4YEJA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
molecule keywords Tail spike protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yejA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yejA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yejA02
2VJJA 2NT6A 3WWGA 3VMVA 1X0CA 4XM3A 2VBEA 1KTWA 4PMHA 4NK8A 2Z8GA 4NK6A 3VMWA 2UVFA 1BN8A 1K5CA 2NZMA 4XORA 4W8TA 4YZAA 3T9GA 4OZZA 3ZPPA 3B90A 1BHEA 4YZXA 1CZFA 1RMGA 2VBKA 4W8RA 4XNFA 2INVA 4W8SA 1O8EA 4XMYA 4XL9A 4XLHA 1OFLA 2O1DA 3VSUA 2QXZA 4I84A 4YZQA 4AVZA 3VSTA 5C1EA 4XKWA 3SUCA 1O8KA 2NTPA 4Z03A 3GRHA 4YZ0A 1O8GA 4XLAA 1VBLA 2X85A 1IDKA 2O0VA 1AIRA 1RWRA 1OFMA 4XOPA 4YEJA 4OJ6A 1PE9A 1PLUA 4OJOA 2QY1A 2PYGA 3KRGA 1DBGA 3FY3A 4URRA 1O8IA 5C1CA 1QJVA 1HG8A 3GQ8A 1OGMX 2INUA 1O8LA 4U4BA 3GQ7A 1GQ8A 1JTAA 1KCCA 2PECA 4YELA 4XONA 4Z05A 2O17A 2QX3A 3EQNA 3UW0A 4Z06A 4U49A 1KCDA 4XQFA 5AMVA 4XLCA 4XN0A 3VSVA 2PYHA 4XLEA 1OOCA 1WMRA 4EW9A 2NTBA 4MR0A 2NSPA 3GQ9A 4OZYA 1IA5A 3B4NA 1NHCA 2EWEA 1O8MA 2IQ7A 2O0WA 1EE6A 1H80A 4XLFA 2NT9A 4MXNA 4OJPA 1IDJA 1O8HA 2NSTA 4XN3A 1PXZA 2X6YA 1O8DA 1XG2A 2X6XA 4XR6A 1QCXA 3B8YA 2BSPA 2VJIA 2X6WA 1JRGA 1O8JA 4W8QA 1IB4A 4HWVA 2O04A 2NTQA 1DBOA 1O88A 4C2LA 4OJ5A 2UVEA 3LMWA 3JURA 4OJLA 3ZSCA 1O8FA 2ODLA 1RU4A 3EQOA 3GQAA 4XKVA 2X3HA 1OGOX 2VBMA 4XOTA
chains in the Genus database with same CATH superfamily
2R6HA 1D1CA 1OR7C 3I54A 2V6EA 1S0UA 2VT3A 1ZRDA 1XG1A 3F21A 2M0CA 4NK8A 1I3AA 3JTGA 2RC5A 3QAHA 4LOCA 2E71A 2L2OA 1FP2A 2JN6A 1J9ZA 1A31A 2DA1A 2NVYJ 3SXYA 2VT2A 3J81K 3C1DA 4A3DJ 4WZEA 1LPQA 1YX2A 1VQ4B 2HQNA 5HKKA 4J01A 3D5RC 3K2AA 4Z1MA 2R7ZJ 4HZFA 1J7KA 2COMA 5FD6A 4D1QA 1G4DA 2QDXA 1YX3A 2WPDA 1RQRA 4YXWA 3W2EA 5L3FA 2E1CA 1LQ1A 1HC8A 2H6CA 5GTIC 3TBIA 2VNHA 4ZGQB 4NC6A 2HOAA 3QYBA 2DA2A 4HAMA 5J4YA 1Y6IA 5DNSA 4TMVA 5THXA 3HRSA 1FYMA 2G9WA 4II3A 1KQ8A 4ZCIA 4CGZA 4EJOA 1ZM3A 3GTMJ 4RJLA 2BY3A 3FK7A 2K4JA 1N08A 4YZ0A 3G6EB 1W35A 3P5JA 5KHDA 1VBLA 3JRFA 2D1VA 4G6QA 1JUPA 4U7DA 3RIQA 3SDBA 4YFXF 3PNVA 4BQAA 4M4SA 3J81k 1ETOA 2DW4A 2AO9A 2BM5A 1J59A 3CD6B 4LITA 3BTLA 3I5UA 1VI0A 4WF2A 3G3ZA 2VQHA 3B6AA 1X1BA 2EIKH 3F6VA 3CCRI 2O8KA 3GTPJ 3FHNA 1EXMA 5FKOA 2E1BA 4WZLA 4I98B 3GQ7A 1BJAA 1SD6A 3F23A 1SC7A 1T6SA 3PFYA 2PE3A 1E62A 2PECA 4OOIA 2ME0A 2L3DA 3BQYA 1LE8B 3BY6A 2E7WA 2HQAA 3CB4A 1EFTA 1IAWA 2V1UA 4EVIA 3CCSB 1MMDA 5F0CA 2PYHA 2XAFA 4BU2A 2HDCA 4X05A 2CYYA 3QU6A 1QFJA 1HKTA 3ABLH 2KZGA 4L0ZB 2O0WA 2OCCH 3PNTA 2CQKA 3I56B 3K0LA 1POGA 4X6AJ 2NOJB 3CZ6A 4HSRA 3Q0UA 4XIDA 3TW7A 2QBYA 2HWVA 4BBRJ 3ZMVA 1EFUA 5FA6A 2ZZQA 2Z3YA 4LIVA 1W36C 3I3LA 3AVXA 3H09A 1T08B 5GAEJ 4UY8I 4JX5A 4HLYA 1QA6A 1EH7A 2R7UA 2WY8Q 4RPDA 4B48A 2DK5A 2ZJQF 4N0BA 1FOWA 3DU6A 3V8LA 5H6RA 3CCVI 1AU7A 3C2BA 3CC4B 3FXKA 3KP2A 1WI9A 3K1NA 2NTQA 2RAEA 1T6ZA 4AIJA 1W0UA 3SJZA 4QIWN 3E3VA 2L7MP 4L9JA 1AKHA 3OL4A 1WGXA 3DKYA 2HQ5A 3K7AJ 5JVGF 1LEAA 3SZGA 4A3EJ 3HB9A 4DQ2A 4NQWB 3WNCA 1U5TC 3CDLA 5J40A 3EETA 4U7BA 5J4VA 3FM5A 2LBFB 2DA3A 5HDNA 3GZ6A 2C2WA 2ZZEA 2KIMA 2PMZN 3KYLA 2XNJA 3DEEA 1ZTRA 1IN5A 1W0JA 3HM5A 1G3TA 2M9HA 1RKWA 2FOKA 3F3XA 2LTPA 1TWHJ 5FLMJ 4HOBA 4ZCLA 1K5CA 1WOPA 3CCMI 3PSZA 2PJRA 2E5ZA 3IKTA 3NB2A 3A35A 2NS8A 1LEBA 4LG0A 1WFXA 3B90A 4IPAA 1I18A 4BE1A 1VQ7I 2R93J 3A1YA 1WH5A 4UNOA 4LG3A 4GXOA 3ZPLA 1VQOB 3H0GJ 2K40A 4D0PA 2LR8A 1JA0A 3HDDA 3KEQA 4AD9A 2MSYA 4NHJA 2CW0F 4P6YA 1TQMA 3TKYA 3GEZA 4BXUA 4QPQA 4L0YB 2Z6BD 3PUMA 3ZQ7A 3O8HA 2ZBUA 4KKUA 4U0WA 4RDUA 4HEA2 5CLSA 4WWCA 5TR9A 1TVCA 2IA1A 4CYCA 2ZO4A 5HZAA 5A2QZ 3L2CA 3SUCA 2E1MC 3U1DA 1J5YA 3ERED 2D5VA 5F4OA 2W57A 3H35A 1FC3A 2CWEA 3PA1A 4RD2A 1TQPA 3JQPA 4X7EA 4KIGA 4UVAA 2F6CA 3BY1A 4JYKA 1H8EA 4HF2A 4PGHA 5KAIC 4HW0A 4W1UA 1RUOA 4OJ6A 3PQKA 3G73A 1F1ZA 3K69A 2CRGA 2OBRA 3GCMA 3W6KB 2LNBA 2MBFA 5TV2A 2Q6KA 3OIPA 1EFRA 3LSMA 1I50J 2GXGA 1AWCA 5F0HA 2XT2A 1FOXA 4RB2C 4LLLA 3HOUJ 1A35A 4TSFA 1YS6A 4A6EA 1GV2A 3MMPA 1OFEA 1TC3C 4E7JA 2FSWA 4HF1A 3GFJA 3LQRA 3IAS2 3DF8A 2IA0A 2LLKA 3HGGA 1HKSA 1GT0C 1V0EA 1TLHB 3I4PA 2WV0A 2GIZA 4HNVA 3OEHA 1W7PA 3HPGA 2GXAA 3ZXSA 1GUUA 4G7XA 4CCMA 1AA7A 2VQGA 1KZLA 3HOTA 3FXMA 5FROA 1H8AC 4IHVA 1YQAA 4WCGA 1O3SA 1T8IA 4Z4ZA 3E20A 1AOYA 2DERA 1JHFA 1YI2B 1R5GA 2VASA 1EH6A 4XRFA 3BH6B 3WTWC 1SKQA 3DV8A 2VKVA 2VE9A 1BR4A 4XR6A 2O5RA 3CCJI 4ENNA 3W2IA 1ZG1A 2VOPA 2GJKA 3BNWA 1VQ5B 1TYUA 4FK8A 1K73D 3TGNA 3OS2A 1OHHA 3ZOBA 2IOUG 2BZTA 2BVLA 4O6JA 5LMZA 1IC8A 1LDJA 3TO9A 1MRZA 3VR6A 3H5AA 4DNCA 1Z7UA 1ORKA 2W24A 1IN8A 4B47A 2ZTGA 3BCBA 3ASSA 3WTYC 3RY8A 2DFHA 3ULQB 1QH0A 1MD0A 4N3NA 3B6CA 1P2FA 1MH3A 3W3CA 1APLC 3QWLA 5J8FA 4KN4X 3TW6A 3FXQA 5B3SH 1YJWI 4A0YA 2V26A 2NT6A 2FU4A 2BHYA 2R92J 4RLQA 2QM3A 4F52A 1B6AA 4QVJA 1OLTA 5KW9A 2EV0A 1ZK8A 3I55I 2B63J 2RV8A 4YFNF 2L7ZA 1G7TA 2VFMA 2CQQA 5FRNA 4IZZA 4X7DA 4NK6A 1ZKGA 4U0YA 1YITI 5IYDJ 3S1QJ 2VE8A 4XORA 3GBGA 2R0QC 3ZQHA 3T9GA 1Y39A 1JKQC 4JX6A 1ZM9A 2NVQJ 4ZH4F 4KICA 4DBRA 3L2QA 1WPCA 4AYBN 4XSZF 1LNWA 3BT9A 3A3GA 2V7XA 4ZDPA 4NDLA 5GADJ 3KP4A 3LAPA 1H0MA 5AIPA 3ZN1A 3V7RA 1TWFJ 3OYIA 3J7ZI 2PG4A 5C44J 2RDPA 2VBZA 2JA7J 1QUFA 4RM2A 1T33A 3CDHA 1HSJA 1VNDA 1FSHA 2XAQA 2OTLI 4XKWA 2QYOA 1I5ZA 2Y31A 2B0LA 3DCFA 5EDNA 3KE2A 2RC4A 3M1CA 3JREA 4ENKA 4C30A 2BGCA 3RSNA 2FD5A 1XTAA 2DJNA 1UHWA 2X85A 2MW8A 3BROA 5M5YJ 1WJAA 3MAJA 2YWGA 2O0VA 3I58A 1P7IA 3ZQFA 4IHXA 2BV3A 4KH3A 2R7QA 2ZXHA 4UVBA 4MNUA 3KCCA 3G1OA 4IQ4A 5K7FA 1HW1A 1U6GA 2QEXB 3A8KA 1K6YA 3UR3C 2VBMA 2LKXA 3CESA 1ETWA 1T0FA 2CG4A 5CPRB 1KK0A 3S1MJ 1QUEA 5C1CA 2OJED 4YIRX 2XROA 1RC9A 9ANTA 1GHCA 3F72A 3P9IA 1E1RA 2DYSH 2VZLA 3BH7B 1XC5A 2JMWA 4GCVA 4RDLA 2J8KA 1CQTA 2LFBA 4ZZDA 1ZUNB 2P81A 3VYRB 4EV0A 3QE2A 4QUZA 3B78A 1LLWA 1DP3A 2V9VA 3HOYJ 3RKYA 3G71I 1KCDA 2HYFA 1W2BB 2CV0A 2JRMA 4XN0A 1E0EA 1P6RA 2MLGA 2X0LA 1LFBA 1JA1A 2RREA 1IA5A 4PC3A 1SVOA 2P8TA 3TO6A 2OTJB 4XLFA 3KPHA 3WNBA 2IBDA 3GVKA 4MXNA 3A0BC 2FBHA 1O8HA 2R5YB 2XNCA 2QZ8A 2DMPA 3JAMZ 1Y1WJ 3W2VA 3GYHX 1FBQA 3CDIA 4FE4A 2V5IA 1ZREA 2YR2A 1I3QJ 4IEJA 3KLOA 4XK4A 5DEQA 4BEHA 4RCZA 2VJIA 4A0ZA 2KLOA 1Q7YD 1QA2A 2CU7A 5TY0A 2W4SA 2P6SA 4LK1F 4CSWA 3NAWA 3JRCA 3BR3A 1CNEA 2IXSA 1IXCA 2UZKA 4E7LA 2FF4A 4OJLA 3LMWA 2STWA 3R6SA 3ISPA 2DIEA 4BS9A 2O61A 2ODLA 1SFEA 4UHTA 1IHMA 4TN1A 2MH9A 3GZ5A 3S3MA 3W2AA 2FRHA 1B2RA 4UUVA 3OYJA 2F4NA 2XIGA 2DYRH 2VJJA 3CUQC 2Y0SN 1RPWA 2I5UA 2VIXA 1X0CA 1XGMA 3QPSA 3WTUC 1O3TA 2XF6A 5ICCA 3CMEI 5IYQA 1LM1A 5JHFA 1JTXA 5CJ9A 5F4JA 1K79A 3OYNA 5D5UB 3WE3A 1QFYA 5DUIA 3JRHA 4I6ZA 3E5QA 2KP6A 1Z67A 3OIOA 5HDGA 3DWLE 5IT9Z 2WSSA 1BJZA 2CQNA 3A2KA 1MABA 2BYVE 2ELJA 3R4KA 2K3FA 1IN7A 1G7RA 3BTCA 3S2WA 2P4WA 3UKGA 4YCQA 3ASOH 1ACIA 2OQGA 5CVIA 2KT0A 2JRTA 3PETA 5D8KB 4DOZA 2LRDA 4RGUA 2KDZA 2WJYA 1WJCA 1OFLA 3S8PA 2CUZA 4KDPA 1WJBA 1TT5B 2CW7A 4DNTB 3ASRA 4AVZA 1XPXA 2RNGA 3F9KA 3TH0A 2A6TA 2WV1A 3Q5FA 4C2TA 2WB1N 4IJAA 2LKPA 1Y56A 4BDZA 5DV5A 4I02A 3GTQJ 1VHOA 4PC6A 1PYVA 3JRDA 5FO0A 4LLGF 2FNAA 2PJPA 5BSXA 3W2WA 4ZYHA 1FOYA 2KL4A 3C2GA 1AIRA 3B82A 2W00A 4WZTA 4OIQF 3CUQB 2GJRA 1ELOA 3I1FA 5DDGA 4BE2A 2ZITA 2CQXA 3G4SB 4N9HA 4IF4A 3FIWA 1G3WA 3BG9A 3T1BA 3CLOA 5EJCA 4A0XA 3OS0A 3E6CC 5J3LA 3JX8A 1HG8A 2LZJA 1Z6RA 3OMYA 2ID3A 2XAHA 4I2OA 2HOSA 1DARA 3JQRA 1W5SA 4A3IJ 2VKEA 2OK7A 1GQ8A 4Y4RA 4D7MA 4HX4A 3V7SA 3A1PA 3SJMA 4LBVA 2DLLA 4JRAC 3E1SA 4Y52J 2OZUA 1ONVA 3DP7A 1SVMA 2QYUA 1BR2A 1YI2I 3BG3A 3K70D 3W2GA 1BX1A 3ZQQA 4HPQA 4M6VA 2LC2A 3VODA 3CCEI 2ECBA 1T39A 1Y1VJ 2ZFWA 1R7JA 1Z05A 2AXLA 1YRNA 1P4XA 3BH4A 1R5NA 3IWZA 3ONQA 3QU3A 4F93B 1Z91A 2EV6A 2IGKA 1KYWA 3NE5B 2VBTA 3BR5A 1ZH5A 5KVRA 1FPQA 3EQLF 3AG4H 4KISA 2X6YA 1O8DA 3BG5A 1X4PA 2ID6A 2X6XA 4CHUA 4RLZA 2K85A 3CO7C 2XRLA 4XLNF 3CJNA 4ZZLA 2KJBA 1BC8C 1RQPA 2X6WA 1V54H 5L3CA 3PQJA 4DIQA 3SZTA 4G94A 2A3SA 4YAFA 3TP0A 4EJVA 2LYCA 3W5HA 3L7WA 2UVEA 2EZLA 5GAGJ 2KIFA 2ISZA 3RKWA 2DXIA 3BPXA 1IDZA 1I8DA 1B9MA 4XOTA 1I6XA 4BUPA 2FMLA 1C0WA 3VMVA 3FMSA 1BBYA 3SDGA 1VHEA 3I56I 1WDTA 2KZVA 1EZGA 4AU7A 1WOOA 4X06A 3SEJA 2MD5A 5AONA 1PP7U 2JWTA 4DK1A 4A5MA 2ETHA 3MKYB 4V2FA 1I1SA 2LY9A 1A36A 2UVFA 1XGOA 3DPUA 2NZMA 4ASNA 5BPDA 1QQIA 1QVFB 2EB7A 1LE8A 1QZYA 2NPFA 1MNDA 2X1EA 3GSIA 4HX7A 1DGRM 5LHIA 1QGYA 4HA8A 4XNFA 1UELB 4ZDOA 2INVA 4M72A 3QFTA 3GUDA 3BCDA 4YFKF 4U87A 4XRMA 3LFUA 2H27A 5F04A 1DPUA 5LHGA 3R6JA 4DGWB 2QQBA 3IWFA 4R8HA 3WE2A 4IHTA 3T0YA 3QQAA 4QHYA 1Q1VA 1Z7LA 2ZJ2A 2IPQX 1TW2A 3K4KA 2VONA 2DA5A 3DKXA 3LNQA 2HFHA 3QPTA 2B7CA 1IXSB 3WNDA 4M74A 3M3YJ 2DETA 4CICA 4I76A 1ZHFA 4TMWA 2QWWA 1U5TB 4N4OB 1QVGB 3H9GA 1Y0NA 4BJTA 2V7UA 5E8GA 2HU9A 1S7OA 4MFDA 2VKDA 4P9FA 1QVUA 5A2QK 1TUIA 2XPWA 1R5OA 4GYIA 2P3MA 3K70C 2E2JJ 4A69C 4I01A 2VC1A 1IN6A 3IAM2 1E3OC 2HTSA 4PC1A 2JA2A 5FFZA 2XZOA 2QN6A 2FVGA 1L3LA 2JVGA 1O8LA 4V2GA 1YYVA 1X19A 2JSPA 2WWYA 1MSEC 1YW7A 3DLAA 3VNVA 3GIRA 2MC3A 4PK4A 1D1BA 1WPKA 5ILSA 4GYGA 2DO7A 1KZHA 2VQCA 1TP4A 4UZEA 1ERDA 4ZC3A 2L7FP 3HIFA 2EA4A 2MGQA 4L5EA 4HX8A 4MFEA 1F43A 4EJWA 4RDJA 1A6IA 3G05A 5E3MA 5K5QA 1E79A 1OYWA 5IP6A 1F5TA 4NC8A 1VQLB 3HZJA 2NXNB 1DDNA 2IJLA 2EWEA 1Q81D 3PM1A 4ASUA 1N75A 1MMSA 1GVDA 2IA2A 3Q3AA 1UCRA 2E35A 2XGXA 4UB8C 5IOZA 2Y0MA 5JLVC 2QQ8A 1FWZA 5M5XJ 4BNCA 3CUQA 2QENA 4L9VA 1IJFA 5K7HA 2EJRA 5EZHA 4OP7A 1Z3YA 4RD3A 4G7HF 4Q4ZF 3OYBA 2DMNA 1EJ9A 3K6GA 5EGOA 3OYEA 3L2RA 1BOAA 2L4MA 5DD8A 3HPHA 2IS6A 2OBPA 1NBMA 3D26A 2LKSA 2W7NA 2NV4A 3BC9A 5F6FA 3PUFA 4EGYA 1KA8A 1K7AA 3IV5A 2XASA 2VN2A 4NCNA 4BH9A 1GO2A 3BCFA 3DQVC 1FIPA 3H5NA 2X3HA 3N90A 1VF9A 4B3XA 2CUEA 2KDOA 2LREA 2B7EA 3BZCA 1H42A 1FNMA 1KGSA 2NS7A 3JTHA 5GTHC 1KTWA 4FHTA 2DPDA 2E34A 3C7JA 3PVDA 2X1CA 2CUJA 3KFWX 3J80Z 1MBGA 4MQ9F 3PJRA 1BN8A 1MDMA 3BR1A 4M71A 4BL0B 2CUFA 2OD5A 5HODA 2XHKA 2JA5J 1MW7A 1TWCJ 2QUFA 3I53A 1SAUA 1G7SA 1Y8RB 2DT5A 1COWA 2OU2A 4WK8F 2GA1A 2VC0A 2PIAA 4A93J 2V79A 1KYZA 2DT6A 4B43A 3L9FA 1NB9A 4G5GA 2CS3A 4QLCU 1OB5A 3ELKA 2FQ3A 4XMYA 2CC2A 2DCEA 2XKOA 2ZJPF 3OE7A 4IRGA 5BS6A 2G0YA 3HYIA 1Y0YA 3PUNA 3SKBA 2HR3A 4LD5A 2K86A 1P4AA 3ONYA 3QOEA 1O57A 2FBKA 2Y0SA 1O8KA 5HLIA 3VEPA 2XOKA 1SMTA 2XGDA 2QEXI 2HOEA 4JQFA 2H09A 2HS5A 2CJJA 1ETVA 3ABMH 1RI7A 3F6OA 3S3NA 2W6JA 2V7WA 4XKCA 1K61A 1FOKA 4R1HA 1SAXA 4I7HA 1BA5A 1IXRC 2XKPA 5LGNA 2O03A 3TOBA 1V5VA 4PABA 1VQ9I 1FX7A 4ZTFA 3ONUA 3DTEA 3AGPA 5CQGA 2OTLB 2JPBA 1R71A 3SJPA 1QJVA 2DMQA 2OBSA 2EK5A 3S32A 