA 3A36A 1OTHA 3RFUA 3AF2A 3ZWWA 2VOJA 3A3PA 3ST7A 4EP1A 1OIWA 5HDBB 5M7EA 4W8GA 3RRNA 4TV8A 3PQDA 1X92A 1HFKA 4ZQBA 4ZO8A 1TK2A 2OXEA 4CF5A 4PYJA 4TXJA 5ANRB 1XR3A 4NCHA 1RLMA 4D9NA 1G42A 2VPXA 5TPWA 1C0PA 2X23A 1HZZC 3S1AB 4O2BB 4PZLA 3T4PA 3VU1A 3MLEA 1GSHA 3FVQA 4B9AA 2PBRA 3I9FA 4UAVA 1TA4A 4LC9A 3AL3A 1P2TA 1OR8A 5AXBA 4PVCA 3D4BA 1Z4OA 4H08A 4TTRA 3RM3A 2OBFA 4KPUA 4ZMSA 4B09A 1NOIA 3KL2A 3CCFA 2R1UA 3C14C 3NDBB 4C0WA 2A9PA 4OEHA 4BO2A 1G7TA 2NXWA 3EVFA 4BZXA 5E6SA 5J1SB 1YR1A 2GN8A 2GK3A 1BSVA 3OT5A 4PZUA 2PH5A 5TF0A 1T2UA 3AM3A 3CB4A 4ZDKA 1MOQA 2A35A 4ZCIA 2I6FA 4QECA 1XRLA 4AN0A 2VQSA 4K40A 3TPZA 1MNAA 3CBGA 3WS7A 5KYYA 2PZFA 3TVDA 4D9EA 2AJLI 3GP5A 2M9MA 2IHBA 1QC5A 1VDMA 2AUTA 2J67A 4DKJA 1HC7A 1ZIYA 2NUAB 2AZ4A 3COSA 2HRCA 2PEZA 3IKJA 3AMVA 3O5AA 5DM4A 1CUWA 4RACA 4XIJA 5F3DA 5B53A 2ZTSA 3PHLA 1VE3A 2CLMB 4Q3AA 4AMBA 1E2FA 4BV9A 2A0UA 3AP1A 3G2OA 3U7EB 1OD6A 1QGZA 1YDWA 2IQ5A 3LGXA 2ZXEA 5HZHA 1VLMA 3HP4A 2QU8A 4EFMA 4MUJA 4BQIA 5EKSA 4RD1A 1N4AA 3IOMA 3G8YA 3P9NA 1DQZA 1VG1A 3MTEA 1R6VA 1CUAA 3GT4A 4TVKA 2A58A 1FJGB 1Z7YA 1IJKA 2CLCX 1ZINA 4HN9A 1U8EA 3RTBA 5MN5A 4UZFA 1FQKA 1GNSA 4PU0A 1WWKA 3RFFA 3KSUA 4QICA 5I3CA 2R6JA 4C0XA 1ZISA 2VSXA 1A5SB 2A1UA 3K9CA 1IXKA 3NGLA 1ZESA 2VK4A 1U98A 1LRLA 2XD9A 1L5SA 1Q20A 3G68A 1KNXA 1XP8A 3NBYC 3QFRA 2JANA 1P7VA 3R24A 1O3YA 2FRXA 2OQIA 1VPWA 3NRBA 3R9IA 5KTKA 3ZE9A 1R4MA 1I33A 3DULA 1FVHA 1R12A 2WIJA 5DI3B 2W93A 3HJBA 3JYNA 1R88A 3RVLA 4HUTA 1XZ8A 2XCOA 4UCQA 4R7GA 2RK3A 4DLYA 2YJ3A 5ITSA 5C1OA 1GCGA 1QU2A 2ISSD 1CP3A 1G3QA 1IMOA 4NCNA 2XCLA 2VFAA 1L5HB 2AWOA 2I2XB 3AU9A 4N6OA 4RSGA 5C52B 1U0BB 1GYQA 3RHTA 3NTUA 3WSVA 2GM5A 4BHTA 3BL6A 2HRZA 4I4CA 1JECA 2PSEA 3M3PA 3RJMA 4CCSA 3KUKA 2DG2A 4RQAA 1J8MF 4TTSA 1XD2A 4E5NA 5LQDA 1UBOS 2H2DA 2QUIA 2PD4A 1HNXB 3AHIA 1A96A 2JGFA 3EVTA 1U3UA 1T0HB 2AMLA 2WKWA 4YIKA 5EE5B 3EVCA 3L7NA 2NACA 3OEEA 5JEEA 1NSFA 3KLPX 2JFWA 1RR6A 3KJFA 3M8KA 3NTOA 4D4IA 5BSUA 1XTTA 1YL5A 2B4AA 1UADA 1GG8A 3HB7A 4GYWA 1VL8A 2EJUA 2O8FA 2CB0A 1Y8RB 4TS9A 3VZBA 3DZCA 3A28A 3SDZA 3S4YA 1M1YB 4U1RA 5IJXA 2BFCB 4MPDA 2VF2A 3OFKA 5A62A 2PWZA 3NHRA 4NNJA 1ECLA 2HFKA 1E2NA 3SJAA 1Q3HA 3HDHA 4TQ9A 3TZ6A 5ICGA 3GDWA 3UUGA 3EDCA 1XAJA 5L3QA 1ABFA 2OYSA 3F5FA 5H3LA 4YUZA 1XD9A 2HIHA 3BSFA 5CA0A 3D6AA 1NFQA 1E3WA 4NQRA 5AK6A 1C8LA 4J1TC 3ZYCA 1LRKA 4EA8A 1SCBA 1TYAE 2O8BA 1WVGA 2H9IA 4X7RA 5B12A 5KQGA 5EJ6A 2BH2A 3KFVA 2XUQA 2FMIA 1OWMA 5K0SA 2FR8C 1RQ2A 5EL0A 1EHYA 1CS4C 4L07A 4ARUA 3LCVB 4MINA 5AW9A 2QVBA 4YMLA 3GUVA 4AKGA 2D2IA 2IZ0A 2PLWA 2QNBA 3VV2A 1SEVA 3C6BA 4BATA 2HO4A 2HO5A 1O6GA 1WF6A 4YCMA 3TTSA 5T8KA 1QVWA 1QIHA 4DJ5X 4UTZA 4C7BA 2X5NA 4PPFA 4C29A 2XMZA 4DCVA 4E5KA 1W2GA 1YS9A 2J87A 5TE9A 7MHTA 1E1KA 4HNAA 4D5GA 1KJWA 5BNZA 4TS3A 3ZWKA 5BN4A 3A25A 3DE6X 3ZWAA 1KZGB 4E5SA 4ZVVA 1PGPA 1IDOA 5EIHA 3L93A 4GEGA 2D3WA 4IZIA 3PYLA 2ORED 3KPUA 4OXRA 2D0IA 3NNNA 1NM5A 4Q4JA 3PFKA 1P1KA 4TZ6A 1X77A 3C8DA 3WO0A 3ZZNA 1ZWKA 4OMCA 2AD5A 4Q34A 4RKRA 3R5JA 1VFPA 2ZI3A 5IUKC 1M74A 4FHGA 1C3XA 1ZGBA 4JGGA 4GLFA 4TYQA 1VLZA 2QZ4A 1AA6A 5FWYB 3WKCA 2Z30A 5I7VA 1U0TA 1WMEA 2Q9BA 4Z7JA 1OB2A 1BKYA 4XTRA 4G1FA 1U3TA 4BC1A 2IYAA 4JJ7A 1DQNA 2P91A 4MKGA 3PCXA 4RF5A 1J07A 1S7CA 4OGFA 5U9CA 3RT7A 1M6VB 1JBEA 1E0JA 4KMMA 5DYNA 2HEGA 3GN2A 3K9GA 4EUSA 3V80A 2WF6A 1KL7A 1L5RA 2Z2KA 2WVGA 3IDAA 4HQLA 4RH1A 5JAPA 2UXDB 5KNBA 1KMMA 4HADA 2DVMA 2DE0X 3KZCA 4TS4A 1IPFA 4IQGA 4F91B 2XRFA 2WKRA 1Z56C 4YJ3A 1TA0A 2VPYA 4NHOA 4TL9A 5IJ9A 3PWSA 1SKUA 1MJGM 5ED0A 3GGDA 1GFIA 2PBFA 1YVPA 3OIUA 3HCWA 4LHSA 5JS7A 1LPSA 2ZIXA 2WFZA 4KLNA 4Y6QA 3AR9A 4A27A 1ML4A 4RKFA 1M2EA 3RTEA 3TRJA 3E7DA 1MZPA 1RJ9A 2I4IA 4GMHA 1QQBA 4OFWA 3H0KA 2NYUA 3X1YA 2PUVA 3H4IA 1AGRA 4L5JA 4F11A 5LP6F 4H1HA 4F2PA 2QN9A 2AMVA 2P2NA 1WDMA 3TR5A 4EZBA 1KFCB 4BJ6A 1MP0A 1QGUA 1JDNA 4G01B 1EIWA 3EIUA 4D3ZA 2W4QA 3ZI7A 4ODIA 3UHAA 4QREA 3BE4A 4WK2B 4XFDA 4QGSA 5I7EA 4EATA 2NOAA 1K88A 2V6IA 1CUBA 1LI4A 2HNBA 3C3PA 4F04A 2PZGA 3QSYA 1I13A 1A8PA 3F78A 2JLSA 3CZPA 5E8RA 2B4YA 1TZKA 2VA8A 4B17A 3DKRA 1PSWA 2A7XA 5K4AA 2V7WA 3EBLA 1C1XA 4ZKEA 2H92A 1H4TA 2H7CA 2ZB7A 