4YEJA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
molecule keywords Tail spike protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yejA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yejA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yejA02
3EQOA 1IDKA 4MXNA 2O0WA 2QX3A 1WMRA 4U49A 2X6YA 2VBKA 2X6XA 1RWRA 3B4NA 2BSPA 2NSPA 3B90A 1CZFA 4HWVA 4MR0A 2PECA 1KCDA 2QXZA 2QY1A 4AVZA 4EW9A 2VBMA 4XLHA 4W8QA 4OJLA 1HG8A 1OFLA 4NK6A 4XNFA 1X0CA 3GRHA 1DBGA 2X85A 3LMWA 3WWGA 4XKWA 1XG2A 4XR6A 3ZPPA 4XLFA 2VJJA 1O88A 2ODLA 4XLEA 2EWEA 4OJOA 4OJ5A 4Z03A 1KTWA 1O8HA 3FY3A 1PLUA 4OJ6A 4YZAA 1OGMX 4XMYA 4XN3A 2NT9A 2VBEA 4YZXA 1OFMA 1EE6A 2PYGA 5AMVA 1DBOA 4XONA 2O04A 4XN0A 2X3HA 1O8GA 3GQAA 2UVEA 1OOCA 1PXZA 1GQ8A 1KCCA 1BHEA 1O8JA 1O8KA 2NTBA 4XLAA 2X6WA 2INVA 4XOTA 3VSTA 4YZ0A 1H80A 1BN8A 1O8IA 3ZSCA 1VBLA 1K5CA 4XOPA 4URRA 4C2LA 4Z06A 2IQ7A 4PMHA 3KRGA 2VJIA 2Z8GA 4W8TA 1O8FA 3JURA 2PYHA 2O0VA 4OZYA 1JRGA 4NK8A 3GQ8A 4OZZA 4W8RA 3SUCA 1PE9A 4XL9A 5C1CA 2O17A 3VSVA 1IB4A 4XORA 4YZQA 2UVFA 1JTAA 1QCXA 1IA5A 4XM3A 1O8LA 1O8EA 2NZMA 5C1EA 3EQNA 3GQ7A 4XLCA 2NTPA 3B8YA 2NT6A 4U4BA 3VMVA 4OJPA 1IDJA 4W8SA 3VSUA 3VMWA 1OGOX 1O8MA 1NHCA 2O1DA 1AIRA 1RMGA 4Z05A 2INUA 3T9GA 2NSTA 2NTQA 4YEJA 1QJVA 1O8DA 4YELA 4XKVA 4I84A 3GQ9A 4XQFA 1RU4A 3UW0A
chains in the Genus database with same CATH superfamily
2L54A 1E3XA 1G3TA 3EQOA 3WE3A 2DTRA 3MEXA 1LE8B 1K83J 1JJ6C 2E1NA 4XRMA 1YJNB 1RZ4A 2WB1N 4GFBA 3DXJF 4LBYA 1XB4A 2XGEA 5KSWB 4Z2YA 2JT1A 2HXOA 1ZARA 3LSRA 1EFCA 1I39A 2XKOA 3RKQA 1ETVA 1ZGWA 2Z33A 2JJ1A 2E2JJ 1IZ1A 3GVJA 3BOQA 1QRCA 3OW2B 4OJLA 1W7PB 1LFBA 2GIVA 3R61A 4NC7A 2JUCA 3EQLF 2F2EA 3KYDB 4M6VA 1FJLA 1TSPA 3I56B 1H9GA 3BCAA 5L3BA 1AA7A 2KKOA 1TC3C 1IN5A 1ZREA 3QOPA 3OS2A 2XASA 1QQ1A 3CDHA 5C44J 3ZQGA 3HOWJ 2E34A 5F4OA 2FEZA 3E20A 2E71A 1K61A 1MDMB 3A3BA 4CICA 1T6YA 4ZGNB 4P3YA 4PJLA 1KTWA 4ENMA 1HA3A 3BH7B 2K5CA 4BY1J 1M1KD 4JK1X 1I6HJ 4LMYA 5LD2C 2L7FP 3E3VA 3GTPJ 4OIOF 1H0MA 1UHMA 2QN6A 3AVVA 3F22A 4DZJA 3G4SI 4MTDA 1KJZA 1DPUA 3V7CA 4EJUA 3G4SB 3WHBA 3I64A 3LA7A 2H6CA 1XMXA 3GQAA 4RMNA 3QP5A 3FM3A 5H20A 3S93A 5E3LA 2XTYA 4MLOA 4YALA 2ZO4A 1TWCJ 1ZRCA 1SKQA 5J1YA 1K78B 3SQVA 4HEA2 1USSA 3QPHA 3BQYA 3CCLI 1YJ9B 1SVLA 3GLLA 1OB2A 2X0LA 4BEHA 2BVMA 1Y0YA 5F4JA 1TUIA 1DPRA 3KZZA 4P9FA 4Q47A 1JE8A 4R71A 4Y17A 2CRGA 2HDCA 2A69F 3MAJA 4B3GA 1W5CC 3LSHA 2DJIA 4G6TB 3LSKA 4AF6A 3SXYA 1FOXA 5LFAA 2LKXA 2EIKH 2GBYA 3RYPA 1ZM3A 3SQNA 1PUFA 1TYUA 3JR9A 3LSIA 5EMNA 5A89A 1VQ4B 3SUCA 3WBKA 4FX0A 4XORA 2PMUA 2CS3A 2TCTA 3BZKA 4DK1A 3C2BA 4HX8A 4MYUA 5H2FC 1G3SA 1OLTA 4RB0A 1TLHB 3VNUA 2FUG2 3BJ6A 2VFQA 3BLYA 1QGAA 4GCVA 1FDRA 2IS4A 2FNAA 3PVDA 2NT6A 1F9NA 3HOUJ 4BUPA 3JCUC 4Y4RA 3K10A 4I01A 1O3TA 1MABA 2J5OA 2HTJA 2WBMA 3IUOA 3OY9A 2HZDA 1TZLA 3SZTA 3WE2A 1UAAA 1FTTA 1Q1HA 1U5TC 3IHUA 1Q86D 5DD4A 3RPQA 3ULQB 4O3MA 5DN6A 3K4NA 2NTQA 3HB9A 3VOEA 5FIUA 3GFJA 1Y0RA 3QPTA 3LA2A 1N0UA 4DBRA 3HBLA 2DT5A 1A8PA 1VFCA 4OIRF 3CO7C 1YIOA 2IS2A 4QV2A 2FMYA 4M3DA 1KU3A 4BDZA 1HBXG 1IDKA 5DYMA 3VWBA 3GO5A 2UZKA 1GV5A 1T6SA 2IGKA 3QYBA 3IL2A 1WWXA 4YFNF 3PA1A 2PEXA 1JA1A 2MLKA 4PC3A 5D8LB 1SVOA 1APLC 2F5FA 3GZ6A 4DIQA 3MFKA 1H89C 2NOJB 3CD6B 1QHGA 3GXOA 1Z7LA 1O7LA 4KITB 4X7FA 4IXAA 3SDGA 3WNBA 1VQ6B 3K7AJ 3B02A 4XKBA 4DW6A 2BXZA 5L3GA 2DYIA 1V4RA 3U1KA 4OP7A 4OPWA 1SVMA 2M8GX 3OW7A 3J81k 4HW0A 1D8JA 4N4NB 1BR4A 1KYWA 5BSYA 3LSGA 3TO6A 1YJWI 3ECOA 1TQPA 5GAGJ 1S7EA 4XICA 2ZMEA 2VYQA 5FKKA 4HF0A 1OR7C 3J80Z 2JVHA 4CUGA 2VNJA 4JX5A 4BHBA 2VBVA 4JRAC 1FOKA 1VNDA 5J1UA 1R36A 1FTZA 2V9PA 5BOXA 2R7SA 1OGMX 4A3IJ 5L3CA 2RC5A 1ZM2A 4YZXA 1OMIA 5D4SA 3H9NA 4HE5A 1U5TB 4IEJA 2JVGA 4NDLA 3TW7A 3N97A 1NDHA 2VT2A 2PJRA 3WNCA 3DPLC 2L3DA 2OPTA 3CC2B 3V7RA 2YU3A 3M1CA 1D1BA 5E8IA 1HSTA 1UCRA 1N08A 4ROXA 4L9VA 2B0LA 2NS7A 2FMLA 3I1FA 1TWGJ 4YIRX 2CUFA 2X6WA 3WBJA 5TR9A 1WSRA 4YZ0A 4PK4A 1K9MD 1L1IA 4IL6C 2JUGA 1S7AA 2VNHA 4ENNA 2HKOA 3CC7B 1GDTA 3PUMA 3BTJA 4Z4TA 1HKQA 3HGGA 1YI2I 2RC4A 3KRGA 2L01A 3KEQA 3BCDA 3JURA 2XDVA 3HXLA 1WVRA 4LJZF 2WAQN 5IT9K 1N75A 1MMDA 1S7OA 1D1NA 3K4BA 1ZTRA 1HSJA 3GTLJ 1K8FA 1FLIA 1HKSA 1A31A 1GVJA 1FBSA 2Q6KA 1D3YA 5TRDA 1PUEE 1CQXA 1FMVA 5DTDA 3ABTA 1W5SA 3DTIA 4ETSA 1JHHA 3Q5FA 2CJJA 4H9GA 2OBTA 1QBJA 1J7KA 2CQQA 1Y8RB 5KCMA 3CB4A 2PBIA 4P6VF 2CFOA 2H09A 2KZGA 3Q39A 4ASUA 4OJPA 5D5WB 5F08A 2OCCH 2QMUA 3T5XA 3K70C 5K7HA 3RQIA 3LOCA 1JI8A 2LOOA 5C4XJ 3ZQFA 3IH3A 1QJVA 1S5LC 3PFYA 3OYLA 4BXXJ 4LC0A 2OBRA 4XQFA 1LM1A 2L9RA 1WORA 2M4GA 1AWCA 2HZTA 1IXSB 1M1EB 2IP2A 2M7BA 3EUHA 2Z5UA 1ORKA 2G0EA 2X1CA 2L9SA 5A8AA 2ID6A 3KZYA 3PL8A 1PJRA 4KIGA 1UG2A 2GOMA 1TYVA 2WJVA 1REPC 4HRIA 4FK8A 2EH3A 5IT3A 1U8BA 3ONYA 4RLFA 2WYRA 2ZXWH 1NG6A 4MR0A 1EF4A 2QXZA 1JB9A 3B82A 1TLLA 2OZUA 4UZFA 1I27A 4LITA 1UJ8A 4LB5A 2ICWG 2Q6IA 4W97A 2KJCA 1EKEA 3ZQCA 2X3UA 2L5QA 4U7BA 1OHHA 3BC8A 5B1AH 1ZM9A 1HLVA 3FPKA 4X7CA 3JRAA 1LLZA 2O6WA 2LFBA 2Y2ZA 4MEXF 3KP2A 5GTIC 2V7XA 4R1HA 2HS5A 4II2A 4PC7A 1BA5A 4X1EA 1DBGA 1I1GA 2BX6A 1MJ9A 5IYWA 3O3KA 3IC7A 2X53S 3GTGJ 3CMMA 4A3EJ 1QQIA 4XLEA 3HOTA 4HIZA 2IVMA 5FKOA 4Z03A 3CXCB 3SHFA 1T38A 3CP8A 1KTVA 2DOEA 2HDNB 4ZCLA 1EH8A 2BW3B 5F64A 1JKRC 1F5TA 3E5XA 2ZZGA 1SFEA 2VJ4A 2EJRA 2BVLA 3G71B 2ESNA 4A6DA 2CUJA 1JUPA 4UNOA 3GTMJ 3ZQLA 1WOSA 4BJ6C 3BG5A 4E4HA 3MZ8A 2XVCA 3L2VA 2HVSA 2L4MA 1UD6A 1WZ2A 3HOZJ 3ASQA 1YHQB 2VZLA 1JGSA 2XT2A 1ZHFA 4C9YA 1AKHB 2EFNA 2K9NA 2NNNA 2NV4A 2HMAA 1Y6IA 2E1RA 1E64A 4X07A 4C2TA 3HSRA 2AXTC 5KVRA 1SFKA 3M07A 3V8JA 3FHZA 3AVXA 1Z3YA 1XG1A 2LMDA 1IJFA 5M3MJ 3AGQA 2BM4A 1LDKB 2DDBA 4MNUA 1T33A 3OE7A 1U9NA 3QPSA 1SC7A 4GQNA 4MYTA 5FO0A 4W8TA 4I98B 1B59A 1TNTA 4M3FA 5GADJ 2ZXIA 2NS8A 3P9IA 3WU1B 2CF4A 1RETA 3IKTA 1FPQA 4E7LA 3T1BA 1FOYA 2WY7Q 1V5GA 1DP3A 3G6EB 3A2KA 2IRFG 4ZYDA 1UHWA 4QLCU 4L0YB 4BPRA 4PGHA 2JSCA 1VQ8B 2M45A 1JHFA 1USTA 4BQNA 4J19A 2GJPA 1HVXA 4L9NA 4B3XA 2M3AA 5BMZA 4KFCA 3C1DA 1XFOA 3KZIC 5LHGA 2HYFA 5EF6A 5LEKA 4LG3A 4ZDLA 1H9TA 3W6VA 3BR1A 5IYDJ 1SEUA 2L7ZA 2O5RA 3HUGA 1UFMA 2OF7A 1Y1WJ 5E79C 3RIQA 3FMSA 5HDNA 1WJ5A 2LBFA 4HX4A 4RLQA 2QBYB 4BQAA 1IHMA 1MBJA 3BH6B 4UB6C 2ZCWA 1U5TA 3OZUA 4L5IA 3AVTA 2JA8J 1K73D 5HZBA 4DNTB 4X7DA 1YO5C 2D5VA 1TQIA 4QHYA 2YS9A 3WG9A 3ML6A 2ZC2A 4IQJA 3LL7A 3S2DJ 1MJAA 1OYYA 4G7ZF 4MXNA 1OB5A 2X6YA 4ZZLA 4OOVA 3KL9A 1W5TA 3CCEB 2QSGX 1EP2B 4ESBA 3PUFA 2P3MA 2ZNZA 4X05A 1LDDA 3HJEA 1FBUA 4KMUX 3BG7A 3CQZJ 2OBSA 1YRNB 4LG0B 1TNSA 2F4NA 1MH4A 3DP7A 3X2QH 3LVBA 2JA5J 1X19A 4L5EA 2B63J 5JVGF 5E3OA 1T2KA 4G94A 3J7ZI 1CF7B 4RD2A 4B4DA 2OZ6A 4XRFA 2VBTA 4JOMA 4BE1A 4ZJZA 2X85A 3R60A 2CUEA 4IHYA 3SKBA 2IT0A 2L9NA 4WWVA 2PMHA 3PNTA 3CD6I 1P4MA 4YCQA 3E0JB 3BP8A 4BAYA 1VQOB 4LGWA 1O8HA 5E1ZB 3EYYA 5A2QK 1GO2A 3JREA 3GTQJ 1VLOA 2DQLA 3FZVA 1WHUA 2ECCA 4V2FA 3WTZA 2GJKA 4P12A 2V7WA 2DYRH 1EE6A 5DCFA 3VPRA 2JA7J 1UHSA 3RCOA 5AMVA 1H42A 5DNSA 3FXJA 4MFDA 5L3DA 1VI0A 2DMQA 2OAZA 4M6XA 4IHWA 4RCZA 1XC5A 1ZG1A 3G1LA 1BIBA 1SD5A 2ELJA 2K85A 4BQOA 4RM3A 1IDZA 1VQ9I 3O8HA 2KP6A 3HHHA 3S1NJ 2DERA 2FX3A 5EYRA 4M9XA 2LY1A 2EIMH 1NK3P 3A01A 3I4PA 3ZRGA 1TW2A 1E17A 1JA0A 1KQ5A 3VSLA 1POGA 2DA1A 4M3GA 4KJZA 4HYEA 2HEOA 1WGXA 3FXOA 4C2MJ 2QQAA 5FL7A 4HDUA 2E35A 2LLKA 3BWGA 3COAC 1QU3A 2GIZA 1UMKA 4TMXA 1XDSA 1G7TA 1BX0A 3PNYA 4IRGA 2BM6A 2F5DA 2BY1A 4OZYA 2JTVA 4RGSA 2DA5A 2LY9A 2BF4A 1J2XA 4IOCF 4M4SA 5C1CA 2VPRA 4YZQA 5KAIC 5B6IA 2JN6A 1BMFA 3B6CA 3QOEA 4F52A 1VQ9B 3HL2A 1XCVA 3QRFF 4Y52J 3F8NA 2H94A 4N3NA 4U0WA 4XLCA 2ZBKA 3B8YA 3HPHA 5LGUA 5LMZA 2DEUA 1ZRFA 3QFSA 3V4GA 2RVCA 1LEAA 1U9OA 3PSIA 1VQNI 3JTHA 2F5EA 1HDDC 3A03A 3IV5A 4I2OA 5BQTA 3MMYB 1TBXA 1Z67A 1O7FA 1IUYA 3Q6QA 2Q6OA 1V0EA 2WR8A 2EV6A 2LP0A 4E0FA 3C2HA 1C0WA 2PIAA 3ZOBA 4I84A 5BNGA 1MSFC 1YLFA 3L1PA 4PABA 4X0GA 3ZP5A 1OFCX 1WJDA 1T6XA 2IW5A 3ZIAA 1S72I 3LQ6A 3EUHC 3V7AA 1J5YA 3BQZA 2JMWA 2NSPA 3QFTA 2EK5A 4HWVA 3T56B 1DP7P 1S4MA 1LLWA 1TWHJ 4D0PA 4K2EA 4RCYA 2QY1A 4OPVA 1LDJA 3HGYA 2ZJRF 4YAFA 1R5GA 2ETHA 4RM0A 2FBKA 3BJAA 5DS9A 1FYMA 2ZKZA 3HDDA 4A3LJ 1WQ2A 1XMKA 2KL4A 5ICCA 2V4DA 3M4OJ 3PUNA 3TL4X 4U88A 5FA6A 1OFLA 5D6FA 1SM4A 4ZGQB 1B6AA 2HQAA 4AVPA 4EGYA 3A8IA 3LAPA 1FC3A 2AO9A 3OIQA 4ITVA 1ENHA 3V7SA 1YE9A 1COWA 3O8GA 2MBFA 3QODA 5A2QZ 2EWEA 3CDLA 3WHCA 2FA5A 4GDFA 2C4UA 2QTZA 2ZL7A 1ETXA 2VQCA 3E1YE 3TQNA 3CO6C 3ZQHA 4DNCA 3WTVC 2IGOA 4A0ZA 3LMWA 5LGTA 3NEUA 2ZJ2A 5HXBA 2VPLA 4PSXA 4XD7A 1KRHA 4CCJA 1YTYA 2PYGA 1S29A 5IYCJ 3ZZUA 2PMDA 4A6EA 1SANA 2Z1DA 2XZOA 4RAGA 2VBSA 3FXQA 2I1LA 3ZPNA 2I5UA 4B44A 3N90A 1KGSA 4M53A 3E6DA 2EFWA 1O8JA 3EPZA 4XLAA 4OIQF 5DV5A 1HXDA 3RDIA 4N4OB 2INVA 1ZH5A 2P6SA 3VYUB 1H80A 2HDWA 4BBSJ 4G6IA 4RD0A 1BN8A 2YUSA 5EG0B 1QA2A 2IS1A 3BG6A 1PKVA 4PSWA 1RQRA 3ASRA 5F4MA 1R4NB 3ABUA 3RKWA 3RIRA 3WYAA 5HOOA 5CVJA 5J47A 1EZGA 2KMUA 1K8AD 2FRHA 2HQRA 2MC4A 1HOMA 3ES9A 2DA2A 2KISA 2FBHA 4FE4A 4OZZA 3K4KA 4W8RA 3SZGA 3H35A 4LIVA 4EVIA 1Z3XA 1QCXA 3HAGA 2VASA 1X1AA 3VB2A 1NTCA 1T5EA 2Q0OA 4CCLA 3N4MA 2KT0A 1OR7A 1X1DA 3CUOA 2KZVA 2Y9YA 2A5WA 2IAIA 4Q48A 4M9ZA 4Y13A 5JR3A 2QA4I 1W87A 4G7OF 3HSFA 2VE9A 4FTHA 5GTHC 2HFHA 3VMWA 1YW7A 2W82A 2ZJPF 1OGOX 3VODA 3Q0VA 1H8HA 3S3NA 3AG4H 1QVFB 1WJBA 2INUA 2F48A 1T95A 4R79A 3RTRA 3G1OA 2OJED 3V76A 3IWZA 3H5NA 4KKSA 3CCEI 5JHFA 2F4OB 3NARA 3C2GA 3JTGA 2P5VA 3DBRB 3JRHA 3GQ9A 2OQGA 3I9V2 2CV1A 4A3JJ 3CCJB 3CMEI 2IPQX 3W2WA 4HOBA 4MTEA 3FMRA 3W3CA 2M7AA 3CLQA 2C5BA 1G59A 4BHPA 5F1RA 3S2HJ 5FLXK 2B0RA 5M5XJ 1JNYA 2MC3A 3WTSC 4KT6A 4BHCA 1WH7A 3A01B 1QX4A 1OCZH 2GWRA 4RM2A 3IRRA 1WPKA 2BN4A 2XRLA 2EINH 1EH7A 1LVKA 2XGCA 3OYKA 1B8IB 1GJRA 2P6TA 1AHDP 3OOUA 4G8XA 3V42A 4DJAA 4U87A 4UV8A 3JU4A 1W1WE 4S0HB 3ZMUA 1E79A 4IPAA 1YX5A 5F6FA 1J75A 1MSEC 2HYGD 3OOCA 2JQ7A 1HW5A 1FP1D 1XX5A 4WX9A 1QRBA 3VDXA 1R49A 4HE6A 2A5YB 1VF7A 3CMEB 2X1DA 3M9AA 1YX2A 4L0ZB 1ZLJA 2YX7A 2ZMEC 1BR1A 1O88A 4A5MA 2ODLA 1P9QC 3GX4X 2TDXA 2VL8A 3BG9A 5F04A 1IJEA 5E18F 2IOUG 1KQSB 2NNYA 4C2UA 3EDPA 4EM0B 3OJWA 4UV9A 4GYGA 4C43A 3OOPA 1VHOA 1TTTA 2DA6A 3MMPA 4NBSA 1JKPC 4YIIA 4BNCA 4CGZA 3RZOJ 3ASPA 3QPLA 3SZPA 3GTOJ 3CZ6A 1YITI 2HOSA 3FKSA 3LQRA 4Y9UA 1Y0NA 1D1CA 2V7UA 3A8JA 1OPCA 1UD3A 1VQ8I 1Y8QB 4KDPA 2DK8A 1FNBA 1R23A 2BHZA 2NOGA 4G6DA 1WJAA 1D0YA 1X58A 5IP7J 4BE2A 3QFCA 4ZCIA 5HS7A 2LF7A 3RSNA 1Y39A 1X1BA 2YWHA 2KIUA 3RJPA 5FKMA 1QGPA 