4YEJA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yejA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yejA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yejA02
1DBGA 1OGMX 3EQNA 2X6XA 4Z03A 4XLAA 2NT6A 1GQ8A 2VBEA 2NT9A 1CZFA 4MR0A 1O88A 2EWEA 5C1CA 1PE9A 1O8EA 4OJ6A 1BHEA 1XG2A 4PMHA 2IQ7A 1O8GA 2NTBA 4I84A 4XQFA 3VMVA 1IB4A 3B8YA 4YZ0A 1X0CA 3VSTA 3JURA 4XKVA 4XOTA 3GQAA 2QXZA 3B4NA 1QJVA 1O8LA 2NTPA 4XKWA 1HG8A 1AIRA 1H80A 2UVFA 1O8HA 3B90A 4U4BA 4XLCA 1IDKA 1RU4A 1BN8A 1KCDA 1VBLA 3GQ7A 1WMRA 2NZMA 4OJ5A 4YZAA 1O8FA 3KRGA 4NK8A 4W8SA 1RMGA 3LMWA 1OOCA 2INVA 4C2LA 1O8DA 4OZYA 5C1EA 3VSUA 4NK6A 4Z06A 4W8QA 4XORA 4XONA 2X3HA 2O0VA 3GQ8A 2X85A 1O8MA 1JTAA 4XLEA 4OJLA 4XL9A 2X6YA 2PYHA 3GQ9A 1PLUA 1OFLA 3GRHA 1QCXA 1KTWA 1EE6A 1O8IA 4XLFA 1KCCA 4OJPA 5AMVA 2QY1A 2O17A 4XLHA 2PYGA 4YELA 1PXZA 2ODLA 4HWVA 3ZSCA 2VBMA 2O0WA 4XOPA 1O8KA 1O8JA 4OZZA 2O1DA 4YEJA 4YZQA 1K5CA 4W8TA 4XR6A 2VBKA 2X6WA 2BSPA 3SUCA 3ZPPA 2QX3A 3EQOA 1RWRA 1NHCA 2Z8GA 2NSTA 4YZXA 3FY3A 3VMWA 2NTQA 4XN0A 1OFMA 2PECA 3UW0A 2VJJA 1JRGA 3WWGA 1IA5A 2NSPA 3VSVA 1DBOA 4XN3A 4XNFA 4AVZA 4W8RA 4Z05A 4MXNA 4U49A 2VJIA 1IDJA 2INUA 1OGOX 2UVEA 4OJOA 3T9GA 4URRA 4EW9A 4XMYA 2O04A 4XM3A
chains in the Genus database with same CATH superfamily
3KP5A 3ZZTA 3LQEA 1AIPA 2KRHA 2VXZA 3KX2A 1JXSA 1F4KA 4FHTA 2VBEA 3FXRA 3JR9A 2H1KA 4B09A 3WHCA 2R7ZJ 5IYWA 2DOEA 3G05A 1R4NB 1A35A 2GWRA 1MMDA 3OZVA 2JN6A 2FBIA 4YDTA 4EATA 1DQUA 2HU9A 2VJ5A 4BJ5C 1QZZA 4UVCA 3HRTA 4ETSA 5K7HA 3OYCA 4KFCA 4KMFA 1WJAA 1VQ9B 3OZWA 3E5UA 4KITB 3WGGA 1YITB 3DKXA 3VMVA 3PENA 1PJRA 3DBRB 2KRCA 2JWTA 5D8LB 3OKXA 3B8YA 3C2GA 1U6GA 1FLIA 1RQRA 1AA7A 4PJJA 3TW6A 4RM0A 2GQQA 3CJNA 1KD1D 1YO5C 2BN4A 2CF4A 1QQIA 2DDBA 2XGDA 3I0TA 3CF5F 4GFBA 1I1SA 2E34A 3OP1A 1CLWA 3VODA 1H0MA 1A31A 2I10A 4RBOA 3ERED 3ZPNA 1EKEA 2UZKA 2A3SA 2H1LA 2UXNA 3FXUA 3ASRA 5FA6A 1ZRCA 1IDKA 4G6IA 1JT6A 3GFMA 4H4KC 1EP1B 1VBLA 3J80K 3GTQJ 2J5PA 4FX0A 1N75A 1Y1VJ 3H3ZA 1XSVA 2E5NA 3V4GA 5HODA 1QA6A 1OKRA 3M1CA 1VFCA 4RAFA 3ASQA 3CD6B 3Q9VA 3BR2A 5IYDJ 4U7DA 1Y0UA 1SAXA 5KCMA 3K2ZA 2VFNA 1FYKA 2GA2A 3CRZA 3FK7A 1FNCA 1RPWA 3LSTA 2A07F 2VN2A 4XONA 5E3NA 3RPUD 2O8KA 2FX0A 4V2GA 3GQ8A 3KIOA 1VLYA 2PE3A 5HKKA 4AIKA 1FNBA 1T2KA 3BG3A 4LFUA 3GLLA 2OAZA 4ENJA 1AKHB 2BXYA 1F43A 2L4AA 3ZZUA 4EH1A 1S5LC 1X2NA 2CSOA 3ASPA 1AHDP 3S14J 1WQ2A 5M5WJ 1YW9A 2OZUA 4RLFA 1TZLA 2OBRA 2HYJA 3WBKA 2IW5A 3TQNA 1LKXA 4QTRA 4AIHA 4XRSA 3SDBA 1PXZA 3QPTA 2N8GA 5C44J 2C4TA 2BVNA 4FISA 5HLIA 4RMNA 2QENA 2R5ZB 1WPKA 4FXUA 3GTMJ 2O1DA 2ZZGA 4YZQA 3H9GA 1SD6A 2KJBA 3WTSC 1BM9A 3RKQA 2K9NA 1FT9A 4PJNA 1KJZA 2J7KA 2LRDA 3HKZA 4O6JA 1RESA 5LHHA 4MTEA 3AL0C 2HR3A 1Q1VA 3AAFA 4TMZA 1LB2A 2NTQA 2BOLA 1TL8A 3LWFA 2Y0MA 2FOWA 2EINH 2EFOA 5D5UB 4BH9A 1T5EA 3GVLA 1WJ5A 3OR2C 3RPUA 3BT9A 3BOQA 5CQGA 2KJCA 1E3PA 2PI0A 1GAQA 1BIAA 2DERA 1I5ZA 1Y39A 2JPCA 3D5SC 2GJRA 5IYQA 2GBYA 3OYJA 3AGQA 3KFWX 2LG4A 1RR7A 3N4MA 1MSFC 4II2A 5JHFA 3LVBA 3QE2A 4YAWA 1YYVA 4YC5A 4G5GA 2JN9A 2H6BA 4F91B 5J47A 1MMAA 3CJQB 3KP7A 1JUPA 3KPHA 4M9XA 3KCCA 1OCCH 5E18F 1DUXC 4DYQA 1BMFA 3TH0A 2XGEA 4P1VA 4PJLA 1R5BA 5EZHA 2E1BA 2E1NA 4P3YA 1WSUA 2LBFB 2JQ7A 5JVGF 2JK3A 1BHEA 2OCCH 2OTJI 3ES9A 2EZIA 3E7LA 3QFCA 2XZLA 2XTWA 1QVUA 4B4DA 5FFXA 4XQFA 2DA4A 5ICGA 5M5XJ 4J00A 1ZR4A 1R23A 4AF6A 3FKSA 2BGCA 2VLAA 1DG1G 2IGKA 4HYEA 3WNCA 3S3NA 2CRGA 2L02A 2BM6A 1Z7UA 2B0RA 2DYIA 2NTPA 4YFOA 3U6KA 4BE1A 3CCMB 3GEZA 1TBXA 3J7ZI 4M2LA 4GO1A 1UD4A 3HOYJ 4NUBA 4A0ZA 3C7JA 3MVPA 4B43A 5EEHA 2VBZA 4HNVA 2A5YB 5CVJA 1G7RA 2CUJA 3KRGA 2DU9A 3AG1H 1H88C 3DXJF 3CO6C 4C2UA 2OTLI 3KYLA 4Z4RA 2F5FA 3TO7A 2GOXB 4J01A 1O8DA 3O8HA 4ZH4F 5KVRA 1UD2A 3CP8A 3LSPA 1VQ4I 1H89C 4Z06A 3RTRA 4ZCLA 4LC0A 2PMZN 1F1ZA 4N0BA 4L0ZB 1VQNI 2J8IA 2XTYA 1K28D 3NRVA 3OV8A 4LG0A 1HDDC 1DARA 1CGPA 3WNBA 4XL9A 3ROUA 3WGHA 1I6XA 5F6FA 3I55B 1WJEA 3QQAA 1QRCA 4OMYA 1E62A 1D1BA 2DO7A 2XOKA 5CQEA 2O9LA 2PMHA 1NTCA 4YELA 5J1UA 2OD5A 3A8JA 1IN4A 2D1VA 3WQZA 2LKSA 4JOMA 1KU3A 2TDXA 2PMUA 3PL8A 3S16J 2KT0A 2BF4A 2V9VA 2DQRA 2YPRA 2PLYA 3PIPF 3V7RA 5GAEJ 1IN6A 4IHVA 1JJ2B 4WF2A 2FUG2 3C2BA 1YE9A 4FX4A 4M3FA 2KKOA 1OCTC 3HG9A 4IQ4A 2NSTA 1T95A 2XNCA 2Q6IA 1LVKA 3T56B 4CZCA 3KLNA 5L3CA 1WJDA 3CTAA 1E2XA 3CP2A 4CCNA 2P5LC 3OYBA 2VJJA 1VTNC 3ZC3A 2KVOA 3B73A 4Z6YA 5ICEA 1LE8A 1WSRA 1FTZA 1G3TA 1DBOA 4R71A 2L01A 1JUSA 3WYAA 3QPSA 3GTKJ 3FBIB 1IXCA 1NH3A 2XGJA 2XKOA 4U49A 2LD5A 2C5HA 2QUFA 1Y1WJ 1QGZA 2F5VA 1ZRFA 2F4OB 2MG4A 4BQNA 1IHMA 4KKTA 3F0CA 4Y13A 4IO9F 3VR6A 1IDZA 3IRQA 3E6CC 1EZGA 3I64A 1LLZA 2X4HA 1P7JA 1TNSA 3WTXC 3CJRB 2HQAA 1I3AA 1USTA 1QZYA 1U5TC 5D4RA 4ABZA 5K5QA 3GTJJ 2OJED 3IAM2 1IRZA 4MYTA 3TOAA 5LBQA 3CC7B 1PE9A 4KN4X 1SVMA 2AXTC 3RQ4A 4G7XA 3OL3A 3N6ZA 3LFUA 1PUEE 2R4GA 3PFYA 4R79A 3HPHA 2XRLA 2RAEA 1F60A 3W5HA 4OPWA 1FOYA 2V6CA 2VXDA 1A04A 3FK6A 4WZTA 3DWLE 1ZM2A 3W2IA 4JYKA 4UVBA 5D5VB 3GIRA 4LMYA 2K9QA 4Z4YA 1BN8A 2E36A 4OJ5A 1RRJA 4BBRJ 1H85A 1VQKB 2HPIA 2JJ7A 2QN6A 2A6TA 1NK3P 2M5SA 2BZTA 2R7RA 3LFKA 4ZZDA 1EP3B 4OPOA 3OYNA 1T08B 1ZYRF 2DYSH 3P26A 1ON1A 4UV8A 3GZ5A 2CV1A 4LIUA 1BR1A 1S7EA 2DMPA 3H0GJ 2OC6A 4N3GA 2M45A 2Z1DA 3CCUB 4UUVA 3EUHC 3IP4B 2IA0A 2DYRH 4ASNA 3AVVA 1BIBA 2CW0F 2EPFA 4HA8A 5DCMA 3H09A 1OMIA 2HKXA 4C0SA 1IZ1A 3ZQ7A 1FNNA 5IYBJ 5IYPA 4RDKA 1VQOB 3CCJI 3CCLB 3A8IA 4EJVA 2KISA 2WADA 2ZMEC 2V4DA 2CK3A 3DPLC 1UMKA 4MEYF 3HXLA 3VYUB 5HOOA 4CA0A 1N77A 2PJPA 1LM1A 3QWLA 3GFIA 3ZSCA 4UAJA 1ITYA 5BSYA 3U9GA 2M3AA 3K70C 1R6RA 4JX5A 3WE3A 2ZL7A 1XGNA 3ABTA 5J4YA 1JHHA 3ML3A 3NB2A 1B9NA 1LJ9A 1EH6A 1OFEA 5J3OA 1KK2A 1ZELA 2K27A 4BEHB 1BR4A 2QX3A 4YXWA 4BDZA 3NWTA 1K79A 3ZBUA 1S72B 4S04A 2P7VB 4WX9A 2WB1A 1U9OA 1WHUA 1TTYA 2IBDA 3HOZJ 2VOOA 3J7AO 1VQLB 1OFMA 4Y7CA 4J0QA 1I8DA 3WNDA 1KU2A 1EV7A 4PGOA 4G6QA 3RJPA 1HKQA 2F4IA 3I59A 4Y4RA 2ZZFA 1ZM3A 3ZCOA 3LOCA 5K7ZA 1TP4A 2E71A 4RB1A 3DP7A 3JAMK 4D0PA 2GQFA 2EK5A 4A3EJ 2MFZA 1XB2A 1E3HA 2BW3B 2X6OA 4OU0A 1YX5A 2Q8KA 1E43A 3CCRB 3UR3C 1E1QA 3EQNA 2QSGX 1WVRA 1B72B 3RKYA 3AL0B 2QTZA 1XGOA 3W6KB 2V7WA 3CC2I 2ZL6A 2L9SA 1IUFA 3SQNA 3JTGA 1E0EA 1IJFA 4HNUA 3M9AA 4P22A 2DA3A 2QGUA 4BAYA 1CZFA 2M8EA 4EVIA 2LY9A 3DDYA 2AHQA 2FQ3A 3ZMDA 1MNDA 4DZJA 1HLVA 4ESBA 2KL4A 2NPFA 3Q38A 1VF7A 3GFJA 2VNHA 1S9HA 4I84A 3ZMTA 5IT9K 1IB4A 3BZKA 4ZYHA 4A3FJ 1Z6RA 3A3GA 3JQPA 4QPQA 4HF1A 3J81K 1OR7C 1UFMA 1X3ZB 3SZEA 4CYCA 5IOYA 4XRMA 1U5TA 2VPRA 1JB9A 2CBXA 4AC9A 2MC3A 3RSNA 5J8CA 3MAJA 4PCQA 2QKMB 4EJOA 2A69F 2BGIA 2UVFA 2JUGA 4DW6A 3BR6A 5HXBA 1VQMB 2NVQJ 1UD6A 3MZ8A 2QSFX 3K2AA 2ZJQF 3IH4A 3IAS2 2HXIA 5LHIA 2R92J 2V79A 2OK8A 1SD7A 3BQJA 3S32A 2F4NA 3ULQB 4HG2A 2KIQA 3IH3A 5EZGA 2BHZA 2LKPA 2DPDA 5ICCA 3W2FA 1YI2B 5J35A 3LMWA 5CYVA 2JA2A 4UUSB 1QG0A 1Z67A 5DNSA 3K70D 2KLOA 1D0YA 2KMUA 5C1EA 1DP3A 3K6GA 2EV6A 1QUFA 1XQBA 5JLWA 2XB5A 2XAFA 1P4XA 1TYUA 5DUIA 3D26A 2H8RA 4EJUA 2EZLA 4ITVA 1PVEA 5DN6A 3NQOA 4NDLA 4U0WA 4Y15A 2OK7A 2XAUA 4LBZA 2X6YA 3CZ6A 3J81k 4F52A 4DZPA 3OS0A 3I56B 1FIPA 4YHBA 1ZHFA 4ON0A 3GTOJ 3K9TA 4OOSA 2XPUA 3AG2H 4JMQA 2K7LA 2J8KA 5FLXK 1GVJA 1HVXA 4HEA2 5F0CA 2DA7A 3QOEA 1YW7A 2CQNA 3LSHA 1VHOA 3I4MJ 2JSPA 4ZYDA 2R0QC 2O0WA 5HZBA 2EQRA 1WP6A 5EEAA 3LJYA 3OW7A 4JBAA 1YLFA 3WTZA 5B5EC 3PNTA 3JAMZ 3GLXA 2K9MA 3DF8A 2BHYA 4XR6A 4RD0A 2UXXA 3VO1A 2ZMEA 1TQMA 5K5RA 1HW5A 1T6XA 4F55A 4RCZA 2NS8A 2L2OA 1DU0A 2QA4B 4B3XA 1LDKB 4CSWA 5KAFC 1IJWC 1WOPA 2IS4A 5ILSA 2PECA 1QO0D 1IUYA 3FMSA 1YG2A 1QZEA 3OSGA 3K1NA 2XZPA 4AF7A 2NSPA 2OCEA 4XN3A 4TV7A 5L3FA 2Z9OA 2RNJA 3QU3A 4Z2YA 1RUOA 5A2QK 5EYRA 2AHOA 2W7ZA 1J2XA 2E7XA 2FF4A 4P96A 5IT9Z 1Z21A 3ZIAA 4ZGQB 4D7MA 1XDUA 5EGOB 2DFIA 1U8BA 3LA7A 3VPRA 4KT6A 1BW5A 3BY1A 4LBYA 4AVPA 4Y7NJ 1D0XA 3CUQB 1EWYA 1MNMC 4GYGA 3BP8A 4F7ZA 3BTJA 2FEZA 3I59B 2RGVA 1V4RA 3MD2A 4RPBA 3PQKA 3OSFA 3PSIA 4BKXA 1K83J 2DIEA 3S93A 4YIRX 2WPDA 2KFDA 4L0YB 1G2HA 1LEAA 2M4KA 4QFMA 3BC9A 4B47A 3NWSA 5EG0A 4LB5A 4ACBA 1W0JA 4DQLA 1K6YA 1ZTRA 3AG3H 5GADJ 2ISZA 2F6CA 4RGSA 1K8FA 3W2WA 5LHGA 1T6SA 4KT5C 2IVMA 5FRNA 2YX7A 1Y0NA 1R1UA 2D5VA 4JX6A 2P6TA 4XLNF 3GZ6A 2ZJRF 3PSFA 1MMNA 1UG2A 1N06A 4PGGA 3MCAA 2R9VA 2QXZA 2XC7A 2AO9A 1X58A 2MD5A 5B66C 1W0TA 1R4MB 3OWTA 5JHUA 1EF4A 2RC6A 3MN2A 2LMDA 2V1UA 2CC2A 5AONA 3C3WA 4HQMA 4HW0A 2BEOA 4U0YA 1U5TB 4HLYA 1GJRA 1ZG3A 1OR7A 2WA0A 2BXZA 4Q48A 1YQAA 2Z99A 4L9NA 2BBYA 2H09A 4QSHA 4Z4UA 1MZBA 1HSJA 2EIJH 1SVOA 4NK8A 1TTTA 2V31A 3SJMA 3CCSB 4ZGNB 1KU7A 1B59A 4Q7JB 2FMYA 1FX0A 2C2WA 2CNDA 5FD5A 4HOBA 2XB0X 4MYUA 5L3EA 2K4JA 2ZXWH 3V42A 5GP9A 3LQRA 4NK6A 1UHWA 4PJ0C 1YJWI 1KK3A 4UB8C 4Z4ZA 2EZHA 3F22A 2CRVA 2GOMA 1O7LA 4HLXA 3I53A 4MQVA 2IRFG 2LDUA 2ZZQA 1O8MA 4M3EA 1NHAA 1VQ7I 1Z3XA 5KNLA 4KA4A 1F20A 4WCGA 2OZ6A 2R7XA 3E5XA 3S3MA 4M6YA 1QHGA 4P55A 2V5IA 4JK1X 4B44A 1KQ8A 1FRQA 2NS7A 3ZMZA 3EPZA 2XUBA 4Y3OA 3HGYA 4LOCA 2VODA 1G7SA 2ZCWA 5F4MA 2CWEA 3R0JA 2ZL5A 1MKMA 3IKTA 2DFEA 3TOBA 1D1CA 1R22A 5A2QZ 2HMAA 5J8FA 2DT6A 4GRIA 4N9IA 5DM7F 2AS5F 1AKHA 3W5UA 2I8DA 1A36A 4A0XA 2X6WA 2K02A 2YUSA 1EFCA 1B1BA 3NE5B 1GVHA 2E35A 1ETYA 2MW8A 4ESFA 4E7JA 3SXYA 5TISC 3FY3A 3VMWA 1D2EA 4IEJA 4IHTA 4B3FX 2CH0A 1E79A 2R5ZA 1GR1A 3GYHX 1HW2A 3UNGC 2ZSHB 3H36A 2M1BA 4KYWA 4W8RA 4P9SA 2DETA 4Z05A 3TP0A 4HF2A 2ZC2A 1EFUA 1TYXA 4EQQA 2L3DA 1VQPB 3EYYA 3CW2A 5HNHA 1ZG5A 1LQ1A 2O61A 2HFHA 1BI0A 1YFHA 3T1BA 3VB2A 2GIZA 1GUUA 1VQ5B 1OYWA 1OYIA 4OP7A 5LFAA 3PETA 2E2HJ 1RI7A 5HZAA 3ZPLA 1IV8A 4EGZA 2WBMA 2MYSA 3KEYA 4OAYA 1Z0XA 4XLAA 3BPVA 4RM2A 1D5VA 1HCRA 3G71I 3ZR8X 2ZJPF 1WH5A 4YRVA 5L3BA 1DABA 1WCMJ 1QPIA 1O7FA 3OW2B 3KE2A 2WY7Q 3ZQLA 2CQXA 4NNJA 1E3OC 5FO1A 2KIUA 2YWGA 4P9FA 1D0ZA 4WXHA 4CICA 1LDJA 3L00A 3Q39A 2MABA 2HDNB 3RQIA 5E17F 4XKVA 1H9GA 4IHWA 1DDIA 3ZQIA 3L09A 2DT5A 2V7XA 3Q5FA 2IS6A 2DW4A 2XAQA 5BSXA 2XT2A 3KYCB 2JIZA 1KONA 3KP2A 2JVHA 4CDGA 2LBFA 1XFOA 1QVFB 3CPWB 1NG7A 2IOUG 2ECCA 1IG7A 4BXUA 1CQXA 2K9LA 1VQ8I 2CW7A 2HQNA 3PQJA 2CGPA 1J9IA 4E7IA 1R7JA 1QRBA 5EJCA 1V5VA 3QRFF 2KDOA 1X1AA 1Q7YD 5EMNA 1T56A 2JDIA 2ZXJA 1QA1A 2DK8A 3HTSB 1W7PB 1OQYA 3H9QA 4MGRA 5KW9A 2LC2A 2K85A 3K4BA 2JPBA 3S1RJ 4XKCA 5H5JA 2V7TA 1YIJI 3ZBTA 1ZAOA 1TW3A 4A5NA 4E6KG 3RZOJ 4CZZA 2O0VA 2QDXA 3SHFA 1X2MA 2PQ8A 2R3SA 3O2PE 3TDUC 4AYBN 3BH4A 4OJLA 3N97A 2IS1A 5KAIC 1PLUA 3FHNA 5ILVA 2OTJB 1B6AA 3CO7C 4NQWB 2X9DA 