4YEJA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yejA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yejA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yejA02
2VBEA 3SUCA 4PMHA 4U49A 4C2LA 5AMVA 2BSPA 1IDJA 1HG8A 1BN8A 3B4NA 5C1CA 1O8HA 2UVEA 2VJIA 4XONA 3VMVA 1JTAA 1RWRA 4OJOA 4OZYA 4XLEA 1QJVA 4W8QA 1O8EA 5C1EA 4YEJA 4U4BA 3FY3A 2VJJA 2NTBA 1PLUA 4OJ5A 2EWEA 4XORA 1DBGA 3LMWA 4XKWA 1O8MA 4Z06A 2O1DA 3T9GA 1OGOX 4XOTA 2NSTA 1AIRA 3ZSCA 2QY1A 4EW9A 2NTQA 4XMYA 1O8IA 2NSPA 1O8JA 2VBKA 1XG2A 3WWGA 1CZFA 1NHCA 1KTWA 3KRGA 4YZQA 3JURA 3GQ9A 4OJPA 4W8SA 1RMGA 2X6WA 4XKVA 3UW0A 1PE9A 3GQ7A 1O8GA 2INVA 4XLCA 1KCDA 4YZ0A 1BHEA 3B90A 1IB4A 1OGMX 4XLHA 4XOPA 4XLFA 1VBLA 4NK8A 4NK6A 2X3HA 3GQAA 2INUA 2X6YA 1JRGA 2PYHA 3GRHA 1O8FA 2Z8GA 4XM3A 4MXNA 3VMWA 1RU4A 2PECA 2PYGA 4I84A 3VSUA 4OZZA 3B8YA 4XN0A 2X85A 2NT9A 4YZXA 2O0WA 1OFLA 2QX3A 3EQNA 4W8TA 2O0VA 4XNFA 1EE6A 2IQ7A 1H80A 1O8KA 2NZMA 1OFMA 4OJLA 4Z03A 4YELA 4XQFA 4HWVA 1GQ8A 2QXZA 4W8RA 2X6XA 4OJ6A 1K5CA 4URRA 4Z05A 2VBMA 1KCCA 4MR0A 4AVZA 1OOCA 3GQ8A 1IA5A 1O88A 1QCXA 1WMRA 2NT6A 3VSVA 2NTPA 3ZPPA 4XR6A 2O17A 3EQOA 3VSTA 1O8LA 1PXZA 4XN3A 1X0CA 1O8DA 2ODLA 2UVFA 4YZAA 4XLAA 1DBOA 2O04A 1IDKA 4XL9A
chains in the Genus database with same CATH superfamily
1QQ1A 3J81k 4AIKA 1MBHA 4RGUA 4CSWA 1C0WA 2GXAA 3JU4A 3LWFA 4Y17A 1S7AA 1XCBA 3F6VA 4KT5C 1W36C 1RUNA 1QUEA 1L0OC 4UV9A 4MGRA 3P7NA 5KK1A 5H2FC 1SC7A 1B72B 3J80Z 5HOOA 1BJKA 4KISA 2O0YA 3PL8A 2XAUA 3HC7A 3SEZA 1DGRM 4XRSA 3OAAA 1O8HA 1VQLI 2VJIA 2VBWA 4KIGA 1ACIA 1D1NA 3GYHX 2WYRA 1D0XA 1JTAA 1SAXA 4XLEA 2B0LA 5JI6A 2NVXJ 2IGKA 3AK5A 1P6RA 2EK5A 4PFPA 1Z91A 1WZ2A 2E1BA 2Y0SN 3FF5A 3QU3A 4KIFA 3HHHA 1MSEC 1VFCA 2CF4A 2KIMA 1P4WA 2ZMEB 1V0FA 1VTNC 1DU0A 2XB0X 2VBZA 1O8MA 4JK1X 2VPLA 4FE4A 4XRSG 4UY8I 1T98A 4Z4VA 1VQ9I 5CKTA 1U9OA 1B9NA 2M1BA 4TMVA 2EJRA 4F93B 2HXOA 1HDPA 1UG0A 2KP6A 4DIQA 3OSGA 2IW5A 3VYUB 1TYUA 2M34A 2ZBKA 5CVUA 3CMEI 1K8AD 4PC2A 3IV5A 3JRGA 4YAFA 1ZG3A 4CGZA 1BC7C 5LHIA 5EZGA 3FXKA 3L2VA 2VI6A 3HIFA 2TRTA 2Q6OA 1FDRA 3BCBA 2BBYA 1WGXA 2FUG2 4OIPF 4FISA 3KFWX 1HZEA 5FIUA 1KCDA 2VE8A 1WRJA 3I4NJ 1HQCA 1OYIA 1JTYA 3TMOA 3JRIA 1FNCA 2RC5A 3CMAB 3K4NA 5HS8A 3JW4A 1ZARA 2XNJA 3TO7A 1GO2A 4LFUA 3OS0A 4BQOA 2STTA 1UB9A 2HGCA 5IP9J 1G6NA 2DQLA 3REOA 1K78B 5GAGJ 4RPDA 3T8RA 3Q6QA 5LEJA 3DTEA 4H4KC 5E20A 4AIDA 2VOOA 1TW2A 2O03A 4DBRA 2LK2A 5D6EA 2R93J 3B8YA 3R4KA 5GAHJ 3SZEA 1W4MA 3VNUA 4QSHA 4LB6B 5CQGA 2IS4A 5E6TA 2M87A 2R3SA 1QVGB 2IQ7A 1T5EA 3WE3A 2E2HJ 4IRGA 1YW7A 1YIOA 4RLZA 5K5OA 1ZREA 4LLLA 3RSNA 2OBSA 3QPSA 4E7HA 3HEFA 4JX5A 5EDNA 2DA6A 4S05A 5LD2C 3PUBA 3DBHB 4DQKA 2VL8A 4CZCA 4RBOA 4BHPA 1ZM3A 3V76A 2DJIA 2QCOA 1EV7A 5IPAA 3CPXA 3ZPPA 3GTMJ 3JR9A 1YO5C 1X1BA 4B44A 2VBXA 3PQKA 2KHMA 3W2WA 3IKTA 2G0YA 4ZGNB 5DUKA 1CNFA 4I99C 1YIJB 2UV1A 3K4KA 3PIOF 5TGTA 3L2QA 5A89A 1ZG5A 1IZ1A 3GZ6A 2PJRB 3BR5A 1UJ8A 5D5XB 4OP7A 1N07A 1YJWB 1YW9A 1WCMJ 4PZJA 4RMNA 2E1NA 1FC3A 2W85A 3I59A 2F6CA 4RAFA 4A0YA 4H0EA 1T33A 1BJZA 1BN8A 4ASNA 4OOXA 4UZEA 2F4NA 3LNQA 2UVEA 3Q0UA 2BM7A 2Y2ZA 5LEKA 1L1IA 2CWEA 2LY1A 2WY7Q 2EQRA 1IRZA 1TWHJ 4II2A 2R7UA 1BX1A 1EA3A 2ZMEA 2GPJA 2F5DA 1YLOA 4QPOA 2B7BA 2VFMA 1J2XA 2XHKA 4BPRA 1J09A 1HF2A 1GR1A 2V1UA 4IEJA 2X51A 5HZAA 3KLNA 1IDYA 4KMFA 1DU6A 4P1WA 3HKZA 4XD7A 2RGVA 3MN2A 1NK2P 1RETA 4BGDA 1K28D 1XDSA 3CDLA 3WODF 1OISA 1W5CC 2VXDA 2E5ZA 4M73A 4Y7NJ 2LY2A 5H6RA 5F04A 1SMTA 1YE9A 3V42A 1IJEA 4X0CA 3WWGA 1G8XA 5LBQA 1WSUA 4G6TB 5GV7A 4OAYA 2CYYA 1DDGA 2GXGA 1QA2A 3CMAI 2K9MA 2B0RA 3O6BB 2A68F 3AG3H 3C2BA 1WJDA 3QWLA 4HIZA 1N0VC 4PSXA 3RQIA 2XZOA 3GQ7A 3ESWB 2YUSA 2ZO4A 3LAPA 4W97A 5H6QA 1R4NB 1WSRA 5AIQA 1KZHA 4CCJA 1FNNA 1YRNB 2KFDA 4X1EA 2QSHX 4E7IA 3FXLA 3BQZA 2XSDC 4G1BA 2LD5A 3BZ6A 1K78A 4M3DA 4G7HF 4I09A 4N4OB 3CC7B 3G73A 3S2HJ 5CQEA 1WI3A 2ETHA 4DNCA 4MXNA 2MA3A 1X4OA 2Y30A 3BJOA 4IRIA 4G6QA 4FX4A 5GTHC 3JQQA 4M4SA 1YJNB 3CCVB 4NDLA 1GVJA 2FNPA 5DS9A 4GGGA 1K73D 2LNBA 3SDBA 3JSPA 4KITB 2QX3A 4YFNF 1YW8A 1JTXA 4UV8A 2K02A 4NQWB 5GAEJ 3FBNB 3MHPA 1A6QA 1I27A 2MBFA 3OIQA 2P5LC 4XQFA 3H36A 4W8RA 3I0TA 2R7RA 4M74A 4OOIA 2R5ZB 3HGYA 4HEA2 5F0CA 3HPGA 2Y0MA 3HOUJ 1YIJI 3U2QA 1WQ2A 2HQNA 5ED4A 2QYOA 2EBIA 1MBGA 1WKMA 2ZSHB 2EV5A 3K4JA 3QYBA 1YFHA 4XBFA 1BIAA 1YJ9B 2XB5A 3CTAA 3J81K 2HPMA 2JA5J 2FBKA 3P9KA 5C4XJ 1YJWI 1NRKA 1JGGA 2JUGA 2O3FA 1TYXA 3MFKA 5F64A 1V5VA 3BQJA 4NBQA 1BI2A 1ON2A 2PJRA 4A6DA 4C43A 3HZJA 2OC6A 1D3YA 4MQ9F 3K69A 3VSLA 3LSPA 3CUQB 3WTXC 4M3EA 5FNZA 1DARA 5DDGA 3MMYB 1NB0A 1T38A 1WWXA 3J80K 1F20A 3Q9SA 3GUDA 4OU0A 4P9FA 5AMVA 2FRHA 5BQTA 5EEGA 1DDNA 2XV4S 3MKLA 4EJVA 3FIWA 5A8AA 1XDUA 2H27A 2QKLB 3RYRA 1DGWY 3HYIA 1J7KA 1OMIA 2WV0A 3WG9A 2LKXA 2YWGA 4CYCB 2OQGA 1SFUA 4H9GA 1LLZA 4Z4WA 1EFTA 3VPRA 1U0JA 3QYEA 3CW2A 5HVQC 3KP6A 4A0XA 2GOMA 1H9GA 3LSMA 1KK1A 3MAJA 1BI3A 2DU9A 1STZA 2JSPA 3MKZA 4P25A 4P9SA 3BH7B 2WJYA 3MVPA 2O1DA 1N06A 5K1YA 1ETKA 5D4RA 1IXRC 3H35A 2JJ2A 4RD2A 3ZSCA 1MMNA 4MHGA 4YAUA 4RJLA 1RKTA 3U21A 1SFKA 1QVTA 2WV1A 3V4GA 1CZFA 4LJZF 5IYBJ 4AYBA 2D9RA 3TO9A 2FF4A 2QLZA 2QF7A 2OTLB 2QN6A 2C5HA 1KZLA 3BR0A 5KAFC 2K9SA 4ENNA 3CC7I 3ASQA 1O8GA 3QQAA 2VPRA 2PJPA 1Z9CA 2CQNA 2M4KA 3TOAA 1UFMA 1F60A 4NB5A 2Y69H 4QWQA 1YJNI 3CCVI 2A6EF 3GFLA 5ICEA 1ERDA 2CO5A 4GFBA 4I01A 5L3BA 4BBSJ 2DMTA 2F5FA 3I5UA 4KJZA 1QX4A 3AVWA 4YAOA 2VE9A 1SVOA 2YU9J 2KPMA 2HVRA 5J1UA 1TQPA 3G4SB 2RN7A 5E1ZB 3ISPA 2BY1A 2O0VA 4EGYA 3KEOA 1EE6A 2LDUA 1VHOA 4OPSA 3E5QA 1HXDA 2B63J 2V9PA 4ZYDA 2HTSA 4LOCA 3WHBA 4RAZA 3PIPF 3BH4A 2K7LA 2WWYA 3AVVA 1K5CA 1R00A 1AA7A 5LGUA 1QNTA 1UD6A 1FOKA 1RRJA 4XLNF 4FWTA 2DAOA 1FLIA 4MQVA 1U5TB 1O88A 3M3YJ 1WMRA 3M1CA 5B1AH 4LC0A 3E1SA 4K2EA 3ZBTA 3DDYA 2GIZA 3F9KA 1QA1A 3FXQA 2C5BA 2L4MA 1QFZA 2WC2A 5CVRA 1O3QA 1ZUNB 2XNDA 4ZTFA 3G6EI 2DCEA 3S93A 4YZAA 4I6ZA 4AWXB 2OTJB 4B4CA 3M1EA 5JLXA 1CF7B 4RB0A 2FQ4A 1EFCA 3CUQA 1Z7LA 2O04A 4KH3A 2R7OA 3QU6A 1TTTA 5KCMA 4A3CJ 1YTYA 2CNDA 1WJEA 4JYKA 1X2MA 3EUHA 2CG4A 3HSFA 4P9UA 3OYJA 4OIOF 3B6CA 4J0QA 1EH8A 1H85A 4M72A 3T5XA 3A0HC 5IYRA 1JI8A 1DDIA 2KIQA 1N25A 1KMHA 3ZPNA 2Y9ZA 1ULYA 3CQZJ 5LHHA 1TUIA 4CYCA 3H3UA 3VMVA 1QHHD 3ULQB 5EEAA 2OD5A 3CB4A 2LLKA 5L3GA 5D8LB 4BYYA 1ZLKA 3PETA 5J1RA 4EV0A 1OCCH 2NAZA 4LBYA 1ZKGA 4X06A 4OJ5A 1WJFA 3BDDA 4IRHA 1EWYA 2IPQX 2DODA 2LG4A 4HNUA 4EJTA 2HTJA 2VUMJ 4DJAA 3QFCA 5HNHA 2YR2A 1S4MA 3OYMA 4YALA 5IYWA 4BL0B 3K4MA 4C3IJ 4Z06A 2V9KA 2OTLI 3OEHA 3T0YA 3AVTA 2ISYA 2M30A 1ETYA 1MZBA 5EG0B 3K70D 5K7ZA 2M0MA 3B8HA 5FFXA 3ZMDA 1MIJA 4A3DJ 1WTHD 4LBWA 1QZEA 1O8IA 3ONYA 3HPHA 2XRNA 2ZXWH 3QE2A 4RB2C 3PJRA 2VKDA 2MD0A 1IDZA 4QVJA 3W2EA 2QBYA 4GQNA 2EFQA 2JIZA 2XGDA 3BTIA 2R7SA 2E71A 3ZCOA 1D1AA 1I5ZA 1LNWA 4R71A 4A3IJ 2FBIA 3SLDA 1P7JA 4P96A 4IPAA 3DU6A 1AWCA 2CC2A 1NDHA 4YZ0A 5JLWA 3IWFA 2I8DA 5DD4A 1IB4A 2W25A 3G4SI 3EYIA 4PGGA 2EIMH 4NK8A 1WJ5A 4PJJA 2LREA 3ASPA 2EV6A 4BJ5C 3H5NA 2NVTJ 1FX7A 3A3BA 2QDXA 3V7SA 4CDGA 4RD4A 2XT2A 2IEKA 2QENA 1GJRA 5DS0A 