4YECA

Crystal structure of a clostripain (parmer_00083) from parabacteroides merdae atcc 43184 in complex with peptide inhibitor ac-vltk-aomk
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
126
structure length
126
Chain Sequence
METPEPRTTRTILVYMMANNSLNSFASKNIESMIEGATSKNLNGGNLIVYYAPAGSPPELLRIKEENGVVKKIHLKDYEKQNSADPDVMRSVIGEVVSQYPADSYGLVLWSHGTAWLPSDYQNKLK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Clostripain family
publication title Substrate Profiling and High Resolution Co-complex Crystal Structure of a Secreted C11 Protease Conserved across Commensal Bacteria.
pubmed doi rcsb
source organism Parabacteroides merdae atcc 43184
molecule tags Unknown function/inhibitor
total genus 39
structure length 126
sequence length 126
ec nomenclature
pdb deposition date 2015-02-24
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.11970 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yecA01
4YECA 3UWSA 5DYNA
chains in the Genus database with same CATH superfamily
4B5KA 1ONBA 4RJJA 4EFKA 1T3LA 2W6PA 2POCA 3FNEA 2QBYB 1OIWA 2PKYX 3SPXA 2Y1CA 4R1UA 1JMYA 1MQSA 1NJ2A 4PG5A 4YTEA 1XHLA 5AK0A 4MCHA 2ENWA 2H7XA 1N6PA 4OFZA 4ARZB 3WK9A 5MN6A 1RHJA 5DPMA 2ZSKA 3KHUA 2NT4A 4A3SA 4ZVKA 4YMVA 1KYZA 3X1WA 1RAIA 4JSRA 3EB9A 4XCQA 5FBWB 5IN5A 2IYLD 4HWSA 5FOUA 3FIJA 3I4CA 2CDRA 4GYYA 4Q3BA 4UAGA 4EP1A 5LOVF 1PNOA 3VO9A 3DLIA 3UJNA 2BKUA 3THXA 1USGA 4NBSA 2CJPA 4TSFD 3IDSA 4QTZA 3L93A 4NAHA 5E8JA 4MPTA 3IOBA 1ZM4A 2GJ9A 1E59A 3AM3A 5AJXA 4WNAA 4K5QA 3MBIA 4E31A 5I7VA 1E94E 4HGOA 4ZJYA 1T0HB 4QVGA 2BDTA 3QY9A 1UWCA 4HV4A 1FP6A 2JHPA 2IH2A 4UW9A 3FZNA 2WTMA 5CHEA 4Q7JB 1KMNA 3DZKA 4Z4QA 1U6JA 1CV2A 3GD7A 3QKWA 4RDHA 1NC3A 3TW6A 2LKCA 1XYGA 1L7XA 1G20B 1FMTA 2XCIA 1XDGA 1QGUA 2GN6A 5EUCA 4JLWA 4N3CA 3NW9A 2ZEJA 3OY7A 3LP8A 3MWJA 3TBFA 3NEYA 3A3PA 4E5SA 4RSHA 5A04A 2P6OA 1K8ZB 1WXQA 5CVUA 1K5DA 1XD9A 3CX4A 3CVUA 1FTSA 2GZDA 4EA8A 3ZWMA 1S2NA 4F2PA 4BLUA 4UUMA 4PN7A 2QGFA 2FJUA 1R10A 3IVGA 1WF6A 3PXEA 4FC6A 5BUZA 2RHRA 2P9YA 3ONWA 3UMYA 3IODA 1C3JA 3QVJA 5CYGA 5K99A 3FWPA 2A4KA 4M98A 4G23A 1NMSA 1U1FA 3PFWO 4QYSA 4FTWA 5BSTA 3Q2OA 4AZ3A 4ZCMA 2YYYA 1UKVY 2X7HA 2FUG1 3CB2A 1Y1KE 2EFEB 4RCVA 4A0GA 5A5EA 4URVR 3CXRA 4LEIA 1AE1A 2DQKA 2C1XA 3OQIA 1OD6A 4MRNA 5CT5A 5EMLA 4ZCRA 2ATEA 3QVKA 4LAFA 4BNMA 1G20E 2GFQA 2IYYA 1ZCZA 5CFPA 5HRCA 1ZGGA 2OG1A 3VJKA 1H94A 5JV5A 4ZJZA 5DRTA 2BSQA 1Z62A 3OE7D 4YUYA 3OCVA 3SS9X 4BZXA 1R6VA 3CS3A 3U4HA 4XM1A 1QJCA 1N3BA 2EKQA 2YUTA 4BAUA 3MLBA 3W06A 4CCSA 1J5EB 1KI6A 2AJ8A 1GEGA 3DQQA 2IU6A 1M72A 5B3JC 3ZLBA 2FQQA 2O7RA 2HCRA 4XJSA 3ZCPA 5JC1A 1IXKA 2IUSA 3WAGA 1T1SA 2OAQ1 2JIMA 5UKDA 1Y3IA 2JHGA 5DHFA 2F2TA 3BE5A 2O8FB 1NBEA 4KL8S 4WD3A 3LZDA 4I9UA 3UG6A 1KY3A 3X43A 3GLIA 4ZAVA 5KNDD 1HX7A 4BGEA 4FBLA 4PONA 4NZNA 4UXJA 4LX8A 2SCUB 4OBWA 3FKQA 3GYBA 1R6TA 1NJ1A 3MJ4A 4ACAA 3D8UA 4NS1A 4DPMA 4MR8A 1KIAA 3UMRA 4QGAA 1H6DA 4D42A 3DZJA 4EW3A 5C81A 3A4NA 3UFXB 2IXTA 2OILA 5HK9A 1YHNA 3M6UA 4BCDA 3VR4D 1JAHA 2QM8A 1AD2A 2NTEA 3R3WA 5K2OA 2WR8A 2ZT6A 4LQLA 5IEBA 3R75A 1D4AA 5F1KA 4X8LA 4U2BA 4JC0A 4LJ6A 2WM9B 1YQ9A 4RSRA 4WCDA 3NUGA 4XLTA 3TMYA 1ST2A 2ANBA 2WI8A 2VTVA 4TLLB 5FI0B 2HV8A 3B48A 4MK4A 1NE2A 2HWUA 1O6CA 4KN9S 2GPAA 2VK8A 3N6XA 3KELA 2QKYA 3CH7A 3UK0A 3OAAA 4TMVA 1E66A 2ON6A 3DXYA 2WZBA 3GYGA 4DR3B 1Q17A 4TTSA 4AJ1A 4N5HX 4JT2A 2C5HA 4D0SA 1CP2A 4KQMA 5GV7A 4FFLA 1YQTA 3AX6A 3W5CA 3C5CA 1BYIA 2VHXA 2EGGA 1OU0A 3DPIA 3PFHA 4PG6A 4YMIA 4CTMA 2Y67A 3QELB 4OXKA 4AP9A 4D9EA 2FH5B 2G06A 2G0NA 3C3JA 4ZPJA 1QO7A 4WV3A 2OFPA 4F1KA 5DN6D 5A0FA 2YVKA 2Q50A 3DEFA 1I6WA 5HF5A 4F85A 1R1DA 2O5EA 1XQWA 5AXAA 2Q3JA 2N9UA 4FFOA 4URHA 1FNMA 3HKBA 5B7GA 2CFTA 1Q22A 5ALYA 4IDQA 5A9SA 3SF8A 4AROA 1FY2A 4DR7B 4D74A 2X41A 1CZLA 2X58A 1U3GA 5B1EA 2FX2A 2Q8PA 1G8AA 3Q87B 3KQKA 4DQXA 1QRSA 1F7UA 5IT5A 1KZ7B 2OC9A 4F21A 5DWDA 2W4IA 5CT6A 5IKOA 2Y66A 3QOFA 4KODA 3CGWA 5TPWB 2PGJA 1TM1E 2YTZA 2OCKA 3EY4A 5A5VA 1R5OA 4Q4HB 4LOJA 3WC4A 1P44A 4GNRA 3UK1A 2Y1XA 2X9NA 1O8CA 1ZH0A 1RYEA 3CR8A 1TKCA 4ZO7A 3RYTC 2XLBA 1PGJA 1QWOA 2AA3A 1JKJB 4RMGA 4ZEOA 3SBXA 5IHPA 1XAGA 1CUDA 2ZG6A 2BEVA 3O4HA 5T6MA 3TSWA 2KBEA 5GONF 4BJHB 3GP5A 1E2FA 1N92A 1U9ZA 5G41A 4DA9A 4YT8A 3OQOA 3PCRB 2H4XA 2Y4OA 4OQ4A 4CKBA 2OFXA 5C8VA 4JSTA 4JB2A 3WIUA 2H1RA 2I62A 3AB7A 3L05A 4PYIA 3X3HA 2BONA 2V58A 4MH0R 3KQQA 5K5EA 4Y18A 2CLEB 1WMEA 3HVJA 4C0QC 4QOFA 3NHBA 1Z6XA 4MGYR 2IV7A 2HU8A 1B76A 3G7UA 3TQQA 4DFDA 4E5DA 1X80B 1EX7A 2FFJA 3PEEA 1E5DA 2A5DA 4BVAA 5LOVB 2GH1A 3R6WA 1BH2A 2MYUA 4LIPD 1JGTA 4JCCA 2C5EA 2JH8A 3HQ4O 2QB5A 1T91A 4OQZA 4WOCA 4S1WA 4CU2A 2HK9A 4CMIB 4RY0A 9LDBA 3L0CA 4C0HA 2YJ6A 3UAVA 4J16A 7YASA 4RENA 2XVXA 4JQZA 3T3EA 4DYVA 3CWQA 2BM0A 4X8OA 4YJGA 3DL4A 1DV2A 2WAYA 3UANA 2QX7A 4BECA 2H9IA 5J1TB 4RABA 1CUFA 3DAPA 5TMPA 4R1MA 2AQHA 3KSMA 2O0KA 4OKNA 1HGXA 3P0RA 2JH3A 3VZCA 5J4KA 3EXEA 1T13A 3QHAA 3LT1A 1LI5A 3ROMA 2HBYA 1XCLA 4QUJA 4LV6A 3RVPA 5CYOA 3FLBA 3DHYA 4HAYA 3WO0A 2EQ5A 2RBGA 2Z8YM 4L0MA 5JH7F 1ZCFA 1Q0TA 3T1NA 3HM9A 4RFSB 2GEFA 2QM0A 2GPNA 4O2LA 1N5JA 5P8WA 1EE2A 3RKUA 4IHJA 2UVPA 1NPTO 1Z6AA 