4LY0A 1DC6A 3HYCA 4TSKA 4DBZA 2LXNA 3IVAA 1ZUNA 1HLGA 3T54A 2ADOA 5JSZA 1DTWB 2A5FA 2PIAA 2HDNB 5KYWB 2ZQ5A 3V1TC 1S6YA 3O0DA 4IJ5A 1E8MA 2P0YA 4AB1A 3NDRA 4JYPA 3O92A 1XN4A 1EGQA 2SHKA 3IA7A 3ONNA 4A1FA 4BNLA 3W06A 4CEIA 3DXZA 3VVLA 3ZDRA 1JHMA 3GLGB 2J0VA 1SBIA 2XMDA 1FU4A 2A30A 3CNNA 4KLRA 5FXMA 4ERXA 3PQ4A 2IDZA 4Q9KA 5CEEA 2BCGY 3LT0A 4UE6A 2ZTVA 1LVUA 3QLJA 1VYUA 3UCEA 5I9IA 2AX3A 3CZ5A 2E1PA 1J00A 3W5HA 4DCSA 3A06A 2Q0HA 5JC1A 1UBCA 5CB6A 4Z2YA 1G5TA 4MUIA 3ICCA 3N8HA 5EIBC 1JG7A 1RQ7A 1ISMA 1HDRA 1B6SA 5LMCA 1UZMA 3PRYA 3PEUA 2FPMA 5LQKA 1I2BA 1P73A 4B31A 2WQ7A 3N1UA 1UPBA 1N8NA 1XF9A 3GGSA 3RAPR 5BUCA 1G9TA 5JSUA 4NMXB 3H17A 1G5HA 4Q4HB 1O97C 4XOUA 1MABA 3ZJYA 3UQYS 4EUEA 1FB5A 1M6YA 1EWKA 3U09A 1HDYA 1V5GA 3HBNA 3NHFA 1E2MA 1HQCA 2FZWA 3ND5A 4XJXA 3PQ8A 2Z95A 5DTMA 1HG0A 1X80A 2HADA 3UM9A 3E15A 1TCCA 3I5AA 3NJ4A 5K0JA 3LYHA 2QKYA 5CNJA 5I4BA 1VE9A 4JQYA 4ECAA 1F60A 4EITA 2UZAA 1RKVA 2QL6A 4JKIA 3T5GA 5IJWA 3NH6A 4X63A 5FI3A 4ZV4A 1LI7A 3RGWS 2WVJA 2Z6UA 1RFGE 4A0RA 4IH1A 4KR3A 5ESDA 1UBFA 1IUOA 2VRNA 2JLBA 3CC8A 3SFVA 4KDCA 3ZQJA 4KYUA 3QLVC 1DBPA 3SYTA 1E5VA 2VT7A 5C8YF 2PS1A 3QU7A 2V5AA 3SJBA 3VR0A 3D8BA 3ZD8A 4C1NA 4Y1FA 4F4FA 3D0RA 4LGCA 4MCHA 4OFBA 1P1BA 1NXQA 4PYNA 1Z0AA 4KDEA 3VJMA 3ZZTA 2QN1A 5F1OA 2QR2A 3VTAA 1NG9A 3F6PA 3SHQA 2I65A 1E32A 1T35A 1E8NA 4J8PA 4JLMA 5FI0B 1ONSA 3M6FA 4EHLA 2IH2A 5C1DA 1AKTA 2PAFA 1JSRA 4KODA 1P7ZA 5JC8A 4TXMA 3HEMA 4US0R 1BJKA 4MRNA 3O2SB 1CJSA 2JGMA 2NVWA 1GAQA 1HEIA 1UBUS 1WXQA 5GONF 5DBOA 1OU4A 4N5MA 1QR6A 4HLUC 1VJCA 5F9FA 5DTRA 2CL7X 3Q15C 3B6EA 1OBFO 2EYQA 3LVFO 4WMLA 1RIIA 2IVFA 4IDFA 5AHWA 2FWPA 4M9QA 2IU3A 3RNLA 3QQPA 1GZVA 1SCAA 1A2QA 2V0CA 4WJKB 2R1VA 4LTDA 3QBVA 4I1PA 3W7BA 2QRQA 3BB1A 4U7FA 3HC7A 4Y7CA 3LWBA 3T9EA 1DJMA 3RREA 2CW5A 4GQBA 4JI7B 1A0OA 2VHXA 2YWEA 1O95C 4ZK6A 4ZI7F 4OQXA 5HKBA 5J4KA 3A1FA 4J16A 4JLNA 4JU9A 4X7BA 3U3RA 5JAHA 2PX8A 5LQNA 1FFHA 4TWZA 3BWDD 1M1ZA 2IDJA 3ZKAA 1HE3A 2QROA 3IBYA 2QTFA 1HY3A 1DUSA 1F6DA 4BMPB 3GLSA 4IIXA 3U44A 1E4EB 1UBLS 1T6XA 3RF7A 2YASA 4NPCA 3UAGA 3TCKA 3OOYA 3QLTA 3LWDA 5LR6A 1OLUB 2F3UA 2M98A 5AESA 2GARA 1PFGA 2ZB4A 4ZYZA 2RB5A 3HY6A 1A9XA 1MAWA 1SQGA 2X4GA 2ZYSA 3R0ZA 3OCXA 4MVCA 3O3OB 1HGXA 2A5LA 4QTXA 3N2GA 1ZD4A 4QASA 1XDSA 3T5BA 3NOXA 3O9VA 4Q4AA 5DYYA 3JWIA 3WGHA 3JYOA 4DADA 1ZOOA 1YZFA 5EE0A 4UTOA 1GPLA 3G9QA 5U4XA 1D09A 1U11A 3LDHA 2ZIAA 3N5CA 3PGA1 4IXTA 4TMFA 4BZPA 5A9RA 4ED9A 5BWLA 3HKEB 1XFDA 1XIVA 2WPNA 2ODPA 2YJ6A 2B21A 2WV7A 4IV0A 3ZIDA 3HDJA 1RSZA 2ZGVA 1PQWA 1NGSA 2IDMA 5LIRA 4YJKA 3G6KA 1U28A 4KI0A 1N2CA 2OCGA 1EWYA 2QM0A 4J90A 4K8OA 1ISHA 3WQQA 4EY3A 2JIOA 2P2SA 4KITB 1L4LA 3KR2A 3W4IA 5DHRA 1NW8A 1Z5NA 1EDBA 4JB2A 3QY9A 1KYXA 5ICCA 2X0NA 1NNLA 3MIZA 4B6EA 4DLNA 5IUJC 3DEFA 4YN3A 1EBFA 1PR1A 1X14A 1ULZA 1PG5A 2IXGA 2Q3HA 2VG8A 4E32A 4I9GA 5K3CA 3BWEA 1LH0A 1I5RA 5CLGA 2FEWB 4G26A 2IHVA 5AMXA 3ICVA 2B7BA 4YRDA 4K6GA 1WAMA 3NIGB 4CI0B 2WVAA 3ENQA 3MUOA 4JP1A 3U4AA 1VYTA 4DABA 1ZUHA 2CLOB 3BXOA 4L4XA 3HVJA 4Y2YA 2QTGA 3L7IA 1V96A 3F5SA 2VWPA 5ALNA 2AFIA 2JGNA 4HD8A 4Q7JB 1FX1A 2WRZA 5ENZA 4OIFA 4Y2QA 2WMDA 3G0IA 1Z17A 1V8OA 3PG5A 1UZNA 3CS3A 3D2BA 4DW8A 2RE8A 2PUTA 4YNBA 3JRXA 4IZOA 2OILA 3QEOA 5DHAA 4DSTA 3G79A 2A5YB 4HZUB 4EHNA 4E14A 4HPWA 3N58A 3GZNB 4W4TA 2PSJA 3VH3A 5BNFA 3PC7A 3A9RA 2WE7A 5BQXA 2CEKA 1JL3A 3G0GA 1GZ4A 1U0GA 2ON6A 1BW9B 5E2AA 5BQOA 4EF4A 5KJ1A 4F3NA 4N1AA 4X3CA 4EO9A 2Y1CA 3B9BA 3PK0A 4H18A 4ZV7A 2HTEA 2PGOA 3INYA 4R0MA 3H2KA 1N6LA 4AN1A 3ILSA 4GM0A 5GV8A 1MEEA 4YP5A 2IW3A 3T3NA 3B36A 2F8SA 4DR7B 1UINA 2IUYA 4RBNA 1IM8A 5A0VA 5B6PA 2ERYA 2AQ8A 1MC8A 2CV0A 1BHQ1 2YNMC 1SKYB 2DUUA 1PYGA 1SIUA 3KEFA 2RC5A 3ZIUA 2PVSA 4O63O 1HK7A 2V5UA 4WAUA 2C0CA 1SC6A 4FK8A 3V8EA 2D5AA 3TOSA 3VTFA 1J0DA 1EVZA 4V2UA 1IZ0A 1P7CA 3ZI4A 4D8WA 5A5VA 1DS6A 1C7ZA 1LDGA 4ND6A 5L6MB 4MYCA 5EI5A 5IJZA 1FW8A 1VMIA 2J0UB 1O2DA 1HTBA 4U4AA 1R9JA 5BWBA 4YJFB 1CJBA 2FZCA 1JVSA 4ZD6A 5LU9A 1HEYA 3D8NA 3EWSA 1CLUA 1NNSA 2ZE8A 4TKMA 1X7ZB 2AOTA 2CVHA 1YNOA 3ZR4B 3FG9A 1WS6A 2X8WA 1W34A 4UQOA 5DNWA 1YZVA 1GPYA 3OZEA 1JQ3A 3NHAA 4BU1A 2VUHB 5CEJA 2PD6A 4EPYA 