3I55B 2RAEA 3RI4A 2R9VA 2GIVA 1MNMC 2R0QC 4EEFG 4KDPA 1Q86D 1NHAA 2LR8A 3DV8A 5M3FJ 4QV2A 2R7VA 1LUJB 2H1LA 3WGIA 3SFIA 3NEUA 2A07F 1H80A 2AXTC 1T6XA 2K9QA 1Y1VJ 2L9VA 3D5LA 1D2EA 5TRDA 1CGPA 2MLKA 5BPDA 2JVHA 2JT1A 5BSXA 3OS1A 4BNCA 3MD2A 4OIQF 3WGGA 2QQBA 1OJLA 2ZB9A 3BY6A 3ERMA 4RAYA 3WTSC 1VF7A 2R4GA 2XZLA 4LIVA 1KCCA 4MR0A 1U5TA 1IUYA 3ZMVA 1R22A 4ASUA 2CUFA 4GYIA 1G3TA 2XPUA 1ZRDA 2OTJI 3BOQA 2E1CA 3TGNA 5K5RA 4OIRF 2ZSIB 4G6DA 2DFHA 4UUSA 1NB9A 1BBYA 2ID3A 1PDNC 4LG0B 2M5SA 4QUZA 1XX5A 3RIRA 1F43A 1FWZA 3OYFA 3GFIA 2CQKA 2IS1A 1LQ1A 3OOCA 3UR3C 2BXZA 1R36A 4HF0A 5GADJ 1IN5A 1CF7A 3A2KA 4PSWA 1ETWA 3I56B 1NJID 4UNOA 4F92B 3HL2A 1UELB 3E97A 1YITB 4MYUA 5DYMA 1VZ0A 4PDKA 2CV2A 1G7CA 4GXOA 3NE5B 3VYTB 4KKTA 3E7LA 3R6KA 3D5SC 1UMKA 4EJUA 1MNDA 2UWMA 1GAWA 4P6YA 3QFSA 3T1BA 4JBAA 1NBMA 2E36A 4BEHA 4BE0A 3RYPA 3OR2C 4HX8A 1D1BA 2JMWA 4ZYGA 4M9ZA 4N0BA 4QFMA 4OJOA 4UUVA 1O8EA 2ICWG 3S16J 4R79A 5EGOA 4OOSA 2VJJA 2N8GA 4Y9UA 1E79A 3GTOJ 4L5JA 3MKYB 3OEEA 3A4CA 3GLXA 1OB5A 1KYZA 4PAAA 1BOBA 1K9MD 2IOUG 2MFZA 3I58A 2PMUA 3L9FA 3A8IA 3R6SA 2HQRA 2ME0A 2XF7A 4RLFA 2M0CA 2O6WA 1X1PA 3A1YA 4I98B 1Y1WJ 2LSOA 4RLQA 5IYCJ 3IL2A 1M1KD 2WTEA 4NC6A 3ZQIA 3KZYA 3OV8A 5HLGA 1UHSA 4U7DA 2DYIA 2FOKA 4GDFA 4C2UA 1G3WA 1DPUA 2VYQA 4FASD 4M0LA 3SJMA 4M9XA 4MEXF 1DP3A 5IYDJ 4XRFA 3OIPA 3AFHA 4RDJA 3I55I 1REPC 3EUAA 1OGMX 2L9SA 4B43A 1IAWA 4KIBA 1UD3A 4ESFA 3NAUA 2DLLA 4GYGA 2ID6A 5L46A 2DN0A 5CVVA 1I3QJ 2ZXJA 3GRHA 2HS5A 2CBXA 5B6IA 2LRDA 1OYWA 2JA6J 2ZJQF 2BV6A 5KAIC 2M7AA 2L7ZA 5FROA 3I1FA 1Z21A 4L8JA 4RD0A 1PUFB 1Q7YD 3BR6A 5A88A 2VT3A 4HRIA 2DCUA 5FKNA 3EQNA 1ETVA 3F8MA 1Z67A 1XE1A 3FWEA 2Q0OA 3HDDA 4A3FJ 1ORKA 2FVGA 2NYXA 3ZGKA 4ZH4F 2H94A 3DLAA 3O2PE 1V3FA 4BXUA 2FX3A 2QXZA 4TMTA 3A3GA 4RCZA 3LSHA 1N08A 2B5OA 3JAMK 4HSRA 2NV4A 1OQYA 2R5YB 1O3TA 3H3VK 2BMWA 5CVJA 1EP2B 3HRSA 2TDXA 1BOAA 3GEZA 1KD1D 1R1TA 3I56I 4RGXA 2CUZA 5FKKA 1QFYA 2IVMA 1YITI 2HDDA 5BNGA 4CHUA 5FA6A 2V5IA 3BY1A 1RC9A 1WP6A 2OCCH 4M1KA 5FKOA 4DW6A 3F22A 1JB9A 3CC2B 3LQRA 1LEBA 1XGOA 2IS6A 1OFDA 1N75A 2F3LA 3ABUA 1S3JA 4G8XA 2MH2A 5LLQA 1RUOA 3OYBA 2MGQA 3RJPA 3OSFA 4YRVA 2FE3A 2A6HF 5FFZA 3A8KA 4G6IA 2DA5A 2MC4A 2EIKH 5D8KB 2VKHA 1FYLA 3E0JB 2QGGA 1KGSA 2JVGA 1BJAA 3UKGA 3E5UA 1BX0A 1BW6A 2Q1ZB 3G1OA 4R8HA 3FISA 3V7RA 1USSA 1SD5A 3B6AA 4I2OA 1IB0A 2OV7A 1IXCA 2V7FA 3L09A 3ZBUA 5F1RA 4LMYA 3J81Z 2GM4A 1QFJA 2X1EA 4FXUA 1S29A 2GXBA 4EM1A 4XK4A 3IRQA 4D9JA 3K7AJ 2QGUA 3A01A 1IO2A 3NQOA 4EJWA 3Q3SA 1LPQA 1FRNA 5IYNA 3N6ZA 1TNTA 1KQ5A 2JN6A 1GLNA 3ABKH 2E5NA 4PUSA 2GOXB 3FBIB 4UB6C 1QVUA 2DT5A 1Y39A 2CK3A 1KC8D 1PP8F 3BCFA 4FT8A 4DYQA 3ZZTA 1NTCA 3GMEA 2L02A 3HOYJ 2GA2A 1IRFA 3IP4B 1UZCA 1Y0NA 4TMWA 2VBVA 3N90A 5HLTA 1WJAA 3PO3J 3TBIA 3I59B 3VODA 2PQ8A 5TJJA 3TO6A 2V6EA 3AVYA 3TP3A 4TMXA 2K3PA 2X6WA 4I02A 1TNSA 1IRGA 3Q5FA 5L3DA 4G7OF 3GVLA 1OB0A 3E6MA 4AD9A 1QU3A 2VBUA 2M7BA 5JHFA 2JRTA 2C77A 1BHEA 3KCCA 2JA8J 1N0UA 3KEYA 2VASA 2DOAA 4G5GA 1E43A 2PE3A 5HS9A 3CESA 1R71A 2MABA 4LBZA 2RREA 2RDPA 3K1MA 3BTLA 2BGCA 4F91B 3U1KA 2CW7A 2QVOA 3KYLA 1EF4A 2DFIA 2FMLA 4P12A 1PUFA 1P92A 1RPWA 3EETA 1WHUA 1W0TA 5JVGF 1T2KA 2NT9A 1MMGA 2LOOA 3CCJB 3K9TA 3E20A 4W8TA 3I64A 3ZQFA 2CQQA 2ZMEC 3WE2A 1X1CA 3WU1B 1G2HA 4RM0A 1JXSA 2MW8A 3SXYA 2VJ5A 2Z99A 1IJFA 2CQ7A 1O7FA 3WG7H 3G1LA 1U9NA 4AU7A 4BUPA 2R5YA 2L7MP 2NXNB 4ZDLA 3ZN0A 4BXXJ 4Q7JB 3CC2I 4CCKA 4ABZA 3EQLF 1T6YA 3PA1A 4URRA 4Z05A 4DGWB 1JKQC 2XIGA 1BR2A 2F1MA 4TMZA 3KP5A 3ZC3A 4KFCA 3WTYC 2WB1N 3S1RJ 2P81A 3E6CC 1ETXA 5FD6A 5FGMA 4MLOA 3OZVA 2XTYA 4A2UA 1KK0A 2QE7A 2OUMA 3W6JB 2X1CA 5EEHA 2P6TA 4JX4A 1UD2A 2VNHA 1X0CA 2D2WA 3I4MJ 3F8NA 2L3DA 3FXOA 3DLLF 5J35A 1I6XA 3M8FA 2XDVA 4IOCF 1G4DA 2XEXA 4D5FA 1S72B 4GCVA 1SKQA 3HOXJ 1R4MB 1ZAOA 2BPOA 3FPKA 1U3EM 1G59A 2RNGA 3N97A 2JJ7A 3H5RA 3FKSA 3P9CA 4QIWN 4N9HA 4ACBA 1I8DA 1QZYA 3RIQA 5IK2A 2GK6A 3MWMA 3U1DA 2GJKA 1WDTA 1X1AA 4RCYA 1KU2A 1EKEA 1ONVA 4Y9RA 2XAFA 3KPHA 1HSTA 1XPXA 2E34A 2FD5A 3OE7A 2XRLA 2PG4A 1HLVA 1X2NA 4YEJA 2EFOA 3L1PA 1D5YA 1HF0A 1D8KA 3L7WA 3L2CA 5KHDA 5GPCA 3FM3A 3IAM2 3FXMA 2VIXA 4YIIA 4Z4YA 4V19K 4WQMA 3OYIA 1JA1A 1BR4A 1TC3C 4XRMA 2DK8A 3M9AA 3FHZA 2MLGA 5J8CA 1APLC 1JE8A 1WPKA 4XMYA 4A3EJ 2PMZA 5CLSA 5FRNA 4BE1A 1SFOJ 2KVOA 3R6JA 2VBKA 2EWNA 4CICA 2D3NA 2WAFA 3CDIA 5C4JJ 4L9VA 2HLDA 1E3PA 2HOEA 2HKOA 3MEXA 4HF2A 3PFIA 4XICA 1LFPA 3KZIC 2EPFA 1P4AA 2ZXHA 1PUEE 1WOPA 2EA2A 5DNSA 4WWCA 2BEOA 1U2RA 4XLCA 2C2WA 3ISXA 3PA2A 1K4TA 1FZPB 1FNDA 3GTKJ 5M3MJ 3BZKA 4S0HB 2CJJA 3GFJA 1AHDP 1LB2A 1DQUA 2FU4A 4B3XA 4A3LJ 2R7XA 3A35A 3CCJI 2VB6A 4XLFA 1ZM9A 4Z4ZA 4BKXA 1HDDC 1FTTA 4MFEA 2CFOA 2OJED 3WBJA 3IH4A 1HCRA 2BXYA 4YFXF 3GFMA 3BPVA 4HZFA 2VZLA 2BHZA 3VMWA 3HG9A 1FOXA 4I84A 1V5FA 2NS8A 3ZR8X 4AIJA 3VFZA 2B7EA 4UAJA 4ITVA 4L0ZB 1FSEA 3W5VA 4B8XA 1FPQA 4ZC3A 1SAUA 4TV7A 2X48A 5DCMA 2NZMA 1VLOA 2BY3A 3DXJF 1HW5A 2DIEA 1GQ8A 3I4PA 4U0WA 1IN7A 1MGTA 2D1HA 4XKBA 4EJOA 2OAZA 2G7UA 2X6XA 2XGEA 2LP0A 5CPRB 1QZZA 3C2HA 5HODA 4Z6YA 2DMNA 2X1DA 4DBQA 3TOBA 5BOXA 3FKJA 4JP0A 1S72I 3LQEA 1N8RD 3S17J 5GP9A 2OF7A 2Y9YA 3PNVA 1ETOA 3JRAA 1FBUA 1N78A 5J4VA 2IP2A 3P27A 4F3QA 2NNYA 1B4AA 4PJNA 3WTZA 4Q4ZF 1XGMA 2XPVA 2BOLA 1H42A 1OR7A 1A35A 2LY9A 3DTIA 3RZOJ 3QOEA 1W0KA 1TWAJ 2K27A 3KYCB 4M6YA 4IF4A 1EP1B 3F0CA 4PK4A 4DYCA 3KP2A 1MMAA 2P4WA 1HW1A 3FKIJ 2F5EA 4UB8C 3ZXSA 1U6GA 2VN2A 2AQFA 5AIPA 1XCVA 5HDNA 3LMMA 1MRZA 4N9IA 3ZQHA 2HCJB 3FK6A 1AMOA 1HG8A 5DEQA 2BGJA 1VNDA 4KT6A 1G7RA 2JK3A 2HNHA 4OPOA 3SQVA 2RC6A 1Z0XA 3WHCA 2VT2A 4U0YA 5DTDA 5BSYA 2W24A 2DK5A 1B1BA 3KP7A 2DYSH 3CCMB 4X7FA 2QSGX 1GV2A 2DA4A 3LA3A 5F4JA 2NTBA 1MD0A 4YHBA 3LYCA 1LDDA 3RZDJ 4UVBA 2DQRA 1ZG1A 3BC9A 1KRHA 1X3WB 3JTGA 4D5CA 5L3CA 3VR6A 3RQ4A 1HC8A 4L9JA 1JNYA 3ASOH 1OGOX 1OYYA 3GBGA 4J19A 2ZXIA 4LK1F 4IQJA 4X6AJ 4IQ4A 1FSHA 2JDIA 3D26A 2IJLA 4C0SA 2XAGA 2R7ZJ 5LMZA 1ZM4A 3QSYA 4Z2YA 2M8EA 3OYCA 3GTPJ 4Q48A 1G3SA 5FRMA 3Q38A 3ABMH 2IA1A 1S9HA 3IH2A 3H94A 1KTWA 5FKMA 2HKXA 2HDCA 2FA5A 2GWRA 2Y31A 3OKXA 4CCNA 1QUFA 2NS0A 1UG2A 4MIMA 5FKLA 5M5XJ 5EF6A 4YFOA 3DEWA 3CP8A 3AVUA 1LDJA 4UZUA 1A04A 3QP5A 3CUQC 2EIXA 3JX8A 4A3JJ 4TKOB 2L0KA 1R7JA 3OS2A 2CFXA 3CO7C 1KQ9A 2XTWA 3EUHC 4FX0A 4QVAA 3WQZA 2F5VA 4R1HA 4HAMA 3AAFA 2XGJA 3SZGA 1G7TA 4D1QA 1QO0D 2E7XA 1GV5A 2BW3A 2LBFB 5DM6F 1KTVA 3ONQA 4ON0A 2A05A 3GW2A 2ZBVA 4FETA 1BIBA 1ZYRF 2DYRH 2COMA 2ZZGA 2W1OA 2KJCA 2O0WA 3K6GA 1O4XA 4HBLA 3RCOA 3WU0A 2QBYB 4HYEA 4D0PA 3FXRA 5K7HA 3R60A 3I71A 5JBQA 5HS7A 1SVMA 3JREA 1I1SA 1P4MA 3OW2B 2HOSA 3TH0A 1QRCA 1HW2A 2VOPA 2EFNA 4YIFA 5E79C 1MBEA 5DSZA 2IAIA 2BX6A 3CLQA 3O8HA 3ELKA 2YUHA 1SD4A 2VBMA 5EMNA 1CNEA 1Z1DA 4B1RA 1R1UA 2OCEA 5FJ8J 3OYGA 4BH9A 1RESA 2J8IA 3GQ8A 1ZHFA 1EA0A 3LO8A 3A0BC 4NUBA 2R6HA 2M4GA 2JA2A 2D3LA 3B82A 1B59A 1AOYA 2H8RA 3BP8A 1Q1VA 3H92A 4LIUA 4L9NA 4KMUX 4M3GA 3JSOA 2BE5F 2ESNA 4Z4SA 2X6OA 1EXMA 3GVAA 3PSSA 2ZCWA 4Y3OA 4BQAA 4A3BJ 2MYSA 1R5NA 4CH7A 2JZYA 3ABTA 3M8EA 1B6AA 1W7PB 3IKVA 