1ZITA 1VE9A 5BW4A 2ZROA 4OLJA 5AM1A 3ZUPA 1CFJA 1JBKA 1U94A 1JB9A 3DFKA 1L1QA 1YVUA 4ME6A 5FUXA 3TVYA 1XG5A 2YJ4A 2WV9A 3H8VA 4AIIA 1U3UA 3PQ7A 4D3FA 1SQ6A 4FYPA 4GI2A 4XX0B 4EI7A 3WL4A 4UD6A 4CMJA 3EVBA 1FLNA 2Q0QA 3CZMA 4JLMA 5LNK6 5JSQA 1BHJA 3A10A 2GAIA 3NOVA 4J0FA 4UBKA 1GOTA 3A26A 2XZPA 3A06A 4OGFA 1MLDA 2PBFA 3JQ8A 4YAEA 4O3FA 1FB5A 2GASA 3HUTA 3I1FA 3NJ4A 1ARZA 3KOMA 2N47A 1FSSA 5LMNB 2C4HA 2XA1A 2FMKA 4U7TB 2IXAA 4YFYA 3WGLA 2UZ1B 3HPQA 3A9CA 1KYQA 2NSYA 4QD3A 3JR7A 4GPTA 2X40A 4N6OA 5JT1A 2X1LA 2WZCA 5KB3A 4N5IX 1FLAA 3ZJTA 1TA9A 1XHEA 2JJQA 2WSIA 2GJKA 3QPVA 4XKJA 4PGMA 5TQ0B 5B4VA 1BX0A 1BXKA 4Q7EA 2CHUA 1DC7A 3IUNA 4RF3A 3OWOA 5A4JA 4CDMA 1M8PA 3IP3A 4WXPA 3EXHB 5HKOA 3OOHA 2ZSAA 3U5TA 2GKSA 3RH0A 1VE3A 2ODBA 4MI6A 4S2EA 3AUUA 2F1RA 5LU9A 1N8TA 3WLHA 4RTQA 2C7RA 1VKOA 3R6DA 4ZAZA 3RSHA 1CETA 3NPMA 1EK1A 1T43A 4RESA 1OI2A 1N2HA 4X3CA 3VYSB 1WZNA 2R66A 3M33A 1PJ2A 1RAHA 2GD0A 1JIVA 4A0QA 4D3ZA 5F21A 1NF2A 1J5XA 3KZOA 3H2ZA 4UASA 5TS3A 3TQHA 3IEVA 2YYSA 1YR9A 2I2AA 2WHPA 1QNLA 3EFOB 2A1UA 4DLXA 5BOSA 2GT1A 4KMRA 1MZPA 4OJKA 4YJDA 3O4FA 3W3AA 1B7GO 1VJ5A 4YA6A 1WPQA 1ZH4A 3PRKE 2FEWB 3VDMA 1ZN7A 1AS3A 2QTFA 2IUFA 3ZQKA 1SC6A 1K8QA 4M37A 3BCRA 3ITEA 4P0QB 2VIIA 2ZUVA 2C20A 3IEXA 4FQ7A 2QXYA 4NV3A 2FPRA 4PYRA 5AKZA 3W5SA 1FVOA 4PLGA 2O8DB 3WQQA 4MPDA 4EQZA 1TTQB 1V9LA 3GR6A 4TMKA 3NRCA 3RRYA 3GEBA 3CRNA 3PXCX 1HY3A 4K6OA 1U31A 3ZEAA 2OP1A 1AGNA 3WVNA 4RF4A 1MAVA 2OORC 2P9TA 2MMGA 1SUSA 2K87A 3A6KA 2G4LA 5TT1A 4ZYUA 1QB8A 4RS3A 1ZRHA 3DC2A 3EJ6A 4E21A 1UJCA 3RGWS 1O7JA 5ECDA 2R6CA 3LY5A 4BU0A 1QE0A 5GP1A 4WN9A 3S2FA 3T4PA 1Z0SA 3Q7EA 3K1JA 4RXTA 2ZJYA 1BVUA 3RYCA 2DBVO 1VIAA 2QV7A 1PIWA 4MV0A 3ZJ5A 4C0AC 1TA4A 3WGGA 3OWXA 1N5MA 4C4XA 3ENQA 1IXZA 5BQPA 1UFQA 1EUZA 5HKLA 5BO5A 3BXPA 3WGVA 2ZM5A 2XMRA 1I9GA 3S28A 1SCIA 4RYDA 4GOLD 4TTVA 1B4DA 1XTBA 3LMKA 4O02B 5DXJA 3DBHB 3VTZA 3ZW9A 4WUTA 4ZDKA 3OBBA 1R00A 3B12A 1OXBB 4NMHA 5FA5A 4ZHQF 4CKZA 1R5JA 1ZLXA 2I4IA 5JI3E 3DKIA 5IRCD 1OLXA 5FUQA 1AA9A 4BZWA 1F17A 1VG0B 4ODIA 5IWCA 1TAGA 1HQKA 4X7BA 3E9DA 4MUJA 1AO3A 3D59A 3FVVA 5K9ZA 1BFKA 1DINA 1SRQA 3CH6A 3F8SA 4EZIA 4ESEA 1BIFA 2WHYA 3H1AA 4RL4A 1VHQA 2CD9A 3OCJA 1ZX1A 5ALPA 1X3LA 4CLRB 1XVTA 4PAGA 4XPIA 1PAUA 1AKMA 1RC1A 2B5OA 4S35A 4Q4LA 4YP1A 2D06A 4MSUA 3O7WA 4Y67A 2WWXA 3IURA 4FEAA 3ZHQA 2WUDA 4R51A 3EPLA 2WWYA 3J80A 3OOEA 5C8YA 5KC9A 3H5AA 5L45A 4CT4B 4AWAA 3QLVA 1I51A 4C5CA 4R8LA 1S3SA 2CDNA 1Y3FE 3FKJA 4MLCA 4S0XA 1WMSA 3A28A 4HUQB 3V9AA 1X7GA 4KBGA 3K9WA 2DEUA 1EINA 4Q1EA 1G2IA 1LDEA 3BIWA 3R41A 2I2DA 1AXEA 3O9MA 5DP1A 5KVVA 5K4GA 1DOZA 2VH1A 5AXDA 3GDWA 4NEQA 3OZXA 1D03A 2ZT5A 1SBTA 1E4VA 4U6SA 3OFNA 2PU7A 3BDVA 4WEQA 4CG3A 1E0DA 1ZK4A 2Q3EA 2ZYSA 3GJZA 3R74A 2Z57A 5J9FA 1TUIA 3NEAA 3RC2A 1H0KA 6CHYA 3QU5A 5DMXA 3D0QA 3Q9NA 1KI9A 2I03A 4P80A 1KDOA 1UJ5A 4R31A 3WFIA 1P72A 5IW8A 5FBKA 3KE8A 5BN1A 3C3XA 1AS0A 4FJ2A 4MUMA 1QGDA 5IJXA 1L7VC 2YKGA 1YGYA 3S3TA 2LGJA 3IQDB 1CSEE 5A5GA 3VA7A 4ZDIA 3U4IA 4W82A 7AT1A 2NV0A 1P31A 2ZVDA 1A82A 3NTVA 3V4PB 3KB2A 4JJ4A 1EK6A 5TX7A 1PZXA 2GAOA 4KXFB 4AUMA 1NXOA 5JH7B 3ZS8A 1GZ4A 4HF7A 4QBIA 4DMFA 4DDVA 3BCHA 3VR2A 3GLGB 1TW3A 3DE2X 1FCJA 4KZKA 1V95A 3P9NA 3C97A 1BS2A 1QVVA 4RK5A 3B8HA 3FNGA 4Y2SA 3AI2A 5A4MS 5F51A 1TEZA 4QSMA 2B4QA 3H13A 4EHJA 1A9YA 1WV1A 2OD7A 3RIGA 1DRKA 2VYND 1KBQA 2WILA 3PUHA 4EVQA 1NU8A 4EI2A 3COZA 4N7JA 4U9UA 1Z07A 1XVLA 2O2GA 1NGSA 4L4XA 3TX6A 2AR7A 1QTQA 1GPJA 3LVQE 1W47A 4EI9A 1G6Q1 1V0JA 4AWXA 1O94A 4RKQA 4J1NA 1R0BA 5JJLA 5IKEA 1ZR4A 1RS0A 4KIGA 1ACMA 4YNBA 1N2GA 4G97A 3HABA 1Q92A 1M74A 1NLZA 2VDJA 1PL0A 3E15A 1TFUA 3FCXA 2HN9A 5GWXA 2C8VA 2QD5A 3WGOA 4A0RA 4C4OA 2EDAA 3GV0A 3QWBA 3ZCTA 4EX6A 5HPYB 3EBLA 1P1CA 5CHYA 5D3ZA 2EL7A 3GLGE 4ZEXA 1PJ8A 4I08A 3S7ZA 1CS4C 1CU1A 1L3CA 2IXBA 4XTCS 4DF3A 5KSWB 4CLOB 4FNMA 4US2R 4Q9NA 5T4HA 5AK5A 3PSAA 1MO6A 4ISBA 1GPKA 3LK7A 3P45A 5B53A 5KSPA 3W8DA 1GFSA 1KDPA 1L7QA 1U0TA 2DR0A 5G53C 3V1NA 1NPDA 4EGJA 2IEAA 5FPKA 4IJ6A 1B3RA 2ANCA 3UJ7A 1XIVA 1NZJA 2AJTA 3EXG2 4BC1A 4OCZA 3TWOA 4EPWA 3D4BA 3OZUA 2G7ZA 4YRKA 1NUQA 2QVGA 4PX5A 3Q5GA 3DVRX 1GTSA 1PZNA 2J7PA 5D3MB 3TIXB 1E2DA 3HBLA 3A4YA 4I1RA 1N8SA 2C03A 2I9PA 4LN1A 1YTUA 5C3UA 3AVQA 2PJZA 3FYTA 2XBLA 3LUPA 1U8XX 2JI7A 3BGIA 3KQTA 3WJAA 4BB0A 3AVUA 5IM4F 4QAQA 3DE5X 4IIDA 4IHKA 4JQOA 1GP2A 5LJLA 1AH2A 2XA9A 1CIJA 2CMFA 2XQJA 2CVPA 2OY0A 4FR2A 5DK4A 3OUUA 1GITA 2BKEA 2ZLBA 2NSHA 3CEAA 3H5IA 1Z47A 4HOYA 2OGUA 2BMEA 1IK6A 3GAMA 4PO1A 5DVZA 4ZI3A 4YS6A 4GVPA 4H0CA 3K5PA 4Q37A 2OMKA 2QRHA 4JMPA 3OJOA 1XLTA 5DWVA 3ZNOA 3K0BA 4K7JA 3OOJA 1VA4A 4DG8A 2A7XA 1TE2A 3BTUA 1CCWA 3DA8A 3TEJA 3LFTA 4A0HA 4EK9A 1QC5B 4ZT2A 3DC7A 2GK7A 1E2KA 1P4RA 2HMTA 3DZFA 1YR7A 3G9QA 3TB6A 1VP9A 4YCLA 2H16A 2VP3A 2WYWA 2WP0A 3SSNA 4RCYA 1Y7IA 3BC1A 3A9RA 4S1PA 1JHMA 3T5MA 3DZIA 3CT4A 4HNTA 2VDWA 3LK6A 3MMPA 4FQ8A 1M8GA 4A5SA 3ILHA 4WWHA 4BO8A 4ZWNA 2J6CA 4BVGA 3TIGA 2OB2A 1KZYC 4MMXB 3WYCA 4IGIA 4GNKA 4PCAA 3DYBA 1YF3A 5CNJA 3IBCA 1ZOOA 3JATA 1Y89A 3GRYA 2HDNB 2CE2X 1MGPA 2YV3A 3BHNA 5KYGA 4NQZA 1XSEA 5IT0A 3OTHA 4K86A 3RK1A 3W2TA 4L0DA 1A9QA 2H08A 2KW5A 