1X2MA 4FE7A 4B09A 2DFEA 1Q9SA 4Y7CA 1WKMA 2GJRA 4V02C 2Q6LA 5FB2A 4AYBN 2EB7A 2A05A 1OYWA 2F6CA 3FK6A 3FXKA 2QLZA 1QNTA 2XGJA 3A0HC 4UY8I 3CF5F 4IW3B 3GQ8A 2XRNA 2BW3A 4MQVA 4E6KG 1ZGAA 4Q7JB 2A68F 4A3DJ 3AG2H 1B9NA 2W4SA 1QFYA 1P4XA 1O8LA 3WTXC 2J5PA 2ZB9A 4KIFA 1WJFA 2M2EA 4RD6A 3OYDA 3GVAA 4I0AA 3R0JA 4RGUA 1GVDA 2LYCA 1HDPA 5D5VB 3LJYA 2QQ8A 3CCVI 1R5HA 5DCMA 4KKUA 1EA3A 3DFGA 2R92J 1I5ZA 1BPLA 3CCUI 1FX7A 4CSWA 3FXRA 3EYIA 2ZMEB 2OTJI 3A1PA 2O1DA 1S6LA 5DM7F 2DDAA 4XK4A 5IYQA 1KQ9A 4Z05A 1KK1A 1WXRA 3T9GA 4AM3A 1N07A 3Q6RA 4AC9A 2FX0A 2K86A 2YWGA 1EXMA 2K9QA 3HRSA 3OP1A 5DSZA 1VQNB 5ILUA 5FD5A 3CCSI 1DBOA 3SEJA 2FSWA 1RU4A 2C78A 3UW0A 2WWYA 4RDKA 2DAOA 2GAUA 1FBQA 2KLOA 3GBGA 2JA6J 1BM9A 4DQKA 1H8EA 3I54A 3K4CA 3VYRB 1K28D 2YR2A 4HAMA 4MIMA 3B4NA 4WXHA 4FASD 1KCDA 2FNPA 4HSRA 3WNDA 3DKWA 1QUEA 3H92A 5FLVA 4PGOA 2PI0A 4NHJA 4OOSA 4W8QA 3A1YA 2LF8A 1HG8A 2RKHA 3RYRA 4TKOB 4YC5A 4OU0A 1O3QA 2ZZFA 1MMNA 3WTUC 4IRIA 2RQQA 1G2HA 3BQJA 1KZHA 3WWGA 2V1UA 4DNRB 2VKHA 2NS0A 3HHGA 3QP6A 4UXNA 5HLHA 4S04A 3LAJA 1DU0A 3EUKL 4RB2C 2AHOA 2R7WA 3E1SA 3ZCOA 4G7HF 2VBWA 1T8IA 2CO5A 2O0YA 4V19K 5A88A 3E7LA 3QQAA 5IPAA 5J4VA 4P22A 4HA8A 3TOBA 3OSFA 2NT9A 2R9VA 1OFMA 2CV2A 2P81A 1V5EA 2Z3YA 4I76A 3JAMK 1A6IA 2WA0A 2GPJA 2Y75A 1XCBA 1WI9A 3TKYA 3BC9A 1K4ZA 4XONA 1UMQA 1VQKI 1K7AA 3C3WA 2V7TA 4M2LA 4LFUA 1OB0A 2UVEA 2X6OA 3HYIA 2O8KA 3FBNB 2IS6A 3OWTA 4LG0A 1YRNA 1YI2B 1KCCA 3DU1X 1KYZA 4G12A 3OKXA 1O4XA 4II3A 1X1CA 4P26A 1J09A 1VF9A 1GXQA 5JHUA 4A12A 2HOAA 2EV0A 5TJJA 2V9VA 2CMPA 2VQGA 4A0YA 4PC2A 2MH9A 1MNEA 2KDZA 1X3UA 3BTLA 2GREA 2G9WA 1QO0D 1U6GA 2HKXA 1O8FA 4IX7A 4JP0A 3GMEA 2PYHA 3SLNA 1W9XA 5E8GA 5IP9J 5AN9A 1QFZA 4Y33A 2WADA 3VSKA 2WZPP 2Y0SA 1SAUA 4V2GA 5KK1A 5J8CA 2ZNYA 3CP2A 4MEYF 1DDIA 3FDYA 2XC7A 4WXDA 4F91B 3QYFA 3L7WA 1DGRM 2VUMJ 4YAWA 1MMAA 1L0OC 3HOXJ 2K9LA 3CC4B 4HNVA 2NTPA 5TISC 1WCMJ 1KK3A 2YWFA 3HM5A 1DGWY 1QPMA 1XSVA 2HPIA 1X3WB 1OJLA 1SFXA 4M3EA 1SFUA 4FN5A 2XF5A 5CQEA 3KEOA 3H3VK 1YLOA 3TGNA 4YIFA 1NHCA 5K5QA 3PSFA 5L3EA 3IP4B 2HOEA 4JBAA 3ABMH 1MBEA 2JRMA 2XC1A 2QQ9A 2P5LC 5K5OA 4G7XA 3LSJA 3M8EA 2OU2A 2ELKA 4XKVA 3C7JA 3CUQB 4YELA 2H1KA 4LD5A 5IK2A 2E1OA 2LC2A 2M4KA 4TV7A 1VQ5B 1VQLB 4BQQA 3KEWA 1IUFA 1RI7A 3W5UA 4P55A 3FPPA 2A07F 3GFMA 3G1MA 2VFNA 2EIXA 4KIBA 2X6XA 1RWRA 5K1YA 1ZR4A 2BSPA 2WC2A 3AL0B 4RPDA 5JLXA 2EZHA 1RIOH 1W36C 4ZYEA 2ISZA 4AYBA 3CJQB 4H0EA 2OK7A 1OFDA 3JQPA 4XLHA 2R7QA 5F1JA 2VNKA 4NQWB 4WWCA 3L2UA 1ERDA 5IOZA 4X0CA 3LWFA 2EPFA 4PCQA 3Q9VA 4QPQA 4DOZA 3W5VA 2XV4S 2XT4A 3OL3A 1LB2A 3I4NJ 1VQ7B 3CPXA 4AD9A 2R0QC 4W1UA 3ABKH 4XLFA 3CCLB 2VFPA 2VFMA 4IJAA 1MW7A 5EZHA 3H36A 1PLUA 4EW9A 1D8TA 2H27A 1E63A 1KA8A 2VBEA 1ACIA 3DBHB 1V54H 2O61A 3QAHA 3KCCA 2PLYA 5TY0A 2QGGA 2XPWA 1D5YA 2D74A 1ZK8A 3K6GA 4HDVA 1IRZA 5E20A 1U0JA 4QWQA 3VYTB 4RDUA 3CCRI 1YS6A 1QVGB 2RN7A 4XN0A 5KHDA 5ED4A 2STWA 4YAOA 1O8GA 2CQNA 1OCCH 4EJWA 4KA4A 2CNDA 1DQUA 1E62A 2JJ7A 2VKVA 2WY8Q 1TW3A 2VNIA 2QENA 1R71A 5JVTA 3W5HA 4UAJA 1TP4A 4WCGA 3W2IA 2EFQA 4XRSA 2QBYA 5B66C 2RREA 4D7MA 2R5YA 1YJ9I 3K9TA 4BYYA 2MYSA 3CCMI 1KU7A 1RKWA 1HW2A 4HF1A 4QUZA 2XPUA 2W1OA 3CJTB 3JW4A 4MGRA 4F3QA 3H0DA 2IQ7A 2DMUA 1VZ0A 4UUVA 1VQKB 1T98A 1G3WA 4WK8F 3K69A 2XZPA 3OL4A 1ON1A 4EV0A 3D26A 3ONUA 2D1HA 2A6TA 3T0YA 5FROA 3OYGA 1V0FA 1LFUP 2R7FA 3SFIA 4M1KA 1PE9A 2XB5A 2VONA 3HRTA 2KRCA 3CCYA 3F0CA 2NYXA 4FT8A 1RNLA 1S9HA 4A3KJ 2XOKA 1IW7F 1IA5A 4E70A 5D5UB 5FFZA 1FYLA 3OMYA 1QGZA 2YPRA 5H6RA 3MZYA 3R6JA 2LKPA 4TMZA 1ETQA 5EEAA 4U7DA 1BJAA 4BE0A 4N0BA 2GXAA 1JXSA 4U4BA 2CU7A 3Q38A 1JJ8C 3ZMDA 2AXLA 2C6YA 1QGYA 4RA2A 4S05A 3DQVC 2PJRB 1KQ8A 1P2FA 2D1VA 1VQ6I 4KH3A 1Y1VJ 4O6JA 3NWSA 4B48A 4P1VA 2R7OA 2L7MP 1LVAA 4YEJA 2I8DA 3I3LA 4D7NA 3BDDA 4M0LA 3H1CA 3GFLA 4JYKA 2E1BA 1XGSA 1ETYA 4N9HA 1M90D 1Z6TA 4NBQA 2LD5A 2EIJH 2K4BA 4OAZA 2DOGA 2WSSA 1LKXA 2QX3A 2LNBA 4Z4SA 5DUKA 1BW5A 3QE2A 1IGNA 2IJLA 3C18A 3PQKA 4AIDA 4IO9F 5THXA 3RZDJ 2V1NA 3K4MA 4R8HA 4PAAA 2XGDA 1SD6A 3GVKA 2L02A 2F4IA 2IA2A 2R3SA 2KPMA 4RB1A 2XAJA 1I50J 1KU9A 1VQ7I 4HSTA 1HC8A 1KC8D 1NHAA 2HQ5A 4NC6A 3TBIA 1HCRA 1RUOA 2W57A 1NB0A 4QTRA 3B90A 3CRZA 5H59A 1TT0A 2XAQA 2JK3A 1GV2A 5GV7A 1B2RA 1HQCA 2IA0A 3I5UA 3DEEA 1N0VC 3N6ZA 3NQOA 4YAUA 4CZCA 2GLOA 3I0TA 3U6BA 2KRHA 1ZLKA 4NUBA 4LOCA 2HDDA 1BLIA 4ENJA 3E6CC 2FU4A 2P4WA 1JTYA 4EGZA 2XPVA 1Z0XA 3S2WA 3S3OA 3ZZTA 4KUMA 5ILVA 4XR6A 4ZDOA 3U9GA 4QSHA 2GXGA 4P25A 2QSHX 1F36A 2WV1A 4DZPA 1XB2A 2BMWA 3A8KA 1RKTA 5DD8A 3JQQA 4KICA 3J81Z 1RC9A 2IGMA 3WGHA 3J80K 3JRGA 4AF7A 3F21A 3ISXA 2EA4A 5IYNA 2P0WA 1IO2A 3KE2A 4NNJA 2QZAA 3BR0A 2L9VA 2ISYA 3LYCA 1P4WA 1YIJB 1R22A 1AU7A 2QM3A 2NAZA 2VB6A 2BVNA 2JPCA 3CMYA 1GQ8A 1W4MA 1B72B 1BJZA 1WP6A 4EATA 1BHEA 2HYJA 5EDNA 3H9QA 3SJPA 1D1AA 2JSPA 1O57A 1MDMA 2VOOA 3HOVJ 5CVVA 2XIGA 1W0TA 3TO9A 2BM7A 4C2LA 2Z99A 3HKZN 1JJ2B 4XIDA 5DEQA 2OTJB 3F23A 5HLIA 3BT9A 3JRCA 5F27A 1Q1VA 2Z8GA 2UWMA 4ZTJA 4RJLA 4DYCA 5DDGA 3P7NA 1Z1DA 2PQ8A 3BTCA 1VTNC 4Z4WA 1JRGA 1FT9A 2K3PA 3WTTC 5J1RA 3CCQI 2A6EF 3VSVA 2CWEA 3OSGA 2J8IA 3OYBA 2QEXI 2CW0F 3PUBA 2K3FA 1WOPA 2E1MC 4EEFG 3ISPA 4G7WA 4YXWA 2XHKA 5HNHA 2Z2SB 3VO1A 5K7FA 2LRDA 4M9SA 2BPOA 2LY2A 2DFIA 1E0EA 1MNMC 2XAUA 1NG7A 2L2OA 1Z77A 3VMVA 2E5NA 3U2QA 2LBFB 4BEHB 2E1CA 1IDJA 2DK5A 3HRMA 1RRJA 1DUXC 2ACJA 5LRSA 2VLAA 4WZKA 3CDIA 3IAM2 3GTJJ 3V8KA 2E7XA 5KNLA 4Z4ZA 1IN6A 2D3LA 1R1UA 5IYRA 4L5JA 5FLMJ 3BR3A 2DMTA 2OQRA 2QQBA 3GVLA 2COBA 2Y0MA 4M3BA 1ZRDA 1W35A 3F6OA 1VQMB 2MFZA 2ZSIB 2R5ZB 3VR6A 4F7DA 4A3MJ 2V1DA 1VQMI 1SKYB 2XNDA 3OYMA 5D4RA 2DIEA 1GXPA 2DOFA 3DDYA 1AOYA 4WZLA 1ODDA 5FO5A 4LBWA 3DV8A 2DODA 1S3JA 1ZELA 2LK2A 2O3FA 2FOKA 3MHPA 3A35A 1R6RA 3RI4A 4CA0A 1XS9A 2V26A 5ICFA 4CO8A 2XSDC 2IGNA 3MN2A 5GPAA 2EZKA 1VQ5I 4KNYA 1TTYA 3CLOA 5E6TA 1I7PA 2IXSA 1E1RA 4TT3A 2W7ZA 2K9MA 3A4CA 3GIRA 1J9IA 2ZXHA 2WTEA 1X0CA 2V31A 2DETA 2BYVE 2QF7A 1XQBA 2VODA 2DO7A 2L7KA 4JX4A 3LSTA 3KLNA 3OIPA 2E2HJ 2NVYJ 3ZBTA 3TH0A 3P9KA 1XG2A 2FQ3A 4M74A 3U21A 2VJJA 1B72A 1I1SA 3J7YJ 5EGOA 1YIJI 1BW6A 3PJRA 1IV8A 3CCJI 4OJ6A 1OQYA 1IDYA 2K9SA 3DPUA 3DKYA 5LLQA 2DJNA 2CBXA 4IF4A 3N05A 4TN1A 1B1BA 1S0UA 4RGRA 1MJBA 2NXNB 2CQ7A 2W84A 4AIJA 5H6QA 1Z6RA 2HGCA 1OCOH 3QSYA 1GVHA 1AKHA 2O04A 1U2WA 5J35A 1F20A 1FNMA 3VMFA 4WZTA 2VXZA 3WG7H 3OS1A 1KONA 2VE8A 1O8KA 3OEEA 3KETA 1W0JA 2BV3A 2Q2EA 1MBGA 1OISA 1ONVA 4PJMA 1D2EA 2QTLA 4RGXA 1ULYA 1V5FA 4I0BA 2BM1A 2R93J 1J9ZA 1H88C 1YJWB 1KQ0A 3E6MA 4N9IA 3M7GA 2OYNA 2LVSA 3K2ZA 4WQMA 1DARA 2LG4A 1CNFA 2KRFA 3IKVA 2EFPA 5HKKA 4Z4VA 1FRQA 2XF7A 2Y31A 3FXLA 2DI3A 3HC7A 3HKZA 2O0VA 1BC8C 2BGJA 2HOTA 2OTLB 2E5ZA 4CCOA 4XL9A 1PP7U 4LK1F 4KISA 3VO2A 1VLYA 2VC0A 3OS0A 1HW1A 2CW7A 1XGMA 2H6BA 3E5UA 5LRRA 1OCRH 2MW8A 3PIOF 1ZUNB 5C1EA 2M5SA 1I6XA 4Z6YA 4HG2A 3EETA 2GA1A 3RY8A 1TL8A 3AVWA 3BY6A 2Q2EB 2Y30A 1N78A 5DS0A 4UUTA 2GK7A 4CYCA 1ZAOA 1JUSA 1FX0A 2EILH 3WU0A 5FNZA 5EJCA 3LFKA 1N8RD 1BX1A 2HR3A 2LTPA 4XSZF 2ZJQF 2ID3A 4IZZA 1YQAA 2RNJA 2Y0SN 4LLGF 2CQXA 1Y56A 2HQNA 1O8DA 4M72A 4M73A 4FX4A 4B3FX 4ZV4A 4HX7A 3SJZA 3W6JB 3IWFA 1E3ZA 1HF2A 4YEIA 4CCKA 1LJ9A 3KP3A 2HXIA 4EJOA 4F7ZA 4A3CJ 4D9JA 1R00A 4B1RA 1A04A 3RQ4A 4QIWN 1VQOI 1MMSA 1YS7A 1YHQI 3GW2A 3I58A 5EGOB 1TQMA 3DPTA 2NVUB 2V6CA 1DDGA 2L4AA 3D5LA 4J00A 3MD2A 1ETKA 2EBIA 2RV8A 4PJ0C 3ROUA 5E3NA 3AAFA 1NH3A 2CGPA 1VHEA 3WGGA 1CF7A 4LIUA 4PFPA 1G6NA 4XNFA 4G1VA 5L46A 5M5YJ 2CQKA 2M87A 2QZ8A 4P5OA 5E3MA 2R4GA 2MGQA 3L2RA 1LUJB 5FFXA 3P4GA 5M3FJ 2WJYA 4KN4X 3TP0A 4XKWA 5J3OA 2TRTA 3ML3A 4CH7A 1E2XA 1CNEA 2XGXA 2HPMA 1T0FC 3F8FA 2DPUA 4X7EA 3OYHA 3K4JA 3KYLA 2UXXA 4EM1A 3ZGKA 2R7RA 4YDTA 2NVXJ 4YFOA 1GLNA 4U9UA 1QFJA 3L2WA 4XN3A 5FKLA 2ZTGA 1SD7A 3BY1A 2QE7A 4RAZA 5ERIA 1HF0A 4RD4A 4UB8C 1EV7A 2R5YB 1EJ9A 4P6YA 4GXOA 4M71A 2HVRA 3K1NA 3ZZ0A 2ESHA 5F0CA 1EP3B 3OV8A 5E1XA 3OJXA 5HDGA 3MKYB 1A36A 1WDTA 1N06A 2R7UA 4RPBA 5BPIA 3CCRB 1OOCA 2X48A 1Z9CA 2M0CA 5EG0A 2R5ZA 2DU9A 2CV0A 4O5VA 2HI3A 1P7IA 3M1EA 2Y69H 2O8XA 5KW9A 4XSXF 3R6KA 1PYVA 3WXMA 2ZXJA 1S8NA 2WAQA 2QSFX 3KIOA 2QEXB 3RPUD 1XTAA 5HLGA 4PC1A 3BR2A 4BGDA 1EH6A 2VC1A 4PMHA 2KFDA 4OPSA 3ONQA 4HF2A 1JKOC 2CG4A 2LREA 4ZDPA 4Z4UA 3DEUA 3TDZC 2B7CA 2BY2A 2E1MB 2FOWA 2QKLB 2O17A 1VJSA 4PFOA 4X8IA 3KFWX 2UVFA 2G7HA 4XM3A 2GOXB 4AIKA 4ACAA 1G7RA 4G1BA 4P1WA 4OPOA 1U3EM 5EZGA 3NAWA 3BTIA 4D5CA 2E60A 2WAFA 1K6YA 3LA3A 3CC4I 1ETOA 3H0GJ 1IAWA 2CC2A 3LMMA 3TO7A 3S3MA 3Q3AA 1QG0A 1EFTA 1JUMA 3TP3A 1UELB 1H8AC 3L2QA 4QVJA 4Z1MA 3WY9A 2F3LA 2C2WA 2EV5A 2X9DA 3GCMA 4E7HA 4IHVA 3SY2A 2C77A 5IP6A 1JKQC 1V3FA 4UVAA 3JRDA 3G73A 1IB0A 3G3ZA 4L9JA 1W7PA 1R5OA 2J7KA 1STZA 2EFOA 3T53B 1I3AA 4J01A 3DKXA 4B47A 3Q0WA 3ZMVA 2O0WA 1NK2P 1OFEA 3H5AA 4B3AA 2BM0A 2M9HA 1V55H 3CF2A 4ZCMA 5TV2A 2M34A 1Z7UA 2OCEA 4BS9A 1JTXA 2IBDA 1FSEA 3B6AA 4P96A 4A3FJ 2DMNA 3OFNA 4BACA 3O2PE 1HKTA 1YFHA 1E43A 2HTSA 4G5GA 2PECA 4P2NA 3K0LA 4ESJA 3MZHA 1W34A 2FE3A 2D9RA 1UZCA 4C3HJ 4G6QA 1QVUA 3DF8A 2AHQA 2WAEA 1FRNA 1BR2A 2EFGA 3AGPA 5FD6A 2NPFA 2JA2A 2MD5A 1SFOJ 1KD1D 2V4JC 3H5RA 3GRHA 2ELHA 4U0VA 3DTKA 1DG1G 1IRXA 3JAMZ 1R9TJ 1VQPI 1FNCA 5IYBJ 4AWXB 4KKTA 3FMQA 5GAHJ 3S17J 4HQEA 4HPQA 4XBFA 4UHTA 1BJKA 1U8RA 3DLAA 5GV8A 2W6JA 4KYWA 1GR1A 4QFMA 2VJ5A 2XAGA 1QA6A 2VBUA 4UUSA 1NJID 2B7EA 3I59A 3BCFA 2MABA 3FHNA 2OA4A 2K27A 3PM1A 1U78A 1V5VA 2X51A 5ICGA 2H1LA 3KPHA 3JQRA 3BROA 2JRTA 3LFUA 1B23P 1BOBA 2X3HA 4D5FA 5CVRA 2LDUA 2WV0A 2GQQA 4ZYHA 5IY5H 5M5WJ 2GA2A 2FVGA 2L0KA 1ON2A 2V7FA 2P8TA 3FK7A 2CK3A 2MG4A 3VSTA 3BG3A 5D6EA 2PX9A 2AQEA 1O8IA 3ZSCA 4BJ5C 1K5CA 1WU8A 4XKCA 1FNDA 3KP4A 4KN7X 4UVBA 4OIPF 2JWTA 5DM6F 3UR3C 2O7OA 3BNWA 2DA7A 2XUBA 2DLLA 3HOYJ 1J0RA 1GUUA 1XN7A 4RDLA 3LO8A 1N05A 4NK8A 3G05A 1KZLA 2ZL6A 4E7SA 1IB4A 5D8KB 3CESA 2R7TA 2A61A 3F72A 1BI3A 3L9FA 1RR7A 2VXDA 3JRIA 1XSDA 4ON0A 3ASNH 4ZYAA 1W7PD 3ZMTA 4IOAF 3BH4A 1FMWA 2XB0X 3CJRB 2CSOA 3EUAA 4CQJA 3ZBUA 1Z21A 4ZZDA 3DWLE 3PO3J 3CMAB 1XDUA 1T56A 3ERED 3TMOA 1KMHA 3RKYA 3AVYA 1O8MA 2RQPA 3KEYA 2VIXA 1AIRA 2D3NA 3I71A 1BI1A 3W2VA 1J59A 3ZQ7A 2X8KA 3U6KA 1RMGA 4CYCB 3PQJA 4Y7NJ 5B3SH 3OYIA 1MMGA 4LBZA 1LE8A 1T6ZA 2BZTA 2RGVA 4QPOA 2M30A 3GF2A 2PJPA 2JZYA 2VBXA 3AK5A 1YOVB 4TMWA 3PSZA 3AKZA 2PMZN 1UD5A 1D0ZA 2JN9A 1RESA 5J6XA 3BR6A 2DTZA 3FF5A 5E1WA 1QZZA 2GQFA 2ZZQA 4BXUA 4UZEA 1X3ZB 2JPBA 4LLNA 2GK6A 3MKWB 