5E8IA 1USTA 2K86A 4BBRJ 1YJ9I 3HXLA 1W7PD 3MCAA 4BQQA 3CCMI 1B9MA 4TSFA 3U6BA 1BI0A 3FMQA 1OFEA 1K6YA 3V8LA 1XS9A 2VNIA 3OFNA 3JAMZ 1W87A 2KLOA 2VKEA 4C3HJ 1MH3A 2A3SA 5F4MA 2CRGA 4M71A 2DETA 2LH9A 4DZPA 1IV6A 1E1RA 4HW0A 4BDYA 1IG7A 2IGOA 4UUSB 2GQQA 3P9IA 5J1YA 2E1MB 1QJVA 3SJPA 2JN9A 1PJ6A 5C1EA 4IHTA 5IY5H 4CQJA 1CQXA 5HDGA 3HUGB 4Y7CA 4I0BA 1OGIA 3DQVC 3D1NI 4WK8F 4XORA 2VODA 1NH3A 4NBSA 1Y8QB 1XG1A 2LTPA 5TISC 3GTQJ 1QG0A 3HKZN 2RVCA 2XKPA 5E3OA 3LAJA 1S8NA 4G7XA 1U5TC 4XOTA 3VOEA 5A2QZ 3AL0B 1Y6IA 1VQOB 5DV5A 1XB2A 2NTQA 4ZZDA 3HHGA 1MKMA 4ZYEA 3JQPA 3JRBA 1B23P 2H1KA 3FXJA 4X7DA 2Z2SB 4BEHB 2OA4A 1FT9A 1XGNA 1T8IA 1KONA 3LSRA 2F43A 3IH3A 4EMSA 4A12A 1OCRH 3OYHA 2R7QA 4W8SA 1WORA 4V2FA 4IX7A 1P9QC 4XKCA 4P2NA 4O6JA 3BR2A 3OYEA 2BM1A 2ZL6A 2EILH 1T56A 1LJ9A 3HTUA 4UVAA 5EGOB 3BTCA 2GJRA 1VQKB 5ICGA 1LE8A 1PJRA 3AL0C 3SYJA 4RB1A 3BLYA 4U87A 2KDOA 3JRFA 3WTWC 3VSKA 2F2EA 3VNVA 2LBFA 1J59A 5EYRA 4LLNA 1EZGA 2HYFA 2WAQA 4XLPF 2PECA 3TQNA 2H6BA 2FEZA 1ETQA 3F21A 4LB5A 1YI2B 2QQAA 1KQ8A 3LNNA 2Q8KA 5HLHA 2RNJA 1V5EA 4OMZA 1H0MA 2KL4A 1FTZA 1O8KA 1H88C 3HOZJ 2XT4A 2IBDA 1YOVB 1Q9SA 3OR1C 1VQ4B 1R1VA 2XGXA 1ENHA 3V7CA 1MBFA 1BR1A 5LFAA 3K70C 3HRMA 2BGIA 1MNEA 2YWEA 3CLOA 4KYWA 1GHCA 2Z33A 1OOCA 4HG2A 3PUMA 3CPWB 1DG1G 5J47A 3J7AO 2CUJA 2VC1A 3TEDA 2CW0F 3SLNA 3RY8A 2PX9A 2ECBA 2UUZA 4DNTB 3ABLH 1TLLA 4V02C 4JRAC 4AF7A 1W5SA 4DYRA 4JOMA 2KZVA 5BS6A 3KLOA 1PP7U 2AHOA 2P3MA 4J01A 1W2BB 6PAXA 1W7PA 1XD7A 3C3WA 3GXOA 2M5WA 3K4BA 3JRHA 1ELOA 1BA5A 4KKSA 2BM6A 1LEAA 3W2VA 4BS9A 3P4GA 2V79A 2VLAA 1KA8A 2VNJA 4KUMA 2XAHA 2KQRA 3G71B 4C2LA 3FJOA 4C2MJ 3LSIA 2H8WA 5M5YJ 4Q5SF 5HXBA 3TDZC 2J7KA 5B1BH 1UD8A 4M9SA 3W5HA 2YSRA 3JTHA 1FRQA 3QYFA 2HOAA 2KZGA 3HUGA 4OZYA 4QLCU 5LGTA 2K9NA 2O9LA 4J00A 2ZZFA 4ZTJA 3QOPA 2Y48A 5DCFA 4C30A 5JFRA 1VQOI 2Y0SA 1KYWA 1EH6A 2L9RA 3GWZA 3LQQA 2DOEA 1OLTA 3N05A 1TWCJ 5IOYA 2DXIA 5H5JA 5CJ9A 4F7DA 2V6CA 2KKOA 2L01A 1JHHA 4OPVA 3DU5A 4GRIA 1GXQA 5FD5A 2QTZA 4DNRB 2WJVA 2ELKA 1WH5A 4N4NB 2NSTA 1R6RA 1G3YA 4Y15A 1GXPA 3A03A 5LHGA 4P55A 5B5EC 5LRSA 1VQKI 1TLHB 2L4AA 4RGSA 2UXXA 4AYBN 3IRRA 1XC5A 3Q9VA 3LFKA 1BPLA 2YU3A 1COWA 2DEUA 3JURA 5J40A 5J8FA 2V1NA 3CXCB 5JVTA 1T0FA 3H0GJ 2BN4A 4RS8A 4N3GA 3WNDA 2XASA 4ZYAA 1R5ID 3FK7A 5IP7J 1U8RA 3A01B 3CJTB 2HFHA 1M1EB 1IRXA 1W0UA 3D5RC 4NCNA 4WF2A 4N3NA 1YI2I 2C4TA 1ON1A 2V7WA 2GLOA 2VNKA 1W35A 4B4DA 2JRMA 3MQ0A 1TVCA 2X3HA 2XAQA 3F8BA 2VQLA 2IA0A 2M3AA 5FO0A 4IKFA 1K6OA 5EJCA 2ZTGA 1VQ7B 5F1JA 1VQ4I 2EFPA 1X3UA 4ZGQB 3J7YJ 1WJCA 2DA1A 2DTRA 3BG7A 4DK1A 1P7IA 1A36A 1VQ8B 4AIHA 3R0AA 2ECCA 4WXDA 1VJSA 3S2WA 2HI3A 5JHUA 3WXMA 2V26A 3E1YE 4YXWA 2BM5A 2M8GX 3BQYA 4HDVA 3WNBA 2B7CA 5E3LA 5KVRA 2WBMA 4ZJZA 2WPDA 1OFMA 2EFWA 3B02A 3QAHA 2DFEA 2LZJA 1I7PA 3OL4A 1IN8A 1KK2A 4HWVA 1D0ZA 1X58A 3FHNA 1DABA 2ZBUA 1S7OA 4RD3A 4OJ6A 1OPCA 4HA8A 1Y0YA 2HOTA 3GCMA 3F72A 4RD6A 1E3HA 2DOFA 1WSVA 3I3LA 1CQTA 3ZMTA 1B2RA 1QA3A 1SEUA 2UZKA 1POGA 2Z6BD 3CCSB 3VSVA 1TQMA 2NT6A 5IYPA 2AO9A 2XC7A 2XKOA 1IF1A 4HSTA 5FO1A 2QSFX 4UUTA 2G7HA 3GTLJ 2FOWA 4AM3A 4JMQA 1PXZA 2G0EA 4WZLA 3BH6B 3COAC 4CXFA 2CRVA 2W00A 4DZJA 1NG7A 1WVRA 2PMDA 1LLWA 3W3CA 2L7KA 3RTRA 4II3A 2LYCA 2RC4A 3PENA 2F5CA 2PN6A 5E18F 1BN5A 1XFOA 1LDKB 1JA0A 3QPLA 2V4JC 4B48A 1W5TA 3Q0WA 2PEXA 4BDZA 4U7BA 5GPAA 1AKHB 2GBYA 2P0WA 2YX7A 3LSGA 2ISZA 2DY1A 3BG3A 3L2WA 3OYKA 3Q39A 3HGGA 3X2QH 2AHQA 1Z05A 3ZQCA 1IGNA 4ZDOA 5TR9A 4XIDA 3PO2J 1FIPA 3LQ6A 5E3NA 1Y56A 3QP6A 3MKWB 1PLUA 3CO6C 2OU2A 1T6SA 3DFGA 3SJZA 1LM1A 1Z6TA 3CMEB 4FHTA 2C6YA 4A6EA 2J5PA 4IHWA 4M2LA 1XSXA 1YLFA 5A2QK 1H8HA 3KP4A 2X9DA 4P26A 2CSOA 3PUFA 2XUBA 4IHSA 1PJ7A 4K1XA 2HWVA 4AF6A 2FXAA 4WXCA 3LA2A 5JLVC 3Q0VA 3U9GA 2CUEA 3VMFA 3S32A 4L5IA 3BT9A 3GF2A 4HNVA 4E7KA 3NB2A 2M2EA 1FNMA 4M6XA 4YDTA 2DPDA 5LRRA 1R58A 1V55H 2OPTA 4PGHA 1VQ7I 2ADUA 2AXLA 4FK8A 4LBVA 2INVA 3W2HA 5HZBA 1VI0A 1MBJA 3GQBA 2L2OA 4ZYHA 3ASTA 2KRCA 1O3RA 4BXFA 2VBYA 2VFQA 1VQ8I 4YAWA 3K10A 3W2FA 3LA7A 5C44J 3GVJA 5D5WB 2X6YA 4PFOA 3RKYA 1TQIA 1H9TA 1QGZA 2OBPA 4Z4UA 4NNJA 1W36D 1TTYA 3BC8A 2Q6KA 4TT3A 2GREA 3SZTA 4CCMA 3HOVJ 1RU4A 4LD5A 2ZFUA 2BY0A 1WFXA 2QQ8A 2Q2EB 4OWRB 1MH4A 3TP0A 4D7NA 3VSUA 1HVXA 4OZZA 4XN0A 4FCYA 1OFLA 3A8JA 3J7ZI 5F0FA 1SKYB 3KIOA 4X7EA 1ZRCA 3KX2A 3D0SA 2HZTA 3BY2A 2Z3YA 1S7EA 1B8IA 4Z03A 1I39A 3OOUA 4X05A 2X0LA 4RA2A 5IYQA 4B47A 1E3XA 4M3FA 4EVIA 2E60A 3DEEA 3RKWA 3WBKA 3CF5F 3KP3A 1JJ2B 4BJTA 3W6VA 5HDKA 1TYVA 1U8BA 5F4OA 2WY8Q 1ODDA 3C7JA 3EQOA 2DOGA 3PFYA 2WR8A 4XN3A 2KMUA 4RGRA 1Z7UA 3ECOA 4E7ZA 2RKHA 2CGPA 2DMUA 1IUFA 2YPRA 1D8TA 4YG2F 2CH0A 2DMQA 3F8FA 4E7LA 2R7WA 4XL9A 1F9NA 3G1MA 3LFUA 2X3UA 5DCMB 3CMYA 4CYDA 3E5XA 4LITA 1AKHA 2Z16A 5KW9A 4L9TA 5F0HA 1SM4A 2K85A 3RPUD 3Q3AA 3QFRA 1OCZH 4BY1J 3ASRA 4F55A 2COBA 2VFPA 3OYAA 2W82A 1E63A 2E2IJ 2HEOA 3EUKL 1WPCA 4A5NA 3WY9A 5TY0A 2I5UA 1OFCX 2R7DA 3ZP5A 2STWA 1XMAA 1X1DA 3LSJA 3SHFA 3QRFF 4AUXA 1QA6A 3CJNA 2O6GE 1YX5A 1D0YA 5THXA 5DUIA 3BCDA 2HQAA 3FMSA 5KSWB 3LMWA 1V4RA 3H9JA 2JTVA 2HQ5A 2OZ6A 4M3BA 2JPCA 2BVNA 4TN1A 3VO2A 3EPZA 2I1LA 5IT9Z 3CCLB 4M53A 3GLLA 2KJBA 4PABA 1UMQA 2LC2A 4EM0B 3BR1A 1QGAA 2NSPA 3ZZ0A 1X3ZB 1Y0RA 4PC1A 2O5RA 5CYVA 4LLGF 3CRZA 2ZZEA 4OJPA 1EJ9A 5FO5A 3QPHA 3GTGJ 4MEYF 1XGSA 2ACJA 3N4MA 1OR7C 1YQAA 3CUOA 2R7TA 4IHYA 3CD6B 1PE9A 4U49A 2A69F 3TL4X 3LJYA 2GAUA 2MG4A 4FTHA 1BQEA 3ZMZA 4RPBA 1SVLA 2XC1A 3DPUA 2RQPA 3H9GA 4I7HA 4BAYA 1F4KA 3GTJJ 2O7OA 4ENKA 4L5EA 3BCAA 1AIPA 3JQRA 1R23A 2NRAC 4UZFA 3CC4B 2LFBA 2ME6A 2V31A 1HKSA 1G7SA 2FNAA 5F27A 2HMAA 2Q2EA 4ETSA 1D1CA 1OGJA 3ES9A 3ASSA 2AQEA 4IW3B 2XF5A 3S1MJ 1ZELA 4HNTA 1OHHA 4YZXA 3H09A 5CVIA 3E6DA 4A93J 1ZR4A 4OMYA 3HSRA 1O7LA 3L00A 4LG3A 4U9UA 3MZ8A 1F1ZA 4CUGA 1T39A 4OJLA 3IWZA 3OP1A 2X8KA 1CLWA 4YELA 3AG2H 4IVNA 3PSIA 4OOVA 1QBJA 3KEWA 1TBXA 3MCZA 4G9YA 2HZDA 1IXSB 3PNYA 3OYNA 1UHWA 1B72A 5FB2A 4ENMA 3GVKA 4Z1MA 2Z9OA 2V7UA 3CCEB 1H8AC 4UXNA 4C9YA 3CZ6A 4U88A 3ZQQA 1T6ZA 2KRFA 3W6KB 2OBRA 1Z3YA 9ANTA 4MYTA 4WWVA 3TDUC 2TCTA 1HBXG 1BLIA 2VQGA 2BW3B 3W5UA 4YC5A 1FIAA 1SFXA 3PSFA 4PC6A 3W2GA 4DOZA 2BM0A 1O8DA 3SZPA 2ODLA 1JT6A 3CJRB 3SQNA 3SYTA 2DMPA 3ZOBA 3J7AY 2VJ4A 3BPXA 2LMDA 1FMVA 2BVLA 3FZVA 3IHUA 5L3EA 1N05A 4E0FA 3OYLA 1TWGJ 2W6JA 3ZUGA 3K4CA 2WZNA 3B78A 3H9NA 3W2AA 1JKRC 1YS6A 3RPUA 1TP4A 1FP2A 2DTZA 3JCUC 4BU2A 1J9ZA 4A3GJ 3SEJA 3ERED 3MZHA 3KYDB 5IT3A 1ZRFA 2V7QA 2P7CB 4ESBA 3L2RA 1FYMA 4KKUA 1JUPA 2E19A 2QMUA 1QVFB 5C1CA 1OCPA 4FQGA 3OMYA 4XSZF 1RWRA 4PCQA 3CCLI 5E3MA 3BWGA 3K2AA 3GZNB 5L3FA 1S0UA 4U4BA 2D1VA 2QTLA 3F3XA 4BHCA 1MMSA 4PC7A 2V7XA 1E0EA 4ZCIA 3OWTA 3NAWA 4XKWA 3S1QJ 2C78A 1Y0UA 2P8TA 4HE6A 3VDXA 2W6IA 3HJEA 4W1UA 4C3JJ 3T9GA 1Y8RB 2F48A 2GK7A 2V9VA 4WZEA 4OM9A 3H0DA 3WGHA 4E7SA 3CD6I 2PIAA 1TT5B 5BPIA 3CCQB 2BYVE 1MW7A 2A5YB 3U6KA 1FBSA 2QKMB 1SANA 3EYYA 2ZL5A 3G3ZA 1ZTRA 2Y75A 3VYSB 5E17F 1JUSA 2XZPA 5H59A 4IZZA 3S8PA 4G1VA 2ELJA 2FMYA 2VQHA 4AVPA 4YCQA 1RNLA 1VQPB 3PUNA 2KT0A 2BV3A 3V7AA 3CC4I 