4XEUA 3TFOA 1HNZB 1KAQA 2PL9A 3F2IA 4R7GA 3NKVA 4ZHSA 3C2QA 5KTPA 4NH4A 3QNUA 4R01A 4BV8A 5EIEA 4I1YA 1CUHA 5EE9A 1Z17A 1BCSB 4EDFA 4M4SA 4YV2A 4M9CA 3OETA 3NM4A 1KI3A 4CM6A 4ZHQB 1BWRA 1GG8A 1EZ1A 2WKRA 1G21A 1PFVA 1PJ4A 1Y5IA 3FBWA 4MWZA 5F76A 1T9BA 1CDDA 1O08A 2P5SA 1V16B 1YCGA 3EWAA 1SU4A 3U7IA 2B82A 4DNXA 2W11A 4JITA 1IHOA 4ZCSA 2EKPA 1MG0A 1RWBA 2WG0A 4PQGA 3U9TA 3ZC3A 2GZ3A 2VHVA 4PAOA 1F4PA 4DNOA 4MW7A 4XVCA 4AZ0A 3RRNA 1U7OA 2Q1WA 2FPOA 2ZKIA 3T1TA 2Q5CA 2WQ6A 4MJXA 2ZCJA 1KJQA 5A9RA 4EW2A 3RNOA 2HNAA 3SEFA 3H7AA 5BNZA 2QXTA 1SG0A 3S5UA 2RK3A 1G8PA 1Z4LA 3KCQA 4IGFA 4XPZA 5AUOB 3MUEA 5EI5A 1Y6ZA 3PFKA 4IIJA 3T3GA 4QAJA 3TQCA 1UODA 1XZAA 2WKQA 3S29A 4B31A 1F3LA 3N87A 1MW8X 3EVCA 1IM2A 1E2JA 3FPEA 3LL7A 1ILWA 1AURA 1ZIXA 1C30A 4QYWA 4F3RA 4P32A 4C3VA 3UBTA 4LWOA 1VLJA 4OXXA 4HN9A 3PE4A 5AQ1A 4HNQA 2GCNA 4X54A 4K2HA 5M2QA 1G7TA 2VL7A 1TGVA 2G04A 3PEVA 4L5YA 4LSMA 3Q1LA 4O4JF 2YXNA 2R60A 4QQRA 2YRFA 3E7WA 3VR1A 1D2AA 1I0LA 3U3DA 2H11A 2YW9A 3L0PA 3QWHA 4JR0A 3DV0B 3EVZA 2FEOA 1V26A 1PO7A 3N8GA 1ZMXA 3IAM1 4BX0A 1C2YA 5A2GA 1P2SA 5BN5A 4YGXB 1GA6A 4EHLA 1Y5NA 1YUMA 1AO0A 4D8YA 2H7VA 3I9KA 3HRIA 2QLTA 5KAMA 5KVQA 4XZ3A 4LRQA 3NHAA 2RD2A 4PNEA 2OCPA 5DI9A 3IEPA 3WRVA 4CUZA 1RKVA 2JANA 4UPEA 1Z33A 1SNYA 3KL4A 4LQ4A 5A62A 4RTMA 2VPYA 4UQOA 4F91B 5AVXA 2EG9A 3M1AA 3DB2A 1NVFA 3VHXA 5HFNA 4HQRA 4N1AA 1LKZA 1OHHD 4YMWA 1Y8CA 4QOSA 4Y2HA 3V3KA 1G17A 4AJIA 3AIIA 1V8ZA 3FF1A 3U61B 1TO1E 2G5TA 2HAEA 3BH7A 3CZQA 2JVKA 2QPTA 5I7RA 1P7YA 2BISA 3AEYA 1EXNA 3L02A 4MKHA 2VI5A 4IH1A 4QKQA 4QHTA 4B80A 1QYXA 5AKLA 3FETA 1J2UA 3WKCA 3ZCXA 4WBXC 4R98A 4ECAA 3RU3A 4UZSA 1B3BA 1CY8A 1I14A 1QCDA 3HU2A 4B75A 3BPSA 3N74A 4Z7OB 5EZYA 2QW8A 2BMJA 4OI4A 3OP4A 4WK6A 5F73A 3JD0A 5SY9A 5B3KA 2OT3B 4C0JA 1ZL2A 1KEKA 5B1HA 1H0RA 4JUDX 4FOOA 4MUFA 3R4CA 4RQUA 1HE5A 2JKVA 1KDYA 3WMEA 5AW9A 4JFRA 2C0PA 1FFYA 4HDNB 2A4MA 1KJNA 1VSUA 2V5AA 4GOND 2JIZD 3KD2A 5IDWA 3K20A 5C4MA 3LPNA 4LJAA 3A6DA 3N9IA 3EH1A 5JWHA 5KKNB 3BOSA 1E7SA 3F3YA 3OCXA 1YS2X 1BHSA 1Z26A 3A27A 4Q82A 3OEED 3W2EA 2J5BA 3JAWB 4QUAA 4YI5A 4WCFB 1TVMA 2HFJA 4EHFA 2DH5A 2PQ0A 1MA3A 5KX5F 2XUAA 4HUJA 3GQBA 1Q1BA 3PQDA 4WRRA 3J81k 1JLSA 2WF9A 4EVSA 4D6XA 4E5VA 4O6VA 2HIHA 2QLMA 3UPUA 4JQYA 3TRJA 1AQLA 3USZA 3IBTA 5K05A 1KEZA 5ED4A 3RHZA 2IW1A 2P4HX 3PDHA 2HJGA 2QP4A 3BCSA 2PL1A 4MA0A 4UVGA 3KHTA 5IJ0B 1MRSA 1FL9A 3SYMA 3NJ8A 3UWSA 2VSNA 2VF8A 2N1BA 3F5MA 1Q2XA 2DYKA 1O9BA 1OZFA 3SC2A 3FIUA 3ECSA 4A91A 4ETMA 3DDUA 1GRNA 3B70A 3TNFA 3UHFA 1IFXA 1R18A 4EO4A 4A15A 2JGDB 1Q6YA 1J2YA 2VN8A 2R6DA 5LA6F 4CF7A 1PG2A 1GNTA 1BKYA 2QT9A 3OPMA 4EELA 4YRCA 4BNTA 1UOOA 2BGIA 1ZMOA 3G79A 2VK1A 2ZRMA 3I8OA 2GM5A 1AZSC 3MTEA 1Z5PA 1FUKA 3H9EO 1E2NA 3PD7A 3KKLA 3QI2A 4URUR 1ZOPA 1N1DA 4BNUA 3ZVNA 3FSEA 2WHEA 2FXIA 5KKAA 1U3FA 2LNDA 2POQX 4B4WA 2PA3A 2JFZA 5FOWA 4K8OA 1Z5VA 3BTVA 1NQUA 4MQ4A 4IWYA 4B3CA 4XFDA 1H0SA 1VJDA 5EINA 2AC4A 2JJMA 3BQMB 1I3KA 1RRMA 3T34A 1RFGE 5ES4B 1EYZA 5JSYA 3ELBA 5B1DA 4UEWA 2HC9A 3DZCA 4J0HA 1GTRA 1OT5A 1U1IA 1WY5A 2G0AA 2JATA 3JQAA 4OXRA 2Z9CA 2EWWA 5G4KA 3AU8A 1LBEA 1PJTA 3FPJA 1TF7A 2JLXA 3EQ7A 4PIVA 3N0VA 2WIAA 1V71A 2WTNA 3UYLA 5BR7A 3B3FA 2LVBA 3GMIA 4YLEA 5C1IA 1G6OA 1V4BA 2XDAA 3HNPA 5F33A 3RO7A 1JHAA 4LQDA 4PZPA 4ZANA 5JRZA 4FCTA 4RVHA 3U3OA 2AGVA 1ZCJA 2FAXA 4DR2B 4U3JA 1BJKA 5KOHB 2MIIA 4AQDA 4B2IA 1U3TA 1L7BA 5JXGA 1CEXA 1JE0A 1VIMA 2WYHA 3EF1A 1ETHA 1DG9A 4OPMA 1CQPA 4U9IS 5TV2A 3LX6A 2NMVA 5TS2A 1WKVA 5JHHB 2NPOA 3FMIA 5K0GA 1PLLA 4ESHA 4DLAA 3NP7A 4YXWD 3KV1A 5SY4A 3BSYA 2GCOB 3KZMA 4LZPA 4A73A 4MUKA 4U2CA 1IWOA 1YZKA 1EFVA 4FJ0A 1M1UA 4ZMSA 2HBRA 3BEDA 4LY0A 3F6BX 3WWYA 1Z3CA 4KLNA 5SZIA 4LC9A 3T0FA 2LDXA 3V8NA 5HVNA 4EITA 3DE1X 3CLRD 5ESWA 2HA5A 3L0ZA 3O2JA 4BMXA 4YXFA 1BC5A 2B2XA 1Y8RB 1Q0HA 2WT4A 4NBWA 4QFBA 1OY1A 3BL8A 2QLFA 3EIUA 1UXGA 2DUWA 4X84A 2HA7A 2WUFA 4FWTA 4D0RA 2ODNA 3VSCA 3K70D 3KAJA 3PQFA 1V11A 2W0SA 1SUIA 4O4JB 4AWBA 4HB0A 2AE2A 1G8HA 4DBZA 2O0JA 1OASA 4P84A 2I6SA 3LX5A 3G0GA 3AM5A 3GRAA 1YI0A 3OKAA 4PC6A 3QLUA 4TYMA 3PVCA 1SVUA 5JYBA 1MJNA 2PXCA 3LXUX 10MHA 1FP1D 4J6EA 5I7SA 2VRCD 3KYBA 4GBED 1OPXA 4X20A 5JQWA 2O7NA 3OIFA 4MW5A 2RHLA 4CG0A 1YQWA 3VNVA 3MWDB 4IIXA 2FWMX 3WL7A 2IBTA 3EOBI 4BASA 1VJTA 3JXEA 3LBIA 3P4XA 5DM2A 2EC5A 4BQNA 4NE2A 1VBMA 1YDEA 1KKUA 1TUBB 1FW6A 1BHQ1 1TU3A 2ECOA 4BQOA 1Q0RA 3GT3A 4M1KA 3GLHB 1NQAO 2FMIA 5IDYA 4CI9A 3DOJA 1TCAA 1Y9EA 3ZJ4A 2ATVA 4JOQA 4KREA 3TG2A 2IXGA 1GQFA 4CM4A 2WHXA 1A7KA 5EWMA 5B2ZA 1N1GA 2XUOA 2YWEA 1U7HA 3FZEA 3IOEA 4MAAA 2X3FA 3AZOA 5GQSA 5LBIA 4WXHA 1YFKA 4US0R 1NJFA 1TT5B 3H9UA 3MRSA 1C4WA 1TQ6A 1YDMA 2ZJ8A 4NBVA 3SXUB 1Q1ZA 3PHGA 4UHCA 4EEZA 1S8FA 1A0OA 3GN1A 4RU1A 1JPJA 3UXYA 3G13A 1KPIA 1OZ0A 1LSJA 2FZKA 3W1WA 6GPBA 1RXIA 1YQUA 4RY2A 1Z63A 1EFPA 1A4IA 1OYOA 1UBKS 1W30A 3FX2A 3I6IA 3LOQA 3MJFA 3OLCX 5DLDA 4CTNA 3CR7A 1YR1A 3H75A 1MH1A 2YV2A 2WFZA 4MTLA 3TTYA 1GG9A 2G77B 3LD9A 2K7ZA 3TI9A 3GRPA 2ZE5A 3FZQA 2J46A 3SS7X 4XRGA 4CW7A 1A7AA 1U2GA 3LW7A 4BCBA 1BQEA 3GLHE 3HVHA 3LBYA 4HX2A 1IB6A 4KPGA 3S1AA 4HNAB 1M2EA 2J9GA 2NU7B 3PX7A 2VATA 2QTTA 1E6EA 3GIDA 