1TWFJ 3HTUA 1R58A 3L2CA 1PUFB 1BOAA 2KIFA 4Y9RA 2P5KA 3O6BB 3JX8A 2QGUA 1X4PA 2CW8A 3KYCB 3LQEA 4I99C 2VBMA 2F5VA 2MA3A 1PP8F 1ZR2A 3ZPLA 3AL0C 3ZMSA 3LNNA 3PETA 1A6QA 2V1XA 4OINF 1BI0A 1MNDA 1R4MB 4CCMA 4ESFA 4I6ZA 1HA8A 4Z4YA 4OMYA 3BY2A 3W2GA 1SMYF 3GZNB 2DT6A 1G8XA 1JT0A 1MIJA 5J8FA 2PN6A 3ESWB 1UB9A 3W2AA 4AC0A 2P7VB 4BBRJ 3OIOA 1W0KA 4PJJA 2LH9A 3MQ0A 2ZL5A 2DA4A 3E97A 2YWEA 4OJ5A 3GSIA 3AG1H 2BY3A 1A5JA 2DQRA 1MBFA 2RAEA 3H94A 1PDNC 2ME6A 3UKGA 2Z9OA 4CHUA 3WU2C 2F1LA 2MSYA 3HIFA 3SJMA 2FJ1A 4QVAA 3H3UA 4LLLA 1S72B 2G7UA 2QYOA 4RAYA 4UVCA 1XD7A 3MVPA 4RS8A 2CUZA 1UD8A 4RDJA 2EWNA 3GEZA 2DCUA 1IRGA 1R1VA 5EEGA 2VFOA 1LQ1A 3E5QA 3GLXA 3K1MA 1YITB 1IN4A 3TEDA 2ZBUA 1BBYA 4K1XA 4C30A 3U1DA 3D1NI 1QRYA 5K7ZA 2H8RA 4FWTA 5JLVC 3OYEA 1BI2A 3P5JA 2CRVA 1FZPB 1WRJA 3FISA 4GO1A 1MH3A 3CC2I 2XAFA 3ZN0A 3KP7A 1XGNA 1YX3A 3AG3H 2CW5A 2VQHA 4ACBA 2JJ2A 1BIAA 3F3XA 2XTWA 2A6HF 3CCUB 1DU6A 4HBLA 3ECHA 4FHTA 1Y0UA 4DQ2A 5CPRB 1EFRA 1OCPA 4ENKA 2VJIA 3LNQA 2CYYA 2DFHA 2BOLA 1K4TA 1LEBA 3J81K 2WB1A 1VQ4I 3PNVA 3U2RA 5GPCA 2VKDA 2E7WA 5HLTA 3J7AY 1ZM4A 2M1BA 3OYNA 3A02A 4BU2A 2BM5A 1F60A 2DFFA 4I02A 2B9SA 1JTAA 2OTLI 3WODF 5HS9A 5JI6A 2NZMA 1XGOA 2YUHA 3FM5A 1QHHD 5KAFC 5L3FA 3EQNA 1P6RA 2LKSA 2ZITA 1D0XA 1T39A 1LNWA 1X4OA 1NRKA 3OEHA 4TSFA 4YG2F 3GFIA 4F92B 1QZEA 3JRBA 4OOIA 3S1QJ 4PDKA 5K5RA 3D0SA 2V7VA 5IYPA 2BBYA 3F6VA 1MBHA 3VYSB 3T51B 1WJCA 1X2NA 3B8HA 2FD5A 4TMVA 2XROA 3FWEA 1A35A 4IQ4A 1X1PA 2DCEA 1U2RA 1SMTA 4D1QA 4OMZA 1FIPA 1IN7A 4BKXA 5HZAA 3DBLB 4FCYA 4RD3A 3F8MA 3MKLA 2DMPA 3E6BA 1Z05A 1O3RA 2UXNA 2F43A 5DCMB 3K1PA 4PGGA 2R7DA 2XNCA 2JDIA 3ELKA 1CZFA 3DU6A 4LK0F 4MO7A 2DYSH 2Y9ZA 3SFZA 1UD2A 3S8PA 1NB9A 3CUQC 3R0AA 4IVNA 3OR1C 4P9UA 2E19A 1E3HA 4AVZA 3PENA 2KIMA 1TYWA 3DU5A 4DBQA 2G0YA 1WSVA 5H5JA 1E3PA 4A3GJ 2VKEA 3S1MJ 2X1EA 4EJTA 3CCVB 3BCBA 3OYFA 1N25A 4DK0A 2K7LA 4CXFA 3HRUA 4WXCA 2ME0A 4L9TA 4CYDA 2JIZA 1MD0A 1P7JA 2XNJA 3H9JA 4HQMA 3QFRA 1RUNA 3S14J 2OBPA 1WSUA 4BJTA 2OV7A 3CW2A 3ZPPA 4ASNA 3ERMA 2QVOA 1QUFA 1PJ6A 2DBBA 1FNNA 5B5EC 5LGNA 5FLXZ 2FXAA 2W48A 1YJNI 2YSRA 3S16J 4Y15A 4EJVA 1WPCA 4AIHA 5EEHA 1E1QA 4MQ9F 3VNVA 1YG2A 1GT0C 2P7CB 1G3YA 4BDYA 2QKMB 4HZFA 2W25A 4UUSB 1Q82D 4NC8A 4WF2A 2QUFA 3ZC3A 3VFZA 4DYQA 3ZMZA 3ZQQA 2K4JA 2F4MB 2Z16A 3P26A 4BXFA 1DDNA 1PXZA 1OYIA 5LHIA 1ETWA 2M0MA 1QVTA 5FRMA 4ZC3A 2ZZEA 2ZSHB 1FP2A 2EZIA 2Q8KA 4ZTFA 3M8JA 5ICEA 1IG7A 4PZJA 3SEQA 4IRHA 3BPXA 5CJ9A 1Z91A 1ZYRF 4ZYGA 1EFUA 2KHMA 5TGTA 4BH9A 1PVEA 3B73A 1W2BB 4Z06A 1FY7A 2W7NA 3L00A 2XAHA 3TDUC 4JQFA 3BZCA 3V8LA 4U0YA 3K70D 3M3YJ 1EWYA 5F0HA 2BSAA 2WZNA 4HNUA 5JLWA 1K79A 2C4TA 5J3LA 1R5BA 1G4DA 2EA2A 2C5HA 3PSSA 3SYJA 3IH2A 1O8EA 1F1ZA 5HODA 1JGGA 2KQRA 1F4KA 2R6HA 4YFXF 2XF6A 2OUMA 2W85A 3FXUA 4GGGA 4PJNA 1I8DA 4OAYA 1T0FA 1IXCA 5CVIA 5DUIA 1WI3A 5HNFA 3T8RA 2YU9J 3TW6A 2Z6BD 2A3SA 3GQBA 4X6AJ 4MHGA 4W8SA 1ITYA 2EZLA 3HOSA 3W6KB 1K6OA 1Q7YD 3ZN1A 4E7IA 2HVQA 2X4HA 2BV6A 4Y3OA 1K4SA 4EMSA 4FXUA 3ASTA 1OCTC 3F8BA 2QYUA 2GXBA 4PUSA 4M6YA 4NB5A 3W2FA 3MWMA 5IT9Z 1OKRA 4E7KA 1P4AA 2AS5F 1ELOA 2CH0A 2VT3A 3Q9SA 1WTHD 3PFIA 4HLXA 2IEKA 5GP9A 4X06A 1TYXA 3SZEA 3ZUGA 4N3GA 4EH1A 5LBQA 3R6SA 4GRIA 2VBKA 4U49A 1IXRC 2D2WA 3BPVA 5FJ8J 2V6EA 3A0BC 2R7ZJ 2MLGA 1AMOA 2QA4B 1QA1A 4IKFA 2R7XA 3NB2A 1ZG5A 4B4CA 3P9CA 1YW8A 2B5OA 3M8FA 1IF1A 5JFRA 1B8IA 3GZ5A 3CUQA 4XLPF 3I59B 1EA0A 2EQRA 3S1RJ 1CQTA 2F1MA 1AIPA 4NK6A 4E7ZA 3ABLH 3WGIA 6PAXA 1F43A 4OM9A 3W2EA 1G7CA 1YYVA 1IJWC 4PC6A 1WOOA 1QA3A 1OGJA 2BHYA 2RNGA 1T08B 2PFBA 1Q81D 1MGTA 3D5RC 3S32A 3A3GA 4OJOA 4LB6B 4H4KC 4KMFA 2K40A 3FY3A 3H9GA 3CCSB 3W2HA 4NCNA 3SDBA 3NAUA 4NQWA 1VQLI 4EM2A 1FYKA 3HEFA 4L18B 2KDOA 2H8WA 1B4AA 4FQGA 3JSPA 2LZJA 4RAFA 2ECBA 2UV1A 5CVUA 2D45A 2R7VA 2ADUA 5J4YA 3G2BA 1SAXA 1E3OC 1FEXA 1K78A 2COMA 4XLNF 1MRZA 1JT6A 4JX6A 3DCFA 2X0KA 3OR2C 2BE5F 4E7JA 3H09A 1HZEA 3S15J 2FQ4A 1XMAA 2ZFUA 4GYIA 4B8XA 2BGCA 3OYJA 2ZTNA 2Q1ZB 3JSOA 4CZZA 1RQPA 4YFKF 3OAAA 3CMAI 1ZN2A 2W00A 2QDXA 1I3QJ 1VBLA 3REOA 4XOPA 4RBOA 5AIQA 1BQEA 5E17F 4URRA 1CLWA 2WPDA 2I10A 4A5NA 3KLOA 2MD0A 5CQGA 4RD1A 2Y48A 3WTYC 2DA3A 5BSXA 3VEPA 4YRVA 2FBIA 2J8KA 4HNTA 2OK8A 5HVQC 4C3IJ 3PIPF 3GYHX 1D5VA 2V5IA 4DYRA 1GHCA 4P9SA 4C3JJ 3K4LA 3CJNA 4HV5A 2XKPA 3ZR8X 5CDFA 1WH5A 2BGIA 1FOWA 2VI6A 3SEZA 2PE3A 5CKTA 2KIQA 3GQ7A 2M8EA 2VQLA 1I18A 2V9KA 2FF4A 2LSOA 3LQQA 2HU9A 3J7AO 1LFPA 1G7SA 3KX2A 3GWZA 3NRVA 2XTXA 2HLDA 4G9YA 5FKNA 5AIPA 4F93B 3OYAA 3I53A 1R1TA 1NBMA 3P27A 4LBVA 4I7HA 2B7BA 1LPQA 4Q5SF 4JMQA 2ZFWA 2NRAC 1L3LA 3BR5A 4P3IA 1XE1A 3KP6A 2OD5A 4J0QA 3CCMB 1W36D 1QPIA 5C4JJ 1IN8A 5CYVA 3I55I 2HCJB 3OPOA 1R5NA 1MKMA 3FKJA 3KP5A 1P92A 5LHHA 2DOAA 2ZBVA 2DXIA 3FJOA 5FO1A 4A3BJ 3LSPA 4ZH4F 3QU6A 1PJ7A 4IHTA 3WQZA 4DQLA 5AONA 1WMRA 3GTKJ 3DLLF 3OZWA 3ZXSA 3SYTA 2AQFA 2CFXA 1BC7C 4BY7J 2QCOA 5D5XB 1BL0A 9ANTA 2XEXA 2VBYA 1N77A 5ILSA 3MKZA 3PO2J 2PMZA 5JBQA 4Z4RA 5JMCB 1D8KA 1QH0A 2KVOA 2OC6A 2V7QA 1B9MA 3K2AA 3QYEA 2DT7B 3HSEA 1GAQA 2PLFA 1EP1B 1ZGJA 4KT5C 5HDKA 2UUZA 2GM4A 1WFXA 3LSMA 3RPUA 4AU7A 1RPWA 3I55B 3MCZA 1CGPA 4AUXA 3FXMA 4RLZA 2KJBA 3WTWC 3FBIB 1IRFA 1ZQ3P 4IHXA 3CPWB 2K02A 5GAEJ 5HS8A 1TVCA 1KU2A 4YZAA 3JRFA 3HTSB 4XMYA 5BPDA 3ASOH 4DGWB 5FRNA 5BS6A 5IOYA 3FX3A 1YW9A 4FETA 3RKXA 2XSJC 1OGIA 3DEWA 1IV6A 3ZQIA 3I4MJ 4OWRB 4RB3C 1TWAJ 3NWTA 2E36A 4A0XA 2HWVA 4A69C 4ABZA 4A93J 2E2IJ 2BEOA 1ZKGA 4C0SA 4I09A 2O03A 1TT5B 1PJ5A 2XZLA 3FIWA 1BN5A 4MFEA 3IRQA 1SD4A 3SLDA 1MBKA 2W24A 3HUGB 2DW4A 5F0FA 4A2UA 5LEJA 3TOAA 1UG0A 3QU3A 2NTBA 2N8GA 3Q0UA 5J40A 4Q4ZF 4XOTA 3QWLA 2DPDA 1KK2A 2STTA 3L09A 4WZEA 5CLSA 1XPXA 1VQPB 3B78A 2YX4A 3HZJA 3PA2A 3UNGC 4B43A 2RC6A 3HPGA 3T8TA 2MH2A 3IAS2 3IH4A 4CCNA 4HV6A 2V79A 1ZG3A 1QZYA 2HNHA 1FWZA 3G71I 3OZVA 3CTAA 2IA1A 2GZWA 3F9KA 2QWWA 1W0UA 4BL0B 1DABA 2DN0A 3DTEA 4OOXA 1XSXA 4IHSA 1H85A 3BZ6A 3OYCA 3CC7I 5C3EJ 3CCQB 1MZBA 2O9LA 4UZUA 2VBZA 3MCAA 3AFHA 1UD4A 3HG9A 2RDPA 1R5ID 3FKIJ 4CDGA 4YHBA 3AVUA 2PG4A 4F55A 5FGMA 1O3SA 2NVQJ 1R7JA 4XRSG 3BJOA 3D5SC 4HLYA 2BXYA 4EQQA 3ASSA 1IC8A 2F5CA 3VSUA 4L8JA 3GUDA 2W6IA 2O6GE 2VN2A 2NVTJ 1FSHA 2DY1A 4FISA 1WJEA 1KK0A 2NSTA 1FIAA 2LR8A 2M5WA 5B1BH 3I56I 1RR8C 2VOPA 2BY0A 4TMTA 3Q3SA 3G6EI 1GAWA 3R4KA 3F8CA 4ANJA 3NE5B 3H3ZA
chains in the Genus database with same CATH topology
1WJDA 1E3XA 2ZZQA 3EQOA 4OAZA 3ZIAA 2WSSA 1LKXA 2QX3A 2GK6A 3MKWB 3EUHC 2V1NA 3K4MA 2NSPA 1X4PA 2CW8A 3GVKA 4HWVA 3T56B 2F4IA 2KPMA 2QY1A 2JJ1A 4EW9A 2VBMA 4HSTA 2F5VA 3TBIA 3AL0C 3GVJA 3LNNA 4OJLA 1TT0A 4NC7A 1MNDA 2KL4A 2V4DA 1OFLA 4CCMA 3TL4X 1HA8A 3DEEA 3BCAA 2HQAA 4CZCA 1AA7A 2KRHA 2DT6A 1G8XA 4NUBA 3OS2A 1BLIA 3LMWA 3W2AA 3OIQA 4ITVA 3S3OA 1COWA 1YE9A 4XR6A 4ZDOA 4PJJA 2LH9A 1W0KA 3QODA 2EWEA 3A3BA 4OJ5A 4PJLA 1KTWA 2VQCA 2K5CA 3H94A 2IGMA 5LD2C 2IGOA 2P0WA 4PSXA 4NNJA 2VPLA 4CCJA 4XD7A 2PYGA 2CUZA 1UD8A 2Z1DA 2XZOA 3GQAA 2VB6A 4RMNA 3ZPNA 4B44A 3S93A 1GQ8A 4MLOA 1WP6A 4EATA 1BHEA 4C30A 1O8JA 3EPZA 4HEA2 3OYEA 3H9QA 4XLAA 1D1AA 2JSPA 2INVA 4N4OB 3VYUB 1H80A 2HDWA 4BEHA 4G6IA 2BVMA 1BN8A 1YX3A 3BG6A 2IS1A 2VQHA 4C2LA 1PKVA 4PSWA 2JJ2A 4B3GA 5CPRB 3LSHA 5HOOA 1EFRA 2VJIA 2DJIA 2Z8GA 2KMUA 4G6TB 2BOLA 3LSKA 4ZTJA 2MC4A 2WB1A 2UWMA 5LFAA 1JRGA 3PNVA 2K3PA 3K4KA 2VKDA 5HLTA 3SZGA 3J7AY 4OZZA 3H35A 3OYNA 3LSIA 4LIVA 4BU2A 4W8RA 3SUCA 3VSVA 4XORA 3OYBA 2CS3A 1Z3XA 4DK1A 1JTAA 1QCXA 3PUBA 3HAGA 2E1MC 2VASA 1X1AA 2NZMA 1T5EA 1OLTA 4G7WA 4YXWA 5HNHA 1QHHD 2Z2SB 4CCLA 3EQNA 2FUG2 1X1DA 2KZVA 2LRDA 3BLYA 2A5WA 2LY2A 2IS4A 1D0XA 1E0EA 2XAUA 1X4OA 1NG7A 2L2OA 1NRKA 3OEHA 4TSFA 2NT6A 3VMVA 2E5NA 2LBFB 4BEHB 4BUPA 4Y4RA 4F92B 1IDJA 3K10A 1MABA 2VLAA 3IAM2 2WBMA 3VMWA 2W82A 3IUOA 1OGOX 3OY9A 2HZDA 5KNLA 1TZLA 1UAAA 1H8HA 2D3LA 3S3NA 3VYSB 3T51B 1WJBA 1WJCA 4R79A 1T95A 3K4NA 3RTRA 3GVLA 5DN6A 2INUA 2NTQA 3H5NA 4KKSA 5JHFA 4IQ4A 2DCEA 3C2GA 2MFZA 4DBRA 2ZSIB 4D1QA 3VR6A 3GQ9A 3I9V2 2CV1A 1SKYB 2XNDA 3OYMA 2IS2A 2DIEA 3W2WA 3W3CA 4BDZA 3DDYA 1IDKA 2M7AA 2F43A 3VWBA 1G59A 2IGKA 3QYBA 1ZELA 2JDIA 4KT6A 1R6RA 3A35A 3DU6A 4CA0A 1CZFA 2V26A 1UD2A 3S8PA 4RM2A 3OR1C 2IGNA 4DIQA 4AVZA 2NOJB 3DU5A 1QHGA 1LVKA 1Z7LA 2IXSA 4DBQA 3OYKA 3OOUA 4DJAA 3V42A 4KITB 4U87A 1E1RA 3JU4A 2K9MA 2X1EA 3A4CA 4XKBA 1E79A 4TT3A 2ZXHA 3BCBA 1YX5A 3OYFA 3OW7A 1X0CA 4DK0A 2V31A 4N4NB 1BR4A 2L7KA 3LSGA 2JIZA 3OOCA 3OIPA 3VDXA 3H9JA 1VF7A 2X1DA 1OR7C 1XG2A 2JVHA 4CUGA 4BJTA 2OV7A 3U21A 3ZPPA 1BR1A 2VJJA 1O88A 2ODLA 1P9QC 2VL8A 3PJRA 4OJ6A 4C2UA 2R7SA 1WPCA 1OGMX 1E1QA 3DPUA 3DKYA 4YZXA 3N05A 4BDYA 2QKMB 2JVGA 2PJRA 4NC8A 3DPLC 3CZ6A 2O04A 3FKSA 3M1CA 1D1BA 3ZQQA 2Z16A 1D1CA 2VXZA 4BXFA 1PXZA 3OS1A 1UD3A 1KONA 2M0MA 2ZZEA 5FRMA 4ZC3A 1O8KA 3OEEA 2ZSHB 1WJAA 1W0JA 1D0YA 4BE2A 2X6WA 3M8JA 4PJMA 4ZTFA 3RSNA 3SEQA 1X1BA 4PK4A 1V5FA 4YZ0A 2JUGA 2KHMA 5TGTA 2GJRA 4Z06A 2W7NA 2LG4A 2F6CA 3KRGA 4JQFA 3BCDA 3JURA 2XGJA 3K70D 5HKKA 2XDVA 3HXLA 2XF7A 3HC7A 3HKZA 4HNUA 2O0VA 3GQ8A 1N75A 1MMDA 2BW3A 4E6KG 3K4BA 2E5ZA 4CCOA 4XL9A 4KISA 1VLYA 3OS0A 2CW7A 2W4SA 1O8EA 1O8LA 5C1EA 1FMVA 2KQRA 2M5SA 1WJFA 3DTIA 2XF6A 3OYDA 2OUMA 4HG2A 4PJNA 1I8DA 4OAYA 2LYCA 5KCMA 2Q2EB 1N78A 5HNFA 2GK7A 2CFOA 4ASUA 4OJPA 2Z6BD 3GQBA 4KKUA 1EA3A 1FX0A 4W8SA 3HOSA 3K70C 1BPLA 4E7IA 2HVQA 4CSWA 2O1DA 4Y3OA 4FXUA 1JI8A 4Z05A 3T9GA 2LOOA 4PUSA 4IZZA 1QJVA 1Y56A 3PFYA 1O8DA 3OYLA 4E7KA 4B3FX 4XQFA 1RU4A 2CH0A 1E3ZA 2M4GA 2M7BA 1WTHD 3UW0A 4CCKA 2X1CA 2KLOA 2L9SA 3GBGA 3PL8A 1PJRA 2GOMA 4D9JA 1H8EA 4U49A 4GRIA 3K4CA 3VYRB 4HRIA 3RQ4A 1K28D 2V6EA 2WJVA 2VBKA 3B4NA 4RLFA 4IKFA 1NG6A 2R7XA 4MR0A 4FASD 1KCDA 3DPTA 4HSRA 2QXZA 4LITA 3D5LA 4J00A 3MD2A 4W8QA 3A1YA 1HG8A 2L5QA 4U7BA 4LIUA 3BC8A 1OHHA 4PFPA 4TKOB 2F1MA 4NK6A 4XNFA 2ZZFA 4P5OA 1MMNA 4E7ZA 2R4GA 1DBGA 4II2A 2RQQA 3L2RA 2WJYA 3WWGA 2RNGA 4XKWA 2X53S 4CH7A 4DNRB 2VKHA 3D5RC 3S32A 3CMMA 2HPMA 1T0FC 4XLEA 3EUKL 3HOTA 3A3GA 4HIZA 3OYHA 3E1SA 3K4JA 3ZCOA 4H4KC 3KYLA 2R7WA 4OJOA 4Z03A 3CP8A 3ZGKA 2R7RA 3FY3A 3H9GA 2BW3B 1GLNA 3SDBA 3L2WA 4XN3A 2ZTGA 4P22A 2NT9A 2QE7A 2R9VA 2ZZGA 1OFMA 2CV2A 1V5EA 2VJ4A 2KDOA 2BVLA 2LZJA 2CUJA 2UV1A 2HVRA 2R7VA 4BJ6C 2WA0A 4E4HA 3L2VA 2HVSA 1UD6A 3G2BA 1DBOA 3BC9A 4XONA 4C9YA 3MKYB 1OB0A 2R7UA 2UVEA 1OOCA 3OR2C 3FBNB 2IS6A 1Y6IA 3OWTA 4E7JA 1KCCA 1HZEA 2ZFUA 2CV0A 4II3A 1X1CA 4C2TA 1J09A 3OYJA 1SFKA 2ZTNA 2Q1ZB 1Z3YA 3OAAA 