4ZCLA 4O5VA 5J3LA 2E2JJ 1NG6A 2KRHA 2IGNA 1MSFC 5B3SH 2K5CA 3B73A 4ENJA 1PVEA 1WOOA 3Q6RA 3CF2A 4XLHA 5ICCA 5D6FA 2OBTA 1E62A 2PBIA 4NK6A 2EZLA 3K1NA 3O3KA 4WCGA 2WSSA 2EB7A 3OY9A 3ZIAA 1O8FA 2XAJA 3OIOA 4S04A 4XM3A 1YHQB 2Z8GA 3RKXA 1PKVA 1RIOH 3QFTA 5F08A 5H20A 2K40A 3HAGA 2E1OA 1R49A 4C2TA 3JRDA 1IC8A 1QPIA 3KZZA 5K7FA 4HQEA 4NC8A 1QPMA 3WTUC 3BG5A 3EDPA 3CCEI 1ZM2A 1QGYA 4EQQA 1OKRA 4PJMA 4AC0A 3V8KA 2PFBA 2WADA 3VYRB 1XB4A 4Y4RA 3P5JA 2V4DA 5ILUA 4P22A 3R0JA 1KU3A 4YFKF 1HKTA 2BVMA 4OAZA 4BQNA 3M4OJ 4WZKA 3L2UA 3T56B 1LE8B 3G6EB 2IS2A 2ZFWA 2DT7B 4AVZA 5K5QA 1LFUP 1J9IA 2DO7A 3ZN1A 2R92J 2W4SA 4E6KG 4ESJA 1MMDA 2QEXB 2FBHA 1PJ5A 3K0LA 1W1WE 2EINH 3KETA 1D5VA 4XSXF 1ITYA 2ZZQA 2BM4A 2W57A 2O17A 1S6LA 2QA4B 2L7FP 3G2BA 1RR8C 4MFDA 5FLVA 3UNGC 3VB2A 4B3FX 1QHGA 2KIFA 2DW4A 1KU7A 1IN4A 2JJ1A 4Z4RA 3CCUB 2KIUA 1EH7A 3ZZUA 1JUMA 3ROUA 3LSKA 4ANJA 2V1XA 3DEUA 3HRTA 1VQ6B 2QM3A 5D4SA 5TV2A 3HBLA 2BSAA 2VBEA 3SUCA 4DQLA 3LL7A 5DN6A 4Y13A 2DDBA 4MTEA 4Q47A 3HRUA 3BROA 1QQIA 2PI0A 4RB3C 2Q6IA 2BSPA 1DUXC 1IDJA 1RKWA 4RDLA 4OINF 4KICA 1W34A 2H6CA 1J0RA 1SFEA 3V8JA 2K4JA 3R61A 1QGPA 1YYVA 3BTJA 2QYUA 1FY7A 2KDZA 4IL6C 3AGQA 3O8GA 3ZRGA 2JA7J 4OPWA 1NK3P 3OL3A 2GA1A 3CCQI 1TL8A 2QZAA 1YRNA 1E3ZA 3TW6A 4B3GA 2UXNA 1DBGA 3GZ5A 3ONUA 5JMCB 3DP7A 1VHEA 5IT9K 1Q1HA 1GVHA 1E64A 3CJQB 3ASNH 4X8IA 5IOZA 4WZTA 1BL0A 3IC7A 1K79A 5IP6A 1VQPI 1WJBA 1JKOC 1AIRA 2Z5UA 1ZK8A 3BG9A 1KJZA 2PMZN 4BE2A 2DPUA 1TZLA 2HYJA 3DTKA 4JX6A 2OYNA 2XTXA 4HV6A 1LFBA 2NOJB 2OQRA 3NWSA 1V0EA 2XOKA 4ACAA 3SKBA 4HLXA 3I53A 1XG2A 4IHXA 4P3IA 1Z3XA 1SD6A 2VXZA 1OB2A 4L18B 4NQWA 1WH7A 3OZUA 5J3OA 3T8TA 2FSWA 4GO1A 3SDGA 3ECHA 4V2GA 1JKPC 3HB9A 3AG4H 4A3MJ 3TW7A 4G7ZF 1WOSA 3AGPA 1H89C 1YHQI 2R5ZA 1UD4A 1I3AA 1J75A 2JSCA 3PM1A 4PJLA 1Q81D 5FL7A 1P2FA 3A02A 1VBLA 3H3ZA 4WX9A 1MJBA 1V54H 2NVQJ 2O61A 2WA0A 2PYHA 2ESHA 3P26A 5HNFA 2V7TA 4X07A 1P4XA 5F6FA 2IA2A 3VEPA 1I6HJ 1KU9A 4JQFA 1T08B 3SFZA 3WTTC 1ZLJA 4HLYA 1JJ6C 1RQPA 2HR3A 2PYGA 1U78A 2E1MC 4DK0A 2K4BA 2A5WA 1FEXA 3VWBA 1F36A 2DDAA 5HLIA 2X85A 1JT0A 3GSIA 1F5TA 1U2WA 1BC8C 1RR7A 4UVCA 1I50J 3FM5A 4XNFA 3ZQGA 4E7JA 3KL9A 2X4HA 2D5VA 3AVXA 2M9HA 2H09A 1XSVA 2XROA 2QEXI 4B3AA 5E8GA 1QH0A 2WZPP 3M07A 4EM2A 1FOWA 2QA4I 3WNCA 1BM9A 4NC7A 3WYAA 2CS3A 3S3OA 2EZIA 4ROXA 3OOPA 2E7WA 3CCUI 2J5OA 1FMWA 3C1DA 2WAEA 5KNLA 3RKQA 3DKXA 1XQBA 1K7AA 1ZQ3P 2NTPA 1VQ6I 1E17A 3MMPA 2VQCA 1PYVA 4LK0F 5FLXZ 3VSTA 4D7MA 1W0JA 1WU8A 2BF4A 4BHBA 2MD5A 3OZWA 1T0FC 1H8EA 1X4PA 4XLAA 1JHFA 3BJAA 1SD7A 1XMKA 1ZGAA 2B9SA 1A31A 2VFNA 4PMHA 5GV8A 1EFUA 2BZTA 2LF7A 4EGZA 2EFGA 4HE5A 4DQ2A 4RM3A 3CMMA 2ZITA 2HDWA 1FP1D 2O8XA 5BMZA 3B4NA 2EV0A 2ELHA 3HTSB 4NHJA 2CQXA 2J8KA 2XVCA 4PGOA 2NPFA 3K1PA 3MZYA 5J6XA 4FN5A 4PC3A 4RM2A 2CV1A 2Z1DA 2VFOA 4HDUA 2YS9A 1K61A 1MJ9A 4FE7A 1RI7A 3LSTA 4CZZA 4WXHA 5ILVA 3C2GA 4HX7A 2XF6A 4HX4A 2ZJ2A 3ZQLA 2JUCA 1MDMB 3BR3A 2RQQA 2OK8A 1HA8A 1QRYA 3OJWA 1R5BA 4MO7A 3JRCA 1AU7A 4IXAA 1IN6A 2D74A 1I18A 2F4IA 4E4HA 2QY1A 2NVUB 3C18A 4EW9A 2CW8A 3G05A 3ZPLA 3WU2C 3PQJA 1HKQA 2DJNA 3DKWA 5M5WJ 1ZR2A 1KQSB 3RPQA 1R5HA 1NHCA 4Y52J 1FYKA 2VBTA 4YZQA 4U0VA 3F6OA 2EA4A 3GQ9A 3K2ZA 1VLYA 3PSZA 4I76A 5ILSA 3LVBA 2F4OB 4XKVA 4EH1A 4CCOA 3BG6A 2P7VB 3CCRB 2P5VA 2AS5F 2PLFA 3UW0A 2NNNA 2D45A 2V7VA 5ICFA 1TWFJ 2P5KA 1XSDA 2QZ8A 2VC0A 2HVSA 2OK7A 2HYGD 2F1LA 1LKXA 3B90A 2E1RA 1K8FA 1HOMA 4HF1A 4L0YB 4P1VA 4ZZLA 2O8KA 2EZHA 4XOPA 2NVYJ 3KE2A 2DBBA 5E1XA 1FBQA 2C4UA 1E2XA 4HQMA 2I10A 5DD8A 2GJPA 2GQFA 2IGMA 5D5UB 1JRGA 1KQ0A 2LVSA 2X53S 2ZTNA 3ML3A 2HXIA 4YEIA 2L54A 2DI3A 2ZNZA 3CDHA 1IHMA 3K4LA 2HU9A 1X19A 2W48A 4IHVA 2NOGA 5HKKA 1D8JA 1LVKA 1HA3A 4HPQA 4RDKA 1YX3A 3FDYA 1MBKA 2A6TA 4PJ0C 1BW5A 4P5OA 1FOYA 2OZUA 1DPRA 3CP2A 3DPLC 2DFFA 1UCRA 1K83J 4F7ZA 5JR3A 4X0GA 1GDTA 2HDNB 2EZKA 4BJ6C 1UD5A 2LKSA 1SMYF 2KISA 2F4MB 2JPBA 3ZMUA 4QHYA 1VQNB 3NRVA 1V5GA 1N77A 1R9TJ 2BY2A 2JWTA 2VONA 2WB1A 1O3SA 1E3OC 4HOBA 1MABA 1QCXA 1I1GA 4CA0A 3DPTA 3DWLE 4XR6A 1A8PA 1Z77A 1E1QA 2HVQA 1XTAA 4A69C 4G12A 4YIRX 1LVAA 1YX2A 2CW5A 2ZJPF 4IO9F 2IRFG 1RQRA 2LF8A 3SY2A 3NWTA 4I0AA 2BHYA 1ZGWA 2CU7A 1Q82D 2L5QA 2GZWA 4G7WA 4QTRA 2FX0A 1EFRA 2PMHA 1DBOA 2XGCA 4Y33A 3H1CA 2PLYA 3BNWA 1ZN2A 1IDKA 1VQ5B 4P6VF 5AN9A 3H5AA 5EG0A 1B8IB 3GIRA 2P6SA 4Z4TA 1Z6RA 2XSJC 4MNUA 4RD1A 1J5YA 2M45A 4BY7J 5LGNA 2V1DA 1VQMB 1DP7P 4RDUA 2K9LA 2RV8A 3QPTA 2A61A 3F23A 4XONA 3S15J 4CO8A 2QUFA 1IJWC 3OJXA 5DM7F 4W8QA 3ZMSA 3T51B 3DU1X 3AKZA 3HSEA 3DF8A 3FY3A 3G71I 3ZQ7A 3BJ6A 1MDMA 2EWEA 4KN4X 4X7CA 3WTVC 3HM5A 3LOCA 2X0KA 3FPPA 1VQLB 4B09A 4P3YA 5ERIA 4G94A 3RDIA 1GUUA 2EIJH 4UHTA 4QPQA 2DA2A 4BACA 2G9WA 2IT0A 3S2DJ 2R7FA 1XMXA 1KK3A 4LGWA 3CCRI 1R5OA 1OCTC 5D5VB 5EZHA 1JGSA 3TKYA 2K3FA 4A0ZA 2YWFA 1O57A 1TSPA 3SEQA 3M8JA 3T53B 1O8JA 2XNCA 3I9V2 1BI1A 3IUOA 3PVDA 1K4ZA 5B66C 4A5MA 2ZL7A 3KRGA 2HPIA 1K4SA 1BMFA 3OW7A 3S1NJ 5CDFA 1YG2A 2ZC2A 1MJAA 1RMGA 5FLMJ 2W7ZA 2IXSA 1VQ9B 2NS7A 3CCYA 1WXRA 2LKPA 4M6VA 1L3LA 2QQ9A 3NARA 4O3MA 1OCOH 3DKYA 3FMRA 3U2RA 3DBRB 2DERA 2JQ7A 4E70A 1QRBA 3E3VA 2E35A 2DA7A 2YWHA 2MC3A 4ZDPA 3OPOA 2L9NA 3I54A 3E6BA 1FNBA 1S5LC 1T95A 1YS7A 4HV5A 4IJAA 4F52A 2YX4A 3GQAA 2INUA 4AC9A 1A6IA 4LG0A 1TW3A 2CMPA 2XPWA 2FJ1A 3ML6A 4RAGA 5GTIC 4MTDA 1W9XA 2WAQN 2DT6A 1HSJA 4ZCMA 2ZKZA 3S14J 1ZH5A 1GVDA 2FQ3A 3W2IA 2VKVA 3BZCA 3IAS2 3KEQA 3FX3A 5AONA 2ZNYA 5E1WA 4CCLA 1VQNI 1GAQA 2W7NA 2QWWA 3OYDA 4KN7X 2CV0A 1ZGJA 2EH3A 4A3KJ 1JJ8C 3S3NA 4KA4A 3VO1A 1WI9A 1M90D 3HOWJ 1R5GA 3QODA 3S3MA 3AG1H 5J4YA 4KNYA 1A5JA 1IV8A 2MSYA 1IW7F 2MH9A 1XN7A 1RZ4A 3F8CA 2DA3A 3HOTA 1GT0C 4ZV4A 1IA5A 1UAAA 3H9QA 2VBSA 3PNTA 2ZJRF 3HOSA 3GX4X 1FJLA 1VQ5I 5FLXK 3DCFA 2W84A 3M7GA 1O8LA 3GO5A 1UHMA 2UVFA 1EP3B 2Q6LA 1TT0A 3A1PA 1FX0A 1VQMI 1TYWA 5C3EJ 1VF9A 4IOAF 3CCSI 3DBLB 4EATA 3FXUA
chains in the Genus database with same CATH topology
1VZ0A 2CV2A 3W2AA 3NE5B 4CSWA 3HXLA 4BU2A 3VYTB 3JU4A 4BQQA 4KKTA 4TSFA 1W36C 4U49A 3VSVA 3D5SC 1K6YA 1MNDA 2UWMA 3OFNA 2V7QA 2KLOA 1NBMA 5HOOA 4BEHA 3L2RA 4KISA 4KKUA 4BE0A 3PL8A 2XAUA 3OR2C 2LH9A 3HC7A 3SEZA 1DGRM 1D1BA 1E1RA 3OAAA 5C1CA 1O8HA 4BDYA 2VJIA 2IGOA 3OMYA 1JTAA 1D0XA 1RWRA 4OJOA 4XLEA 2E1MB 1QJVA 1O8EA 2IGKA 5C1EA 4PFPA 2E1BA 4R79A 3HUGB 4U4BA 3DQVC 2VJJA 1E0EA 3OWTA 4XORA 1E79A 4XKWA 1V0FA 3MKYB 3OEEA 3A4CA 3VDXA 2W6IA 1BOBA 1O8MA 3T9GA 2VPLA 2MFZA 4G7XA 2GK7A 4XOTA 3AL0B 1Y6IA 5CKTA 2XF7A 4RLFA 4E7SA 3H0DA 2NTQA 1MW7A 4F93B 1UG0A 2KP6A 2QKMB 3A1YA 4DIQA 4RLQA 3VYUB 2Z2SB 3VYSB 4BEHB 2XZPA 2F43A 1KONA 3S8PA 4IZZA 2ELJA 2VQHA 2R7QA 3OYHA 4FASD 4C2UA 4W8SA 4IX7A 1P9QC 4XKCA 3L2VA 3OYEA 3BCBA 2FUG2 1HZEA 1DP3A 1NG6A 2KRHA 3OIPA 1KCDA 2IGNA 3AFHA 2GJRA 2K5CA 3EUAA 1OGMX 1PJRA 2L9SA 3CF2A 3TMOA 4XLHA 3BLYA 4U87A 3K4NA 4B43A 3AL0C 1UD3A 2KDOA 4NK6A 3OS0A 4BQOA 3VSKA 2WSSA 2LBFA 3OY9A 3GRHA 3ZIAA 1O8FA 2Z8GA 4XM3A 2LRDA 3DTEA 4H4KC 1PKVA 2WAQA 2M7AA 2PECA 4DBRA 5FROA 3HAGA 1Z21A 4C2TA 4L8JA 3B8YA 4HRIA 4NC8A 3EQNA 3LNNA 5CQGA 