3DDWA 1WW8A 4JA2A 1MX3A 4U5XA 3D81A 5HJ7A 1QYVA 4WOJA 1C4OA 2FZVA 4EABA 5CDTA 2QYOA 4HX9A 5G1OA 4AQYB 1Z28A 2WJ6A 3HDTA 3OIYA 4G5FA 4GAEA 4DBVO 3CX3A 1PNQA 1Q1QA 1UUFA 1GGNA 1W4RA 3D6HA 4RPHA 5I7AA 4BB9A 3ILYA 3U19A 3C24A 2WJWA 3VC3A 3AILA 5CLJA 1SRQA 5INTA 3HP1A 3N8GA 1N2GA 4KQEA 1NV8A 4QHYA 1NNEA 2H2WA 1JKMA 1N0HA 1SHZA 3FWKA 1BFDA 2I3AA 5DX8A 1DFGA 1GQOA 2JA2A 3LA6A 5DGHA 3GI1A 3V1LA 1A97A 1PZNA 1T5IA 3K1TA 3TBKA 1P6XA 4LF7B 3VNUA 4FN4A 5IM4F 1HFWA 3IAS1 2QQGA 2OZKA 1K63A 3H8VA 1K7CA 3G5TA 1P2FA 3TW6A 2BKAA 2RHHA 2VA9A 5T3UA 2TMGA 2W71A 1Q16A 5HIAA 3H0CA 5JSFA 5K0TA 5GJBA 3NKFA 1YR3A 4BCBA 1YXMA 2Q3JA 3C3XA 4KTTE 2O2EA 1PFYA 2OLJA 1PR9A 3D1JA 1YRYE 3FWHA 4Q7MB 3HBAA 1RM4A 1W0JA 2VBCA 2Y1OA 2C83A 2GQ0A 1VDZA 3QKIA 1LS6A 1EINA 1FQJA 1MRSA 4NY1A 5LUBA 2UZ1A 1LD3A 3STWA 3Q7QA 1X0VA 2KS6A 4DNPA 1KIAA 3GT3A 5CXUA 3H97A 1DAIA 4CN8A 4YV7A 3Q6NA 1YTUA 2V58A 1T1GA 4GZLA 3G5MA 5GZ1A 5H3HA 5K8UA 1RRKA 2FG7C 4BNNA 4ZJYA 4YAFA 4KOEC 2IYNA 2G9RA 3P9YA 3DKPA 3N28A 2Y3IA 3KUUA 3RE1A 2GN6A 2P1ZA 1GITA 2QVGA 3QJYA 3OJXA 3IMGA 3P52A 4F6LA 4H60A 1OKKD 2BE7A 3E70C 1WP4A 1V16B 4JUFA 2WJZB 2FUG6 3QW2A 4NVRA 4BX2A 1IUNA 1A8IA 1GIAA 1QG2A 3RUHA 3JSXA 5EKTA 2BMAA 1CVRA 3C6XA 3HB5X 4WK6A 4CF6A 3QXGA 1I8TA 1DIGA 1YR9A 5LU8A 4QPPA 5I7FA 3OO1A 4WN3A 2ATCA 1TU0A 1V6AA 3L8DA 1NASA 5HVNA 2PZBA 4BGVA 3CG0A 1Z62A 5KAMA 4DOMA 5D8DA 2ZDHA 1KEEB 1U63A 2QE7D 2GZAA 1CETA 3SMVA 2Q46A 3KOMA 4JQCA 2HMVA 4PX9A 4HDNA 1DAOA 4K9RA 1PT7A 2OCYC 2D1SA 2HNAA 4LIPD 4JCOA 4N6NA 4LTMA 4B3TB 2P3SA 5C80A 2QE7A 1JALA 2JHPA 1BU8A 2VAMA 3V7WA 3G5AA 4FIZA 5BV8A 1DWQA 2NUBA 3PHIA 2JGLA 2PV0A 4ZZIA 1P5FA 3LHFA 3CUSA 3HBFA 3KO8A 3KR1A 3SZOA 4LGVA 1R8QA 3VU9A 5B7GA 1IBSA 5EJGA 3PNMA 1H3NA 4JELA 3PSAA 3BILA 1ZNYA 3MMSA 5F2KA 1Y3HA 4YYEA 4QYSA 3IOBA 1Z2NX 2QAGC 4XUEA 3FCOA 3FPGA 5EJ5A 5JQGF 1XK7A 2G17A 2TYSB 3RPEA 2F3RA 4QOJA 1YMUA 4OYHA 4QXAA 2QRJA 3D6VA 1MZVA 4P36A 5AWFC 4B84A 4UTRA 1OWLA 1HEUA 1ZZEA 2RK6A 5C8XA 2BR3A 3T1TA 4JVLA 2J9YB 2EIXA 2FPIA 1IZYA 1QVZA 3GQBA 3EXFA 4PHTA 3BHIA 3K8OE 4ANFA 3AI3A 4FR0A 5IZCC 2DY1A 4Y2TA 1PJLA 2R8RA 4W82A 3S2ZA 4DMCA 2HWXA 1SC4A 3FZEA 1PZFA 2C84A 4I5GA 3UPUA 5EQDA 1V7PC 2IEDA 3AERA 1JDZA 3NKLA 5KQPA 2X3YA 4ZQIA 3RFVA 3UKOA 1O0BA 1NW7A 4ZKDA 3LXXA 4PRYA 4EFDA 3K0SA 2H4JA 1Z0IA 5HXAA 2I03A 2P2CA 1WRBA 3I2YX 3PP8A 2ZRFA 2GJ9A 2MOKA 3LOQA 3QVOA 4F6RA 3TH5A 4D9JA 2BSQA 1Z0SA 4WI1A 2L69A 2KBFA 1FY2A 2PL1A 5LB4A 2QENA 1RRMA 3EUEA 3GLIB 1K7YA 2AN3A 3KZNA 1L5GB 1F1JA 3B85A 3BL5A 4P5PA 2FZKA 2QPLA 2A9VA 2NPFA 2YZGA 4FFDA 2B0JA 3A04A 4B3DA 1G291 3THRA 3DDSA 2DFPA 1E62A 1W46A 3QSGA 2ZUUA 5AHKA 2A1IA 1TIKA 4K05A 5HKOA 2QUJA 2QAIA 2XCTB 3SEFA 1AK9A 4IX9A 3D54D 1V6SA 1JJVA 1I7LA 1JRLA 2QVYX 2Z5LA 3PUHA 3FSEA 1PN3A 4QHTA 4GVXA 4DQDA 1R5JA 4RJLA 1HF3A 3BGOS 3E03A 2OHGA 1T5HX 4WKOA 3CVUA 3A6EA 1QH9A 1FJHA 1KQNA 5KZMB 3JQGB 4ER6A 3O3MB 3OQOA 3RG2A 1G41A 2H4WA 1T8UA 4PONA 3WC4A 4BUZA 3CRRA 1V9SA 1AOXA 3F98A 4LDQA 5JADA 3K6RA 1I3OA 3F6SA 4CM1A 2PO5A 1I30A 2P2DA 3I39X 4HOYA 4MP3A 5BOSA 5HJ2A 1UH5A 1D5WA 1DHRA 1VRVA 4BX0A 4F5DA 1ESCA 2QIOA 4DXHA 1JZTA 4HH1A 4IHJA 1I3MA 2O19A 2QXYA 3GA7A 2RH9B 4PNEA 2CFIA 1CF4A 1SPBS 5CK5A 4A4DA 4AUKA 2I2WA 2YXLA 2WSYB 3FSRA 4UUQA 3SHVA 4RFSA 5A3JA 1JE1A 1PR6A 1F0PA 2N42A 5JBIA 4L50A 3VISA 3UEOA 2Q99A 1D6NA 3DMGA 3NHZA 3RV3A 2DAPA 1MORA 3IPRA 1OIXA 3IVMA 2PL9A 1R4NA 1VLVA 3FTPA 4C6TA 2CVOA 3FRJA 3F49S 4JEMA 2QSJA 3ZQ4A 4XJTA 4DDMA 1L3IA 4YAOA 4HB2A 5JW6A 5ARDA 1HZJA 5B3JC 1ZA1A 3DPIA 4JY7A 1SO8A 4L73A 2YMMA 1C7JA 2GLTA 1JHOA 4FFSA 3O21A 1P8AA 1MX1A 1X1TA 3HADA 1M8KA 4RORA 3RF6A 3QUSA 2HF2A 3PNPA 4ZHQF 3T1QA 5TR9A 3EFHA 1FNBA 1Y7LA 4UMEA 1QO0A 3AHHA 3Q7EA 3A3YA 1SMKA 3F4KA 4YUWA 1M1XB 1XMJA 1Q12A 1SUFA 3ETCA 3LQFA 5HEKA 2YKGA 1GT6A 3PIDA 2ERCA 1DJLA 4RTSA 2VRBA 3GLFB 3RUPA 4KVZA 5CDSA 3HR8A 4RSMA 2H1LA 3UUWA 2RGRA 2EERA 2FEOA 1I7SB 3OQPA 3TYXA 1I6LA 2XT6A 4NFYA 4BLVA 2DLCX 1JYSA 2W43A 3MZ0A 2HT6A 1BAPA 1R18A 4G0NA 2P41A 3FPBA 3L3BA 4MUFA 1Y8QB 3KC2A 4NATA 1A2BA 3CNEA 4QELA 3PRJA 1N7HA 4INZA 4F7DA 4B85A 1QYWA 1T3LA 3AKEA 4QYIB 3H9JA 2OZVA 1EWVA 1NN0A 3PPVA 3CMMA 2QZSA 5HGJA 4B35A 