3OIOA 1KCCA 1EH7A 1JUMA 4BXXJ 2QY1A 3RKWA 2PYGA 2GZWA 2ME0A 2DPUA 1QGPA 4R8HA 1QPMA 1X4OA 1Z77A 4Z4WA 1HKTA 1QVGB 1DU6A 2WAQN 5LGTA 2E2IJ 5F27A 2DT7B 3Q0WA 2O3FA 3QODA 3GTGJ 1ETXA 4W8TA 3E0JB 4H9GA 2VBKA 1QNTA 3CCQI 1A5JA 2EB7A 1MH3A 4PC6A 2VQCA 2LLKA 4H0EA 2E1RA 4RAYA 2V1DA 3FKIJ 4OOXA 3Q9SA 1WU8A 1OCRH 2M7BA 3GFLA 1JHFA 3F21A 2HPMA 1MABA 1F9NA 2ZTGA 4Z1MA 4G8XA 1E1RA 2OTLB 1TYVA 2KQRA 2XC1A 2NNYA 2VBUA 2NVXJ 1BQEA 1JRGA 3A01B 3HC7A 1BX0A 1U9NA 2FD5A 5FKKA 1IAWA 3WTWC 2B0LA 3LSIA 3VWBA 3OFNA 3AVUA 1VQNB 2UVEA 4XLPF 4OJOA 3PNYA 3T9GA 2WV0A 2ID6A 1W1WE 3FXJA 2JA6J 2IS2A 2OYNA 3WU1B 3HYIA 3WU2C 1DGRM 1JJ6C 4BY1J 4P12A 5AIPA 4MLOA 4Q4ZF 2L0KA 4II3A 4UB6C 2EV5A 5BPDA 2ADUA 3QFTA 4RB2C 3G4SI 2D45A 2BY3A 3HBLA 4AYBA 2VC1A 3IL2A 2K86A 1APLC 4C2TA 1Y0YA 1R9TJ 1AWCA 1REPC 2FMLA 1K4ZA 2ZNYA 4LK1F 1ELOA 1O8EA 5FFZA 3CMEI 1W0UA 1MNEA 2D3NA 1XG2A 2VQGA 1HOMA 2EV0A 2LNBA 1OCPA 2UV1A 2XAHA 3CESA 1WPCA 1XMXA 4O5VA 2PBIA 1LNWA 3PUMA 1XE1A 1QX4A 3P4GA 1VZ0A 2WAQA 1XS9A 4FWTA 5ED4A 1CF7B 5IOZA 4OOIA 3KETA 1M1KD 1UAAA 5HVQC 3HHGA 2RC5A 2GXGA 2L7FP 2IP2A 2LH9A 2Q1ZB 2QQ9A 2FNPA 3JW4A 4L9TA 1H8AC 9ANTA 4ACAA 2L54A 3CC4I 3AKZA 2MA3A 2DXIA 4HE6A 3ABLH 3ISXA 1BI1A 2ZTNA 2KIFA 4MHGA 2VBYA 2VE8A 2Q2EB 4RGUA 2XF5A 1N0UA 3HRUA 1RMGA 4BHPA 4CCOA 1SD4A 3BWGA 2EA4A 3OEHA 2Y31A 2LYCA 1R00A 2Z16A 2VE9A 4ZTJA 4WZLA 3B78A 3OR1C 3U6BA 1R49A 4AM3A 3HB9A 2ACJA 2ZKZA 2ELJA 5FRMA 1J09A 1Z7LA 4LITA 2ZFWA 2DFHA 4ANJA 1X19A 3OPOA 3PSZA 2WYRA 3TGNA 4EM1A 1HW1A 2VL8A 3GRHA 2E5ZA 2VOPA 4CCJA 5JI6A 5TGTA 2QSHX 3R61A 2HDCA 3R4KA 3CCEI 1GDTA 3PO2J 3V8KA 1O3TA 4FASD 3GVKA 3IH2A 5TY0A 2O17A 5AMVA 3JTHA 3JRHA 1I50J 2W6JA 5IPAA 4Z4VA 1WJBA 4CXFA 1WTHD 1YW8A 4IZZA 1O3RA 4V19K 4BBSJ 2VBTA 1GHCA 4IOAF 4BL0B 5DS0A 3GZNB 5LEJA 3W2GA 5GAHJ 1SFOJ 2E2JJ 3GO5A 1COWA 2QTLA 3DFGA 3GQBA 4W97A 3WBJA 3FX3A 3LQ6A 4QLCU 4A3JJ 3SUCA 3PJRA 2IAIA 1SMYF 2HTJA 5CVUA 1SFUA 3R0AA 1B8IB 4M3DA 1PJ6A 2KPMA 2R5YB 2HVQA 1EXMA 2Z5UA 4EMSA 2GK7A 1TLLA 4LB6B 5FKLA 1OISA 3OYDA 1JE8A 1FOWA 2R6HA 4A6EA 2WJVA 2HKOA 3ZZ0A 3RCOA 4E7SA 2KDZA 3J7YJ 2DLLA 4RDUA 4S05A 3DLAA 1A6IA 2HQ5A 2H8WA 4M3BA 2EZKA 4MXNA 1NK2P 1LDDA 4FN5A 3BCAA 2DJIA 1JT0A 2R7OA 4BEHA 1YJ9B 4I7HA 3G6EI 4A3CJ 1IN5A 2L7MP 4R1HA 3MEXA 5GV7A 2GJPA 1HKSA 1UZCA 3CUQC 5LRSA 4LLLA 3L7WA 2ICWG 3FZVA 5IK2A 2LY1A 2NNNA 1U0JA 3F8BA 2F5EA 2VNIA 2X0LA 3HOWJ 3Q6QA 3GWZA 2EFPA 2L4MA 2L9VA 3DKYA 3PUBA 1WOOA 3X2QH 1I6HJ 2LR8A 1R71A 1LPQA 1IV6A 4CYDA 2YWHA 4BJ6C 1IC8A 2DFFA 4RAGA 2GXBA 1MJBA 2QKLB 2NAZA 2WV1A 4OWRB 2C78A 5K1YA 5E1WA 4ASUA 1Y56A 2NTBA 4B4CA 2STWA 2BW3A 1KRHA 1Q82D 4UNOA 5JR3A 3ELKA 4KDPA 2W25A 2IJLA 1OCZH 3U1KA 4C2MJ 1B72A 1Z1DA 4IRIA 3VDXA 4G12A 1OPCA 4P26A 1VLOA 2XDVA 5EEGA 1ZM9A 3K69A 2PMZA 2CQ7A 3K4KA 3D0SA 5CJ9A 2Q6KA 5A8AA 1WDTA 3H35A 2JMWA 2ZB9A 4B8XA 2DAOA 1ONVA 1CQTA 2Y9YA 1NDHA 4ZTFA 3P9KA 1E63A 3OJXA 3ABUA 3VOEA 4IHXA 2CU7A 1E3ZA 2NVUB 4CGZA 1XN7A 4F92B 1T38A 3WXMA 1BLIA 1PUFB 2M0MA 2P6SA 2XV4S 2VIXA 3CCVI 1FNDA 4UZUA 4C2LA 2CQQA 2F4MB 1N25A 4OZYA 3A3BA 2I5UA 4A2UA 2WSSA 5DTDA 4RCYA 1WGXA 1KK1A 3H3UA 4G7OF 1XX5A 2P81A 4LJZF 3CC2B 5E79C 3S8PA 3J7AY 2BYVE 3S1NJ 3ONYA 2NOJB 3GTLJ 3OE7A 4BYYA 2JTVA 3KZYA 1IGNA 2ELKA 3GCMA 1IN7A 2GAUA 4D7NA 5DS9A 3ZOBA 3GQ9A 1QUEA 2W82A 4UUSA 1X3WB 1STZA 1Z3YA 4TMXA 3F8FA 3SFZA 4N9HA 2EFQA 2XIGA 3K0LA 5M3FJ 3MMYB 3JRGA 4XRFA 1BN5A 3QPLA 1FBSA 3BG9A 3IV5A 4HWVA 3LSRA 3IKVA 3LSJA 2GLOA 3KEQA 2IT0A 3OYKA 2XEXA 3I1FA 3KLOA 5J1YA 2AQEA 2P5VA 4CO8A 5BQTA 3FXKA 2BSPA 1Z05A 2M30A 3R6JA 4UZFA 3FMRA 5IY5H 3FHZA 3DEEA 2C4UA 1YJNI 2CV2A 2D74A 4RD6A 1P92A 3E97A 2FBHA 2MSYA 2XPVA 4AWXB 1OB5A 2XF6A 3UW0A 3LQQA 4GQNA 2BV6A 5DSZA 2X51A 1UHMA 2IEKA 1KQ5A 2DOGA 5B3SH 4XNFA 3KL9A 5DD4A 3DQVC 5JFRA 5FD6A 3FKJA 1H8EA 3ZMVA 1OGOX 3L2UA 2YU9J 1TW2A 2Z3YA 3P5JA 2RREA 1T0FC 2HZDA 2LOOA 1LUJB 2G9WA 3R60A 5FKOA 4TMWA 4KH3A 4BHBA 3ZRGA 2EFWA 2PX9A 1MJ9A 3V7SA 3WGIA 4EJTA 4V02C 2LFBA 4GYIA 1MBKA 3BCBA 4M0LA 2X48A 3K4JA 2ETHA 2JVGA 1RKWA 1BX1A 2ZZEA 3SEJA 1O88A 2IA2A 1LFBA 4RB3C 3D5RC 3G2BA 5EGOA 3FM3A 5HLHA 3CJTB 3OIQA 1XD7A 3CUQA 3F8NA 3HRSA 3VSLA 1KQSB 1POGA 1G3WA 1D1NA 4BJTA 2L7ZA 2JJ2A 1MW7A 2KIMA 1QFZA 4M4SA 2FU4A 4PC7A 2IPQX 4X0CA 4N3NA 4DNRB 1QH0A 2B9SA 4Q5SF 2O6WA 2VKHA 4U4BA 4BDYA 2ESHA 3A4CA 1SC7A 3E6DA 2QQ8A 4HF0A 4RS8A 2NZMA 4MIMA 4WWCA 4YZAA 4DYRA 1YHQI 3CDIA 4NCNA 4ZCMA 1SMTA 3BJ6A 3CC7I 1HSTA 2OQRA 3AGPA 2FE3A 2IGNA 5CVRA 3F9KA 5TRDA 3M4OJ 1K73D 2MLGA 1I7PA 1KYWA 2LP0A 3L2RA 3S1QJ 3KYDB 2X85A 4P6YA 2UUZA 2W7NA 3VNVA 4A69C 3W2EA 1LFPA 3TO9A 4OPSA 2V26A 1IDYA 1S6LA 1UHSA 1BI3A 4DNCA 4DOZA 1RKTA 1HC8A 5BNGA 1IRXA 4AUXA 4L9JA 2RNGA 3VYSB 3WG9A 4ZDOA 3LO8A 4RD2A 3AK5A 3HL2A 1QVTA 4C3HJ 4TMTA 3IWZA 1JKOC 2XGCA 3ML6A 4XLHA 5J1RA 2VKDA 4N4NB 1U2WA 5DCFA 3SZTA 4NC7A 3BDDA 1Z9CA 2RVCA 1JGGA 3QOPA 4O3MA 2XRNA 1TYWA 1QA2A 1A8PA 2QYUA 3AVTA 2V9KA 1PKVA 4DQKA 3FBNB 1RQPA 2CS3A 1OCOH 1Q1HA 4G1VA 3LSKA 2F1LA 5F0HA 1ZGAA 2EA2A 3HSEA 3JCUC 3MKWB 3DLLF 3OAAA 1B23P 1PDNC 1TVCA 4HBLA 3Q0UA 1KZHA 5DV5A 5DEQA 2DK5A 1ZR2A 3GXOA 2PIAA 4RD3A 4ENKA 1M90D 5E3LA 1T8IA 1HA3A 1KZLA 4ZZLA 1R36A 2IGOA 1O3SA 1IA5A 3HPGA 3EUHA 4ZC3A 3L1PA 4RDLA 1QU3A 2JUCA 4RGXA 5L3DA 4DNTB 4KJZA 1YJWB 2FRHA 2Y69H 2P5KA 3CCLI 4EGYA 3BY6A 2M0CA 1TLHB 1J7KA 2YR2A 1JJ8C 4UY8I 1VQ7B 4EW9A 5TV2A 3OS2A 3BR1A 3NEUA 3LA2A 4BACA 1GAWA 3P7NA 4LBVA 2QZAA 2X6XA 3H1CA 4Z03A 4A3MJ 2X53S 3CB4A 4EM2A 3BG7A 3BCFA 4NBSA 2NT6A 1SANA 1E17A 1A6QA 1HBXG 4E4HA 3WTYC 2NS0A 2W48A 5C1CA 1FSEA 2HWVA 1T0FA 2G7HA 2HZTA 3KP4A 3V76A 2PLFA 3SQVA 2IQ7A 1VQLI 4ZDLA 4YIFA 2R7TA 1WWXA 3WTVC 2DMUA 4WK8F 1LEBA 2P8TA 4YAUA 4LG3A 1Q9SA 2DA1A 1BA5A 1XDSA 1OGIA 5FIUA 1W7PD 4LIVA 4HZFA 1F5TA 1V0EA 1D3YA 3BR0A 4B48A 2EWNA 1VF9A 1U2RA 5GPAA 1BOBA 2CFXA 1VQ6B 2D1HA 3HGGA 4YAOA 3H5NA 2DMQA 3FWEA 4MNUA 3T8TA 2Z33A 4RD1A 1P4WA 2M4GA 4M71A 4PFOA 1KYZA 2G7UA 1UD8A 1R5ID 1MH4A 3CCRI 5F0FA 4XD7A 2ZBKA 1X1DA 4BXFA 3HOSA 1KCDA 2QEXI 3CXCB 1WMRA 5IYRA 3RDIA 3DCFA 1QBJA 2LTPA 3H92A 1I18A 2X1CA 3TMOA 3A2KA 1MBHA 1MJAA 2JJ1A 4BNCA 2CUFA 2P3MA 4WZKA 3BROA 1UJ8A 4KMUX 5D8KB 1E3XA 5F64A 1XGMA 1D8JA 2INVA 1DDNA 3ASSA 2XTXA 1FMVA 3M3YJ 2NVTJ 4KIFA 5FROA 3WODF 5GPCA 3PO3J 3G1OA 1T6ZA 3ZMSA 4PABA 3VSUA 1MBEA 4MTDA 1ZM4A 1OB0A 4IOCF 2MC4A 2VPLA 5F04A 3L2CA 1O4XA 1BOAA 3BZCA 2CO5A 3REOA 1JA0A 4M9SA 3G71B 1P2FA 3OY9A 3ASOH 4XLEA 2BM0A 4WWVA 5H59A 2B7BA 4BY7J 1BI2A 3ECHA 4BQOA 1JA1A 4C43A 5B6IA 4OIPF 4FTHA 2FXAA 4FE4A 1W7PA 3B6CA 1MMSA 5DYMA 2VB6A 3TKYA 5LLQA 2K3FA 4D1QA 2DBBA 4PGHA 1ZLKA 4XIDA 2ODLA 1JGSA 4TT3A 5AIQA 2FBKA 1N05A 1G7CA 1T6YA 1O8JA 4G1BA 3G1LA 4EJWA 2KRFA 3OMYA 2DMTA 1NRKA 1WORA 1J5YA 3HRMA 1W0KA 1V54H 4NQWA 4BS9A 1VQ8B 3M8EA 3Q0VA 1ZG1A 5KK1A 2E7WA 3DEUA 2VC0A 4L5IA 4QWQA 2LKXA 1NHCA 1MSEC 1TT5B 1SAUA 3BJAA 2Y30A 3H5AA 2W4SA 3CDLA 3MKYB 2Y9ZA 2D3LA 3L9FA 2P7CB 2XSDC 2LF8A 3TL4X 3PIOF 2VT2A 4JP0A 4RGRA 2QMUA 2CG4A 5FO5A 1YIJB 1BL0A 3A1YA 1X1CA 3CUOA 4U0VA 1KU9A 2Y0SN 2KP6A 4UUTA 4D9JA 1YOVB 4XKBA 2VI6A 1K4SA 2VFPA 4KICA 2BSAA 3EUAA 3SYTA 4FT8A 2QWWA 5FLVA 1DBGA 1K78B 1YLOA 3ZP5A 1BW6A 2HOAA 4YG2F 3A01A 3S2HJ 2M34A 1UB9A 5J3LA 4C30A 3E6BA 4ENNA 4MR0A 1NG6A 2EWEA 1SFEA 4XICA 4YEIA 1PJ5A 1O8HA 3E20A 2X1EA 3QYEA 3T51B 2PMDA 2PJRB 2W1OA 1O8GA 2XZOA 1XGSA 1SFKA 3HIFA 1AMOA 2OUMA 3I58A 4MO7A 1J59A 1ZRDA 1G7TA 4OIOF 3AVWA 1TSPA 5D5WB 3B82A 1RETA 3A0BC 2HCJB 3VSTA 4ZDPA 2WY8Q 2XF7A 3TW7A 3CCQB 2W6IA 4X7EA 4E7KA 3SLNA 1O8LA 3CMAI 2E1CA 4MFEA 4JQFA 4BE0A 3WY9A 4NC6A 4KIGA 1N07A 3G1MA 1V5EA 1MD0A 3TP3A 2BVMA 3LA3A 1BR2A 3GSIA 5L3GA 1G8XA 4E7LA 3W2HA 4UHTA 2QBYA 2A05A 4LGWA 4PUSA 1SFXA 1OYYA 2VT3A 1KQ0A 3F23A 2IXSA 1K61A 2QM3A 4E0FA 1TUIA 2EFGA 5E1ZB 3HZJA 3RIRA 1CF7A 2CJJA 1FJLA 3HUGB 4W8QA 4Z4SA 1FPQA 4ENMA 2QQAA 5C3EJ 3U2RA 3TO6A 3L2VA 2NV4A 1WXRA 3HSRA 3FXOA 2Q2EA 3ISPA 1XSXA 4RB0A 2HNHA 4X1EA 4GDFA 3CMEB 3DBHB 3AVXA 2NXNB 1EJ9A 1IRFA 3H9NA 1BBYA 1KTWA 5A88A 2VASA 1ZARA 1EE6A 2VONA 1U3EM 1O8IA 4XLFA 4BE2A 4D5FA 4TSFA 3U1DA 2X3UA 4A3DJ 2K40A 2EBIA 2WZNA 3Q3SA 4BPRA 4IRGA 4U9UA 3V7CA 4UVAA 2WWYA 2B7EA 2PFBA 4HNTA 1L3LA 4HE5A 4CCMA 2NVYJ 1VJSA 2F43A 5E6TA 4OZZA 4YEJA 2UWMA 2VNKA 2BX6A 1BC7C 4ZYGA 3CC4B 2V7UA 1V0FA 1SD5A 2CUEA 2LK2A 3NARA 2PEXA 1S29A 1G4DA 1RR8C 1S7AA 1YX2A 1WSVA 5CPRB 2ZNZA 1WKMA 5D5XB 1RWRA 3A0HC 5FL7A 4HDVA 4K2EA 5FLMJ 4P5OA 1KQ9A 2K9SA 4XN0A 1ZN2A 3JU4A 3B8HA 2V1NA 3BLYA 2YU3A 2DDAA 2H27A 3OYLA 3S17J 1GO2A 2BVLA 4AC0A 1VHEA 5JLVC 1Y6IA 1XG1A 1D8KA 1IDJA 4IVNA 2LSOA 3ZXSA 2G0EA 4IRHA 4B3AA 1OFCX 1YS6A 4RPDA 4I02A 1G3SA 2HYGD 1B8IA 3VSKA 5E8IA 2X0KA 2AQFA 2FSWA 3HKZN 3NAWA 2OV7A 2R5YA 4CHUA 4X7FA 2Y75A 3DTEA 1IJEA 4TKOB 1OGMX 2W84A 3EYIA 3CCEB 2Q0OA 5HNFA 1L0OC 1GQ8A 2V1XA 4GXOA 1GT0C 4IQJA 5JLXA 1QFJA 4LLNA 2FNAA 4I76A 4AD9A 2QVOA 4RA2A 1SVLA 5IYNA 3F72A 1MDMB 1R5NA 4BQAA 2XASA 5DD8A 1VQ4B 1IW7F 1HXDA 1V3FA 4A93J 3CMYA 3KP3A 4W1UA 4RLQA 4OINF 2VBXA 4A3LJ 2GPJA 1L1IA 4QVAA 3IWFA 1IXSB 2VKEA 1LFUP 3QYFA 1Q81D 3ASTA 3L2QA 3MKZA 2F3LA 4XOTA 2RV8A 4P6VF 5CDFA 1NJID 3BG5A 1SKQA 3ZQQA 1VQPI 3CDHA 2YWEA 4XKWA 4I01A 4PSWA 1JNYA 2NYXA 1H8HA 1VQ5I 2HLDA 2W00A 1FP2A 2EILH 4OOVA 1UG0A 3GX4X 1YTYA 3S1MJ 4HQEA 2A5WA 2DQLA 2BY1A 5A89A 2MGQA 2A6HF 4A3IJ 1XB4A 2XROA 3DTKA 1UMQA 2O8XA 3MQ0A 1YIOA 3NAUA 4MEXF 3IUOA 5BPIA 3I4NJ 2ZBUA 3A35A 5KSWB 1WH7A 3G6EB 4PK4A 1HF2A 3DEWA 2ISYA 2A6EF 2CW8A 1BJKA 4QHYA 1YX3A 2XSJC 2QBYB 3MWMA 5BOXA 1K7AA 2HOSA 1FOXA 2PG4A 4PAAA 1EA0A 2X3HA 2IA1A 3PFIA 2W85A 4BUPA 2BM7A 4X07A 2OU2A 2L5QA 3BJOA 4X7CA 2PYHA 1UELB 1PUFA 3O8GA 1U78A 4EM0B 3A02A 4F7DA 3FXMA 5ICFA 4CH7A 4HX7A 4CQJA 3U21A 1FP1D 4WXDA 4E7HA 3H3VK 1ULYA 1PYVA 2HDWA 4G6DA 3TDZC 5D4SA 5GAGJ 2O0YA 4K1XA 4ROXA 4IKFA 3DV8A 3OYAA 3F6OA 2DCUA 1W87A 3F8CA 2F48A 2VZLA 1LVAA 4X7DA 1Z91A 2RQPA 4I09A 3T53B 1VQ9I 4XOPA 5GV8A 2B5OA 1YITI 3V8JA 4FCYA 2ZFUA 4AU7A 4G7HF 1D5YA 4RLZA 2G0YA 3I71A 2ZJ2A 5D6EA 2X8KA 1YRNB 4IHSA 3KP6A 4PDKA 1JKQC 3HDDA 2VUMJ 3E5QA 1GV5A 2E60A 2DJNA 2EIMH 2DA6A 2O03A 3HOXJ 2FX3A 1ZKGA 4ZYAA 2V7VA 4KKSA 3J80Z 2ESNA 4IHYA 2NOGA 3HM5A 4A3BJ 3JQQA 3CCVB 2FA5A 3WWGA 4G9YA 1Y0RA 1NBMA 2WZPP 3T0YA 3VEPA 3H9JA 1G6NA 1K4TA 3M1EA 1R5HA 4PSXA 1TT0A 4X0GA 3DPTA 2LY2A 2HQRA 5F08A 3QSYA 1FIAA 3RKXA 3CD6I 1N8RD 1GLNA 2ZXIA 1HZEA 1W34A 4YIIA 1MRZA 1R5GA 3SJPA 4MQ9F 3V7AA 3QFSA 1R5OA 2V6EA 5HLTA 2RN7A 1J9ZA 