2Q8QA 2QRUA 3NBUA 2W2OA 3CNNA 2VJBA 4WJZA 5JO9A 2FQXA 1I2ZA 2W83A 4Q00A 1E32A 4JOCA 1N77A 3JD3A 3MWLA 3RF7A 3HXMA 2J1LA 3WI7A 2J85A 4HBGA 5HQ3B 2QBYA 2QRKA 4DV3B 3ZDEA 1UDXA 3G5AA 4UVHA 5AR1A 4A92A 1S0UA 4GRAA 3K35A 2BE9A 1EFDN 1WX1A 4JB0A 1LSOA 1V5WA 3P4UA 4YRNA 3GCWA 2R6HA 3DOOA 5TGTA 3R20A 1Z4QA 4ZA2A 5JTUA 5T64A 2JLUA 5M3BA 2M6SA 2R6ZA 4GPD1 5BSKA 1IN7A 3THYB 2V7WA 5AHXA 5A0TA 3VKHA 5FH9A 3G9XA 2Y1DA 3QHPA 1CQJB 1N1MA 3EDOA 3NGXA 2GM9A 2Q5HA 1LUAA 2XQIA 1LTHR 2PXHA 1E1LA 2O3TA 3I2GA 3HU1A 5AM2A 2PDAA 3IV7A 5LA6B 1NASA 2FN3A 4H17A 3S44A 2VPXA 1H6AA 4K40A 4F9EA 3PGLA 2JFXA 3UWPA 5FDFA 4GEGA 5L8VA 4KBFA 3U44B 1SXIA 5DO9A 4TXJA 1O58A 1A9OA 3QTBA 4RGYA 3HP1A 5KYUB 3ODPA 4V2IA 2IDJA 2OMEA 4K6KA 4C30A 4CETA 3PDIB 4YDHB 1QGYA 1WV0A 1WQ4A 3CLVA 1E9FA 1G20A 1SBCA 3GGOA 3T8YA 3TW8B 3FTFA 1PJ3A 1ONPA 4Q1AA 5M5BA 2MHCA 3CYFA 1STOA 3U1TA 2GXUA 3MCZA 4GPAA 2R9VA 5DKFA 5FBVB 4LVNA 1P4SA 3G9TA 4EG0A 2QT1A 3GAAA 4PX2A 4GEKA 2AFVA 2BJWA 3PBKA 4KUGA 1X94A 2HREA 5GV8A 3SXJA 5BV0A 5A7FA 3A36A 3BZWA 3SE7A 3NNDA 4RPJA 4S12A 5BW5A 8LDHA 3OIWA 1DV1A 2TMGA 4AO7A 3FOEC 3GJSA 4XSGA 4LMRA 1ZC3A 3AWDA 2Z2IA 4KQWA 2PUBA 4BFUA 3NH9A 1LW7A 2OV1A 2WU0A 3JU3A 3H5LA 3B1YA 3RSOA 3BILA 3PCTA 5CLLA 4EMSA 3PEUA 1K7SN 2NZ2A 1G5FA 3CSUA 1NI4B 5CA0F 6LDHA 4XDGA 1TUEA 3TDNA 5IDVA 1O4WA 2VG8A 3P0EA 4RKRA 3QVUA 2FCRA 2ZUBA 1Y0BA 4KMSA 3T4UA 3O6VA 2YCLA 2J9FA 5JIBA 3ZY6A 3OO1A 2H1SA 4CF3A 3NATA 3O47A 4X8HA 3WWZA 1LQUA 3DMNA 3AUJB 1T2VA 2REQB 3G2HA 1Q0ZA 1X87A 3EEBA 1J2RA 1XTZA 2PJUA 3K53A 4JJFA 1EFRA 1T25A 3BE8A 4G67A 3IHLA 3URMA 4KXUA 1O96B 1WW3A 2WMYA 4YO7A 1H2WA 2BGTA 5LBTA 2VK2A 4LE2A 4R2JA 3TQOA 5KVSA 4KHPB 2CLIB 3EDYA 1GCGA 3HM2A 3C0KA 4H3VA 4J6FA 1UKYA 1VI2A 4NE7A 5ENZA 4FE4A 5JLAA 1EH5A 5IH3A 1EM6A 2B4YA 4F3CA 4YJ2A 1JLLB 1MX1A 3GH3A 3NAGA 3NAZA 1KJJA 3M5DA 4HVAA 3WKBA 3QKIA 2C5LA 4O0LA 1KAEA 1GA4A 4G5SA 1YNSA 1YIAA 5IUJC 2XCTB 3ON5A 2Z3WA 3GN2A 4G5OA 4I36A 3NHWA 3S4YA 2D7JA 3T3HA 3A2KA 2O8FA 4YQYA 3U48A 1COWA 3WV5A 1FDSA 2UUOA 1RP1A 2AK2A 2VAVA 2DC1A 3DMFA 3KBOA 2WWVD 2DXIA 1GSIA 1MFPA 1ZJ4A 3N53A 1GLNA 2Z8XA 1F6WA 2XMZA 2SCUA 3ZZTA 4ADSG 1K88A 1GYQA 2HRRA 3ROEA 4ZVUA 3K6RA 3M83A 3QEJA 2AVDA 1LS6A 5I4CA 2YVQA 4ZZ0A 1OLSA 1PR0A 2ZRAA 1BEZA 1UC4B 3A0RB 3AMVA 4HZGA 3B3AA 3UFXA 4DREA 4H08A 2Z98A 4TT3A 3ESBA 5CIQA 3S27A 1OX4B 3S70A 4UXHA 2YNMD 1RZUA 5FOTA 3BTSA 4GI7A 2HTFA 5IVDA 2H31A 4F38A 3RVOA 4BNWA 2IELA 4BOYA 5TXGA 2P9EA 2GJ8A 3OU6A 1N0VC 1O5IA 2DGDA 1VHDA 5ADVA 5LZ8A 2J3QA 4TS9A 3EBOA 4AY3A 4RPIA 4DR5B 1A4XA 3ICEA 2YFQA 2GNAA 5IKXA 3KJNA 3LYUA 4IH9A 1P4JA 4GVLA 3SNKA 4FZRA 1DAGA 2VWQA 4FZVA 2XQFA 2H5EA 3P2JA 5T7BA 2HHHB 3B9PA 3PNPA 5A4AA 2E7ZA 1HLDA 1JPUA 4MI3A 3W6NA 5DHAA 4A26A 1JG4A 3RIMA 2V7XA 1UZUA 3QELA 2FZ4A 4NCXA 1NX6A 2ZR7A 3R44A 2GHRA 2DVMA 4P34A 3C3AA 4LDZA 5YASA 3VFDA 1P0QA 1K97A 1G19A 3KR9A 2FSVA 4OHOA 2XUGA 1KZ9A 4GXQA 4ZVLA 4NOJA 3QFTA 4IJWA 1SBIA 2HBQA 3RWMB 4D3XA 2OV4A 4TZKA 1Q7EA 1QHIA 3C6QA 3WQHA 1Y9DA 2PGDA 1M9NA 2QQGA 5EFZA 2R79A 1ODIA 2VNHA 4D8UA 2DETA 3BBLA 3SLKA 1EXDA 2BUCA 1TADA 1LD3A 1K3FA 1Q83A 4W7IA 3BRSA 3GGCA 4JQCA 3VZBA 3T7DA 4CKEB 1ZXXA 4KFUA 1N2JA 2ZETA 3OLYA 4RK4A 5FUYA 1MB0A 4Q4HA 1UIRA 3L6UA 4XOUA 1P1HA 1KHHA 1SPXA 4HDRB 2WP8J 3JSAA 5EKDA 3CMMA 5HJ5A 3NM5A 3WK8A 3ZVKA 5A02A 5DLPA 3HRHA 2DKOA 3ENZA 3UUFA 2WABA 3ZHTA 3BJIC 4DAEA 4F9TA 3OX4A 4C9BA 2C97A 3OOYA 4YALA 4ZCQA 1FJXA 3ZWBA 1DBWA 3TXXA 4CDNA 3K9HA 5JFOA 1T6ZA 2I4OA 4AMZA 2XUHA 3E9QA 5EIHA 1G9TA 4P4SA 4UUQA 5DSZA 2XZTA 2PU5A 7REQB 3PNOA 3TNJA 1X80A 2ZQZA 4Q9AA 4Q9JA 3UT6A 3H8JA 2ZBRA 4AZTA 5LOVA 3P0FA 2BGUA 2G1UA 1M10A 3JX9A 4ITRC 4URWR 5K3FA 1TMYA 1W1UA 1MENA 1WXFA 2EBFX 3IIIA 3KRTA 1GPH1 4LDPA 4M9QA 4C4TA 4CMIA 1K3TA 3CSDA 3MTQA 1TJYA 4OU5A 3MXTA 4Q4AB 5CTAA 4NMXB 1AZTA 1PJQA 2HW8A 2B1RA 4ZO6A 9ABPA 5BNIA 4YCSA 3QFHA 2QV0A 2VQSA 2ZYIA 3C14C 1Z38A 4G1VA 4J75A 4LKRA 3QXSA 4X6XA 1BVYF 1FJ2A 4GVXA 4CLEA 4BFWA 4U2FA 1M7BA 2IOQA 1G0OA 2DULA 1XN1A 3FNBA 1KDZA 4MVJI 4X1OA 1QCZA 2VJPA 4XB1A 3G02A 3G0CA 2ZTUA 4LBVA 2O6LA 5MGNA 1QVAA 1PLJA 4RFSA 1IEVA 1GADO 1R9NA 4MKRA 2O3QA 4PPNA 1M2NA 4D9JA 1T8TA 1E3DA 4OYYA 2LKDA 3TSYA 4R8VA 4HYEA 5A3JA 5DLYA 3RG2A 1AUXA 2IHBA 1P9OA 2J6IA 5EHNA 2VJDA 4JLSA 1WSWA 2IIVA 4JT8A 4DRZA 5AVZA 2JGEA 4RPLA 2J3DA 1NUSA 4PCVA 2CD7A 3IPXA 4K9MA 5LZ9A 3HZZA 4BNYA 2MSNA 2W71A 3CVYA 4RD6A 5CA0B 2DPGA 1ZN2A 3OTIA 4IZOA 4GU5A 3LRTA 1D9XA 1WZEA 1Y5LA 1PP4A 4V0SA 4EHDA 2JRLA 3C7TA 3K2QA 2XCUA 4N3NA 2Q41A 2ZS7A 4IOKA 2EU8A 3F1KA 2Y0BA 3EZ9A 4U7JA 5EE3A 1JHYA 2DPYA 2R8OA 1CY1A 1U8ZA 1AZLA 4D9FA 5GOTA 1UFKA 1JHPA 1XD2A 2HCBA 1JR3D 2OYRA 1ESEA 4YACA 5DX0A 5TQ0A 3BZBA 1HUQA 3I2HA 5SYNA 4FOTA 3QPWA 4MQBA 1TM7E 1XKQA 4CCWA 5B3AA 2F9FA 3RUHA 1FFEA 2GBFA 3GJ4A 2NN3C 4ZQEA 1G6KA 1FEZA 1TVKB 2Z2KA 3E81A 4OQMA 1Z0IA 4NLLA 4XSHA 3SJZA 4X6LA 2SKCA 3ZHCA 4X91A 2BGNA 4XDHA 4HNSA 3BSSA 4O1IA 1G2PA 1SAYA 1W5BA 5DHPA 3TSAA 2XV1A 4MUAA 1JH9A 3V8BA 1DFGA 1LQTA 1O6GA 4LE1A 2FZWA 5ADWA 4J1TC 1OC2A 4M6WA 4WTOA 5DOZA 3VKGA 4LYFA 3HLKA 3NTQA 4XGNA 2ZANA 2YJNA 3SZ3A 1VB3A 1CUSA 1RP7A 1F51E 3B1KA 2DQSA 5AVRA 3DYVA 1EHIA 2BKXA 4RA9A 1BDMA 4UU8A 