3AKZA 3B8HA 1E3HA 1GAWA 3B73A 1B1BA 3CW2A 5E6TA 1QGPA 5K1YA 4H9GA 5KAFC 2X53S 2BXYA 4F55A 3U6BA 3VSVA 3LSKA 1BOBA 2DK8A 2BXZA 4Z4TA 2PMDA 1U2RA 5BSYA 3ZZTA 1Q86D 1EP1B 3A3BA 1FTTA 1KC8D 1VQNB 2LSOA 1H80A 3OYKA 3R0AA 1QNTA 3KP7A 2HNHA 1U5TA 5A89A 1XN7A 2WTEA 2NSTA 3VPRA 1S8NA 2M2EA 2XGCA 5DCMB 2E2HJ 1X3ZB 1EA3A 1U0JA 2VPRA 4KITB 4JMQA 3LO8A 5GAHJ 2FJ1A 2XC1A 3RDIA 3OL3A 3G2BA 4PJLA 2LVSA 1VQ8B 1WJDA 3LQEA 4GGGA 3WQZA 4A6DA 1DBOA 2M5WA 4QSHA 1XS9A 1G3YA 1MBEA 1QZZA 1S6LA 3QSYA 3ASQA 1D0XA 5JFRA 4EGZA 3OZWA 2GK6A 3SLDA 1PDNC 1KD1D 4IXAA 4WX9A 2LF8A 1O8FA 3H3UA 3Q3SA 4AC0A 3GMEA 3OZUA 4XD7A 2J8IA 2QA4I 4H0EA 2BM1A 3D1NI 3FKSA 2OAZA 1HF2A 2CFOA 3G1LA 2PMUA 1D0ZA 1E63A 1MJ9A 5TJJA 3NQOA 4OM9A 1XMXA 1ULYA 3HSEA 1WP6A 5IY5H 1P4MA 4Z4RA 2WYRA 4YDTA 4DYCA 4U88A 1UHMA 2DT7B 2Z9OA 2HDWA 2DI3A 2PX9A 3KYDB 3Q9SA 4AF7A 4OIRF 2OQRA 1UMKA 4YEIA 2VBKA 1U9NA 4Y13A 2PLFA 2QE7A 4FX4A 2PBIA 2IGNA 4RAZA 3REOA 2EINH 3FZVA 2EFNA 3LA3A 3CRZA 1KRHA 5JHUA 3K1PA 4M3EA 1EP3B 1YO5C 5LRRA 1F60A 4RS8A 2ZCWA 2FBIA 1X2NA 3P9KA 2R5YA 4M3FA 1YFHA 3BJ6A 1FLIA 4D9JA 1WZ2A 2CH0A 2DFEA 5FD5A 3SQNA 2XSDC 2XPUA 3CC4I 2WC2A 3X2QH 3GRHA 4BEHB 3OYFA 4ZYAA 4I09A 2KJCA 4A12A 5IYRA 1YJWB 2XDVA 4XLAA 2VXDA 4R79A 2VFPA 4N4NB 1TLLA 3AGQA 3A8JA 1IRZA 2NYXA 3AVYA 2M8EA 2UUZA 2Y69H 2L5QA 3A01B 4PJ0C 2VXZA 4KUMA 3IRRA 1R49A 1G59A 2KIUA 2DQLA 1MDMB 1W34A 1NG6A 3ZZ0A 2FEZA 3GW2A 4PJMA 2K3PA 5IYWA 2ISYA 1BI0A 2MABA 4BACA 2X51A 5HNFA 1E64A 4CQJA 4J0QA 1P9QC 1QQ1A 3GVJA 2NVTJ 2VI6A 1OISA 1OGMX 4L18B 5IYCJ 3CCSI 1X3UA 4KT5C 1KCCA 2BW3A 2M4GA 1AMOA 3HUGA 4X0GA 1ETYA 3E0JB 5J1RA 2O17A 3IH2A 4LJZF 5AIQA 3UW0A 4H4KC 1XDUA 2XZPA 2DU9A 2WAQN 2A69F 3Q9VA 5FKMA 2HVRA 3B02A 2F1MA 3MCZA 1R1TA 5FLXK 4XKBA 1DU0A 3CCMB 3MWMA 3C2HA 3K2ZA 5DCFA 2RGVA 3LFKA 1WCMJ 4BQOA 1B8IA 1W87A 2ECCA 3LOCA 1P4WA 3QOPA 4M2LA 4HYEA 5D5XB 4PCQA 1T6YA 3N05A 3R61A 3IUOA 1PJ5A 2F5DA 4LBZA 2M0MA 2Y9YA 3LSPA 2MC4A 3T56B 3GO5A 2TCTA 3M8EA 4X7FA 1UG0A 4FCYA 3GQBA 3RJPA 2GLOA 1TL8A 4XBFA 2F48A 2YU3A 4QPOA 5H20A 4ZTJA 4U0VA 1JB9A 2EPFA 3FXJA 5J6XA 1S72I 1YLOA 3IH3A 1V5GA 4JOMA 2ZSIB 2EH3A 3CP8A 3FXOA 1WORA 1RU4A 3PFIA 3ZRGA 3CCVB 4ZYEA 4OPSA 3K4JA 4II2A 4M3DA 2QQAA 2QA4B 5IP7J 1Y0UA 2Q2EA 4CDGA 2BGJA 1XMKA 3AVUA 3KP5A 4OAZA 1OGJA 2V7FA 1OFMA 2ZTNA 1M1EB 2GWRA 2A6HF 4PUSA 1HKQA 3GXOA 3HHGA 3WGHA 3T51B 4RB1A 1QRCA 4G9YA 4ZDLA 5L3EA 5DN6A 5IPAA 3S93A 4OINF 2DODA 1HVXA 3ES9A 3V7CA 3RQ4A 4OZZA 3OS1A 2M34A 1USSA 2ZJRF 2HPMA 2RN7A 4GFBA 2JZYA 1IUYA 1G2HA 4MTDA 1Q1HA 5E3NA 1G3SA 2XUBA 3DBHB 4X1EA 3SYTA 1N25A 1R22A 4OAYA 3RZDJ 2O9LA 2FXAA 5TRDA 1YW8A 2YUHA 5LD2C 4FETA 1KONA 5EYRA 4I84A 4CYDA 1JUMA 3NAUA 2O0YA 4Y17A 1EWYA 2RC6A 1NK3P 2HVSA 3HC7A 2HEOA 1R23A 3G1MA 4BXXJ 2EIMH 3HOWJ 1W5CC 1WJFA 2V4JC 2B5OA 3CTAA 4YHBA 2IEKA 4UUTA 1X1AA 2R4GA 1JJ8C 4NBQA 5FGMA 4A3CJ 3OV8A 4ON0A 4A3FJ 2M7BA 2ZMEC 1K78A 1UMQA 1MIJA 1GR1A 2JJ7A 1IDKA 3D0SA 3OOCA 3L2VA 3OW7A 3H92A 3JAMK 1B72B 2N8GA 3EUHC 3OKXA 2F2EA 2HDNB 5GPAA 3WBKA 4Z4WA 1ZARA 2KPMA 3S15J 4ACBA 1FBSA 1OCRH 4FASD 2FQ4A 2M87A 4GDFA 5LFAA 1ZG3A 1T38A 1O8IA 2E1RA 4MO7A 2Q6IA 1DDGA 2ZMEA 2DOFA 2INUA 3J7AO 2RVCA 4U4BA 3EPZA 3FF5A 5F1JA 3DXJF 1JTAA 4KT6A 4RGXA 3HKZA 4C43A 3QYFA 1XB2A 1YE9A 4WQMA 3EQNA 3AAFA 5CKTA 3AG3H 5JVTA 3L09A 3AFHA 4Z06A 1Z21A 3MN2A 5AMVA 1OFCX 1QPMA 2V7VA 2HZDA 4GQNA 2H1KA 3ZQIA 3QODA 4XICA 3ZMSA 3V8JA 1VQ6I 3HHHA 4URRA 2EA2A 1NHCA 4RAGA 1JKOC 4P3YA 2ZNZA 4HQMA 5D6EA 3N6ZA 2PQ8A 4HBLA 1IZ1A 2EWNA 1UAAA 1EA0A 4YALA 5IK2A 5KSWB 4PC7A 1R6RA 2YUSA 3OYLA 1LJ9A 1ZRCA 5JI6A 1H9GA 1YTYA 1W36D 1ZRFA 2LOOA 4B3GA 2BSPA 3RQIA 1IG7A 1R4MB 3MFKA 2XTYA 3RPUA 4UB6C 4RDKA 4V19K 1PUFA 2FX3A 1OB2A 2DN0A 1JE8A 2PN6A 2BW3B 4BYYA 2HQRA 5E1WA 1U2WA 2PFBA 1YJ9I 1LKXA 1OGOX 2W85A 1F4KA 2Z1DA 1OPCA 2ZZGA 2HXIA 3G6EI 4IHSA 1TQIA 3PSFA 4RGSA 4DBQA 4O3MA 1VQ9B 2AQEA 1BW5A 4BXFA 4X07A 4QV2A 1ZGAA 2HMAA 2VBEA 1V55H 4UAJA 1I6HJ 3H3ZA 3F0CA 1N07A 4E7ZA 5K5RA 1ITYA 4BAYA 3HL2A 4L5IA 5BQTA 2VBYA 3HRUA 3FJOA 4YC5A 2ZSHB 3SEQA 4EJUA 3ASNH 2ZZFA 4HG2A 1L1IA 3JSPA 3KZZA 5FNZA 4W8RA 2V6CA 1JI8A 5K7ZA 4A3BJ 4LC0A 3CXCB 4D5FA 3L00A 1J0RA 4XL9A 4XLHA 1NB0A 3JSOA 1A8PA 1FIAA 2WBMA 3M4OJ 1VQ6B 1TYVA 1STZA 1JT6A 3TDUC 4IHYA 2QXZA 1GXQA 2LG4A 3LSJA 4YZQA 1ENHA 2D74A 1V4RA 3DFGA 3BTIA 1VQPI 2ME6A 2W25A 3AVWA 1MNMC 4ZV4A 3QPHA 1WJ5A 4PDKA 3ZP5A 3S17J 1GAQA 2DEUA 1OYYA 3BJOA 3Q6QA 1SD4A 4KJZA 3BC8A 3ZCOA 3I59A 2Y2ZA 1UZCA 2CV2A 2RQQA 1KK1A 3PSIA 3SFIA 4BHCA 1DU6A 2CV1A 1QO0D 3C3WA 3D5SC 2XB5A 1QBJA 1ON2A 3WODF 1S9HA 2O6WA 4YFOA 2K9NA 1VQKI 1EF4A 1KU3A 4BKXA 4HF0A 5ILUA 3PIOF 2BPOA 2OPTA 4RM3A 1R36A 2L9VA 4GRIA 1NJID 2DAOA 4ITVA 2EZHA 3CCLB 2RQPA 3HKZN 2QKLB 2DTRA 5EZGA 3LSGA 1FNDA 3MCAA 4YG2F 2JA6J 2PMHA 4E7SA 4OU0A 3OEEA 2F4IA 5DUKA 2B0RA 3JRAA 1VJSA 1IRXA 1FBUA 2BBYA 4UV8A 2YX7A 1DG1G 4EM2A 2C4TA 5F0FA 5EEGA 4BQQA 1BIAA 2WZPP 4J00A 2J7KA 2Y48A 1UJ8A 4P1VA 3T53B 2WJVA 3S3OA 3JRGA 3L1PA 3RTRA 2PJRB 3GX4X 3H9QA 1HDDC 4LG0B 4Y9UA 3ESWB 3CJQB 4PZJA 1BIBA 4G1BA 3K4MA 1O8MA 1ETKA 5IYBJ 2IQ7A 4KMUX 3CCUI 1Y8QB 2GBYA 1ZLJA 2JUCA 3H1CA 1YX5A 1IO2A 1IRGA 3M1EA 1YW9A 5DSZA 1PXZA 1P92A 3Q39A 2IAIA 3FMQA 2E1NA 1VQLI 3ZGKA 3LQ6A 5C3EJ 1VQPB 4Z6YA 2FA5A 3M8FA 2MYSA 2XV4S 2JQ7A 2BF4A 1BN5A 2DMTA 4UVCA 2C4UA 1ZR2A 4Q47A 1JGGA 3PA2A 3SFZA 2AQFA 1S3JA 1U3EM 3S2HJ 3OY9A 2W7ZA 3MZHA 3SZEA 4NB5A 3HOVJ 5IYPA 3GFLA 2QZAA 3IH4A 2ELKA 3FXLA 4EM0B 1UD6A 3LA7A 3RI4A 3MVPA 1R4NB 3K10A 3RPQA 1WSUA 3QP5A 3FX3A 4Q7JB 3U6KA 2IS4A 1HSTA 3NWTA 4BY7J 1WH7A 2X3UA 2XVCA 4Y7CA 1WRJA 1KK3A 4WXDA 5E20A 4TMTA 2J5OA 2JDIA 3P26A 2FUG2 5HNHA 4PMHA 4PFPA 2HI3A 3HJEA 1BJKA 2NVUB 4CCJA 3A01A 4XRSG 2NNNA 3VDXA 1KQ0A 2Y30A 1VQMI 4LB5A 3FKIJ 1O4XA 2JN9A 4W8TA 2HTJA 2PEXA 4M53A 3WGIA 4DYQA 2HKOA 3SEZA 4P9SA 3VFZA 3NARA 5HLHA 1BHEA 2BEOA 2X0KA 3BTJA 3ZMZA 2F5FA 3GWZA 1IN4A 1Q82D 1OCTC 2BOLA 2M30A 4IX7A 1LB2A 2L9NA 2QBYB 4W8SA 2F4OB 3HUGB 3I4NJ 3QFCA 5LGTA 3DU5A 3FPKA 5ICGA 1YS7A 2ZB9A 5FO5A 3JCUC 4AIDA 4NBSA 2O1DA 2MH2A 3BR6A 3VWBA 2EILH 4O5VA 1UD4A 3CCEB 3FXUA 4IVNA 4C3IJ 5DD4A 2MFZA 3RIRA 4RA2A 2BY1A 4M6XA 3T5XA 3ABUA 1W5TA 2STTA 2O3FA 2MG4A 3CPWB 1I27A 5F1RA 4RBOA 5ERIA 4E7KA 4PGOA 1XMAA 2X48A 4RCYA 1O8GA 2R7OA 4CCOA 4C0SA 4RPBA 1K8AD 2OZ6A 3CO6C 3ZBTA 4LB6B 3WHCA 1FJLA 1NRKA 5CVRA 3S1NJ 4UZFA 3KEWA 2VB6A 2QKMB 2QSGX 3J7YJ 2L54A 4YAWA 5CVVA 4EJTA 1BQEA 3CJTB 2QVOA 4CH7A 5JBQA 1S29A 4XRSA 1FY7A 4BHBA 1HBXG 1HF0A 2XGJA 3AVTA 3O2PE 3R0JA 4XONA 3BR2A 1REPC 4Z05A 2OV7A 4Z4SA 4A3LJ 3OZVA 2A05A 1UFMA 4CA0A 3QP6A 3EUKL 2L9SA 3WU1B 1HZEA 3WYAA 2CFXA 2GZWA 1O3RA 2C5HA 4HE6A 1QGZA 1VQ7B 4XLEA 3VYSB 4AIHA 1UG2A 2O6GE 3ISXA 1E3XA 2DTZA 3K4BA 1D5VA 1FNCA 1E2XA 3MMYB 3LWFA 2E19A 3CC2B 4ABZA 1XCBA 1IDJA 1TYXA 5TGTA 1BL0A 1ZN2A 2CO5A 5L3GA 1FEXA 1LVKA 2DJIA 3W5UA 3FBIB 2Z2SB 2CGPA 4S0HB 1B4AA 2E60A 2AS5F 2IRFG 3DU1X 2W1OA 1VTNC 1R58A 3WTSC 1QHHD 1AIPA 3DEWA 5L3DA 1N0UA 2BM6A 1H9TA 3Q38A 3M07A 4P96A 2B9SA 2XB0X 3J81Z 2WA0A 5BOXA 5H59A 3GTOJ 3WXMA 3EUHA 1LDKB 1FX0A 1TNSA 2K9QA 2EZKA 4OJ5A 4RD4A 3JURA 1U8BA 1EH8A 2EFPA 5EF6A 3PO3J 1SM4A 4UXNA 4P3IA 5FLVA 1MMGA 2LY2A 1B59A 3COAC 1OMIA 3ZC3A 2F3LA 1GLNA 2A5WA 1QPIA 4XM3A 1K6OA 3H94A 4M9ZA 4QWQA 2R5ZB 3RZOJ 2YWHA 3P4GA 2QMUA 1MGTA 1RR7A 2XAGA 1HLVA 3OOUA 1OCCH 2X8KA 3KZYA 4KKTA 5LBQA 3OIQA 3ECOA 5E1XA 5ICFA 4FN5A 2IS2A 1N06A 3W6VA 1WU8A 2G7HA 2A6EF 3GFIA 3E97A 1KTVA 1ETQA 5J1YA 2VL8A 1UD5A 1J2XA 2VBWA 3SQVA 4DYRA 3RYPA 4FT8A 3TOAA 2K9MA 4RD6A 4X0CA 4OOVA 3BZKA 5D4SA 4IO9F 4F91B 1LUJB 4RLFA 2M7AA 3KP6A 1S72B 4P6VF 2K27A 4A3MJ 1VQNI 2BX6A 3RCOA 1I1GA 2PI0A 2R7WA 2EFWA 3OSGA 1FZPB 3VSUA 1HDPA 1X58A 2KRHA 3I4MJ 1Q9SA 2ZL6A 5HLTA 1XDSA 4RAYA 2D9RA 3V7AA 1SFXA 2P7VB 1FNNA 1X4OA 4PSXA 2M3AA 4RM0A 3BDDA 1D5YA 2UWMA 3U1KA 2VBSA 4P26A 4Z03A 4W97A 3CD6I 1ZGWA 3OYDA 4A5NA 4YIFA 1OR7A 2K02A 5F27A 2HYGD 1RUNA 4MGRA 2HOTA 3PIPF 2OBTA 2A5YB 1XSVA 1DGWY 1ON1A 1IF1A 2P7CB 1T6XA 1PE9A 1PLUA 2YWFA 3CC2I 3KP3A 1QFZA 2QY1A 2PYGA 3BCAA 2D2WA 5F4MA 5ILVA 3GQ8A 4JX4A 2VJ5A 3OJXA 4D5CA 4AWXB 1FSEA 2Z33A 1IW7F 1PUFB 1MSFC 2VNIA 1N78A 4Y3OA 1HQCA 5BNGA 1DUXC 2R9VA 1DPRA 1WJEA 3ZQGA 3CLQA 1Z0XA 3HEFA 3RKXA 3HOSA 3I9V2 2VUMJ 3QYEA 1FRQA 4YAOA 3WHBA 2NNYA 2VFOA 2VFQA 3CCQB 4P25A 4BGDA 4G7ZF 2V9PA 3KZIC 3GTJJ 1PKVA 3CUOA 5CYVA 1O7LA 4CUGA 1ZM2A 2F1LA 4XLPF 1EP2B 3BLYA 5DS9A 2QSHX 4ESFA 1QRBA 3BP8A 3CCQI 4OMYA 1PVEA 3WU2C 3ZPNA 1K4TA 3BPVA 4M73A 1DP7P 1RESA 3TP3A 1ZLKA 2NVXJ 2ZXWH 1XGNA 5LLQA 2DMUA 2ZXJA 4S05A 1IB4A 2W84A 2R7VA 4HE5A 1ZYRF 3F8MA 5HS7A 3QFSA 1U78A 1TW3A 1TSPA 1X1PA 1NK2P 1O88A 4X8IA 1CGPA 1R5BA 4OIOF 3O8GA 4G6TB 4AM3A 3I55B 2V1DA 2QTZA 4EEFG 3FMRA 1T2KA 1D8TA 3OYMA 3ZQCA 2BGIA 1B72A 2HVQA 3GTGJ 4E6KG 2XTXA 5GV8A 3Q6RA 3WTXC 3I59B 3W5VA 1K8FA 3LNNA 1V5EA 2R7FA 1EKEA 4LIUA 1TNTA 2P6TA 1A6QA 4HNTA 5DS0A 5GPCA 2A07F 5KK1A 5EEAA 4BY1J 4CCNA 2JT1A 4YZAA 2LY1A 5FIUA 3HRTA 2VODA 1YG2A 2GK7A 1MMAA 3A8IA 1DABA 3IP4B 2ICWG 3OYAA 3CC7I 1F9NA 1FYKA 2QQ9A 2R7XA 1GJRA 4ESBA 4B1RA 4QTRA 2VNKA 1YRNB 4G6IA 5L3BA 3QFRA 4FISA 2ZKZA 4K1XA 4RB0A 2IW5A 4M1KA 3VSKA 4AIKA 2NS0A 3A0HC 2VYQA 1JGSA 1VZ0A 1HW5A 1QRYA 2Z5UA 1BI3A 1M1KD 1SKYB 2LDUA 1YIJI 3HG9A 2DOEA 1IGNA 3T8RA 1D2EA 3CJRB 1YITB 2OTJI 1RWRA 4IRIA 5IT9K 5DM6F 2LP0A 2WAFA 1H88C 1YIOA 4I0AA 4DK0A 3BG6A 2M45A 5JLXA 5HZBA 2Z16A 4Q5SF 2XT4A 2ELHA 3OYCA 3PUBA 2COBA 3K4CA 4KFCA 1D8JA 1F36A 3ASPA 5IYNA 4I99C 4L9NA 1BI1A 3CF2A 5J3OA 4EMSA 3U2RA 1BLIA 1E43A 2JIZA 3FHZA 3ABKH 3ABTA 4B3AA 1KQ9A 2W82A 1NTCA 1V0FA 1K28D 3E5XA 5FO1A 1S7EA 2BVMA 4M0LA 3DEUA 3IC7A 4EM1A 1XD7A 1QGAA 2DY1A 4U49A 3L2UA 3BG7A 4TKOB 3WG7H 4P2NA 5J35A 3OP1A 3BOQA 5K5OA 3DLLF 1Z77A 4ENMA 2DDBA 2ZXIA 3WBJA 2XEXA 3MKWB 2NSPA 4IOCF 2VLAA 3CCLI 3GQ9A 3KLNA 2DDAA 4M3BA 2P0WA 2EIXA 3VO1A 4OMZA 4PJNA 4DW6A 3RPUD 5EG0B 5C4JJ 3CPXA 1VQKB 2DPUA 2DYIA 4E4HA 1ODDA 4OPVA 2BV6A 4OJPA 3FISA 1TT0A 3CQZJ 3PL8A 2JPCA 1VQOI 1ZG5A 4AYBA 1K83J 3E6MA 1Z1DA 3OWTA 4KNYA 3P9CA 4MIMA 1QHGA 1N77A 2XC7A 3Q0WA 4ZJZA 1EV7A 5LGUA 2L02A 4EATA 1SFOJ 2KRFA 2XRNA 1NH3A 1N0VC 4M3GA 1RZ4A 2F43A 3TEDA 1JTYA 2ZBVA 2V7TA 3MZ8A 3KIOA 1O7FA 1OQYA 3MKZA 3ZSCA 2BE5F 4RGRA 2H94A 1LDDA 3H9JA 3GTKJ 2PMZA 1TYWA 5FRMA 1MZBA 3KYCB 5D5WB 4RB3C 1WI3A 3RKQA 3ASTA 2X1DA 2WB1A 3VYUB 2F4MB 3LSHA 5FFXA 3CCUB 3ZMUA 1SMYF 1QZEA 3H9NA 3M7GA 1JHHA 3I64A 2W6IA 3M8JA 3OW2B 3FXRA 2OUMA 