4M0EA 1HO3A 1DUVG 3F74A 3SXUA 4BXOB 4FNGA 4L0QA 4NU5A 3V00A 2G6BA 2CDCA 1GLVA 3FVTA 4XGIA 5GINE 4PIVA 4LJRA 4IZ6A 4MV8A 2OQ2A 2P9ZA 3P32A 4JR1A 4JLVA 3ISVA 4O2AA 4D6YA 4UBMA 5FUYA 2GJSA 1X8LA 5G1PA 1KWGA 2AW5A 1PIWA 1QK3A 2X76A 3EGVA 3HYLA 5IHPA 3T5MA 1YC2A 1IHOA 2Z09A 4N0PA 4IFIA 2VVTA 3AEXA 3O4IA 4KXUA 3VU0A 3I3OA 3VJRA 1EZZA 1EEHA 1YASA 4WUVA 2WG1A 4BVHA 1GV1A 3IIIA 3ZBTA 5CB0A 3IAUA 2YUIA 2BTEA 3V4VB 5KWIA 3BPSA 3WYBA 1G6OA 1Z37A 2WJVA 4B0OA 1CEXA 1G4UR 4E7PA 2QV7A 4C4SA 3A1WA 3GJ0A 3AB3A 1C41A 3B2NA 1YKSA 2E18A 3F4BA 5DDIP 1N6NA 1FSZA 4FMDF 2FI1A 1JQEA 2C97A 2FRVA 1J90A 2XNHA 2ZYHA 4ASUD 3WRVA 1II9A 3H7AA 4LWZA 5B36A 4YY3B 1E64A 2IV2X 3H8SA 3T7SA 4YI3A 3UW3A 1BKSB 1H2ZA 2WTNA 3HP7A 3QVSA 2E3JA 3OZCA 3GLKA 3KPVA 4ASUA 1IZZA 3PGJA 3H13A 2A14A 3QEMA 1FQOA 4R9RA 2VHVA 3ZY4A 4E4YA 3GMIA 2X1LA 3K6JA 1QE5A 3MCAA 3RYHA 1VG8A 3KJQA 3BFKA 2VH2A 5B2FA 3BXEA 4HLCA 4BMXA 4JMPA 3NC1C 4DC9A 3NHBA 4R8VA 3L77A 4XDYA 5TEWA 2F67A 4H0CA 1LK5A 1IYZA 5DHSA 5LBIA 3ANMA 1PF7E 1NKVA 4YB8A 4MB0A 2PKYX 5EHQA 2ENWA 4JP5A 1WEHA 1MV8A 2GPAA 5G3YA 1PV2A 1KC3A 1V35A 4V0QA 3WK7A 5HFNA 1QLHA 2QT1A 4CT0A 5J2TA 2EZ4A 3DCJA 3JATA 4K26A 3WMXA 4ND3A 5KVSA 2XCSB 5K0FA 1U0SY 3ND7A 4MS4B 4JUBA 3JZIA 1Z8NA 4OM8A 2X0DA 5KPJA 2I29A 1Z5UA 1BXKA 2VKQA 1FNNA 2WTBA 4G1MB 4JL8A 3KBBA 1E9SA 2FQ1A 1NZDA 2RGWA 3IAAA 3TZCA 3H5RA 4A6DA 4YUXA 3KVOA 4WOPA 4YHBA 1WHTB 1LDBA 4N3CA 1YJQA 3K1YA 4UC0A 2A84A 3R0IA 1B23P 3H3JA 5F4ZA 3X2SA 1U7WA 1SULA 1QPGA 3LQQA 1OVGA 1JG3A 1M2VA 4RLSA 1ZY2A 4QFMA 2O5VA 4QUKA 4WCFA 4QOIA 3BN3A 3ZBPA 1OAOC 1YQEA 5IAEA 2FLKA 4URVR 2ZU6A 1NVTA 3ANNA 2BCEA 2CEAA 5HOEA 4L8FA 1LK0A 5JT1A 2DLDA 4JT4A 5HQ3A 2DWOA 1J0CA 3I04M 4AG6A 2OB1A 5K3SA 5HPYB 2CHEA 4L5BA 5KNBH 5M29A 4ISBA 4XQCA 4DG5A 4LQCA 1K92A 1GTL1 5FQOA 4C5CA 3K9HA 4YAEA 5AQEA 5K4GA 3IMKA 5ALXA 3JQBC 3JPWA 1XTPA 4G0YA 2XTAA 3RWOA 4AJJA 3K92A 3NT4A 3BE6A 4XDGA 5L3RA 1US8B 2J5BA 2E4WA 2X8JA 1K8YB 4IDEA 2PT5A 1SVKA 1KEZA 2IP2A 3EQ2A 1HQKA 2A9JA 1RXUA 4ZA2A 3WWZA 3FDFA 4A0HA 1XJWA 1XXHE 5JMTA 1CNEA 1SA0A 3SX0A 2DCMA 4DNXA 4PHFA 5FF9A 2YDXA 1PYDA 1E2GA 3EG9B 5FTJA 4DJDC 3CF4A 1FXWA 2C42A 4XWWA 2ST1A 3K6KA 3G5UA 3QQ5A 4KXQA 4LS3A 4M0MA 5ENVA 5C0OE 1S4MA 2BISA 5AJHA 1YSCA 1I6WA 2GHRA 3HZZA 1J2YA 4ZDJA 1N8KA 3KL4A 5BVHA 5LWQA 1R0KA 2PHZA 3M1AA 4GOMD 4LY3A 3QE9Y 3DZKA 1AO3A 4YDHB 2WWVD 4TT8A 5AVUA 4UU1A 2FF5A 4Y7DA 5A1TA 1AK2A 1PSZA 2DWQA 3BGVA 3OAAA 1T3SA 4KKVA 4QDJA 4B34A 1ZJJA 4RSHA 2QD2A 1RI5A 4K3VA 4MO2A 2HDHA 4WCDA 1VSQA 5LB2A 2HRDA 3WK4A 2O2YA 4INAA 1IUPA 4IGFA 1NI3A 3HKBB 3OIGA 4RPIA 3OEHD 3W9SA 1QRTA 5JPIA 3FIJA 2OCDA 2GYWA 4BX9A 1ISGA 5EHGA 2JI9A 5A5GA 4FBGA 1W5TA 4X00A 2FEMA 4RTPA 3WLJA 4JC5A 3H1BA 3CLTC 3VR3A 3W3ZB 3NEAA 3OEHA 4IDOA 2JGRA 2X14A 3RIEA 3PA6A 1DCTA 1WU7A 3CH5A 3WIEA 2D5LA 2FOLA 2WHPA 5A03A 4JWTA 5BNIA 1OPXA 4UARA 5MGBA 2ES4A 3LNTA 5B1EA 5COQA 3KR0A 1L7DA 4U7PB 2PJRA 4MZXA 1CR0A 5E7QA 3DTVB 2GD0A 4RZSA 1OT3A 3NIBA 1DJOA 1E0SA 2D7JA 2J45A 6Q21A 2XXAB 3QF4A 3RTCA 1E6EA 1Y9EA 5DCLA 4LRTB 1WB4A 3K71B 2KWIA 4JVOA 4ZEWA 4NZ9A 3V2HA 1TKAA 1T4MA 4PO8A 3SVLA 3AOEC 1SZJG 4YRRA 3PJFA 2WZBA 1RKUA 3O8QA 1WMSA 4J03A 2JBWA 2BTQA 1F9AA 3M9WA 1ZOPA 4S35A 3QF7A 4MDYA 4R6WA 5KOHB 2PWAA 4OJYA 1L5VA 1N2HA 3H6HA 4IH4A 3GROA 1FYVA 1QVAA 5I7UA 1OFVA 2C5FA 4K03A 1KJIA 5ALDA 5CDUA 4A15A 5DNCA 3QVKA 3E1SA 2SNIE 1IN7A 4NMMA 1KP2A 4YECA 4QJ4A 4UW9A 4V3CA 4ACAA 2Y77A 3LC1O 4LVUA 4C5BA 2AD1A 3ISTA 5HG0A 1E2PA 1U7XA 5IJ0B 1QHFA 2DC1A 3KQMA 1U81A 2FEXA 4L08A 4ML3A 4BNHA 5AW4A 3KYBA 3ECCA 1V1JA 1W30A 4QUIA 5CBKA 3P9PA 4YP0A 2IBTA 2EQAA 4FNOA 5BSWA 3OZBA 4DRYA 1QFZA 3RANA 4F4UA 2NMVA 1R8JA 4MQFB 5DP1A 1T6NA 5H68A 4X45A 1XVVA 2ATVA 1UM9B 2HV8A 3GEDA 1RZUA 5I7RA 1TCVA 2VPZA 1MVLA 4A2QA 3D8HA 3SIXA 3FVRA 4YLYA 5IKXA 3OQIB 3LBFA 4V1CB 3MYYA 4FYKA 3T5DA 4W9MC 1Q21A 1T0IA 1EFPB 3KT0A 3WLOA 2WWYA 4PQRA 1XQ6A 2CVFA 4RSRA 4IG4A 4O4HB 4MAFA 1KI6B 5D7BA 3HMKA 4X1IA 2EXXA 5AIAA 5FBVB 5G0TA 4F1WA 3CH6A 4UPEA 3GUUA 3C85A 4E0BA 2OHXA 4BVFA 2J4DA 4I6JA 3FYUB 1TT5A 5JMOA 1E18A 2R7NA 1QX4A 2BVNA 3HA7A 1YR6A 4XM2A 5EMMA 3QE0A 3S5UA 1DEAA 1N1DA 3R3SA 1Y48E 5CTJA 4Z9AA 1FFXA 