3ZN1A 4EV0A 1C0WA 1FBQA 2DOFA 1TQPA 3H5RA 5LD2C 4FQGA 2V9PA 2XT4A 1FX7A 1FWZA 3O3KA 4M6VA 3M8FA 3L2WA 3LYCA 1SKYB 4NBQA 4EEFG 3GMEA 1G3YA 2BY0A 3JRBA 3S15J 1N08A 3B6AA 1XCBA 3HOUJ 1XCVA 2JA8J 4RJLA 2L7KA 2VFMA 4XK4A 2ELHA 3SDGA 3GQAA 4L5JA 4I99C 5D6FA 1T98A 1YJNB 1N0VC 3OL4A 1IRGA 3JRIA 1SM4A 1ETOA 3K4MA 1DPUA 2C77A 2R7QA 3CPXA 1AIRA 3HTUA 1H80A 3N90A 1PP7U 1X1PA 4L5EA 3WE2A 3G3ZA 3CCJB 2XGXA 3HSFA 3OIPA 3P27A 1QQ1A 3BQYA 4LLGF 4UZEA 2XNJA 3GQ7A 3QYBA 1TC3C 2R7UA 2R7VA 3SKBA 4OAZA 2YUHA 5K5OA 4HSRA 3K4LA 4UV9A 3ONUA 3JRFA 2CMPA 3UKGA 2DOAA 5HLGA 2K5CA 2QZ8A 2BV3A 3FPPA 3EQLF 3WTTC 1Q86D 3T5XA 1R1TA 4XORA 3LNQA 2XAJA 4U7BA 2VBWA 1LLWA 1ZK8A 4KKUA 1JTAA 3I3LA 3BTLA 3KZIC 2WAEA 3AG4H 5IP7J 2M9HA 3Q3AA 4CCKA 4OIRF 1ETQA 3N05A 5FB2A 2P4WA 3PVDA 2YS9A 3K10A 2Z6BD 5THXA 4IX7A 4A0YA 2BPOA 4IXAA 4QIWN 4YFKF 3DBLB 2CQKA 5HS7A 4AIDA 4I6ZA 1IO2A 2QQBA 1ORKA 1EP2B 3CQZJ 1ZGWA 2YX4A 1O8KA 1S7OA 1E64A 3I54A 2HOTA 1CNEA 2LVSA 5JVTA 3D1NI 2HTSA 3RY8A 3LAPA 4M9ZA 3V8LA 4A12A 3MCZA 3ZPPA 1YHQB 3BR5A 3EQOA 1EA3A 3F8MA 4IPAA 4KIBA 4F3QA 1U8RA 2STTA 1ETVA 2Z8GA 1HDPA 1V55H 3CCMI 2LZJA 2PN6A 3FIWA 1ETWA 1DGWY 2DY1A 1RC9A 3K1MA 5HDKA 4DIQA 4YFNF 2X1DA 5FKNA 2DCEA 3DU6A 3VSVA 4E70A 5DM6F 5M3MJ 1FZPB 4Y52J 1H42A 4M1KA 4L8JA 2VJIA 2K3PA 3PUNA 3FJOA 3ZMUA 2COMA 3F6VA 1FOKA 3SLDA 2V7FA 1PP8F 2R7FA 2RQQA 5F1RA 4XSXF 4XMYA 2O04A 4U87A 4YFXF 5H20A 4BQQA 2MH2A 4U88A 3OJWA 1V5GA 1VNDA 1Y8RB 2P0WA 2XNDA 4HAMA 1OGJA 5C4JJ 1RZ4A 3JX8A 1BC8C 1GXQA 2WB1N 1MBJA 1VI0A 1UD3A 5B1BH 3ZQFA 2WR8A 2BY2A 2K4BA 2DTZA 4BHCA 2XKPA 5M5YJ 5FJ8J 1P6RA 4KN7X 1ZGJA 3F3XA 4OJ6A 4D5CA 2XVCA 1ZH5A 3I55I 4GCVA 3B02A 2COBA 4IL6C 2VYQA 4GGGA 4WQMA 3W2AA 4P1WA 3FXLA 2ME6A 2HYFA 3WHBA 4DGWB 3MZHA 3SEQA 4KNYA 5K7FA 2ZITA 2O7OA 1IB0A 1I1GA 3JSPA 4Y9RA 3U2QA 3ASNH 3VO2A 1P7IA 2OF7A 4CUGA 3G73A 1W5SA 2FQ4A 1YJ9I 2OBPA 1FC3A 4I98B 5FGMA 3M07A 2OBSA 1P4AA 2HOEA 1FEXA 2CUZA 1I39A 1ODDA 3GBGA 3A8KA 2J5OA 2M7AA 2MBFA 1WJFA 4P9UA 2EH3A 4QUZA 3LAJA 1FYLA 2VFQA 1FY7A 4A3KJ 2F2EA 1HF0A 5LGUA 3OYHA 1W2BB 1Z6TA 3BPXA 4LG0B 1OOCA 1KC8D 2Y2ZA 2O6GE 2JSCA 3MHPA 4QVJA 2GIVA 2E1MC 5LRRA 3JSOA 3FF5A 4X6AJ 2V7QA 2KHMA 5LGNA 4ZCIA 4OM9A 2YSRA 5IT3A 2AXLA 2VBSA 3D5LA 4F93B 4FK8A 3R6SA 3Q6RA 1J75A 3SZGA 2FVGA 2WJYA 2TCTA 1WOSA 3PNVA 3OOPA 5H2FC 4LK0F 1B9MA 4Q47A 1S0UA 3DTIA 1SEUA 3E3VA 4G94A 3VMFA 2HGCA 4LD5A 3VFZA 5LEKA 3OYIA 1WZ2A 1QCXA 3GF2A 4JRAC 4OIQF 2H94A 1BPLA 4ZV4A 1NB9A 5L46A 2A61A 2LF7A 1AOYA 3IC7A 3WG7H 4L18B 1QFYA 1GV2A 3ABMH 1N78A 3S2WA 3S3OA 1ZREA 3JRAA 1QGYA 3QAHA 1OHHA 4OMZA 1I3QJ 1YS7A 5E1XA 2HVSA 1DP7P 3W5VA 4B1RA 5H6RA 3FDYA 3MKLA 1LE8B 4PC2A 1PJ7A 4ZYEA 4E7ZA 2JA7J 1KK0A 2CYYA 1MIJA 1B4AA 1XPXA 3ZN0A 4XSZF 5BS6A 3C2HA 4DBQA 4M74A 2QEXB 1DPRA 1ON2A 3BC8A 5E8GA 4C3JJ 5BMZA 3ZQCA 3AFHA 2LREA 2BM4A 1W36C 4PC3A 1S3JA 2KZGA 1KA8A 2HVRA 1Y8QB 4KISA 1EFRA 4JX4A 3CF2A 1XC5A 1FDRA 2FJ1A 1ZUNB 3MZYA 1IF1A 3HOTA 3RI4A 2C5BA 2RDPA 3M8JA 1VQKI 5H6QA 3TBIA 1W9XA 2ZBVA 1H9TA 4S0HB 1JKPC 4RD4A 5J6XA 2GK6A 2R7DA 3JREA 2QF7A 4DJAA 2CV0A 1ZLJA 4HX4A 5HDGA 3WTUC 3GVJA 4I0AA 1B2RA 3AVYA 2OBTA 2ECBA 1UD5A 1D8TA 3W6VA 1ACIA 3BTIA 2E1OA 2V4JC 3CCUI 4P3IA 4I0BA 2QGGA 2DA2A 2M5WA 3K4CA 1DDGA 4BGDA 1KMHA 1W35A 1K6OA 2CW5A 4HIZA 1TWCJ 3HHHA 4M3GA 5IYCJ 5HDNA 2OQGA 3ZQGA 5J4VA 3CCYA 3KEOA 4FE7A 2GA1A 4A5MA 5EDNA 2WC2A 1JI8A 3A1PA 2MD0A 1K8AD 4PMHA 1O57A 2M2EA 2W24A 1VQOI 2O5RA 5F4OA 3HJEA 4KUMA 4M73A 1W5CC 1T33A 4YZ0A 3O6BB 5KHDA 5HS8A 1K78A 4P2NA 6PAXA 1TNTA 2DA5A 3JURA 1S8NA 3EDPA 3LSMA 1JTXA 5FKMA 1V5FA 5B1AH 3W3CA 1O3QA 5JBQA 1QJVA 1EH8A 1HG8A 5DUKA 2QE7A 2GJKA 1OB2A 3R6KA 1T39A 3B90A 3ESWB 2D2WA 4HPQA 2PJRA 1FYMA 2QLZA 4DBRA 2QCOA 3OZUA 3ECOA 1X4PA 2IGMA 4CCLA 5GTIC 5DCMB 4X05A 5IP9J 1S72I 2YWFA 2DN0A 1HQCA 5LMZA 4HSTA 4X8IA 3ABKH 3BR3A 1G59A 3BNWA 2JRTA 2R7WA 3KZZA 3SEZA 3H0DA 4NB5A 4I2OA 5TR9A 2VFOA 2F5DA 3FISA 3GUDA 4M53A 4HDUA 2QYOA 3SY2A 3RPQA 4A3GJ 1NB0A 3GTPJ 2KZVA 1ETKA 1QHHD 4Y33A 4Y17A 5CVIA 3FMQA 1HA8A 3PA1A 1W36D 1MBFA 2ID3A 4NC8A 5AN9A 4PJMA 3HAGA 2XAGA 2DMNA 3ZQHA 3PM1A 2FOKA 1ENHA 4G7ZF 4RDJA 5HS9A 1XMKA 3FXQA 5C4XJ 2HXOA 2CFOA 4WZEA 1X1BA 1WJCA 2NRAC 3HUGA 3K1PA 4PFPA 4AIJA 1TWFJ 4HRIA 3P9CA 2VBMA 3I9V2 3CMAB 3GW2A 3J81Z 1X3UA 4DYCA 2JA5J 3E1YE 1AU7A 2EIXA 5E20A 2D9RA 1USSA 4X06A 4YCQA 4B3GA 4RAZA 3JQRA 2JT1A 2MH9A 2JZYA 2BE5F 2M87A 4QV2A 4TMVA 3CLOA 4XBFA 3QP5A 4Y9UA 3CLQA 3VYTB 2EFNA 3S2DJ 1ZQ3P 1WFXA 1MGTA 1WI3A 3K7AJ 3QP6A 1VQMI 2TRTA 2ZSIB 3IRRA 2Q6OA 4WXCA 4ESJA 1TWHJ 5TJJA 2B7CA 2Q6LA 4ZJZA 2RC4A 3SJZA 1I27A 2B63J 3SFIA 1F36A 5IP6A 1QRYA 3M7GA 1YI2I 4UXNA 3CMMA 3OYFA 3RZDJ 1RUNA 3BY2A 4URRA 3E1SA 3BG6A 1OFDA 1RIOH 4QPOA 3OYMA 3P9IA 3OYEA 4FETA 2HEOA 3DPUA 4NHJA 2BMWA 4CYCB 1GVDA 2WTEA 4HX8A 1BJAA 4IF4A 2GREA 1J0RA 3OYGA 1FSHA 3FPKA 2NT9A 4P25A 2OA4A 2VBVA 3OEEA 3LL7A 3OS1A 4J19A 1P4MA 2HDDA 5FLXZ 5CVVA 5ERIA 4DK0A 5FNZA 5JMCB 1XSDA 1FNMA 2DEUA 1OJLA 2HI3A 2XPWA 3EETA 4L9VA 4PZJA 3I56I 4BU2A 1GXPA 2I1LA 1CNFA 5F1JA 5DDGA 1X0CA 1FTTA 5CLSA 2BM5A 5GTHC 3KEWA 3SYJA 5ILUA 3LSGA 3ERMA 3DU1X 3ONQA 3B4NA 3BTCA 3I4PA 1QA3A 2EJRA 3RYRA 5E3OA 3C1DA 3LMMA 3PUFA 4V2FA 3MFKA 4XLCA 1WI9A 1MDMA 2H6CA 3W2VA 1XTAA 3RYPA 1MBGA 3GVAA 1RU4A 1P9QC 3C18A 2L9NA 3A03A 4M6XA 1W5TA 3VYRB 1O8FA 1KGSA 2OPTA 2VKVA 4G7WA 4W8SA 3BH6B 1FRNA 2QA4I 4LBWA 3T8RA 2RKHA 5J40A 4HV6A 4G6TB 1JTYA 3PA2A 2JRMA 2VJ4A 2HS5A 2ZO4A 3DKWA 1IXRC 2MLKA 5EF6A 2R93J 3TEDA 3JRDA 3MMPA 2Z2SB 3ZGKA 5CKTA 4XRSG 1VQ6I 1EFTA 3WU0A 3QU6A 1R1VA 1D1AA 3FM5A 3W6JB 4A6DA 3PSSA 1W4MA 1OFLA 1XMAA 4HV5A 4DQ2A 1R58A 1M1EB 2F5CA 2ZMEB 2EIKH 2GM4A 5E3MA 4OJPA 1WRJA 3BH7B 2E1MB 3E6MA 3ZUGA 2F1MA 1MMGA 3LNNA 3OOCA 5F4JA 1TWAJ 4YAFA 2DI3A 2VQLA 1FMWA 2GXAA 1K9MD 1QGAA 4DK1A 1K5CA 2ZXHA 4C3IJ 1BJZA 2Y0SA 3I5UA 3COAC 2BM1A 1FBUA 3G4SB 3HEFA 3BCDA 3RIQA 4N4OB 2WAFA 4MFDA 4Z4TA 2M8GX 3DU5A 4YZXA 5FO0A 2A68F 4RM3A 1IN8A 2XHKA 1UCRA 1RNLA 1S4MA 3BZ6A 4YALA 1ERDA 2L9RA 4IJAA 3OOUA 3EUKL 1KTVA 4PC1A 1OLTA 3IHUA 2BGJA 2R7SA 2DTRA 4AVZA 3JRCA 1JKRC 5EG0B 4OPVA 3K4NA 3HOVJ 3SZPA 2E19A 2VQHA 2VNJA 3H94A 3QFRA 4TN1A 3VNUA 1YRNA 1TWGJ 2INUA 2DODA 2C6YA 3CCSI 4M72A 2Y48A 4IW3B 1TQIA 3BQZA 3QPHA 4XM3A 4C9YA 2W57A
chains in the Genus database with same CATH topology
2HZDA 2LOOA 2ZXIA 3PSIA 1HZEA 2DIEA 3S93A 3ZRGA 2KRHA 2VXZA 3KX2A 2WPDA 2M4KA 2VBEA 2V6EA 5HLTA 3BC9A 3BCBA 4B47A 3NWSA 3K4JA 2JVGA 2ZZEA 3G05A 5LD2C 3H5RA 1O88A 1W0JA 1MMDA 3D5RC 3G2BA 1DQUA 2HU9A 2VJ5A 1K6YA 4BJ5C 4EATA 3OIQA 3OYCA 2F6CA 3L2WA 1WJAA 3W2WA 4KITB 1SKYB 3VSLA 3DKXA 5FRNA 3VMVA 1PJRA 2INUA 2KRCA 3B8YA 4BJTA 3C2GA 1AA7A 1MW7A 4PJJA 2JJ2A 2L7KA 3PSFA 1MMNA 3GQAA 2R9VA 2QXZA 2XC7A 3OL4A 4DNRB 3K4MA 3OWTA 1AIRA 1H80A 2R7QA 3ZPNA 2VKHA 4U4BA 4BDYA 3A4CA 3OIPA 1IDKA 4G6IA 4H4KC 1VBLA 3GQ7A 2NZMA 3QYBA 2WA0A 2R7UA 2R7VA 4YZAA 4OAZA 4NK8A 1N75A 4HSRA 2E5NA 2V31A 3K4LA 3M1CA 2IGNA 1FX0A 3F9KA 2CMPA 2DOAA 2K5CA 3V42A 5KCMA 4C9YA 3FPPA 4NK6A 4XORA 4XONA 2GOMA 4U7BA 3RPUD 3L2RA 3GQ8A 2X85A 1VLYA 2ZZQA 4KKUA 5HKKA 2UUZA 3I3LA 2W7NA 1JTAA 1O8MA 1Z3XA 5KNLA 2WAEA 1LFPA 4CCKA 2V26A 3N05A 2R7XA 3S3MA 4DOZA 3K10A 2Z6BD 1QHGA 1IRXA 4ZDOA 2RNGA 3VYSB 3HL2A 4IX7A 4RLFA 4B44A 1TZLA 3EPZA 4Y3OA 1LKXA 4XLHA 2VKDA 4N4NB 3SDBA 4NC7A 1PXZA 1D1CA 4RMNA 4FXUA 2DT6A 2V9KA 4GRIA 1PKVA 1O8KA 2O1DA 3FBNB 2ZZGA 2CS3A 4YZQA 3H9GA 3LSKA 2I8DA 2X6WA 4PJNA 3MKWB 3OAAA 2LRDA 3HKZA 3NE5B 3ZPPA 3EQOA 1EA3A 3AL0C 4F3QA 2Z8GA 4E7JA 3FY3A 3VMWA 1KZLA 2LZJA 1XG2A 2NTQA 2BOLA 4B3FX 2IGOA 1DGWY 2CH0A 1IA5A 1E79A 3HPGA 4ZC3A 4DIQA 2X1DA 2DCEA 3DU6A 1QU3A 3VSVA 3UNGC 2ZSHB 1T5EA 3GVLA 4W8RA 4DNTB 1WJ5A 3OR2C 4KJZA 4L8JA 5CQGA 4Z05A 2VJIA 2K3PA 3D5SC 2GJRA 2V7FA 3OYJA 2RQQA 4EW9A 4XMYA 2LG4A 5HNHA 2O04A 4U87A 3OS2A 4BQQA 4II2A 5JHFA 4BACA 1V5GA 5LFAA 2XNDA 2P0WA 4F91B 1MMAA 3CJQB 2X6XA 2WBMA 4Z03A 2X53S 2MYSA 3KEYA 4OAYA 3BG7A 4XLAA 3BCFA 1BMFA 2NT6A 4RM2A 1UD3A 4E4HA 4PJLA 3ZR8X 2E1BA 5C1CA 4YRVA 4OJ6A 2LBFB 1BHEA 2WY7Q 4NNJA 2IQ7A 2XZLA 4ZDLA 2R7TA 1D0ZA 4XQFA 3W2AA 4P1WA 4J00A 4LG3A 2MABA 4DGWB 3SEQA 3FKSA 4LIVA 4XKVA 1V0EA 4B48A 2VLAA 2IGKA 1BOBA 3S3NA 2IS6A 4CUGA 3H5NA 2JIZA 2NTPA 1KONA 4BE1A 2JVHA 2M4GA 2LBFA 1UD4A 2CUZA 3GBGA 4NUBA 4PFOA 2M7AA 1UD8A 1NG7A 1WJFA 4B43A 4XD7A 1X1DA 4BXFA 3HOSA 1KCDA 1WMRA 2K9LA 2CW7A 2CUJA 3KRGA 1I18A 2X1CA 3OYHA 4E7IA 3TMOA 3A2KA 2JJ1A 4C2UA 1OOCA 2KDOA 3KYLA 1X1AA 1E3XA 2INVA 2E1MC 2GOXB 4J01A 2JDIA 1O8DA 2V7QA 1FMVA 2KHMA 1UD2A 3CP8A 5FROA 3H9QA 2LC2A 3VSUA 3D5LA 4Z06A 3K4BA 3RTRA 4F93B 1OB0A 4XKCA 2VPLA 2MC4A 3SZGA 2WJYA 2O0VA 4E6KG 3PNVA 3DTIA 1K28D 3OY9A 4XLEA 3BH4A 4BQOA 4OJLA 4XL9A 2IS1A 1PLUA 3FHNA 1WJEA 1QCXA 3OYIA 4NQWB 1BPLA 1KCCA 2VB6A 1D1BA 1N78A 2XOKA 5CQEA 3S3OA 2QY1A 2PYGA 4D1QA 4YELA 1OHHA 2ODLA 4TT3A 2HVSA 1X4OA 3WQZA 4JOMA 3FDYA 1O8JA 3PL8A 4E7ZA 3OMYA 1NRKA 2DT7B 3QODA 4W8TA 3E0JB 2VBKA 3C2HA 4DBQA 1W0KA 4BS9A 3BC8A 2FUG2 1YE9A 2VQCA 3AFHA 3HG9A 2LREA 4IQ4A 2NSTA 1T95A 1NHCA 1W36C 2M7BA 1MABA 1LVKA 2HPMA 4CZCA 2ZTGA 4Z1MA 1SAUA 1WJDA 3H5AA 3MKYB 2W4SA 2HVRA 3CP2A 2KQRA 4CCNA 3OYBA 2VJJA 3CF2A 4KISA 1EFRA 2KVOA 1JRGA 3HC7A 3TL4X 3HOTA 1DBOA 3FBIB 3M8JA 2XGJA 4U49A 3LSIA 3TBIA 1W9XA 3VWBA 3OFNA 3A1YA 1X1CA 2GK6A 2UVEA 4OJOA 4DJAA 3PNYA 2CV0A 3T9GA 2F5VA 2KP6A 4D9JA 4XKBA 3GVJA 3EUAA 3SYTA 4BQNA 2IS2A 4KKTA 1UD5A 1DGRM 1DBGA 3VR6A 2V4JC 2D3LA 4MLOA 4II3A 3K4CA 4BGDA 1KMHA 3CJRB 2HQAA 4AYBA 4C2TA 4C30A 4HIZA 4MR0A 1NG6A 2EWEA 1PE9A 3IAM2 1O8EA 1JI8A 1MNEA 2X1EA 3RQ4A 3QYEA 2VQGA 2MD0A 2PJRB 2D3NA 4G7XA 3T51B 4PMHA 3OL3A 2W1OA 3LFUA 2O5RA 1O8GA 2R4GA 2XZOA 1SFKA 2UV1A 2OUMA 4YZ0A 3PFYA 3CESA 5KHDA 1WPCA 4R79A 3VSTA 3JURA 4ZDPA 3HPHA 3LSMA 2WY8Q 2XF7A 2W6IA 1V5FA 4E7KA 1VZ0A 2WAQA 3W3CA 1O8LA 1QJVA 2VXDA 1HG8A 2QE7A 1UAAA 5HVQC 2GJKA 3DWLE 4JQFA 2Q1ZB 2LH9A 4BE0A 1O8HA 3B90A 4HPQA 2PJRA 1V5EA 3AKZA 2DXIA 1BN8A 4DBRA 4OJ5A 2BVMA 1X4PA 2IGMA 1BR2A 4CCLA 1G8XA 4E7LA 2ZTNA 2HPIA 4PUSA 2Q2EB 2XF5A 2A6TA 2M5SA 2R7RA 1RMGA 2IXSA 4CCOA 4E0FA 3OYNA 4HSTA 3OEHA 1G59A 2LYCA 2R7WA 2CV1A 3SEZA 4LIUA 1BR1A 3H0DA 2Z16A 2OC6A 4ZTJA 2Z1DA 3EUHC 3OR1C 3HUGB 3IP4B 4W8QA 2ELJA 2KZVA 5FRMA 1J09A 1QHHD 4Y33A 3L2VA 1Z7LA 4LITA 1HA8A 1W36D 2HNHA 4ANJA 1X19A 4NC8A 3OPOA 4PJMA 3HAGA 2VL8A 3GRHA 2E5ZA 4CCJA 1KTWA 2VASA 5TGTA 1EE6A 1O8IA 4XLFA 4BE2A 4TSFA 2CFOA 2WADA 4FASD 3GVKA 