1PYVA 2W00A 1VBLA 2CMPA 2VQGA 4XOPA 4URRA 1LDKB 2WAQA 2WPDA 1MNEA 3RPUD 2MD0A 5CQGA 4BGDA 3OE7A 4PMHA 4YRVA 4GQNA 4W8TA 3ONQA 4IX7A 1O8FA 4HNTA 2LREA 2PYHA 1W9XA 5HVQC 4ZDPA 2ZXIA 2E1MB 2WADA 4Y33A 3VSKA 4E7LA 2WZPP 2QKLB 2WY7Q 1V5GA 2Y0SA 3K4LA 3A2KA 1SAUA 1DP3A 1VJSA 4PFOA 2UVFA 4XM3A 3CP2A 2GOXB 3ZR8X 3FDYA 2XC7A 5CDFA 4F91B 3QYFA 4BQNA 2GJPA 3SEZA 1HVXA 1DGRM 5CKTA 4P1WA 4B3XA 3GQ7A 2M3AA 1MMAA 2VQLA 1I18A 2V9KA 2K9LA 2HU9A 2NTPA 1LFPA 3KX2A 2E60A 1DGWY 2WAFA 1K6YA 2HPIA 2HLDA 4F93B 3OYAA 3LMMA 4LG3A 3S3MA 2XF5A 4ZDLA 1NBMA 5CQEA 1NHCA 2O5RA 3PSFA 3IP4B 1UELB 4JMQA 3L2QA 4Z1MA 1WJ5A 2LBFA 4RLQA 4E7HA 1W36D 4G7XA 4YELA 4XKVA 5IK2A 3OPOA 2LC2A 4DNTB 2M4KA 3FKJA 2DOAA 2DXIA 3T53B 4BQQA 4J01A 3KEWA 4IQJA 3DKXA 3LL7A 4B47A 3FPPA 3WQZA 2O0WA 1WMRA 4MXNA 3H5AA 2X6YA 3CF2A 3ZXSA 3SYTA 2X6XA 1RWRA 4BS9A 2BSPA 2AQFA 3OFNA 3AL0B 3B90A 4BACA 1E43A 2PECA 1W36C 4AYBA 3CJQB 1N77A 3MKZA 2PMZA 3BG7A 4XLHA 2KVOA 2V7QA 2OC6A 2R7QA 4NQWB 1X19A 2WAEA 1BR2A 3L2UA 3QYEA 1ERDA 2DT7B 2JA2A 2V4JC 3H5RA 3GRHA 4JOMA 4BE1A 3DTKA 4QPQA 1IRXA 4ZJZA 2UUZA 1WFXA 2X85A 3LSMA 4AU7A 4DOZA 3OL3A 4KKTA 2L9NA 3PNTA 4HPQA 3E0JB 4XLFA 3DLAA 3FBIB 2W6JA 2VJ5A 1MW7A 1O8HA 1PLUA 4YZAA 3BCFA 2O17A 4XMYA 4DGWB 5FRNA 2GJKA 2MABA 2VBEA 4FETA 3FHNA 1EE6A 2XSJC 3RCOA 5AMVA 2X51A 4OWRB 3NWTA 3K6GA 1U0JA 3VYTB 3LFUA 1BOBA 4XN0A 5KHDA 2X3HA 1O8GA 2ELJA 4BQOA 4RM3A 2XZLA 2KP6A 1DQUA 2WY8Q 3HUGB 2NTBA 2LY1A 1UG0A 2V7FA 3ZRGA 2CK3A 4XOTA 3VSLA 3VSTA 2AQEA 2RREA 1O8IA 4KJZA 3ZSCA 4BJ5C 1K5CA 2MYSA 4XKCA 3UNGC 2W1OA 3UR3C 5FL7A 4B43A 4F3QA 3HPGA 3H0DA 1QU3A 2IQ7A 1VZ0A 3IAS2 4CCNA 2XZPA 3OL4A 2HNHA 3PNYA 2A6TA 3F9KA 5FROA 4OZYA 3OYGA 1V0FA 4NK8A 4BL0B 3G05A 1KZLA 1PE9A 3DTEA 4E7SA 5C1CA 1IB4A 2KRCA 3CESA 2R7TA 4YZQA 3OYCA 2XOKA 1S9HA 2VXDA 1BMFA 1IA5A 4UZUA 4ZYAA 3QOEA 4F52A 3AFHA 3BH4A 3HL2A 3OMYA 1UD4A 1FMWA 3HG9A 3CJRB 4BE0A 4XLCA 4F55A 3EUAA 3B8YA 3HPHA 1Z21A 4U4BA 3DWLE 3D5SC 3TMOA 3PSIA 3VSUA 3DQVC 1KMHA 2W6IA 4L8JA 2PJRB 1O8MA 3KEYA 2VIXA 1AIRA 2D3NA 3W2VA 1RMGA 3MMYB 2X8KA 1WJEA 3NWSA 3OYIA 2NSTA 1MMGA 4B48A 1V0EA 2R7OA 4E0FA 4QPOA 3C2HA 4YEJA 2I8DA 3I3LA 4I84A 3AKZA 1UD5A 1D0ZA 2E1BA 4X0GA 4ANJA 3NE5B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EQO A;  1IDK A;  4MXN A;  2O0W A;  2QX3 A;  1WMR A;  4U49 A;  2X6Y A;  2VBK A;  2X6X A;  1RWR A;  3B4N A;  2BSP A;  2NSP A;  3B90 A;  1CZF A;  4HWV A;  4MR0 A;  2PEC A;  1KCD A;  2QXZ A;  2QY1 A;  4AVZ A;  4EW9 A;  2VBM A;  4XLH A;  4W8Q A;  4OJL A;  1HG8 A;  1OFL A;  4NK6 A;  4XNF A;  1X0C A;  3GRH A;  1DBG A;  2X85 A;  3LMW A;  3WWG A;  4XKW A;  1XG2 A;  4XR6 A;  3ZPP A;  4XLF A;  2VJJ A;  1O88 A;  2ODL A;  4XLE A;  2EWE A;  4OJO A;  4OJ5 A;  4Z03 A;  1KTW A;  1O8H A;  3FY3 A;  1PLU A;  4OJ6 A;  4YZA A;  1OGM X;  4XMY A;  4XN3 A;  2NT9 A;  2VBE A;  4YZX A;  1OFM A;  1EE6 A;  2PYG A;  5AMV A;  1DBO A;  4XON A;  2O04 A;  4XN0 A;  2X3H A;  1O8G A;  3GQA A;  2UVE A;  1OOC A;  1PXZ A;  1GQ8 A;  1KCC A;  1BHE A;  1O8J A;  1O8K A;  2NTB A;  4XLA A;  2X6W A;  2INV A;  4XOT A;  3VST A;  4YZ0 A;  1H80 A;  1BN8 A;  1O8I A;  3ZSC A;  1VBL A;  1K5C A;  4XOP A;  4URR A;  4C2L A;  4Z06 A;  2IQ7 A;  4PMH A;  3KRG A;  2VJI A;  2Z8G A;  4W8T A;  1O8F A;  3JUR A;  2PYH A;  2O0V A;  4OZY A;  1JRG A;  4NK8 A;  3GQ8 A;  4OZZ A;  4W8R A;  3SUC A;  1PE9 A;  4XL9 A;  5C1C A;  2O17 A;  3VSV A;  1IB4 A;  4XOR A;  4YZQ A;  2UVF A;  1JTA A;  1QCX A;  1IA5 A;  4XM3 A;  1O8L A;  1O8E A;  2NZM A;  5C1E A;  3EQN A;  3GQ7 A;  4XLC A;  2NTP A;  3B8Y A;  2NT6 A;  4U4B A;  3VMV A;  4OJP A;  1IDJ A;  4W8S A;  3VSU A;  3VMW A;  1OGO X;  1O8M A;  1NHC A;  2O1D A;  1AIR A;  1RMG A;  4Z05 A;  2INU A;  3T9G A;  2NST A;  2NTQ A;  4YEJ A;  1QJV A;  1O8D A;  4YEL A;  4XKV A;  4I84 A;  3GQ9 A;  4XQF A;  1RU4 A;  3UW0 A; 
#chains in the Genus database with same CATH topology
 2L54 A;  1E3X A;  1G3T A;  3EQO A;  3WE3 A;  2DTR A;  3MEX A;  1LE8 B;  1K83 J;  1JJ6 C;  2E1N A;  4XRM A;  1YJN B;  1RZ4 A;  2WB1 N;  4GFB A;  3DXJ F;  4LBY A;  1XB4 A;  2XGE A;  5KSW B;  4Z2Y A;  2JT1 A;  2HXO A;  1ZAR A;  3LSR A;  1EFC A;  1I39 A;  2XKO A;  3RKQ A;  1ETV A;  1ZGW A;  2Z33 A;  2JJ1 A;  2E2J J;  1IZ1 A;  3GVJ A;  3BOQ A;  1QRC A;  3OW2 B;  4OJL A;  1W7P B;  1LFB A;  2GIV A;  3R61 A;  4NC7 A;  2JUC A;  3EQL F;  2F2E A;  3KYD B;  4M6V A;  1FJL A;  1TSP A;  3I56 B;  1H9G A;  3BCA A;  5L3B A;  1AA7 A;  2KKO A;  1TC3 C;  1IN5 A;  1ZRE A;  3QOP A;  3OS2 A;  2XAS A;  1QQ1 A;  3CDH A;  5C44 J;  3ZQG A;  3HOW J;  2E34 A;  5F4O A;  2FEZ A;  3E20 A;  2E71 A;  1K61 A;  1MDM B;  3A3B A;  4CIC A;  1T6Y A;  4ZGN B;  4P3Y A;  4PJL A;  1KTW A;  4ENM A;  1HA3 A;  3BH7 B;  2K5C A;  4BY1 J;  1M1K D;  4JK1 X;  1I6H J;  4LMY A;  5LD2 C;  2L7F P;  3E3V A;  3GTP J;  4OIO F;  1H0M A;  1UHM A;  2QN6 A;  3AVV A;  3F22 A;  4DZJ A;  3G4S I;  4MTD A;  1KJZ A;  1DPU A;  3V7C A;  4EJU A;  3G4S B;  3WHB A;  3I64 A;  3LA7 A;  2H6C A;  1XMX A;  3GQA A;  4RMN A;  3QP5 A;  3FM3 A;  5H20 A;  3S93 A;  5E3L A;  2XTY A;  4MLO A;  4YAL A;  2ZO4 A;  1TWC J;  1ZRC A;  1SKQ A;  5J1Y A;  1K78 B;  3SQV A;  4HEA 2;  1USS A;  3QPH A;  3BQY A;  3CCL I;  1YJ9 B;  1SVL A;  3GLL A;  1OB2 A;  2X0L A;  4BEH A;  2BVM A;  1Y0Y A;  5F4J A;  1TUI A;  1DPR A;  3KZZ A;  4P9F A;  4Q47 A;  1JE8 A;  4R71 A;  4Y17 A;  2CRG A;  2HDC A;  2A69 F;  3MAJ A;  4B3G A;  1W5C C;  3LSH A;  2DJI A;  4G6T B;  3LSK A;  4AF6 A;  3SXY A;  1FOX A;  5LFA A;  2LKX A;  2EIK H;  2GBY A;  3RYP A;  1ZM3 A;  3SQN A;  1PUF A;  1TYU A;  3JR9 A;  3LSI A;  5EMN A;  5A89 A;  1VQ4 B;  3SUC A;  3WBK A;  4FX0 A;  4XOR A;  2PMU A;  2CS3 A;  2TCT A;  3BZK A;  4DK1 A;  3C2B A;  4HX8 A;  4MYU A;  5H2F C;  1G3S A;  1OLT A;  4RB0 A;  1TLH B;  3VNU A;  2FUG 2;  3BJ6 A;  2VFQ A;  3BLY A;  1QGA A;  4GCV A;  1FDR A;  2IS4 A;  2FNA A;  3PVD A;  2NT6 A;  1F9N A;  3HOU J;  4BUP A;  3JCU C;  4Y4R A;  3K10 A;  4I01 A;  1O3T A;  1MAB A;  2J5O A;  2HTJ A;  2WBM A;  3IUO A;  3OY9 A;  2HZD A;  1TZL A;  3SZT A;  3WE2 A;  1UAA A;  1FTT A;  1Q1H A;  1U5T C;  3IHU A;  1Q86 D;  5DD4 A;  3RPQ A;  3ULQ B;  4O3M A;  5DN6 A;  3K4N A;  2NTQ A;  3HB9 A;  3VOE A;  5FIU A;  3GFJ A;  1Y0R A;  3QPT A;  3LA2 A;  1N0U A;  4DBR A;  3HBL A;  2DT5 A;  1A8P A;  1VFC A;  4OIR F;  3CO7 C;  1YIO A;  2IS2 A;  4QV2 A;  2FMY A;  4M3D A;  1KU3 A;  4BDZ A;  1HBX G;  1IDK A;  5DYM A;  3VWB A;  3GO5 A;  2UZK A;  1GV5 A;  1T6S A;  2IGK A;  3QYB A;  3IL2 A;  1WWX A;  4YFN F;  3PA1 A;  2PEX A;  1JA1 A;  2MLK A;  4PC3 A;  5D8L B;  1SVO A;  1APL C;  2F5F A;  3GZ6 A;  4DIQ A;  3MFK A;  1H89 C;  2NOJ B;  3CD6 B;  1QHG A;  3GXO A;  1Z7L A;  1O7L A;  4KIT B;  4X7F A;  4IXA A;  3SDG A;  3WNB A;  1VQ6 B;  3K7A J;  3B02 A;  4XKB A;  4DW6 A;  2BXZ A;  5L3G A;  2DYI A;  1V4R A;  3U1K A;  4OP7 A;  4OPW A;  1SVM A;  2M8G X;  3OW7 A;  3J81 k;  4HW0 A;  1D8J A;  4N4N B;  1BR4 A;  1KYW A;  5BSY A;  3LSG A;  3TO6 A;  1YJW I;  3ECO A;  1TQP A;  5GAG J;  1S7E A;  4XIC A;  2ZME A;  2VYQ A;  5FKK A;  4HF0 A;  1OR7 C;  3J80 Z;  2JVH A;  4CUG A;  2VNJ A;  4JX5 A;  4BHB A;  2VBV A;  4JRA C;  1FOK A;  1VND A;  5J1U A;  1R36 A;  1FTZ A;  2V9P A;  5BOX A;  2R7S A;  1OGM X;  4A3I J;  5L3C A;  2RC5 A;  1ZM2 A;  4YZX A;  1OMI A;  5D4S A;  3H9N A;  4HE5 A;  1U5T B;  4IEJ A;  2JVG A;  4NDL A;  3TW7 A;  3N97 A;  1NDH A;  2VT2 A;  2PJR A;  3WNC A;  3DPL C;  2L3D A;  2OPT A;  3CC2 B;  3V7R A;  2YU3 A;  3M1C A;  1D1B A;  5E8I A;  1HST A;  1UCR A;  1N08 A;  4ROX A;  4L9V A;  2B0L A;  2NS7 A;  2FML A;  3I1F A;  1TWG J;  4YIR X;  2CUF A;  2X6W A;  3WBJ A;  5TR9 A;  1WSR A;  4YZ0 A;  4PK4 A;  1K9M D;  1L1I A;  4IL6 C;  2JUG A;  1S7A A;  2VNH A;  4ENN A;  2HKO A;  3CC7 B;  1GDT A;  3PUM A;  3BTJ A;  4Z4T A;  1HKQ A;  3HGG A;  1YI2 I;  2RC4 A;  3KRG A;  2L01 A;  3KEQ A;  3BCD A;  3JUR A;  2XDV A;  3HXL A;  1WVR A;  4LJZ F;  2WAQ N;  5IT9 K;  1N75 A;  1MMD A;  1S7O A;  1D1N A;  3K4B A;  1ZTR A;  1HSJ A;  3GTL J;  1K8F A;  1FLI A;  1HKS A;  1A31 A;  1GVJ A;  1FBS A;  2Q6K A;  1D3Y A;  5TRD A;  1PUE E;  1CQX A;  1FMV A;  5DTD A;  3ABT A;  1W5S A;  3DTI A;  4ETS A;  1JHH A;  3Q5F A;  2CJJ A;  4H9G A;  2OBT A;  1QBJ A;  1J7K A;  2CQQ A;  1Y8R B;  5KCM A;  3CB4 A;  2PBI A;  4P6V F;  2CFO A;  2H09 A;  2KZG A;  3Q39 A;  4ASU A;  4OJP A;  5D5W B;  5F08 A;  2OCC H;  2QMU A;  3T5X A;  3K70 C;  5K7H A;  3RQI A;  3LOC A;  1JI8 A;  2LOO A;  5C4X J;  3ZQF A;  3IH3 A;  1QJV A;  1S5L C;  3PFY A;  3OYL A;  4BXX J;  4LC0 A;  2OBR A;  4XQF A;  1LM1 A;  2L9R A;  1WOR A;  2M4G A;  1AWC A;  2HZT A;  1IXS B;  1M1E B;  2IP2 A;  2M7B A;  3EUH A;  2Z5U A;  1ORK A;  2G0E A;  2X1C A;  2L9S A;  5A8A A;  2ID6 A;  3KZY A;  3PL8 A;  1PJR A;  4KIG A;  1UG2 A;  2GOM A;  1TYV A;  2WJV A;  1REP C;  4HRI A;  4FK8 A;  2EH3 A;  5IT3 A;  1U8B A;  3ONY A;  4RLF A;  2WYR A;  2ZXW H;  1NG6 A;  4MR0 A;  1EF4 A;  2QXZ A;  1JB9 A;  3B82 A;  1TLL A;  2OZU A;  4UZF A;  1I27 A;  4LIT A;  1UJ8 A;  4LB5 A;  2ICW G;  2Q6I A;  4W97 A;  2KJC A;  1EKE A;  3ZQC A;  2X3U A;  2L5Q A;  4U7B A;  1OHH A;  3BC8 A;  5B1A H;  1ZM9 A;  1HLV A;  3FPK A;  4X7C A;  3JRA A;  1LLZ A;  2O6W A;  2LFB A;  2Y2Z A;  4MEX F;  3KP2 A;  5GTI C;  2V7X A;  4R1H A;  2HS5 A;  4II2 A;  4PC7 A;  1BA5 A;  4X1E A;  1DBG A;  1I1G A;  2BX6 A;  1MJ9 A;  5IYW A;  3O3K A;  3IC7 A;  2X53 S;  3GTG J;  3CMM A;  4A3E J;  1QQI A;  4XLE A;  3HOT A;  4HIZ A;  2IVM A;  5FKO A;  4Z03 A;  3CXC B;  3SHF A;  1T38 A;  3CP8 A;  1KTV A;  2DOE A;  2HDN B;  4ZCL A;  1EH8 A;  2BW3 B;  5F64 A;  1JKR C;  1F5T A;  3E5X A;  2ZZG A;  1SFE A;  2VJ4 A;  2EJR A;  2BVL A;  3G71 B;  2ESN A;  4A6D A;  2CUJ A;  1JUP A;  4UNO A;  3GTM J;  3ZQL A;  1WOS A;  4BJ6 C;  3BG5 A;  4E4H A;  3MZ8 A;  2XVC A;  3L2V A;  2HVS A;  2L4M A;  1UD6 A;  1WZ2 A;  3HOZ J;  3ASQ A;  1YHQ B;  2VZL A;  1JGS A;  2XT2 A;  1ZHF A;  4C9Y A;  1AKH B;  2EFN A;  2K9N A;  2NNN A;  2NV4 A;  2HMA A;  1Y6I A;  2E1R A;  1E64 A;  4X07 A;  4C2T A;  3HSR A;  2AXT C;  5KVR A;  1SFK A;  3M07 A;  3V8J A;  3FHZ A;  3AVX A;  1Z3Y A;  1XG1 A;  2LMD A;  1IJF A;  5M3M J;  3AGQ A;  2BM4 A;  1LDK B;  2DDB A;  4MNU A;  1T33 A;  3OE7 A;  1U9N A;  3QPS A;  1SC7 A;  4GQN A;  4MYT A;  5FO0 A;  