3TTUA 1TO6A 4E2XA 3VU3A 1NN3A 5DW0A 1E5DA 2I33A 3ON5A 4QXQA 4BQFA 2CXOA 2RH5A 3DFUA 4TROA 1B93A 1CUYA 4FWIB 4WXRA 5D3MB 3WL5A 5LZ9A 3IMFA 1XPUA 1W73A 5IZ4A 2R7MA 4NMWA 1P9LA 2YJTD 3IQFA 3KFLA 4PICA 3ZGVA 2IS2A 2IPOA 4PYKA 4UVHA 4HQRA 2CF5A 5JLJA 4RC9A 4EF6A 3TCXB 3WWPA 3EIFA 3N0WA 4R51A 3KYJB 5K3DA 1U9JA 3KXDA 3IV6A 3O9MA 1T4DA 1BE1A 2ZPUA 3BREA 1KDYA 1P4SA 2LPMA 4IILA 4MV9A 4PYIA 4ZO9A 1LDEA 3ZDCA 2PKRA 2WTMA 2ZVQX 3A9CA 5DWVA 5LWHA 1WXEA 4TWRA 4M9CA 2PXXA 2O7VA 4BKPA 2FN7A 1OXBB 4K46A 4PEVA 1XQ9A 1OXXK 2I62A 4WKGA 1CR1A 1VIAA 3LHDA 1G9SA 4RKEA 2DBYA 1B16A 2WKQA 2H85A 3AONB 1PJ2A 3IXQA 4KNYA 4I08A 2WW8A 4PTYA 2D4AA 4X1OA 4Z51A 3U56A 1JR2A 4E31A 1IHYA 2AI3A 1P2UA 1S3IA 2G0TA 2LRHA 1R37A 1P18A 2H4FA 2QP3A 2X0KA 4O3FA 4YGXB 5ALRA 4ZAGA 2WM3A 3V4OA 5KREA 1GG2A 2ZJ7A 1W4LA 1M2GA 4KQ1A 2BOVA 1R27A 2WUWE 4GR4A 1DIRA 4RNCA 4F2GA 4P22A 3AR8A 2ZRMA 4KYVA 1V9LA 3AW8A 1Y9DA 1CC1S 3L18A 1K2VN 4EEZA 2QRLA 4JHLA 3RUAA 1HLFA 4WKNA 2Q8QA 3QWAA 1NVAA 2CLHB 3GPIA 1ULBA 3GUHA 3HYSA 3NWJA 2XTNA 2A1TR 3KM0A 5B1HA 2PX4A 4YREA 3DB1A 1P4RA 3SF8B 3QVMA 4MKXA 2G7ZA 4HNUA 2RKBA 2ZPTX 4NL4H 3DV9A 2QM8A 1SIWA 2VUIB 4Q9IA 2FFJA 4TV9B 1J8QA 1JMVA 3W2GA 3HNPA 4Z4IA 5FP0A 5LQAA 3CCCA 2A86A 3LF2A 2DH6A 2M6RA 4P82A 4R2LA 3WNZA 4BQEA 1RC8A 3BXHA 3GF4A 3BXXA 3IR7A 1GPBA 3D31A 1OGIA 2O2SA 3BCHA 3R44A 4OYRA 1F0YA 4YLGA 3MOSA 1U4NA 2Z5GA 1GL9B 4ND8A 1UPAA 5EWLA 4FZVA 3H8JA 1P1JA 1HYGA 5K8IA 4LWOA 5LYJA 1OE0A 2VRCA 3SBDA 2HBQA 3D7RA 1MC5A 1OJLA 1NYLA 2DOKA 3EAQA 3HQ4O 4DLLA 2II6A 3B7WA 4OJMX 1E3MA 3ZS9A 1CQIB 1M6NA 4KAJA 1WCIA 1IBKB 4GPBA 2IZ1A 4ZVTA 4EUKA 1Y1SA 5KWJA 1QF7A 4XARA 2VJYA 1KTVA 3IJPA 3KYCB 2PZKA 2ZI9A 1DFHA 1SVNA 3LC7O 3OZVA 1D0SA 4O4LA 1XJCA 3DOIA 3NP7A 4F0JA 3LX8A 4DRXA 1YE8A 4FM9A 3PQCA 5DBGA 4NEQA 2DFTA 2JFGA 3T5PA 1O9BA 1LKZA 3BCUA 4OL0A 1O5OA 2AFVA 2ZYAA 4G97A 4R5MA 1COWD 4NMLA 5KYXB 1Y4UA 1LSOA 1KQOA 2OCXA 2WIKA 3BWYA 4A3SA 2CXRA 3D7LA 4CUKA 4FDAA 3RB8A 4Y30A 1E6LA 4WZBE 1DXQA 4X6YA 3UMSA 1F1BA 4E1VA 4Y9TA 1P0CA 2UVPA 1G16A 2QN6A 5DLQC 2BJVA 3FYHA 5ALLA 3BFPA 2QZ9A 4ZVKA 3TBHA 1SXQA 1EZ1A 3O4JA 4D9FA 1I9CA 3RC1A 1KHTA 2IL1A 5JIBA 5GM1A 4WOKA 2B2CA 2VJAA 4XRGA 2EQBA 3L84A 2ODWA 2DULA 2X3UA 3HWWA 4KR6A 1CUFA 1IXRC 1OZAA 3G9ZA 2CBXA 3PENA 3QEKA 3GLQA 4O4JB 1CIVA 3RSSA 3W8FA 3LUCA 2WM9B 3RFTA 3PHJA 5A04A 4RNDB 1NXWA 1X7XA 1NYQA 2C2KA 5A7GA 4YRFA 4EGFA 4EY4A 6YASA 3W5CA 3HI4A 1MHTA 3NHUA 4IJQA 1MAHA 1XDDA 4Y18A 2FZ5A 2ZBUA 4CDGA 2LCIA 3RS8A 1FMTA 2XADA 1JFVA 2W90A 5IABA 3VXKA 3IBFA 4UMVA 5FAKA 5IC5A 3QUCA 4QRHA 5DM2A 1ECGA 1C0EA 3CB2A 3ONVA 1YQQA 1C9DB 1CQJB 2CMGA 4JL6A 2O48X 2ZRNA 3IAFA 3M89A 4L7QA 4FFWA 4Q47A 2E4ZA 1KXZA 4ENRA 2Q5QA 1EX7A 4P7BA 1G8SA 1XAGA 1GRQA 3KCQA 4UDXX 3TX6A 1ZJWA 4N6GA 5TT0A 4LRYA 3IURA 2V97A 2ZREA 4BE7B 3NBKA 1T2FA 4L9SA 3BVPA 3R7BA 5J63A 4QA9A 4DUGD 1YE3A 2NWQA 5D51S 1A5BB 2JI8A 4X20B 2EDAA 4M1EA 4NBVA 2ISQA 2Z4RA 4TYPA 4EMSA 2VBIA 5CDFE 3SYNA 4MQEB 3R5HA 3ESCA 3DKVA 4LDNA 5AKEA 5B1SA 4P7FA 1EDEA 1W6UA 2VLIA 3OSZA 1UFVA 2BFAA 4FJ1A 4PZEA 4XSGA 4ZQFA 4DUGA 4EVIA 4UUOA 4DQXA 4MYHA 1N9GA 5IXSA 3U16A 1QGED 5HBRA 1IBCA 4K8RB 4NIMA 3DCIA 1XYGA 3QU2A 4L9RA 1Y7IA 5JXGA 4QVGA 1YFKA 1P4HA 2H5LA 3ESXA 3UJNA 4JJKA 3AVUA 4XWAA 4U2KA 4BO4A 2FMUA 2NU7B 4KH1A 3CUUA 4KH0A 4G89A 1MJNA 3DVSX 2BGJA 2ETVA 3HV0A 4OHXA 5BMVA 1RFLA 3MWDB 4OQYA 4OXYA 3W5JA 3UMMA 1TJYA 5AUQA 1HTTA 4ZTZB 2OAGA 5IKEA 1TKCA 4BRWA 5KNDD 5BQPA 2FZGA 4G8BA 3ZWYA 3O3CA 2D1FA 5ALIA 3U26A 1JLSA 3QG5A 2AFRA 3P45A 5DMXA 4DR1B 1W59A 3L43A 1M76A 1N6RA 2WLSA 1X7YB 3HYTA 4RENA 3LWZA 1Q7EA 3BIOA 1V3VA 1O94A 4DG9A 5KNDA 1UFOA 2AB0A 3FGNA 1A7JA 3GHHA 4LTNA 3U9SA 4LOJA 1KRXA 2V3CC 4MYTA 4CM4B 1ZU5A 3F1KA 4G0ZA 4YRLA 3WLFA 4HLNA 2ZBEA 3ER8A 2FQQA 4AG3A 5TJ9A 2F48A 4B7UA 4IDBA 4CIXA 4CODB 3K1AA 4KSBA 2G9VA 5EP4A 1ADYA 2W48A 2WHRA 2PS3A 2ZVDA 1YFZA 1C1YA 5JSYA 4Q4LA 2I99A 3DDOA 5FV4A 4HX5A 1F20A 1ZK0A 1X7GA 2CLDX 2EIHA 4K2AA 4KIUA 4D0LB 1HSOA 1IL0A 3FSJX 1ZEMA 1DO0A 3A05A 2IW1A 4ZAXA 3RK1A 4D9IA 5AJWA 1KO7A 1OXVA 3S6JA 3AYXB 5DHFA 4WNCA 3OPMA 3TQCA 4ROSA 4JH0A 2DCUA 2J0QA 1SOMA 2YOHA 1U9ZA 4UUBA 4CM8A 2VBFA 3P26A 3K70C 3H16A 