5AMVA 2O17A 1X1BA 1WJCA 2V4DA 2CK3A 3DPLC 2W6JA 3HXLA 4PFPA 3VYUB 4CA0A 5HOOA 1WJBA 1N77A 4HRIA 1WTHD 2VBMA 3ZSCA 4HNTA 4IZZA 3I9V2 4CCMA 1VJSA 2M3AA 3K70C 1R6RA 2F43A 4OZZA 4YEJA 4BL0B 2UWMA 1COWA 1V0FA 3GQBA 4B3GA 3SUCA 3PJRA 1ZELA 5CPRB 4BEHB 1BR4A 2QX3A 4YXWA 1RWRA 4BDZA 5FL7A 3NWTA 3VYTB 2KPMA 4P5OA 2HVQA 2GK7A 4XN0A 2WB1A 3JU4A 1OFMA 1WFXA 2WJVA 3OYDA 2V1NA 3BLYA 1I8DA 2ZSIB 3RCOA 4E7SA 3OYLA 2F4IA 4Y4RA 2BVLA 4ZJZA 2ZZFA 3DLAA 3ZCOA 4MXNA 1Y6IA 1IDJA 3CMMA 3OYFA 3ZXSA 3BCAA 2DJIA 4URRA 2R7OA 3E1SA 4BEHA 3BG6A 3VSKA 2AQFA 2MFZA 2OV7A 2BW3B 4QPOA 1YX5A 3OYMA 3OYEA 3DTEA 1E43A 4FETA 3UR3C 1E1QA 2GJPA 4TKOB 1OGMX 3EQNA 3DPUA 3AL0B 5IK2A 2L9SA 2LY1A 1E0EA 1U0JA 5HNFA 4HNUA 1GQ8A 4P22A 4IQJA 2NT9A 3OYGA 1CZFA 3DKYA 3PUBA 3DDYA 3LL7A 3OEEA 3OS1A 4BJ6C 4DK0A 1MNDA 2QKLB 2KL4A 4OWRB 1VF7A 4ASUA 2NTBA 1S9HA 1Y56A 4BU2A 4I84A 2BW3A 1IB4A 4RLQA 3A3GA 1X0CA 4QPQA 3QYFA 3T56B 1OR7C 3VDXA 3MKZA 3L2QA 3KEWA 3LSGA 4XOTA 5CDFA 3ONQA 3ZQQA 3RSNA 3B4NA 2XDVA 2QKMB 4XKWA 4PSWA 2UVFA 2JUGA 2PMZA 3K4KA 3LMMA 1H8HA 4XLCA 1UD6A 3H35A 2W00A 2HLDA 3W2VA 1UG0A 3IAS2 1RU4A 1P9QC 4ZTFA 2L9NA 2A5WA 3VYRB 3S32A 1O8FA 4HG2A 1E3ZA 4G7WA 4W8SA 3LMWA 3DTKA 4F92B 1E1RA 2JA2A 3A35A 3IUOA 1BLIA 2M0MA 2VIXA 4PK4A 4UZUA 4C2LA 3K70D 2KLOA 3A3BA 4OZYA 1D0YA 2CW8A 2KMUA 1YX3A 2XSJC 5C1EA 2WSSA 4G6TB 1DP3A 3K6GA 2VJ4A 3S8PA 3J7AY 2X3HA 2NOJB 2Z2SB 3OE7A 3ZGKA 4ITVA 4BUPA 5CKTA 5DN6A 2L5QA 2XAUA 1D1AA 2X6YA 2W82A 3CZ6A 2PYHA 1UELB 4F52A 3GQ9A 1OFLA 1Z3YA 3OS0A 4CH7A 3U21A 4JMQA 4E7HA 2HDWA 1PYVA 3MMYB 1HVXA 4OJPA 4HEA2 3QOEA 2E1MB 4IKFA 2F1MA 1MMGA 3LSHA 3LNNA 3OOCA 3OYAA 2JSPA 4HWVA 2VQLA 1FMWA 2O0WA 1WP6A 3T53B 4XOPA 3OW7A 2ZFUA 4AU7A 3OYKA 3PNTA 4DK1A 1K5CA 2K9MA 2ZXHA 2AQEA 2Y0SA 2X8KA 4XR6A 2BSPA 3BCDA 4N4OB 2WAFA 3DEEA 2E60A 4F55A 3DU5A 4YZXA 2L2OA 2CV2A 4ZYAA 4RM3A 4KKSA 4B3XA 1LDKB 4CSWA 2PECA 2XF6A 2IS4A 1ERDA 3UW0A 4GQNA 3WWGA 3OOUA 3EUKL 2X51A 1NBMA 2XZPA 2WZPP 2NSPA 1OLTA 2R7SA 4XN3A 3H9JA 4XNFA 4AVZA 3K4NA 3DQVC 3H94A 2VQHA 3FKJA 4PSXA 1Z21A 1TT0A 4X0GA 3DPTA 3L2UA 1H8EA 2LY2A 3ZIAA 1OGOX 4KT6A 1D0XA 4XM3A 2RREA 1T0FC 1GLNA 3MD2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DBG A;  1OGM X;  3EQN A;  2X6X A;  4Z03 A;  4XLA A;  2NT6 A;  1GQ8 A;  2VBE A;  2NT9 A;  1CZF A;  4MR0 A;  1O88 A;  2EWE A;  5C1C A;  1PE9 A;  1O8E A;  4OJ6 A;  1BHE A;  1XG2 A;  4PMH A;  2IQ7 A;  1O8G A;  2NTB A;  4I84 A;  4XQF A;  3VMV A;  1IB4 A;  3B8Y A;  4YZ0 A;  1X0C A;  3VST A;  3JUR A;  4XKV A;  4XOT A;  3GQA A;  2QXZ A;  3B4N A;  1QJV A;  1O8L A;  2NTP A;  4XKW A;  1HG8 A;  1AIR A;  1H80 A;  2UVF A;  1O8H A;  3B90 A;  4U4B A;  4XLC A;  1IDK A;  1RU4 A;  1BN8 A;  1KCD A;  1VBL A;  3GQ7 A;  1WMR A;  2NZM A;  4OJ5 A;  4YZA A;  1O8F A;  3KRG A;  4NK8 A;  4W8S A;  1RMG A;  3LMW A;  1OOC A;  2INV A;  4C2L A;  1O8D A;  4OZY A;  5C1E A;  3VSU A;  4NK6 A;  4Z06 A;  4W8Q A;  4XOR A;  4XON A;  2X3H A;  2O0V A;  3GQ8 A;  2X85 A;  1O8M A;  1JTA A;  4XLE A;  4OJL A;  4XL9 A;  2X6Y A;  2PYH A;  3GQ9 A;  1PLU A;  1OFL A;  3GRH A;  1QCX A;  1KTW A;  1EE6 A;  1O8I A;  4XLF A;  1KCC A;  4OJP A;  5AMV A;  2QY1 A;  2O17 A;  4XLH A;  2PYG A;  4YEL A;  1PXZ A;  2ODL A;  4HWV A;  3ZSC A;  2VBM A;  2O0W A;  4XOP A;  1O8K A;  1O8J A;  4OZZ A;  2O1D A;  4YEJ A;  4YZQ A;  1K5C A;  4W8T A;  4XR6 A;  2VBK A;  2X6W A;  2BSP A;  3SUC A;  3ZPP A;  2QX3 A;  3EQO A;  1RWR A;  1NHC A;  2Z8G A;  2NST A;  4YZX A;  3FY3 A;  3VMW A;  2NTQ A;  4XN0 A;  1OFM A;  2PEC A;  3UW0 A;  2VJJ A;  1JRG A;  3WWG A;  1IA5 A;  2NSP A;  3VSV A;  1DBO A;  4XN3 A;  4XNF A;  4AVZ A;  4W8R A;  4Z05 A;  4MXN A;  4U49 A;  2VJI A;  1IDJ A;  2INU A;  1OGO X;  2UVE A;  4OJO A;  3T9G A;  4URR A;  4EW9 A;  4XMY A;  2O04 A;  4XM3 A; 
#chains in the Genus database with same CATH topology
 3KP5 A;  3ZZT A;  3LQE A;  1AIP A;  2KRH A;  2VXZ A;  3KX2 A;  1JXS A;  1F4K A;  4FHT A;  2VBE A;  3FXR A;  3JR9 A;  2H1K A;  4B09 A;  3WHC A;  2R7Z J;  5IYW A;  2DOE A;  3G05 A;  1R4N B;  1A35 A;  2GWR A;  1MMD A;  3OZV A;  2JN6 A;  2FBI A;  4YDT A;  4EAT A;  1DQU A;  2HU9 A;  2VJ5 A;  4BJ5 C;  1QZZ A;  4UVC A;  3HRT A;  4ETS A;  5K7H A;  3OYC A;  4KFC A;  4KMF A;  1WJA A;  1VQ9 B;  3OZW A;  3E5U A;  4KIT B;  3WGG A;  1YIT B;  3DKX A;  3VMV A;  3PEN A;  1PJR A;  3DBR B;  2KRC A;  2JWT A;  5D8L B;  3OKX A;  3B8Y A;  3C2G A;  1U6G A;  1FLI A;  1RQR A;  1AA7 A;  4PJJ A;  3TW6 A;  4RM0 A;  2GQQ A;  3CJN A;  1KD1 D;  1YO5 C;  2BN4 A;  2CF4 A;  1QQI A;  2DDB A;  2XGD A;  3I0T A;  3CF5 F;  4GFB A;  1I1S A;  2E34 A;  3OP1 A;  1CLW A;  3VOD A;  1H0M A;  1A31 A;  2I10 A;  4RBO A;  3ERE D;  3ZPN A;  1EKE A;  2UZK A;  2A3S A;  2H1L A;  2UXN A;  3FXU A;  3ASR A;  5FA6 A;  1ZRC A;  1IDK A;  4G6I A;  1JT6 A;  3GFM A;  4H4K C;  1EP1 B;  1VBL A;  3J80 K;  3GTQ J;  2J5P A;  4FX0 A;  1N75 A;  1Y1V J;  3H3Z A;  1XSV A;  2E5N A;  3V4G A;  5HOD A;  1QA6 A;  1OKR A;  3M1C A;  1VFC A;  4RAF A;  3ASQ A;  3CD6 B;  3Q9V A;  3BR2 A;  5IYD J;  4U7D A;  1Y0U A;  1SAX A;  5KCM A;  3K2Z A;  2VFN A;  1FYK A;  2GA2 A;  3CRZ A;  3FK7 A;  1FNC A;  1RPW A;  3LST A;  2A07 F;  2VN2 A;  4XON A;  5E3N A;  3RPU D;  2O8K A;  2FX0 A;  4V2G A;  3GQ8 A;  3KIO A;  1VLY A;  2PE3 A;  5HKK A;  4AIK A;  1FNB A;  1T2K A;  3BG3 A;  4LFU A;  3GLL A;  2OAZ A;  4ENJ A;  1AKH B;  2BXY A;  1F43 A;  2L4A A;  3ZZU A;  4EH1 A;  1S5L C;  1X2N A;  2CSO A;  3ASP A;  1AHD P;  3S14 J;  1WQ2 A;  5M5W J;  1YW9 A;  2OZU A;  4RLF A;  1TZL A;  2OBR A;  2HYJ A;  3WBK A;  2IW5 A;  3TQN A;  1LKX A;  4QTR A;  4AIH A;  4XRS A;  3SDB A;  1PXZ A;  3QPT A;  2N8G A;  5C44 J;  2C4T A;  2BVN A;  4FIS A;  5HLI A;  4RMN A;  2QEN A;  2R5Z B;  1WPK A;  4FXU A;  3GTM J;  2O1D A;  2ZZG A;  4YZQ A;  3H9G A;  1SD6 A;  2KJB A;  3WTS C;  1BM9 A;  3RKQ A;  2K9N A;  1FT9 A;  4PJN A;  1KJZ A;  2J7K A;  2LRD A;  3HKZ A;  4O6J A;  1RES A;  5LHH A;  4MTE A;  3AL0 C;  2HR3 A;  1Q1V A;  3AAF A;  4TMZ A;  1LB2 A;  2NTQ A;  2BOL A;  1TL8 A;  3LWF A;  2Y0M A;  2FOW A;  2EIN H;  2EFO A;  5D5U B;  4BH9 A;  1T5E A;  3GVL A;  1WJ5 A;  3OR2 C;  3RPU A;  3BT9 A;  3BOQ A;  5CQG A;  2KJC A;  1E3P A;  2PI0 A;  1GAQ A;  1BIA A;  2DER A;  1I5Z A;  1Y39 A;  2JPC A;  3D5S C;  2GJR A;  5IYQ A;  2GBY A;  3OYJ A;  3AGQ A;  3KFW X;  2LG4 A;  1RR7 A;  3N4M A;  1MSF C;  4II2 A;  5JHF A;  3LVB A;  3QE2 A;  4YAW A;  1YYV A;  4YC5 A;  4G5G A;  2JN9 A;  2H6B A;  4F91 B;  5J47 A;  1MMA A;  3CJQ B;  3KP7 A;  1JUP A;  3KPH A;  4M9X A;  3KCC A;  1OCC H;  5E18 F;  1DUX C;  4DYQ A;  1BMF A;  3TH0 A;  2XGE A;  4P1V A;  4PJL A;  1R5B A;  5EZH A;  2E1B A;  2E1N A;  4P3Y A;  1WSU A;  2LBF B;  2JQ7 A;  5JVG F;  2JK3 A;  1BHE A;  2OCC H;  2OTJ I;  3ES9 A;  2EZI A;  3E7L A;  3QFC A;  2XZL A;  2XTW A;  1QVU A;  4B4D A;  5FFX A;  4XQF A;  2DA4 A;  5ICG A;  5M5X J;  4J00 A;  1ZR4 A;  1R23 A;  4AF6 A;  3FKS A;  2BGC A;  2VLA A;  1DG1 G;  2IGK A;  4HYE A;  3WNC A;  3S3N A;  2CRG A;  2L02 A;  2BM6 A;  1Z7U A;  2B0R A;  2DYI A;  2NTP A;  4YFO A;  3U6K A;  4BE1 A;  3CCM B;  3GEZ A;  1TBX A;  3J7Z I;  4M2L A;  4GO1 A;  1UD4 A;  3HOY J;  4NUB A;  4A0Z A;  3C7J A;  3MVP A;  4B43 A;  5EEH A;  2VBZ A;  4HNV A;  2A5Y B;  5CVJ A;  1G7R A;  2CUJ A;  3KRG A;  2DU9 A;  3AG1 H;  1H88 C;  3DXJ F;  3CO6 C;  4C2U A;  2OTL I;  3KYL A;  4Z4R A;  2F5F A;  3TO7 A;  2GOX B;  4J01 A;  1O8D A;  3O8H A;  4ZH4 F;  5KVR A;  1UD2 A;  3CP8 A;  3LSP A;  1VQ4 I;  1H89 C;  4Z06 A;  3RTR A;  4ZCL A;  4LC0 A;  2PMZ N;  1F1Z A;  4N0B A;  4L0Z B;  1VQN I;  2J8I A;  2XTY A;  1K28 D;  3NRV A;  3OV8 A;  4LG0 A;  1HDD C;  1DAR A;  1CGP A;  3WNB A;  4XL9 A;  3ROU A;  3WGH A;  1I6X A;  5F6F A;  3I55 B;  1WJE A;  3QQA A;  1QRC A;  4OMY A;  1E62 A;  1D1B A;  2DO7 A;  2XOK A;  5CQE A;  2O9L A;  2PMH A;  1NTC A;  4YEL A;  5J1U A;  2OD5 A;  3A8J A;  1IN4 A;  2D1V A;  3WQZ A;  2LKS A;  4JOM A;  1KU3 A;  2TDX A;  2PMU A;  3PL8 A;  3S16 J;  2KT0 A;  2BF4 A;  2V9V A;  2DQR A;  2YPR A;  2PLY A;  3PIP F;  3V7R A;  5GAE J;  1IN6 A;  4IHV A;  1JJ2 B;  4WF2 A;  2FUG 2;  3C2B A;  1YE9 A;  4FX4 A;  4M3F A;  2KKO A;  1OCT C;  3HG9 A;  4IQ4 A;  2NST A;  1T95 A;  2XNC A;  2Q6I A;  1LVK A;  3T56 B;  4CZC A;  3KLN A;  5L3C A;  1WJD A;  3CTA A;  1E2X A;  3CP2 A;  4CCN A;  2P5L C;  3OYB A;  2VJJ A;  1VTN C;  3ZC3 A;  2KVO A;  3B73 A;  4Z6Y A;  5ICE A;  1LE8 A;  1WSR A;  1FTZ A;  1G3T A;  1DBO A;  4R71 A;  2L01 A;  1JUS A;  3WYA A;  3QPS A;  3GTK J;  3FBI B;  1IXC A;  1NH3 A;  2XGJ A;  2XKO A;  4U49 A;  2LD5 A;  2C5H A;  2QUF A;  1Y1W J;  1QGZ A;  2F5V A;  1ZRF A;  2F4O B;  2MG4 A;  4BQN A;  1IHM A;  4KKT A;  3F0C A;  4Y13 A;  4IO9 F;  3VR6 A;  1IDZ A;  3IRQ A;  3E6C C;  1EZG A;  3I64 A;  1LLZ A;  2X4H A;  1P7J A;  1TNS A;  3WTX C;  3CJR B;  2HQA A;  1I3A A;  1UST A;  1QZY A;  1U5T C;  5D4R A;  4ABZ A;  5K5Q A;  3GTJ J;  2OJE D;  3IAM 2;  1IRZ A;  4MYT A;  3TOA A;  5LBQ A;  3CC7 B;  1PE9 A;  4KN4 X;  1SVM A;  2AXT C;  3RQ4 A;  4G7X A;  3OL3 A;  3N6Z A;  3LFU A;  1PUE E;  2R4G A;  3PFY A;  4R79 A;  3HPH A;  2XRL A;  2RAE A;  1F60 A;  3W5H A;  4OPW A;  1FOY A;  2V6C A;  2VXD A;  1A04 A;  3FK6 A;  4WZT A;  3DWL E;  1ZM2 A;  3W2I A;  4JYK A;  4UVB A;  5D5V B;  3GIR A;  4LMY A;  2K9Q A;  4Z4Y A;  1BN8 A;  2E36 A;  4OJ5 A;  1RRJ A;  4BBR J;  1H85 A;  1VQK B;  2HPI A;  2JJ7 A;  2QN6 A;  2A6T A;  1NK3 P;  2M5S A;  2BZT A;  2R7R A;  3LFK A;  4ZZD A;  1EP3 B;  4OPO A;  3OYN A;  1T08 B;  1ZYR F;  2DYS H;  3P26 A;  1ON1 A;  4UV8 A;  3GZ5 A;  2CV1 A;  4LIU A;  1BR1 A;  1S7E A;  2DMP A;  3H0G J;  2OC6 A;  4N3G A;  2M45 A;  2Z1D A;  3CCU B;  4UUV A;  3EUH C;  3IP4 B;  2IA0 A;  2DYR H;  4ASN A;  3AVV A;  1BIB A;  2CW0 F;  2EPF A;  4HA8 A;  5DCM A;  3H09 A;  1OMI A;  2HKX A;  4C0S A;  1IZ1 A;  3ZQ7 A;  1FNN A;  5IYB J;  5IYP A;  4RDK A;  1VQO B;  3CCJ I;  3CCL B;  3A8I A;  4EJV A;  2KIS A;  2WAD A;  2ZME C;  2V4D A;  2CK3 A;  3DPL C;  1UMK A;  4MEY F;  3HXL A;  3VYU B;  5HOO A;  4CA0 A;  1N77 A;  2PJP A;  1LM1 A;  3QWL A;  3GFI A;  3ZSC A;  4UAJ A;  1ITY A;  5BSY A;  3U9G A;  2M3A A;  3K70 C;  1R6R A;  4JX5 A;  3WE3 A;  2ZL7 A;  1XGN A;  3ABT A;  5J4Y A;  1JHH A;  3ML3 A;  3NB2 A;  1B9N A;  1LJ9 A;  1EH6 A;  1OFE A;  