4Y33A 1KU2A 3ROUA 2Z8GA 1BI2A 4G6DA 2CQ7A 5L46A 1X2MA 1WHUA 2FX0A 2XGEA 2TRTA 5B6IA 2AXTC 2WR8A 1BC7C 3U2QA 5HXBA 1VF7A 4PSWA 2UXNA 4LLNA 3MD2A 3DDYA 3AG2H 1ETXA 5A8AA 4AUXA 1MH4A 1J75A 3GVLA 4E70A 2H6BA 2K7LA 3OR1C 2P5VA 3CCYA 2OF7A 1MNEA 2GOMA 2HXOA 4IQJA 1S7AA 2ACJA 1F20A 4HIZA 4FXUA 1KK2A 3I71A 3E7LA 1MBKA 2WAEA 2XSJC 1BR1A 1D1AA 5FKKA 4PFOA 1K9MD 3CCJB 4M6YA 4G12A 1T98A 1FP1D 2ZBKA 1IUFA 4DQLA 5CQEA 1TZLA 3H36A 5HS8A 5LRSA 3CMMA 4A3KJ 2JA8J 3BZ6A 2NRAC 4BJ6C 5EGOB 1Z6TA 4DJAA 3D5LA 3VMFA 3BWGA 1D1NA 2KKOA 2HYJA 1WWXA 2K9SA 2O7OA 3MQ0A 4YEJA 5DM7F 2VOOA 3HGYA 3F8NA 3S16J 4M9SA 2CMPA 4OJOA 5E18F 3JR9A 1XQBA 1Z3XA 1UHSA 4YAUA 4Z2YA 2JVHA 2GQQA 4AC9A 1QVTA 1RKTA 4RMNA 2GXBA 2D1HA 4N9IA 2V31A 4PJJA 3AK5A 1UB9A 3HSRA 1I39A 2XAUA 2QX3A 2BN4A 3VNUA 2AHOA 1G8XA 1USTA 1YOVB 2LH9A 2RKHA 3LSTA 1XSXA 4UV9A 5M3MJ 3WTTC 2LD5A 1L0OC 1CQXA 1XE1A 2R5ZA 1QU3A 4E0FA 1OOCA 3OPOA 4FX0A 4I0BA 4DZJA 4C2MJ 4FWTA 1D0YA 1KQ5A 4B09A 4S04A 3WTVC 1S4MA 5B1BH 4RD1A 4ACAA 4Q48A 2V7QA 4M9XA 2F5VA 1VQ4I 1LFPA 1SEUA 2ZFUA 1NHAA 3KEYA 5E79C 4NNJA 4BQNA 4AVPA 1DQUA 3U21A 5FLXZ 4Z4YA 1O8JA 1JUSA 1IJWC 2CRVA 3QPLA 4K2EA 1BPLA 3E1YE 4MYUA 2EFOA 2QCOA 4J19A 5AN9A 4YIIA 2HPIA 1TTYA 1GDTA 1BW6A 2ZL7A 4HRIA 3EQOA 2P5LC 2L7KA 4C3JJ 4UUSB 2GQFA 2G0EA 4TT3A 4NC7A 2VQLA 1YIJB 3WWGA 4QFMA 3OSFA 5J1UA 3LSRA 4P12A 4ZYGA 3BJAA 1IDYA 2MLKA 3ML6A 1T0FC 4G1VA 2B7BA 4KMFA 4V02C 5D6FA 1TTTA 4FQGA 4HDVA 2M8GX 3RYRA 1MBFA 3DPLC 4Z4UA 4FTHA 2D3NA 2KRCA 3A02A 1LVAA 3BY2A 1W4MA 1WTHD 3KL9A 5H5JA 4ZCMA 1B9NA 4KYWA 3HOXJ 5F64A 5M3FJ 3DBLB 3ZPPA 2QF7A 1U8RA 4Y15A 3NRVA 1KMHA 3ZUGA 1RRJA 1O3QA 3MEXA 1PUEE 4A2UA 1CZFA 1RMGA 1SANA 2ADUA 3U9GA 2R7RA 4JK1X 3HTSB 1CF7B 2Q1ZB 2FE3A 3JW4A 3EYIA 3DBRB 2VNJA 4EQQA 2JJ1A 4CCLA 2L01A 2BY2A 1SFUA 2Z99A 2DQRA 2D3LA 3F8FA 4LBWA 2EQRA 5GV7A 3T8TA 1XCVA 3LYCA 3VSTA 5C1EA 2JUGA 1WXRA 3G71B 1RETA 4XSXF 5IT3A 4X7CA 4CXFA 2V1NA 1R5ID 3LAJA 1AKHB 3WGGA 4U9UA 2M4KA 3FM3A 4L5JA 4NQWA 2EFQA 3SZPA 4Z4VA 3OOPA 3VB2A 2BMWA 2LF7A 1YJ9B 2LBFA 1MKMA 1GV5A 2I10A 2Y9ZA 1JKPC 4IL6C 3WTZA 3KRGA 1X1CA 2TDXA 4HV5A 4OWRB 5E1ZB 4B3FX 4DNRB 3OFNA 2K5CA 5FJ8J 5B66C 2GJPA 2YX4A 5E3OA 2V9KA 2R3SA 4WXHA 1SVLA 1ZAOA 4JP0A 3IRQA 4GO1A 2H8RA 1IRFA 5HDKA 4FE7A 5J47A 2BSAA 2WY7Q 5JLWA 2WAQA 1IV6A 3ZR8X 2IS1A 3LMMA 1XFOA 1V3FA 1QG0A 3CCRB 4XQFA 4ENJA 1T56A 5B1AH 3I0TA 4LFUA 1BM9A 2EBIA 4MTEA 5LHHA 1E1QA 1NDHA 2GM4A 4C9YA 1E3PA 4EW9A 1DDIA 3HXLA 4G7WA 2NTBA 4MR0A 2GA2A 3W2HA 1CLWA 4ZGNB 4Y7NJ 3AVVA 1K4ZA 1YJNB 2C77A 3GFMA 4G7OF 1K4SA 1QA1A 3O6BB 3NWSA 5DYMA 1TWAJ 1FYLA 1XG2A 1ZELA 3WG9A 2UV1A 1W7PD 1YLFA 1FT9A 2R7TA 1G7CA 3V42A 1R1UA 1P7JA 1QA3A 3FBNB 3SHFA 5EEHA 3B8YA 5E17F 3JU4A 1R5HA 2OYNA 3WY9A 4CZZA 1JRGA 3O3KA 5HLGA 3V4GA 3J7AY 2O04A 4HWVA 4PC2A 1N05A 1V5FA 1GVHA 4PAAA 2GAUA 2O8XA 2UXXA 2XF5A 3KX2A 5IP9J 2DFIA 2M1BA 2MA3A 3PSSA 5ICEA 1TWGJ 2IP2A 1VLYA 4MLOA 3W6JB 2CF4A 2ESNA 3GQAA 4MEXF 2KVOA 2K9LA 2PLYA 2DA6A 2JJ2A 5FB2A 5CVUA 4AF6A 2VPLA 3LJYA 4ANJA 4ZYDA 4LBYA 5HOOA 3VSLA 2FOWA 4R71A 4F3QA 3HSFA 5HVQC 3ZQLA 1J9IA 4F7DA 4IHWA 3JRBA 1MBJA 3CMEB 5JR3A 4IRHA 4HSTA 3H0DA 3JQQA 3HTUA 1ZGJA 3IKVA 5B5EC 5H2FC 3ZN0A 2EFGA 5JMCB 2MD0A 4C2UA 5M5WJ 3V76A 2R7DA 4ETSA 3VYTB 2KMUA 2HKXA 3HOZJ 1YHQB 4YZXA 5GP9A 1J09A 2Y75A 4CCKA 2XNDA 1W9XA 1OJLA 2X6OA 5CVJA 3DKWA 5DTDA 2YSRA 1CNFA 3HBLA 2IGOA 4WWVA 5DCMA 1I7PA 4N3GA 4KIFA 3TL4X 5D4RA 2H1LA 4OOSA 3AG1H 1NG7A 1OB0A 2ESHA 3G4SI 1OCZH 2F5CA 3AL0C 1OFDA 1B8IB 2LMDA 1D8KA 3L2WA 2XZLA 2VKHA 2NAZA 3M9AA 1KU7A 4QVAA 4UUSA 1Y0RA 3ERMA 4ROXA 2QTLA 1HOMA 1WQ2A 2X4HA 4HDUA 3K1MA 4MHGA 4IOAF 1XX5A 2R7SA 2V1XA 3MZYA 2WZNA 2KFDA 4IKFA 2E36A 4XOPA 3ZBUA 2DA7A 4BBSJ 1GXPA 5FKLA 2CK3A 1OKRA 4E7HA 3OJWA 4KN7X 3FY3A 3LL7A 2E1MB 2RNJA 1MJAA 4P1WA 4A3GJ 1BMFA 3BR0A 2VBVA 1T95A 4IW3B 2OA4A 2EIJH 1FMVA 3TMOA 1HA3A 1RIOH 1CF7A 3MHPA 2GIVA 2YWEA 3PO2J 2LK2A 2KHMA 2D45A 3DPTA 3TO7A 2V4DA 1OCOH 3E6BA 3E5UA 5BPIA 1JKRC 3HAGA 3GTLJ 1OCPA 2Q6LA 1WVRA 1T5EA 2EZIA 3SYJA 2A61A 4TMZA 6PAXA 5C4XJ 1TBXA 2G7UA 3CP2A 1FNBA 3CMAI 2ZC2A 3B4NA 2CBXA 2W48A 2YS9A 3P27A 3CF5F 5LEKA 1VQMB 1EE6A 3R6KA 2VBXA 3A4CA 4B4CA 3K9TA 3A03A 2A68F 4RD0A 1E17A 5FL7A 3GVAA 1UD3A 1VLOA 4XN3A 1JNYA 1R1VA 2C78A 5KCMA 4MYTA 1D3YA 3CMAB 1G6NA 1KJZA 1GVJA 2OK8A 1Z9CA 4TMXA 3JRIA 3EDPA 5A88A 4P9UA 2X9DA 1U9OA 3ECHA 3FK6A 5F08A 3WU0A 4BJ5C 3ZMTA 2KQRA 1VFCA 4OOXA 4ESJA 1HXDA 3E6DA 5TISC 3MKLA 3S1RJ 1XSDA 3HRMA 2XF7A 3FDYA 3K4NA 2Q8KA 3OYGA 2FNPA 2KISA 4L9TA 3OYHA 2FMYA 4KKSA 4NUBA 4XKVA 2NOGA 2XTWA 3FWEA 1PJ7A 4WXCA 2AHQA 1A5JA 2H8WA 1H85A 1ZQ3P 1OGIA 3PENA 2HLDA 1W7PB 1JXSA 3DTKA 3PNYA 1A04A 2QGGA 3LVBA 2I1LA 3EUAA 3ML3A 3EYYA 2ZL5A 1HA8A 1SFKA 4P5OA 4LMYA 2I8DA 1X1DA 3AL0B 3VMWA 2JSCA 4Y9RA 4D7NA 4HNUA 2DOAA 4KA4A 2C6YA 4B4DA 1JJ6C 3N97A 3F8CA 3IL2A 3KEOA 5HS9A 2KIQA 4DZPA 2ZNYA 3LSIA 4E7IA 1PJ6A 2M5SA 3DTIA 2HZTA 2E1OA 3OR2C 3LA2A 2DOGA 1KQSB 4CO8A 1S5LC 5LEJA 1W1WE 1YJNI 1O8EA 1WOSA 1KU9A 1RR8C 1FDRA 2CW5A 2Q0OA 1AHDP 4TV7A 1XGSA 3TQNA 1HW2A 1FTZA 3NEUA 1IJEA 2VJ4A 4MEYF 3F8BA 5EG0A 1QX4A 2CNDA 4L8JA 5D8LB 1VQ5I 2DA4A 4HLXA 3CC7B 2K4BA 2BY0A 3IHUA 5BMZA 4F92B 3CMYA 3GZNB 1WKMA 1SD5A 1YHQI 3BQZA 2EV5A 4BDYA 2NTPA 5FKNA 2VFNA 3S2DJ 1IB0A 2GPJA 4OPOA 2BHZA 4YRVA 2JK3A 5D5VB 2C5BA 3F22A 3SY2A 4RAFA 3W2FA 2BVNA 3SLNA 2CW8A 2DFFA 2Q2EB 4B44A 2E2IJ 2DBBA 4BHPA 4OPWA 3V8KA 2HDDA 1B23P 1WSRA 2WADA 3OAAA 2L0KA 1DBGA 1W0TA 4B8XA 1VQ8I 2DCUA 1LLZA 5J8CA 4BE0A 1UD8A 2E5NA 1UD2A 1H89C 4BPRA 2E7XA 3H5RA 4G8XA 3ZMDA 2HCJB 4YELA 5CDFA 5E3LA 1HCRA 3VO2A 3UNGC 2IGMA 5KNLA 2YU9J 1JJ2B 2QSFX 1W0KA 3P7NA 2VBUA 4EH1A 3R60A 5IOYA 1M90D 4XLCA 2GREA 1WSVA 3VOEA 3Q0VA 2OCEA 1WMRA 3FKJA 1SD7A 3GLLA 4F7ZA 1R00A 1E3ZA 4OZYA 3FPPA 1N8RD 2BM7A 1H8HA 2YPRA 2F5EA 4CZCA 3TDZC 1OYIA 2XPVA 2NT9A 4WZKA 2L4AA 2QLZA 4OIPF 4DQKA 3LQQA 1IV8A 2JTVA 3GF2A 1MMNA 4P22A 5EMNA 4A3JJ 1ZM4A 5E8IA 2Q6OA 1BX0A 1FRNA 1QCXA 4JBAA 4MQVA 3N4MA 1FMWA 2IVMA 4P55A 1K78B 4W8QA 4LK0F 2OC6A 2BM4A 3QRFF 3H3VK 1LFUP 3S14J 1RNLA 3KETA 1MBHA 2XAJA 1ZR4A 1X3WB 1XB4A 2J5PA 1PP8F 4C2LA 4HQEA 3J80K 1EFCA 4C3HJ 4HV6A 4LGWA 4PGGA 5ED4A 2BM0A 1MJBA 2HGCA 3GLXA 2CSOA 2P5KA 4KIBA 3BQJA 3C18A 5H6QA 4CYCB 4UZUA 1PJRA 1R9TJ 1JT0A 2IT0A 2GOXB 2ZMEB 3K4LA 3ZIAA 2QGUA 3ZZUA 2L9RA
chains in the Genus database with same CATH topology
4BUPA 1D1CA 4DBQA 3PSFA 3VMVA 1OR7C 2X1DA 2WB1A 3VYUB 3LSHA 2V6EA 2AQEA 2KZVA 4BXFA 2VBEA 4AU7A 2W6IA 3M8JA 4NK8A 2OUMA 4Y33A 4DK1A 2Z8GA 3MKYB 2L2OA 2UVFA 3DPUA 4E7ZA 2NZMA 3HL2A 5HKKA 4J01A 3D5RC 1MNDA 2X1EA 2ZSHB 3SEQA 1VF7A 2ZZFA 1DGRM 4PSWA 4HG2A 3MD2A 4D1QA 2WPDA 3DDYA 1YX3A 4XNFA 1UELB 4YXWA 4W8RA 4ZDOA 1JI8A 2INVA 3GVLA 3BCDA 4U87A 3TBIA 4XL9A 3LFUA 3OR1C 4XLHA 1MNEA 3QYBA 2GOMA 4IQJA 2WBMA 4HIZA 4DGWB 4FXUA 1Y6IA 2QXZA 2LG4A 1Z7LA 4YZQA 2WAEA 2XSJC 3K4KA 1BR1A 1D1AA 3DKXA 4II3A 4PFOA 5CQEA 1WJ5A 1TZLA 3CMMA 4YZ0A 4KJZA 3BC8A 3ZCOA 5KHDA 4BJ6C 2CV2A 1VBLA 2RQQA 4N4OB 4DJAA 3H9GA 3D5LA 3PSIA 4BJTA 3SDBA 2HU9A 2CV1A 1OFMA 2VKDA 4YEJA 3PNVA 3D5SC 1S9HA 2CMPA 3K70C 4OJOA 1Z3XA 4LITA 2JVHA 4RM3A 2VQHA 4GRIA 1X1BA 4ITVA 3IAM2 3FHNA 2JA2A 2QKLB 4RMNA 2XZOA 3LSGA 2E1BA 2JVGA 1O8LA 2V31A 3GQ7A 4PJJA 3PFYA 4E7SA 3OEEA 1X19A 2JSPA 2F4IA 2PECA 3DLAA 1VJSA 1IRXA 2XAUA 4PK4A 2QX3A 1D1BA 2WZPP 4BQQA 1G8XA 2VQCA 2LH9A 1ERDA 2HQAA 4ZC3A 4J00A 3T53B 2WJVA 3S3OA 1MMDA 3RTRA 2PJRB 4BU2A 1QU3A 3G05A 3H9QA 4E0FA 1OOCA 1E79A 2PYHA 3OPOA 3CJQB 4NC8A 3K4MA 2EWEA 1O8MA 2IQ7A 3PNTA 2O0WA 4ASUA 1D0YA 1N75A 2NOJB 3CZ6A 4HSRA 1YX5A 1PXZA 2ZZQA 4LIVA 1W36C 3I3LA 2V7QA 3ZGKA 1Z3YA 2F5VA 1LFPA 2MYSA 3OYBA 2R7UA 2WY8Q 4B48A 3KEYA 2ZFUA 3K6GA 3OYEA 4NNJA 4BQNA 3DU6A 1DQUA 3U21A 3L2RA 1O8JA 3HPHA 2AQFA 2IS6A 1BPLA 2NTQA 3OY9A 1NBMA 2W7NA 3BC9A 2HPIA 1UD6A 3BCFA 3OL4A 3DQVC 4HRIA 3DKYA 3EQOA 3K10A 3SZGA 3H5NA 2X3HA 2L7KA 4NQWB 4B3XA 3NWTA 4U7BA 2IS4A 2VBMA 4TT3A 2LBFB 2KDOA 2LREA 2VQLA 4NC7A 2ZZEA 3WWGA 3KYLA 3DEEA 1T0FC 1W0JA 2JDIA 2FUG2 5HNHA 1KTWA 4PFPA 4PMHA 4CCJA 2X1CA 2CUJA 3DPLC 3PJRA 3VDXA 2D3NA 2KRCA 1BN8A 1K5CA 1WTHD 4BL0B 4W8TA 2PJRA 2E5ZA 3A35A 3SEZA 1MW7A 3ZPPA 1WFXA 1SAUA 3VR6A 1KMHA 1BHEA 1COWA 3B90A 1I18A 4BE1A 1CZFA 1RMGA 3A1YA 4LG3A 2R7RA 2DT6A 2BOLA 4B43A 4IX7A 2L9NA 2Q1ZB 4W8SA 2CS3A 3HUGB 3DU5A 4XMYA 2JJ1A 2DCEA 4CCLA 3OE7A 4QPQA 2Z6BD 2O1DA 3VWBA 1UD4A 4KKUA 4HEA2 2D3LA 2MFZA 3QOEA 3VSTA 5C1EA 2JUGA 2Y0SA 3SUCA 2E1MC 1O8KA 2XOKA 4E7KA 4JQFA 2V1NA 1O8GA 3H35A 3S3NA 2R7OA 2W6JA 4CCOA 4XKCA 2F6CA 2M4KA 1H8EA 4OJ6A 1NRKA 2LBFA 3KEWA 2VB6A 2QKMB 3KRGA 1X1CA 4OWRB 4CH7A 4ZTFA 3OIPA 4B3FX 4DNRB 3DTEA 1EFRA 5CQGA 2K5CA 3LSMA 3OFNA 2XGJA 1QJVA 2GJPA 4TSFA 2V9KA 3S32A 3AKZA 4XONA 4E7JA 2WY7Q 2IS1A 2WAQA 4Z05A 2OV7A 3ZR8X 3LMMA 4CA0A 3IAS2 3EUKL 2L9SA 4XQFA 2X53S 1V0EA 1HZEA 4F55A 3OEHA 3VSVA 3HPGA 3LSKA 1BOBA 1E1QA 3ZXSA 4XLEA 3VYSB 4C9YA 4EW9A 3HXLA 4G7XA 4CCMA 1AA7A 2VQGA 1KZLA 4G7WA 2NTBA 3HOTA 3A3BA 1E3XA 5FROA 4MR0A 3K4BA 1H80A 3MMYB 3OYKA 2VASA 2HNHA 1IDJA 5TGTA 3NWSA 2NSTA 1XG2A 1LVKA 1ZELA 2UV1A 1BR4A 1EA3A 1U0JA 2DJIA 3FBIB 2Z2SB 4XR6A 2O5RA 3V42A 4KITB 2R7TA 4JMQA 3FBNB 2E60A 2GJKA 3B8YA 2W1OA 3JU4A 3OS2A 1OHHA 1JRGA 3OL3A 3G2BA 2BVLA 1QHHD 4PJLA 3J7AY 2O04A 4HWVA 1V5FA 1WJDA 3WQZA 1DBOA 2XF5A 2WA0A 3KX2A 3H5AA 1LDKB 4B47A 1FX0A 3BCBA 1VLYA 1D0XA 2ZTGA 4OJ5A 4MLOA 2GK6A 3JURA 1O8FA 4XD7A 3GQAA 2KVOA 2K9LA 3W3CA 2JJ2A 1MMGA 2LY2A 2VPLA 3FKSA 4ANJA 2V26A 5HOOA 3VSLA 2NT6A 1GLNA 2A5WA 4RLQA 2CFOA 4XM3A 4F52A 1D0ZA 4F3QA 3H94A 1OLTA 5HVQC 3OOUA 5FRNA 4IZZA 2X8KA 4HSTA 3H0DA 4KKTA 3OIQA 4NK6A 1WP6A 2IS2A 2MD0A 4C2UA 4XORA 3GBGA 3T9GA 3VYTB 2DT7B 2KMUA 4YZXA 2HDWA 2VL8A 1UD5A 1J09A 4CCKA 2XNDA 1W9XA 2K9MA 2VBKA 4DBRA 3L2QA 1WPCA 4F91B 2QE7A 4RLFA 2M7AA 2IGNA 2IGOA 3A3GA 2ZZGA 4ZDPA 3TL4X 3RCOA 2R7WA 1NG7A 1OB0A 3OYIA 3VSUA 2KRHA 4RM2A 3AL0C 5HLTA 3L2WA 2XZLA 1X4OA 2VKHA 4PSXA 4D9JA 4XKWA 2M3AA 2CH0A 3M1CA 2UWMA 4Z03A 4C30A 3GRHA 4BEHB 3OYFA 4ZYAA 3OYDA 3RSNA 2XDVA 4XLAA 2X85A 2VXDA 2O0VA 2R7SA 4R79A 4N4NB 1WJAA 3FY3A 2UUZA 1DGWY 4IKFA 4XOPA 2L5QA 1PE9A 2VXZA 2R7QA 1PLUA 2ZXHA 1G59A 2QY1A 2CK3A 2PYGA 1NG6A 4IQ4A 3BCAA 4PJMA 1K6YA 2K3PA 2MABA 3UR3C 4BACA 3LL7A 3CESA 2E1MB 2X51A 4P1WA 5HNFA 1P9QC 5CPRB 1BMFA 2VJ5A 3GVJA 3GQ8A 1T95A 5C1CA 1E1RA 1OGMX 1N78A 1FMVA 4Y3OA 3TMOA 1KCCA 2R9VA 2BW3A 2M4GA 1WJEA 3VYRB 4X0GA 3E0JB 2O17A 2KHMA 