2B1IA 1UJ4A 3ESBA 4Q1CA 4R69A 3NOQA 3RSZA 3SWWA 1AJEA 4V02A 3REQA 4X64B 4K9NA 2XLCA 5ESWA 3BRQA 2DB3A 3AL0C 2PSFA 1X1QA 2O8CB 3LP5A 2GVZC 2H06A 2ONKA 3FNRA 4Y2HA 3RT1A 4F9EA 3G23A 3AI2A 3TD9A 1GSAA 1BXRA 4FCCA 1LDNA 2Q3LA 1FFYA 4KWTA 1YKGA 4P4TA 2NXJA 4IJMA 3MCVA 1C3OA 3WIBA 1EA5A 3D59A 4IIEA 1NIPA 4NEGA 1WXHA 3T7TA 4MAMA 2BFDA 3FX2A 1OWOA 3R3ZA 4LZPA 4O0LA 3NB0A 2FPIB 4KGXA 5CVCA 1ZG3A 3G2QA 1HRDA 3KWJA 4AYWA 1P5JA 2R4UA 1EFUA 2PU5A 1M0SA 4JBLA 1B1CA 4LAFA 1GQ2A 3SJUA 3VR4D 1SOWA 2PTHA 2FSVC 2VJOA 3B8EA 3PGKA 1KKLA 1F9EA 2W2KB 2ZFUA 3QX9A 2EJTA 6GPBA 5EXSA 4B75A 3GMDA 2EGGA 4E33A 2B5WA 3IE2A 4NCXA 3VR4A 1IMJA 5B58C 5AM4A 3IUMA 3WFJA 4CMEA 4D96A 2IYPA 2V7PA 4J76A 3E7FA 3DV2A 4YQZA 4Z1MA 2EP8A 2VUUA 2H63A 2W6CX 3O4FA 3BH0A 2VL7A 1MB4A 2XAAA 4IEIA 4W99A 5DIZA 4ER3A 4AZWA 1O9GA 3JQAB 821PA 5KTOA 1EJBA 1ZOSA 4YIHA 2PTGA 4ZRNA 4KN5A 3QFSA 4EG5A 4HWSA 2VP6A 3P4UA 1ISFA 1WPQA 3PHGA 4GKBA 4HO1X 4R1LA 2A67A 5L3VA 2XB4A 2X9QA 1QVVA 3EISA 4PC7A 4BO0A 1FU8A 2NVOA 1QRAA 4HSEA 4BDSA 1SXGA 3EUAA 1EQ2A 1AUPA 4TL8A 2YOFA 4NEHB 2Q4BA 3R9XA 5CGZA 4OHMA 1TFUA 4L75A 5T4FA 4RDHA 1RBQA 3T94A 1G20E 4S3MA 2FPPA 1XEXA 1GCAA 3BRCA 3PE3A 5E0KB 1PDWA 3DMPA 4QODA 3ETGA 3PUIA 3P94A 3FHOA 3W5IA 4C6RA 4EEKA 2WICA 1G2QA 3SYLA 5B3KA 4DBLE 3A1TA 3PQ5A 4ZI5A 1XLVA 4W1QA 1UJ2A 4S2EA 2CK3A 4HZIA 4FHDA 4CHGA 2MYUA 1BXGB 3FPAA 2LWIA 1K1EA 2W6NA 4CEJB 1Z0ZA 1PWZA 1V1RB 1MG5A 5CLIA 3TB6A 4WBNB 1JDSA 3FYCA 2BFBB 2EBWA 4OGGA 2PKQP 4Q00A 1FBTA 1EG7A 3NH9A 4GP9A 1MF7A 4N03A 4E2YA 3OTQA 1VPDA 1WNFA 2IQIA 3AVQA 5FULA 4NCKA 2GYVA 1BD3A 1DVRA 3OZXA 4G86A 2RHTA 5E3HA 3FKSD 2J33A 2XYPA 3P2IA 3QYPA 2IIPA 4IQ8A 4C4OA 3C48A 4UBIA 4MKRA 4EZIA 4MRMB 5KYUB 1DAEA 1JKIA 3WKBA 3I32A 3WJAA 2H08A 1YT5A 2X5OA 5CG2A 1SXJE 2IOHA 3SYKA 2B20A 3D3WA 4BFLA 4BE4A 1N5LA 3W8NA 5HUQA 2DU8A 5KNCH 4AUEA 1MVOA 1THGA 3A1VA 4KVAA 4WFJA 3ZE1B 5ISMA 1E0AA 5J40A 2VNIA 2VAWA 5EUQB 1GUAA 2DT5A 1Z0FA 2O3JA 4L22A 2WR8A 2B4TO 1HX7A 2VJDA 1PR0A 2A0XA 1EFHA 1FXSA 1AGYA 2G5GX 4TXLA 1R16A 2AR9A 3TXYA 2MWMA 4OVKA 3TLAA 2R8OA 4X1KB 3M6VA 1THMA 4OYYA 4QSHA 5DX0A 3HLKA 2JF0A 4LXXA 3NNSA 4CKYA 1F12A 1BYIA 3DNPA 3IT0A 3KYDB 4I50A 1FRQA 2PGNA 2XECA 1RADA 1JT2A 2YS7A 4LE1A 2EKZA 1IN8A 3QA3E 2V7QA 2FMHA 4NBKA 4OU5A 1MO4A 4W1RA 4WV3A 1S8FA 2C9YA 5FUMA 2HL6A 1D2MA 1Z5VA 3QM1A 4ARZA 5FEMA 1KO4A 2PT9A 1X1EA 1NZJA 2HTFA 1I32A 1IE3A 1VSBA 3DG9A 4GDMA 4LECA 4RL6A 2V59A 1NJ8A 4B45A 2F1RA 4KKXB 1ARZA 4U2EA 4CNQA 1S3SA 3GB9A 4DV7B 13PKA 3PUVA 4XTCS 3T12A 3VZPA 4DZTA 1T3GA 3GJSA 1CUHA 2FW7A 2B9EA 3IP1A 3UOAB 4MVJM 4KPFC 4L0MA 3ZQKA 5G4LA 1T25A 1KNQA 2FSUA 4KRFA 1IQ0A 2I1LA 5IFLA 5JYBA 4MUAA 3RC7A 2B1RA 3UJBA 3WICA 5F3RA 1TW3A 4YDSA 4CV0A 1Y80A 2XCQA 3X2EA 1Z0KA 3Q9UA 4QXPA 3E05A 1DRJA 3ROPA 1PEAA 3RS0A 4U2CA 1TPZA 2JZCA 3MW8A 1ESEA 1W96A 2IU6A 4M8SA 1ZR2A 5KWVA 1V6CA 2QRVA 1M66A 5BW6B 3AH8A 2LGJA 3LWNA 2JPDA 2XTMA 2XB6A 3DTVD 621PA 3KLMX 1U31A 2C04A 4R05A 1FP4B 1I7QB 2DP4E 4OOEA 1Q77A 2C3UA 2Q28A 2DHQA 5LA6B 1N0VC 3SEAA 4M0FA 3UAVA 3NCHA 4YCAA 1GJRA 3LI2A 4D9BA 1M2OA 4QEDA 1QHYA 1GLGA 3KQVA 4EJ2A 1T13A 3DOJA 3MTGA 4LDJA 1S01A 1JEDA 1ZMTA 2GYUA 2V98A 2ZAGA 3GNQA 2ZS8A 3H19A 1U2DC 1VJRA 3DS8A 3LRPA 3OPNA 4W8HA 2C4NA 4CLEA 3HJAA 121PA 2Z83A 4OQMA 3FYTA 3WGNA 3TLKA 1ECFA 1E60A 4URYR 4IJWA 3WGJA 3VSCA 5JH7A 1U02A 1HQYE 1H8HD 3I3SR 3QK7A 2QSUA 3PI7A 4LUCA 1BRMA 2AJCA 1JVBA 2JLCA 2QTRA 3AHJA 3T99A 1X1AA 2YXEA 3U0BA 1Z7GA 3G0OA 5L7WA 4M49A 3IP3A 4ZGBA 2PH3A 3ORRA 2FFAA 1OC2A 4PQEA 1O95A 4P0PB 3ZH2A 1B74A 2W2PA 1Q19A 4LSZA 3PX2A 2AJTA 1AXRA 3KOZA 5A3SA 1RZVA 2OZLA 1YQ9A 3FDXA 4TUYA 3RC9A 3M0EA 1EG2A 3RFXA 4QG3A 1KVTA 5CM2Z 4ZALA 1VRWA 2XKBA 4OQEA 4D4HA 1FPQA 3WHKA 3LTNC 3VZRA 2WK1A 3VUEA 5FBQB 3KE8A 3Q9SA 2WWWA 4OAPA 3LVRE 4BV2A 1KIMA 3PNLA 3VR5A 4C14A 3KAJA 1G5IA 3KUCA 3BTOA 1BNCA 2WYUA 3DBLB 4PG7A 4XWGA 2H4XA 3PI6A 5LQRA 4G1VA 4AKSA 3PL5A 1H0HA 3TI7A 1DBVO 4NDNE 1ISSA 2PX2A 1FYDA 1EK0A 1GYPA 2Q6OA 2FWJA 1TQ2A 2HUPA 2Q6VA 1ORTA 2Y4NA 3SE0A 2A92A 1JR4A 1YB2A 1YS2X 3CG4A 2H4ZA 5EZQA 2OGUA 4S24A 3E8MA 3ML1A 1E6KA 1FFAA 1SKAA 3TW8B 1NR5A 1KVRA 3OE1A 4F3YA 3IKLA 2ASEA 1NOJA 2JAQA 