5J3O A;  1KK2 A;  1ZEL A;  2K27 A;  4BEH B;  1BR4 A;  2QX3 A;  4YXW A;  4BDZ A;  3NWT A;  1K79 A;  3ZBU A;  1S72 B;  4S04 A;  2P7V B;  4WX9 A;  2WB1 A;  1U9O A;  1WHU A;  1TTY A;  2IBD A;  3HOZ J;  2VOO A;  3J7A O;  1VQL B;  1OFM A;  4Y7C A;  4J0Q A;  1I8D A;  3WND A;  1KU2 A;  1EV7 A;  4PGO A;  4G6Q A;  3RJP A;  1HKQ A;  2F4I A;  3I59 A;  4Y4R A;  2ZZF A;  1ZM3 A;  3ZCO A;  3LOC A;  5K7Z A;  1TP4 A;  2E71 A;  4RB1 A;  3DP7 A;  3JAM K;  4D0P A;  2GQF A;  2EK5 A;  4A3E J;  2MFZ A;  1XB2 A;  1E3H A;  2BW3 B;  2X6O A;  4OU0 A;  1YX5 A;  2Q8K A;  1E43 A;  3CCR B;  3UR3 C;  1E1Q A;  3EQN A;  2QSG X;  1WVR A;  1B72 B;  3RKY A;  3AL0 B;  2QTZ A;  1XGO A;  3W6K B;  2V7W A;  3CC2 I;  2ZL6 A;  2L9S A;  1IUF A;  3SQN A;  3JTG A;  1E0E A;  1IJF A;  4HNU A;  3M9A A;  4P22 A;  2DA3 A;  2QGU A;  4BAY A;  1CZF A;  2M8E A;  4EVI A;  2LY9 A;  3DDY A;  2AHQ A;  2FQ3 A;  3ZMD A;  1MND A;  4DZJ A;  1HLV A;  4ESB A;  2KL4 A;  2NPF A;  3Q38 A;  1VF7 A;  3GFJ A;  2VNH A;  1S9H A;  4I84 A;  3ZMT A;  5IT9 K;  1IB4 A;  3BZK A;  4ZYH A;  4A3F J;  1Z6R A;  3A3G A;  3JQP A;  4QPQ A;  4HF1 A;  3J81 K;  1OR7 C;  1UFM A;  1X3Z B;  3SZE A;  4CYC A;  5IOY A;  4XRM A;  1U5T A;  2VPR A;  1JB9 A;  2CBX A;  4AC9 A;  2MC3 A;  3RSN A;  5J8C A;  3MAJ A;  4PCQ A;  2QKM B;  4EJO A;  2A69 F;  2BGI A;  2UVF A;  2JUG A;  4DW6 A;  3BR6 A;  5HXB A;  1VQM B;  2NVQ J;  1UD6 A;  3MZ8 A;  2QSF X;  3K2A A;  2ZJQ F;  3IH4 A;  3IAS 2;  2HXI A;  5LHI A;  2R92 J;  2V79 A;  2OK8 A;  1SD7 A;  3BQJ A;  3S32 A;  2F4N A;  3ULQ B;  4HG2 A;  2KIQ A;  3IH3 A;  5EZG A;  2BHZ A;  2LKP A;  2DPD A;  5ICC A;  3W2F A;  1YI2 B;  5J35 A;  3LMW A;  5CYV A;  2JA2 A;  4UUS B;  1QG0 A;  1Z67 A;  5DNS A;  3K70 D;  2KLO A;  1D0Y A;  2KMU A;  5C1E A;  1DP3 A;  3K6G A;  2EV6 A;  1QUF A;  1XQB A;  5JLW A;  2XB5 A;  2XAF A;  1P4X A;  1TYU A;  5DUI A;  3D26 A;  2H8R A;  4EJU A;  2EZL A;  4ITV A;  1PVE A;  5DN6 A;  3NQO A;  4NDL A;  4U0W A;  4Y15 A;  2OK7 A;  2XAU A;  4LBZ A;  2X6Y A;  3CZ6 A;  3J81 k;  4F52 A;  4DZP A;  3OS0 A;  3I56 B;  1FIP A;  4YHB A;  1ZHF A;  4ON0 A;  3GTO J;  3K9T A;  4OOS A;  2XPU A;  3AG2 H;  4JMQ A;  2K7L A;  2J8K A;  5FLX K;  1GVJ A;  1HVX A;  4HEA 2;  5F0C A;  2DA7 A;  3QOE A;  1YW7 A;  2CQN A;  3LSH A;  1VHO A;  3I4M J;  2JSP A;  4ZYD A;  2R0Q C;  2O0W A;  5HZB A;  2EQR A;  1WP6 A;  5EEA A;  3LJY A;  3OW7 A;  4JBA A;  1YLF A;  3WTZ A;  5B5E C;  3PNT A;  3JAM Z;  3GLX A;  2K9M A;  3DF8 A;  2BHY A;  4XR6 A;  4RD0 A;  2UXX A;  3VO1 A;  2ZME A;  1TQM A;  5K5R A;  1HW5 A;  1T6X A;  4F55 A;  4RCZ A;  2NS8 A;  2L2O A;  1DU0 A;  2QA4 B;  4B3X A;  1LDK B;  4CSW A;  5KAF C;  1IJW C;  1WOP A;  2IS4 A;  5ILS A;  2PEC A;  1QO0 D;  1IUY A;  3FMS A;  1YG2 A;  1QZE A;  3OSG A;  3K1N A;  2XZP A;  4AF7 A;  2NSP A;  2OCE A;  4XN3 A;  4TV7 A;  5L3F A;  2Z9O A;  2RNJ A;  3QU3 A;  4Z2Y A;  1RUO A;  5A2Q K;  5EYR A;  2AHO A;  2W7Z A;  1J2X A;  2E7X A;  2FF4 A;  4P96 A;  5IT9 Z;  1Z21 A;  3ZIA A;  4ZGQ B;  4D7M A;  1XDU A;  5EGO B;  2DFI A;  1U8B A;  3LA7 A;  3VPR A;  4KT6 A;  1BW5 A;  3BY1 A;  4LBY A;  4AVP A;  4Y7N J;  1D0X A;  3CUQ B;  1EWY A;  1MNM C;  4GYG A;  3BP8 A;  4F7Z A;  3BTJ A;  2FEZ A;  3I59 B;  2RGV A;  1V4R A;  3MD2 A;  4RPB A;  3PQK A;  3OSF A;  3PSI A;  4BKX A;  1K83 J;  2DIE A;  3S93 A;  4YIR X;  2WPD A;  2KFD A;  4L0Y B;  1G2H A;  1LEA A;  2M4K A;  4QFM A;  3BC9 A;  4B47 A;  3NWS A;  5EG0 A;  4LB5 A;  4ACB A;  1W0J A;  4DQL A;  1K6Y A;  1ZTR A;  3AG3 H;  5GAD J;  2ISZ A;  2F6C A;  4RGS A;  1K8F A;  3W2W A;  5LHG A;  1T6S A;  4KT5 C;  2IVM A;  5FRN A;  2YX7 A;  1Y0N A;  1R1U A;  2D5V A;  4JX6 A;  2P6T A;  4XLN F;  3GZ6 A;  2ZJR F;  3PSF A;  1MMN A;  1UG2 A;  1N06 A;  4PGG A;  3MCA A;  2R9V A;  2QXZ A;  2XC7 A;  2AO9 A;  1X58 A;  2MD5 A;  5B66 C;  1W0T A;  1R4M B;  3OWT A;  5JHU A;  1EF4 A;  2RC6 A;  3MN2 A;  2LMD A;  2V1U A;  2CC2 A;  5AON A;  3C3W A;  4HQM A;  4HW0 A;  2BEO A;  4U0Y A;  1U5T B;  4HLY A;  1GJR A;  1ZG3 A;  1OR7 A;  2WA0 A;  2BXZ A;  4Q48 A;  1YQA A;  2Z99 A;  4L9N A;  2BBY A;  2H09 A;  4QSH A;  4Z4U A;  1MZB A;  1HSJ A;  2EIJ H;  1SVO A;  4NK8 A;  1TTT A;  2V31 A;  3SJM A;  3CCS B;  4ZGN B;  1KU7 A;  1B59 A;  4Q7J B;  2FMY A;  1FX0 A;  2C2W A;  2CND A;  5FD5 A;  4HOB A;  2XB0 X;  4MYU A;  5L3E A;  2K4J A;  2ZXW H;  3V42 A;  5GP9 A;  3LQR A;  4NK6 A;  1UHW A;  4PJ0 C;  1YJW I;  1KK3 A;  4UB8 C;  4Z4Z A;  2EZH A;  3F22 A;  2CRV A;  2GOM A;  1O7L A;  4HLX A;  3I53 A;  4MQV A;  2IRF G;  2LDU A;  2ZZQ A;  1O8M A;  4M3E A;  1NHA A;  1VQ7 I;  1Z3X A;  5KNL A;  4KA4 A;  1F20 A;  4WCG A;  2OZ6 A;  2R7X A;  3E5X A;  3S3M A;  4M6Y A;  1QHG A;  4P55 A;  2V5I A;  4JK1 X;  4B44 A;  1KQ8 A;  1FRQ A;  2NS7 A;  3ZMZ A;  3EPZ A;  2XUB A;  4Y3O A;  3HGY A;  4LOC A;  2VOD A;  1G7S A;  2ZCW A;  5F4M A;  2CWE A;  3R0J A;  2ZL5 A;  1MKM A;  3IKT A;  2DFE A;  3TOB A;  1D1C A;  1R22 A;  5A2Q Z;  2HMA A;  5J8F A;  2DT6 A;  4GRI A;  4N9I A;  5DM7 F;  2AS5 F;  1AKH A;  3W5U A;  2I8D A;  1A36 A;  4A0X A;  2X6W A;  2K02 A;  2YUS A;  1EFC A;  1B1B A;  3NE5 B;  1GVH A;  2E35 A;  1ETY A;  2MW8 A;  4ESF A;  4E7J A;  3SXY A;  5TIS C;  3FY3 A;  3VMW A;  1D2E A;  4IEJ A;  4IHT A;  4B3F X;  2CH0 A;  1E79 A;  2R5Z A;  1GR1 A;  3GYH X;  1HW2 A;  3UNG C;  2ZSH B;  3H36 A;  2M1B A;  4KYW A;  4W8R A;  4P9S A;  2DET A;  4Z05 A;  3TP0 A;  4HF2 A;  2ZC2 A;  1EFU A;  1TYX A;  4EQQ A;  2L3D A;  1VQP B;  3EYY A;  3CW2 A;  5HNH A;  1ZG5 A;  1LQ1 A;  2O61 A;  2HFH A;  1BI0 A;  1YFH A;  3T1B A;  3VB2 A;  2GIZ A;  1GUU A;  1VQ5 B;  1OYW A;  1OYI A;  4OP7 A;  5LFA A;  3PET A;  2E2H J;  1RI7 A;  5HZA A;  3ZPL A;  1IV8 A;  4EGZ A;  2WBM A;  2MYS A;  3KEY A;  4OAY A;  1Z0X A;  4XLA A;  3BPV A;  4RM2 A;  1D5V A;  1HCR A;  3G71 I;  3ZR8 X;  2ZJP F;  1WH5 A;  4YRV A;  5L3B A;  1DAB A;  1WCM J;  1QPI A;  1O7F A;  3OW2 B;  3KE2 A;  2WY7 Q;  3ZQL A;  2CQX A;  4NNJ A;  1E3O C;  5FO1 A;  2KIU A;  2YWG A;  4P9F A;  1D0Z A;  4WXH A;  4CIC A;  1LDJ A;  3L00 A;  3Q39 A;  2MAB A;  2HDN B;  3RQI A;  5E17 F;  4XKV A;  1H9G A;  4IHW A;  1DDI A;  3ZQI A;  3L09 A;  2DT5 A;  2V7X A;  3Q5F A;  2IS6 A;  2DW4 A;  2XAQ A;  5BSX A;  2XT2 A;  3KYC B;  2JIZ A;  1KON A;  3KP2 A;  2JVH A;  4CDG A;  2LBF A;  1XFO A;  1QVF B;  3CPW B;  1NG7 A;  2IOU G;  2ECC A;  1IG7 A;  4BXU A;  1CQX A;  2K9L A;  1VQ8 I;  2CW7 A;  2HQN A;  3PQJ A;  2CGP A;  1J9I A;  4E7I A;  1R7J A;  1QRB A;  5EJC A;  1V5V A;  3QRF F;  2KDO A;  1X1A A;  1Q7Y D;  5EMN A;  1T56 A;  2JDI A;  2ZXJ A;  1QA1 A;  2DK8 A;  3HTS B;  1W7P B;  1OQY A;  3H9Q A;  4MGR A;  5KW9 A;  2LC2 A;  2K85 A;  3K4B A;  2JPB A;  3S1R J;  4XKC A;  5H5J A;  2V7T A;  1YIJ I;  3ZBT A;  1ZAO A;  1TW3 A;  4A5N A;  4E6K G;  3RZO J;  4CZZ A;  2O0V A;  2QDX A;  3SHF A;  1X2M A;  2PQ8 A;  2R3S A;  3O2P E;  3TDU C;  4AYB N;  3BH4 A;  4OJL A;  3N97 A;  2IS1 A;  5KAI C;  1PLU A;  3FHN A;  5ILV A;  2OTJ B;  1B6A A;  3CO7 C;  4NQW B;  2X9D A;  3OIO A;  1KCC A;  1EH7 A;  1JUM A;  4BXX J;  2QY1 A;  3RKW A;  2PYG A;  2GZW A;  2ME0 A;  2DPU A;  1QGP A;  4R8H A;  1QPM A;  1X4O A;  1Z77 A;  4Z4W A;  1HKT A;  1QVG B;  1DU6 A;  2WAQ N;  5LGT A;  2E2I J;  5F27 A;  2DT7 B;  3Q0W A;  2O3F A;  3QOD A;  3GTG J;  1ETX A;  4W8T A;  3E0J B;  4H9G A;  2VBK A;  1QNT A;  3CCQ I;  1A5J A;  2EB7 A;  1MH3 A;  4PC6 A;  2VQC A;  2LLK A;  4H0E A;  2E1R A;  4RAY A;  2V1D A;  3FKI J;  4OOX A;  3Q9S A;  1WU8 A;  1OCR H;  2M7B A;  3GFL A;  1JHF A;  3F21 A;  2HPM A;  1MAB A;  1F9N A;  2ZTG A;  4Z1M A;  4G8X A;  1E1R A;  2OTL B;  1TYV A;  2KQR A;  2XC1 A;  2NNY A;  2VBU A;  2NVX J;  1BQE A;  1JRG A;  3A01 B;  3HC7 A;  1BX0 A;  1U9N A;  2FD5 A;  5FKK A;  1IAW A;  3WTW C;  2B0L A;  3LSI A;  3VWB A;  3OFN A;  3AVU A;  1VQN B;  2UVE A;  4XLP F;  4OJO A;  3PNY A;  3T9G A;  2WV0 A;  2ID6 A;  1W1W E;  3FXJ A;  2JA6 J;  2IS2 A;  2OYN A;  3WU1 B;  3HYI A;  3WU2 C;  1DGR M;  1JJ6 C;  4BY1 J;  4P12 A;  5AIP A;  4MLO A;  4Q4Z F;  2L0K A;  4II3 A;  4UB6 C;  2EV5 A;  5BPD A;  2ADU A;  3QFT A;  4RB2 C;  3G4S I;  2D45 A;  2BY3 A;  3HBL A;  4AYB A;  2VC1 A;  3IL2 A;  2K86 A;  1APL C;  4C2T A;  1Y0Y A;  1R9T J;  1AWC A;  1REP C;  2FML A;  1K4Z A;  2ZNY A;  4LK1 F;  1ELO A;  1O8E A;  5FFZ A;  3CME I;  1W0U A;  1MNE A;  2D3N A;  1XG2 A;  2VQG A;  1HOM A;  2EV0 A;  2LNB A;  1OCP A;  2UV1 A;  2XAH A;  3CES A;  1WPC A;  1XMX A;  4O5V A;  2PBI A;  1LNW A;  3PUM A;  1XE1 A;  1QX4 A;  3P4G A;  1VZ0 A;  2WAQ A;  1XS9 A;  4FWT A;  5ED4 A;  1CF7 B;  5IOZ A;  4OOI A;  3KET A;  1M1K D;  1UAA A;  5HVQ C;  3HHG A;  2RC5 A;  2GXG A;  2L7F P;  2IP2 A;  2LH9 A;  2Q1Z B;  2QQ9 A;  2FNP A;  3JW4 A;  4L9T A;  1H8A C;  9ANT A;  4ACA A;  2L54 A;  3CC4 I;  3AKZ A;  2MA3 A;  2DXI A;  4HE6 A;  3ABL H;  3ISX A;  1BI1 A;  2ZTN A;  2KIF A;  4MHG A;  2VBY A;  2VE8 A;  2Q2E B;  4RGU A;  2XF5 A;  1N0U A;  3HRU A;  1RMG A;  4BHP A;  4CCO A;  1SD4 A;  3BWG A;  2EA4 A;  3OEH A;  2Y31 A;  2LYC A;  1R00 A;  2Z16 A;  2VE9 A;  4ZTJ A;  4WZL A;  3B78 A;  3OR1 C;  3U6B A;  1R49 A;  4AM3 A;  3HB9 A;  2ACJ A;  2ZKZ A;  2ELJ A;  5FRM A;  1J09 A;  1Z7L A;  4LIT A;  2ZFW A;  2DFH A;  4ANJ A;  1X19 A;  3OPO A;  3PSZ A;  2WYR A;  3TGN A;  4EM1 A;  1HW1 A;  2VL8 A;  3GRH A;  2E5Z A;  2VOP A;  4CCJ A;  5JI6 A;  5TGT A;  2QSH X;  3R61 A;  2HDC A;  3R4K A;  3CCE I;  1GDT A;  3PO2 J;  3V8K A;  1O3T A;  4FAS D;  3GVK A;  3IH2 A;  5TY0 A;  2O17 A;  5AMV A;  3JTH A;  3JRH A;  1I50 J;  2W6J A;  5IPA A;  4Z4V A;  1WJB A;  4CXF A;  1WTH D;  1YW8 A;  4IZZ A;  1O3R A;  4V19 K;  4BBS J;  2VBT A;  1GHC A;  4IOA F;  4BL0 B;  5DS0 A;  3GZN B;  5LEJ A;  3W2G A;  5GAH J;  1SFO J;  2E2J J;  3GO5 A;  1COW A;  2QTL A;  3DFG A;  3GQB A;  4W97 A;  3WBJ A;  3FX3 A;  3LQ6 A;  4QLC U;  4A3J J;  3SUC A;  3PJR A;  2IAI A;  1SMY F;  2HTJ A;  5CVU A;  1SFU A;  3R0A A;  1B8I B;  4M3D A;  1PJ6 A;  2KPM A;  2R5Y B;  2HVQ A;  1EXM A;  2Z5U A;  4EMS A;  2GK7 A;  1TLL A;  4LB6 B;  5FKL A;  1OIS A;  3OYD A;  1JE8 A;  1FOW A;  2R6H A;  4A6E A;  2WJV A;  2HKO A;  3ZZ0 A;  3RCO A;  4E7S A;  2KDZ A;  3J7Y J;  2DLL A;  4RDU A;  4S05 A;  3DLA A;  1A6I A;  2HQ5 A;  2H8W A;  4M3B A;  2EZK A;  4MXN A;  1NK2 P;  1LDD