2IS4A 1V5EA 2KL4A 4PJMA 1T5EA 2IQ7A 1O8KA 2WADA 3VYRB 3OR1C 3ZGKA 4Y4RA 3DLAA 3RSNA 1BR1A 5LFAA 3K70C 2V4DA 2QXZA 4P22A 4E7HA 3A3GA 3LSHA 1MNEA 2BVMA 3PUBA 4OAZA 4HSRA 4BQNA 3L2UA 5LD2C 3T56B 2IS2A 4AVZA 2DT7B 1OOCA 4HG2A 2VL8A 2W4SA 2CUZA 4E6KG 1MMDA 4CZCA 3ZPPA 2CUJA 2DJIA 2UUZA 2ZZQA 4DNTB 1X1BA 4B44A 2O17A 1WP6A 2KHMA 3G2BA 3W2WA 3UNGC 4JOMA 2KZVA 1QHGA 2IS6A 4B3FX 2JJ1A 1N75A 4J01A 2UV1A 3LSKA 3K4KA 4ANJA 3OYBA 3K4BA 5TGTA 3L2QA 4KKSA 4YRVA 2PJRB 2VBEA 4G6IA 3SUCA 2MC4A 3W2VA 3LL7A 4BS9A 2VLAA 2VKHA 5DN6A 3E0JB 2JVGA 2KQRA 4RMNA 4C2LA 3LSIA 2Q1ZB 2F6CA 2BSPA 1IDJA 1BN8A 1UD8A 2UVEA 2OV7A 2V7FA 3QYFA 4OZYA 2LY1A 4FXUA 2WY7Q 2X1EA 4II2A 4J00A 2R7UA 3ZRGA 4ZTJA 2ZZFA 1EA3A 4C30A 4D9JA 3OL3A 2Y0SA 4QPOA 4B3GA 1E3ZA 1OLTA 3N05A 1GLNA 4PUSA 2E5NA 2DXIA 1DBGA 2GOXB 3FBIB 1J09A 2X51A 2CK3A 3CJQB 3DU5A 4GRIA 4DNRB 3BCFA 2WJVA 4P1WA 3HKZA 4XD7A 4N4NB 1WJBA 1R6RA 4BGDA 1AIRA 2NSTA 1K28D 3IP4B 4BE2A 1TZLA 3DTKA 2VXDA 1WJAA 2E5ZA 2LY2A 5HLTA 3V42A 1YE9A 2NOJB 3NWSA 3TBIA 1V0EA 2XOKA 1G8XA 1XG2A 3WWGA 4G6TB 4OAYA 1Z3XA 2V6EA 1BPLA 2VXZA 1COWA 3JURA 2K9MA 2K3PA 2X6WA 2V1NA 1WJDA 4HIZA 4PSXA 2XZOA 3GVLA 1OB0A 4ZYAA 3GQ7A 1QU3A 2M7BA 5JHFA 1BHEA 1UD4A 3KEYA 4CCJA 1IRXA 4PJLA 3D5RC 2VASA 4E7IA 5FL7A 2DOAA 1E43A 1VBLA 2X3HA 4N4OB 3CESA 2VQLA 2MABA 2M3AA 2WA0A 2RREA 5CQEA 2PYHA 5HNFA 3KYLA 4IKFA 4F91B 2ZTGA 2CW7A 4MXNA 4JQFA 1X4OA 2PYGA 2E1MC 1WJCA 3BG7A 4DK0A 4DK1A 2A5WA 3VWBA 2X85A 2NT9A 1MMGA 2LOOA 1VJSA 2QX3A 3SDBA 4KITB 4W8TA 2V26A 4YXWA 4XNFA 4E7JA 1X1CA 4NQWB 3FBNB 2WBMA 4ZJZA 2WPDA 1OFMA 2VJ5A 3OIQA 2LZJA 2WZPP 3OL4A 4XQFA 4HWVA 1D0ZA 4AU7A 4BUPA 3FHNA 4W8RA 2R7RA 4ZDLA 4NC7A 4OJ6A 4CCKA 4URRA 2CS3A 4Z05A 4DGWB 3S3OA 4HEA2 1BR2A 2F1MA 3I3LA 3HPGA 1FMWA 2Z6BD 4MLOA 2WAEA 2ZSHB 3K4JA 3QYBA 5KNLA 3DKXA 2XC7A 2QE7A 2NT6A 2NTPA 2OUMA 4HSTA 2X1CA 2HPMA 2VQCA 1PYVA 3VSTA 4JMQA 1UD2A 1PXZA 1W0JA 1X0CA 1NRKA 2W00A 1NG7A 2JUGA 1T0FC 2XDVA 1H8EA 3W3CA 2L7KA 3RTRA 4II3A 2LYCA 1X4PA 4XLAA 2PJRA 2OC6A 3VSLA 1G59A 2RNGA 4PMHA 3H5RA 3FKSA 1LDKB 3MMYB 1I8DA 2V4JC 2GK6A 4B48A 5IK2A 2GJKA 4RM3A 4BDZA 4U7BA 5AMVA 3CMMA 2P0WA 2HDWA 1X1AA 3LSGA 3B4NA 3L2WA 3OYKA 2QKLB 4ZDOA 1DGWY 3OE7A 4RM2A 2CV1A 4YEJA 1Y56A 2Z1DA 1U0JA 3MKWB 1PLUA 3QYEA 5HVQC 5KHDA 3IAM2 2GOMA 2VIXA 3C2GA 3LSMA 2XF6A 2JSPA 3MKZA 2RQQA 2WJYA 1HA8A 3OYIA 2O1DA 1BR4A 1I18A 1H8HA 3ZSCA 2F4IA 3H35A 4E4HA 2JJ2A 2QY1A 1MMNA 4EW9A 4XMYA 2CW8A 2PMZA 5FRNA 4BE1A 2KVOA 3U21A 3G05A 1SFKA 2VBKA 2D3NA 2WAFA 1CZFA 1NHCA 4AYBA 4YZQA 3S32A 2HLDA 3GQ9A 4E7KA 1KZLA 1VLYA 4XKVA 1LFPA 3UW0A 2ZXHA 3BG6A 4CCOA 1O8GA 2INVA 4XLCA 2HVSA 1LKXA 2M4KA 3B90A 3GQBA 2L2OA 2KRCA 4BXFA 1DQUA 4XOPA 4B3XA 2R7XA 3A35A 1ERDA 2VB6A 3K10A 4XLFA 3GVJA 4KJZA 2CFOA 2IGMA 2X6YA 4PFOA 2GJPA 1JRGA 2X53S 2ZTNA 4NNJA 1W36D 3BC8A 4TT3A 4CCMA 3VMWA 1RU4A 2KPMA 3HG9A 2ZFUA 3K4LA 1WFXA 2HU9A 1V5FA 2Q2EB 4OWRB 3ZR8X 2HVRA 4I84A 1X19A 1HVXA 4OZZA 4XN0A 5HKKA 1OFLA 4ITVA 2O0VA 1SKYB 1LVKA 1EE6A 4HPQA 4ZC3A 1YX3A 3KX2A 1SAUA 3FDYA 2A6TA 2NZMA 4P5OA 4Z03A 3OOUA 2DIEA 3DPLC 3CP2A 1GQ8A 4B47A 4X0GA 1E3XA 4XKBA 3BH4A 2X6XA 5CPRB 4BJ6C 1UD5A 1K5CA 3C2HA 1AA7A 2E60A 3DEEA 2X1DA 1V5GA 4DBQA 1N77A 1UD6A 2WB1A 3FKJA 4BJTA 1MABA 1O88A 1QCXA 1WMRA 3M1CA 4CA0A 3PNVA 3E1SA 3DPTA 3DWLE 4XR6A 1N78A 3F9KA 2WY8Q 3DDYA 1E1QA 2HVQA 3EQOA 4F3QA 3PFYA 4PJNA 4XN3A 2XNDA 2KMUA 2BOLA 4ZTFA 2DCEA 3S93A 4E7ZA 3NWTA 4YZAA 2L5QA 3DTIA 4G7WA 3QOEA 1W0KA 1EFRA 1DBOA 4Y33A 2CH0A 1Z7LA 4PK4A 4E7LA 1MMAA 1IDKA 2R7OA 4XL9A 2R7WA 2O04A 3LFUA 5KCMA 3H5AA 3ZXSA 1WJEA 2AQFA 2XSJC 4LITA 2Z16A 3OYJA 3LMMA 3RPUD 1JI8A 1HG8A 4F55A 1KMHA 2K9LA 3OYAA 3ZPNA 2W82A 4KT6A 3EUKL 1WPCA 4XONA 3VMVA 2HNHA 1QHHD 4W8QA 3T51B 3AKZA 1X1DA 3FY3A 4OJ5A 2NTBA 1WJFA 1YX5A 1D0YA 3BCDA 2EWEA 2HQAA 2LG4A 4HNUA 3LMWA 3H9JA 4DJAA 3BC9A 5HNHA 3FPPA 3OYMA 3EPZA 3VR6A 4BL0B 3K4MA 3RQ4A 4Z06A 2V9KA 4QPQA 3OEHA 1OGOX 4BACA 3GBGA 4IQJA 2ZXIA 2JDIA 4IQ4A 3K70D 2M0MA 2LC2A 1WTHD 1O8IA 3OYCA 2NSPA 5FRMA 3HPHA 1S9HA 2O5RA 3SEQA 3M8JA 3T53B 1O8JA 3I9V2 3IUOA 2VKDA 2MD0A 3PJRA 3H94A 1KTWA 3KRGA 4GQNA 2HPIA 2JIZA 1BMFA 2R7SA 2ZZEA 3OW7A 4OJPA 4CCNA 3ZCOA 5CDFA 1D1AA 1RMGA 2IXSA 2R7TA 1OR7C 1PE9A 3CP8A 4UZUA 3DKYA 3DU6A 3TL4X 4YZ0A 4TKOB 2I8DA 1IB4A 3OS2A 3DPUA 3H9GA 4ZDPA 3OPOA 2L9NA 3EUHC 4NK8A 1WJ5A 4PJJA 1T95A 2LREA 3BCAA 4F52A 3WQZA 2F5VA 4BJ5C 3H5NA 3A3BA 2XGJA 2INUA 3GQAA 3SZGA 2CMPA 2V31A 4D1QA 1W9XA 2BW3A 2LBFB 1D1CA 2DT6A 2R9VA 3ONQA 2AQEA 2XF5A 4FETA 1ZELA 4HNTA 1OHHA 2ZZGA 3IAS2 2W1OA 4YZXA 2O0WA 3K6GA 4CCLA 3RCOA 2R7VA 4LG3A 2W7NA 3OYDA 2CV0A 4CUGA 1H80A 4OJLA 3D5LA 3S3NA 2X8KA 4YELA 3PSIA 2JVHA 3KEWA 3OS1A 3MD2A 3QODA 3OYNA 3S3MA 2HZDA 3PNYA 1VF7A 2R4GA 3GVKA 4Z1MA 4LIVA 2XZLA 2VBMA 1KCCA 4MR0A 4C9YA 4ASUA 3OYGA 3HOTA 3CZ6A 3GQ8A 3ZQQA 1IA5A 2ZSIB 1UAAA 3H9QA 4NUBA 1Z3YA 2JA2A 2M4GA 3PNTA 3HOSA 2D3LA 2M5SA 4LIUA 3OYFA 2IS1A 1BLIA 2VQGA 3OOCA 2BW3B 1O8LA 3UR3C 3PSFA 4DOZA 1O8DA 2ODLA 2UVFA 3A2KA 1TT0A 4Y3OA 4PSWA 1FX0A 3CJRB 3SYTA 3J7AY 2VJ4A 2MYSA 1FMVA 2BVLA 4F92B 4CH7A 3HL2A 4E0FA 3VSUA 3OYLA 1UELB 2W6JA 4EATA 3K4CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2VBE A;  3SUC A;  4PMH A;  4U49 A;  4C2L A;  5AMV A;  2BSP A;  1IDJ A;  1HG8 A;  1BN8 A;  3B4N A;  5C1C A;  1O8H A;  2UVE A;  2VJI A;  4XON A;  3VMV A;  1JTA A;  1RWR A;  4OJO A;  4OZY A;  4XLE A;  1QJV A;  4W8Q A;  1O8E A;  5C1E A;  4YEJ A;  4U4B A;  3FY3 A;  2VJJ A;  2NTB A;  1PLU A;  4OJ5 A;  2EWE A;  4XOR A;  1DBG A;  3LMW A;  4XKW A;  1O8M A;  4Z06 A;  2O1D A;  3T9G A;  1OGO X;  4XOT A;  2NST A;  1AIR A;  3ZSC A;  2QY1 A;  4EW9 A;  2NTQ A;  4XMY A;  1O8I A;  2NSP A;  1O8J A;  2VBK A;  1XG2 A;  3WWG A;  1CZF A;  1NHC A;  1KTW A;  3KRG A;  4YZQ A;  3JUR A;  3GQ9 A;  4OJP A;  4W8S A;  1RMG A;  2X6W A;  4XKV A;  3UW0 A;  1PE9 A;  3GQ7 A;  1O8G A;  2INV A;  4XLC A;  1KCD A;  4YZ0 A;  1BHE A;  3B90 A;  1IB4 A;  1OGM X;  4XLH A;  4XOP A;  4XLF A;  1VBL A;  4NK8 A;  4NK6 A;  2X3H A;  3GQA A;  2INU A;  2X6Y A;  1JRG A;  2PYH A;  3GRH A;  1O8F A;  2Z8G A;  4XM3 A;  4MXN A;  3VMW A;  1RU4 A;  2PEC A;  2PYG A;  4I84 A;  3VSU A;  4OZZ A;  3B8Y A;  4XN0 A;  2X85 A;  2NT9 A;  4YZX A;  2O0W A;  1OFL A;  2QX3 A;  3EQN A;  4W8T A;  2O0V A;  4XNF A;  1EE6 A;  2IQ7 A;  1H80 A;  1O8K A;  2NZM A;  1OFM A;  4OJL A;  4Z03 A;  4YEL A;  4XQF A;  4HWV A;  1GQ8 A;  2QXZ A;  4W8R A;  2X6X A;  4OJ6 A;  1K5C A;  4URR A;  4Z05 A;  2VBM A;  1KCC A;  4MR0 A;  4AVZ A;  1OOC A;  3GQ8 A;  1IA5 A;  1O88 A;  1QCX A;  1WMR A;  2NT6 A;  3VSV A;  2NTP A;  3ZPP A;  4XR6 A;  2O17 A;  3EQO A;  3VST A;  1O8L A;  1PXZ A;  4XN3 A;  1X0C A;  1O8D A;  2ODL A;  2UVF A;  4YZA A;  4XLA A;  1DBO A;  2O04 A;  1IDK A;  4XL9 A; 
#chains in the Genus database with same CATH topology