4ZP1A 1TM4E 2Q4RA 2JHAA 4EW1A 5TT1A 3L4KA 3BAFA 3F4LA 4S1NA 1JNYA 1SUDA 5L95A 4WZAE 1T34A 5IMBA 4TT3D 3GJ6A 2I78A 3S55A 1XZLA 4YQFA 3FKQA 1GU0A 3HUDA 2H52A 1NUQA 4IYRA 4MR7B 4TQAA 4B5LA 5CDYA 2XGGA 1AXEA 1GL3A 5FLYA 4M9UA 4DLSA 3L6UA 2C5HA 1T3HA 2IHJA 1YZQA 3O0TA 3EC1A 4TT3A 3D7SA 1JQBA 4BGIA 1Q7GA 2HUNA 4M1ZA 1VA4A 3S2GA 3TR6A 4E3WA 3HDYA 1JTFA 1RWPA 2ZRAA 4EUHA 3F73A 3S99A 1L7BA 3T7AA 3PDIB 1SCIA 5JI2E 2J3JA 3V4FA 4YCNA 3WISA 4C9BA 1VGRA 2HSJA 3GIWA 1NPTO 4B2YA 1QAOA 2FPWA 2DKFA 2FDXA 3HFRA 4BNTA 1GFZA 2L0XA 2XIJA 2D06A 1J21A 2HJ9A 2R8EA 2A3RA 2YWFA 2ZKLA 3ELUA 3T1HB 2FWAA 4Z4EA 2GA8A 3VOTA 1AZWA 1C30B 1CU1A 1JEOA 3A26A 3H2BA 1XXHA 2NVUB 2VP4A 4GOJA 4JEHA 1RU3A 4B6OA 3FUCA 1RJFA 2N0SA 4PTZA 4UZEA 3ZOZA 1I1QB 4ZCTA 1A4XA 1NI4A 3ZHVA 2I3ZA 5K8TA 4Z7OB 2PLAA 4YDQA 2KLBA 4HDRB 1R4AA 2O3TA 4C3UA 8GPBA 2UZ4A 3C3BA 1V25A 1LBEA 4HMPA 3FPLA 4TLMB 1F3OA 5DXAA 5FNZA 2OYCA 4C0JA 1INLA 5HK8A 3FLEA 3C7DB 3K2IA 5AK0A 1XV5A 2XLBA 2J1LA 4CNBA 4RD4A 2X9LA 4JFAA 2UXCB 3WNQA 1QKJA 5KTNA 1FYWA 2C7GA 4YRGA 2IIBA 1FUUA 2A7QA 3AM5A 4G8JA 4AWBA 2G83A 4IIFA 2A0KA 2IF2A 3AY3A 4ITVA 5E0OA 4AY6A 2WHXA 4X7PA 1ECBA 2J3DA 4PN3A 2PKQO 4QPZA 1V3QE 1HE4A 1P33A 2EAUA 1WXXA 3DAHA 4KXFB 4IFEA 1R2QA 4ZYTA 1ULSA 5CFPA 4UQLA 2CXNA 4G5GA 3SI7A 4E7OA 5C1BA 2HCTA 3WA7A 4XM0A 3OHMA 3VJKA 2ZJBA 2PRZA 2ZAIA 1Q22A 3PJGA 4TMKA 3C41J 5FI5A 2JVIA 5K03A 1PQUA 4KK3A 1OA1A 3B5JA 2P4QA 4BP9A 4EB3A 3CXUA 3KK0A 4LQLA 4HVCA 5K4HA 1PJRA 1VBFA 1GQFA 1QBGA 1P2GA 2WDPA 3SKXA 1JHUA 3DMHA 2AG6A 5KINB 4P81A 3TTWA 4HT3B 3LU1A 2Q1XA 5CVUA 3ZGYA 5GWXA 1JLHA 4YGYA 4RK6A 3IVGA 2ZSFA 4C04A 1ISJA 1ZN7A 4X24A 3UAYA 2Q9UA 5CRIA 3RW9A 4QTUB 5KDDA 4W7HA 1OU0A 3PQFA 3GRFA 4DF3A 1DWPA 4KEAA 4KRYA 4GGOA 5YASA 2J3IA 3WADA 1WW2A 3EQZA 3LTEA 2NYRA 3GLFE 3I2GA 3FOEC 1SH7A 1SCQA 4TTIA 4HMQA 2QX8A 5CJPA 1NV9A 4YXWA 4PGAA 4EJ0A 5HM8A 1BDHA 2IT1A 3O8LA 5CM8B 1V5WA 2HV9A 3E27A 3EXEA 4AT1A 2EEZA 2VYQA 2GCPA 2XB8A 3NAZA 4KWHA 2PZAA 4DIKA 5H9WA 1N3IA 2HZBA 1AD2A 2OQRA 2I8LA 1BJRE 1JZQA 1L4MA 1OFTA 2QSYA 2WF5A 3Q10A 3V46A 4JXXA 4O4IB 1QE0A 4KG7A 4MVJH 2JHCA 3JAKB 5CXXA 4FB4A 1GUBA 2V6MA 1NQOA 1QZUA 3GGCA 1LW7A 2VJQA 1K7FB 1BHJA 1L5OA 3O2NA 4MMYB 4D74A 1YB7A 1M73E 3ROKA 3TEFA 2PQ6A 5DRTA 1ZW1A 4UHKA 2QLLA 2WFMA 3OCUA 2O8EA 4ZOLA 1UT6A 2J6BA 2OCPA 3QELB 1HKHA 4UXIA 3UK6A 1NE7A 3WGKA 4J0EA 4JVNA 4YP1A 3PPXA 1KYQA 2QLMA 4CQNA 5CB4A 3F6EX 4S0ZA 2QEQA 2C8JA 5FPQA 4QATA 5HF9A 1SK9A 2XCRB 2F43B 3GBSA 3FTCA 4PCUA 4WQMA 1DKQA 1R7RA 2YFQA 5IYZB 4J43A 5TF4A 2PMWB 1ML3A 1TVKA 3DDZX 1AX9A 1RD4A 1KFKB 1F8XA 1PI3A 1ECPA 2VNKA 2YS6A 1PX2A 1VHQA 3H11A 4YMIA 4C87A 4Y3UA 2RHRA 2OO5C 1NUPA 4L2IB 3T5AA 3SZ3A 1FLVA 2Q5EA 4FX2A 1QYDA 2QRNA 1H1LB 5E4TA 2PA3A 5KQSA 4YRJA 1TW2A 1P80A 1OA0A 2O3QA 3FYSA 3ONEA 4HH4A 4M99A 2Z6AA 1DCFA 1SHKA 1S2IA 1QRRA 4HK4A 4CJXA 3EOAI 4N8SA 2HHJA 3S68A 4AG5A 1A1SA 3GCXA 2HHHB 2VHWA 3HACA 2C9CA 4YAUA 4OOFA 5DM1A 2P6MA 5EMLA 4EJSA 2FJ0A 1GTRA 4R1UA 1Z5OA 3DD5A 4HDAA 1O4WA 1RXWA 2H59A 1QP4A 1S7GA 2KQUA 4BTVA 3RYCA 3AG5A 4DVGA 2FPGA 3AVTA 1Y7TA 4PPQA 2AZMA 2WZQA 2YXBA 5IAJA 5ARCA 1NC1A 1D5CA 5JLAA 2JKVA 2RCYA 4CQMA 5BR1A 8ATCA 3PE4A 3DYIA 2ZANA 3WDMA 4CE6A 1FDOA 3GNSA 1DP4A 2UAGA 2Y0CA 1UP4A 1TLLA 1RWNA 3KCNA 5DT9A 1IJBA 2IWHA 2I1VB 1PGJA 2UKDA 4IGIA 2FPRA 3K5PA 3BF7A 3N6XA 1YFLA 4OMUA 2OSBA 3RYIA 3ZDQA 3N2LA 2QAGA 3LAWA 4FILA 3ZOKA 1JFRA 4XOIA 4E07A 2P5SA 3FH0A 1S2MA 5H9VA 4INJA 3VR2D 2PZ8A 4UNIA 5EIFA 3VH2A 3W05A 4BWGA 1TLFA 2ZJAA 5LDHA 2Q2WA 3DBRB 2NXNA 3OT1A 4H6VA 5DLDA 5GGXA 2Z5FA 3AZOA 2CUNA 2QN7A 2J5QA 1R15A 2AFHE 3D7KA 4NICA 1T9GS 4PINA 4RGYA 4YRQA 2GHQA 1XHEA 2PXAA 1G8PA 1M5TA 2DBZA 2QZZA 4LJLA 4P4SA 3RVNA 4YBZA 2C7PA 4K6OA 3A2MA 3FGPA 1OBCA 4PLVA 1NZFA 1WXWA 8OHMA 4RA6A 5CW2A 4AJ2A 2HMTA 2XYRA 3V8QA 2NN3C 2R6AA 5A4AA 1DJQA 3M33A 5JTTA 4D9CA 1CZOA 1D4FA 2JRCA 2QV0A 3L7AA 2WSIA 4HAIA 1TVMA 2CNNA 2RHCA 3IAEA 3UJAA 1DIBA 4ZAZA 5TNXA 4AMYA 4BBJA 5CXQA 1PL8A 5IMSA 3C5CA 2P27A 4P4UA 3M7IA 2BFFA 3HVUA 4NENB 3E18A 3I0NA 3O9ZA 4JI8B 1QHIA 4KXNA 3JY6A 4B79A 2D62A 1R6TA 4JUCA 5FLEX 4C0BA 4M1OA 1I3LA 4J1SA 1FS4A 2ZUTA 4OQNA 4MVJG 3O6VA 5I7SA 2RONA 5KC8A 2VYVA 4FLEA 2M2IA 2O3UA 3SHWA 5I7HA 2XODA 4W63A 3F46A 1J42A 1SCKA 1U8FO 2GRAA 4GPAA 5DTEA 5FHRA 4F4IA 5CYGA 3K5HA 1I51A 4QU9A 1XDUA 4Y2PA 1H2XA 2IYYA 4EI2A 2BEWB 5CLHA 5F21A 3L41A 5LZ2A 5E38A 1E69A 1SVSA 2PA0A 3WGGA 4CMGA 3DL7A 3ND6A 1BMFA 1EDDA 2IYRA 2R5NA 2VYND 4ZEOA 5U4QA 4CM7A 3HSSA 3DL4A 3M82A 1M9NA 2B8EA 2Q4TA 1Z7WA 1ZVMA 2H2GA 4YMSA 3R9WA 1ZD1A 5TB5A 3TZBA 4BNDB 2HJWA 3GPCA 2ECQA 1WMDA 2VSFA 3K1JA 3PPWA 3QVJA 4PHHA 3VKVA 4ZVMA 4TMXA 4RCZA 5ESXA 5LZ7A 4YRKA 1T2DA 1QUFA 1I0ZA 3AFMA 4TL6A 4EVQA 4K9DA 5KTSA 3L7CA 4KHPB 1J25A 1DG3A 5C1PA 1JH8A 1SBTA 4WZBA 1QCZA 1ZNZA 2ECOA 1XBTA 1NT2A 1UJ6A 1AUOA 1Z9BA 1AMUA 2OCBA 2YCLA 1AHPA 5B4VA 1L4EA 1VL6A 3Q41A 2J9FB 3KAQA 3T4XA 2QAJA 1K27A 4J6FA 3GPLA 3EIQA 1KR2A 3RSCA 4PX3A 3RS9A 1H2WA 3OSUA 4PXSA 3JQAD 3UW1A 4ZV9A 3C6KA 3Q1KA 2YV5A 3LXMA 3SHOA 3DMNA 5FUBA 1Z4NA 3ZVKA 4B4OA 3FOCA 4FDTA 4H9GA 1QO9A 4QBIA 1VJ5A 1Y8CA 4UTVA 3EF3A 4RY2A 2BP7B 4J0QA 3H2SA 1WX1A 3FTQA 1OX6A 4KDFA 1DCKA 2NSJA 1MX9A 3O1JC 4I1RA 3QPCA 4MIKA 2O57A 1RCUA 4LBYA 4OUKX 3I9OA 4EHBA 4MIOA 4CM9A 1QIGA 1QS0B 2DPYA 2IIVA 1SWVA 1RI3A 1Y9ZA 3DFKA 3DLIA 2IHYA 2O9JA 2RKOA 2Z2YA 4HRVA 2WABA 4JJEA 2H4YA 4M88A 5ALPA 5EE1A 3PXBA 2P35A 4WHMA 4Q48A 5HKKD 1J22A 1NP7A 2ODQA 4EI8A 2VDJA 4FOLA 4Z9XA 4H27A 2PX5A 1ZH6A 4GVLA 4I5EA 1H4QA 3I64A 3WYFA 5GOTA 1ULAA 4R40A 3PQ7A 2QBYA 3P2OA 2CJWA 2NSDA 1I4WA 5K0ZA 2F8TA 1WCWA 1YJ5A 2FG5A 3QI2A 4IF6A 3CONA 3CR7A 5GGYA 1QONA 4H3HB 3K6SB 4IRUB 1JJ7A 4CU5A 1TJPB 1F4VA 2KJQA 2XQKA 2BSXA 4XGKA 4TYNA 4MDEA 2C9OA 4J0JA 4JENA 3ILVA 3GEPA 1KERA 1TQ4A 5HCIA 3N76A 2QB5A 5JFGA 4NYIR 5CDFA 4L1KA 1CUIA 2EX4A 3SC6A 1XPJA 4BLRA 2VWGA 3F3YA 2WNHA 1NJSA 3HZRA 4AZ0A 1RBMA 1F2VA 2MHCA 2XQFA 4EGQA 1CW2B 2PZEA 4MUKA 2WF9A 2WIAA 1AVTA 4DIMA 2ERXA 4OHRA 1B4DA 1QB7A 1NQAO 3VO1A 5EWMB 5BUQA 2RGEA 5HIKA 3B1FA 1PVVA 1BQ3A 2OORA 5CCEA 2JCSA 4F93B 1XMIA 3FFAA 3NV7A 2J09A 2EFGA 2WINI 1ST3A 1T1JA 1EE1A 1JBKA 1TJ5A 2I6TA 2J9ZB 3CRZA 4X3PA 4CF3A 3W5UA 3ZDAA 3CLUD 3GPBA 5EZYB 1O57A 3BC1A 4UUAA 1IY1A 4X7MA 4JN6B 1X74A 3BD9A 3KTAB 1Z6PA 1EGHA 2X77A 1XEWY 3T5CA 4BO3A 4CQLB 2GEKA 2O2JA 5JAQA 2C7QA 3KQSA 4GZ5A 2P1RA 4CMJA 2WKSA 1TTQB 1XZJA 1YZGA 4YRSA 5BV7A 4NQZA 3M6XA 4LE0A 2RGNC 4V0ME 1ZIOA 1A9OA 3P9IA 3M4YA 5KNCD 1PWEA 3UCFA 3LDFA 2GAJA 4NBTA 2XDQB 4EARA 3NZEA 2PBLA 1QQ6A 4KL8S 1Y1TA 4TLCA 4AFNA 5DW3A 5NLLA 5HCUA 6REQA 4YJ2A 4O3MA 3B20A 3HYRA 4M98A 4DY6A 2C3OA 4YWHA 2BDEA 3CEPB 4BFYA 1B3RA 3N3BC 1FS6A 3TSAA 1JHPA 4HAYA 3W5SA 4B9EA 1HLDA 1OREA 2HA6A 3KOXA 4JQOA 4C2TA 3U80A 3TLGB 4A5OA 3BF8A 3LLMA 4I2VA 1GXSB 4RF3A 2X8AA 3MCTA 4IKPA 1QIDA 3IHWA 2PR2A 2BEUA 2HIAA 4R2IA 2XYQA 3LW8A 3NAMA 1IK4A 1NN1A 4OP2A 2C2XA 1BWSA 4PZPA 3VZDA 2NADA 4D8UA 1F8YA 1AGNA 1E3JA 3AEYA 1RMYA 3IAS6 1MLDA 4AMVA 4CM6A 4S0XA 1JQAA 1U7PA 1KZ9A 3BXPA 4RVFA 4EGSA 4HQKA 2ICAA 3C39A 4PPGA 4RMHA 1EFLA 1T36B 5HP4A 4LN1A 1PJTA 3A3NA 3EZNA 5JV5A 4KSYA 1O6BA 2Q5JA 3T0FA 3GFBA 1JG6A 5JYDA 3UFXA 2ZUBA 3OMLA 4ACBA 1U1GA 1Z4JA 4CIWA 1IEXA 4FGZA 1NJ5A 3AUFA 3GVIA 3EOZA 3QMPA 3FTFA 3LX6A 4ND5A 5TVKA 5KTYA 2AX4A 1JLMA 4EL5A 5IW8A 5TMBA 2HPZA 1BCRA 3PWKA 1JQLB 2QU7A 3LY8A 1IWPB 1NVFA 1G3IA 1Q95A 4X84A 2PFKA 1YZHA 4KQKA 4OB6A 1P39A 1TEVA 3IO3A 3UG6A 2BFPA 1UEXC 2V54A 4KQ2A 4BQPA 3GELA 3FNGA 2I0FA 3JYLA 2CCGA 2LCQA 2PKWA 5KMGA 4ZT4A 3T7EA 1C8KA 2VDLB 2G8LA 1TIBA 2NV0A 3NTVA 3TL6A 1OAOA 3OZAA 1B14A 3H9EO 2Q5HA 3DP9A 3DO6A 4IVQA 3GGPA 4KO4S 4UHEA 1AKVA 4OSEA 4F3TA 4YJHB 1PL7A 5GJCA 1YGPA 3G7UA 3DDNA 4ZAVA 1IVYA 3ASYA 1TQHA 2JLZA 4L5CA 1LJ8A 4MUHA 5MHTA 3BSYA 3T7JA 4B71A 3FUUA 1JE0A 1YVRA 3ZLVA 2AN1A 2UYHA 1QIIA 3GP8A 2VJPA 1RVV1 2CD7A 3CVWA 1Y3FE 1Z8DA 1G18A 2RHGB 3JQBA 4HX2A 4M21A 4LGYA 3TUJC 1LNZA 1QTNA 3L4JA 4ARCA 4CKWA 3H1AA 3WSTA 3W1EA 4LNUB 3AR7A 4P54A 4PYRA 1P3Y1 1OCEA 1YCDA 2QW8A 1J1IA 1ACJA 1A3CA 4PG5A 3BFVA 4CF4A 1GVHA 2GDZA 1AXGA 2FRDA 2HPVA 3AF1A 4FGKA 2APJA 2W2LA 2XB9A 3NM6B 3D1LA 4HC4A 1BIFA 2CJYA 4H7EA 4RVDA 4FSHA 2HLDA 1CRZA 2FHPA 4NFHA 2E0IA 1YUNA 5B4UA 1D6MA 2R86A 1DKNA 4AP6A 3R5TA 3RRBA 3BXFA 2VEOA 1KZHA 5K2MA 4OU4A 3E5MA 1YB1A 4UDNA 4R1NA 3LF1A 3TUZC 3K16A 1G20A 4G9GA 1YFJA 2I76A 4G0OA 4KR7A 2PWBA