3HOSA 3I9V2 3DPTA 2V4DA 1DP3A 3QYEA 3UW0A 1KCDA 4H4KC 3HAGA 2CV0A 2XZPA 1E0EA 4XN0A 4BGDA 2HVRA 2F1MA 1PKVA 4CUGA 1IA5A 2RREA 3CP2A 3B4NA 3BLYA 4XKBA 1EE6A 4XLFA 3C2HA 3A4CA 3GVKA 4MXNA 4BQOA 5FL7A 3ZPNA 1O8HA 1UD3A 4XN3A 5KCMA 3W2VA 3N05A 3IUOA 4Z1MA 4BEHA 2M0MA 3T56B 2MC4A 2VJIA 1IB4A 1UG0A 2KLOA 2R7VA 3GQBA 2W4SA 4BJ5C 2KQRA 4QPOA 4CSWA 4ZTJA 4E7HA 1O88A 2IXSA 4G6TB 2XF7A 3FDYA 4E7LA 3K4NA 3LMWA 4OJLA 3OYGA 4JOMA 1V5GA 4BS9A 2ZSIB 3CP8A 2DIEA 1RU4A 2ODLA 3OYHA 4KKSA 4NUBA 4XKVA 3ZRGA 3OYMA 3S3MA 3W2AA 3K4JA 4II2A 3OYJA 2HVQA 4E6KG 2VJJA 2VIXA 1X0CA 2HLDA 4OAZA 2V7FA 3DTKA 2ZTNA 3PNYA 3LNNA 4PUSA 1V5EA 2XF6A 3EUAA 4LIUA 4HNTA 3T51B 5JHFA 1HA8A 4ZDLA 3OYNA 1SFKA 4P5OA 3AL0B 2I8DA 1X1DA 3VMWA 5DN6A 3S93A 4CCNA 1HVXA 4HNUA 2DOAA 2KP6A 4YZAA 3DWLE 3RQ4A 4OZZA 2LY1A 3OS1A 2HPMA 2WSSA 2GK7A 1MMAA 3A2KA 1MABA 2ELJA 3IP4B 3LSIA 4E7IA 2M5SA 3DTIA 3OYAA 3OR2C 3SYTA 2R7XA 1O8EA 4OAYA 4DOZA 2LRDA 2WJYA 4G6IA 1WJCA 1OFLA 5LD2C 4FETA 1KONA 3S8PA 2CUZA 2VJ4A 1WJBA 4L8JA 2CW7A 4DNTB 4I84A 4AVZA 2RNGA 3F9KA 3VSKA 2A6TA 4C2TA 2HVSA 4F92B 3HC7A 1VZ0A 1Y56A 4BDZA 2V4JC 1WJFA 2NTPA 4BDYA 1PYVA 1SKYB 1X1AA 2R4GA 3HG9A 3W2WA 4YRVA 2M7BA 2KL4A 3C2GA 3CJRB 1AIRA 1IDKA 2W00A 1RWRA 3OOCA 2GJRA 3L2VA 2WAFA 3OW7A 4DK0A 3EUHC 2CW8A 3BG6A 2Q2EB 4B44A 4BE2A 2KPMA 2Z16A 3OAAA 2WADA 4FASD 3OYCA 1DBGA 3PUBA 3OS0A 5LFAA 1O8IA 3K4CA 1HG8A 2LZJA 4BE0A 3OMYA 1UD8A 2INUA 2E5NA 4U4BA 3CF2A 3EPZA 1BLIA 1E43A 4Y4RA 1UD2A 2JIZA 1GQ8A 1JTAA 3H5RA 4KT6A 2W82A 3HKZA 4YELA 5CDFA 3QYFA 1V0FA 1YE9A 2IGMA 3UNGC 5KNLA 1K28D 3EQNA 3E1SA 5CKTA 2BVMA 1W0KA 3AFHA 4Z06A 4U49A 1Z21A 5AMVA 1BR2A 3L2UA 3BG7A 4TKOB 2HZDA 4XLCA 3K70D 4GQNA 3ZQQA 4HPQA 3QODA 2LC2A 1WMRA 2ZXIA 3FKJA 4URRA 3MKWB 1E3ZA 2NSPA 2VLAA 3GQ9A 4OZYA 3FPPA 3BH4A 1NHCA 2P0WA 1H8HA 3ONQA 4F93B 4PJNA 4CZCA 3RPUD 2NT9A 2IGKA 1UAAA 4OJPA 4E4HA 3NE5B 5IK2A 1TT0A 3PL8A 4KISA 2X6YA 4AYBA 1R6RA 1O8DA 1X4PA 2X6XA 1MMNA 3OWTA 3OYLA 4P22A 1W36D 2LOOA 4B3GA 1QCXA 1QHGA 2BSPA 1FMWA 1N77A 2X6WA 2XC7A 4ZJZA 1T5EA 4W8QA 4EATA 2OC6A 4DIQA 2F43A 2LYCA 4C2LA 2BW3B 2UVEA 3MKZA 3ZSCA 1LKXA 3H9JA 2DXIA 4UZUA 1PJRA 1OGOX 3ZIAA 2PMZA 2GOXB 2Z1DA 3K4LA 1I8DA 5FRMA 4XOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VJJ A;  2NT6 A;  3WWG A;  3VMV A;  1X0C A;  4XM3 A;  2VBE A;  1KTW A;  4PMH A;  4NK8 A;  2Z8G A;  4NK6 A;  3VMW A;  2UVF A;  1BN8 A;  1K5C A;  2NZM A;  4XOR A;  4W8T A;  4YZA A;  3T9G A;  4OZZ A;  3ZPP A;  3B90 A;  1BHE A;  4YZX A;  1CZF A;  1RMG A;  2VBK A;  4W8R A;  4XNF A;  2INV A;  4W8S A;  1O8E A;  4XMY A;  4XL9 A;  4XLH A;  1OFL A;  2O1D A;  3VSU A;  2QXZ A;  4I84 A;  4YZQ A;  4AVZ A;  3VST A;  5C1E A;  4XKW A;  3SUC A;  1O8K A;  2NTP A;  4Z03 A;  3GRH A;  4YZ0 A;  1O8G A;  4XLA A;  1VBL A;  2X85 A;  1IDK A;  2O0V A;  1AIR A;  1RWR A;  1OFM A;  4XOP A;  4YEJ A;  4OJ6 A;  1PE9 A;  1PLU A;  4OJO A;  2QY1 A;  2PYG A;  3KRG A;  1DBG A;  3FY3 A;  4URR A;  1O8I A;  5C1C A;  1QJV A;  1HG8 A;  3GQ8 A;  1OGM X;  2INU A;  1O8L A;  4U4B A;  3GQ7 A;  1GQ8 A;  1JTA A;  1KCC A;  2PEC A;  4YEL A;  4XON A;  4Z05 A;  2O17 A;  2QX3 A;  3EQN A;  3UW0 A;  4Z06 A;  4U49 A;  1KCD A;  4XQF A;  5AMV A;  4XLC A;  4XN0 A;  3VSV A;  2PYH A;  4XLE A;  1OOC A;  1WMR A;  4EW9 A;  2NTB A;  4MR0 A;  2NSP A;  3GQ9 A;  4OZY A;  1IA5 A;  3B4N A;  1NHC A;  2EWE A;  1O8M A;  2IQ7 A;  2O0W A;  1EE6 A;  1H80 A;  4XLF A;  2NT9 A;  4MXN A;  4OJP A;  1IDJ A;  1O8H A;  2NST A;  4XN3 A;  1PXZ A;  2X6Y A;  1O8D A;  1XG2 A;  2X6X A;  4XR6 A;  1QCX A;  3B8Y A;  2BSP A;  2VJI A;  2X6W A;  1JRG A;  1O8J A;  4W8Q A;  1IB4 A;  4HWV A;  2O04 A;  2NTQ A;  1DBO A;  1O88 A;  4C2L A;  4OJ5 A;  2UVE A;  3LMW A;  3JUR A;  4OJL A;  3ZSC A;  1O8F A;  2ODL A;  1RU4 A;  3EQO A;  3GQA A;  4XKV A;  2X3H A;  1OGO X;  2VBM A;  4XOT A; 
#chains in the Genus database with same CATH topology
 2R6H A;  1D1C A;  1OR7 C;  3I54 A;  2V6E A;  1S0U A;  2VT3 A;  1ZRD A;  1XG1 A;  3F21 A;  2M0C A;  4NK8 A;  1I3A A;  3JTG A;  2RC5 A;  3QAH A;  4LOC A;  2E71 A;  2L2O A;  1FP2 A;  2JN6 A;  1J9Z A;  1A31 A;  2DA1 A;  2NVY J;  3SXY A;  2VT2 A;  3J81 K;  3C1D A;  4A3D J;  4WZE A;  1LPQ A;  1YX2 A;  1VQ4 B;  2HQN A;  5HKK A;  4J01 A;  3D5R C;  3K2A A;  4Z1M A;  2R7Z J;  4HZF A;  1J7K A;  2COM A;  5FD6 A;  4D1Q A;  1G4D A;  2QDX A;  1YX3 A;  2WPD A;  1RQR A;  4YXW A;  3W2E A;  5L3F A;  2E1C A;  1LQ1 A;  1HC8 A;  2H6C A;  5GTI C;  3TBI A;  2VNH A;  4ZGQ B;  4NC6 A;  2HOA A;  3QYB A;  2DA2 A;  4HAM A;  5J4Y A;  1Y6I A;  5DNS A;  4TMV A;  5THX A;  3HRS A;  1FYM A;  2G9W A;  4II3 A;  1KQ8 A;  4ZCI A;  4CGZ A;  4EJO A;  1ZM3 A;  3GTM J;  4RJL A;  2BY3 A;  3FK7 A;  2K4J A;  1N08 A;  4YZ0 A;  3G6E B;  1W35 A;  3P5J A;  5KHD A;  1VBL A;  3JRF A;  2D1V A;  4G6Q A;  1JUP A;  4U7D A;  3RIQ A;  3SDB A;  4YFX F;  3PNV A;  4BQA A;  4M4S A;  3J81 k;  1ETO A;  2DW4 A;  2AO9 A;  2BM5 A;  1J59 A;  3CD6 B;  4LIT A;  3BTL A;  3I5U A;  1VI0 A;  4WF2 A;  3G3Z A;  2VQH A;  3B6A A;  1X1B A;  2EIK H;  3F6V A;  3CCR I;  2O8K A;  3GTP J;  3FHN A;  1EXM A;  5FKO A;  2E1B A;  4WZL A;  4I98 B;  3GQ7 A;  1BJA A;  1SD6 A;  3F23 A;  1SC7 A;  1T6S A;  3PFY A;  2PE3 A;  1E62 A;  2PEC A;  4OOI A;  2ME0 A;  2L3D A;  3BQY A;  1LE8 B;  3BY6 A;  2E7W A;  2HQA A;  3CB4 A;  1EFT A;  1IAW A;  2V1U A;  4EVI A;  3CCS B;  1MMD A;  5F0C A;  2PYH A;  2XAF A;  4BU2 A;  2HDC A;  4X05 A;  2CYY A;  3QU6 A;  1QFJ A;  1HKT A;  3ABL H;  2KZG A;  4L0Z B;  2O0W A;  2OCC H;  3PNT A;  2CQK A;  3I56 B;  3K0L A;  1POG A;  4X6A J;  2NOJ B;  3CZ6 A;  4HSR A;  3Q0U A;  4XID A;  3TW7 A;  2QBY A;  2HWV A;  4BBR J;  3ZMV A;  1EFU A;  5FA6 A;  2ZZQ A;  2Z3Y A;  4LIV A;  1W36 C;  3I3L A;  3AVX A;  3H09 A;  1T08 B;  5GAE J;  4UY8 I;  4JX5 A;  4HLY A;  1QA6 A;  1EH7 A;  2R7U A;  2WY8 Q;  4RPD A;  4B48 A;  2DK5 A;  2ZJQ F;  4N0B A;  1FOW A;  3DU6 A;  3V8L A;  5H6R A;  3CCV I;  1AU7 A;  3C2B A;  3CC4 B;  3FXK A;  3KP2 A;  1WI9 A;  3K1N A;  2NTQ A;  2RAE A;  1T6Z A;  4AIJ A;  1W0U A;  3SJZ A;  4QIW N;  3E3V A;  2L7M P;  4L9J A;  1AKH A;  3OL4 A;  1WGX A;  3DKY A;  2HQ5 A;  3K7A J;  5JVG F;  1LEA A;  3SZG A;  4A3E J;  3HB9 A;  4DQ2 A;  4NQW B;  3WNC A;  1U5T C;  3CDL A;  5J40 A;  3EET A;  4U7B A;  5J4V A;  3FM5 A;  2LBF B;  2DA3 A;  5HDN A;  3GZ6 A;  2C2W A;  2ZZE A;  2KIM A;  2PMZ N;  3KYL A;  2XNJ A;  3DEE A;  1ZTR A;  1IN5 A;  1W0J A;  3HM5 A;  1G3T A;  2M9H A;  1RKW A;  2FOK A;  3F3X A;  2LTP A;  1TWH J;  5FLM J;  4HOB A;  4ZCL A;  1K5C A;  1WOP A;  3CCM I;  3PSZ A;  2PJR A;  2E5Z A;  3IKT A;  3NB2 A;  3A35 A;  2NS8 A;  1LEB A;  4LG0 A;  1WFX A;  3B90 A;  4IPA A;  1I18 A;  4BE1 A;  1VQ7 I;  2R93 J;  3A1Y A;  1WH5 A;  4UNO A;  4LG3 A;  4GXO A;  3ZPL A;  1VQO B;  3H0G J;  2K40 A;  4D0P A;  2LR8 A;  1JA0 A;  3HDD A;  3KEQ A;  4AD9 A;  2MSY A;  4NHJ A;  2CW0 F;  4P6Y A;  1TQM A;  3TKY A;  3GEZ A;  4BXU A;  4QPQ A;  4L0Y B;  2Z6B D;  3PUM A;  3ZQ7 A;  3O8H A;  2ZBU A;  4KKU A;  4U0W A;  4RDU A;  4HEA 2;  5CLS A;  4WWC A;  5TR9 A;  1TVC A;  2IA1 A;  4CYC A;  2ZO4 A;  5HZA A;  5A2Q Z;  3L2C A;  3SUC A;  2E1M C;  3U1D A;  1J5Y A;  3ERE D;  2D5V A;  5F4O A;  2W57 A;  3H35 A;  1FC3 A;  2CWE A;  3PA1 A;  4RD2 A;  1TQP A;  3JQP A;  4X7E A;  4KIG A;  4UVA A;  2F6C A;  3BY1 A;  4JYK A;  1H8E A;  4HF2 A;  4PGH A;  5KAI C;  4HW0 A;  4W1U A;  1RUO A;  4OJ6 A;  3PQK A;  3G73 A;  1F1Z A;  3K69 A;  2CRG A;  2OBR A;  3GCM A;  3W6K B;  2LNB A;  2MBF A;  5TV2 A;  2Q6K A;  3OIP A;  1EFR A;  3LSM A;  1I50 J;  2GXG A;  1AWC A;  5F0H A;  2XT2 A;  1FOX A;  4RB2 C;  4LLL A;  3HOU J;  1A35 A;  4TSF A;  1YS6 A;  4A6E A;  1GV2 A;  3MMP A;  1OFE A;  1TC3 C;  4E7J A;  2FSW A;  4HF1 A;  3GFJ A;  3LQR A;  3IAS 2;  3DF8 A;  2IA0 A;  2LLK A;  3HGG A;  1HKS A;  1GT0 C;  1V0E A;  1TLH B;  3I4P A;  2WV0 A;  2GIZ A;  4HNV A;  3OEH A;  1W7P A;  3HPG A;  2GXA A;  3ZXS A;  1GUU A;  4G7X A;  4CCM A;  1AA7 A;  2VQG A;  1KZL A;  3HOT A;  3FXM A;  5FRO A;  1H8A C;  4IHV A;  1YQA A;  4WCG A;  1O3S A;  1T8I A;  4Z4Z A;  3E20 A;  1AOY A;  2DER A;  1JHF A;  1YI2 B;  1R5G A;  2VAS A;  1EH6 A;  4XRF A;  3BH6 B;  3WTW C;  1SKQ A;  3DV8 A;  2VKV A;  2VE9 A;  1BR4 A;  4XR6 A;  2O5R A;  3CCJ I;  4ENN A;  3W2I A;  1ZG1 A;  2VOP A;  2GJK A;  3BNW A;  1VQ5 B;  1TYU A;  4FK8 A;  1K73 D;  3TGN A;  3OS2 A;  1OHH A;  3ZOB A;  2IOU G;  2BZT A;  2BVL A;  4O6J A;  5LMZ A;  1IC8 A;  1LDJ A;  3TO9 A;  1MRZ A;  3VR6 A;  3H5A A;  4DNC A;  1Z7U A;  1ORK A;  2W24 A;  1IN8 A;  4B47 A;  2ZTG A;  3BCB A;  3ASS A;  3WTY C;  3RY8 A;  2DFH A;  3ULQ B;  1QH0 A;  1MD0 A;  4N3N A;  3B6C A;  1P2F A;  1MH3 A;  3W3C A;  1APL C;  3QWL A;  5J8F A;  4KN4 X;  3TW6 A;  3FXQ A;  5B3S H;  1YJW I;  4A0Y A;  2V26 A;  2NT6 A;  2FU4 A;  2BHY A;  2R92 J;  4RLQ A;  2QM3 A;  4F52 A;  1B6A A;  4QVJ A;  1OLT A;  5KW9 A;  2EV0 A;  1ZK8 A;  3I55 I;  2B63 J;  2RV8 A;  4YFN F;  2L7Z A;  1G7T A;  2VFM A;  2CQQ A;  5FRN A;  4IZZ A;  4X7D A;  4NK6 A;  1ZKG A;  4U0Y A;  1YIT I;  5IYD J;  3S1Q J;  2VE8 A;  4XOR A;  3GBG A;  2R0Q C;  3ZQH A;  3T9G A;  1Y39 A;  1JKQ C;  4JX6 A;  1ZM9 A;  2NVQ J;  4ZH4 F;  4KIC A;  4DBR A;  3L2Q A;  1WPC A;  4AYB N;  4XSZ F;  1LNW A;  3BT9 A;  3A3G A;  2V7X A;  4ZDP A;  4NDL A;  5GAD J;  3KP4 A;  3LAP A;  1H0M A;  5AIP A;  3ZN1 A;  3V7R A;  1TWF J;  3OYI A;  3J7Z I;  2PG4 A;  5C44 J;  2RDP A;  2VBZ A;  2JA7 J;  1QUF A;  4RM2 A;  1T33 A;  3CDH A;  1HSJ A;  1VND A;  1FSH A;  2XAQ A;  2OTL I;  4XKW A;  2QYO A;  1I5Z A;  2Y31 A;  2B0L A;  3DCF A;  5EDN A;  3KE2 A;  2RC4 A;  3M1C A;  3JRE A;  4ENK A;  4C30 A;  2BGC A;  3RSN A;  2FD5 A;  1XTA A;  2DJN A;  1UHW A;  2X85 A;  2MW8 A;  3BRO A;  5M5Y J;  1WJA A;  3MAJ A;  2YWG A;  2O0V A;  3I58 A;  1P7I A;  3ZQF A;  4IHX A;  2BV3 A;  4KH3 A;  2R7Q A;  2ZXH A;  4UVB A;  4MNU A;  3KCC A;  3G1O A;  4IQ4 A;  5K7F A;  1HW1 A;  1U6G A;  2QEX B;  3A8K A;  1K6Y A;  3UR3 C;  2VBM A;  2LKX A;  3CES A;  1ETW A;  1T0F A;  2CG4 A;  5CPR B;  1KK0 A;  3S1M J;  1QUE A;  5C1C A;  2OJE D;  4YIR X;  2XRO A;  1RC9 A;  9ANT A;  1GHC A;  3F72 A;  3P9I A;  1E1R A;  2DYS H;  2VZL A;  3BH7 B;  1XC5 A;  2JMW A;  4GCV A;  4RDL A;  2J8K A;  1CQT A;  2LFB A;  4ZZD A;  1ZUN B;  2P81 A;  3VYR B;  