A;  4FN5 A;  3BCA A;  2DJI A;  1JT0 A;  2R7O A;  4BEH A;  1YJ9 B;  4I7H A;  3G6E I;  4A3C J;  1IN5 A;  2L7M P;  4R1H A;  3MEX A;  5GV7 A;  2GJP A;  1HKS A;  1UZC A;  3CUQ C;  5LRS A;  4LLL A;  3L7W A;  2ICW G;  3FZV A;  5IK2 A;  2LY1 A;  2NNN A;  1U0J A;  3F8B A;  2F5E A;  2VNI A;  2X0L A;  3HOW J;  3Q6Q A;  3GWZ A;  2EFP A;  2L4M A;  2L9V A;  3DKY A;  3PUB A;  1WOO A;  3X2Q H;  1I6H J;  2LR8 A;  1R71 A;  1LPQ A;  1IV6 A;  4CYD A;  2YWH A;  4BJ6 C;  1IC8 A;  2DFF A;  4RAG A;  2GXB A;  1MJB A;  2QKL B;  2NAZ A;  2WV1 A;  4OWR B;  2C78 A;  5K1Y A;  5E1W A;  4ASU A;  1Y56 A;  2NTB A;  4B4C A;  2STW A;  2BW3 A;  1KRH A;  1Q82 D;  4UNO A;  5JR3 A;  3ELK A;  4KDP A;  2W25 A;  2IJL A;  1OCZ H;  3U1K A;  4C2M J;  1B72 A;  1Z1D A;  4IRI A;  3VDX A;  4G12 A;  1OPC A;  4P26 A;  1VLO A;  2XDV A;  5EEG A;  1ZM9 A;  3K69 A;  2PMZ A;  2CQ7 A;  3K4K A;  3D0S A;  5CJ9 A;  2Q6K A;  5A8A A;  1WDT A;  3H35 A;  2JMW A;  2ZB9 A;  4B8X A;  2DAO A;  1ONV A;  1CQT A;  2Y9Y A;  1NDH A;  4ZTF A;  3P9K A;  1E63 A;  3OJX A;  3ABU A;  3VOE A;  4IHX A;  2CU7 A;  1E3Z A;  2NVU B;  4CGZ A;  1XN7 A;  4F92 B;  1T38 A;  3WXM A;  1BLI A;  1PUF B;  2M0M A;  2P6S A;  2XV4 S;  2VIX A;  3CCV I;  1FND A;  4UZU A;  4C2L A;  2CQQ A;  2F4M B;  1N25 A;  4OZY A;  3A3B A;  2I5U A;  4A2U A;  2WSS A;  5DTD A;  4RCY A;  1WGX A;  1KK1 A;  3H3U A;  4G7O F;  1XX5 A;  2P81 A;  4LJZ F;  3CC2 B;  5E79 C;  3S8P A;  3J7A Y;  2BYV E;  3S1N J;  3ONY A;  2NOJ B;  3GTL J;  3OE7 A;  4BYY A;  2JTV A;  3KZY A;  1IGN A;  2ELK A;  3GCM A;  1IN7 A;  2GAU A;  4D7N A;  5DS9 A;  3ZOB A;  3GQ9 A;  1QUE A;  2W82 A;  4UUS A;  1X3W B;  1STZ A;  1Z3Y A;  4TMX A;  3F8F A;  3SFZ A;  4N9H A;  2EFQ A;  2XIG A;  3K0L A;  5M3F J;  3MMY B;  3JRG A;  4XRF A;  1BN5 A;  3QPL A;  1FBS A;  3BG9 A;  3IV5 A;  4HWV A;  3LSR A;  3IKV A;  3LSJ A;  2GLO A;  3KEQ A;  2IT0 A;  3OYK A;  2XEX A;  3I1F A;  3KLO A;  5J1Y A;  2AQE A;  2P5V A;  4CO8 A;  5BQT A;  3FXK A;  2BSP A;  1Z05 A;  2M30 A;  3R6J A;  4UZF A;  3FMR A;  5IY5 H;  3FHZ A;  3DEE A;  2C4U A;  1YJN I;  2CV2 A;  2D74 A;  4RD6 A;  1P92 A;  3E97 A;  2FBH A;  2MSY A;  2XPV A;  4AWX B;  1OB5 A;  2XF6 A;  3UW0 A;  3LQQ A;  4GQN A;  2BV6 A;  5DSZ A;  2X51 A;  1UHM A;  2IEK A;  1KQ5 A;  2DOG A;  5B3S H;  4XNF A;  3KL9 A;  5DD4 A;  3DQV C;  5JFR A;  5FD6 A;  3FKJ A;  1H8E A;  3ZMV A;  1OGO X;  3L2U A;  2YU9 J;  1TW2 A;  2Z3Y A;  3P5J A;  2RRE A;  1T0F C;  2HZD A;  2LOO A;  1LUJ B;  2G9W A;  3R60 A;  5FKO A;  4TMW A;  4KH3 A;  4BHB A;  3ZRG A;  2EFW A;  2PX9 A;  1MJ9 A;  3V7S A;  3WGI A;  4EJT A;  4V02 C;  2LFB A;  4GYI A;  1MBK A;  3BCB A;  4M0L A;  2X48 A;  3K4J A;  2ETH A;  2JVG A;  1RKW A;  1BX1 A;  2ZZE A;  3SEJ A;  1O88 A;  2IA2 A;  1LFB A;  4RB3 C;  3D5R C;  3G2B A;  5EGO A;  3FM3 A;  5HLH A;  3CJT B;  3OIQ A;  1XD7 A;  3CUQ A;  3F8N A;  3HRS A;  3VSL A;  1KQS B;  1POG A;  1G3W A;  1D1N A;  4BJT A;  2L7Z A;  2JJ2 A;  1MW7 A;  2KIM A;  1QFZ A;  4M4S A;  2FU4 A;  4PC7 A;  2IPQ X;  4X0C A;  4N3N A;  4DNR B;  1QH0 A;  2B9S A;  4Q5S F;  2O6W A;  2VKH A;  4U4B A;  4BDY A;  2ESH A;  3A4C A;  1SC7 A;  3E6D A;  2QQ8 A;  4HF0 A;  4RS8 A;  2NZM A;  4MIM A;  4WWC A;  4YZA A;  4DYR A;  1YHQ I;  3CDI A;  4NCN A;  4ZCM A;  1SMT A;  3BJ6 A;  3CC7 I;  1HST A;  2OQR A;  3AGP A;  2FE3 A;  2IGN A;  5CVR A;  3F9K A;  5TRD A;  3M4O J;  1K73 D;  2MLG A;  1I7P A;  1KYW A;  2LP0 A;  3L2R A;  3S1Q J;  3KYD B;  2X85 A;  4P6Y A;  2UUZ A;  2W7N A;  3VNV A;  4A69 C;  3W2E A;  1LFP A;  3TO9 A;  4OPS A;  2V26 A;  1IDY A;  1S6L A;  1UHS A;  1BI3 A;  4DNC A;  4DOZ A;  1RKT A;  1HC8 A;  5BNG A;  1IRX A;  4AUX A;  4L9J A;  2RNG A;  3VYS B;  3WG9 A;  4ZDO A;  3LO8 A;  4RD2 A;  3AK5 A;  3HL2 A;  1QVT A;  4C3H J;  4TMT A;  3IWZ A;  1JKO C;  2XGC A;  3ML6 A;  4XLH A;  5J1R A;  2VKD A;  4N4N B;  1U2W A;  5DCF A;  3SZT A;  4NC7 A;  3BDD A;  1Z9C A;  2RVC A;  1JGG A;  3QOP A;  4O3M A;  2XRN A;  1TYW A;  1QA2 A;  1A8P A;  2QYU A;  3AVT A;  2V9K A;  1PKV A;  4DQK A;  3FBN B;  1RQP A;  2CS3 A;  1OCO H;  1Q1H A;  4G1V A;  3LSK A;  2F1L A;  5F0H A;  1ZGA A;  2EA2 A;  3HSE A;  3JCU C;  3MKW B;  3DLL F;  3OAA A;  1B23 P;  1PDN C;  1TVC A;  4HBL A;  3Q0U A;  1KZH A;  5DV5 A;  5DEQ A;  2DK5 A;  1ZR2 A;  3GXO A;  2PIA A;  4RD3 A;  4ENK A;  1M90 D;  5E3L A;  1T8I A;  1HA3 A;  1KZL A;  4ZZL A;  1R36 A;  2IGO A;  1O3S A;  1IA5 A;  3HPG A;  3EUH A;  4ZC3 A;  3L1P A;  4RDL A;  1QU3 A;  2JUC A;  4RGX A;  5L3D A;  4DNT B;  4KJZ A;  1YJW B;  2FRH A;  2Y69 H;  2P5K A;  3CCL I;  4EGY A;  3BY6 A;  2M0C A;  1TLH B;  1J7K A;  2YR2 A;  1JJ8 C;  4UY8 I;  1VQ7 B;  4EW9 A;  5TV2 A;  3OS2 A;  3BR1 A;  3NEU A;  3LA2 A;  4BAC A;  1GAW A;  3P7N A;  4LBV A;  2QZA A;  2X6X A;  3H1C A;  4Z03 A;  4A3M J;  2X53 S;  3CB4 A;  4EM2 A;  3BG7 A;  3BCF A;  4NBS A;  2NT6 A;  1SAN A;  1E17 A;  1A6Q A;  1HBX G;  4E4H A;  3WTY C;  2NS0 A;  2W48 A;  5C1C A;  1FSE A;  2HWV A;  1T0F A;  2G7H A;  2HZT A;  3KP4 A;  3V76 A;  2PLF A;  3SQV A;  2IQ7 A;  1VQL I;  4ZDL A;  4YIF A;  2R7T A;  1WWX A;  3WTV C;  2DMU A;  4WK8 F;  1LEB A;  2P8T A;  4YAU A;  4LG3 A;  1Q9S A;  2DA1 A;  1BA5 A;  1XDS A;  1OGI A;  5FIU A;  1W7P D;  4LIV A;  4HZF A;  1F5T A;  1V0E A;  1D3Y A;  3BR0 A;  4B48 A;  2EWN A;  1VF9 A;  1U2R A;  5GPA A;  1BOB A;  2CFX A;  1VQ6 B;  2D1H A;  3HGG A;  4YAO A;  3H5N A;  2DMQ A;  3FWE A;  4MNU A;  3T8T A;  2Z33 A;  4RD1 A;  1P4W A;  2M4G A;  4M71 A;  4PFO A;  1KYZ A;  2G7U A;  1UD8 A;  1R5I D;  1MH4 A;  3CCR I;  5F0F A;  4XD7 A;  2ZBK A;  1X1D A;  4BXF A;  3HOS A;  1KCD A;  2QEX I;  3CXC B;  1WMR A;  5IYR A;  3RDI A;  3DCF A;  1QBJ A;  2LTP A;  3H92 A;  1I18 A;  2X1C A;  3TMO A;  3A2K A;  1MBH A;  1MJA A;  2JJ1 A;  4BNC A;  2CUF A;  2P3M A;  4WZK A;  3BRO A;  1UJ8 A;  4KMU X;  5D8K B;  1E3X A;  5F64 A;  1XGM A;  1D8J A;  2INV A;  1DDN A;  3ASS A;  2XTX A;  1FMV A;  3M3Y J;  2NVT J;  4KIF A;  5FRO A;  3WOD F;  5GPC A;  3PO3 J;  3G1O A;  1T6Z A;  3ZMS A;  4PAB A;  3VSU A;  1MBE A;  4MTD A;  1ZM4 A;  1OB0 A;  4IOC F;  2MC4 A;  2VPL A;  5F04 A;  3L2C A;  1O4X A;  1BOA A;  3BZC A;  2CO5 A;  3REO A;  1JA0 A;  4M9S A;  3G71 B;  1P2F A;  3OY9 A;  3ASO H;  4XLE A;  2BM0 A;  4WWV A;  5H59 A;  2B7B A;  4BY7 J;  1BI2 A;  3ECH A;  4BQO A;  1JA1 A;  4C43 A;  5B6I A;  4OIP F;  4FTH A;  2FXA A;  4FE4 A;  1W7P A;  3B6C A;  1MMS A;  5DYM A;  2VB6 A;  3TKY A;  5LLQ A;  2K3F A;  4D1Q A;  2DBB A;  4PGH A;  1ZLK A;  4XID A;  2ODL A;  1JGS A;  4TT3 A;  5AIQ A;  2FBK A;  1N05 A;  1G7C A;  1T6Y A;  1O8J A;  4G1B A;  3G1L A;  4EJW A;  2KRF A;  3OMY A;  2DMT A;  1NRK A;  1WOR A;  1J5Y A;  3HRM A;  1W0K A;  1V54 H;  4NQW A;  4BS9 A;  1VQ8 B;  3M8E A;  3Q0V A;  1ZG1 A;  5KK1 A;  2E7W A;  3DEU A;  2VC0 A;  4L5I A;  4QWQ A;  2LKX A;  1NHC A;  1MSE C;  1TT5 B;  1SAU A;  3BJA A;  2Y30 A;  3H5A A;  2W4S A;  3CDL A;  3MKY B;  2Y9Z A;  2D3L A;  3L9F A;  2P7C B;  2XSD C;  2LF8 A;  3TL4 X;  3PIO F;  2VT2 A;  4JP0 A;  4RGR A;  2QMU A;  2CG4 A;  5FO5 A;  1YIJ B;  1BL0 A;  3A1Y A;  1X1C A;  3CUO A;  4U0V A;  1KU9 A;  2Y0S N;  2KP6 A;  4UUT A;  4D9J A;  1YOV B;  4XKB A;  2VI6 A;  1K4S A;  2VFP A;  4KIC A;  2BSA A;  3EUA A;  3SYT A;  4FT8 A;  2QWW A;  5FLV A;  1DBG A;  1K78 B;  1YLO A;  3ZP5 A;  1BW6 A;  2HOA A;  4YG2 F;  3A01 A;  3S2H J;  2M34 A;  1UB9 A;  5J3L A;  4C30 A;  3E6B A;  4ENN A;  4MR0 A;  1NG6 A;  2EWE A;  1SFE A;  4XIC A;  4YEI A;  1PJ5 A;  1O8H A;  3E20 A;  2X1E A;  3QYE A;  3T51 B;  2PMD A;  2PJR B;  2W1O A;  1O8G A;  2XZO A;  1XGS A;  1SFK A;  3HIF A;  1AMO A;  2OUM A;  3I58 A;  4MO7 A;  1J59 A;  1ZRD A;  1G7T A;  4OIO F;  3AVW A;  1TSP A;  5D5W B;  3B82 A;  1RET A;  3A0B C;  2HCJ B;  3VST A;  4ZDP A;  2WY8 Q;  2XF7 A;  3TW7 A;  3CCQ B;  2W6I A;  4X7E A;  4E7K A;  3SLN A;  1O8L A;  3CMA I;  2E1C A;  4MFE A;  4JQF A;  4BE0 A;  3WY9 A;  4NC6 A;  4KIG A;  1N07 A;  3G1M A;  1V5E A;  1MD0 A;  3TP3 A;  2BVM A;  3LA3 A;  1BR2 A;  3GSI A;  5L3G A;  1G8X A;  4E7L A;  3W2H A;  4UHT A;  2QBY A;  2A05 A;  4LGW A;  4PUS A;  1SFX A;  1OYY A;  2VT3 A;  1KQ0 A;  3F23 A;  2IXS A;  1K61 A;  2QM3 A;  4E0F A;  1TUI A;  2EFG A;  5E1Z B;  3HZJ A;  3RIR A;  1CF7 A;  2CJJ A;  1FJL A;  3HUG B;  4W8Q A;  4Z4S A;  1FPQ A;  4ENM A;  2QQA A;  5C3E J;  3U2R A;  3TO6 A;  3L2V A;  2NV4 A;  1WXR A;  3HSR A;  3FXO A;  2Q2E A;  3ISP A;  1XSX A;  4RB0 A;  2HNH A;  4X1E A;  4GDF A;  3CME B;  3DBH B;  3AVX A;  2NXN B;  1EJ9 A;  1IRF A;  3H9N A;  1BBY A;  1KTW A;  5A88 A;  2VAS A;  1ZAR A;  1EE6 A;  2VON A;  1U3E M;  1O8I A;  4XLF A;  4BE2 A;  4D5F A;  4TSF A;  3U1D A;  2X3U A;  4A3D J;  2K40 A;  2EBI A;  2WZN A;  3Q3S A;  4BPR A;  4IRG A;  4U9U A;  3V7C A;  4UVA A;  2WWY A;  2B7E A;  2PFB A;  4HNT A;  1L3L A;  4HE5 A;  4CCM A;  2NVY J;  1VJS A;  2F43 A;  5E6T A;  4OZZ A;  4YEJ A;  2UWM A;  2VNK A;  2BX6 A;  1BC7 C;  4ZYG A;  3CC4 B;  2V7U A;  1V0F A;  1SD5 A;  2CUE A;  2LK2 A;  3NAR A;  2PEX A;  1S29 A;  1G4D A;  1RR8 C;  1S7A A;  1YX2 A;  1WSV A;  5CPR B;  2ZNZ A;  1WKM A;  5D5X B;  1RWR A;  3A0H C;  5FL7 A;  4HDV A;  4K2E A;  5FLM J;  4P5O A;  1KQ9 A;  2K9S A;  4XN0 A;  1ZN2 A;  3JU4 A;  3B8H A;  2V1N A;  3BLY A;  2YU3 A;  2DDA A;  2H27 A;  3OYL A;  3S17 J;  1GO2 A;  2BVL A;  4AC0 A;  1VHE A;  5JLV C;  1Y6I A;  1XG1 A;  1D8K A;  1IDJ A;  4IVN A;  2LSO A;  3ZXS A;  2G0E A;  4IRH A;  4B3A A;  1OFC X;  1YS6 A;  4RPD A;  4I02 A;  1G3S A;  2HYG D;  1B8I A;  3VSK A;  5E8I A;  2X0K A;  2AQF A;  2FSW A;  3HKZ N;  3NAW A;  2OV7 A;  2R5Y A;  4CHU A;  4X7F A;  2Y75 A;  3DTE A;  1IJE A;  4TKO B;  1OGM X;  2W84 A;  3EYI A;  3CCE B;  2Q0O A;  5HNF A;  1L0O C;  1GQ8 A;  2V1X A;  4GXO A;  1GT0 C;  4IQJ A;  5JLX A;  1QFJ A;  4LLN A;  2FNA A;  4I76 A;  4AD9 A;  2QVO A;  4RA2 A;  1SVL A;  5IYN A;  3F72 A;  1MDM B;  1R5N A;  4BQA A;  2XAS A;  5DD8 A;  1VQ4 B;  1IW7 F;  1HXD A;  1V3F A;  4A93 J;  3CMY A;  3KP3 A;  4W1U A;  4RLQ A;  4OIN F;  2VBX A;  4A3L J;  2GPJ A;  1L1I A;  4QVA A;  3IWF A;  1IXS B;  2VKE A;  1LFU P;  3QYF A;  1Q81 D;  3AST A;  3L2Q A;  3MKZ A;  2F3L A;  4XOT A;  2RV8 A;  4P6V F;  5CDF A;  1NJI D;  3BG5 A;  1SKQ A;  3ZQQ A;  1VQP I;  3CDH A;  2YWE A;  4XKW A;  