4W8T A;  4I98 B;  1B59 A;  1TNT A;  4M3F A;  5GAD J;  2ZXI A;  2NS8 A;  3P9I A;  3WU1 B;  2CF4 A;  1RET A;  3IKT A;  1FPQ A;  4E7L A;  3T1B A;  1FOY A;  2WY7 Q;  1V5G A;  1DP3 A;  3G6E B;  3A2K A;  2IRF G;  4ZYD A;  1UHW A;  4QLC U;  4L0Y B;  4BPR A;  4PGH A;  2JSC A;  1VQ8 B;  2M45 A;  1JHF A;  1UST A;  4BQN A;  4J19 A;  2GJP A;  1HVX A;  4L9N A;  4B3X A;  2M3A A;  5BMZ A;  4KFC A;  3C1D A;  1XFO A;  3KZI C;  5LHG A;  2HYF A;  5EF6 A;  5LEK A;  4LG3 A;  4ZDL A;  1H9T A;  3W6V A;  3BR1 A;  5IYD J;  1SEU A;  2L7Z A;  2O5R A;  3HUG A;  1UFM A;  2OF7 A;  1Y1W J;  5E79 C;  3RIQ A;  3FMS A;  5HDN A;  1WJ5 A;  2LBF A;  4HX4 A;  4RLQ A;  2QBY B;  4BQA A;  1IHM A;  1MBJ A;  3BH6 B;  4UB6 C;  2ZCW A;  1U5T A;  3OZU A;  4L5I A;  3AVT A;  2JA8 J;  1K73 D;  5HZB A;  4DNT B;  4X7D A;  1YO5 C;  2D5V A;  1TQI A;  4QHY A;  2YS9 A;  3WG9 A;  3ML6 A;  2ZC2 A;  4IQJ A;  3LL7 A;  3S2D J;  1MJA A;  1OYY A;  4G7Z F;  4MXN A;  1OB5 A;  2X6Y A;  4ZZL A;  4OOV A;  3KL9 A;  1W5T A;  3CCE B;  2QSG X;  1EP2 B;  4ESB A;  3PUF A;  2P3M A;  2ZNZ A;  4X05 A;  1LDD A;  3HJE A;  1FBU A;  4KMU X;  3BG7 A;  3CQZ J;  2OBS A;  1YRN B;  4LG0 B;  1TNS A;  2F4N A;  1MH4 A;  3DP7 A;  3X2Q H;  3LVB A;  2JA5 J;  1X19 A;  4L5E A;  2B63 J;  5JVG F;  5E3O A;  1T2K A;  4G94 A;  3J7Z I;  1CF7 B;  4RD2 A;  4B4D A;  2OZ6 A;  4XRF A;  2VBT A;  4JOM A;  4BE1 A;  4ZJZ A;  2X85 A;  3R60 A;  2CUE A;  4IHY A;  3SKB A;  2IT0 A;  2L9N A;  4WWV A;  2PMH A;  3PNT A;  3CD6 I;  1P4M A;  4YCQ A;  3E0J B;  3BP8 A;  4BAY A;  1VQO B;  4LGW A;  1O8H A;  5E1Z B;  3EYY A;  5A2Q K;  1GO2 A;  3JRE A;  3GTQ J;  1VLO A;  2DQL A;  3FZV A;  1WHU A;  2ECC A;  4V2F A;  3WTZ A;  2GJK A;  4P12 A;  2V7W A;  2DYR H;  1EE6 A;  5DCF A;  3VPR A;  2JA7 J;  1UHS A;  3RCO A;  5AMV A;  1H42 A;  5DNS A;  3FXJ A;  4MFD A;  5L3D A;  1VI0 A;  2DMQ A;  2OAZ A;  4M6X A;  4IHW A;  4RCZ A;  1XC5 A;  1ZG1 A;  3G1L A;  1BIB A;  1SD5 A;  2ELJ A;  2K85 A;  4BQO A;  4RM3 A;  1IDZ A;  1VQ9 I;  3O8H A;  2KP6 A;  3HHH A;  3S1N J;  2DER A;  2FX3 A;  5EYR A;  4M9X A;  2LY1 A;  2EIM H;  1NK3 P;  3A01 A;  3I4P A;  3ZRG A;  1TW2 A;  1E17 A;  1JA0 A;  1KQ5 A;  3VSL A;  1POG A;  2DA1 A;  4M3G A;  4KJZ A;  4HYE A;  2HEO A;  1WGX A;  3FXO A;  4C2M J;  2QQA A;  5FL7 A;  4HDU A;  2E35 A;  2LLK A;  3BWG A;  3COA C;  1QU3 A;  2GIZ A;  1UMK A;  4TMX A;  1XDS A;  1G7T A;  1BX0 A;  3PNY A;  4IRG A;  2BM6 A;  2F5D A;  2BY1 A;  4OZY A;  2JTV A;  4RGS A;  2DA5 A;  2LY9 A;  2BF4 A;  1J2X A;  4IOC F;  4M4S A;  5C1C A;  2VPR A;  4YZQ A;  5KAI C;  5B6I A;  2JN6 A;  1BMF A;  3B6C A;  3QOE A;  4F52 A;  1VQ9 B;  3HL2 A;  1XCV A;  3QRF F;  4Y52 J;  3F8N A;  2H94 A;  4N3N A;  4U0W A;  4XLC A;  2ZBK A;  3B8Y A;  3HPH A;  5LGU A;  5LMZ A;  2DEU A;  1ZRF A;  3QFS A;  3V4G A;  2RVC A;  1LEA A;  1U9O A;  3PSI A;  1VQN I;  3JTH A;  2F5E A;  1HDD C;  3A03 A;  3IV5 A;  4I2O A;  5BQT A;  3MMY B;  1TBX A;  1Z67 A;  1O7F A;  1IUY A;  3Q6Q A;  2Q6O A;  1V0E A;  2WR8 A;  2EV6 A;  2LP0 A;  4E0F A;  3C2H A;  1C0W A;  2PIA A;  3ZOB A;  4I84 A;  5BNG A;  1MSF C;  1YLF A;  3L1P A;  4PAB A;  4X0G A;  3ZP5 A;  1OFC X;  1WJD A;  1T6X A;  2IW5 A;  3ZIA A;  1S72 I;  3LQ6 A;  3EUH C;  3V7A A;  1J5Y A;  3BQZ A;  2JMW A;  2NSP A;  3QFT A;  2EK5 A;  4HWV A;  3T56 B;  1DP7 P;  1S4M A;  1LLW A;  1TWH J;  4D0P A;  4K2E A;  4RCY A;  2QY1 A;  4OPV A;  1LDJ A;  3HGY A;  2ZJR F;  4YAF A;  1R5G A;  2ETH A;  4RM0 A;  2FBK A;  3BJA A;  5DS9 A;  1FYM A;  2ZKZ A;  3HDD A;  4A3L J;  1WQ2 A;  1XMK A;  2KL4 A;  5ICC A;  2V4D A;  3M4O J;  3PUN A;  3TL4 X;  4U88 A;  5FA6 A;  1OFL A;  5D6F A;  1SM4 A;  4ZGQ B;  1B6A A;  2HQA A;  4AVP A;  4EGY A;  3A8I A;  3LAP A;  1FC3 A;  2AO9 A;  3OIQ A;  4ITV A;  1ENH A;  3V7S A;  1YE9 A;  1COW A;  3O8G A;  2MBF A;  3QOD A;  5A2Q Z;  2EWE A;  3CDL A;  3WHC A;  2FA5 A;  4GDF A;  2C4U A;  2QTZ A;  2ZL7 A;  1ETX A;  2VQC A;  3E1Y E;  3TQN A;  3CO6 C;  3ZQH A;  4DNC A;  3WTV C;  2IGO A;  4A0Z A;  3LMW A;  5LGT A;  3NEU A;  2ZJ2 A;  5HXB A;  2VPL A;  4PSX A;  4XD7 A;  1KRH A;  4CCJ A;  1YTY A;  2PYG A;  1S29 A;  5IYC J;  3ZZU A;  2PMD A;  4A6E A;  1SAN A;  2Z1D A;  2XZO A;  4RAG A;  2VBS A;  3FXQ A;  2I1L A;  3ZPN A;  2I5U A;  4B44 A;  3N90 A;  1KGS A;  4M53 A;  3E6D A;  2EFW A;  1O8J A;  3EPZ A;  4XLA A;  4OIQ F;  5DV5 A;  1HXD A;  3RDI A;  4N4O B;  2INV A;  1ZH5 A;  2P6S A;  3VYU B;  1H80 A;  2HDW A;  4BBS J;  4G6I A;  4RD0 A;  1BN8 A;  2YUS A;  5EG0 B;  1QA2 A;  2IS1 A;  3BG6 A;  1PKV A;  4PSW A;  1RQR A;  3ASR A;  5F4M A;  1R4N B;  3ABU A;  3RKW A;  3RIR A;  3WYA A;  5HOO A;  5CVJ A;  5J47 A;  1EZG A;  2KMU A;  1K8A D;  2FRH A;  2HQR A;  2MC4 A;  1HOM A;  3ES9 A;  2DA2 A;  2KIS A;  2FBH A;  4FE4 A;  4OZZ A;  3K4K A;  4W8R A;  3SZG A;  3H35 A;  4LIV A;  4EVI A;  1Z3X A;  1QCX A;  3HAG A;  2VAS A;  1X1A A;  3VB2 A;  1NTC A;  1T5E A;  2Q0O A;  4CCL A;  3N4M A;  2KT0 A;  1OR7 A;  1X1D A;  3CUO A;  2KZV A;  2Y9Y A;  2A5W A;  2IAI A;  4Q48 A;  4M9Z A;  4Y13 A;  5JR3 A;  2QA4 I;  1W87 A;  4G7O F;  3HSF A;  2VE9 A;  4FTH A;  5GTH C;  2HFH A;  3VMW A;  1YW7 A;  2W82 A;  2ZJP F;  1OGO X;  3VOD A;  3Q0V A;  1H8H A;  3S3N A;  3AG4 H;  1QVF B;  1WJB A;  2INU A;  2F48 A;  1T95 A;  4R79 A;  3RTR A;  3G1O A;  2OJE D;  3V76 A;  3IWZ A;  3H5N A;  4KKS A;  3CCE I;  5JHF A;  2F4O B;  3NAR A;  3C2G A;  3JTG A;  2P5V A;  3DBR B;  3JRH A;  3GQ9 A;  2OQG A;  3I9V 2;  2CV1 A;  4A3J J;  3CCJ B;  3CME I;  2IPQ X;  3W2W A;  4HOB A;  4MTE A;  3FMR A;  3W3C A;  2M7A A;  3CLQ A;  2C5B A;  1G59 A;  4BHP A;  5F1R A;  3S2H J;  5FLX K;  2B0R A;  5M5X J;  1JNY A;  2MC3 A;  3WTS C;  4KT6 A;  4BHC A;  1WH7 A;  3A01 B;  1QX4 A;  1OCZ H;  2GWR A;  4RM2 A;  3IRR A;  1WPK A;  2BN4 A;  2XRL A;  2EIN H;  1EH7 A;  1LVK A;  2XGC A;  3OYK A;  1B8I B;  1GJR A;  2P6T A;  1AHD P;  3OOU A;  4G8X A;  3V42 A;  4DJA A;  4U87 A;  4UV8 A;  3JU4 A;  1W1W E;  4S0H B;  3ZMU A;  1E79 A;  4IPA A;  1YX5 A;  5F6F A;  1J75 A;  1MSE C;  2HYG D;  3OOC A;  2JQ7 A;  1HW5 A;  1FP1 D;  1XX5 A;  4WX9 A;  1QRB A;  3VDX A;  1R49 A;  4HE6 A;  2A5Y B;  1VF7 A;  3CME B;  2X1D A;  3M9A A;  1YX2 A;  4L0Z B;  1ZLJ A;  2YX7 A;  2ZME C;  1BR1 A;  1O88 A;  4A5M A;  2ODL A;  1P9Q C;  3GX4 X;  2TDX A;  2VL8 A;  3BG9 A;  5F04 A;  1IJE A;  5E18 F;  2IOU G;  1KQS B;  2NNY A;  4C2U A;  3EDP A;  4EM0 B;  3OJW A;  4UV9 A;  4GYG A;  4C43 A;  3OOP A;  1VHO A;  1TTT A;  2DA6 A;  3MMP A;  4NBS A;  1JKP C;  4YII A;  4BNC A;  4CGZ A;  3RZO J;  3ASP A;  3QPL A;  3SZP A;  3GTO J;  3CZ6 A;  1YIT I;  2HOS A;  3FKS A;  3LQR A;  4Y9U A;  1Y0N A;  1D1C A;  2V7U A;  3A8J A;  1OPC A;  1UD3 A;  1VQ8 I;  1Y8Q B;  4KDP A;  2DK8 A;  1FNB A;  1R23 A;  2BHZ A;  2NOG A;  4G6D A;  1WJA A;  1D0Y A;  1X58 A;  5IP7 J;  4BE2 A;  3QFC A;  4ZCI A;  5HS7 A;  2LF7 A;  3RSN A;  1Y39 A;  1X1B A;  2YWH A;  2KIU A;  3RJP A;  5FKM A;  1QGP A;  1X2M A;  4FE7 A;  4B09 A;  2DFE A;  1Q9S A;  4Y7C A;  1WKM A;  2GJR A;  4V02 C;  2Q6L A;  5FB2 A;  4AYB N;  2EB7 A;  2A05 A;  1OYW A;  2F6C A;  3FK6 A;  3FXK A;  2QLZ A;  1QNT A;  2XGJ A;  3A0H C;  4UY8 I;  3CF5 F;  4IW3 B;  3GQ8 A;  2XRN A;  2BW3 A;  4MQV A;  4E6K G;  1ZGA A;  4Q7J B;  2A68 F;  4A3D J;  3AG2 H;  1B9N A;  2W4S A;  1QFY A;  1P4X A;  1O8L A;  3WTX C;  2J5P A;  2ZB9 A;  4KIF A;  1WJF A;  2M2E A;  4RD6 A;  3OYD A;  3GVA A;  4I0A A;  3R0J A;  4RGU A;  1GVD A;  2LYC A;  1HDP A;  5D5V B;  3LJY A;  2QQ8 A;  3CCV I;  1R5H A;  5DCM A;  4KKU A;  1EA3 A;  3DFG A;  2R92 J;  1I5Z A;  1BPL A;  3CCU I;  1FX7 A;  4CSW A;  3FXR A;  3EYI A;  2ZME B;  2OTJ I;  3A1P A;  2O1D A;  1S6L A;  5DM7 F;  2DDA A;  4XK4 A;  5IYQ A;  1KQ9 A;  4Z05 A;  1KK1 A;  1WXR A;  3T9G A;  4AM3 A;  1N07 A;  3Q6R A;  4AC9 A;  2FX0 A;  2K86 A;  2YWG A;  1EXM A;  2K9Q A;  3HRS A;  3OP1 A;  5DSZ A;  1VQN B;  5ILU A;  5FD5 A;  3CCS I;  1DBO A;  3SEJ A;  2FSW A;  1RU4 A;  2C78 A;  3UW0 A;  2WWY A;  4RDK A;  2DAO A;  2GAU A;  1FBQ A;  2KLO A;  3GBG A;  2JA6 J;  1BM9 A;  4DQK A;  1H8E A;  3I54 A;  3K4C A;  3VYR B;  1K28 D;  2YR2 A;  4HAM A;  4MIM A;  3B4N A;  4WXH A;  4FAS D;  1KCD A;  2FNP A;  4HSR A;  3WND A;  3DKW A;  1QUE A;  3H92 A;  5FLV A;  4PGO A;  2PI0 A;  4NHJ A;  4OOS A;  4W8Q A;  3A1Y A;  2LF8 A;  1HG8 A;  2RKH A;  3RYR A;  4TKO B;  4YC5 A;  4OU0 A;  1O3Q A;  2ZZF A;  1MMN A;  3WTU C;  4IRI A;  2RQQ A;  1G2H A;  3BQJ A;  1KZH A;  3WWG A;  2V1U A;  4DNR B;  2VKH A;  2NS0 A;  3HHG A;  3QP6 A;  4UXN A;  5HLH A;  4S04 A;  3LAJ A;  1DU0 A;  3EUK L;  4RB2 C;  2AHO A;  2R7W A;  3E1S A;  3ZCO A;  4G7H F;  2VBW A;  1T8I A;  2CO5 A;  2O0Y A;  4V19 K;  5A88 A;  3E7L A;  3QQA A;  5IPA A;  5J4V A;  4P22 A;  4HA8 A;  3TOB A;  3OSF A;  2NT9 A;  2R9V A;  1OFM A;  2CV2 A;  2P81 A;  1V5E A;  2Z3Y A;  4I76 A;  3JAM K;  1A6I A;  2WA0 A;  2GPJ A;  2Y75 A;  1XCB A;  1WI9 A;  3TKY A;  3BC9 A;  1K4Z A;  4XON A;  1UMQ A;  1VQK I;  1K7A A;  3C3W A;  2V7T A;  4M2L A;  4LFU A;  1OB0 A;  2UVE A;  2X6O A;  3HYI A;  2O8K A;  3FBN B;  2IS6 A;  3OWT A;  4LG0 A;  1YRN A;  1YI2 B;  1KCC A;  3DU1 X;  1KYZ A;  4G12 A;  3OKX A;  1O4X A;  4II3 A;  1X1C A;  4P26 A;  1J09 A;  1VF9 A;  1GXQ A;  5JHU A;  4A12 A;  2HOA A;  2EV0 A;  5TJJ A;  2V9V A;  2CMP A;  2VQG A;  4A0Y A;  4PC2 A;  2MH9 A;  1MNE A;  2KDZ A;  1X3U A;  3BTL A;  2GRE A;  2G9W A;  1QO0 D;  1U6G A;  2HKX A;  1O8F A;  4IX7 A;  4JP0 A;  3GME A;  2PYH A;  3SLN A;  1W9X A;  5E8G A;  5IP9 J;  5AN9 A;  1QFZ A;  4Y33 A;  2WAD A;  3VSK A;  2WZP P;  2Y0S A;  1SAU A;  4V2G A;  5KK1 A;  5J8C A;  2ZNY A;  3CP2 A;  4MEY F;  1DDI A;  3FDY A;  2XC7 A;  4WXD A;  4F91 B;  3QYF A;  3L7W A;  1DGR M;  2VUM J;  4YAW A;  1MMA A;  1L0O C;  3HOX J;  2K9L A;  3CC4 B;  4HNV A;  2NTP A;  5TIS C;  1WCM J;  1KK3 A;  2YWF A;  3HM5 A;  1DGW Y;  1QPM A;  1XSV A;  2HPI A;  1X3W B;  1OJL A;  1SFX A;  4M3E A;  1SFU A;  4FN5 A;  2XF5 A;  5CQE A;  3KEO A;  3H3V K;  1YLO A;  3TGN A;  4YIF A;  1NHC A;  5K5Q A;  3PSF A;  5L3E A;  3IP4 B;  2HOE A;  4JBA A;  3ABM H;  1MBE A;  2JRM A;  2XC1 A;  2QQ9 A;  2P5L C;  5K5O A;  4G7X A;  3LSJ A;  3M8E A;  2OU2 A;  2ELK A;  4XKV A;  3C7J A;  3CUQ B;  4YEL A;  2H1K A;  4LD5 A;  5IK2 A;  2E1O A;  2LC2 A;  2M4K A;  