4EV0 A;  3QE2 A;  4QUZ A;  3B78 A;  1LLW A;  1DP3 A;  2V9V A;  3HOY J;  3RKY A;  3G71 I;  1KCD A;  2HYF A;  1W2B B;  2CV0 A;  2JRM A;  4XN0 A;  1E0E A;  1P6R A;  2MLG A;  2X0L A;  1LFB A;  1JA1 A;  2RRE A;  1IA5 A;  4PC3 A;  1SVO A;  2P8T A;  3TO6 A;  2OTJ B;  4XLF A;  3KPH A;  3WNB A;  2IBD A;  3GVK A;  4MXN A;  3A0B C;  2FBH A;  1O8H A;  2R5Y B;  2XNC A;  2QZ8 A;  2DMP A;  3JAM Z;  1Y1W J;  3W2V A;  3GYH X;  1FBQ A;  3CDI A;  4FE4 A;  2V5I A;  1ZRE A;  2YR2 A;  1I3Q J;  4IEJ A;  3KLO A;  4XK4 A;  5DEQ A;  4BEH A;  4RCZ A;  2VJI A;  4A0Z A;  2KLO A;  1Q7Y D;  1QA2 A;  2CU7 A;  5TY0 A;  2W4S A;  2P6S A;  4LK1 F;  4CSW A;  3NAW A;  3JRC A;  3BR3 A;  1CNE A;  2IXS A;  1IXC A;  2UZK A;  4E7L A;  2FF4 A;  4OJL A;  3LMW A;  2STW A;  3R6S A;  3ISP A;  2DIE A;  4BS9 A;  2O61 A;  2ODL A;  1SFE A;  4UHT A;  1IHM A;  4TN1 A;  2MH9 A;  3GZ5 A;  3S3M A;  3W2A A;  2FRH A;  1B2R A;  4UUV A;  3OYJ A;  2F4N A;  2XIG A;  2DYR H;  2VJJ A;  3CUQ C;  2Y0S N;  1RPW A;  2I5U A;  2VIX A;  1X0C A;  1XGM A;  3QPS A;  3WTU C;  1O3T A;  2XF6 A;  5ICC A;  3CME I;  5IYQ A;  1LM1 A;  5JHF A;  1JTX A;  5CJ9 A;  5F4J A;  1K79 A;  3OYN A;  5D5U B;  3WE3 A;  1QFY A;  5DUI A;  3JRH A;  4I6Z A;  3E5Q A;  2KP6 A;  1Z67 A;  3OIO A;  5HDG A;  3DWL E;  5IT9 Z;  2WSS A;  1BJZ A;  2CQN A;  3A2K A;  1MAB A;  2BYV E;  2ELJ A;  3R4K A;  2K3F A;  1IN7 A;  1G7R A;  3BTC A;  3S2W A;  2P4W A;  3UKG A;  4YCQ A;  3ASO H;  1ACI A;  2OQG A;  5CVI A;  2KT0 A;  2JRT A;  3PET A;  5D8K B;  4DOZ A;  2LRD A;  4RGU A;  2KDZ A;  2WJY A;  1WJC A;  1OFL A;  3S8P A;  2CUZ A;  4KDP A;  1WJB A;  1TT5 B;  2CW7 A;  4DNT B;  3ASR A;  4AVZ A;  1XPX A;  2RNG A;  3F9K A;  3TH0 A;  2A6T A;  2WV1 A;  3Q5F A;  4C2T A;  2WB1 N;  4IJA A;  2LKP A;  1Y56 A;  4BDZ A;  5DV5 A;  4I02 A;  3GTQ J;  1VHO A;  4PC6 A;  1PYV A;  3JRD A;  5FO0 A;  4LLG F;  2FNA A;  2PJP A;  5BSX A;  3W2W A;  4ZYH A;  1FOY A;  2KL4 A;  3C2G A;  1AIR A;  3B82 A;  2W00 A;  4WZT A;  4OIQ F;  3CUQ B;  2GJR A;  1ELO A;  3I1F A;  5DDG A;  4BE2 A;  2ZIT A;  2CQX A;  3G4S B;  4N9H A;  4IF4 A;  3FIW A;  1G3W A;  3BG9 A;  3T1B A;  3CLO A;  5EJC A;  4A0X A;  3OS0 A;  3E6C C;  5J3L A;  3JX8 A;  1HG8 A;  2LZJ A;  1Z6R A;  3OMY A;  2ID3 A;  2XAH A;  4I2O A;  2HOS A;  1DAR A;  3JQR A;  1W5S A;  4A3I J;  2VKE A;  2OK7 A;  1GQ8 A;  4Y4R A;  4D7M A;  4HX4 A;  3V7S A;  3A1P A;  3SJM A;  4LBV A;  2DLL A;  4JRA C;  3E1S A;  4Y52 J;  2OZU A;  1ONV A;  3DP7 A;  1SVM A;  2QYU A;  1BR2 A;  1YI2 I;  3BG3 A;  3K70 D;  3W2G A;  1BX1 A;  3ZQQ A;  4HPQ A;  4M6V A;  2LC2 A;  3VOD A;  3CCE I;  2ECB A;  1T39 A;  1Y1V J;  2ZFW A;  1R7J A;  1Z05 A;  2AXL A;  1YRN A;  1P4X A;  3BH4 A;  1R5N A;  3IWZ A;  3ONQ A;  3QU3 A;  4F93 B;  1Z91 A;  2EV6 A;  2IGK A;  1KYW A;  3NE5 B;  2VBT A;  3BR5 A;  1ZH5 A;  5KVR A;  1FPQ A;  3EQL F;  3AG4 H;  4KIS A;  2X6Y A;  1O8D A;  3BG5 A;  1X4P A;  2ID6 A;  2X6X A;  4CHU A;  4RLZ A;  2K85 A;  3CO7 C;  2XRL A;  4XLN F;  3CJN A;  4ZZL A;  2KJB A;  1BC8 C;  1RQP A;  2X6W A;  1V54 H;  5L3C A;  3PQJ A;  4DIQ A;  3SZT A;  4G94 A;  2A3S A;  4YAF A;  3TP0 A;  4EJV A;  2LYC A;  3W5H A;  3L7W A;  2UVE A;  2EZL A;  5GAG J;  2KIF A;  2ISZ A;  3RKW A;  2DXI A;  3BPX A;  1IDZ A;  1I8D A;  1B9M A;  4XOT A;  1I6X A;  4BUP A;  2FML A;  1C0W A;  3VMV A;  3FMS A;  1BBY A;  3SDG A;  1VHE A;  3I56 I;  1WDT A;  2KZV A;  1EZG A;  4AU7 A;  1WOO A;  4X06 A;  3SEJ A;  2MD5 A;  5AON A;  1PP7 U;  2JWT A;  4DK1 A;  4A5M A;  2ETH A;  3MKY B;  4V2F A;  1I1S A;  2LY9 A;  1A36 A;  2UVF A;  1XGO A;  3DPU A;  2NZM A;  4ASN A;  5BPD A;  1QQI A;  1QVF B;  2EB7 A;  1LE8 A;  1QZY A;  2NPF A;  1MND A;  2X1E A;  3GSI A;  4HX7 A;  1DGR M;  5LHI A;  1QGY A;  4HA8 A;  4XNF A;  1UEL B;  4ZDO A;  2INV A;  4M72 A;  3QFT A;  3GUD A;  3BCD A;  4YFK F;  4U87 A;  4XRM A;  3LFU A;  2H27 A;  5F04 A;  1DPU A;  5LHG A;  3R6J A;  4DGW B;  2QQB A;  3IWF A;  4R8H A;  3WE2 A;  4IHT A;  3T0Y A;  3QQA A;  4QHY A;  1Q1V A;  1Z7L A;  2ZJ2 A;  2IPQ X;  1TW2 A;  3K4K A;  2VON A;  2DA5 A;  3DKX A;  3LNQ A;  2HFH A;  3QPT A;  2B7C A;  1IXS B;  3WND A;  4M74 A;  3M3Y J;  2DET A;  4CIC A;  4I76 A;  1ZHF A;  4TMW A;  2QWW A;  1U5T B;  4N4O B;  1QVG B;  3H9G A;  1Y0N A;  4BJT A;  2V7U A;  5E8G A;  2HU9 A;  1S7O A;  4MFD A;  2VKD A;  4P9F A;  1QVU A;  5A2Q K;  1TUI A;  2XPW A;  1R5O A;  4GYI A;  2P3M A;  3K70 C;  2E2J J;  4A69 C;  4I01 A;  2VC1 A;  1IN6 A;  3IAM 2;  1E3O C;  2HTS A;  4PC1 A;  2JA2 A;  5FFZ A;  2XZO A;  2QN6 A;  2FVG A;  1L3L A;  2JVG A;  1O8L A;  4V2G A;  1YYV A;  1X19 A;  2JSP A;  2WWY A;  1MSE C;  1YW7 A;  3DLA A;  3VNV A;  3GIR A;  2MC3 A;  4PK4 A;  1D1B A;  1WPK A;  5ILS A;  4GYG A;  2DO7 A;  1KZH A;  2VQC A;  1TP4 A;  4UZE A;  1ERD A;  4ZC3 A;  2L7F P;  3HIF A;  2EA4 A;  2MGQ A;  4L5E A;  4HX8 A;  4MFE A;  1F43 A;  4EJW A;  4RDJ A;  1A6I A;  3G05 A;  5E3M A;  5K5Q A;  1E79 A;  1OYW A;  5IP6 A;  1F5T A;  4NC8 A;  1VQL B;  3HZJ A;  2NXN B;  1DDN A;  2IJL A;  2EWE A;  1Q81 D;  3PM1 A;  4ASU A;  1N75 A;  1MMS A;  1GVD A;  2IA2 A;  3Q3A A;  1UCR A;  2E35 A;  2XGX A;  4UB8 C;  5IOZ A;  2Y0M A;  5JLV C;  2QQ8 A;  1FWZ A;  5M5X J;  4BNC A;  3CUQ A;  2QEN A;  4L9V A;  1IJF A;  5K7H A;  2EJR A;  5EZH A;  4OP7 A;  1Z3Y A;  4RD3 A;  4G7H F;  4Q4Z F;  3OYB A;  2DMN A;  1EJ9 A;  3K6G A;  5EGO A;  3OYE A;  3L2R A;  1BOA A;  2L4M A;  5DD8 A;  3HPH A;  2IS6 A;  2OBP A;  1NBM A;  3D26 A;  2LKS A;  2W7N A;  2NV4 A;  3BC9 A;  5F6F A;  3PUF A;  4EGY A;  1KA8 A;  1K7A A;  3IV5 A;  2XAS A;  2VN2 A;  4NCN A;  4BH9 A;  1GO2 A;  3BCF A;  3DQV C;  1FIP A;  3H5N A;  2X3H A;  3N90 A;  1VF9 A;  4B3X A;  2CUE A;  2KDO A;  2LRE A;  2B7E A;  3BZC A;  1H42 A;  1FNM A;  1KGS A;  2NS7 A;  3JTH A;  5GTH C;  1KTW A;  4FHT A;  2DPD A;  2E34 A;  3C7J A;  3PVD A;  2X1C A;  2CUJ A;  3KFW X;  3J80 Z;  1MBG A;  4MQ9 F;  3PJR A;  1BN8 A;  1MDM A;  3BR1 A;  4M71 A;  4BL0 B;  2CUF A;  2OD5 A;  5HOD A;  2XHK A;  2JA5 J;  1MW7 A;  1TWC J;  2QUF A;  3I53 A;  1SAU A;  1G7S A;  1Y8R B;  2DT5 A;  1COW A;  2OU2 A;  4WK8 F;  2GA1 A;  2VC0 A;  2PIA A;  4A93 J;  2V79 A;  1KYZ A;  2DT6 A;  4B43 A;  3L9F A;  1NB9 A;  4G5G A;  2CS3 A;  4QLC U;  1OB5 A;  3ELK A;  2FQ3 A;  4XMY A;  2CC2 A;  2DCE A;  2XKO A;  2ZJP F;  3OE7 A;  4IRG A;  5BS6 A;  2G0Y A;  3HYI A;  1Y0Y A;  3PUN A;  3SKB A;  2HR3 A;  4LD5 A;  2K86 A;  1P4A A;  3ONY A;  3QOE A;  1O57 A;  2FBK A;  2Y0S A;  1O8K A;  5HLI A;  3VEP A;  2XOK A;  1SMT A;  2XGD A;  2QEX I;  2HOE A;  4JQF A;  2H09 A;  2HS5 A;  2CJJ A;  1ETV A;  3ABM H;  1RI7 A;  3F6O A;  3S3N A;  2W6J A;  2V7W A;  4XKC A;  1K61 A;  1FOK A;  4R1H A;  1SAX A;  4I7H A;  1BA5 A;  1IXR C;  2XKP A;  5LGN A;  2O03 A;  3TOB A;  1V5V A;  4PAB A;  1VQ9 I;  1FX7 A;  4ZTF A;  3ONU A;  3DTE A;  3AGP A;  5CQG A;  2OTL B;  2JPB A;  1R71 A;  3SJP A;  1QJV A;  2DMQ A;  2OBS A;  2EK5 A;  3S32 A;  3AKZ A;  3B8H A;  1E3H A;  1GAW A;  3B73 A;  1B1B A;  3CW2 A;  5E6T A;  1QGP A;  5K1Y A;  4H9G A;  5KAF C;  2X53 S;  2BXY A;  4F55 A;  3U6B A;  3VSV A;  3LSK A;  1BOB A;  2DK8 A;  2BXZ A;  4Z4T A;  2PMD A;  1U2R A;  5BSY A;  3ZZT A;  1Q86 D;  1EP1 B;  3A3B A;  1FTT A;  1KC8 D;  1VQN B;  2LSO A;  1H80 A;  3OYK A;  3R0A A;  1QNT A;  3KP7 A;  2HNH A;  1U5T A;  5A89 A;  1XN7 A;  2WTE A;  2NST A;  3VPR A;  1S8N A;  2M2E A;  2XGC A;  5DCM B;  2E2H J;  1X3Z B;  1EA3 A;  1U0J A;  2VPR A;  4KIT B;  4JMQ A;  3LO8 A;  5GAH J;  2FJ1 A;  2XC1 A;  3RDI A;  3OL3 A;  3G2B A;  4PJL A;  2LVS A;  1VQ8 B;  1WJD A;  3LQE A;  4GGG A;  3WQZ A;  4A6D A;  1DBO A;  2M5W A;  4QSH A;  1XS9 A;  1G3Y A;  1MBE A;  1QZZ A;  1S6L A;  3QSY A;  3ASQ A;  1D0X A;  5JFR A;  4EGZ A;  3OZW A;  2GK6 A;  3SLD A;  1PDN C;  1KD1 D;  4IXA A;  4WX9 A;  2LF8 A;  1O8F A;  3H3U A;  3Q3S A;  4AC0 A;  3GME A;  3OZU A;  4XD7 A;  2J8I A;  2QA4 I;  4H0E A;  2BM1 A;  3D1N I;  3FKS A;  2OAZ A;  1HF2 A;  2CFO A;  3G1L A;  2PMU A;  1D0Z A;  1E63 A;  1MJ9 A;  5TJJ A;  3NQO A;  4OM9 A;  1XMX A;  1ULY A;  3HSE A;  1WP6 A;  5IY5 H;  1P4M A;  4Z4R A;  2WYR A;  4YDT A;  4DYC A;  4U88 A;  1UHM A;  2DT7 B;  2Z9O A;  2HDW A;  2DI3 A;  2PX9 A;  3KYD B;  3Q9S A;  4AF7 A;  4OIR F;  2OQR A;  1UMK A;  4YEI A;  2VBK A;  1U9N A;  4Y13 A;  2PLF A;  2QE7 A;  4FX4 A;  2PBI A;  2IGN A;  4RAZ A;  3REO A;  2EIN H;  3FZV A;  2EFN A;  3LA3 A;  3CRZ A;  1KRH A;  5JHU A;  3K1P A;  4M3E A;  1EP3 B;  1YO5 C;  5LRR A;  1F60 A;  4RS8 A;  2ZCW A;  2FBI A;  1X2N A;  3P9K A;  2R5Y A;  4M3F A;  1YFH A;  3BJ6 A;  1FLI A;  4D9J A;  1WZ2 A;  2CH0 A;  2DFE A;  5FD5 A;  3SQN A;  2XSD C;  2XPU A;  3CC4 I;  2WC2 A;  3X2Q H;  3GRH A;  4BEH B;  3OYF A;  4ZYA A;  4I09 A;  2KJC A;  4A12 A;  5IYR A;  1YJW B;  2XDV A;  4XLA A;  2VXD A;  4R79 A;  2VFP A;  4N4N B;  1TLL A;  3AGQ A;  3A8J A;  1IRZ A;  2NYX A;  3AVY A;  2M8E A;  2UUZ A;  2Y69 H;  2L5Q A;  3A01 B;  4PJ0 C;  2VXZ A;  4KUM A;  3IRR A;  1R49 A;  1G59 A;  2KIU A;  2DQL A;  1MDM B;  1W34 A;  1NG6 A;  3ZZ0 A;  2FEZ A;  3GW2 A;  4PJM A;  2K3P A;  5IYW A;  2ISY A;  1BI0 A;  2MAB A;  4BAC A;  2X51 A;  5HNF A;  1E64 A;  4CQJ A;  4J0Q A;  1P9Q C;  1QQ1 A;  3GVJ A;  2NVT J;  2VI6 A;  1OIS A;  1OGM X;  4L18 B;  5IYC J;  3CCS I;  1X3U A;  4KT5 C;  1KCC A;  2BW3 A;  2M4G A;  1AMO A;  3HUG A;  4X0G A;  1ETY A;  3E0J B;  5J1R A;  2O17 A;  3IH2 A;  4LJZ F;  5AIQ A;  3UW0 A;  4H4K C;  1XDU A;  2XZP A;  2DU9 A;  2WAQ N;  2A69 F;  3Q9V A;  5FKM A;  2HVR A;  3B02 A;  2F1M A;  3MCZ A;  1R1T A;  5FLX K;  4XKB A;  1DU0 A;  3CCM B;  3MWM A;  3C2H A;  3K2Z A;  5DCF A;  2RGV A;  3LFK A;  1WCM J;  4BQO A;  1B8I A;  1W87 A;  2ECC A;  3LOC A;  1P4W A;  3QOP A;  4M2L A;  4HYE A;  5D5X B;  4PCQ A;  1T6Y A;  3N05 A;  3R61 A;  3IUO A;  1PJ5 A;  2F5D A;  4LBZ A;  2M0M A;  2Y9Y A;  3LSP A;  2MC4 A;  3T56 B;  3GO5 A;  2TCT A;  3M8E A;  4X7F A;  1UG0 A;  4FCY A;  3GQB A;  3RJP A;  2GLO A;  1TL8 A;  4XBF A;  2F48 A;  2YU3 A;  4QPO A;  5H20 A;  4ZTJ A;  4U0V A;  1JB9 A;  2EPF A;  3FXJ A;  5J6X A;  1S72 I;  1YLO A;  3IH3 A;  1V5G A;  4JOM A;  2ZSI B;  2EH3 A;  3CP8 A;  3FXO A;  1WOR A;  1RU4 A;  3PFI A;  3ZRG A;  3CCV B;  4ZYE A;  4OPS A;  3K4J A;  4II2 A;  4M3D A;  2QQA A;  2QA4 B;  5IP7 J;  