4I01 A;  4PSW A;  1JNY A;  2NYX A;  1H8H A;  1VQ5 I;  2HLD A;  2W00 A;  1FP2 A;  2EIL H;  4OOV A;  1UG0 A;  3GX4 X;  1YTY A;  3S1M J;  4HQE A;  2A5W A;  2DQL A;  2BY1 A;  5A89 A;  2MGQ A;  2A6H F;  4A3I J;  1XB4 A;  2XRO A;  3DTK A;  1UMQ A;  2O8X A;  3MQ0 A;  1YIO A;  3NAU A;  4MEX F;  3IUO A;  5BPI A;  3I4N J;  2ZBU A;  3A35 A;  5KSW B;  1WH7 A;  3G6E B;  4PK4 A;  1HF2 A;  3DEW A;  2ISY A;  2A6E F;  2CW8 A;  1BJK A;  4QHY A;  1YX3 A;  2XSJ C;  2QBY B;  3MWM A;  5BOX A;  1K7A A;  2HOS A;  1FOX A;  2PG4 A;  4PAA A;  1EA0 A;  2X3H A;  2IA1 A;  3PFI A;  2W85 A;  4BUP A;  2BM7 A;  4X07 A;  2OU2 A;  2L5Q A;  3BJO A;  4X7C A;  2PYH A;  1UEL B;  1PUF A;  3O8G A;  1U78 A;  4EM0 B;  3A02 A;  4F7D A;  3FXM A;  5ICF A;  4CH7 A;  4HX7 A;  4CQJ A;  3U21 A;  1FP1 D;  4WXD A;  4E7H A;  3H3V K;  1ULY A;  1PYV A;  2HDW A;  4G6D A;  3TDZ C;  5D4S A;  5GAG J;  2O0Y A;  4K1X A;  4ROX A;  4IKF A;  3DV8 A;  3OYA A;  3F6O A;  2DCU A;  1W87 A;  3F8C A;  2F48 A;  2VZL A;  1LVA A;  4X7D A;  1Z91 A;  2RQP A;  4I09 A;  3T53 B;  1VQ9 I;  4XOP A;  5GV8 A;  2B5O A;  1YIT I;  3V8J A;  4FCY A;  2ZFU A;  4AU7 A;  4G7H F;  1D5Y A;  4RLZ A;  2G0Y A;  3I71 A;  2ZJ2 A;  5D6E A;  2X8K A;  1YRN B;  4IHS A;  3KP6 A;  4PDK A;  1JKQ C;  3HDD A;  2VUM J;  3E5Q A;  1GV5 A;  2E60 A;  2DJN A;  2EIM H;  2DA6 A;  2O03 A;  3HOX J;  2FX3 A;  1ZKG A;  4ZYA A;  2V7V A;  4KKS A;  3J80 Z;  2ESN A;  4IHY A;  2NOG A;  3HM5 A;  4A3B J;  3JQQ A;  3CCV B;  2FA5 A;  3WWG A;  4G9Y A;  1Y0R A;  1NBM A;  2WZP P;  3T0Y A;  3VEP A;  3H9J A;  1G6N A;  1K4T A;  3M1E A;  1R5H A;  4PSX A;  1TT0 A;  4X0G A;  3DPT A;  2LY2 A;  2HQR A;  5F08 A;  3QSY A;  1FIA A;  3RKX A;  3CD6 I;  1N8R D;  1GLN A;  2ZXI A;  1HZE A;  1W34 A;  4YII A;  1MRZ A;  1R5G A;  3SJP A;  4MQ9 F;  3V7A A;  3QFS A;  1R5O A;  2V6E A;  5HLT A;  2RN7 A;  1J9Z A;  3ZN1 A;  4EV0 A;  1C0W A;  1FBQ A;  2DOF A;  1TQP A;  3H5R A;  5LD2 C;  4FQG A;  2V9P A;  2XT4 A;  1FX7 A;  1FWZ A;  3O3K A;  4M6V A;  3M8F A;  3L2W A;  3LYC A;  1SKY B;  4NBQ A;  4EEF G;  3GME A;  1G3Y A;  2BY0 A;  3JRB A;  3S15 J;  1N08 A;  3B6A A;  1XCB A;  3HOU J;  1XCV A;  2JA8 J;  4RJL A;  2L7K A;  2VFM A;  4XK4 A;  2ELH A;  3SDG A;  3GQA A;  4L5J A;  4I99 C;  5D6F A;  1T98 A;  1YJN B;  1N0V C;  3OL4 A;  1IRG A;  3JRI A;  1SM4 A;  1ETO A;  3K4M A;  1DPU A;  2C77 A;  2R7Q A;  3CPX A;  1AIR A;  3HTU A;  1H80 A;  3N90 A;  1PP7 U;  1X1P A;  4L5E A;  3WE2 A;  3G3Z A;  3CCJ B;  2XGX A;  3HSF A;  3OIP A;  3P27 A;  1QQ1 A;  3BQY A;  4LLG F;  4UZE A;  2XNJ A;  3GQ7 A;  3QYB A;  1TC3 C;  2R7U A;  2R7V A;  3SKB A;  4OAZ A;  2YUH A;  5K5O A;  4HSR A;  3K4L A;  4UV9 A;  3ONU A;  3JRF A;  2CMP A;  3UKG A;  2DOA A;  5HLG A;  2K5C A;  2QZ8 A;  2BV3 A;  3FPP A;  3EQL F;  3WTT C;  1Q86 D;  3T5X A;  1R1T A;  4XOR A;  3LNQ A;  2XAJ A;  4U7B A;  2VBW A;  1LLW A;  1ZK8 A;  4KKU A;  1JTA A;  3I3L A;  3BTL A;  3KZI C;  2WAE A;  3AG4 H;  5IP7 J;  2M9H A;  3Q3A A;  4CCK A;  4OIR F;  1ETQ A;  3N05 A;  5FB2 A;  2P4W A;  3PVD A;  2YS9 A;  3K10 A;  2Z6B D;  5THX A;  4IX7 A;  4A0Y A;  2BPO A;  4IXA A;  4QIW N;  4YFK F;  3DBL B;  2CQK A;  5HS7 A;  4AID A;  4I6Z A;  1IO2 A;  2QQB A;  1ORK A;  1EP2 B;  3CQZ J;  1ZGW A;  2YX4 A;  1O8K A;  1S7O A;  1E64 A;  3I54 A;  2HOT A;  1CNE A;  2LVS A;  5JVT A;  3D1N I;  2HTS A;  3RY8 A;  3LAP A;  4M9Z A;  3V8L A;  4A12 A;  3MCZ A;  3ZPP A;  1YHQ B;  3BR5 A;  3EQO A;  1EA3 A;  3F8M A;  4IPA A;  4KIB A;  4F3Q A;  1U8R A;  2STT A;  1ETV A;  2Z8G A;  1HDP A;  1V55 H;  3CCM I;  2LZJ A;  2PN6 A;  3FIW A;  1ETW A;  1DGW Y;  2DY1 A;  1RC9 A;  3K1M A;  5HDK A;  4DIQ A;  4YFN F;  2X1D A;  5FKN A;  2DCE A;  3DU6 A;  3VSV A;  4E70 A;  5DM6 F;  5M3M J;  1FZP B;  4Y52 J;  1H42 A;  4M1K A;  4L8J A;  2VJI A;  2K3P A;  3PUN A;  3FJO A;  3ZMU A;  2COM A;  3F6V A;  1FOK A;  3SLD A;  2V7F A;  1PP8 F;  2R7F A;  2RQQ A;  5F1R A;  4XSX F;  4XMY A;  2O04 A;  4U87 A;  4YFX F;  5H20 A;  4BQQ A;  2MH2 A;  4U88 A;  3OJW A;  1V5G A;  1VND A;  1Y8R B;  2P0W A;  2XND A;  4HAM A;  1OGJ A;  5C4J J;  1RZ4 A;  3JX8 A;  1BC8 C;  1GXQ A;  2WB1 N;  1MBJ A;  1VI0 A;  1UD3 A;  5B1B H;  3ZQF A;  2WR8 A;  2BY2 A;  2K4B A;  2DTZ A;  4BHC A;  2XKP A;  5M5Y J;  5FJ8 J;  1P6R A;  4KN7 X;  1ZGJ A;  3F3X A;  4OJ6 A;  4D5C A;  2XVC A;  1ZH5 A;  3I55 I;  4GCV A;  3B02 A;  2COB A;  4IL6 C;  2VYQ A;  4GGG A;  4WQM A;  3W2A A;  4P1W A;  3FXL A;  2ME6 A;  2HYF A;  3WHB A;  4DGW B;  3MZH A;  3SEQ A;  4KNY A;  5K7F A;  2ZIT A;  2O7O A;  1IB0 A;  1I1G A;  3JSP A;  4Y9R A;  3U2Q A;  3ASN H;  3VO2 A;  1P7I A;  2OF7 A;  4CUG A;  3G73 A;  1W5S A;  2FQ4 A;  1YJ9 I;  2OBP A;  1FC3 A;  4I98 B;  5FGM A;  3M07 A;  2OBS A;  1P4A A;  2HOE A;  1FEX A;  2CUZ A;  1I39 A;  1ODD A;  3GBG A;  3A8K A;  2J5O A;  2M7A A;  2MBF A;  1WJF A;  4P9U A;  2EH3 A;  4QUZ A;  3LAJ A;  1FYL A;  2VFQ A;  1FY7 A;  4A3K J;  2F2E A;  1HF0 A;  5LGU A;  3OYH A;  1W2B B;  1Z6T A;  3BPX A;  4LG0 B;  1OOC A;  1KC8 D;  2Y2Z A;  2O6G E;  2JSC A;  3MHP A;  4QVJ A;  2GIV A;  2E1M C;  5LRR A;  3JSO A;  3FF5 A;  4X6A J;  2V7Q A;  2KHM A;  5LGN A;  4ZCI A;  4OM9 A;  2YSR A;  5IT3 A;  2AXL A;  2VBS A;  3D5L A;  4F93 B;  4FK8 A;  3R6S A;  3Q6R A;  1J75 A;  3SZG A;  2FVG A;  2WJY A;  2TCT A;  1WOS A;  3PNV A;  3OOP A;  5H2F C;  4LK0 F;  1B9M A;  4Q47 A;  1S0U A;  3DTI A;  1SEU A;  3E3V A;  4G94 A;  3VMF A;  2HGC A;  4LD5 A;  3VFZ A;  5LEK A;  3OYI A;  1WZ2 A;  1QCX A;  3GF2 A;  4JRA C;  4OIQ F;  2H94 A;  1BPL A;  4ZV4 A;  1NB9 A;  5L46 A;  2A61 A;  2LF7 A;  1AOY A;  3IC7 A;  3WG7 H;  4L18 B;  1QFY A;  1GV2 A;  3ABM H;  1N78 A;  3S2W A;  3S3O A;  1ZRE A;  3JRA A;  1QGY A;  3QAH A;  1OHH A;  4OMZ A;  1I3Q J;  1YS7 A;  5E1X A;  2HVS A;  1DP7 P;  3W5V A;  4B1R A;  5H6R A;  3FDY A;  3MKL A;  1LE8 B;  4PC2 A;  1PJ7 A;  4ZYE A;  4E7Z A;  2JA7 J;  1KK0 A;  2CYY A;  1MIJ A;  1B4A A;  1XPX A;  3ZN0 A;  4XSZ F;  5BS6 A;  3C2H A;  4DBQ A;  4M74 A;  2QEX B;  1DPR A;  1ON2 A;  3BC8 A;  5E8G A;  4C3J J;  5BMZ A;  3ZQC A;  3AFH A;  2LRE A;  2BM4 A;  1W36 C;  4PC3 A;  1S3J A;  2KZG A;  1KA8 A;  2HVR A;  1Y8Q B;  4KIS A;  1EFR A;  4JX4 A;  3CF2 A;  1XC5 A;  1FDR A;  2FJ1 A;  1ZUN B;  3MZY A;  1IF1 A;  3HOT A;  3RI4 A;  2C5B A;  2RDP A;  3M8J A;  1VQK I;  5H6Q A;  3TBI A;  1W9X A;  2ZBV A;  1H9T A;  4S0H B;  1JKP C;  4RD4 A;  5J6X A;  2GK6 A;  2R7D A;  3JRE A;  2QF7 A;  4DJA A;  2CV0 A;  1ZLJ A;  4HX4 A;  5HDG A;  3WTU C;  3GVJ A;  4I0A A;  1B2R A;  3AVY A;  2OBT A;  2ECB A;  1UD5 A;  1D8T A;  3W6V A;  1ACI A;  3BTI A;  2E1O A;  2V4J C;  3CCU I;  4P3I A;  4I0B A;  2QGG A;  2DA2 A;  2M5W A;  3K4C A;  1DDG A;  4BGD A;  1KMH A;  1W35 A;  1K6O A;  2CW5 A;  4HIZ A;  1TWC J;  3HHH A;  4M3G A;  5IYC J;  5HDN A;  2OQG A;  3ZQG A;  5J4V A;  3CCY A;  3KEO A;  4FE7 A;  2GA1 A;  4A5M A;  5EDN A;  2WC2 A;  1JI8 A;  3A1P A;  2MD0 A;  1K8A D;  4PMH A;  1O57 A;  2M2E A;  2W24 A;  1VQO I;  2O5R A;  5F4O A;  3HJE A;  4KUM A;  4M73 A;  1W5C C;  1T33 A;  4YZ0 A;  3O6B B;  5KHD A;  5HS8 A;  1K78 A;  4P2N A;  6PAX A;  1TNT A;  2DA5 A;  3JUR A;  1S8N A;  3EDP A;  3LSM A;  1JTX A;  5FKM A;  1V5F A;  5B1A H;  3W3C A;  1O3Q A;  5JBQ A;  1QJV A;  1EH8 A;  1HG8 A;  5DUK A;  2QE7 A;  2GJK A;  1OB2 A;  3R6K A;  1T39 A;  3B90 A;  3ESW B;  2D2W A;  4HPQ A;  2PJR A;  1FYM A;  2QLZ A;  4DBR A;  2QCO A;  3OZU A;  3ECO A;  1X4P A;  2IGM A;  4CCL A;  5GTI C;  5DCM B;  4X05 A;  5IP9 J;  1S72 I;  2YWF A;  2DN0 A;  1HQC A;  5LMZ A;  4HST A;  4X8I A;  3ABK H;  3BR3 A;  1G59 A;  3BNW A;  2JRT A;  2R7W A;  3KZZ A;  3SEZ A;  3H0D A;  4NB5 A;  4I2O A;  5TR9 A;  2VFO A;  2F5D A;  3FIS A;  3GUD A;  4M53 A;  4HDU A;  2QYO A;  3SY2 A;  3RPQ A;  4A3G J;  1NB0 A;  3GTP J;  2KZV A;  1ETK A;  1QHH D;  4Y33 A;  4Y17 A;  5CVI A;  3FMQ A;  1HA8 A;  3PA1 A;  1W36 D;  1MBF A;  2ID3 A;  4NC8 A;  5AN9 A;  4PJM A;  3HAG A;  2XAG A;  2DMN A;  3ZQH A;  3PM1 A;  2FOK A;  1ENH A;  4G7Z F;  4RDJ A;  5HS9 A;  1XMK A;  3FXQ A;  5C4X J;  2HXO A;  2CFO A;  4WZE A;  1X1B A;  1WJC A;  2NRA C;  3HUG A;  3K1P A;  4PFP A;  4AIJ A;  1TWF J;  4HRI A;  3P9C A;  2VBM A;  3I9V 2;  3CMA B;  3GW2 A;  3J81 Z;  1X3U A;  4DYC A;  2JA5 J;  3E1Y E;  1AU7 A;  2EIX A;  5E20 A;  2D9R A;  1USS A;  4X06 A;  4YCQ A;  4B3G A;  4RAZ A;  3JQR A;  2JT1 A;  2MH9 A;  2JZY A;  2BE5 F;  2M87 A;  4QV2 A;  4TMV A;  3CLO A;  4XBF A;  3QP5 A;  4Y9U A;  3CLQ A;  3VYT B;  2EFN A;  3S2D J;  1ZQ3 P;  1WFX A;  1MGT A;  1WI3 A;  3K7A J;  3QP6 A;  1VQM I;  2TRT A;  2ZSI B;  3IRR A;  2Q6O A;  4WXC A;  4ESJ A;  1TWH J;  5TJJ A;  2B7C A;  2Q6L A;  4ZJZ A;  2RC4 A;  3SJZ A;  1I27 A;  2B63 J;  3SFI A;  1F36 A;  5IP6 A;  1QRY A;  3M7G A;  1YI2 I;  4UXN A;  3CMM A;  3OYF A;  3RZD J;  1RUN A;  3BY2 A;  4URR A;  3E1S A;  3BG6 A;  1OFD A;  1RIO H;  4QPO A;  3OYM A;  3P9I A;  3OYE A;  4FET A;  2HEO A;  3DPU A;  4NHJ A;  2BMW A;  4CYC B;  1GVD A;  2WTE A;  4HX8 A;  1BJA A;  4IF4 A;  2GRE A;  1J0R A;  3OYG A;  1FSH A;  3FPK A;  2NT9 A;  4P25 A;  2OA4 A;  2VBV A;  3OEE A;  3LL7 A;  3OS1 A;  4J19 A;  1P4M A;  2HDD A;  5FLX Z;  5CVV A;  5ERI A;  4DK0 A;  5FNZ A;  5JMC B;  1XSD A;  1FNM A;  2DEU A;  1OJL A;  2HI3 A;  2XPW A;  3EET A;  4L9V A;  4PZJ A;  3I56 I;  4BU2 A;  1GXP A;  2I1L A;  1CNF A;  5F1J A;  5DDG A;  1X0C A;  1FTT A;  5CLS A;  2BM5 A;  5GTH C;  3KEW A;  3SYJ A;  5ILU A;  3LSG A;  3ERM A;  3DU1 X;  3ONQ A;  3B4N A;  3BTC A;  3I4P A;  1QA3 A;  2EJR A;  3RYR A;  5E3O A;  3C1D A;  3LMM A;  3PUF A;  4V2F A;  3MFK A;  4XLC A;  1WI9 A;  1MDM A;  2H6C A;  3W2V A;  1XTA A;  3RYP A;  1MBG A;  3GVA A;  1RU4 A;  1P9Q C;  3C18 A;  2L9N A;  3A03 A;  4M6X A;  1W5T A;  3VYR B;  1O8F A;  1KGS A;  2OPT A;  2VKV A;  4G7W A;  4W8S A;  3BH6 B;  1FRN A;  2QA4 I;  4LBW A;  3T8R A;  2RKH A;  5J40 A;  4HV6 A;  4G6T B;  1JTY A;  3PA2 A;  2JRM A;  2VJ4 A;  2HS5 A;  2ZO4 A;  3DKW A;  1IXR C;  2MLK A;  5EF6 A;  2R93 J;  3TED A;  3JRD A;  3MMP A;  2Z2S B;  3ZGK A;  5CKT A;  4XRS G;  1VQ6 I;  1EFT A;  3WU0 A;  3QU6 A;  1R1V A;  1D1A A;  3FM5 A;  3W6J B;  4A6D A;  3PSS A;  1W4M A;  1OFL A;  1XMA A;  4HV5 A;  4DQ2 A;  1R58 A;  1M1E B;  2F5C A;  2ZME B;  2EIK H;  2GM4 A;  5E3M A;  4OJP A;  1WRJ A;  3BH7 B;  2E1M B;  3E6M A;  3ZUG A;  2F1M A;  1MMG A;  3LNN A;  3OOC A;  5F4J A;  1TWA J;  4YAF A;  2DI3 A;  2VQL A;  1FMW A;  2GXA A;  1K9M D;  1QGA A;  4DK1 A;  1K5C A;  2ZXH A;  4C3I J;  1BJZ A;  2Y0S A;  3I5U A;  3COA C;  2BM1 A;  1FBU A;  3G4S B;  3HEF A;  3BCD A;  3RIQ A;  4N4O B;  2WAF A;  4MFD A;  4Z4T A;  2M8G X;  3DU5 A;  4YZX A;  5FO0 A;  2A68 F;  4RM3 A;  1IN8 A;  2XHK A;  1UCR A;  1RNL A;  1S4M A;  3BZ6 A;  4YAL A;  1ERD A;  2L9R A;  4IJA A;  3OOU A;  3EUK L;  1KTV A;  4PC1 A;  1OLT A;  3IHU A;  2BGJ A;  2R7S A;  2DTR A;  4AVZ A;  3JRC A;  1JKR C;  5EG0 B;  4OPV A;  3K4N A;  3HOV J;  3SZP A;  2E19 A;  2VQH A;  2VNJ A;  3H94 A;  3QFR A;  4TN1 A;  3VNU A;  1YRN A;  1TWG J;  2INU A;  2DOD A;  2C6Y A;  3CCS I;  4M72 A;  2Y48 A;  4IW3 B;  1TQI A;  3BQZ A;  3QPH A;  4XM3 A;  4C9Y A;  2W57 A; 