 1QQ1 A;  3J81 k;  4AIK A;  1MBH A;  4RGU A;  4CSW A;  1C0W A;  2GXA A;  3JU4 A;  3LWF A;  4Y17 A;  1S7A A;  1XCB A;  3F6V A;  4KT5 C;  1W36 C;  1RUN A;  1QUE A;  1L0O C;  4UV9 A;  4MGR A;  3P7N A;  5KK1 A;  5H2F C;  1SC7 A;  1B72 B;  3J80 Z;  5HOO A;  1BJK A;  4KIS A;  2O0Y A;  3PL8 A;  2XAU A;  3HC7 A;  3SEZ A;  1DGR M;  4XRS A;  3OAA A;  1O8H A;  1VQL I;  2VJI A;  2VBW A;  4KIG A;  1ACI A;  1D1N A;  3GYH X;  2WYR A;  1D0X A;  1JTA A;  1SAX A;  4XLE A;  2B0L A;  5JI6 A;  2NVX J;  2IGK A;  3AK5 A;  1P6R A;  2EK5 A;  4PFP A;  1Z91 A;  1WZ2 A;  2E1B A;  2Y0S N;  3FF5 A;  3QU3 A;  4KIF A;  3HHH A;  1MSE C;  1VFC A;  2CF4 A;  2KIM A;  1P4W A;  2ZME B;  1V0F A;  1VTN C;  1DU0 A;  2XB0 X;  2VBZ A;  1O8M A;  4JK1 X;  2VPL A;  4FE4 A;  4XRS G;  4UY8 I;  1T98 A;  4Z4V A;  1VQ9 I;  5CKT A;  1U9O A;  1B9N A;  2M1B A;  4TMV A;  2EJR A;  4F93 B;  2HXO A;  1HDP A;  1UG0 A;  2KP6 A;  4DIQ A;  3OSG A;  2IW5 A;  3VYU B;  1TYU A;  2M34 A;  2ZBK A;  5CVU A;  3CME I;  1K8A D;  4PC2 A;  3IV5 A;  3JRG A;  4YAF A;  1ZG3 A;  4CGZ A;  1BC7 C;  5LHI A;  5EZG A;  3FXK A;  3L2V A;  2VI6 A;  3HIF A;  2TRT A;  2Q6O A;  1FDR A;  3BCB A;  2BBY A;  1WGX A;  2FUG 2;  4OIP F;  4FIS A;  3KFW X;  1HZE A;  5FIU A;  1KCD A;  2VE8 A;  1WRJ A;  3I4N J;  1HQC A;  1OYI A;  1JTY A;  3TMO A;  3JRI A;  1FNC A;  2RC5 A;  3CMA B;  3K4N A;  5HS8 A;  3JW4 A;  1ZAR A;  2XNJ A;  3TO7 A;  1GO2 A;  4LFU A;  3OS0 A;  4BQO A;  2STT A;  1UB9 A;  2HGC A;  5IP9 J;  1G6N A;  2DQL A;  3REO A;  1K78 B;  5GAG J;  4RPD A;  3T8R A;  3Q6Q A;  5LEJ A;  3DTE A;  4H4K C;  5E20 A;  4AID A;  2VOO A;  1TW2 A;  2O03 A;  4DBR A;  2LK2 A;  5D6E A;  2R93 J;  3B8Y A;  3R4K A;  5GAH J;  3SZE A;  1W4M A;  3VNU A;  4QSH A;  4LB6 B;  5CQG A;  2IS4 A;  5E6T A;  2M87 A;  2R3S A;  1QVG B;  2IQ7 A;  1T5E A;  3WE3 A;  2E2H J;  4IRG A;  1YW7 A;  1YIO A;  4RLZ A;  5K5O A;  1ZRE A;  4LLL A;  3RSN A;  2OBS A;  3QPS A;  4E7H A;  3HEF A;  4JX5 A;  5EDN A;  2DA6 A;  4S05 A;  5LD2 C;  3PUB A;  3DBH B;  4DQK A;  2VL8 A;  4CZC A;  4RBO A;  4BHP A;  1ZM3 A;  3V76 A;  2DJI A;  2QCO A;  1EV7 A;  5IPA A;  3CPX A;  3ZPP A;  3GTM J;  3JR9 A;  1YO5 C;  1X1B A;  4B44 A;  2VBX A;  3PQK A;  2KHM A;  3W2W A;  3IKT A;  2G0Y A;  4ZGN B;  5DUK A;  1CNF A;  4I99 C;  1YIJ B;  2UV1 A;  3K4K A;  3PIO F;  5TGT A;  3L2Q A;  5A89 A;  1ZG5 A;  1IZ1 A;  3GZ6 A;  2PJR B;  3BR5 A;  1UJ8 A;  5D5X B;  4OP7 A;  1N07 A;  1YJW B;  1YW9 A;  1WCM J;  4PZJ A;  4RMN A;  2E1N A;  1FC3 A;  2W85 A;  3I59 A;  2F6C A;  4RAF A;  4A0Y A;  4H0E A;  1T33 A;  1BJZ A;  1BN8 A;  4ASN A;  4OOX A;  4UZE A;  2F4N A;  3LNQ A;  2UVE A;  3Q0U A;  2BM7 A;  2Y2Z A;  5LEK A;  1L1I A;  2CWE A;  2LY1 A;  2WY7 Q;  2EQR A;  1IRZ A;  1TWH J;  4II2 A;  2R7U A;  1BX1 A;  1EA3 A;  2ZME A;  2GPJ A;  2F5D A;  1YLO A;  4QPO A;  2B7B A;  2VFM A;  1J2X A;  2XHK A;  4BPR A;  1J09 A;  1HF2 A;  1GR1 A;  2V1U A;  4IEJ A;  2X51 A;  5HZA A;  3KLN A;  1IDY A;  4KMF A;  1DU6 A;  4P1W A;  3HKZ A;  4XD7 A;  2RGV A;  3MN2 A;  1NK2 P;  1RET A;  4BGD A;  1K28 D;  1XDS A;  3CDL A;  3WOD F;  1OIS A;  1W5C C;  2VXD A;  2E5Z A;  4M73 A;  4Y7N J;  2LY2 A;  5H6R A;  5F04 A;  1SMT A;  1YE9 A;  3V42 A;  1IJE A;  4X0C A;  3WWG A;  1G8X A;  5LBQ A;  1WSU A;  4G6T B;  5GV7 A;  4OAY A;  2CYY A;  1DDG A;  2GXG A;  1QA2 A;  3CMA I;  2K9M A;  2B0R A;  3O6B B;  2A68 F;  3AG3 H;  3C2B A;  1WJD A;  3QWL A;  4HIZ A;  1N0V C;  4PSX A;  3RQI A;  2XZO A;  3GQ7 A;  3ESW B;  2YUS A;  2ZO4 A;  3LAP A;  4W97 A;  5H6Q A;  1R4N B;  1WSR A;  5AIQ A;  1KZH A;  4CCJ A;  1FNN A;  1YRN B;  2KFD A;  4X1E A;  2QSH X;  4E7I A;  3FXL A;  3BQZ A;  2XSD C;  4G1B A;  2LD5 A;  3BZ6 A;  1K78 A;  4M3D A;  4G7H F;  4I09 A;  4N4O B;  3CC7 B;  3G73 A;  3S2H J;  5CQE A;  1WI3 A;  2ETH A;  4DNC A;  4MXN A;  2MA3 A;  1X4O A;  2Y30 A;  3BJO A;  4IRI A;  4G6Q A;  4FX4 A;  5GTH C;  3JQQ A;  4M4S A;  1YJN B;  3CCV B;  4NDL A;  1GVJ A;  2FNP A;  5DS9 A;  4GGG A;  1K73 D;  2LNB A;  3SDB A;  3JSP A;  4KIT B;  2QX3 A;  4YFN F;  1YW8 A;  1JTX A;  4UV8 A;  2K02 A;  4NQW B;  5GAE J;  3FBN B;  3MHP A;  1A6Q A;  1I27 A;  2MBF A;  3OIQ A;  2P5L C;  4XQF A;  3H36 A;  4W8R A;  3I0T A;  2R7R A;  4M74 A;  4OOI A;  2R5Z B;  3HGY A;  4HEA 2;  5F0C A;  3HPG A;  2Y0M A;  3HOU J;  1YIJ I;  3U2Q A;  1WQ2 A;  2HQN A;  5ED4 A;  2QYO A;  2EBI A;  1MBG A;  1WKM A;  2ZSH B;  2EV5 A;  3K4J A;  3QYB A;  1YFH A;  4XBF A;  1BIA A;  1YJ9 B;  2XB5 A;  3CTA A;  3J81 K;  2HPM A;  2JA5 J;  2FBK A;  3P9K A;  5C4X J;  1YJW I;  1NRK A;  1JGG A;  2JUG A;  2O3F A;  1TYX A;  3MFK A;  5F64 A;  1V5V A;  3BQJ A;  4NBQ A;  1BI2 A;  1ON2 A;  2PJR A;  4A6D A;  4C43 A;  3HZJ A;  2OC6 A;  1D3Y A;  4MQ9 F;  3K69 A;  3VSL A;  3LSP A;  3CUQ B;  3WTX C;  4M3E A;  5FNZ A;  1DAR A;  5DDG A;  3MMY B;  1NB0 A;  1T38 A;  1WWX A;  3J80 K;  1F20 A;  3Q9S A;  3GUD A;  4OU0 A;  4P9F A;  5AMV A;  2FRH A;  5BQT A;  5EEG A;  1DDN A;  2XV4 S;  3MKL A;  4EJV A;  3FIW A;  5A8A A;  1XDU A;  2H27 A;  2QKL B;  3RYR A;  1DGW Y;  3HYI A;  1J7K A;  1OMI A;  2WV0 A;  3WG9 A;  2LKX A;  2YWG A;  4CYC B;  2OQG A;  1SFU A;  4H9G A;  1LLZ A;  4Z4W A;  1EFT A;  3VPR A;  1U0J A;  3QYE A;  3CW2 A;  5HVQ C;  3KP6 A;  4A0X A;  2GOM A;  1H9G A;  3LSM A;  1KK1 A;  3MAJ A;  1BI3 A;  2DU9 A;  1STZ A;  2JSP A;  3MKZ A;  4P25 A;  4P9S A;  3BH7 B;  2WJY A;  3MVP A;  2O1D A;  1N06 A;  5K1Y A;  1ETK A;  5D4R A;  1IXR C;  3H35 A;  2JJ2 A;  4RD2 A;  3ZSC A;  1MMN A;  4MHG A;  4YAU A;  4RJL A;  1RKT A;  3U21 A;  1SFK A;  1QVT A;  2WV1 A;  3V4G A;  1CZF A;  4LJZ F;  5IYB J;  4AYB A;  2D9R A;  3TO9 A;  2FF4 A;  2QLZ A;  2QF7 A;  2OTL B;  2QN6 A;  2C5H A;  1KZL A;  3BR0 A;  5KAF C;  2K9S A;  4ENN A;  3CC7 I;  3ASQ A;  1O8G A;  3QQA A;  2VPR A;  2PJP A;  1Z9C A;  2CQN A;  2M4K A;  3TOA A;  1UFM A;  1F60 A;  4NB5 A;  2Y69 H;  4QWQ A;  1YJN I;  3CCV I;  2A6E F;  3GFL A;  5ICE A;  1ERD A;  2CO5 A;  4GFB A;  4I01 A;  5L3B A;  4BBS J;  2DMT A;  2F5F A;  3I5U A;  4KJZ A;  1QX4 A;  3AVW A;  4YAO A;  2VE9 A;  1SVO A;  2YU9 J;  2KPM A;  2HVR A;  5J1U A;  1TQP A;  3G4S B;  2RN7 A;  5E1Z B;  3ISP A;  2BY1 A;  2O0V A;  4EGY A;  3KEO A;  1EE6 A;  2LDU A;  1VHO A;  4OPS A;  3E5Q A;  1HXD A;  2B63 J;  2V9P A;  4ZYD A;  2HTS A;  4LOC A;  3WHB A;  4RAZ A;  3PIP F;  3BH4 A;  2K7L A;  2WWY A;  3AVV A;  1K5C A;  1R00 A;  1AA7 A;  5LGU A;  1QNT A;  1UD6 A;  1FOK A;  1RRJ A;  4XLN F;  4FWT A;  2DAO A;  1FLI A;  4MQV A;  1U5T B;  1O88 A;  3M3Y J;  1WMR A;  3M1C A;  5B1A H;  4LC0 A;  3E1S A;  4K2E A;  3ZBT A;  3DDY A;  2GIZ A;  3F9K A;  1QA1 A;  3FXQ A;  2C5B A;  2L4M A;  1QFZ A;  2WC2 A;  5CVR A;  1O3Q A;  1ZUN B;  2XND A;  4ZTF A;  3G6E I;  2DCE A;  3S93 A;  4YZA A;  4I6Z A;  4AWX B;  2OTJ B;  4B4C A;  3M1E A;  5JLX A;  1CF7 B;  4RB0 A;  2FQ4 A;  1EFC A;  3CUQ A;  1Z7L A;  2O04 A;  4KH3 A;  2R7O A;  3QU6 A;  1TTT A;  5KCM A;  4A3C J;  1YTY A;  2CND A;  1WJE A;  4JYK A;  1X2M A;  3EUH A;  2CG4 A;  3HSF A;  4P9U A;  3OYJ A;  4OIO F;  3B6C A;  4J0Q A;  1EH8 A;  1H85 A;  4M72 A;  3T5X A;  3A0H C;  5IYR A;  1JI8 A;  1DDI A;  2KIQ A;  1N25 A;  1KMH A;  3ZPN A;  2Y9Z A;  1ULY A;  3CQZ J;  5LHH A;  1TUI A;  4CYC A;  3H3U A;  3VMV A;  1QHH D;  3ULQ B;  5EEA A;  2OD5 A;  3CB4 A;  2LLK A;  5L3G A;  5D8L B;  4BYY A;  1ZLK A;  3PET A;  5J1R A;  4EV0 A;  1OCC H;  2NAZ A;  4LBY A;  1ZKG A;  4X06 A;  4OJ5 A;  1WJF A;  3BDD A;  4IRH A;  1EWY A;  2IPQ X;  2DOD A;  2LG4 A;  4HNU A;  4EJT A;  2HTJ A;  2VUM J;  4DJA A;  3QFC A;  5HNH A;  2YR2 A;  1S4M A;  3OYM A;  4YAL A;  5IYW A;  4BL0 B;  3K4M A;  4C3I J;  4Z06 A;  2V9K A;  2OTL I;  3OEH A;  3T0Y A;  3AVT A;  2ISY A;  2M30 A;  1ETY A;  1MZB A;  5EG0 B;  3K70 D;  5K7Z A;  2M0M A;  3B8H A;  5FFX A;  3ZMD A;  1MIJ A;  4A3D J;  1WTH D;  4LBW A;  1QZE A;  1O8I A;  3ONY A;  3HPH A;  2XRN A;  2ZXW H;  3QE2 A;  4RB2 C;  3PJR A;  2VKD A;  2MD0 A;  1IDZ A;  4QVJ A;  3W2E A;  2QBY A;  4GQN A;  2EFQ A;  2JIZ A;  2XGD A;  3BTI A;  2R7S A;  2E71 A;  3ZCO A;  1D1A A;  1I5Z A;  1LNW A;  4R71 A;  4A3I J;  2FBI A;  3SLD A;  1P7J A;  4P96 A;  4IPA A;  3DU6 A;  1AWC A;  2CC2 A;  1NDH A;  4YZ0 A;  5JLW A;  3IWF A;  2I8D A;  5DD4 A;  1IB4 A;  2W25 A;  3G4S I;  3EYI A;  4PGG A;  2EIM H;  4NK8 A;  1WJ5 A;  4PJJ A;  2LRE A;  3ASP A;  2EV6 A;  4BJ5 C;  3H5N A;  2NVT J;  1FX7 A;  3A3B A;  2QDX A;  3V7S A;  4CDG A;  4RD4 A;  2XT2 A;  2IEK A;  2QEN A;  1GJR A;  5DS0 A;  3I55 B;  2RAE A;  3RI4 A;  2R9V A;  2GIV A;  1MNM C;  2R0Q C;  4EEF G;  4KDP A;  1Q86 D;  1NHA A;  2LR8 A;  3DV8 A;  5M3F J;  4QV2 A;  2R7V A;  1LUJ B;  2H1L A;  3WGI A;  3SFI A;  3NEU A;  2A07 F;  1H80 A;  2AXT C;  1T6X A;  2K9Q A;  1Y1V J;  2L9V A;  3D5L A;  1D2E A;  5TRD A;  1CGP A;  2MLK A;  5BPD A;  2JVH A;  2JT1 A;  5BSX A;  3OS1 A;  4BNC A;  3MD2 A;  4OIQ F;  3WGG A;  2QQB A;  1OJL A;  2ZB9 A;  3BY6 A;  3ERM A;  4RAY A;  3WTS C;  1VF7 A;  2R4G A;  2XZL A;  4LIV A;  1KCC A;  4MR0 A;  1U5T A;  1IUY A;  3ZMV A;  1R22 A;  4ASU A;  2CUF A;  4GYI A;  1G3T A;  2XPU A;  1ZRD A;  2OTJ I;  3BOQ A;  2E1C A;  3TGN A;  5K5R A;  4OIR F;  2ZSI B;  4G6D A;  2DFH A;  4UUS A;  1NB9 A;  1BBY A;  2ID3 A;  1PDN C;  4LG0 B;  2M5S A;  4QUZ A;  1XX5 A;  3RIR A;  1F43 A;  1FWZ A;  3OYF A;  3GFI A;  2CQK A;  2IS1 A;  1LQ1 A;  3OOC A;  3UR3 C;  2BXZ A;  1R36 A;  4HF0 A;  5GAD J;  1IN5 A;  1CF7 A;  3A2K A;  4PSW A;  1ETW A;  3I56 B;  1NJI D;  4UNO A;  4F92 B;  3HL2 A;  1UEL B;  3E97 A;  1YIT B;  4MYU A;  5DYM A;  1VZ0 A;  4PDK A;  2CV2 A;  1G7C A;  4GXO A;  3NE5 B;  3VYT B;  4KKT A;  3E7L A;  3R6K A;  3D5S C;  1UMK A;  4EJU A;  1MND A;  2UWM A;  1GAW A;  4P6Y A;  3QFS A;  3T1B A;  4JBA A;  1NBM A;  2E36 A;  4BEH A;  4BE0 A;  3RYP A;  3OR2 C;  4HX8 A;  1D1B A;  2JMW A;  4ZYG A;  4M9Z A;  4N0B A;  4QFM A;  4OJO A;  4UUV A;  1O8E A;  2ICW G;  3S16 J;  4R79 A;  5EGO A;  4OOS A;  2VJJ A;  2N8G A;  4Y9U A;  1E79 A;  3GTO J;  4L5J A;  3MKY B;  3OEE A;  3A4C A;  3GLX A;  1OB5 A;  1KYZ A;  4PAA A;  1BOB A;  1K9M D;  2IOU G;  2MFZ A;  3I58 A;  2PMU A;  3L9F A;  3A8I A;  3R6S A;  2HQR A;  2ME0 A;  2XF7 A;  4RLF A;  2M0C A;  2O6W A;  1X1P A;  3A1Y A;  4I98 B;  1Y1W J;  2LSO A;  4RLQ A;  5IYC J;  3IL2 A;  1M1K D;  2WTE A;  4NC6 A;  3ZQI A;  3KZY A;  3OV8 A;  5HLG A;  1UHS A;  4U7D A;  2DYI A;  2FOK A;  4GDF A;  4C2U A;  1G3W A;  1DPU A;  2VYQ A;  4FAS D;  4M0L A;  3SJM A;  4M9X A;  4MEX F;  1DP3 A;  5IYD J;  4XRF A;  3OIP A;  3AFH A;  4RDJ A;  3I55 I;  1REP C;  3EUA A;  1OGM X;  2L9S A;  4B43 A;  1IAW A;  4KIB A;  1UD3 A;  4ESF A;  3NAU A;  2DLL A;  4GYG A;  2ID6 A;  5L46 A;  2DN0 A;  5CVV A;  1I3Q J;  2ZXJ A;  3GRH A;  2HS5 A;  2CBX A;  5B6I A;  2LRD A;  1OYW A;  2JA6 J;  2ZJQ F;  2BV6 A;  5KAI C;  2M7A A;  2L7Z A;  5FRO A;  3I1F A;  1Z21 A;  4L8J A;  4RD0 A;  1PUF B;  1Q7Y D;  3BR6 A;  5A88 A;  2VT3 A;  4HRI A;  2DCU A;  5FKN A;  3EQN A;  1ETV A;  3F8M A;  1Z67 A;  1XE1 A;  3FWE A;  2Q0O A;  3HDD A;  4A3F J;  1ORK A;  2FVG A;  2NYX A;  3ZGK A;  4ZH4 F;  2H94 A;  3DLA A;  3O2P E;  1V3F A;  4BXU A;  2FX3 A;  2QXZ A;  4TMT A;  3A3G A;  4RCZ A;  3LSH A;  1N08 A;  2B5O A;  3JAM K;  4HSR A;  2NV4 A;  1OQY A;  2R5Y B;  1O3T A;  3H3V K;  2BMW A;  5CVJ A;  1EP2 B;  3HRS A;  2TDX A;  1BOA A;  3GEZ A;  1KD1 D;  1R1T A;  3I56 I;  4RGX A;  2CUZ A;  5FKK A;  1QFY A;  2IVM A;  1YIT I;  2HDD A;  5BNG A;  4CHU A;  5FA6 A;  2V5I A;  3BY1 A;  1RC9 A;  1WP6 A;  2OCC H;  4M1K A;  5FKO A;  4DW6 A;  3F22 A;  1JB9 A;  3CC2 B;  3LQR A;  1LEB A;  1XGO A;  2IS6 A;  1OFD A;  1N75 A;  2F3L A;  3ABU A;  1S3J A;  4G8X A;  2MH2 A;  5LLQ A;  1RUO A;  3OYB A;  2MGQ A;  3RJP A;  3OSF A;  4YRV A;  2FE3 A;  2A6H F;  5FFZ A;  3A8K A;  4G6I A;  2DA5 A;  2MC4 A;  2EIK H;  5D8K B;  2VKH A;  1FYL A;  3E0J B;  2QGG A;  1KGS A;  2JVG A;  1BJA A;  3UKG A;  3E5U A;  1BX0 A;  1BW6 A;  2Q1Z B;  3G1O A;  4R8H A;  3FIS A;  3V7R A;  1USS A;  1SD5 A;  3B6A A;  4I2O A;  1IB0 A;  2OV7 A;  1IXC A;  2V7F A;  3L09 A;  3ZBU A;  5F1R A;  4LMY A;  3J81 Z;  2GM4 A;  1QFJ A;  2X1E A;  4FXU A;  1S29 A;  2GXB A;  4EM1 A;  4XK4 A;  3IRQ A;  4D9J A;  3K7A J;  2QGU A;  3A01 A;  1IO2 A;  3NQO A;  4EJW A;  3Q3S A;  1LPQ A;  1FRN A;  5IYN A;  3N6Z A;  1TNT A;  1KQ5 A;  2JN6 A;  1GLN A;  3ABK H;  2E5N A;  4PUS A;  2GOX B;  3FBI B;  4UB6 C;  1QVU A;  2DT5 A;  1Y39 A;  2CK3 A;  1KC8 D;  1PP8 F;  3BCF A;  4FT8 A;  4DYQ A;  3ZZT A;  1NTC A;  3GME A;  2L02 A;  3HOY J;  2GA2 A;  1IRF A;  3IP4 B;  1UZC A;  1Y0N A;  4TMW A;  2VBV A;  3N90 A;  5HLT A;  1WJA A;  3PO3 J;  3TBI A;  3I59 B;  3VOD A;  2PQ8 A;  5TJJ A;  3TO6 A;  2V6E A;  3AVY A;  3TP3 A;  4TMX A;  2K3P A;  2X6W A;  4I02 A;  1TNS A;  1IRG A;  3Q5F A;  5L3D A;  4G7O F;  3GVL A;  1OB0 A;  3E6M A;  4AD9 A;  1QU3 A;  2VBU A;  2M7B A;  5JHF A;  2JRT A;  2C77 A;  1BHE A;  3KCC A;  2JA8 J;  1N0U A;  3KEY A;  2VAS A;  2DOA A;  4G5G A;  1E43 A;  2PE3 A;  5HS9 A;  3CES A;  1R71 A;  2MAB A;  4LBZ A;  2RRE A;  2RDP A;  3K1M A;  3BTL A;  2BGC A;  4F91 B;  3U1K A;  2CW7 A;  2QVO A;  3KYL A;  1EF4 A;  2DFI A;  2FML A;  4P12 A;  1PUF A;  1P92 A;  1RPW A;  3EET A;  1WHU A;  1W0T A;  5JVG F;  1T2K A;  2NT9 A;  1MMG A;  2LOO A;  3CCJ B;  3K9T A;  3E20 A;  4W8T A;  3I64 A;  3ZQF A;  2CQQ A;  2ZME C;  3WE2 A;  1X1C A;  3WU1 B;  1G2H A;  4RM0 A;  1JXS A;  2MW8 A;  3SXY A;  2VJ5 A;  2Z99 A;  1IJF A;  2CQ7 A;  1O7F A;  3WG7 H;  3G1L A;  1U9N A;  4AU7 A;  4BUP A;  2R5Y A;  2L7M P;  2NXN B;  4ZDL A;  3ZN0 A;  4BXX J;  4Q7J B;  3CC2 I;  4CCK A;  4ABZ A;  3EQL F;  1T6Y A;  3PA1 A;  4URR A;  4Z05 A;  4DGW B;  1JKQ C;  2XIG A;  1BR2 A;  2F1M A;  4TMZ A;  3KP5 A;  3ZC3 A;  4KFC A;  3WTY C;  2WB1 N;  3S1R J;  2P81 A;  3E6C C;  1ETX A;  5FD6 A;  5FGM A;  4MLO A;  3OZV A;  2XTY A;  4A2U A;  1KK0 A;  2QE7 A;  2OUM A;  3W6J B;  2X1C A;  5EEH A;  2P6T A;  4JX4 A;  1UD2 A;  2VNH A;  1X0C A;  2D2W A;  3I4M J;  3F8N A;  2L3D A;  3FXO A;  3DLL F;  5J35 A;  1I6X A;  3M8F A;  2XDV A;  4IOC F;  1G4D A;  2XEX A;  4D5F A;  1S72 B;  4GCV A;  