4TV7 A;  1VQ5 B;  1VQL B;  4BQQ A;  3KEW A;  1IUF A;  1RI7 A;  3W5U A;  4P55 A;  3FPP A;  2A07 F;  3GFM A;  3G1M A;  2VFN A;  2EIX A;  4KIB A;  2X6X A;  1RWR A;  5K1Y A;  1ZR4 A;  2BSP A;  2WC2 A;  3AL0 B;  4RPD A;  5JLX A;  2EZH A;  1RIO H;  1W36 C;  4ZYE A;  2ISZ A;  4AYB A;  3CJQ B;  4H0E A;  2OK7 A;  1OFD A;  3JQP A;  4XLH A;  2R7Q A;  5F1J A;  2VNK A;  4NQW B;  4WWC A;  3L2U A;  1ERD A;  5IOZ A;  4X0C A;  3LWF A;  2EPF A;  4PCQ A;  3Q9V A;  4QPQ A;  4DOZ A;  3W5V A;  2XV4 S;  2XT4 A;  3OL3 A;  1LB2 A;  3I4N J;  1VQ7 B;  3CPX A;  4AD9 A;  2R0Q C;  4W1U A;  3ABK H;  4XLF A;  3CCL B;  2VFP A;  2VFM A;  4IJA A;  1MW7 A;  5EZH A;  3H36 A;  1PLU A;  4EW9 A;  1D8T A;  2H27 A;  1E63 A;  1KA8 A;  2VBE A;  1ACI A;  3DBH B;  1V54 H;  2O61 A;  3QAH A;  3KCC A;  2PLY A;  5TY0 A;  2QGG A;  2XPW A;  1D5Y A;  2D74 A;  1ZK8 A;  3K6G A;  4HDV A;  1IRZ A;  5E20 A;  1U0J A;  4QWQ A;  3VYT B;  4RDU A;  3CCR I;  1YS6 A;  1QVG B;  2RN7 A;  4XN0 A;  5KHD A;  5ED4 A;  2STW A;  4YAO A;  1O8G A;  2CQN A;  1OCC H;  4EJW A;  4KA4 A;  2CND A;  1DQU A;  1E62 A;  2JJ7 A;  2VKV A;  2WY8 Q;  1TW3 A;  2VNI A;  2QEN A;  1R71 A;  5JVT A;  3W5H A;  4UAJ A;  1TP4 A;  4WCG A;  3W2I A;  2EFQ A;  4XRS A;  2QBY A;  5B66 C;  2RRE A;  4D7M A;  2R5Y A;  1YJ9 I;  3K9T A;  4BYY A;  2MYS A;  3CCM I;  1KU7 A;  1RKW A;  1HW2 A;  4HF1 A;  4QUZ A;  2XPU A;  2W1O A;  3CJT B;  3JW4 A;  4MGR A;  4F3Q A;  3H0D A;  2IQ7 A;  2DMU A;  1VZ0 A;  4UUV A;  1VQK B;  1T98 A;  1G3W A;  4WK8 F;  3K69 A;  2XZP A;  3OL4 A;  1ON1 A;  4EV0 A;  3D26 A;  3ONU A;  2D1H A;  2A6T A;  3T0Y A;  5FRO A;  3OYG A;  1V0F A;  1LFU P;  2R7F A;  3SFI A;  4M1K A;  1PE9 A;  2XB5 A;  2VON A;  3HRT A;  2KRC A;  3CCY A;  3F0C A;  2NYX A;  4FT8 A;  1RNL A;  1S9H A;  4A3K J;  2XOK A;  1IW7 F;  1IA5 A;  4E70 A;  5D5U B;  5FFZ A;  1FYL A;  3OMY A;  1QGZ A;  2YPR A;  5H6R A;  3MZY A;  3R6J A;  2LKP A;  4TMZ A;  1ETQ A;  5EEA A;  4U7D A;  1BJA A;  4BE0 A;  4N0B A;  2GXA A;  1JXS A;  4U4B A;  2CU7 A;  3Q38 A;  1JJ8 C;  3ZMD A;  2AXL A;  2C6Y A;  1QGY A;  4RA2 A;  4S05 A;  3DQV C;  2PJR B;  1KQ8 A;  1P2F A;  2D1V A;  1VQ6 I;  4KH3 A;  1Y1V J;  4O6J A;  3NWS A;  4B48 A;  4P1V A;  2R7O A;  2L7M P;  1LVA A;  4YEJ A;  2I8D A;  3I3L A;  4D7N A;  3BDD A;  4M0L A;  3H1C A;  3GFL A;  4JYK A;  2E1B A;  1XGS A;  1ETY A;  4N9H A;  1M90 D;  1Z6T A;  4NBQ A;  2LD5 A;  2EIJ H;  2K4B A;  4OAZ A;  2DOG A;  2WSS A;  1LKX A;  2QX3 A;  2LNB A;  4Z4S A;  5DUK A;  1BW5 A;  3QE2 A;  1IGN A;  2IJL A;  3C18 A;  3PQK A;  4AID A;  4IO9 F;  5THX A;  3RZD J;  2V1N A;  3K4M A;  4R8H A;  4PAA A;  2XGD A;  1SD6 A;  3GVK A;  2L02 A;  2F4I A;  2IA2 A;  2R3S A;  2KPM A;  4RB1 A;  2XAJ A;  1I50 J;  1KU9 A;  1VQ7 I;  4HST A;  1HC8 A;  1KC8 D;  1NHA A;  2HQ5 A;  4NC6 A;  3TBI A;  1HCR A;  1RUO A;  2W57 A;  1NB0 A;  4QTR A;  3B90 A;  3CRZ A;  5H59 A;  1TT0 A;  2XAQ A;  2JK3 A;  1GV2 A;  5GV7 A;  1B2R A;  1HQC A;  2IA0 A;  3I5U A;  3DEE A;  1N0V C;  3N6Z A;  3NQO A;  4YAU A;  4CZC A;  2GLO A;  3I0T A;  3U6B A;  2KRH A;  1ZLK A;  4NUB A;  4LOC A;  2HDD A;  1BLI A;  4ENJ A;  3E6C C;  2FU4 A;  2P4W A;  1JTY A;  4EGZ A;  2XPV A;  1Z0X A;  3S2W A;  3S3O A;  3ZZT A;  4KUM A;  5ILV A;  4XR6 A;  4ZDO A;  3U9G A;  4QSH A;  2GXG A;  4P25 A;  2QSH X;  1F36 A;  2WV1 A;  4DZP A;  1XB2 A;  2BMW A;  3A8K A;  1RKT A;  5DD8 A;  3JQQ A;  4KIC A;  3J81 Z;  1RC9 A;  2IGM A;  3WGH A;  3J80 K;  3JRG A;  4AF7 A;  3F21 A;  3ISX A;  2EA4 A;  5IYN A;  2P0W A;  1IO2 A;  3KE2 A;  4NNJ A;  2QZA A;  3BR0 A;  2L9V A;  2ISY A;  3LYC A;  1P4W A;  1YIJ B;  1R22 A;  1AU7 A;  2QM3 A;  2NAZ A;  2VB6 A;  2BVN A;  2JPC A;  3CMY A;  1GQ8 A;  1W4M A;  1B72 B;  1BJZ A;  1WP6 A;  4EAT A;  1BHE A;  2HYJ A;  5EDN A;  3H9Q A;  3SJP A;  1D1A A;  2JSP A;  1O57 A;  1MDM A;  2VOO A;  3HOV J;  5CVV A;  2XIG A;  1W0T A;  3TO9 A;  2BM7 A;  4C2L A;  2Z99 A;  3HKZ N;  1JJ2 B;  4XID A;  5DEQ A;  2OTJ B;  3F23 A;  5HLI A;  3BT9 A;  3JRC A;  5F27 A;  1Q1V A;  2Z8G A;  2UWM A;  4ZTJ A;  4RJL A;  4DYC A;  5DDG A;  3P7N A;  1Z1D A;  2PQ8 A;  3BTC A;  1VTN C;  4Z4W A;  1JRG A;  1FT9 A;  2K3P A;  3WTT C;  5J1R A;  3CCQ I;  2A6E F;  3VSV A;  2CWE A;  3OSG A;  2J8I A;  3OYB A;  2QEX I;  2CW0 F;  3PUB A;  2K3F A;  1WOP A;  2E1M C;  4EEF G;  3ISP A;  4G7W A;  4YXW A;  2XHK A;  5HNH A;  2Z2S B;  3VO1 A;  5K7F A;  2LRD A;  4M9S A;  2BPO A;  2LY2 A;  2DFI A;  1E0E A;  1MNM C;  2XAU A;  1NG7 A;  2L2O A;  1Z77 A;  3VMV A;  2E5N A;  3U2Q A;  2LBF B;  4BEH B;  2E1C A;  1IDJ A;  2DK5 A;  3HRM A;  1RRJ A;  1DUX C;  2ACJ A;  5LRS A;  2VLA A;  4WZK A;  3CDI A;  3IAM 2;  3GTJ J;  3V8K A;  2E7X A;  5KNL A;  4Z4Z A;  1IN6 A;  2D3L A;  1R1U A;  5IYR A;  4L5J A;  5FLM J;  3BR3 A;  2DMT A;  2OQR A;  2QQB A;  3GVL A;  2COB A;  2Y0M A;  4M3B A;  1ZRD A;  1W35 A;  3F6O A;  1VQM B;  2MFZ A;  2ZSI B;  2R5Z B;  3VR6 A;  4F7D A;  4A3M J;  2V1D A;  1VQM I;  1SKY B;  2XND A;  3OYM A;  5D4R A;  2DIE A;  1GXP A;  2DOF A;  3DDY A;  1AOY A;  4WZL A;  1ODD A;  5FO5 A;  4LBW A;  3DV8 A;  2DOD A;  1S3J A;  1ZEL A;  2LK2 A;  2O3F A;  2FOK A;  3MHP A;  3A35 A;  1R6R A;  3RI4 A;  4CA0 A;  1XS9 A;  2V26 A;  5ICF A;  4CO8 A;  2XSD C;  2IGN A;  3MN2 A;  5GPA A;  2EZK A;  1VQ5 I;  4KNY A;  1TTY A;  3CLO A;  5E6T A;  1I7P A;  2IXS A;  1E1R A;  4TT3 A;  2W7Z A;  2K9M A;  3A4C A;  3GIR A;  1J9I A;  2ZXH A;  2WTE A;  1X0C A;  2V31 A;  2DET A;  2BYV E;  2QF7 A;  1XQB A;  2VOD A;  2DO7 A;  2L7K A;  4JX4 A;  3LST A;  3KLN A;  3OIP A;  2E2H J;  2NVY J;  3ZBT A;  3TH0 A;  3P9K A;  1XG2 A;  2FQ3 A;  4M74 A;  3U21 A;  2VJJ A;  1B72 A;  1I1S A;  3J7Y J;  5EGO A;  1YIJ I;  1BW6 A;  3PJR A;  1IV8 A;  3CCJ I;  4OJ6 A;  1OQY A;  1IDY A;  2K9S A;  3DPU A;  3DKY A;  5LLQ A;  2DJN A;  2CBX A;  4IF4 A;  3N05 A;  4TN1 A;  1B1B A;  1S0U A;  4RGR A;  1MJB A;  2NXN B;  2CQ7 A;  2W84 A;  4AIJ A;  5H6Q A;  1Z6R A;  2HGC A;  1OCO H;  3QSY A;  1GVH A;  1AKH A;  2O04 A;  1U2W A;  5J35 A;  1F20 A;  1FNM A;  3VMF A;  4WZT A;  2VXZ A;  3WG7 H;  3OS1 A;  1KON A;  2VE8 A;  1O8K A;  3OEE A;  3KET A;  1W0J A;  2BV3 A;  2Q2E A;  1MBG A;  1OIS A;  1ONV A;  4PJM A;  1D2E A;  2QTL A;  4RGX A;  1ULY A;  1V5F A;  4I0B A;  2BM1 A;  2R93 J;  1J9Z A;  1H88 C;  1YJW B;  1KQ0 A;  3E6M A;  4N9I A;  3M7G A;  2OYN A;  2LVS A;  3K2Z A;  4WQM A;  1DAR A;  2LG4 A;  1CNF A;  2KRF A;  3IKV A;  2EFP A;  5HKK A;  4Z4V A;  1FRQ A;  2XF7 A;  2Y31 A;  3FXL A;  2DI3 A;  3HC7 A;  3HKZ A;  2O0V A;  1BC8 C;  2BGJ A;  2HOT A;  2OTL B;  2E5Z A;  4CCO A;  4XL9 A;  1PP7 U;  4LK1 F;  4KIS A;  3VO2 A;  1VLY A;  2VC0 A;  3OS0 A;  1HW1 A;  2CW7 A;  1XGM A;  2H6B A;  3E5U A;  5LRR A;  1OCR H;  2MW8 A;  3PIO F;  1ZUN B;  5C1E A;  2M5S A;  1I6X A;  4Z6Y A;  4HG2 A;  3EET A;  2GA1 A;  3RY8 A;  1TL8 A;  3AVW A;  3BY6 A;  2Q2E B;  2Y30 A;  1N78 A;  5DS0 A;  4UUT A;  2GK7 A;  4CYC A;  1ZAO A;  1JUS A;  1FX0 A;  2EIL H;  3WU0 A;  5FNZ A;  5EJC A;  3LFK A;  1N8R D;  1BX1 A;  2HR3 A;  2LTP A;  4XSZ F;  2ZJQ F;  2ID3 A;  4IZZ A;  1YQA A;  2RNJ A;  2Y0S N;  4LLG F;  2CQX A;  1Y56 A;  2HQN A;  1O8D A;  4M72 A;  4M73 A;  4FX4 A;  4B3F X;  4ZV4 A;  4HX7 A;  3SJZ A;  3W6J B;  3IWF A;  1E3Z A;  1HF2 A;  4YEI A;  4CCK A;  1LJ9 A;  3KP3 A;  2HXI A;  4EJO A;  4F7Z A;  4A3C J;  4D9J A;  1R00 A;  4B1R A;  1A04 A;  3RQ4 A;  4QIW N;  1VQO I;  1MMS A;  1YS7 A;  1YHQ I;  3GW2 A;  3I58 A;  5EGO B;  1TQM A;  3DPT A;  2NVU B;  2V6C A;  1DDG A;  2L4A A;  3D5L A;  4J00 A;  3MD2 A;  1ETK A;  2EBI A;  2RV8 A;  4PJ0 C;  3ROU A;  5E3N A;  3AAF A;  1NH3 A;  2CGP A;  1VHE A;  3WGG A;  1CF7 A;  4LIU A;  4PFP A;  1G6N A;  4XNF A;  4G1V A;  5L46 A;  5M5Y J;  2CQK A;  2M87 A;  2QZ8 A;  4P5O A;  5E3M A;  2R4G A;  2MGQ A;  3L2R A;  1LUJ B;  5FFX A;  3P4G A;  5M3F J;  2WJY A;  4KN4 X;  3TP0 A;  4XKW A;  5J3O A;  2TRT A;  3ML3 A;  4CH7 A;  1E2X A;  1CNE A;  2XGX A;  2HPM A;  1T0F C;  3F8F A;  2DPU A;  4X7E A;  3OYH A;  3K4J A;  3KYL A;  2UXX A;  4EM1 A;  3ZGK A;  2R7R A;  4YDT A;  2NVX J;  4YFO A;  1GLN A;  4U9U A;  1QFJ A;  3L2W A;  4XN3 A;  5FKL A;  2ZTG A;  1SD7 A;  3BY1 A;  2QE7 A;  4RAZ A;  5ERI A;  1HF0 A;  4RD4 A;  4UB8 C;  1EV7 A;  2R5Y B;  1EJ9 A;  4P6Y A;  4GXO A;  4M71 A;  2HVR A;  3K1N A;  3ZZ0 A;  2ESH A;  5F0C A;  1EP3 B;  3OV8 A;  5E1X A;  3OJX A;  5HDG A;  3MKY B;  1A36 A;  1WDT A;  1N06 A;  2R7U A;  4RPB A;  5BPI A;  3CCR B;  1OOC A;  2X48 A;  1Z9C A;  2M0C A;  5EG0 A;  2R5Z A;  2DU9 A;  2CV0 A;  4O5V A;  2HI3 A;  1P7I A;  3M1E A;  2Y69 H;  2O8X A;  5KW9 A;  4XSX F;  3R6K A;  1PYV A;  3WXM A;  2ZXJ A;  1S8N A;  2WAQ A;  2QSF X;  3KIO A;  2QEX B;  3RPU D;  1XTA A;  5HLG A;  4PC1 A;  3BR2 A;  4BGD A;  1EH6 A;  2VC1 A;  4PMH A;  2KFD A;  4OPS A;  3ONQ A;  4HF2 A;  1JKO C;  2CG4 A;  2LRE A;  4ZDP A;  4Z4U A;  3DEU A;  3TDZ C;  2B7C A;  2BY2 A;  2E1M B;  2FOW A;  2QKL B;  2O17 A;  1VJS A;  4PFO A;  4X8I A;  3KFW X;  2UVF A;  2G7H A;  4XM3 A;  2GOX B;  4AIK A;  4ACA A;  1G7R A;  4G1B A;  4P1W A;  4OPO A;  1U3E M;  5EZG A;  3NAW A;  3BTI A;  4D5C A;  2E60 A;  2WAF A;  1K6Y A;  3LA3 A;  3CC4 I;  1ETO A;  3H0G J;  1IAW A;  2CC2 A;  3LMM A;  3TO7 A;  3S3M A;  3Q3A A;  1QG0 A;  1EFT A;  1JUM A;  3TP3 A;  1UEL B;  1H8A C;  3L2Q A;  4QVJ A;  4Z1M A;  3WY9 A;  2F3L A;  2C2W A;  2EV5 A;  2X9D A;  3GCM A;  4E7H A;  4IHV A;  3SY2 A;  2C77 A;  5IP6 A;  1JKQ C;  1V3F A;  4UVA A;  3JRD A;  3G73 A;  1IB0 A;  3G3Z A;  4L9J A;  1W7P A;  1R5O A;  2J7K A;  1STZ A;  2EFO A;  3T53 B;  1I3A A;  4J01 A;  3DKX A;  4B47 A;  3Q0W A;  3ZMV A;  2O0W A;  1NK2 P;  1OFE A;  3H5A A;  4B3A A;  2BM0 A;  2M9H A;  1V55 H;  3CF2 A;  4ZCM A;  5TV2 A;  2M34 A;  1Z7U A;  2OCE A;  4BS9 A;  1JTX A;  2IBD A;  1FSE A;  3B6A A;  4P96 A;  4A3F J;  2DMN A;  3OFN A;  4BAC A;  3O2P E;  1HKT A;  1YFH A;  1E43 A;  2HTS A;  4G5G A;  2PEC A;  4P2N A;  3K0L A;  4ESJ A;  3MZH A;  1W34 A;  2FE3 A;  2D9R A;  1UZC A;  4C3H J;  4G6Q A;  1QVU A;  3DF8 A;  2AHQ A;  2WAE A;  1FRN A;  1BR2 A;  2EFG A;  3AGP A;  5FD6 A;  2NPF A;  2JA2 A;  2MD5 A;  1SFO J;  1KD1 D;  2V4J C;  3H5R A;  3GRH A;  2ELH A;  4U0V A;  3DTK A;  1DG1 G;  1IRX A;  3JAM Z;  1R9T J;  1VQP I;  1FNC A;  5IYB J;  4AWX