#chains in the Genus database with same CATH homology
 2HZD A;  2LOO A;  2ZXI A;  3PSI A;  1HZE A;  2DIE A;  3S93 A;  3ZRG A;  2KRH A;  2VXZ A;  3KX2 A;  2WPD A;  2M4K A;  2VBE A;  2V6E A;  5HLT A;  3BC9 A;  3BCB A;  4B47 A;  3NWS A;  3K4J A;  2JVG A;  2ZZE A;  3G05 A;  5LD2 C;  3H5R A;  1O88 A;  1W0J A;  1MMD A;  3D5R C;  3G2B A;  1DQU A;  2HU9 A;  2VJ5 A;  1K6Y A;  4BJ5 C;  4EAT A;  3OIQ A;  3OYC A;  2F6C A;  3L2W A;  1WJA A;  3W2W A;  4KIT B;  1SKY B;  3VSL A;  3DKX A;  5FRN A;  3VMV A;  1PJR A;  2INU A;  2KRC A;  3B8Y A;  4BJT A;  3C2G A;  1AA7 A;  1MW7 A;  4PJJ A;  2JJ2 A;  2L7K A;  3PSF A;  1MMN A;  3GQA A;  2R9V A;  2QXZ A;  2XC7 A;  3OL4 A;  4DNR B;  3K4M A;  3OWT A;  1AIR A;  1H80 A;  2R7Q A;  3ZPN A;  2VKH A;  4U4B A;  4BDY A;  3A4C A;  3OIP A;  1IDK A;  4G6I A;  4H4K C;  1VBL A;  3GQ7 A;  2NZM A;  3QYB A;  2WA0 A;  2R7U A;  2R7V A;  4YZA A;  4OAZ A;  4NK8 A;  1N75 A;  4HSR A;  2E5N A;  2V31 A;  3K4L A;  3M1C A;  2IGN A;  1FX0 A;  3F9K A;  2CMP A;  2DOA A;  2K5C A;  3V42 A;  5KCM A;  4C9Y A;  3FPP A;  4NK6 A;  4XOR A;  4XON A;  2GOM A;  4U7B A;  3RPU D;  3L2R A;  3GQ8 A;  2X85 A;  1VLY A;  2ZZQ A;  4KKU A;  5HKK A;  2UUZ A;  3I3L A;  2W7N A;  1JTA A;  1O8M A;  1Z3X A;  5KNL A;  2WAE A;  1LFP A;  4CCK A;  2V26 A;  3N05 A;  2R7X A;  3S3M A;  4DOZ A;  3K10 A;  2Z6B D;  1QHG A;  1IRX A;  4ZDO A;  2RNG A;  3VYS B;  3HL2 A;  4IX7 A;  4RLF A;  4B44 A;  1TZL A;  3EPZ A;  4Y3O A;  1LKX A;  4XLH A;  2VKD A;  4N4N B;  3SDB A;  4NC7 A;  1PXZ A;  1D1C A;  4RMN A;  4FXU A;  2DT6 A;  2V9K A;  4GRI A;  1PKV A;  1O8K A;  2O1D A;  3FBN B;  2ZZG A;  2CS3 A;  4YZQ A;  3H9G A;  3LSK A;  2I8D A;  2X6W A;  4PJN A;  3MKW B;  3OAA A;  2LRD A;  3HKZ A;  3NE5 B;  3ZPP A;  3EQO A;  1EA3 A;  3AL0 C;  4F3Q A;  2Z8G A;  4E7J A;  3FY3 A;  3VMW A;  1KZL A;  2LZJ A;  1XG2 A;  2NTQ A;  2BOL A;  4B3F X;  2IGO A;  1DGW Y;  2CH0 A;  1IA5 A;  1E79 A;  3HPG A;  4ZC3 A;  4DIQ A;  2X1D A;  2DCE A;  3DU6 A;  1QU3 A;  3VSV A;  3UNG C;  2ZSH B;  1T5E A;  3GVL A;  4W8R A;  4DNT B;  1WJ5 A;  3OR2 C;  4KJZ A;  4L8J A;  5CQG A;  4Z05 A;  2VJI A;  2K3P A;  3D5S C;  2GJR A;  2V7F A;  3OYJ A;  2RQQ A;  4EW9 A;  4XMY A;  2LG4 A;  5HNH A;  2O04 A;  4U87 A;  3OS2 A;  4BQQ A;  4II2 A;  5JHF A;  4BAC A;  1V5G A;  5LFA A;  2XND A;  2P0W A;  4F91 B;  1MMA A;  3CJQ B;  2X6X A;  2WBM A;  4Z03 A;  2X53 S;  2MYS A;  3KEY A;  4OAY A;  3BG7 A;  4XLA A;  3BCF A;  1BMF A;  2NT6 A;  4RM2 A;  1UD3 A;  4E4H A;  4PJL A;  3ZR8 X;  2E1B A;  5C1C A;  4YRV A;  4OJ6 A;  2LBF B;  1BHE A;  2WY7 Q;  4NNJ A;  2IQ7 A;  2XZL A;  4ZDL A;  2R7T A;  1D0Z A;  4XQF A;  3W2A A;  4P1W A;  4J00 A;  4LG3 A;  2MAB A;  4DGW B;  3SEQ A;  3FKS A;  4LIV A;  4XKV A;  1V0E A;  4B48 A;  2VLA A;  2IGK A;  1BOB A;  3S3N A;  2IS6 A;  4CUG A;  3H5N A;  2JIZ A;  2NTP A;  1KON A;  4BE1 A;  2JVH A;  2M4G A;  2LBF A;  1UD4 A;  2CUZ A;  3GBG A;  4NUB A;  4PFO A;  2M7A A;  1UD8 A;  1NG7 A;  1WJF A;  4B43 A;  4XD7 A;  1X1D A;  4BXF A;  3HOS A;  1KCD A;  1WMR A;  2K9L A;  2CW7 A;  2CUJ A;  3KRG A;  1I18 A;  2X1C A;  3OYH A;  4E7I A;  3TMO A;  3A2K A;  2JJ1 A;  4C2U A;  1OOC A;  2KDO A;  3KYL A;  1X1A A;  1E3X A;  2INV A;  2E1M C;  2GOX B;  4J01 A;  2JDI A;  1O8D A;  2V7Q A;  1FMV A;  2KHM A;  1UD2 A;  3CP8 A;  5FRO A;  3H9Q A;  2LC2 A;  3VSU A;  3D5L A;  4Z06 A;  3K4B A;  3RTR A;  4F93 B;  1OB0 A;  4XKC A;  2VPL A;  2MC4 A;  3SZG A;  2WJY A;  2O0V A;  4E6K G;  3PNV A;  3DTI A;  1K28 D;  3OY9 A;  4XLE A;  3BH4 A;  4BQO A;  4OJL A;  4XL9 A;  2IS1 A;  1PLU A;  3FHN A;  1WJE A;  1QCX A;  3OYI A;  4NQW B;  1BPL A;  1KCC A;  2VB6 A;  1D1B A;  1N78 A;  2XOK A;  5CQE A;  3S3O A;  2QY1 A;  2PYG A;  4D1Q A;  4YEL A;  1OHH A;  2ODL A;  4TT3 A;  2HVS A;  1X4O A;  3WQZ A;  4JOM A;  3FDY A;  1O8J A;  3PL8 A;  4E7Z A;  3OMY A;  1NRK A;  2DT7 B;  3QOD A;  4W8T A;  3E0J B;  2VBK A;  3C2H A;  4DBQ A;  1W0K A;  4BS9 A;  3BC8 A;  2FUG 2;  1YE9 A;  2VQC A;  3AFH A;  3HG9 A;  2LRE A;  4IQ4 A;  2NST A;  1T95 A;  1NHC A;  1W36 C;  2M7B A;  1MAB A;  1LVK A;  2HPM A;  4CZC A;  2ZTG A;  4Z1M A;  1SAU A;  1WJD A;  3H5A A;  3MKY B;  2W4S A;  2HVR A;  3CP2 A;  2KQR A;  4CCN A;  3OYB A;  2VJJ A;  3CF2 A;  4KIS A;  1EFR A;  2KVO A;  1JRG A;  3HC7 A;  3TL4 X;  3HOT A;  1DBO A;  3FBI B;  3M8J A;  2XGJ A;  4U49 A;  3LSI A;  3TBI A;  1W9X A;  3VWB A;  3OFN A;  3A1Y A;  1X1C A;  2GK6 A;  2UVE A;  4OJO A;  4DJA A;  3PNY A;  2CV0 A;  3T9G A;  2F5V A;  2KP6 A;  4D9J A;  4XKB A;  3GVJ A;  3EUA A;  3SYT A;  4BQN A;  2IS2 A;  4KKT A;  1UD5 A;  1DGR M;  1DBG A;  3VR6 A;  2V4J C;  2D3L A;  4MLO A;  4II3 A;  3K4C A;  4BGD A;  1KMH A;  3CJR B;  2HQA A;  4AYB A;  4C2T A;  4C30 A;  4HIZ A;  4MR0 A;  1NG6 A;  2EWE A;  1PE9 A;  3IAM 2;  1O8E A;  1JI8 A;  1MNE A;  2X1E A;  3RQ4 A;  3QYE A;  2VQG A;  2MD0 A;  2PJR B;  2D3N A;  4G7X A;  3T51 B;  4PMH A;  3OL3 A;  2W1O A;  3LFU A;  2O5R A;  1O8G A;  2R4G A;  2XZO A;  1SFK A;  2UV1 A;  2OUM A;  4YZ0 A;  3PFY A;  3CES A;  5KHD A;  1WPC A;  4R79 A;  3VST A;  3JUR A;  4ZDP A;  3HPH A;  3LSM A;  2WY8 Q;  2XF7 A;  2W6I A;  1V5F A;  4E7K A;  1VZ0 A;  2WAQ A;  3W3C A;  1O8L A;  1QJV A;  2VXD A;  1HG8 A;  2QE7 A;  1UAA A;  5HVQ C;  2GJK A;  3DWL E;  4JQF A;  2Q1Z B;  2LH9 A;  4BE0 A;  1O8H A;  3B90 A;  4HPQ A;  2PJR A;  1V5E A;  3AKZ A;  2DXI A;  1BN8 A;  4DBR A;  4OJ5 A;  2BVM A;  1X4P A;  2IGM A;  1BR2 A;  4CCL A;  1G8X A;  4E7L A;  2ZTN A;  2HPI A;  4PUS A;  2Q2E B;  2XF5 A;  2A6T A;  2M5S A;  2R7R A;  1RMG A;  2IXS A;  4CCO A;  4E0F A;  3OYN A;  4HST A;  3OEH A;  1G59 A;  2LYC A;  2R7W A;  2CV1 A;  3SEZ A;  4LIU A;  1BR1 A;  3H0D A;  2Z16 A;  2OC6 A;  4ZTJ A;  2Z1D A;  3EUH C;  3OR1 C;  3HUG B;  3IP4 B;  4W8Q A;  2ELJ A;  2KZV A;  5FRM A;  1J09 A;  1QHH D;  4Y33 A;  3L2V A;  1Z7L A;  4LIT A;  1HA8 A;  1W36 D;  2HNH A;  4ANJ A;  1X19 A;  4NC8 A;  3OPO A;  4PJM A;  3HAG A;  2VL8 A;  3GRH A;  2E5Z A;  4CCJ A;  1KTW A;  2VAS A;  5TGT A;  1EE6 A;  1O8I A;  4XLF A;  4BE2 A;  4TSF A;  2CFO A;  2WAD A;  4FAS D;  3GVK A;  5AMV A;  2O17 A;  1X1B A;  1WJC A;  2V4D A;  2CK3 A;  3DPL C;  2W6J A;  3HXL A;  4PFP A;  3VYU B;  4CA0 A;  5HOO A;  1WJB A;  1N77 A;  4HRI A;  1WTH D;  2VBM A;  3ZSC A;  4HNT A;  4IZZ A;  3I9V 2;  4CCM A;  1VJS A;  2M3A A;  3K70 C;  1R6R A;  2F43 A;  4OZZ A;  4YEJ A;  4BL0 B;  2UWM A;  1COW A;  1V0F A;  3GQB A;  4B3G A;  3SUC A;  3PJR A;  1ZEL A;  5CPR B;  4BEH B;  1BR4 A;  2QX3 A;  4YXW A;  1RWR A;  4BDZ A;  5FL7 A;  3NWT A;  3VYT B;  2KPM A;  4P5O A;  2HVQ A;  2GK7 A;  4XN0 A;  2WB1 A;  3JU4 A;  1OFM A;  1WFX A;  2WJV A;  3OYD A;  2V1N A;  3BLY A;  1I8D A;  2ZSI B;  3RCO A;  4E7S A;  3OYL A;  2F4I A;  4Y4R A;  2BVL A;  4ZJZ A;  2ZZF A;  3DLA A;  3ZCO A;  4MXN A;  1Y6I A;  1IDJ A;  3CMM A;  3OYF A;  3ZXS A;  3BCA A;  2DJI A;  4URR A;  2R7O A;  3E1S A;  4BEH A;  3BG6 A;  3VSK A;  2AQF A;  2MFZ A;  2OV7 A;  2BW3 B;  4QPO A;  1YX5 A;  3OYM A;  3OYE A;  3DTE A;  1E43 A;  4FET A;  3UR3 C;  1E1Q A;  2GJP A;  4TKO B;  1OGM X;  3EQN A;  3DPU A;  3AL0 B;  5IK2 A;  2L9S A;  2LY1 A;  1E0E A;  1U0J A;  5HNF A;  4HNU A;  1GQ8 A;  4P22 A;  4IQJ A;  2NT9 A;  3OYG A;  1CZF A;  3DKY A;  3PUB A;  3DDY A;  3LL7 A;  3OEE A;  3OS1 A;  4BJ6 C;  4DK0 A;  1MND A;  2QKL B;  2KL4 A;  4OWR B;  1VF7 A;  4ASU A;  2NTB A;  1S9H A;  1Y56 A;  4BU2 A;  4I84 A;  2BW3 A;  1IB4 A;  4RLQ A;  3A3G A;  1X0C A;  4QPQ A;  3QYF A;  3T56 B;  1OR7 C;  3VDX A;  3MKZ A;  3L2Q A;  3KEW A;  3LSG A;  4XOT A;  5CDF A;  3ONQ A;  3ZQQ A;  3RSN A;  3B4N A;  2XDV A;  2QKM B;  4XKW A;  4PSW A;  2UVF A;  2JUG A;  2PMZ A;  3K4K A;  3LMM A;  1H8H A;  4XLC A;  1UD6 A;  3H35 A;  2W00 A;  2HLD A;  3W2V A;  1UG0 A;  3IAS 2;  1RU4 A;  1P9Q C;  4ZTF A;  2L9N A;  2A5W A;  3VYR B;  3S32 A;  1O8F A;  4HG2 A;  1E3Z A;  4G7W A;  4W8S A;  3LMW A;  3DTK A;  4F92 B;  1E1R A;  2JA2 A;  3A35 A;  3IUO A;  1BLI A;  2M0M A;  2VIX A;  4PK4 A;  4UZU A;  4C2L A;  3K70 D;  2KLO A;  3A3B A;  4OZY A;  1D0Y A;  2CW8 A;  2KMU A;  1YX3 A;  2XSJ C;  5C1E A;  2WSS A;  4G6T B;  1DP3 A;  3K6G A;  2VJ4 A;  3S8P A;  3J7A Y;  2X3H A;  2NOJ B;  2Z2S B;  3OE7 A;  3ZGK A;  4ITV A;  4BUP A;  5CKT A;  5DN6 A;  2L5Q A;  2XAU A;  1D1A A;  2X6Y A;  2W82 A;  3CZ6 A;  2PYH A;  1UEL B;  4F52 A;  3GQ9 A;  1OFL A;  1Z3Y A;  3OS0 A;  4CH7 A;  3U21 A;  4JMQ A;  4E7H A;  2HDW A;  1PYV A;  3MMY B;  1HVX A;  4OJP A;  4HEA 2;  3QOE A;  2E1M B;  4IKF A;  2F1M A;  1MMG A;  3LSH A;  3LNN A;  3OOC A;  3OYA A;  2JSP A;  4HWV A;  2VQL A;  1FMW A;  2O0W A;  1WP6 A;  3T53 B;  4XOP A;  3OW7 A;  2ZFU A;  4AU7 A;  3OYK A;  3PNT A;  4DK1 A;  1K5C A;  2K9M A;  2ZXH A;  2AQE A;  2Y0S A;  2X8K A;  4XR6 A;  2BSP A;  3BCD A;  4N4O B;  2WAF A;  3DEE A;  2E60 A;  4F55 A;  3DU5 A;  4YZX A;  2L2O A;  2CV2 A;  4ZYA A;  4RM3 A;  4KKS A;  4B3X A;  1LDK B;  4CSW A;  2PEC A;  2XF6 A;  2IS4 A;  1ERD A;  3UW0 A;  4GQN A;  3WWG A;  3OOU A;  3EUK L;  2X51 A;  1NBM A;  2XZP A;  2WZP P;  2NSP A;  1OLT A;  2R7S A;  4XN3 A;  3H9J A;  4XNF A;  4AVZ A;  3K4N A;  3DQV C;  3H94 A;  2VQH A;  3FKJ A;  4PSX A;  1Z21 A;  1TT0 A;  4X0G A;  3DPT A;  3L2U A;  1H8E A;  2LY2 A;  3ZIA A;  1OGO X;  4KT6 A;  1D0X A;  4XM3 A;  2RRE A;  1T0F C;  1GLN A;  3MD2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...