1Y0U A;  2Q2E A;  4CDG A;  2BGJ A;  1XMK A;  3AVU A;  3KP5 A;  4OAZ A;  1OGJ A;  2V7F A;  1OFM A;  2ZTN A;  1M1E B;  2GWR A;  2A6H F;  4PUS A;  1HKQ A;  3GXO A;  3HHG A;  3WGH A;  3T51 B;  4RB1 A;  1QRC A;  4G9Y A;  4ZDL A;  5L3E A;  5DN6 A;  5IPA A;  3S93 A;  4OIN F;  2DOD A;  1HVX A;  3ES9 A;  3V7C A;  3RQ4 A;  4OZZ A;  3OS1 A;  2M34 A;  1USS A;  2ZJR F;  2HPM A;  2RN7 A;  4GFB A;  2JZY A;  1IUY A;  1G2H A;  4MTD A;  1Q1H A;  5E3N A;  1G3S A;  2XUB A;  3DBH B;  4X1E A;  3SYT A;  1N25 A;  1R22 A;  4OAY A;  3RZD J;  2O9L A;  2FXA A;  5TRD A;  1YW8 A;  2YUH A;  5LD2 C;  4FET A;  1KON A;  5EYR A;  4I84 A;  4CYD A;  1JUM A;  3NAU A;  2O0Y A;  4Y17 A;  1EWY A;  2RC6 A;  1NK3 P;  2HVS A;  3HC7 A;  2HEO A;  1R23 A;  3G1M A;  4BXX J;  2EIM H;  3HOW J;  1W5C C;  1WJF A;  2V4J C;  2B5O A;  3CTA A;  4YHB A;  2IEK A;  4UUT A;  1X1A A;  2R4G A;  1JJ8 C;  4NBQ A;  5FGM A;  4A3C J;  3OV8 A;  4ON0 A;  4A3F J;  2M7B A;  2ZME C;  1K78 A;  1UMQ A;  1MIJ A;  1GR1 A;  2JJ7 A;  1IDK A;  3D0S A;  3OOC A;  3L2V A;  3OW7 A;  3H92 A;  3JAM K;  1B72 B;  2N8G A;  3EUH C;  3OKX A;  2F2E A;  2HDN B;  5GPA A;  3WBK A;  4Z4W A;  1ZAR A;  2KPM A;  3S15 J;  4ACB A;  1FBS A;  1OCR H;  4FAS D;  2FQ4 A;  2M87 A;  4GDF A;  5LFA A;  1ZG3 A;  1T38 A;  1O8I A;  2E1R A;  4MO7 A;  2Q6I A;  1DDG A;  2ZME A;  2DOF A;  2INU A;  3J7A O;  2RVC A;  4U4B A;  3EPZ A;  3FF5 A;  5F1J A;  3DXJ F;  1JTA A;  4KT6 A;  4RGX A;  3HKZ A;  4C43 A;  3QYF A;  1XB2 A;  1YE9 A;  4WQM A;  3EQN A;  3AAF A;  5CKT A;  3AG3 H;  5JVT A;  3L09 A;  3AFH A;  4Z06 A;  1Z21 A;  3MN2 A;  5AMV A;  1OFC X;  1QPM A;  2V7V A;  2HZD A;  4GQN A;  2H1K A;  3ZQI A;  3QOD A;  4XIC A;  3ZMS A;  3V8J A;  1VQ6 I;  3HHH A;  4URR A;  2EA2 A;  1NHC A;  4RAG A;  1JKO C;  4P3Y A;  2ZNZ A;  4HQM A;  5D6E A;  3N6Z A;  2PQ8 A;  4HBL A;  1IZ1 A;  2EWN A;  1UAA A;  1EA0 A;  4YAL A;  5IK2 A;  5KSW B;  4PC7 A;  1R6R A;  2YUS A;  3OYL A;  1LJ9 A;  1ZRC A;  5JI6 A;  1H9G A;  1YTY A;  1W36 D;  1ZRF A;  2LOO A;  4B3G A;  2BSP A;  3RQI A;  1IG7 A;  1R4M B;  3MFK A;  2XTY A;  3RPU A;  4UB6 C;  4RDK A;  4V19 K;  1PUF A;  2FX3 A;  1OB2 A;  2DN0 A;  1JE8 A;  2PN6 A;  2BW3 B;  4BYY A;  2HQR A;  5E1W A;  1U2W A;  2PFB A;  1YJ9 I;  1LKX A;  1OGO X;  2W85 A;  1F4K A;  2Z1D A;  1OPC A;  2ZZG A;  2HXI A;  3G6E I;  4IHS A;  1TQI A;  3PSF A;  4RGS A;  4DBQ A;  4O3M A;  1VQ9 B;  2AQE A;  1BW5 A;  4BXF A;  4X07 A;  4QV2 A;  1ZGA A;  2HMA A;  2VBE A;  1V55 H;  4UAJ A;  1I6H J;  3H3Z A;  3F0C A;  1N07 A;  4E7Z A;  5K5R A;  1ITY A;  4BAY A;  3HL2 A;  4L5I A;  5BQT A;  2VBY A;  3HRU A;  3FJO A;  4YC5 A;  2ZSH B;  3SEQ A;  4EJU A;  3ASN H;  2ZZF A;  4HG2 A;  1L1I A;  3JSP A;  3KZZ A;  5FNZ A;  4W8R A;  2V6C A;  1JI8 A;  5K7Z A;  4A3B J;  4LC0 A;  3CXC B;  4D5F A;  3L00 A;  1J0R A;  4XL9 A;  4XLH A;  1NB0 A;  3JSO A;  1A8P A;  1FIA A;  2WBM A;  3M4O J;  1VQ6 B;  1TYV A;  1STZ A;  1JT6 A;  3TDU C;  4IHY A;  2QXZ A;  1GXQ A;  2LG4 A;  3LSJ A;  4YZQ A;  1ENH A;  2D74 A;  1V4R A;  3DFG A;  3BTI A;  1VQP I;  2ME6 A;  2W25 A;  3AVW A;  1MNM C;  4ZV4 A;  3QPH A;  1WJ5 A;  4PDK A;  3ZP5 A;  3S17 J;  1GAQ A;  2DEU A;  1OYY A;  3BJO A;  3Q6Q A;  1SD4 A;  4KJZ A;  3BC8 A;  3ZCO A;  3I59 A;  2Y2Z A;  1UZC A;  2CV2 A;  2RQQ A;  1KK1 A;  3PSI A;  3SFI A;  4BHC A;  1DU6 A;  2CV1 A;  1QO0 D;  3C3W A;  3D5S C;  2XB5 A;  1QBJ A;  1ON2 A;  3WOD F;  1S9H A;  2O6W A;  4YFO A;  2K9N A;  1VQK I;  1EF4 A;  1KU3 A;  4BKX A;  4HF0 A;  5ILU A;  3PIO F;  2BPO A;  2OPT A;  4RM3 A;  1R36 A;  2L9V A;  4GRI A;  1NJI D;  2DAO A;  4ITV A;  2EZH A;  3CCL B;  2RQP A;  3HKZ N;  2QKL B;  2DTR A;  5EZG A;  3LSG A;  1FND A;  3MCA A;  4YG2 F;  2JA6 J;  2PMH A;  4E7S A;  4OU0 A;  3OEE A;  2F4I A;  5DUK A;  2B0R A;  3JRA A;  1VJS A;  1IRX A;  1FBU A;  2BBY A;  4UV8 A;  2YX7 A;  1DG1 G;  4EM2 A;  2C4T A;  5F0F A;  5EEG A;  4BQQ A;  1BIA A;  2WZP P;  4J00 A;  2J7K A;  2Y48 A;  1UJ8 A;  4P1V A;  3T53 B;  2WJV A;  3S3O A;  3JRG A;  3L1P A;  3RTR A;  2PJR B;  3GX4 X;  3H9Q A;  1HDD C;  4LG0 B;  4Y9U A;  3ESW B;  3CJQ B;  4PZJ A;  1BIB A;  4G1B A;  3K4M A;  1O8M A;  1ETK A;  5IYB J;  2IQ7 A;  4KMU X;  3CCU I;  1Y8Q B;  2GBY A;  1ZLJ A;  2JUC A;  3H1C A;  1YX5 A;  1IO2 A;  1IRG A;  3M1E A;  1YW9 A;  5DSZ A;  1PXZ A;  1P92 A;  3Q39 A;  2IAI A;  3FMQ A;  2E1N A;  1VQL I;  3ZGK A;  3LQ6 A;  5C3E J;  1VQP B;  4Z6Y A;  2FA5 A;  3M8F A;  2MYS A;  2XV4 S;  2JQ7 A;  2BF4 A;  1BN5 A;  2DMT A;  4UVC A;  2C4U A;  1ZR2 A;  4Q47 A;  1JGG A;  3PA2 A;  3SFZ A;  2AQF A;  1S3J A;  1U3E M;  3S2H J;  3OY9 A;  2W7Z A;  3MZH A;  3SZE A;  4NB5 A;  3HOV J;  5IYP A;  3GFL A;  2QZA A;  3IH4 A;  2ELK A;  3FXL A;  4EM0 B;  1UD6 A;  3LA7 A;  3RI4 A;  3MVP A;  1R4N B;  3K10 A;  3RPQ A;  1WSU A;  3QP5 A;  3FX3 A;  4Q7J B;  3U6K A;  2IS4 A;  1HST A;  3NWT A;  4BY7 J;  1WH7 A;  2X3U A;  2XVC A;  4Y7C A;  1WRJ A;  1KK3 A;  4WXD A;  5E20 A;  4TMT A;  2J5O A;  2JDI A;  3P26 A;  2FUG 2;  5HNH A;  4PMH A;  4PFP A;  2HI3 A;  3HJE A;  1BJK A;  2NVU B;  4CCJ A;  3A01 A;  4XRS G;  2NNN A;  3VDX A;  1KQ0 A;  2Y30 A;  1VQM I;  4LB5 A;  3FKI J;  1O4X A;  2JN9 A;  4W8T A;  2HTJ A;  2PEX A;  4M53 A;  3WGI A;  4DYQ A;  2HKO A;  3SEZ A;  4P9S A;  3VFZ A;  3NAR A;  5HLH A;  1BHE A;  2BEO A;  2X0K A;  3BTJ A;  3ZMZ A;  2F5F A;  3GWZ A;  1IN4 A;  1Q82 D;  1OCT C;  2BOL A;  2M30 A;  4IX7 A;  1LB2 A;  2L9N A;  2QBY B;  4W8S A;  2F4O B;  3HUG B;  3I4N J;  3QFC A;  5LGT A;  3DU5 A;  3FPK A;  5ICG A;  1YS7 A;  2ZB9 A;  5FO5 A;  3JCU C;  4AID A;  4NBS A;  2O1D A;  2MH2 A;  3BR6 A;  3VWB A;  2EIL H;  4O5V A;  1UD4 A;  3CCE B;  3FXU A;  4IVN A;  4C3I J;  5DD4 A;  2MFZ A;  3RIR A;  4RA2 A;  2BY1 A;  4M6X A;  3T5X A;  3ABU A;  1W5T A;  2STT A;  2O3F A;  2MG4 A;  3CPW B;  1I27 A;  5F1R A;  4RBO A;  5ERI A;  4E7K A;  4PGO A;  1XMA A;  2X48 A;  4RCY A;  1O8G A;  2R7O A;  4CCO A;  4C0S A;  4RPB A;  1K8A D;  2OZ6 A;  3CO6 C;  3ZBT A;  4LB6 B;  3WHC A;  1FJL A;  1NRK A;  5CVR A;  3S1N J;  4UZF A;  3KEW A;  2VB6 A;  2QKM B;  2QSG X;  3J7Y J;  2L54 A;  4YAW A;  5CVV A;  4EJT A;  1BQE A;  3CJT B;  2QVO A;  4CH7 A;  5JBQ A;  1S29 A;  4XRS A;  1FY7 A;  4BHB A;  1HBX G;  1HF0 A;  2XGJ A;  3AVT A;  3O2P E;  3R0J A;  4XON A;  3BR2 A;  1REP C;  4Z05 A;  2OV7 A;  4Z4S A;  4A3L J;  3OZV A;  2A05 A;  1UFM A;  4CA0 A;  3QP6 A;  3EUK L;  2L9S A;  3WU1 B;  1HZE A;  3WYA A;  2CFX A;  2GZW A;  1O3R A;  2C5H A;  4HE6 A;  1QGZ A;  1VQ7 B;  4XLE A;  3VYS B;  4AIH A;  1UG2 A;  2O6G E;  3ISX A;  1E3X A;  2DTZ A;  3K4B A;  1D5V A;  1FNC A;  1E2X A;  3MMY B;  3LWF A;  2E19 A;  3CC2 B;  4ABZ A;  1XCB A;  1IDJ A;  1TYX A;  5TGT A;  1BL0 A;  1ZN2 A;  2CO5 A;  5L3G A;  1FEX A;  1LVK A;  2DJI A;  3W5U A;  3FBI B;  2Z2S B;  2CGP A;  4S0H B;  1B4A A;  2E60 A;  2AS5 F;  2IRF G;  3DU1 X;  2W1O A;  1VTN C;  1R58 A;  3WTS C;  1QHH D;  1AIP A;  3DEW A;  5L3D A;  1N0U A;  2BM6 A;  1H9T A;  3Q38 A;  3M07 A;  4P96 A;  2B9S A;  2XB0 X;  3J81 Z;  2WA0 A;  5BOX A;  5H59 A;  3GTO J;  3WXM A;  3EUH A;  1LDK B;  1FX0 A;  1TNS A;  2K9Q A;  2EZK A;  4OJ5 A;  4RD4 A;  3JUR A;  1U8B A;  1EH8 A;  2EFP A;  5EF6 A;  3PO3 J;  1SM4 A;  4UXN A;  4P3I A;  5FLV A;  1MMG A;  2LY2 A;  1B59 A;  3COA C;  1OMI A;  3ZC3 A;  2F3L A;  1GLN A;  2A5W A;  1QPI A;  4XM3 A;  1K6O A;  3H94 A;  4M9Z A;  4QWQ A;  2R5Z B;  3RZO J;  2YWH A;  3P4G A;  2QMU A;  1MGT A;  1RR7 A;  2XAG A;  1HLV A;  3OOU A;  1OCC H;  2X8K A;  3KZY A;  4KKT A;  5LBQ A;  3OIQ A;  3ECO A;  5E1X A;  5ICF A;  4FN5 A;  2IS2 A;  1N06 A;  3W6V A;  1WU8 A;  2G7H A;  2A6E F;  3GFI A;  3E97 A;  1KTV A;  1ETQ A;  5J1Y A;  2VL8 A;  1UD5 A;  1J2X A;  2VBW A;  3SQV A;  4DYR A;  3RYP A;  4FT8 A;  3TOA A;  2K9M A;  4RD6 A;  4X0C A;  4OOV A;  3BZK A;  5D4S A;  4IO9 F;  4F91 B;  1LUJ B;  4RLF A;  2M7A A;  3KP6 A;  1S72 B;  4P6V F;  2K27 A;  4A3M J;  1VQN I;  2BX6 A;  3RCO A;  1I1G A;  2PI0 A;  2R7W A;  2EFW A;  3OSG A;  1FZP B;  3VSU A;  1HDP A;  1X58 A;  2KRH A;  3I4M J;  1Q9S A;  2ZL6 A;  5HLT A;  1XDS A;  4RAY A;  2D9R A;  3V7A A;  1SFX A;  2P7V B;  1FNN A;  1X4O A;  4PSX A;  2M3A A;  4RM0 A;  3BDD A;  1D5Y A;  2UWM A;  3U1K A;  2VBS A;  4P26 A;  4Z03 A;  4W97 A;  3CD6 I;  1ZGW A;  3OYD A;  4A5N A;  4YIF A;  1OR7 A;  2K02 A;  5F27 A;  2HYG D;  1RUN A;  4MGR A;  2HOT A;  3PIP F;  2OBT A;  2A5Y B;  1XSV A;  1DGW Y;  1ON1 A;  1IF1 A;  2P7C B;  1T6X A;  1PE9 A;  1PLU A;  2YWF A;  3CC2 I;  3KP3 A;  1QFZ A;  2QY1 A;  2PYG A;  3BCA A;  2D2W A;  5F4M A;  5ILV A;  3GQ8 A;  4JX4 A;  2VJ5 A;  3OJX A;  4D5C A;  4AWX B;  1FSE A;  2Z33 A;  1IW7 F;  1PUF B;  1MSF C;  2VNI A;  1N78 A;  4Y3O A;  1HQC A;  5BNG A;  1DUX C;  2R9V A;  1DPR A;  1WJE A;  3ZQG A;  3CLQ A;  1Z0X A;  3HEF A;  3RKX A;  3HOS A;  3I9V 2;  2VUM J;  3QYE A;  1FRQ A;  4YAO A;  3WHB A;  2NNY A;  2VFO A;  2VFQ A;  3CCQ B;  4P25 A;  4BGD A;  4G7Z F;  2V9P A;  3KZI C;  3GTJ J;  1PKV A;  3CUO A;  5CYV A;  1O7L A;  4CUG A;  1ZM2 A;  2F1L A;  4XLP F;  1EP2 B;  3BLY A;  5DS9 A;  2QSH X;  4ESF A;  1QRB A;  3BP8 A;  3CCQ I;  4OMY A;  1PVE A;  3WU2 C;  3ZPN A;  1K4T A;  3BPV A;  4M73 A;  1DP7 P;  1RES A;  3TP3 A;  1ZLK A;  2NVX J;  2ZXW H;  1XGN A;  5LLQ A;  2DMU A;  2ZXJ A;  4S05 A;  1IB4 A;  2W84 A;  2R7V A;  4HE5 A;  1ZYR F;  3F8M A;  5HS7 A;  3QFS A;  1U78 A;  1TW3 A;  1TSP A;  1X1P A;  1NK2 P;  1O88 A;  4X8I A;  1CGP A;  1R5B A;  4OIO F;  3O8G A;  4G6T B;  4AM3 A;  3I55 B;  2V1D A;  2QTZ A;  4EEF G;  3FMR A;  1T2K A;  1D8T A;  3OYM A;  3ZQC A;  2BGI A;  1B72 A;  2HVQ A;  3GTG J;  4E6K G;  2XTX A;  5GV8 A;  3Q6R A;  3WTX C;  3I59 B;  3W5V A;  1K8F A;  3LNN A;  1V5E A;  2R7F A;  1EKE A;  4LIU A;  1TNT A;  2P6T A;  1A6Q A;  4HNT A;  5DS0 A;  5GPC A;  2A07 F;  5KK1 A;  5EEA A;  4BY1 J;  4CCN A;  2JT1 A;  4YZA A;  2LY1 A;  5FIU A;  3HRT A;  2VOD A;  1YG2 A;  2GK7 A;  1MMA A;  3A8I A;  1DAB A;  3IP4 B;  2ICW G;  3OYA A;  3CC7 I;  1F9N A;  1FYK A;  2QQ9 A;  2R7X A;  1GJR A;  4ESB A;  4B1R A;  4QTR A;  2VNK A;  1YRN B;  4G6I A;  5L3B A;  3QFR A;  4FIS A;  2ZKZ A;  4K1X A;  4RB0 A;  2IW5 A;  4M1K A;  3VSK A;  4AIK A;  2NS0 A;  3A0H C;  2VYQ A;  1JGS A;  1VZ0 A;  1HW5 A;  1QRY A;  2Z5U A;  1BI3 