B;  4KKT A;  3FMQ A;  5GAH J;  3S17 J;  4HQE A;  4HPQ A;  4XBF A;  4UHT A;  1BJK A;  1U8R A;  3DLA A;  5GV8 A;  2W6J A;  4KYW A;  1GR1 A;  4QFM A;  2VJ5 A;  2XAG A;  1QA6 A;  2VBU A;  4UUS A;  1NJI D;  2B7E A;  3I59 A;  3BCF A;  2MAB A;  3FHN A;  2OA4 A;  2K27 A;  3PM1 A;  1U78 A;  1V5V A;  2X51 A;  5ICG A;  2H1L A;  3KPH A;  3JQR A;  3BRO A;  2JRT A;  3LFU A;  1B23 P;  1BOB A;  2X3H A;  4D5F A;  5CVR A;  2LDU A;  2WV0 A;  2GQQ A;  4ZYH A;  5IY5 H;  5M5W J;  2GA2 A;  2FVG A;  2L0K A;  1ON2 A;  2V7F A;  2P8T A;  3FK7 A;  2CK3 A;  2MG4 A;  3VST A;  3BG3 A;  5D6E A;  2PX9 A;  2AQE A;  1O8I A;  3ZSC A;  4BJ5 C;  1K5C A;  1WU8 A;  4XKC A;  1FND A;  3KP4 A;  4KN7 X;  4UVB A;  4OIP F;  2JWT A;  5DM6 F;  3UR3 C;  2O7O A;  3BNW A;  2DA7 A;  2XUB A;  2DLL A;  3HOY J;  1J0R A;  1GUU A;  1XN7 A;  4RDL A;  3LO8 A;  1N05 A;  4NK8 A;  3G05 A;  1KZL A;  2ZL6 A;  4E7S A;  1IB4 A;  5D8K B;  3CES A;  2R7T A;  2A61 A;  3F72 A;  1BI3 A;  3L9F A;  1RR7 A;  2VXD A;  3JRI A;  1XSD A;  4ON0 A;  3ASN H;  4ZYA A;  1W7P D;  3ZMT A;  4IOA F;  3BH4 A;  1FMW A;  2XB0 X;  3CJR B;  2CSO A;  3EUA A;  4CQJ A;  3ZBU A;  1Z21 A;  4ZZD A;  3DWL E;  3PO3 J;  3CMA B;  1XDU A;  1T56 A;  3ERE D;  3TMO A;  1KMH A;  3RKY A;  3AVY A;  1O8M A;  2RQP A;  3KEY A;  2VIX A;  1AIR A;  2D3N A;  3I71 A;  1BI1 A;  3W2V A;  1J59 A;  3ZQ7 A;  2X8K A;  3U6K A;  1RMG A;  4CYC B;  3PQJ A;  4Y7N J;  5B3S H;  3OYI A;  1MMG A;  4LBZ A;  1LE8 A;  1T6Z A;  2BZT A;  2RGV A;  4QPO A;  2M30 A;  3GF2 A;  2PJP A;  2JZY A;  2VBX A;  3AK5 A;  1YOV B;  4TMW A;  3PSZ A;  3AKZ A;  2PMZ N;  1UD5 A;  1D0Z A;  2JN9 A;  1RES A;  5J6X A;  3BR6 A;  2DTZ A;  3FF5 A;  5E1W A;  1QZZ A;  2GQF A;  2ZZQ A;  4BXU A;  4UZE A;  1X3Z B;  2JPB A;  4LLN A;  2GK6 A;  3MKW B;  1TWF J;  3HTU A;  1R58 A;  3L2C A;  1PUF B;  1BOA A;  2KIF A;  4Y9R A;  2P5K A;  3O6B B;  3JX8 A;  2QGU A;  1X4P A;  2CW8 A;  3KYC B;  3LQE A;  4I99 C;  2VBM A;  2F5V A;  2MA3 A;  1PP8 F;  1ZR2 A;  3ZPL A;  3AL0 C;  3ZMS A;  3LNN A;  3PET A;  1A6Q A;  2V1X A;  4OIN F;  1BI0 A;  1MND A;  1R4M B;  4CCM A;  4ESF A;  4I6Z A;  1HA8 A;  4Z4Y A;  4OMY A;  3BY2 A;  3W2G A;  1SMY F;  3GZN B;  2DT6 A;  1G8X A;  1JT0 A;  1MIJ A;  5J8F A;  2PN6 A;  3ESW B;  1UB9 A;  3W2A A;  4AC0 A;  2P7V B;  4BBR J;  3OIO A;  1W0K A;  4PJJ A;  2LH9 A;  3MQ0 A;  2ZL5 A;  2DA4 A;  3E97 A;  2YWE A;  4OJ5 A;  3GSI A;  3AG1 H;  2BY3 A;  1A5J A;  2DQR A;  1MBF A;  2RAE A;  3H94 A;  1PDN C;  2ME6 A;  3UKG A;  2Z9O A;  4CHU A;  3WU2 C;  2F1L A;  2MSY A;  3HIF A;  3SJM A;  2FJ1 A;  4QVA A;  3H3U A;  4LLL A;  1S72 B;  2G7U A;  2QYO A;  4RAY A;  4UVC A;  1XD7 A;  3MVP A;  4RS8 A;  2CUZ A;  1UD8 A;  4RDJ A;  2EWN A;  3GEZ A;  2DCU A;  1IRG A;  1R1V A;  5EEG A;  2VFO A;  1LQ1 A;  3E5Q A;  3GLX A;  3K1M A;  1YIT B;  1IN4 A;  3TED A;  2ZBU A;  1BBY A;  4K1X A;  4C30 A;  3U1D A;  3D1N I;  1QRY A;  5K7Z A;  2H8R A;  4FWT A;  5JLV C;  3OYE A;  1BI2 A;  3P5J A;  2CRV A;  1FZP B;  1WRJ A;  3FIS A;  4GO1 A;  1MH3 A;  3CC2 I;  2XAF A;  3ZN0 A;  3KP7 A;  1XGN A;  1YX3 A;  3AG3 H;  2CW5 A;  2VQH A;  4ACB A;  2JJ2 A;  1BIA A;  3F3X A;  2XTW A;  2A6H F;  3CCU B;  1DU6 A;  4HBL A;  3ECH A;  4FHT A;  1Y0U A;  4DQ2 A;  5CPR B;  1EFR A;  1OCP A;  4ENK A;  2VJI A;  3LNQ A;  2CYY A;  2DFH A;  2BOL A;  1K4T A;  1LEB A;  3J81 K;  2WB1 A;  1VQ4 I;  3PNV A;  3U2R A;  5GPC A;  2VKD A;  2E7W A;  5HLT A;  3J7A Y;  1ZM4 A;  2M1B A;  3OYN A;  3A02 A;  4BU2 A;  2BM5 A;  1F60 A;  2DFF A;  4I02 A;  2B9S A;  1JTA A;  2OTL I;  3WOD F;  5HS9 A;  5JI6 A;  2NZM A;  1XGO A;  2YUH A;  3FM5 A;  1QHH D;  5KAF C;  5L3F A;  3EQN A;  1P6R A;  2LKS A;  2ZIT A;  1D0X A;  1T39 A;  1LNW A;  1X4O A;  1NRK A;  3OEH A;  4TSF A;  4YG2 F;  3GFI A;  4F92 B;  1QZE A;  3JRB A;  4OOI A;  3S1Q J;  4PDK A;  5K5R A;  3D0S A;  2V7V A;  5IYP A;  2BBY A;  3F6V A;  1MBH A;  3VYS B;  3T51 B;  1WJC A;  1X2N A;  3B8H A;  2FD5 A;  4TMV A;  2XRO A;  3FWE A;  1A35 A;  4IQ4 A;  1X1P A;  2DCE A;  1U2R A;  1SMT A;  4D1Q A;  4OMZ A;  1FIP A;  1IN7 A;  4BKX A;  5HZA A;  3DBL B;  4FCY A;  4RD3 A;  3F8M A;  3MKL A;  2DMP A;  3E6B A;  1Z05 A;  1O3R A;  2UXN A;  2F43 A;  5DCM B;  3K1P A;  4PGG A;  2R7D A;  2XNC A;  2JDI A;  3ELK A;  1CZF A;  3DU6 A;  4LK0 F;  4MO7 A;  2DYS H;  2Y9Z A;  3SFZ A;  1UD2 A;  3S8P A;  1NB9 A;  3CUQ C;  3R0A A;  4IVN A;  3OR1 C;  4P9U A;  2E19 A;  1E3H A;  4AVZ A;  3PEN A;  2KIM A;  1TYW A;  3DU5 A;  4DBQ A;  2G0Y A;  1WSV A;  5H5J A;  1E3P A;  4A3G J;  2VKE A;  3S1M J;  2X1E A;  4EJT A;  3CCV B;  3BCB A;  3OYF A;  1N25 A;  4DK0 A;  2K7L A;  4CXF A;  3HRU A;  4WXC A;  2ME0 A;  4L9T A;  4CYD A;  2JIZ A;  1MD0 A;  1P7J A;  2XNJ A;  3H9J A;  4HQM A;  3QFR A;  1RUN A;  3S14 J;  2OBP A;  1WSU A;  4BJT A;  2OV7 A;  3CW2 A;  3ZPP A;  4ASN A;  3ERM A;  2QVO A;  1QUF A;  1PJ6 A;  2DBB A;  1FNN A;  5B5E C;  5LGN A;  5FLX Z;  2FXA A;  2W48 A;  1YJN I;  2YSR A;  3S16 J;  4Y15 A;  4EJV A;  1WPC A;  4AIH A;  5EEH A;  1E1Q A;  4MQ9 F;  3VNV A;  1YG2 A;  1GT0 C;  2P7C B;  1G3Y A;  4BDY A;  2QKM B;  4HZF A;  2W25 A;  4UUS B;  1Q82 D;  4NC8 A;  4WF2 A;  2QUF A;  3ZC3 A;  3VFZ A;  4DYQ A;  3ZMZ A;  3ZQQ A;  2K4J A;  2F4M B;  2Z16 A;  3P26 A;  4BXF A;  1DDN A;  1PXZ A;  1OYI A;  5LHI A;  1ETW A;  2M0M A;  1QVT A;  5FRM A;  4ZC3 A;  2ZZE A;  2ZSH B;  1FP2 A;  2EZI A;  2Q8K A;  4ZTF A;  3M8J A;  5ICE A;  1IG7 A;  4PZJ A;  3SEQ A;  4IRH A;  3BPX A;  5CJ9 A;  1Z91 A;  1ZYR F;  4ZYG A;  1EFU A;  2KHM A;  5TGT A;  4BH9 A;  1PVE A;  3B73 A;  1W2B B;  4Z06 A;  1FY7 A;  2W7N A;  3L00 A;  2XAH A;  3TDU C;  4JQF A;  3BZC A;  3V8L A;  4U0Y A;  3K70 D;  3M3Y J;  1EWY A;  5F0H A;  2BSA A;  2WZN A;  4HNU A;  5JLW A;  1K79 A;  2C4T A;  5J3L A;  1R5B A;  1G4D A;  2EA2 A;  2C5H A;  3PSS A;  3SYJ A;  3IH2 A;  1O8E A;  1F1Z A;  5HOD A;  1JGG A;  2KQR A;  1F4K A;  2R6H A;  4YFX F;  2XF6 A;  2OUM A;  2W85 A;  3FXU A;  4GGG A;  4PJN A;  1I8D A;  4OAY A;  1T0F A;  1IXC A;  5CVI A;  5DUI A;  1WI3 A;  5HNF A;  3T8R A;  2YU9 J;  3TW6 A;  2Z6B D;  2A3S A;  3GQB A;  4X6A J;  4MHG A;  4W8S A;  1ITY A;  2EZL A;  3HOS A;  3W6K B;  1K6O A;  1Q7Y D;  3ZN1 A;  4E7I A;  2HVQ A;  2X4H A;  2BV6 A;  4Y3O A;  1K4S A;  4EMS A;  4FXU A;  3AST A;  1OCT C;  3F8B A;  2QYU A;  2GXB A;  4PUS A;  4M6Y A;  4NB5 A;  3W2F A;  3MWM A;  5IT9 Z;  1OKR A;  4E7K A;  1P4A A;  2AS5 F;  1ELO A;  2CH0 A;  2VT3 A;  3Q9S A;  1WTH D;  3PFI A;  4HLX A;  2IEK A;  5GP9 A;  4X06 A;  1TYX A;  3SZE A;  3ZUG A;  4N3G A;  4EH1 A;  5LBQ A;  3R6S A;  4GRI A;  2VBK A;  4U49 A;  1IXR C;  2D2W A;  3BPV A;  5FJ8 J;  2V6E A;  3A0B C;  2R7Z J;  2MLG A;  1AMO A;  2QA4 B;  1QA1 A;  4IKF A;  2R7X A;  3NB2 A;  1ZG5 A;  4B4C A;  3P9C A;  1YW8 A;  2B5O A;  3M8F A;  1IF1 A;  5JFR A;  1B8I A;  3GZ5 A;  3CUQ A;  4XLP F;  3I59 B;  1EA0 A;  2EQR A;  3S1R J;  1CQT A;  2F1M A;  1AIP A;  4NK6 A;  4E7Z A;  3ABL H;  3WGI A;  6PAX A;  1F43 A;  4OM9 A;  3W2E A;  1G7C A;  1YYV A;  1IJW C;  4PC6 A;  1WOO A;  1QA3 A;  1OGJ A;  2BHY A;  2RNG A;  1T08 B;  2PFB A;  1Q81 D;  1MGT A;  3D5R C;  3S32 A;  3A3G A;  4OJO A;  4LB6 B;  4H4K C;  4KMF A;  2K40 A;  3FY3 A;  3H9G A;  3CCS B;  3W2H A;  4NCN A;  3SDB A;  3NAU A;  4NQW A;  1VQL I;  4EM2 A;  1FYK A;  3HEF A;  4L18 B;  2KDO A;  2H8W A;  1B4A A;  4FQG A;  3JSP A;  2LZJ A;  4RAF A;  2ECB A;  2UV1 A;  5CVU A;  2D45 A;  2R7V A;  2ADU A;  5J4Y A;  3G2B A;  1SAX A;  1E3O C;  1FEX A;  1K78 A;  2COM A;  4XLN F;  1MRZ A;  1JT6 A;  4JX6 A;  3DCF A;  2X0K A;  3OR2 C;  2BE5 F;  4E7J A;  3H09 A;  1HZE A;  3S15 J;  2FQ4 A;  1XMA A;  2ZFU A;  4GYI A;  4B8X A;  2BGC A;  3OYJ A;  2ZTN A;  2Q1Z B;  3JSO A;  4CZZ A;  1RQP A;  4YFK F;  3OAA A;  3CMA I;  1ZN2 A;  2W00 A;  2QDX A;  1I3Q J;  1VBL A;  3REO A;  4XOP A;  4RBO A;  5AIQ A;  1BQE A;  5E17 F;  4URR A;  1CLW A;  2WPD A;  2I10 A;  4A5N A;  3KLO A;  2MD0 A;  5CQG A;  4RD1 A;  2Y48 A;  3WTY C;  2DA3 A;  5BSX A;  3VEP A;  4YRV A;  2FBI A;  2J8K A;  4HNT A;  2OK8 A;  5HVQ C;  4C3I J;  3PIP F;  3GYH X;  1D5V A;  2V5I A;  4DYR A;  1GHC A;  4P9S A;  4C3J J;  3K4L A;  3CJN A;  4HV5 A;  2XKP A;  3ZR8 X;  5CDF A;  1WH5 A;  2BGI A;  1FOW A;  2VI6 A;  3SEZ A;  2PE3 A;  5CKT A;  2KIQ A;  3GQ7 A;  2M8E A;  2VQL A;  1I18 A;  2V9K A;  2FF4 A;  2LSO A;  3LQQ A;  2HU9 A;  3J7A O;  1LFP A;  1G7S A;  3KX2 A;  3GWZ A;  3NRV A;  2XTX A;  2HLD A;  4G9Y A;  5FKN A;  5AIP A;  4F93 B;  3OYA A;  3I53 A;  1R1T A;  1NBM A;  3P27 A;  4LBV A;  4I7H A;  2B7B A;  1LPQ A;  4Q5S F;  4JMQ A;  2ZFW A;  2NRA C;  1L3L A;  3BR5 A;  4P3I A;  1XE1 A;  3KP6 A;  2OD5 A;  4J0Q A;  3CCM B;  1W36 D;  1QPI A;  5C4J J;  1IN8 A;  5CYV A;  3I55 I;  2HCJ B;  3OPO A;  1R5N A;  1MKM A;  3FKJ A;  3KP5 A;  1P92 A;  5LHH A;  2DOA A;  2ZBV A;  2DXI A;  3FJO A;  5FO1 A;  4A3B J;  3LSP A;  4ZH4 F;  3QU6 A;  1PJ7 A;  4IHT A;  3WQZ A;  4DQL A;  5AON A;  1WMR A;  3GTK J;  3DLL F;  3OZW A;  3ZXS A;  3SYT A;  2AQF A;  2CFX A;  1BC7 C;  4BY7 J;  2QCO A;  5D5X B;  1BL0 A;  9ANT A;  2XEX A;  2VBY A;  1N77 A;  5ILS A;  3MKZ A;  3PO2 J;  2PMZ A;  5JBQ A;  4Z4R A;  5JMC B;  1D8K A;  1QH0 A;  2KVO A;  2OC6 A;  2V7Q A;  1B9M A;  3K2A A;  3QYE A;  2DT7 B;  3HSE A;  1GAQ A;  2PLF A;  1EP1 B;  1ZGJ A;  4KT5 C;  5HDK A;  2UUZ A;  2GM4 A;  1WFX A;  3LSM A;  3RPU A;  4AU7 A;  1RPW A;  3I55 B;  3MCZ A;  1CGP A;  4AUX A;  3FXM A;  4RLZ A;  2KJB A;  3WTW C;  3FBI B;  1IRF A;  1ZQ3 P;  4IHX A;  3CPW B;  2K02 A;  5GAE J;  5HS8 A;  1TVC A;  1KU2 A;  4YZA A;  3JRF A;  3HTS B;  4XMY A;  5BPD A;  3ASO H;  4DGW B;  5FRN A;  5BS6 A;  5IOY A;  3FX3 A;  1YW9 A;  4FET A;  3RKX A;  2XSJ C;  1OGI A;  3DEW A;  1IV6 A;  3ZQI A;  3I4M J;  4OWR B;  4RB3 C;  1TWA J;  3NWT A;  2E36 A;  4A0X A;  2HWV A;  4A69 C;  4ABZ A;  4A93 J;  2E2I J;  2BEO A;  1ZKG A;  4C0S A;  4I09 A;  2O03 A;  1TT5 B;  1PJ5 A;  2XZL A;  3FIW A;  1BN5 A;  4MFE A;  3IRQ A;  1SD4 A;  3SLD A;  1MBK A;  2W24 A;  3HUG B;  2DW4 A;  5F0F A;  4A2U A;  5LEJ A;  3TOA A;  1UG0 A;  3QU3 A;  2NTB A;  2N8G A;  3Q0U A;  5J40 A;  4Q4Z F;  4XOT A;  3QWL A;  2DPD A;  1KK2 A;  2STT A;  3L09 A;  4WZE A;  5CLS A;  1XPX A;  1VQP B;  3B78 A;  2YX4 A;  3HZJ A;  3PA2 A;  3UNG C;  4B43 A;  2RC6 A;  3HPG A;  3T8T A;  2MH2 A;  3IAS 2;  3IH4 A;  4CCN A;  4HV6 A;  2V79 A;  1ZG3 A;  1QZY A;  2HNH A;  1FWZ A;  3G71 I;  3OZV A;  3CTA A;  2IA1 A;  2GZW A;  3F9K A;  2QWW A;  1W0U A;  4BL0 B;  1DAB A;  2DN0 A;  3DTE A;  4OOX A;  1XSX A;  4IHS A;  1H85 A;  3BZ6 A;  3OYC A;  3CC7 I;  5C3E J;  3CCQ B;  1MZB A;  2O9L A;  4UZU A;  2VBZ A;  3MCA A;  3AFH A;  1UD4 A;  3HG9 A;  2RDP A;  1R5I D;  3FKI J;  4CDG A;  4YHB A;  3AVU A;  2PG4 A;  4F55 A;  5FGM A;  1O3S A;  2NVQ J;  1R7J A;  4XRS G;  3BJO A;  3D5S C;  4HLY A;  2BXY A;  4EQQ A;  3ASS A;  1IC8 A;  2F5C A;  3VSU A;  4L8J A;  3GUD A;  2W6I A;  2O6G E;  2VN2 A;  2NVT J;  1FSH A;  2DY1 A;  4FIS A;  1WJE A;  1KK0 A;  2NST A;  1FIA A;  2LR8 A;  2M5W A;  5B1B H;  3I56 I;  1RR8 C;  2VOP A;  2BY0 A;  4TMT A;  3Q3S A;  3G6E I;  1GAW A;  3R4K A;  3F8C A;  4ANJ A;  3NE5 B;  3H3Z A; 