4B6PA 1VP3A 3SBOA 1EQ2A 3MTJA 4IHAA 1L5LA 1OFHA 3G82C 4XSVA 1T1IA 1G8JA 3NHLA 3KB1A 4AQYB 4I4TA 4LYDA 3DVSX 2PGOA 2O8DA 4X97A 4WNIA 2XCRB 1PWXA 2QTRA 1X3SA 2VDPB 3ZJUA 1ELOA 3IQXA 2HX1A 4G5YA 4P58A 5LZ2A 2LCQA 1I7PA 1MT0A 3JWGA 3ETJA 4HQOA 2CSUA 4BO5A 4ZKDA 3TZLA 2NLOA 1TKBA 2OGWA 4UBNA 1AHIA 3GUUA 3EMDA 5CDYA 4DR6B 1RRFA 3KB8A 1ENZA 1O9HA 3T1OA 4MPJA 4HAIA 4DRYA 1IM5A 3CGGA 3TM4A 2DAPA 2FMXA 4BS9A 4EZBA 2O1WA 3KP1A 4NYIQ 5T8KC 2O3SA 3UJBA 3AP3A 2PO5A 3I2JA 3AVWA 1M6VA 3UOAB 1TK2A 2BBWA 1HLPA 1H1LB 2DHDA 1CNMA 1D09A 3BIFA 2C92A 1TAQA 3M6WA 4NHOA 4B7CA 3IKTA 1WXEA 1ISHA 3QMPA 4K2AA 4X63A 2FDXA 3IUQA 3SZMA 4D8XA 3DO6A 5F12A 2XRFA 1C1DB 3ACCA 2UYHA 2X9VA 1V5GA 3J81A 1WBBA 4F9GA 5AP9A 2NO1A 3D3JA 2PKQO 3O8BA 2EFJA 1QHHB 3GG2A 4Z0NA 1ADBA 3FNFA 3OHSX 1E1RA 4CI0B 1G5QA 2HWWA 2M6RA 3HO8A 4TWZA 1JPVA 3EDCA 2IHJA 3F3KA 5TT0A 4CT0A 3ENKA 2BYTA 4JJAA 1DXHA 2PMFA 4IGKA 5JISA 3D7KA 1TM3E 3HSYA 1EDOA 1U7XA 1A8HA 2WW8A 2I2FA 4II3A 4KIJA 2O19A 4X7RA 3T3PB 2CYBA 1XRQA 2ZK7A 3MUOA 4GL4A 3FPCA 4M8IA 1B8OA 4EHBA 1W85A 1RDFA 4CLRA 2P9GA 1R4AA 2WG1A 4OAQA 3PXXA 6REQB 5I9IA 3FHJA 4BPBA 3JTMA 1TKAA 4J29A 2PX4A 1VHLA 5EP1A 5G3YA 5GONA 3TKLA 5JNLA 2Q6OA 2PLRA 3GROA 3COPA 4QEDA 1JDVA 1C9YA 5FTMA 3MIZA 3BWMA 4JUBA 2QD2A 3M49A 4KNWA 5EJGA 4Z4FA 1GG2A 2G28A 1G42A 1MW9X 1Z8FA 4G26A 2IYUA 4HUQA 2HA4A 3IQWA 3KLOA 4M9ZA 2A14A 4CQMB 1CZUA 5HWSA 2HWYA 5EFOA 5FLEX 4HS9A 1EWVA 1ID1A 2AOUB 721PA 1IYZA 1Z6PA 1FE8A 1MNAA 4Q03A 2VDRB 3LIPA 4OJQA 4BQFA 1N2SA 2CFCA 2J0SA 1QQTA 3KZ1E 4MVXA 4M8LA 4FMDF 1C7IA 1E2BA 4Q9DA 4ZTBA 5CGZA 4CHGA 3I9FA 1T2CA 3HCOA 4UU0A 5KQRA 3W5JA 4H31A 2NPIA 2H1WA 2XDQB 3L6RA 5JO0A 1TLTA 2AD5A 2GVZC 3TAHA 3KE9A 3ZWDA 4Q19A 1J24A 3ILVA 4G1UC 3VKFA 5IK2D 4KE7A 4ITUA 1MO4A 4ZYZA 4JYZA 3DP7A 4L28A 4DLSA 3P27A 4XYMA 2XSZA 1BMTA 4GI1A 4M76B 3HZOA 4RY8A 4MS4B 1QTIA 3QX9A 5DHUA 1SG6A 2F43B 2I99A 1DB3A 2VP6A 3G88A 4EM6A 2PD4A 5JH7A 3F1LA 3SQMA 3FLMA 4DUPA 1DKPA 1P80A 1V8OA 3Q6NA 1H2ZA 4B87A 1ZAYA 3SR3A 4Y98A 1G4AE 3IVCA 3VO1A 3ZE8A 3G7NA 2OE2A 2QR3A 2WNSA 5IANA 1BCRA 2X4IA 3FYHA 4FFWA 1PFWA 5KUTA 2J30A 1L4LA 1T6YA 1WR8A 2FZLA 1BGXT 4ZJUA 2AF3C 3CLUD 2WC1A 3RYIB 2XXAB 3HZHA 3WGUA 2VNKA 5EMHA 1LS1A 4TN1A 2HOQA 4FEGA 5IYZF 3HGMA 1FF9A 1TQDA 1SWVA 5A1TA 2BELA 5FP0A 3L7OA 4NZ9A 4CKWA 5KPDA 4D5EA 1W2WB 2BR4A 3ZQJA 2XKBA 3P71T 4RTPA 2ACVA 4KQGA 5C18A 5HKKA 1GZHB 3T5AA 5BQXA 2C8JA 1V41E 1M6HA 3EEQA 1LLDA 1JIKA 4NE9A 3IOCA 3N05A 4RY9A 1R8XA 2RHHA 2WOOA 1YDGA 2BFDB 3KWLA 4EABA 2PH3A 3HE3A 4IF6A 2R8XA 4R8MA 3RYFB 2C31A 3SYTA 5LN1A 1RWXA 4II2A 4DW8A 2Q7OE 4BNIA 4Q9LA 1DAEA 1JG1A 3IR7A 1X70A 3VX3A 4ALIA 1XNJA 1VC2A 4P92A 5E1OA 3W8RA 3ZWOA 3D4LA 3AKZA 4EHHA 2NZJA 2WTUA 5B4UA 2QJFA 1T24A 2FPWA 1CJMA 4I8DA 2Z5GA 3VH3A 1P1FA 1YHYA 1ZU5A 4EVIA 1BU5A 3MB5A 4MTCA 4PG7A 3FCOA 3TE7A 3NHSA 1WDTA 4L2IB 5BN4B 5FEMA 4LI3X 5EIAA 3TM5A 4F8EA 1U63A 1XTIA 4R1OA 2NV6A 3QA9A 3TOVA 2QP9X 1BXZA 4UCXA 4NV0A 3QVGA 4CM1A 3OM9A 3UM9A 1NN0A 3ND8A 4DZZA 4MVJD 1WMDA 4KIWA 5FD8A 1ZVKA 2ODWA 3MOIA 4GLBA 4UUAA 2QRZA 5K8IA 1PZMA 5IAJA 2H1FA 2DH6A 4HMQA 2FETA 2WBLC 3IIJA 3NI2A 3REQA 3O3NB 1YBAA 4QBGB 5BXYA 2IBSA 1JX6A 2CBGA 5J59A 4IEEA 2BL4A 1J09A 2SNIE 3KLBA 4G0PA 4IV8A 3M7IA 4UU1A 3EXHC 1H2YA 3R3VA 1IY8A 3TGPA 4MA4A 3RYHA 5AUPB 3RV4A 4J2TA 4X92A 2RJ3A 5KDDA 2X2FA 4LRSB 2WY2D 5FORA 1J42A 3DOUA 5GVRA 1ZS9A 5C46F 1V3VA 2EXXA 2QL9A 3NQ41 3TOSA 1NVMB 3U26A 2GDZA 2QENA 2FPGB 1U7DA 2OZLB 2WIGA 4DV2B 4B6QA 3LG2A 3H5VA 3UJCA 4C2TA 1JW9B 4NZZA 1SU8A 3O7MA 4G85A 1IHYA 3EVTA 1QMPA 3HMQA 5G0SA 4LHEA 1CUUA 4B6EA 1TQ2A 1Y4SA 4B84A 1VL0A 2FYTA 4O1HA 2QR5A 4BWVA 1UM9B 2ZUWA 3HI6A 1Q20A 1W2GA 2QUIA 2W8BA 3CT6A 1NA5A 3LKZA 4JLDA 1DRUA 1A9PA 1I5OA 4A03A 5AK4A 1XTRA 1LPSA 2BGLA 2PA0A 1KRXA 1GDTA 3RBVA 3WQRA 4ENQA 1UMKA 1UDCA 1I33A 3ZVMA 2FPSA 2CLSA 2H65A 3T9AA 4DWJA 1MF7A 2I3GA 4I4IA 4EL5A 3KSDO 5JRJA 1MAWA 4OHFA 4Q47A 2QRVA 1UINA 2GD2A 2FUEA 2VDVE 4Q39A 3AW8A 4A2PA 1ZZEA 1EDBA 1C41A 2C8LA 3E3OA 1JQKA 3KDSE 4TVOA 3OPYB 1E7YA 3MM4A 4K26A 3U7FB 2J0UA 2W2XA 5GJCA 3F0TA 3NHJA 3VHRA 4BP3A 1MJHA 4P4LA 3OSZA 1BTOA 1E7WA 1I6MA 1QP8A 2OKCA 3CLTC 4R84A 5D8DA 4TYNA 1T8PA 1CB0A 1BCSA 2G9UA 3GVXA 5H82A 1G5TA 1YZYA 2X77A 4ZHQA 4F1JA 3NBKA 4N3GA 2QN9A 3EDQA 1KIMA 2CNKA 4X9XA 4IV0A 4Y1GA 1QRTA 3ACBA 3HP4A 4QUDA 4OI0A 5HDBB 1L5KA 4YBZA 3UA4A 3SZGA 2ZUFA 3ME5A 3ZY5A 3F71A 4KG7A 1HT2E 2GJ4A 1N6LA 1T2NA 3EF3A 2J3JA 3ANYB 4HQ6A 5L3RA 1UKEA 221PA 3V8MA 3ZDZB 4BUZA 4F06A 1VCNA 1WZIA 4CIWA 3ICQB 3K71B 2IHZA 1PV1A 1JHVA 2CDCA 4JENA 4WLNA 2UVDA 3AR4A 4MV5A 1WOYA 2XTAA 4WY8A 2GHIA 5BYJA 3TIVA 1J1IA 1E5TA 1ZD1A 4GP7A 5JDCC 1GPYA 1FK8A 3TNLA 1XL1A 2QYTA 3WLIA 4UULA 4UNPA 1PZEA 3BRWD 4A16A 1G55A 1D2EA 1W2HA 5C1DA 2GSWA 2ILVA 2VEOA 2NVUA 3N2YA 3E3AA 1OXMA 1W0KA 3TLMA 3H2BA 4LZOA 1QCYA 1KMMA 3HV2A 1JQAA 2Y2UA 3IULA 8AT1A 1WCYA 3PT5A 4DSNA 5I7EA 1CF9A 1P4GA 3PYXA 3BREA 4R9UC 5BNTA 4QHYA 3AVYA 3AHDA 1CG6A 1K7EB 4IICA 4FMDB 3I73A 3UPDA 2YVUA 3ZV4A 3X1ZA 2W48A 1ADJA 3NHMA 4GYJA 4MUEA 3LDUA 4TXHA 4HPWA 1WB6A 5LQJA 3JQPA 1SULA 1ZUD1 1RBMA 2FNAA 4FWIB 1NFFA 3UXMA 1E8DA 2NUAB 1N5LA 4LSWA 4AO6A 2H07A 4J1SA 1JU4A 