A;  1M1K D;  1SKY B;  2LDU A;  1YIJ I;  3HG9 A;  2DOE A;  1IGN A;  3T8R A;  1D2E A;  3CJR B;  1YIT B;  2OTJ I;  1RWR A;  4IRI A;  5IT9 K;  5DM6 F;  2LP0 A;  2WAF A;  1H88 C;  1YIO A;  4I0A A;  4DK0 A;  3BG6 A;  2M45 A;  5JLX A;  5HZB A;  2Z16 A;  4Q5S F;  2XT4 A;  2ELH A;  3OYC A;  3PUB A;  2COB A;  3K4C A;  4KFC A;  1D8J A;  1F36 A;  3ASP A;  5IYN A;  4I99 C;  4L9N A;  1BI1 A;  3CF2 A;  5J3O A;  4EMS A;  3U2R A;  1BLI A;  1E43 A;  2JIZ A;  3FHZ A;  3ABK H;  3ABT A;  4B3A A;  1KQ9 A;  2W82 A;  1NTC A;  1V0F A;  1K28 D;  3E5X A;  5FO1 A;  1S7E A;  2BVM A;  4M0L A;  3DEU A;  3IC7 A;  4EM1 A;  1XD7 A;  1QGA A;  2DY1 A;  4U49 A;  3L2U A;  3BG7 A;  4TKO B;  3WG7 H;  4P2N A;  5J35 A;  3OP1 A;  3BOQ A;  5K5O A;  3DLL F;  1Z77 A;  4ENM A;  2DDB A;  2ZXI A;  3WBJ A;  2XEX A;  3MKW B;  2NSP A;  4IOC F;  2VLA A;  3CCL I;  3GQ9 A;  3KLN A;  2DDA A;  4M3B A;  2P0W A;  2EIX A;  3VO1 A;  4OMZ A;  4PJN A;  4DW6 A;  3RPU D;  5EG0 B;  5C4J J;  3CPX A;  1VQK B;  2DPU A;  2DYI A;  4E4H A;  1ODD A;  4OPV A;  2BV6 A;  4OJP A;  3FIS A;  1TT0 A;  3CQZ J;  3PL8 A;  2JPC A;  1VQO I;  1ZG5 A;  4AYB A;  1K83 J;  3E6M A;  1Z1D A;  3OWT A;  4KNY A;  3P9C A;  4MIM A;  1QHG A;  1N77 A;  2XC7 A;  3Q0W A;  4ZJZ A;  1EV7 A;  5LGU A;  2L02 A;  4EAT A;  1SFO J;  2KRF A;  2XRN A;  1NH3 A;  1N0V C;  4M3G A;  1RZ4 A;  2F43 A;  3TED A;  1JTY A;  2ZBV A;  2V7T A;  3MZ8 A;  3KIO A;  1O7F A;  1OQY A;  3MKZ A;  3ZSC A;  2BE5 F;  4RGR A;  2H94 A;  1LDD A;  3H9J A;  3GTK J;  2PMZ A;  1TYW A;  5FRM A;  1MZB A;  3KYC B;  5D5W B;  4RB3 C;  1WI3 A;  3RKQ A;  3AST A;  2X1D A;  2WB1 A;  3VYU B;  2F4M B;  3LSH A;  5FFX A;  3CCU B;  3ZMU A;  1SMY F;  1QZE A;  3H9N A;  3M7G A;  1JHH A;  3I64 A;  2W6I A;  3M8J A;  3OW2 B;  3FXR A;  2OUM A;  4Y33 A;  1KU2 A;  3ROU A;  2Z8G A;  1BI2 A;  4G6D A;  2CQ7 A;  5L46 A;  1X2M A;  1WHU A;  2FX0 A;  2XGE A;  2TRT A;  5B6I A;  2AXT C;  2WR8 A;  1BC7 C;  3U2Q A;  5HXB A;  1VF7 A;  4PSW A;  2UXN A;  4LLN A;  3MD2 A;  3DDY A;  3AG2 H;  1ETX A;  5A8A A;  4AUX A;  1MH4 A;  1J75 A;  3GVL A;  4E70 A;  2H6B A;  2K7L A;  3OR1 C;  2P5V A;  3CCY A;  2OF7 A;  1MNE A;  2GOM A;  2HXO A;  4IQJ A;  1S7A A;  2ACJ A;  1F20 A;  4HIZ A;  4FXU A;  1KK2 A;  3I71 A;  3E7L A;  1MBK A;  2WAE A;  2XSJ C;  1BR1 A;  1D1A A;  5FKK A;  4PFO A;  1K9M D;  3CCJ B;  4M6Y A;  4G12 A;  1T98 A;  1FP1 D;  2ZBK A;  1IUF A;  4DQL A;  5CQE A;  1TZL A;  3H36 A;  5HS8 A;  5LRS A;  3CMM A;  4A3K J;  2JA8 J;  3BZ6 A;  2NRA C;  4BJ6 C;  5EGO B;  1Z6T A;  4DJA A;  3D5L A;  3VMF A;  3BWG A;  1D1N A;  2KKO A;  2HYJ A;  1WWX A;  2K9S A;  2O7O A;  3MQ0 A;  4YEJ A;  5DM7 F;  2VOO A;  3HGY A;  3F8N A;  3S16 J;  4M9S A;  2CMP A;  4OJO A;  5E18 F;  3JR9 A;  1XQB A;  1Z3X A;  1UHS A;  4YAU A;  4Z2Y A;  2JVH A;  2GQQ A;  4AC9 A;  1QVT A;  1RKT A;  4RMN A;  2GXB A;  2D1H A;  4N9I A;  2V31 A;  4PJJ A;  3AK5 A;  1UB9 A;  3HSR A;  1I39 A;  2XAU A;  2QX3 A;  2BN4 A;  3VNU A;  2AHO A;  1G8X A;  1UST A;  1YOV B;  2LH9 A;  2RKH A;  3LST A;  1XSX A;  4UV9 A;  5M3M J;  3WTT C;  2LD5 A;  1L0O C;  1CQX A;  1XE1 A;  2R5Z A;  1QU3 A;  4E0F A;  1OOC A;  3OPO A;  4FX0 A;  4I0B A;  4DZJ A;  4C2M J;  4FWT A;  1D0Y A;  1KQ5 A;  4B09 A;  4S04 A;  3WTV C;  1S4M A;  5B1B H;  4RD1 A;  4ACA A;  4Q48 A;  2V7Q A;  4M9X A;  2F5V A;  1VQ4 I;  1LFP A;  1SEU A;  2ZFU A;  1NHA A;  3KEY A;  5E79 C;  4NNJ A;  4BQN A;  4AVP A;  1DQU A;  3U21 A;  5FLX Z;  4Z4Y A;  1O8J A;  1JUS A;  1IJW C;  2CRV A;  3QPL A;  4K2E A;  1BPL A;  3E1Y E;  4MYU A;  2EFO A;  2QCO A;  4J19 A;  5AN9 A;  4YII A;  2HPI A;  1TTY A;  1GDT A;  1BW6 A;  2ZL7 A;  4HRI A;  3EQO A;  2P5L C;  2L7K A;  4C3J J;  4UUS B;  2GQF A;  2G0E A;  4TT3 A;  4NC7 A;  2VQL A;  1YIJ B;  3WWG A;  4QFM A;  3OSF A;  5J1U A;  3LSR A;  4P12 A;  4ZYG A;  3BJA A;  1IDY A;  2MLK A;  3ML6 A;  1T0F C;  4G1V A;  2B7B A;  4KMF A;  4V02 C;  5D6F A;  1TTT A;  4FQG A;  4HDV A;  2M8G X;  3RYR A;  1MBF A;  3DPL C;  4Z4U A;  4FTH A;  2D3N A;  2KRC A;  3A02 A;  1LVA A;  3BY2 A;  1W4M A;  1WTH D;  3KL9 A;  5H5J A;  4ZCM A;  1B9N A;  4KYW A;  3HOX J;  5F64 A;  5M3F J;  3DBL B;  3ZPP A;  2QF7 A;  1U8R A;  4Y15 A;  3NRV A;  1KMH A;  3ZUG A;  1RRJ A;  1O3Q A;  3MEX A;  1PUE E;  4A2U A;  1CZF A;  1RMG A;  1SAN A;  2ADU A;  3U9G A;  2R7R A;  4JK1 X;  3HTS B;  1CF7 B;  2Q1Z B;  2FE3 A;  3JW4 A;  3EYI A;  3DBR B;  2VNJ A;  4EQQ A;  2JJ1 A;  4CCL A;  2L01 A;  2BY2 A;  1SFU A;  2Z99 A;  2DQR A;  2D3L A;  3F8F A;  4LBW A;  2EQR A;  5GV7 A;  3T8T A;  1XCV A;  3LYC A;  3VST A;  5C1E A;  2JUG A;  1WXR A;  3G71 B;  1RET A;  4XSX F;  5IT3 A;  4X7C A;  4CXF A;  2V1N A;  1R5I D;  3LAJ A;  1AKH B;  3WGG A;  4U9U A;  2M4K A;  3FM3 A;  4L5J A;  4NQW A;  2EFQ A;  3SZP A;  4Z4V A;  3OOP A;  3VB2 A;  2BMW A;  2LF7 A;  1YJ9 B;  2LBF A;  1MKM A;  1GV5 A;  2I10 A;  2Y9Z A;  1JKP C;  4IL6 C;  3WTZ A;  3KRG A;  1X1C A;  2TDX A;  4HV5 A;  4OWR B;  5E1Z B;  4B3F X;  4DNR B;  3OFN A;  2K5C A;  5FJ8 J;  5B66 C;  2GJP A;  2YX4 A;  5E3O A;  2V9K A;  2R3S A;  4WXH A;  1SVL A;  1ZAO A;  4JP0 A;  3IRQ A;  4GO1 A;  2H8R A;  1IRF A;  5HDK A;  4FE7 A;  5J47 A;  2BSA A;  2WY7 Q;  5JLW A;  2WAQ A;  1IV6 A;  3ZR8 X;  2IS1 A;  3LMM A;  1XFO A;  1V3F A;  1QG0 A;  3CCR B;  4XQF A;  4ENJ A;  1T56 A;  5B1A H;  3I0T A;  4LFU A;  1BM9 A;  2EBI A;  4MTE A;  5LHH A;  1E1Q A;  1NDH A;  2GM4 A;  4C9Y A;  1E3P A;  4EW9 A;  1DDI A;  3HXL A;  4G7W A;  2NTB A;  4MR0 A;  2GA2 A;  3W2H A;  1CLW A;  4ZGN B;  4Y7N J;  3AVV A;  1K4Z A;  1YJN B;  2C77 A;  3GFM A;  4G7O F;  1K4S A;  1QA1 A;  3O6B B;  3NWS A;  5DYM A;  1TWA J;  1FYL A;  1XG2 A;  1ZEL A;  3WG9 A;  2UV1 A;  1W7P D;  1YLF A;  1FT9 A;  2R7T A;  1G7C A;  3V42 A;  1R1U A;  1P7J A;  1QA3 A;  3FBN B;  3SHF A;  5EEH A;  3B8Y A;  5E17 F;  3JU4 A;  1R5H A;  2OYN A;  3WY9 A;  4CZZ A;  1JRG A;  3O3K A;  5HLG A;  3V4G A;  3J7A Y;  2O04 A;  4HWV A;  4PC2 A;  1N05 A;  1V5F A;  1GVH A;  4PAA A;  2GAU A;  2O8X A;  2UXX A;  2XF5 A;  3KX2 A;  5IP9 J;  2DFI A;  2M1B A;  2MA3 A;  3PSS A;  5ICE A;  1TWG J;  2IP2 A;  1VLY A;  4MLO A;  3W6J B;  2CF4 A;  2ESN A;  3GQA A;  4MEX F;  2KVO A;  2K9L A;  2PLY A;  2DA6 A;  2JJ2 A;  5FB2 A;  5CVU A;  4AF6 A;  2VPL A;  3LJY A;  4ANJ A;  4ZYD A;  4LBY A;  5HOO A;  3VSL A;  2FOW A;  4R71 A;  4F3Q A;  3HSF A;  5HVQ C;  3ZQL A;  1J9I A;  4F7D A;  4IHW A;  3JRB A;  1MBJ A;  3CME B;  5JR3 A;  4IRH A;  4HST A;  3H0D A;  3JQQ A;  3HTU A;  1ZGJ A;  3IKV A;  5B5E C;  5H2F C;  3ZN0 A;  2EFG A;  5JMC B;  2MD0 A;  4C2U A;  5M5W J;  3V76 A;  2R7D A;  4ETS A;  3VYT B;  2KMU A;  2HKX A;  3HOZ J;  1YHQ B;  4YZX A;  5GP9 A;  1J09 A;  2Y75 A;  4CCK A;  2XND A;  1W9X A;  1OJL A;  2X6O A;  5CVJ A;  3DKW A;  5DTD A;  2YSR A;  1CNF A;  3HBL A;  2IGO A;  4WWV A;  5DCM A;  1I7P A;  4N3G A;  4KIF A;  3TL4 X;  5D4R A;  2H1L A;  4OOS A;  3AG1 H;  1NG7 A;  1OB0 A;  2ESH A;  3G4S I;  1OCZ H;  2F5C A;  3AL0 C;  1OFD A;  1B8I B;  2LMD A;  1D8K A;  3L2W A;  2XZL A;  2VKH A;  2NAZ A;  3M9A A;  1KU7 A;  4QVA A;  4UUS A;  1Y0R A;  3ERM A;  4ROX A;  2QTL A;  1HOM A;  1WQ2 A;  2X4H A;  4HDU A;  3K1M A;  4MHG A;  4IOA F;  1XX5 A;  2R7S A;  2V1X A;  3MZY A;  2WZN A;  2KFD A;  4IKF A;  2E36 A;  4XOP A;  3ZBU A;  2DA7 A;  4BBS J;  1GXP A;  5FKL A;  2CK3 A;  1OKR A;  4E7H A;  3OJW A;  4KN7 X;  3FY3 A;  3LL7 A;  2E1M B;  2RNJ A;  1MJA A;  4P1W A;  4A3G J;  1BMF A;  3BR0 A;  2VBV A;  1T95 A;  4IW3 B;  2OA4 A;  2EIJ H;  1FMV A;  3TMO A;  1HA3 A;  1RIO H;  1CF7 A;  3MHP A;  2GIV A;  2YWE A;  3PO2 J;  2LK2 A;  2KHM A;  2D45 A;  3DPT A;  3TO7 A;  2V4D A;  1OCO H;  3E6B A;  3E5U A;  5BPI A;  1JKR C;  3HAG A;  3GTL J;  1OCP A;  2Q6L A;  1WVR A;  1T5E A;  2EZI A;  3SYJ A;  2A61 A;  4TMZ A;  6PAX A;  5C4X J;  1TBX A;  2G7U A;  3CP2 A;  1FNB A;  3CMA I;  2ZC2 A;  3B4N A;  2CBX A;  2W48 A;  2YS9 A;  3P27 A;  3CF5 F;  5LEK A;  1VQM B;  1EE6 A;  3R6K A;  2VBX A;  3A4C A;  4B4C A;  3K9T A;  3A03 A;  2A68 F;  4RD0 A;  1E17 A;  5FL7 A;  3GVA A;  1UD3 A;  1VLO A;  4XN3 A;  1JNY A;  1R1V A;  2C78 A;  5KCM A;  4MYT A;  1D3Y A;  3CMA B;  1G6N A;  1KJZ A;  1GVJ A;  2OK8 A;  1Z9C A;  4TMX A;  3JRI A;  3EDP A;  5A88 A;  4P9U A;  2X9D A;  1U9O A;  3ECH A;  3FK6 A;  5F08 A;  3WU0 A;  4BJ5 C;  3ZMT A;  2KQR A;  1VFC A;  4OOX A;  4ESJ A;  1HXD A;  3E6D A;  5TIS C;  3MKL A;  3S1R J;  1XSD A;  3HRM A;  2XF7 A;  3FDY A;  3K4N A;  2Q8K A;  3OYG A;  2FNP A;  2KIS A;  4L9T A;  3OYH A;  2FMY A;  4KKS A;  4NUB A;  4XKV A;  2NOG A;  2XTW A;  3FWE A;  1PJ7 A;  4WXC A;  2AHQ A;  1A5J A;  2H8W A;  1H85 A;  1ZQ3 P;  1OGI A;  3PEN A;  2HLD A;  1W7P B;  1JXS A;  3DTK A;  3PNY A;  1A04 A;  2QGG A;  3LVB A;  2I1L A;  3EUA A;  3ML3 A;  3EYY A;  2ZL5 A;  1HA8 A;  1SFK A;  4P5O A;  4LMY A;  2I8D A;  1X1D A;  3AL0 B;  3VMW A;  2JSC A;  4Y9R A;  4D7N A;  4HNU A;  2DOA A;  4KA4 A;  2C6Y A;  4B4D A;  1JJ6 C;  3N97 A;  3F8C A;  3IL2 A;  3KEO A;  5HS9 A;  2KIQ A;  4DZP A;  2ZNY A;  3LSI A;  4E7I A;  1PJ6 A;  2M5S A;  3DTI A;  2HZT A;  2E1O A;  3OR2 C;  3LA2 A;  2DOG A;  1KQS B;  4CO8 A;  1S5L C;  5LEJ A;  1W1W E;  1YJN I;  1O8E A;  1WOS A;  1KU9 A;  1RR8 C;  1FDR A;  2CW5 A;  2Q0O A;  1AHD P;  4TV7 A;  1XGS A;  3TQN A;  1HW2 A;  1FTZ A;  3NEU A;  1IJE A;  2VJ4 A;  4MEY F;  3F8B A;  5EG0 A;  1QX4 A;  2CND A;  4L8J A;  5D8L B;  1VQ5 I;  2DA4 A;  4HLX A;  3CC7 B;  2K4B A;  2BY0 A;  3IHU A;  5BMZ A;  4F92 B;  3CMY A;  3GZN B;  1WKM A;  1SD5 A;  1YHQ I;  3BQZ A;  2EV5 A;  4BDY A;  2NTP A;  5FKN A;  2VFN A;  3S2D J;  1IB0 A;  2GPJ A;  4OPO A;  2BHZ A;  4YRV A;  2JK3 A;  5D5V B;  2C5B A;  3F22 A;  3SY2 A;  4RAF A;  3W2F A;  2BVN A;  3SLN A;  2CW8 A;  2DFF A;  2Q2E B;  4B44 A;  2E2I J;  2DBB A;  4BHP A;  4OPW A;  3V8K A;  2HDD A;  1B23 P;  1WSR A;  2WAD A;  3OAA A;  2L0K A;  1DBG A;  1W0T A;  4B8X A;  1VQ8 I;  2DCU A;  1LLZ A;  5J8C A;  4BE0 A;  1UD8 A;  2E5N A;  1UD2 A;  1H89 C;  4BPR A;  2E7X A;  3H5R A;  4G8X A;  3ZMD A;  2HCJ B;  4YEL A;  5CDF A;  5E3L A;  1HCR A;  3VO2 A;  3UNG C;  2IGM A;  5KNL A;  2YU9 J;  1JJ2 B;  2QSF X;  1W0K A;  3P7N A;  2VBU A;  4EH1 A;  3R60 A;  5IOY A;  1M90 D;  4XLC A;  2GRE A;  1WSV A;  3VOE A;  3Q0V A;  2OCE A;  1WMR A;  3FKJ A;  1SD7 A;  3GLL A;  4F7Z A;  1R00 A;  1E3Z A;  4OZY A;  3FPP A;  1N8R D;  2BM7 A;  1H8H A;  2YPR A;  2F5E A;  4CZC A;  3TDZ C;  1OYI A;  2XPV A;  2NT9 A;  4WZK A;  2L4A A;  2QLZ A;  4OIP F;  4DQK A;  3LQQ A;  1IV8 A;  2JTV A;  3GF2 A;  1MMN A;  4P22 A;  5EMN A;  4A3J J;  1ZM4 A;  5E8I A;  2Q6O A;  1BX0 A;  1FRN A;  1QCX A;  4JBA A;  4MQV A;  3N4M A;  1FMW A;  2IVM A;  4P55 A;  1K78 B;  4W8Q A;  4LK0 F;  2OC6 A;  2BM4 A;  3QRF F;  3H3V K;  1LFU P;  3S14 J;  1RNL A;  3KET A;  1MBH A;  2XAJ A;  1ZR4 A;  1X3W B;  1XB4 A;  2J5P A;  1PP8 F;  4C2L A;  4HQE A;  3J80 K;  1EFC A;  4C3H J;  4HV6 A;  4LGW A;  4PGG A;  5ED4 A;  2BM0 A;  1MJB A;  2HGC A;  3GLX A;  2CSO A;  2P5K A;  4KIB A;  3BQJ A;  3C18 A;  5H6Q A;  4CYC B;  4UZU A;  1PJR A;  1R9T J;  1JT0 A;  2IT0 A;  2GOX B;  2ZME B;  3K4L A;  3ZIA A;  2QGU A;  3ZZU A;  2L9R A; 