#chains in the Genus database with same CATH homology
 1WJD A;  1E3X A;  2ZZQ A;  3EQO A;  4OAZ A;  3ZIA A;  2WSS A;  1LKX A;  2QX3 A;  2GK6 A;  3MKW B;  3EUH C;  2V1N A;  3K4M A;  2NSP A;  1X4P A;  2CW8 A;  3GVK A;  4HWV A;  3T56 B;  2F4I A;  2KPM A;  2QY1 A;  2JJ1 A;  4EW9 A;  2VBM A;  4HST A;  2F5V A;  3TBI A;  3AL0 C;  3GVJ A;  3LNN A;  4OJL A;  1TT0 A;  4NC7 A;  1MND A;  2KL4 A;  2V4D A;  1OFL A;  4CCM A;  3TL4 X;  1HA8 A;  3DEE A;  3BCA A;  2HQA A;  4CZC A;  1AA7 A;  2KRH A;  2DT6 A;  1G8X A;  4NUB A;  3OS2 A;  1BLI A;  3LMW A;  3W2A A;  3OIQ A;  4ITV A;  3S3O A;  1COW A;  1YE9 A;  4XR6 A;  4ZDO A;  4PJJ A;  2LH9 A;  1W0K A;  3QOD A;  2EWE A;  3A3B A;  4OJ5 A;  4PJL A;  1KTW A;  2VQC A;  2K5C A;  3H94 A;  2IGM A;  5LD2 C;  2IGO A;  2P0W A;  4PSX A;  4NNJ A;  2VPL A;  4CCJ A;  4XD7 A;  2PYG A;  2CUZ A;  1UD8 A;  2Z1D A;  2XZO A;  3GQA A;  2VB6 A;  4RMN A;  3ZPN A;  4B44 A;  3S93 A;  1GQ8 A;  4MLO A;  1WP6 A;  4EAT A;  1BHE A;  4C30 A;  1O8J A;  3EPZ A;  4HEA 2;  3OYE A;  3H9Q A;  4XLA A;  1D1A A;  2JSP A;  2INV A;  4N4O B;  3VYU B;  1H80 A;  2HDW A;  4BEH A;  4G6I A;  2BVM A;  1BN8 A;  1YX3 A;  3BG6 A;  2IS1 A;  2VQH A;  4C2L A;  1PKV A;  4PSW A;  2JJ2 A;  4B3G A;  5CPR B;  3LSH A;  5HOO A;  1EFR A;  2VJI A;  2DJI A;  2Z8G A;  2KMU A;  4G6T B;  2BOL A;  3LSK A;  4ZTJ A;  2MC4 A;  2WB1 A;  2UWM A;  5LFA A;  1JRG A;  3PNV A;  2K3P A;  3K4K A;  2VKD A;  5HLT A;  3SZG A;  3J7A Y;  4OZZ A;  3H35 A;  3OYN A;  3LSI A;  4LIV A;  4BU2 A;  4W8R A;  3SUC A;  3VSV A;  4XOR A;  3OYB A;  2CS3 A;  1Z3X A;  4DK1 A;  1JTA A;  1QCX A;  3PUB A;  3HAG A;  2E1M C;  2VAS A;  1X1A A;  2NZM A;  1T5E A;  1OLT A;  4G7W A;  4YXW A;  5HNH A;  1QHH D;  2Z2S B;  4CCL A;  3EQN A;  2FUG 2;  1X1D A;  2KZV A;  2LRD A;  3BLY A;  2A5W A;  2LY2 A;  2IS4 A;  1D0X A;  1E0E A;  2XAU A;  1X4O A;  1NG7 A;  2L2O A;  1NRK A;  3OEH A;  4TSF A;  2NT6 A;  3VMV A;  2E5N A;  2LBF B;  4BEH B;  4BUP A;  4Y4R A;  4F92 B;  1IDJ A;  3K10 A;  1MAB A;  2VLA A;  3IAM 2;  2WBM A;  3VMW A;  2W82 A;  3IUO A;  1OGO X;  3OY9 A;  2HZD A;  5KNL A;  1TZL A;  1UAA A;  1H8H A;  2D3L A;  3S3N A;  3VYS B;  3T51 B;  1WJB A;  1WJC A;  4R79 A;  1T95 A;  3K4N A;  3RTR A;  3GVL A;  5DN6 A;  2INU A;  2NTQ A;  3H5N A;  4KKS A;  5JHF A;  4IQ4 A;  2DCE A;  3C2G A;  2MFZ A;  4DBR A;  2ZSI B;  4D1Q A;  3VR6 A;  3GQ9 A;  3I9V 2;  2CV1 A;  1SKY B;  2XND A;  3OYM A;  2IS2 A;  2DIE A;  3W2W A;  3W3C A;  4BDZ A;  3DDY A;  1IDK A;  2M7A A;  2F43 A;  3VWB A;  1G59 A;  2IGK A;  3QYB A;  1ZEL A;  2JDI A;  4KT6 A;  1R6R A;  3A35 A;  3DU6 A;  4CA0 A;  1CZF A;  2V26 A;  1UD2 A;  3S8P A;  4RM2 A;  3OR1 C;  2IGN A;  4DIQ A;  4AVZ A;  2NOJ B;  3DU5 A;  1QHG A;  1LVK A;  1Z7L A;  2IXS A;  4DBQ A;  3OYK A;  3OOU A;  4DJA A;  3V42 A;  4KIT B;  4U87 A;  1E1R A;  3JU4 A;  2K9M A;  2X1E A;  3A4C A;  4XKB A;  1E79 A;  4TT3 A;  2ZXH A;  3BCB A;  1YX5 A;  3OYF A;  3OW7 A;  1X0C A;  4DK0 A;  2V31 A;  4N4N B;  1BR4 A;  2L7K A;  3LSG A;  2JIZ A;  3OOC A;  3OIP A;  3VDX A;  3H9J A;  1VF7 A;  2X1D A;  1OR7 C;  1XG2 A;  2JVH A;  4CUG A;  4BJT A;  2OV7 A;  3U21 A;  3ZPP A;  1BR1 A;  2VJJ A;  1O88 A;  2ODL A;  1P9Q C;  2VL8 A;  3PJR A;  4OJ6 A;  4C2U A;  2R7S A;  1WPC A;  1OGM X;  1E1Q A;  3DPU A;  3DKY A;  4YZX A;  3N05 A;  4BDY A;  2QKM B;  2JVG A;  2PJR A;  4NC8 A;  3DPL C;  3CZ6 A;  2O04 A;  3FKS A;  3M1C A;  1D1B A;  3ZQQ A;  2Z16 A;  1D1C A;  2VXZ A;  4BXF A;  1PXZ A;  3OS1 A;  1UD3 A;  1KON A;  2M0M A;  2ZZE A;  5FRM A;  4ZC3 A;  1O8K A;  3OEE A;  2ZSH B;  1WJA A;  1W0J A;  1D0Y A;  4BE2 A;  2X6W A;  3M8J A;  4PJM A;  4ZTF A;  3RSN A;  3SEQ A;  1X1B A;  4PK4 A;  1V5F A;  4YZ0 A;  2JUG A;  2KHM A;  5TGT A;  2GJR A;  4Z06 A;  2W7N A;  2LG4 A;  2F6C A;  3KRG A;  4JQF A;  3BCD A;  3JUR A;  2XGJ A;  3K70 D;  5HKK A;  2XDV A;  3HXL A;  2XF7 A;  3HC7 A;  3HKZ A;  4HNU A;  2O0V A;  3GQ8 A;  1N75 A;  1MMD A;  2BW3 A;  4E6K G;  3K4B A;  2E5Z A;  4CCO A;  4XL9 A;  4KIS A;  1VLY A;  3OS0 A;  2CW7 A;  2W4S A;  1O8E A;  1O8L A;  5C1E A;  1FMV A;  2KQR A;  2M5S A;  1WJF A;  3DTI A;  2XF6 A;  3OYD A;  2OUM A;  4HG2 A;  4PJN A;  1I8D A;  4OAY A;  2LYC A;  5KCM A;  2Q2E B;  1N78 A;  5HNF A;  2GK7 A;  2CFO A;  4ASU A;  4OJP A;  2Z6B D;  3GQB A;  4KKU A;  1EA3 A;  1FX0 A;  4W8S A;  3HOS A;  3K70 C;  1BPL A;  4E7I A;  2HVQ A;  4CSW A;  2O1D A;  4Y3O A;  4FXU A;  1JI8 A;  4Z05 A;  3T9G A;  2LOO A;  4PUS A;  4IZZ A;  1QJV A;  1Y56 A;  3PFY A;  1O8D A;  3OYL A;  4E7K A;  4B3F X;  4XQF A;  1RU4 A;  2CH0 A;  1E3Z A;  2M4G A;  2M7B A;  1WTH D;  3UW0 A;  4CCK A;  2X1C A;  2KLO A;  2L9S A;  3GBG A;  3PL8 A;  1PJR A;  2GOM A;  4D9J A;  1H8E A;  4U49 A;  4GRI A;  3K4C A;  3VYR B;  4HRI A;  3RQ4 A;  1K28 D;  2V6E A;  2WJV A;  2VBK A;  3B4N A;  4RLF A;  4IKF A;  1NG6 A;  2R7X A;  4MR0 A;  4FAS D;  1KCD A;  3DPT A;  4HSR A;  2QXZ A;  4LIT A;  3D5L A;  4J00 A;  3MD2 A;  4W8Q A;  3A1Y A;  1HG8 A;  2L5Q A;  4U7B A;  4LIU A;  3BC8 A;  1OHH A;  4PFP A;  4TKO B;  2F1M A;  4NK6 A;  4XNF A;  2ZZF A;  4P5O A;  1MMN A;  4E7Z A;  2R4G A;  1DBG A;  4II2 A;  2RQQ A;  3L2R A;  2WJY A;  3WWG A;  2RNG A;  4XKW A;  2X53 S;  4CH7 A;  4DNR B;  2VKH A;  3D5R C;  3S32 A;  3CMM A;  2HPM A;  1T0F C;  4XLE A;  3EUK L;  3HOT A;  3A3G A;  4HIZ A;  3OYH A;  3E1S A;  3K4J A;  3ZCO A;  4H4K C;  3KYL A;  2R7W A;  4OJO A;  4Z03 A;  3CP8 A;  3ZGK A;  2R7R A;  3FY3 A;  3H9G A;  2BW3 B;  1GLN A;  3SDB A;  3L2W A;  4XN3 A;  2ZTG A;  4P22 A;  2NT9 A;  2QE7 A;  2R9V A;  2ZZG A;  1OFM A;  2CV2 A;  1V5E A;  2VJ4 A;  2KDO A;  2BVL A;  2LZJ A;  2CUJ A;  2UV1 A;  2HVR A;  2R7V A;  4BJ6 C;  2WA0 A;  4E4H A;  3L2V A;  2HVS A;  1UD6 A;  3G2B A;  1DBO A;  3BC9 A;  4XON A;  4C9Y A;  3MKY B;  1OB0 A;  2R7U A;  2UVE A;  1OOC A;  3OR2 C;  3FBN B;  2IS6 A;  1Y6I A;  3OWT A;  4E7J A;  1KCC A;  1HZE A;  2ZFU A;  2CV0 A;  4II3 A;  1X1C A;  4C2T A;  1J09 A;  3OYJ A;  1SFK A;  2ZTN A;  2Q1Z B;  1Z3Y A;  3OAA A;  1PYV A;  2W00 A;  1VBL A;  2CMP A;  2VQG A;  4XOP A;  4URR A;  1LDK B;  2WAQ A;  2WPD A;  1MNE A;  3RPU D;  2MD0 A;  5CQG A;  4BGD A;  3OE7 A;  4PMH A;  4YRV A;  4GQN A;  4W8T A;  3ONQ A;  4IX7 A;  1O8F A;  4HNT A;  2LRE A;  2PYH A;  1W9X A;  5HVQ C;  4ZDP A;  2ZXI A;  2E1M B;  2WAD A;  4Y33 A;  3VSK A;  4E7L A;  2WZP P;  2QKL B;  2WY7 Q;  1V5G A;  2Y0S A;  3K4L A;  3A2K A;  1SAU A;  1DP3 A;  1VJS A;  4PFO A;  2UVF A;  4XM3 A;  3CP2 A;  2GOX B;  3ZR8 X;  3FDY A;  2XC7 A;  5CDF A;  4F91 B;  3QYF A;  4BQN A;  2GJP A;  3SEZ A;  1HVX A;  1DGR M;  5CKT A;  4P1W A;  4B3X A;  3GQ7 A;  2M3A A;  1MMA A;  2VQL A;  1I18 A;  2V9K A;  2K9L A;  2HU9 A;  2NTP A;  1LFP A;  3KX2 A;  2E60 A;  1DGW Y;  2WAF A;  1K6Y A;  2HPI A;  2HLD A;  4F93 B;  3OYA A;  3LMM A;  4LG3 A;  3S3M A;  2XF5 A;  4ZDL A;  1NBM A;  5CQE A;  1NHC A;  2O5R A;  3PSF A;  3IP4 B;  1UEL B;  4JMQ A;  3L2Q A;  4Z1M A;  1WJ5 A;  2LBF A;  4RLQ A;  4E7H A;  1W36 D;  4G7X A;  4YEL A;  4XKV A;  5IK2 A;  3OPO A;  2LC2 A;  4DNT B;  2M4K A;  3FKJ A;  2DOA A;  2DXI A;  3T53 B;  4BQQ A;  4J01 A;  3KEW A;  4IQJ A;  3DKX A;  3LL7 A;  4B47 A;  3FPP A;  3WQZ A;  2O0W A;  1WMR A;  4MXN A;  3H5A A;  2X6Y A;  3CF2 A;  3ZXS A;  3SYT A;  2X6X A;  1RWR A;  4BS9 A;  2BSP A;  2AQF A;  3OFN A;  3AL0 B;  3B90 A;  4BAC A;  1E43 A;  2PEC A;  1W36 C;  4AYB A;  3CJQ B;  1N77 A;  3MKZ A;  2PMZ A;  3BG7 A;  4XLH A;  2KVO A;  2V7Q A;  2OC6 A;  2R7Q A;  4NQW B;  1X19 A;  2WAE A;  1BR2 A;  3L2U A;  3QYE A;  1ERD A;  2DT7 B;  2JA2 A;  2V4J C;  3H5R A;  3GRH A;  4JOM A;  4BE1 A;  3DTK A;  4QPQ A;  1IRX A;  4ZJZ A;  2UUZ A;  1WFX A;  2X85 A;  3LSM A;  4AU7 A;  4DOZ A;  3OL3 A;  4KKT A;  2L9N A;  3PNT A;  4HPQ A;  3E0J B;  4XLF A;  3DLA A;  3FBI B;  2W6J A;  2VJ5 A;  1MW7 A;  1O8H A;  1PLU A;  4YZA A;  3BCF A;  2O17 A;  4XMY A;  4DGW B;  5FRN A;  2GJK A;  2MAB A;  2VBE A;  4FET A;  3FHN A;  1EE6 A;  2XSJ C;  3RCO A;  5AMV A;  2X51 A;  4OWR B;  3NWT A;  3K6G A;  1U0J A;  3VYT B;  3LFU A;  1BOB A;  4XN0 A;  5KHD A;  2X3H A;  1O8G A;  2ELJ A;  4BQO A;  4RM3 A;  2XZL A;  2KP6 A;  1DQU A;  2WY8 Q;  3HUG B;  2NTB A;  2LY1 A;  1UG0 A;  2V7F A;  3ZRG A;  2CK3 A;  4XOT A;  3VSL A;  3VST A;  2AQE A;  2RRE A;  1O8I A;  4KJZ A;  3ZSC A;  4BJ5 C;  1K5C A;  2MYS A;  4XKC A;  3UNG C;  2W1O A;  3UR3 C;  5FL7 A;  4B43 A;  4F3Q A;  3HPG A;  3H0D A;  1QU3 A;  2IQ7 A;  1VZ0 A;  3IAS 2;  4CCN A;  2XZP A;  3OL4 A;  2HNH A;  3PNY A;  2A6T A;  3F9K A;  5FRO A;  4OZY A;  3OYG A;  1V0F A;  4NK8 A;  4BL0 B;  3G05 A;  1KZL A;  1PE9 A;  3DTE A;  4E7S A;  5C1C A;  1IB4 A;  2KRC A;  3CES A;  2R7T A;  4YZQ A;  3OYC A;  2XOK A;  1S9H A;  2VXD A;  1BMF A;  1IA5 A;  4UZU A;  4ZYA A;  3QOE A;  4F52 A;  3AFH A;  3BH4 A;  3HL2 A;  3OMY A;  1UD4 A;  1FMW A;  3HG9 A;  3CJR B;  4BE0 A;  4XLC A;  4F55 A;  3EUA A;  3B8Y A;  3HPH A;  1Z21 A;  4U4B A;  3DWL E;  3D5S C;  3TMO A;  3PSI A;  3VSU A;  3DQV C;  1KMH A;  2W6I A;  4L8J A;  2PJR B;  1O8M A;  3KEY A;  2VIX A;  1AIR A;  2D3N A;  3W2V A;  1RMG A;  3MMY B;  2X8K A;  1WJE A;  3NWS A;  3OYI A;  2NST A;  1MMG A;  4B48 A;  1V0E A;  2R7O A;  4E0F A;  4QPO A;  3C2H A;  4YEJ A;  2I8D A;  3I3L A;  4I84 A;  3AKZ A;  1UD5 A;  1D0Z A;  2E1B A;  4X0G A;  4ANJ A;  3NE5 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...