2CY0A 4YRZA 1YT5A 5JPDA 4NU6A 3IESA 1E2IA 3ITNA 1DQYA 4KDCA 1AUQA 1NTOA 1SMKA 4HNRA 1BH6A 4HX5A 4NY1A 5FPYA 5INTA 4W6QA 1H23A 1YJCA 2VLIA 4RK1A 1VJ0A 2PKCA 3AKDA 4R6XA 3S6JA 2P4EA 1XTKA 1SOAA 1UBCA 4M87A 1NNLA 3KYIB 3ESCA 4PRKA 2GRJA 3JRNA 3MAJA 2LCIA 4YRLA 4B73A 3PPWA 5AJWA 4YUAA 5A0VA 1ML3A 3IAUA 5C4GB 2ZJ0A 1X6VA 3DE3X 1N7IA 1DUIA 4XYBA 1YS7A 3B78A 3MC1A 3H7IA 3OQ6A 3W0LB 1OH8A 3H5TA 2KSQA 4E4TA 3BSFA 4LHVA 4QNRA 1GRVA 1KR2A 1S2DA 1TFRA 2QGNA 4NARA 3QLTA 3HJRA 2XEDA 4XUGB 3GFPA 2LE0A 2I91A 3RS2A 2HU5A 3KSUA 4X44A 3AB8A 4CMAA 4YQEA 2CHEA 2JAXA 2A9QA 5FA6A 1NXXA 3AEUB 1KEPA 2OV8A 4ASUA 1QH9A 2FZVA 1GL6A 1SCUA 1LTQA 2HK8A 4IRMA 2A0KA 2BEUB 4ZALA 4TLEA 3UB2A 4TYWA 1QMGA 1JAXA 3FVTA 3NLLA 4RS4A 2JLYA 1RABA 1NY6A 4PQRA 1RMTA 1XEAA 4DQDA 1IHUA 2DLDA 1ZA2A 1LK0A 1WVMA 4RYLA 2PGIA 4TWBA 1LNQA 4X1YB 5F9MA 4UNQA 1OLUA 3QY0A 3KHSA 4FDVA 3W5VA 3ABSB 4B6FA 2BCEA 1POWA 3L9WA 2WPNA 4IJVA 2ID7A 4PY2A 3P96A 1TUGA 4WX2B 2ZB2A 1C8BA 2J0EA 2DFVA 2Q6KA 1R3UA 3WOVA 3CTPA 4N82A 4FR0A 4HDNA 3QWAA 4RJKA 5DRYA 3TAXA 5C8ZA 3DBOB 1BQ3A 4LVOA 2WUWE 4E2FA 1ZHOA 2P2CA 1DEHA 1T4CB 2XXJA 3KSAC 5CBPA 3V1LA 3DDCA 4JBGA 3TEFA 1E79A 3AV3A 2C54A 2PFGA 3BEOA 4FFPA 2PS0A 2ZIEA 4QYIB 3A9UA 4EQ6B 4MKFA 3JVEA 3LLUA 5K3CA 4F7DA 5BW8A 2OXCA 4RMNA 5CAEB 4L51A 3VH2A 5JJCA 2WFAA 4JUIA 2AJLI 4D96A 1CDEA 2Q2NA 4M8SA 4MARA 4BB6A 1NNSA 2A84A 3MSXA 5C34B 1D2MA 4CV1A 3GZNA 3K09C 4N7MA 4ZN6A 2I5PO 2EBWA 2RH5A 3AUKA 5IM4A 3T7KA 1SUAA 4ZVNA 3DWFA 3LLCA 1KVQA 4JT9A 4C01A 1AKRA 4L8FA 5IDQA 3A4LA 2VAXA 5B37A 3KUCA 4G4JA 4P5PA 4BX2A 1OLOA 5I9NA 2QJOA 4GMKA 5CP8A 1D04A 3V32A 5U4QA 2JGDA 4FYWA 4B83A 2HF9A 3NVAA 2RCNA 3CNEA 1TO2E 4OHMA 5EZQA 2JC3A 4H7FA 4P3OA 2ZWIA 3IV9A 3W7VA 4C7VA 3C1UA 1XRRA 4ZYXA 4CM5A 3RFXA 5AHRA 5AW7A 3MAAC 2H8GA 1ZDMA 1RMQA 2KBFA 3GFTA 3IMKA 4FKMA 5IFLA 1Q1EA 3M89A 5IXYA 1ZISA 3M6FA 5FUWA 1PS8A 3L6BA 4MVJP 4Q01A 1I13A 4PSCA 4BDTA 3VR6A 5I01A 1SBZA 1QKKA 1E1DA 2X22A 5JE8A 3ZXSA 2E5FA 4D9HA 4DQUA 4HC4A 3I9JA 2CNWA 4NBNA 2OKGA 5F5XA 4IUCS 4AVYA 1ZUWA 3V2HA 1YRQA 1IQRA 2P4QA 2QGZA 4PLTA 4BCCA 1SHUX 2CNDA 2W22A 1B1CA 5TDHA 3RABA 4CF4A 1GL7A 1X2EA 2EEZA 2V7PA 4Y1RA 1GGKA 1G3MA 1XV5A 4PBTA 2QN8A 3CZRA 3VC3A 2A9JA 1NATA 4U6NA 5GIPE 4WECA 5EMJA 1PK7A 4NMLA 3MS7A 2XCQA 2YC2C 3VM6A 2QHXA 2Y05A 1P75A 1WTCA 5AUQA 3VUFA 2V1UA 3JVUA 1XF9A 3DAOA 3L43A 2I0FA 3PENA 3CV3A 4HJRA 4MWTA 1KI2A 1W5EA 5KWSA 1RQXA 2HLDA 3GGPA 4GECA 4MB0A 1PLKA 2YHIA 3PP8A 3WGTA 2C9CA 2WKWA 5KVCA 4CEJB 4IMJB 1RJDA 4UNIA 3V00A 1H9AA 1IXRC 5EP2A 4JS0A 3D6MA 1DFIA 1CHNA 3CEJA 3P1JA 2XYGA 4RXMA 3Q8MA 3GQVA 2ZJAA 4YK7A 4B0PA 3Q3EA 1DNPA 3EPHA 2E4AA 2JFQA 1KMHB 4HZUB 2D62A 3A1NA 2VSOA 4JP1A 1YNOA 2H8KA 4HLUA 4M0EA 1OXVA 1TKRA 1UADA 2NVWA 4N03A 2DFNA 2R1VB 2Z3VA 3KD3A 5L95A 3ND5A 1XALA 2PZJA 1OTXA 1F2DA 3D6FA 3EUEA 4LVUA 5EJ5A 3RARA 4OO3A 1FUEA 1ZGHA 4P7FA 3WHIA 2REOA 4BGUA 3EODA 4DM3A 4B6GA 2QA5A 3A31A 3OO0A 3GMDA 3BXEA 3KQLA 2B8EA 1MAUA 2GFIA 2OP0A 1KERA 1QGZA 4AZWA 4CR8A 5H4GA 1Y8RA 4G8CA 5DTJA 4ZDJA 2HDHA 3HVIA 1KH1A 4MR9B 5DSTA 3VPGA 4CLHA 4LGCA 1L8LA 2K2QB 4XXHA 4QTYA 3EOAI 3M3HA 1NQTA 3F67A 3TXYA 3W90A 4PNHA 3RRJA 821PA 1ILEA 3KV3O 4LTNA 3BL5A 3LUCA 3ZNPA 3ZWVA 5AW0A 5I5EA 2HNKA 5F9HA 3FDZB 1XCPA 4WBNF 1KORA 2ZYGA 1F4LA 4JP8A 1DQNA 1WP4A 2ATCA 2JI8A 4M0CA 2I8AA 1XTQA 3K0FA 2EVWX 4BMYA 5LWQA 1D8TA 3KQSA 4S0ZA 3H5NA 3R9WA 1YB2A 4BNGA 5CFMA 1NIPA 1JIIA 1IJEA 3MWDA 5B7NA 2C95A 1VZ2A 3GUYA 3KFLA 4CFSA 4DLNA 1Y3DE 4LTMA 5JNVA 3BMQA 1C8VB 1HNNA 2P7IA 3OF5A 1V96A 2I4RA 3R4VA 3ZUGA 4FGWA 5C32A 7MDHA 1TUBA 2VBCA 4RXUA 1MKYA 2AYXA 4BLRA 3HZRA 3ANLA 2DHRA 3LNCA 3C3MA 1Y6JA 3AOEA 2PGAA 1M5TA 3GLHA 3IQGX 1Q1GA 3EG9B 5F64A 1NQVA 2TRSB 1AUPA 1B15A 4RPCA 1L2TA 4WXMA 3OMLA 3S8EA 1ML4A 3DTNA 4LX0A 4EKGA 2VWPA 3H11A 3C6KA 2WWGA 2AKAB 4FDTA 2GYUA 4LFAB 4C21A 4TPKA 4DIDA 1NVVQ 2OV3A 1TT5A 2P9JA 3GDFA 3SXUA 3TAUA 5GJBA 1Z74A 1TYBE 5DTRA 1DWQA 3N2GA 2GZMA 4TYQA 5CR9A 4C06A 1L6IA 1SD5A 2XOXA 3AVOA 4HWTA 1EUQA 1AKTA 4RZIA 5KWVA 2MYNA 4M46A 3QX3A 3GVIA 4Y6RA 1RQ7A 3UJ9A 1DRVA 3O4JA 4HQNA 4BTEA 4BEBA 3HS3A 1TTHA 1MAHA 3P20A 3IO3A 3BAZA 3OOWA 1SOVA 1ORIA 2WJIA 3IHTA 3QVSA 1C0KA 1U6IA 1Z7YA 2IVFA 2NU7A 3NR2A 2J5KA 1LQ2A 4ATNA 1A8UA 3HEBA 3N3BC 2C4NA 3RR2A 4HDCA 1V3QE 4ID3A 2BZSA 3M9XA 4IO0A 4QATA 1CZRA 3NDJA 1FX1A 3EGXB 3ORRA 2FOXA 1A72A 1DUSA 2GQ0A 2XMQA 1QZXA 2BUBA 2EV9A 2OHVA 4KVAA 1TT7A 4E5YA 2V45A 3GCDA 4TVSA 1E6CA 5LUAA 3HCDA 3PJEA 3OP1A 2R751 5KX5A 5LDDC 5M34A 2J9ZB 3DHVA 3AFNA 3EOZA 3OPXA 3GJTA 4YDSA 1GDHA 4ARIA 4E2WA 2YZNA 1HFEL 3BRQA 2BHRA 3P2KA 1SBYA 4MUYA 1UDBA 2DP4E 3F6PA 4HQFA 4KH0A 2HLPA 1M2OB 2I6UA 4JI5B 4AK9A 2F67A 2GKGA 5BMOA 4W1QA 1L5HA 3THYA 4D9MA 2HNBA 4QOJA 2QTCA 3BE4A 4AULA 4YUZA 2GZAA 4L85A 2HXYA 3C1TA 3G0HA 4V0ME 1AKWA 1T0JB 1GKUB 1KU6A 1PVDA 1TM5E 1J0DA 1ZA1A 1HORA 4OKSA 5CVVA 1XFAA 1Z5WA 3BMNB 3QMVA 4Q3CA 4UEQA 4EUEA 5EJMA 1VYTA 3T1HB 4AKSA 1LPAB 4O29A 3AG6A 4F96A 2IUUA 4JODA 3ZNNA 3LYHA 1E4EB 5DDIP 3B6ZA 4FYJA 4K9OA 2I2WA 4ND3A 1FFXA 2L2QA 3JS5A 4D4KA 4LE0A 1SA0B 5J4YA 3VPAA 3WS7A 4MHSA 3TW8A 2LPMA 4NZPA 2JW5A 2R6JA 3LUAA 4QOGA 3EVNA 1G5HA 1NVEA 1WCIA 1K08A 3H3XA 