#chains in the Genus database with same CATH homology
 4BUP A;  1D1C A;  4DBQ A;  3PSF A;  3VMV A;  1OR7 C;  2X1D A;  2WB1 A;  3VYU B;  3LSH A;  2V6E A;  2AQE A;  2KZV A;  4BXF A;  2VBE A;  4AU7 A;  2W6I A;  3M8J A;  4NK8 A;  2OUM A;  4Y33 A;  4DK1 A;  2Z8G A;  3MKY B;  2L2O A;  2UVF A;  3DPU A;  4E7Z A;  2NZM A;  3HL2 A;  5HKK A;  4J01 A;  3D5R C;  1MND A;  2X1E A;  2ZSH B;  3SEQ A;  1VF7 A;  2ZZF A;  1DGR M;  4PSW A;  4HG2 A;  3MD2 A;  4D1Q A;  2WPD A;  3DDY A;  1YX3 A;  4XNF A;  1UEL B;  4YXW A;  4W8R A;  4ZDO A;  1JI8 A;  2INV A;  3GVL A;  3BCD A;  4U87 A;  3TBI A;  4XL9 A;  3LFU A;  3OR1 C;  4XLH A;  1MNE A;  3QYB A;  2GOM A;  4IQJ A;  2WBM A;  4HIZ A;  4DGW B;  4FXU A;  1Y6I A;  2QXZ A;  2LG4 A;  1Z7L A;  4YZQ A;  2WAE A;  2XSJ C;  3K4K A;  1BR1 A;  1D1A A;  3DKX A;  4II3 A;  4PFO A;  5CQE A;  1WJ5 A;  1TZL A;  3CMM A;  4YZ0 A;  4KJZ A;  3BC8 A;  3ZCO A;  5KHD A;  4BJ6 C;  2CV2 A;  1VBL A;  2RQQ A;  4N4O B;  4DJA A;  3H9G A;  3D5L A;  3PSI A;  4BJT A;  3SDB A;  2HU9 A;  2CV1 A;  1OFM A;  2VKD A;  4YEJ A;  3PNV A;  3D5S C;  1S9H A;  2CMP A;  3K70 C;  4OJO A;  1Z3X A;  4LIT A;  2JVH A;  4RM3 A;  2VQH A;  4GRI A;  1X1B A;  4ITV A;  3IAM 2;  3FHN A;  2JA2 A;  2QKL B;  4RMN A;  2XZO A;  3LSG A;  2E1B A;  2JVG A;  1O8L A;  2V31 A;  3GQ7 A;  4PJJ A;  3PFY A;  4E7S A;  3OEE A;  1X19 A;  2JSP A;  2F4I A;  2PEC A;  3DLA A;  1VJS A;  1IRX A;  2XAU A;  4PK4 A;  2QX3 A;  1D1B A;  2WZP P;  4BQQ A;  1G8X A;  2VQC A;  2LH9 A;  1ERD A;  2HQA A;  4ZC3 A;  4J00 A;  3T53 B;  2WJV A;  3S3O A;  1MMD A;  3RTR A;  2PJR B;  4BU2 A;  1QU3 A;  3G05 A;  3H9Q A;  4E0F A;  1OOC A;  1E79 A;  2PYH A;  3OPO A;  3CJQ B;  4NC8 A;  3K4M A;  2EWE A;  1O8M A;  2IQ7 A;  3PNT A;  2O0W A;  4ASU A;  1D0Y A;  1N75 A;  2NOJ B;  3CZ6 A;  4HSR A;  1YX5 A;  1PXZ A;  2ZZQ A;  4LIV A;  1W36 C;  3I3L A;  2V7Q A;  3ZGK A;  1Z3Y A;  2F5V A;  1LFP A;  2MYS A;  3OYB A;  2R7U A;  2WY8 Q;  4B48 A;  3KEY A;  2ZFU A;  3K6G A;  3OYE A;  4NNJ A;  4BQN A;  3DU6 A;  1DQU A;  3U21 A;  3L2R A;  1O8J A;  3HPH A;  2AQF A;  2IS6 A;  1BPL A;  2NTQ A;  3OY9 A;  1NBM A;  2W7N A;  3BC9 A;  2HPI A;  1UD6 A;  3BCF A;  3OL4 A;  3DQV C;  4HRI A;  3DKY A;  3EQO A;  3K10 A;  3SZG A;  3H5N A;  2X3H A;  2L7K A;  4NQW B;  4B3X A;  3NWT A;  4U7B A;  2IS4 A;  2VBM A;  4TT3 A;  2LBF B;  2KDO A;  2LRE A;  2VQL A;  4NC7 A;  2ZZE A;  3WWG A;  3KYL A;  3DEE A;  1T0F C;  1W0J A;  2JDI A;  2FUG 2;  5HNH A;  1KTW A;  4PFP A;  4PMH A;  4CCJ A;  2X1C A;  2CUJ A;  3DPL C;  3PJR A;  3VDX A;  2D3N A;  2KRC A;  1BN8 A;  1K5C A;  1WTH D;  4BL0 B;  4W8T A;  2PJR A;  2E5Z A;  3A35 A;  3SEZ A;  1MW7 A;  3ZPP A;  1WFX A;  1SAU A;  3VR6 A;  1KMH A;  1BHE A;  1COW A;  3B90 A;  1I18 A;  4BE1 A;  1CZF A;  1RMG A;  3A1Y A;  4LG3 A;  2R7R A;  2DT6 A;  2BOL A;  4B43 A;  4IX7 A;  2L9N A;  2Q1Z B;  4W8S A;  2CS3 A;  3HUG B;  3DU5 A;  4XMY A;  2JJ1 A;  2DCE A;  4CCL A;  3OE7 A;  4QPQ A;  2Z6B D;  2O1D A;  3VWB A;  1UD4 A;  4KKU A;  4HEA 2;  2D3L A;  2MFZ A;  3QOE A;  3VST A;  5C1E A;  2JUG A;  2Y0S A;  3SUC A;  2E1M C;  1O8K A;  2XOK A;  4E7K A;  4JQF A;  2V1N A;  1O8G A;  3H35 A;  3S3N A;  2R7O A;  2W6J A;  4CCO A;  4XKC A;  2F6C A;  2M4K A;  1H8E A;  4OJ6 A;  1NRK A;  2LBF A;  3KEW A;  2VB6 A;  2QKM B;  3KRG A;  1X1C A;  4OWR B;  4CH7 A;  4ZTF A;  3OIP A;  4B3F X;  4DNR B;  3DTE A;  1EFR A;  5CQG A;  2K5C A;  3LSM A;  3OFN A;  2XGJ A;  1QJV A;  2GJP A;  4TSF A;  2V9K A;  3S32 A;  3AKZ A;  4XON A;  4E7J A;  2WY7 Q;  2IS1 A;  2WAQ A;  4Z05 A;  2OV7 A;  3ZR8 X;  3LMM A;  4CA0 A;  3IAS 2;  3EUK L;  2L9S A;  4XQF A;  2X53 S;  1V0E A;  1HZE A;  4F55 A;  3OEH A;  3VSV A;  3HPG A;  3LSK A;  1BOB A;  1E1Q A;  3ZXS A;  4XLE A;  3VYS B;  4C9Y A;  4EW9 A;  3HXL A;  4G7X A;  4CCM A;  1AA7 A;  2VQG A;  1KZL A;  4G7W A;  2NTB A;  3HOT A;  3A3B A;  1E3X A;  5FRO A;  4MR0 A;  3K4B A;  1H80 A;  3MMY B;  3OYK A;  2VAS A;  2HNH A;  1IDJ A;  5TGT A;  3NWS A;  2NST A;  1XG2 A;  1LVK A;  1ZEL A;  2UV1 A;  1BR4 A;  1EA3 A;  1U0J A;  2DJI A;  3FBI B;  2Z2S B;  4XR6 A;  2O5R A;  3V42 A;  4KIT B;  2R7T A;  4JMQ A;  3FBN B;  2E60 A;  2GJK A;  3B8Y A;  2W1O A;  3JU4 A;  3OS2 A;  1OHH A;  1JRG A;  3OL3 A;  3G2B A;  2BVL A;  1QHH D;  4PJL A;  3J7A Y;  2O04 A;  4HWV A;  1V5F A;  1WJD A;  3WQZ A;  1DBO A;  2XF5 A;  2WA0 A;  3KX2 A;  3H5A A;  1LDK B;  4B47 A;  1FX0 A;  3BCB A;  1VLY A;  1D0X A;  2ZTG A;  4OJ5 A;  4MLO A;  2GK6 A;  3JUR A;  1O8F A;  4XD7 A;  3GQA A;  2KVO A;  2K9L A;  3W3C A;  2JJ2 A;  1MMG A;  2LY2 A;  2VPL A;  3FKS A;  4ANJ A;  2V26 A;  5HOO A;  3VSL A;  2NT6 A;  1GLN A;  2A5W A;  4RLQ A;  2CFO A;  4XM3 A;  4F52 A;  1D0Z A;  4F3Q A;  3H94 A;  1OLT A;  5HVQ C;  3OOU A;  5FRN A;  4IZZ A;  2X8K A;  4HST A;  3H0D A;  4KKT A;  3OIQ A;  4NK6 A;  1WP6 A;  2IS2 A;  2MD0 A;  4C2U A;  4XOR A;  3GBG A;  3T9G A;  3VYT B;  2DT7 B;  2KMU A;  4YZX A;  2HDW A;  2VL8 A;  1UD5 A;  1J09 A;  4CCK A;  2XND A;  1W9X A;  2K9M A;  2VBK A;  4DBR A;  3L2Q A;  1WPC A;  4F91 B;  2QE7 A;  4RLF A;  2M7A A;  2IGN A;  2IGO A;  3A3G A;  2ZZG A;  4ZDP A;  3TL4 X;  3RCO A;  2R7W A;  1NG7 A;  1OB0 A;  3OYI A;  3VSU A;  2KRH A;  4RM2 A;  3AL0 C;  5HLT A;  3L2W A;  2XZL A;  1X4O A;  2VKH A;  4PSX A;  4D9J A;  4XKW A;  2M3A A;  2CH0 A;  3M1C A;  2UWM A;  4Z03 A;  4C30 A;  3GRH A;  4BEH B;  3OYF A;  4ZYA A;  3OYD A;  3RSN A;  2XDV A;  4XLA A;  2X85 A;  2VXD A;  2O0V A;  2R7S A;  4R79 A;  4N4N B;  1WJA A;  3FY3 A;  2UUZ A;  1DGW Y;  4IKF A;  4XOP A;  2L5Q A;  1PE9 A;  2VXZ A;  2R7Q A;  1PLU A;  2ZXH A;  1G59 A;  2QY1 A;  2CK3 A;  2PYG A;  1NG6 A;  4IQ4 A;  3BCA A;  4PJM A;  1K6Y A;  2K3P A;  2MAB A;  3UR3 C;  4BAC A;  3LL7 A;  3CES A;  2E1M B;  2X51 A;  4P1W A;  5HNF A;  1P9Q C;  5CPR B;  1BMF A;  2VJ5 A;  3GVJ A;  3GQ8 A;  1T95 A;  5C1C A;  1E1R A;  1OGM X;  1N78 A;  1FMV A;  4Y3O A;  3TMO A;  1KCC A;  2R9V A;  2BW3 A;  2M4G A;  1WJE A;  3VYR B;  4X0G A;  3E0J B;  2O17 A;  2KHM A;  3HOS A;  3I9V 2;  3DPT A;  2V4D A;  1DP3 A;  3QYE A;  3UW0 A;  1KCD A;  4H4K C;  3HAG A;  2CV0 A;  2XZP A;  1E0E A;  4XN0 A;  4BGD A;  2HVR A;  2F1M A;  1PKV A;  4CUG A;  1IA5 A;  2RRE A;  3CP2 A;  3B4N A;  3BLY A;  4XKB A;  1EE6 A;  4XLF A;  3C2H A;  3A4C A;  3GVK A;  4MXN A;  4BQO A;  5FL7 A;  3ZPN A;  1O8H A;  1UD3 A;  4XN3 A;  5KCM A;  3W2V A;  3N05 A;  3IUO A;  4Z1M A;  4BEH A;  2M0M A;  3T56 B;  2MC4 A;  2VJI A;  1IB4 A;  1UG0 A;  2KLO A;  2R7V A;  3GQB A;  2W4S A;  4BJ5 C;  2KQR A;  4QPO A;  4CSW A;  4ZTJ A;  4E7H A;  1O88 A;  2IXS A;  4G6T B;  2XF7 A;  3FDY A;  4E7L A;  3K4N A;  3LMW A;  4OJL A;  3OYG A;  4JOM A;  1V5G A;  4BS9 A;  2ZSI B;  3CP8 A;  2DIE A;  1RU4 A;  2ODL A;  3OYH A;  4KKS A;  4NUB A;  4XKV A;  3ZRG A;  3OYM A;  3S3M A;  3W2A A;  3K4J A;  4II2 A;  3OYJ A;  2HVQ A;  4E6K G;  2VJJ A;  2VIX A;  1X0C A;  2HLD A;  4OAZ A;  2V7F A;  3DTK A;  2ZTN A;  3PNY A;  3LNN A;  4PUS A;  1V5E A;  2XF6 A;  3EUA A;  4LIU A;  4HNT A;  3T51 B;  5JHF A;  1HA8 A;  4ZDL A;  3OYN A;  1SFK A;  4P5O A;  3AL0 B;  2I8D A;  1X1D A;  3VMW A;  5DN6 A;  3S93 A;  4CCN A;  1HVX A;  4HNU A;  2DOA A;  2KP6 A;  4YZA A;  3DWL E;  3RQ4 A;  4OZZ A;  2LY1 A;  3OS1 A;  2HPM A;  2WSS A;  2GK7 A;  1MMA A;  3A2K A;  1MAB A;  2ELJ A;  3IP4 B;  3LSI A;  4E7I A;  2M5S A;  3DTI A;  3OYA A;  3OR2 C;  3SYT A;  2R7X A;  1O8E A;  4OAY A;  4DOZ A;  2LRD A;  2WJY A;  4G6I A;  1WJC A;  1OFL A;  5LD2 C;  4FET A;  1KON A;  3S8P A;  2CUZ A;  2VJ4 A;  1WJB A;  4L8J A;  2CW7 A;  4DNT B;  4I84 A;  4AVZ A;  2RNG A;  3F9K A;  3VSK A;  2A6T A;  4C2T A;  2HVS A;  4F92 B;  3HC7 A;  1VZ0 A;  1Y56 A;  4BDZ A;  2V4J C;  1WJF A;  2NTP A;  4BDY A;  1PYV A;  1SKY B;  1X1A A;  2R4G A;  3HG9 A;  3W2W A;  4YRV A;  2M7B A;  2KL4 A;  3C2G A;  3CJR B;  1AIR A;  1IDK A;  2W00 A;  1RWR A;  3OOC A;  2GJR A;  3L2V A;  2WAF A;  3OW7 A;  4DK0 A;  3EUH C;  2CW8 A;  3BG6 A;  2Q2E B;  4B44 A;  4BE2 A;  2KPM A;  2Z16 A;  3OAA A;  2WAD A;  4FAS D;  3OYC A;  1DBG A;  3PUB A;  3OS0 A;  5LFA A;  1O8I A;  3K4C A;  1HG8 A;  2LZJ A;  4BE0 A;  3OMY A;  1UD8 A;  2INU A;  2E5N A;  4U4B A;  3CF2 A;  3EPZ A;  1BLI A;  1E43 A;  4Y4R A;  1UD2 A;  2JIZ A;  1GQ8 A;  1JTA A;  3H5R A;  4KT6 A;  2W82 A;  3HKZ A;  4YEL A;  5CDF A;  3QYF A;  1V0F A;  1YE9 A;  2IGM A;  3UNG C;  5KNL A;  1K28 D;  3EQN A;  3E1S A;  5CKT A;  2BVM A;  1W0K A;  3AFH A;  4Z06 A;  4U49 A;  1Z21 A;  5AMV A;  1BR2 A;  3L2U A;  3BG7 A;  4TKO B;  2HZD A;  4XLC A;  3K70 D;  4GQN A;  3ZQQ A;  4HPQ A;  3QOD A;  2LC2 A;  1WMR A;  2ZXI A;  3FKJ A;  4URR A;  3MKW B;  1E3Z A;  2NSP A;  2VLA A;  3GQ9 A;  4OZY A;  3FPP A;  3BH4 A;  1NHC A;  2P0W A;  1H8H A;  3ONQ A;  4F93 B;  4PJN A;  4CZC A;  3RPU D;  2NT9 A;  2IGK A;  1UAA A;  4OJP A;  4E4H A;  3NE5 B;  5IK2 A;  1TT0 A;  3PL8 A;  4KIS A;  2X6Y A;  4AYB A;  1R6R A;  1O8D A;  1X4P A;  2X6X A;  1MMN A;  3OWT A;  3OYL A;  4P22 A;  1W36 D;  2LOO A;  4B3G A;  1QCX A;  1QHG A;  2BSP A;  1FMW A;  1N77 A;  2X6W A;  2XC7 A;  4ZJZ A;  1T5E A;  4W8Q A;  4EAT A;  2OC6 A;  4DIQ A;  2F43 A;  2LYC A;  4C2L A;  2BW3 B;  2UVE A;  3MKZ A;  3ZSC A;  1LKX A;  3H9J A;  2DXI A;  4UZU A;  1PJR A;  1OGO X;  3ZIA A;  2PMZ A;  2GOX B;  2Z1D A;  3K4L A;  1I8D A;  5FRM A;  4XOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...