3TSCA 4B7UA 3ZXIA 2ZRPA 1FX0B 4Z54A 2R2GA 2PQMA 3PQEA 2ZRJA 1NOJA 1LDGA 4L5CA 5KI6A 1V3UA 5K3AA 1DCKA 2DE0X 4KKVA 4PZ9A 3STYA 1IZ0A 1USWA 3BDAA 1IZ9A 1QIIA 1TMOA 2IEBA 1Z6YA 3IV6A 4C2AA 2HO5A 1U0EA 3NFYA 1JS1X 3I6ZA 1H1DA 4KR6A 1R6UA 4NMMA 4D45A 3H1PA 1BMDA 3S1LA 4DDMA 1Z7BA 3T7EA 4ARCA 1TC1A 2L0XA 3Q3JB 1NSFA 1XEFA 1K8XB 3HCPA 3P8ZA 1NI4A 1KYVA 1YIOA 4EZEA 3CNLA 5LVAA 3QJ5A 1N7GA 3W04A 5BR8B 1V5EA 2H92A 1UPUA 2H17A 3M9WA 4UUPA 4WKGA 4G89A 3EIWA 3C3PA 1B00A 4CWAA 2ZRFA 4G65A 5DYNA 1UOPA 2NTVA 2C2BA 2REQA 2WJWA 2XB6A 3DF7A 1NOKA 3NIDB 1VIDA 3RS7A 4UUBA 3V1UA 4D9GA 1CUAA 4A0FA 4ESOA 1RQLA 2B2NA 1RNLA 4R5HA 3RVSA 1NXQA 2H1CA 3I0MA 2WF8A 2X86A 1U9IC 4LXYA 4OQQA 5B58T 2OHIA 1P0PA 1TZBA 1FU4A 4KB5A 4F8JA 3IP7A 1NDQA 3ZTWA 4OXQA 2IHYA 5J2UA 4F93B 3T1QA 1JLLA 1MQAA 3VV2A 3T4XA 1I6LA 3IEUA 1NLFA 2ZBDA 2AMLA 4LF7B 3TQIA 3VGPA 3EIXA 1PR3A 4C5AA 2BWJA 4B4KA 4EUNA 3Q8KA 4N5LA 1U8AA 2MSWA 1TQ4A 3EZYA 3PTZA 1SQ0A 4YREA 1VCIA 5I5GA 3SKYA 3WIVA 1FOEB 1L4NA 2D54A 3LDFA 1W96A 2XOKA 4V03A 1QO0D 1XQVA 4WKCA 5ECWA 4BVBA 3S68A 4DYDA 2DM6A 5A06A 1DC8A 2ZTMA 2J87A 2E4WA 5EC8A 1UZMA 3SHVA 3UHOA 4JJ7A 1FVFA 1FDVA 4B3SB 3FNQA 3M5WA 3VI4B 4WBNB 1E1CB 1HQDA 3PKZA 3DCIA 3TFQA 4UVDA 4QBTA 1U7PA 1GL3A 3LQ2A 3HDHA 1JTEA 3GLQA 1A8SA 3DL0A 4QSHA 5EUBA 3WTCA 1OX4A 3UH1A 3NUQA 1JZQA 3TVTA 1BJRE 5BUCA 4EUSA 4XWWA 4MQEA 2QS9A 4JVSB 5AT1A 1VE6A 1L3IA 3Q9LA 3M34A 5KMGA 1IOLA 2ZRQA 3CKYA 1JG2A 3ADKA 4G1FA 1VMDA 3V1KA 4GOMD 4ZIRA 2IUEA 1JIXA 2IOFA 3PHIA 4IY1A 2VJYA 1E9VA 3B9QA 1MHPA 3HCAA 4O59O 1PQYA 3R3JA 3R9IA 4ED9A 1WXXA 3Q11A 3GLUA 1GQOA 2OQ2A 4XJTA 3RGGA 5IPFA 5LLTA 1XK6A 3N7AA 3Q85A 1JU9A 2W7TA 2Z5FA 3FYCA 4TRMA 1QHNA 2H3HA 1EXWA 3CMCO 1NIJA 1Q5PA 2PS3A 3FG9A 3KOUA 3O1HB 3JZAA 2GPYA 4U2DA 4KQCA 1KP9A 1ZC4A 2PZAA 4A1OA 3DV2A 5I9LA 2RGXA 3UMSA 2WNHA 2UYGA 1ENPA 3WADA 1CK4A 4B8ZA 2H51A 5ITZB 1Y6FA 3VJMA 2X0NA 3B20A 1EUDB 2Z43A 1W59A 3QPCA 3INYA 4KPUA 1U7TA 4ZQGA 1YCHA 3V7WA 1NBMD 4OTZA 3TZQA 2J7KA 4CM9A 1ZGBA 5LLSA 1N5OX 3AOEC 1HYQA 1ZSNA 2OO3A 3IVAA 1FS6A 2MR6A 1NN1A 3FPLA 3QQPA 1WUJS 4G41A 4ROTA 5JJBA 1BMFD 4YAIA 1I7DA 3AXTA 3QYAA 2AS0A 2WUEA 4Z51A 3QE2A 1IPHA 4YCCA 2QQ5A 1H5QA 4MB6A 3AI3A 1FZTA 1JFLA 2JVIA 1QWSA 3JZDA 2ZQ5A 1ZH2A 2K5UA 4WHMA 4AS1A 1L9XA 2A9VA 4CKEA 2GK6A 4J0IA 1DMRA 1PBTA 3L8GA 4XARA 5FIUA 4L4YA 1EVYA 1F1BA 2H9AA 3OMWA 2VRBA 3D4PA 1D0SA 1RYMA 1UBOS 4HDRA 1XZLA 4J1QA 1J0AA 4ZVTA 3RC1A 3ADDA 1MJGM 1QK5A 2VDQB 4ZAGA 1KEUA 2QI9F 3E2MA 3WE7A 2QUZA 4WN3A 4INAA 5H1YA 2W6ID 3H3JA 3CW2A 4AW9A 1PN3A 3U7JA 3LPAA 2HSGA 3TLEA 4TMXA 1QH8B 2FJPA 2X8AA 2WIJA 2B9EA 1N2ZA 3F7TA 5K0TA 1CUGA 4LZNA 4R2MA 1HI9A 1GDDA 2ZW9A 4B3HA 2Y0CA 3E3LA 1V8FA 2NU9B 3UIEA 2NSDA 2OG2A 4RKFA 3ZY3A 1P0CA 2VBGA 1YRAA 1CQIB 1TECE 2CWWA 5E9AA 1W4CA 4X45A 4HTFA 2ZDGA 3LH5A 4LJ9A 5I47A 3I2KA 4EY3A 3BD6A 4ALLA 1GVHA 2B8NA 4JAVC 1SD2A 2J9RA 2PX2A 3ADPA 4L7VA 3T9CA 3FM9A 5FEUA 1KBZA 1NXSA 1X1AA 3B1VA 3GRCA 1HZJA 1KMCA 1SKUA 5AVOA 3UA3A 1QOZA 1YBMA 1P81A 3NX4A 2VF5X 1TZ2A 4W5JA 4DCPA 1PEYA 1OR8A 3OFND 2X5OA 1IHPA 4DDTA 4ZV4A 1Q15A 4ID9A 3MB8A 4OXIA 4KO3S 1J0XO 1S89A 3VVLA 4C87A 4A7PA 2VJQA 1EAMA 2ZWAA 1KAOA 2B5VA 2ZFUA 3INRA 4LJ4A 2ZT7A 4RLHA 3TKYA 1BFDA 2I1QA 3TI7A 4HLNA 1J1ZA 2QP3A 2DUJA 3CRQA 3DTTA 4HL6A 3N2KA 3QE9Y 3WMFA 4UM9D 4Y30A 1X15A 4C3OB 5HE8A 3R3HA 1YASA 4YN3A 3E4DA 8GPBA 1MVLA 3RIYA 1F9EA 4CMHA 2QG6A 3Q3CA 4ZARA 3A37A 3ICPA 3K1TA 3OCCA 3NAMA 2JGNA 3ETLA 4LDRA 1Q21A 5LP1A 1G18A 2WWIA 3TL6A 3ZE6A 1XELA 2QW0X 4F4FA 3TR0A 1F8YA 4PSKA 4YJFB 5FYDA 2WUGA 2IHNA 5CFZA 2D0OB 3AERB 3NOOA 1ORTA 4Q4DA 1IJBA 1T2UA 4N54A 3MWYW 5CDGA 1UZNA 4CCYA 4XQ9A 2HMUA 5CITA 3LLMA 1Z6GA 1YTLA 2BFOA 4IDNA 5GTDA 4ZZIA 5CA0A 4GD3Q 4RVNA 2BHSA 2HSJA 2JFNA 1P2BA 4LZLA 1E96A 1Z2AA 4BLQA 4DUYB 1Z68A 1E9SA 2B0CA 2X8WA 1SUPA 4WESB 1T1JA 1UH5A 1W19A 4PC1A 3VO2A 4AJJA 5B3LA 5F35A 1EGQA 2I7TA 2OCDA 1E98A 5CGQB 4MW1A 4FUQA 4QYTA 4UQPA 4EO9A 2IEZA 2PV7A 1M0SA 4TLDA 4U1RA 4WUVA 5ELMA 4Q18A 1ZVMA 2R5WA 5E6SA 3SG0A 3IAFA 1VLZA 2YQ5A 1EHYA 3QSYA 3IKJA 3TCXB 1QP7A 2YWXA 3RVNA 1M83A 5FBQB 3RVJA 2N0SA 1KBOA 1I30A 3U13A 2IS6A 3VSAA 2JJ2A 4BUCA 4JYMA 4AS3A 2VYVA 2YASA 2QIOA 3FNRA 3R23A 4ZAFA 3TLXA 4DV7B 3TGWA 2Q3BA 2YWCA 3ESDA 3FTEA 5EGSA 1OAOC 2IYSA 1MTZA 5FRDA 2GGSA 3V8VA 3CUYA 3AONB 3C6ZA 3H42B 3WWOA 3F2VA 2ORED 2JLRA 3CPJB 3R5XA 4MYCA 3RU2A 3ZCQA 5FUMA 3TECE 3D0OA 1F2TA 4NONA 1YE3A 1UMCB 1KAMA 2RHWA 4PPYA 4QDTA 5LMCA 1VKZA 1IMOA 3QA3E 4H7JA 4KKXB 4Z6KA 5HZHA 5JS2A 1SQ5A 2D1QA 3GFVA 3BFVA 2HMVA 3HVKA 2V8OA 4NYIR 1UC9A 4NH0A 4XQEA 2VYFA 2W2LA 5TGDA 2ZU0C 3WJ1A 1VMKA 5DTQA 3WYGA 2JZNA 4REQB 3BDIA 5AWFC 1ZU4A 3ZTTA 2OSBA 4NENA 3CNQS 1X7YB 3O83A 2R4UA 1SXJD 1WW8A 4QU9A 1BA3A 4GX2A 3A6FA 1H5NA 3M3DA 1OB5A 1NLMA 5DM0A 3TLCA 2BMDA 4LXQA 5L40A 1LNSA 3BWYA 3GVHA 1MB9A 1PEDA 5LQMA 1LW6E 1RQNA 4YP7A 1YULA 3BCUA 3GARA 4Q7LA 3UGTA 5LD2B 1ULAA 3LQQA 3PUYA 3QKSA 4W7HA 1BRTA 2ZIAA 3JSXA 4PLYA 3PTLA 4KFSA 2RI1A 3FNIA 3UZUA 3NB0A 1UPFA 4MINA 4RJLA 2F64A 2NVBA 5DGCA 3PEYA 5TVGA 5BUSA 3WJ2A 1RHUA 1JHRA 2QRMA 1Z2OX 4LPSA 5HIMA 3WMRA 4BMCA 1V1RB 2WAOA 4HDSA 3I2IA 4KK4A 4WKPA 4PPQA 4BVJA 1IBMB 1QIKA 4G0UA 1KKLA 1PX2A 4BGDA 5JASA 1YB4A 5GINE 2J5XA 4IXNA 2VXBA 3RTAA 3BICA 3OHPA 3CONA 3NG1A 3T5TA 4DT1A 4PSDA 5FI3A 2CT8A 2Q4RA 3PE3A 3D4IA 4ZOEA 3SSAA 5EYPA 1FRVA 1D2RA 3KXPA 1TIKA 1KO5A 1UM8A 1GZ3A 3KKZA 2P9QA 4ND6A 4MCIA 4IFIA 1C7ZA 4KQJA 4QODA 1EAYA 1Y8QB 2PBZA 1QYWA 3PGVA 4QPNA 5AKEA 4Z0HO 3IR5A 4RQBA 4GL2A 2H48A 3AUYA 4I1SA 3L1UA 2ZI4A 2KYRA 3OF3A 3TUIC 3V8RA 1E4OA 3OBIA 4GDFA 4RHFA 1KQ3A 4ZT4A 5NLLA 2VTKA 1AM4D 2UZIR 4PQYA 5F5LA 1WXHA 4U0JA 3G5TA 5DIFA 4ZC1A 1B8NA 1BW9B 1G66A 1DRWA 3F3SA 3MW8A 1ISPA 1NF9A 1VE7A 3LY8A 1AU9A 1F2UB 1J6UA 1XLVA 5CDUA 4Q3EA 3EVDA 4S2UA 3WHLA 1I3OA 4G8JA 2VA8A 1PGNA 4RO0A 5TMBA 3D4OA 4PS0A 3R9KA 1ZVVA 3KQPA 3PC3A 4Z8XA 1F06A 2P2SA 2D2EA 4LRWA 2I1VB 3TCKA 4CMBA 3GJ5A 4LK2A 3DM5A 3SHTA 4PO9A 3O8OA 2VHCA 1ULZA 3W7AA 3OWHA 4BNLA 5BVHA 2Q49A 3QUTA 2YXBA 1SC3A 2QJWA 2AI3A 4JELA 4ZYLA 4G0ZA 3R9XB 2F00A 2MR5A 3O1IC 5DTMA 1K89A 2W90A 2XTZA 4PZDA 1AQYA 2PUVA 3U0BA 3PXDA 4JLVA 3HNRA 3RSFA 4Z0PA 1AOXA 3EGCA 4JYBA 1I4DD 4M0DA 2J3KA 1ID8A 1KVSA 1Y5RA 3AEQB 5FO1A 4KQ1A 1W49A 1QFZA 2B3TA 3K0KA 3NXKA 5LSAA 4EOGA 1GQYA 3HJFA 2YJZA 1G3IA 3AH8A 1H2XA 2L82A 5HKAA 1ORVA 4M1WA 4KO1S 3HB1A 4Y9TA 4E1AA 1NW8A 5JC8A 2EIHA 2ZIXB 5TEVA 4WT7A 1Z6TA 1RKXA 5KTOA 3DT9A 1ZG3A 1JFFB 2FPIA 1JHZA 4UNSA 4BB5A 1QB7A 2XADA 4LMAA 4Q21A 3E22B 2GZSA 3E8MA 3TSOA 2ZT8A 2ZRCA 2XDWA 1IQUA 4EFMA 1T6BY 1T15A 1U4OA 2R00A 4QIHA 4QOHA 3X1XA 4D9IA 3FE2A 1XZCA 3PGXA 2QVZX 4LCEA 5CH3A 1P1KA 1W87A 2X6TA 4MS4A 5ALIA 3RUEA 3M5PA 3ZHVA 3R7WB 3BHJA 2CJFA 4A8JB 3E1GA 1GEEA 2PUGA 3EY9A 2ZE7A 4NU0A 3AM4A 1E3EA 1GV1A 2GYYA 3V4SA 1Z36A 3HJGA 3WYDA 1V45E 2DCMA 3BERA 4CN8A 4ZOQI 2YY7A 5IAKA 2LV8A 4LXIA 2BIFA 2XXAA 5TQ2B 1L5NA 3B38A 3WK5A 1PQPA 2GDJA 2C7BA 4NZYA 5REQA 2R6GA 1D8AA 1HDZA 4JGIA 4R1QA 5ER6A 2APJA 2BZ0A 1OJLA 1YZFA 1LK7A 2CDAA 3DONA 4JBYA 4J0DA 5H59A 2BM9A 2CW5A 3KO8A 4RD2A 2YWRA 3SOPA 2WU3A 1I36A 2D2FA 3CLSC 2QM3A 3ZJYA 2C2XA 2PRZA 2GD1O 1R0LA 1UBHS 3BE6A 3FYDA 2BFDA 3MCWA 3RYFA 2WSSA 3LQ4A 1U6KA 1QE5A 3BN3A 3D8RA 3HYNA 3OCWA 3DTVD 5IAAA 5JZMA 4D02A 3LM8A 4GM1A 4UC0A 1CZKA 1JDBB 4BFXA 2XMSA 3ANNA 3AY7A 4PWYA 4Q1BA 1WB4A 4BLVA 1SC1A 1NC1A 1V37A 2JI9A 1C4KA 5FNVA 5BNFA 4E15A 4OB8A 4YYEA 5JSZA 2P6UA 1ZJ6A 1PDOA 3KEFA 1T26A 4OK5A 4Y0VA 2Z2JA 3ZBPA 5EPOA 4WLVA 3WO1A 5BN4A 2RGRA 2WJAA 2X4LA 1KSGA 1YS1X 1DRJA 1CTQA 1ZWKA 1WHSA 1C0IA 2ZJ1A 3GLTA 4BV3A 2C0CA 2IU0A 4GGMX 4TMZA 5KBYA 4NOMA 1LA2A 2R87A 4PO8A 2DR2A 1QGUB 1X74A 5DWQA 5DX8A 1Q91A 3QYFA 4E1VA 2HU2A 1JXAA 3LNTA 2XWBF 1JLRA 1P0IA 1JXMA 4MDEA 4ARAA 2RHGB 1B0ZA 4LOLA 2QMYA 5E7IA 1K6JA 3WJ7A 2OHFA 2V74B 1DAPA 1ZESA 3G59A 3U3MA 1RKUA 2JFYA 1ZHHA 3OQBA 3TR5A 2FVXA 4DRXB 2UZ4A 2EFYA 2P78A 2IWHA 4Z0TA 1A7JA 3EW7A 4JA0A 5HZMA 1RBZA 2EOAA 2XX3A 3ELYA 2FP3A 1HG0A 4D82A 1W29A 4B2YA 4M1MA 5ALGA 4AZ3B 4LF5B 1S5PA 1XQ6A 3EVAA 2HQSA 2VDOB 2GEJA 2FG7C 3AKCA 5CB0A 1PQWA 3FJYA 3H87A 1RAAA 5EKXA 4CVNA 3OQIB 4KLAA 1TL7C 1ISGA 3OC6A 4OMFG 1L8OA 4IIHA 2ONKA 1BD4A 3LKDA 5H9VA 4Y6GB 2OEPA 3U3RA 1ATIA 1C80A 2PGNA 1H1TA 3S7TA 3CBGA 1JHOA 3WLTA 4DJAA 1NKSA 5DHSA 2RMKA 4ML3A 4FEYA 4P7BA 4QPCA 5K6RA 1SQFA 3CE6A 3KZCA 1KI6B 3D6NB 1ZM7A 2H00A 4OEHA 2GVNA 5T6BA 1DVRA 4Q4JB 2Z6QA 1P17A 4DCJA 2QX4A 2X0EA 5FOXA 1A9XB 2RFLA 1QUEA 3E18A 3OPYA 5ELXA 1F9AA 4B32A 4R69A 2ZXFA 1SG9A 4J91A 4NI5A 3E8XA 2VSYA 4JKIA 5F1OA 1PL7A 3AU9A 5KJEA 4EHKA 3DNPA 4C6TA 2ZBQA 5EKUA 3GLIB 3QPAA 2DJ5A 5DNCA 4EVRA 3AF4A 4BVFA 4AN1A 2X19A 5B36A 3QKUA 2G1AA 3F5FA 3STTA 4F60A 2O20A 1NG1A 5JSFA 5AVWA 1K68A 4BJ5A 3DNMA 4MGKR 1DCMA 1ZR2A 4MQ5A 1HYGA 5E6UA 3OZSA 4NICA 2WSYB 4RWEA 4TKVB 2B8WA 2NACA 1A76A 1O77A 1Q16A 1JSZA 2OTCA 2X2OA 4J7UA 4DJ5X 4W5QA 1BROA 2VT3A 2EQBA 4DLBA 5TVKA 3BD8A 1AX9A 2X0KA 1BKDR 1H3EA 2MINA 1C1YA 4WK4B 4GSLA 4G0QA 4Q3AA 3R76A 1B2LA 3KUKA 2E6KA 4G1CA 1R9GA 3AVPA 1F0YA 2DWQA 4ZMBA 2I54A 1MIHA 3UK2A 2XVMA 4NC9A 4PNZA 2YMPA 5HIKA 2CC2A 4M0KA 7ADHA 3G23A 2BFFB 2I4LA 5I9TA 3GLIE 4G24A 4KCGA 3DT6A 1RVDA 2CEAA 4W8OA 5I9MA 5JAUA 2QG9A 2OGZA 3TL3A 3CH5A 4AKTA 1U3DA 2CHGA 2RGDA 4OVKA 3VPBA 5MF6A 3NYQA 2D2XA 3OE4A 3FGPA 4NMWA 3ZH9B 2Y1WA 3ONFA 2WG2A 3DDOA 1J25A 4H18A 1RJFA 2ZPTX 3ICOA 4FYMA 5KHAA 2BGKA 2DF8A 2V65A 1IC6A 3DG9A 3Q5EA 5AVVA 3SVTA 4LBYA 4HNGA 1T0UA 4P31A 4E22A 5IABA 3DH0A 3G1WA 3OFVA 1TIBA 2C1ZA 4GYWA 5KHOC 5DJ5A 4KAFA 4FI3F 2DERA 3FA2A 5LMUB 1EEHA 2ODPA 2IYOA 2QU7A 3IAAA 1CY2A 2HGZA 4MKIA 1SURA 1DWOA 3I5YA 4W8HA 3ZU3A 5KZMB 4YP9A 1R12A 2WMOB 4JYAB 1NLUA 3WB2A 2C5SA 2ZSDA 4JFAA 3SHOA 5LMZA 4ZVSA 1F2VA 3BK7A 2MSCB 2NYVA 4ZVQA 3MIIA 4IMPA 3K2EA 2OWEA 2YCBA 4AICA 4BKPA 2E0IA 4R4JA 4DLZA 2JHCA 4FGKA 1PS9A 5FB3A 4UHFA 3PXGA 3F6YA 1CJSA 4KQHA 4QTUB 4EYSA 4KDRA 1P62B 1DC6A 2BMAA 1DPFA 2EFGA 2ZRIA 3PF8A 2R6FA 4HQ0A 4LJSA 5L51A 3O90A 5AQEA 3DFIA 2V7QD 2PS1A 4UM7A 1PFKA 1EG7A 1U7ZA 2Q8NA 3LLSA 1O5TA 3AEUA 4QL3A 2B69A 2J41A 4BWYA 4YLYA 2GXAA 3WK4A 1PTJC 2NYRA 2VJOA 2WYUA 4CTOA 4OBXA 4EYKA 5C8YF 1XN4A 2UZ3A 3INNA 1JG6A 3SU8A 3PWTA 5JXJA 4J9UE 4MP6A 1TEVA 2IPXA 3DFZA 1C8KA 2FEMA 1XTUA 3BB4A 3LHKA 3W9UA 5C37A 4TROA 4H2DA 1Y3AA 3A3YA 3PKJA 3LT0A 4RACA 4X1YA 5A6VA 1LEHA 4RCZA 3CINA 5TPZA 3OZIA 1LC0A 3BIOA 2NO6A </