1SKQ A;  3HOX J;  1R4M B;  1ZAO A;  2BPO A;  3FPK A;  1U3E M;  1G59 A;  2RNG A;  3N97 A;  2JJ7 A;  3H5R A;  3FKS A;  3P9C A;  4QIW N;  4N9H A;  4ACB A;  1I8D A;  1QZY A;  3RIQ A;  5IK2 A;  2GK6 A;  3MWM A;  3U1D A;  2GJK A;  1WDT A;  1X1A A;  4RCY A;  1KU2 A;  1EKE A;  1ONV A;  4Y9R A;  2XAF A;  3KPH A;  1HST A;  1XPX A;  2E34 A;  2FD5 A;  3OE7 A;  2XRL A;  2PG4 A;  1HLV A;  1X2N A;  4YEJ A;  2EFO A;  3L1P A;  1D5Y A;  1HF0 A;  1D8K A;  3L7W A;  3L2C A;  5KHD A;  5GPC A;  3FM3 A;  3IAM 2;  3FXM A;  2VIX A;  4YII A;  4Z4Y A;  4V19 K;  4WQM A;  3OYI A;  1JA1 A;  1BR4 A;  1TC3 C;  4XRM A;  2DK8 A;  3M9A A;  3FHZ A;  2MLG A;  5J8C A;  1APL C;  1JE8 A;  1WPK A;  4XMY A;  4A3E J;  2PMZ A;  5CLS A;  5FRN A;  4BE1 A;  1SFO J;  2KVO A;  3R6J A;  2VBK A;  2EWN A;  4CIC A;  2D3N A;  2WAF A;  3CDI A;  5C4J J;  4L9V A;  2HLD A;  1E3P A;  2HOE A;  2HKO A;  3MEX A;  4HF2 A;  3PFI A;  4XIC A;  1LFP A;  3KZI C;  2EPF A;  1P4A A;  2ZXH A;  1PUE E;  1WOP A;  2EA2 A;  5DNS A;  4WWC A;  2BEO A;  1U2R A;  4XLC A;  2C2W A;  3ISX A;  3PA2 A;  1K4T A;  1FZP B;  1FND A;  3GTK J;  5M3M J;  3BZK A;  4S0H B;  2CJJ A;  3GFJ A;  1AHD P;  1LB2 A;  1DQU A;  2FU4 A;  4B3X A;  4A3L J;  2R7X A;  3A35 A;  3CCJ I;  2VB6 A;  4XLF A;  1ZM9 A;  4Z4Z A;  4BKX A;  1HDD C;  1FTT A;  4MFE A;  2CFO A;  2OJE D;  3WBJ A;  3IH4 A;  1HCR A;  2BXY A;  4YFX F;  3GFM A;  3BPV A;  4HZF A;  2VZL A;  2BHZ A;  3VMW A;  3HG9 A;  1FOX A;  4I84 A;  1V5F A;  2NS8 A;  3ZR8 X;  4AIJ A;  3VFZ A;  2B7E A;  4UAJ A;  4ITV A;  4L0Z B;  1FSE A;  3W5V A;  4B8X A;  1FPQ A;  4ZC3 A;  1SAU A;  4TV7 A;  2X48 A;  5DCM A;  2NZM A;  1VLO A;  2BY3 A;  3DXJ F;  1HW5 A;  2DIE A;  1GQ8 A;  3I4P A;  4U0W A;  1IN7 A;  1MGT A;  2D1H A;  4XKB A;  4EJO A;  2OAZ A;  2G7U A;  2X6X A;  2XGE A;  2LP0 A;  5CPR B;  1QZZ A;  3C2H A;  5HOD A;  4Z6Y A;  2DMN A;  2X1D A;  4DBQ A;  3TOB A;  5BOX A;  3FKJ A;  4JP0 A;  1S72 I;  3LQE A;  1N8R D;  3S17 J;  5GP9 A;  2OF7 A;  2Y9Y A;  3PNV A;  1ETO A;  3JRA A;  1FBU A;  1N78 A;  5J4V A;  2IP2 A;  3P27 A;  4F3Q A;  2NNY A;  1B4A A;  4PJN A;  3WTZ A;  4Q4Z F;  1XGM A;  2XPV A;  2BOL A;  1H42 A;  1OR7 A;  1A35 A;  2LY9 A;  3DTI A;  3RZO J;  3QOE A;  1W0K A;  1TWA J;  2K27 A;  3KYC B;  4M6Y A;  4IF4 A;  1EP1 B;  3F0C A;  4PK4 A;  4DYC A;  3KP2 A;  1MMA A;  2P4W A;  1HW1 A;  3FKI J;  2F5E A;  4UB8 C;  3ZXS A;  1U6G A;  2VN2 A;  2AQF A;  5AIP A;  1XCV A;  5HDN A;  3LMM A;  1MRZ A;  4N9I A;  3ZQH A;  2HCJ B;  3FK6 A;  1AMO A;  1HG8 A;  5DEQ A;  2BGJ A;  1VND A;  4KT6 A;  1G7R A;  2JK3 A;  2HNH A;  4OPO A;  3SQV A;  2RC6 A;  1Z0X A;  3WHC A;  2VT2 A;  4U0Y A;  5DTD A;  5BSY A;  2W24 A;  2DK5 A;  1B1B A;  3KP7 A;  2DYS H;  3CCM B;  4X7F A;  2QSG X;  1GV2 A;  2DA4 A;  3LA3 A;  5F4J A;  2NTB A;  1MD0 A;  4YHB A;  3LYC A;  1LDD A;  3RZD J;  4UVB A;  2DQR A;  1ZG1 A;  3BC9 A;  1KRH A;  1X3W B;  3JTG A;  4D5C A;  5L3C A;  3VR6 A;  3RQ4 A;  1HC8 A;  4L9J A;  1JNY A;  3ASO H;  1OGO X;  1OYY A;  3GBG A;  4J19 A;  2ZXI A;  4LK1 F;  4IQJ A;  4X6A J;  4IQ4 A;  1FSH A;  2JDI A;  3D26 A;  2IJL A;  4C0S A;  2XAG A;  2R7Z J;  5LMZ A;  1ZM4 A;  3QSY A;  4Z2Y A;  2M8E A;  3OYC A;  3GTP J;  4Q48 A;  1G3S A;  5FRM A;  3Q38 A;  3ABM H;  2IA1 A;  1S9H A;  3IH2 A;  3H94 A;  1KTW A;  5FKM A;  2HKX A;  2HDC A;  2FA5 A;  2GWR A;  2Y31 A;  3OKX A;  4CCN A;  1QUF A;  2NS0 A;  1UG2 A;  4MIM A;  5FKL A;  5M5X J;  5EF6 A;  4YFO A;  3DEW A;  3CP8 A;  3AVU A;  1LDJ A;  4UZU A;  1A04 A;  3QP5 A;  3CUQ C;  2EIX A;  3JX8 A;  4A3J J;  4TKO B;  2L0K A;  1R7J A;  3OS2 A;  2CFX A;  3CO7 C;  1KQ9 A;  2XTW A;  3EUH C;  4FX0 A;  4QVA A;  3WQZ A;  2F5V A;  4R1H A;  4HAM A;  3AAF A;  2XGJ A;  3SZG A;  1G7T A;  4D1Q A;  1QO0 D;  2E7X A;  1GV5 A;  2BW3 A;  2LBF B;  5DM6 F;  1KTV A;  3ONQ A;  4ON0 A;  2A05 A;  3GW2 A;  2ZBV A;  4FET A;  1BIB A;  1ZYR F;  2DYR H;  2COM A;  2ZZG A;  2W1O A;  2KJC A;  2O0W A;  3K6G A;  1O4X A;  4HBL A;  3RCO A;  3WU0 A;  2QBY B;  4HYE A;  4D0P A;  3FXR A;  5K7H A;  3R60 A;  3I71 A;  5JBQ A;  5HS7 A;  1SVM A;  3JRE A;  1I1S A;  1P4M A;  3OW2 B;  2HOS A;  3TH0 A;  1QRC A;  1HW2 A;  2VOP A;  2EFN A;  4YIF A;  5E79 C;  1MBE A;  5DSZ A;  2IAI A;  2BX6 A;  3CLQ A;  3O8H A;  3ELK A;  2YUH A;  1SD4 A;  2VBM A;  5EMN A;  1CNE A;  1Z1D A;  4B1R A;  1R1U A;  2OCE A;  5FJ8 J;  3OYG A;  4BH9 A;  1RES A;  2J8I A;  3GQ8 A;  1ZHF A;  1EA0 A;  3LO8 A;  3A0B C;  4NUB A;  2R6H A;  2M4G A;  2JA2 A;  2D3L A;  3B82 A;  1B59 A;  1AOY A;  2H8R A;  3BP8 A;  1Q1V A;  3H92 A;  4LIU A;  4L9N A;  4KMU X;  4M3G A;  3JSO A;  2BE5 F;  2ESN A;  4Z4S A;  2X6O A;  1EXM A;  3GVA A;  3PSS A;  2ZCW A;  4Y3O A;  4BQA A;  4A3B J;  2MYS A;  1R5N A;  4CH7 A;  2JZY A;  3ABT A;  3M8E A;  1B6A A;  1W7P B;  3IKV A;  5E8I A;  1UST A;  2K86 A;  4BBR J;  1YJ9 I;  3HXL A;  1W7P D;  3MCA A;  4BQQ A;  3CCM I;  1B9M A;  4TSF A;  3U6B A;  1BI0 A;  3FMQ A;  1OFE A;  1K6Y A;  3V8L A;  1XS9 A;  2VNI A;  3OFN A;  3JAM Z;  1W87 A;  2KLO A;  2VKE A;  4C3H J;  1MH3 A;  2A3S A;  5F4M A;  2CRG A;  4M71 A;  2DET A;  2LH9 A;  4DZP A;  1IV6 A;  1E1R A;  4HW0 A;  4BDY A;  1IG7 A;  2IGO A;  4UUS B;  2GQQ A;  3P9I A;  5J1Y A;  2E1M B;  1QJV A;  3SJP A;  2JN9 A;  1PJ6 A;  5C1E A;  4IHT A;  5IY5 H;  4CQJ A;  1CQX A;  5HDG A;  3HUG B;  4Y7C A;  4I0B A;  1OGI A;  3DQV C;  3D1N I;  4WK8 F;  4XOR A;  2VOD A;  1NH3 A;  4NBS A;  1Y8Q B;  1XG1 A;  2LTP A;  5TIS C;  3GTQ J;  1QG0 A;  3HKZ N;  2RVC A;  2XKP A;  5E3O A;  3LAJ A;  1S8N A;  4G7X A;  1U5T C;  4XOT A;  3VOE A;  5A2Q Z;  3AL0 B;  1Y6I A;  1VQO B;  5DV5 A;  1XB2 A;  2NTQ A;  4ZZD A;  3HHG A;  1MKM A;  4ZYE A;  3JQP A;  3JRB A;  1B23 P;  2H1K A;  3FXJ A;  4X7D A;  2Z2S B;  4BEH B;  2OA4 A;  1FT9 A;  1XGN A;  1T8I A;  1KON A;  3LSR A;  2F43 A;  3IH3 A;  4EMS A;  4A12 A;  1OCR H;  3OYH A;  2R7Q A;  4W8S A;  1WOR A;  4V2F A;  4IX7 A;  1P9Q C;  4XKC A;  4P2N A;  4O6J A;  3BR2 A;  3OYE A;  2BM1 A;  2ZL6 A;  2EIL H;  1T56 A;  1LJ9 A;  3HTU A;  4UVA A;  5EGO B;  3BTC A;  2GJR A;  1VQK B;  5ICG A;  1LE8 A;  1PJR A;  3AL0 C;  3SYJ A;  4RB1 A;  3BLY A;  4U87 A;  2KDO A;  3JRF A;  3WTW C;  3VSK A;  2F2E A;  3VNV A;  2LBF A;  1J59 A;  5EYR A;  4LLN A;  1EZG A;  2HYF A;  2WAQ A;  4XLP F;  2PEC A;  3TQN A;  2H6B A;  2FEZ A;  1ETQ A;  3F21 A;  4LB5 A;  1YI2 B;  2QQA A;  1KQ8 A;  3LNN A;  2Q8K A;  5HLH A;  2RNJ A;  1V5E A;  4OMZ A;  1H0M A;  2KL4 A;  1FTZ A;  1O8K A;  1H88 C;  3HOZ J;  2XT4 A;  2IBD A;  1YOV B;  1Q9S A;  3OR1 C;  1VQ4 B;  1R1V A;  2XGX A;  1ENH A;  3V7C A;  1MBF A;  1BR1 A;  5LFA A;  3K70 C;  3HRM A;  2BGI A;  1MNE A;  2YWE A;  3CLO A;  4KYW A;  1GHC A;  2Z33 A;  1OOC A;  4HG2 A;  3PUM A;  3CPW B;  1DG1 G;  5J47 A;  3J7A O;  2CUJ A;  2VC1 A;  3TED A;  2CW0 F;  3SLN A;  3RY8 A;  2PX9 A;  2ECB A;  2UUZ A;  4DNT B;  3ABL H;  1TLL A;  4V02 C;  4JRA C;  4AF7 A;  1W5S A;  4DYR A;  4JOM A;  2KZV A;  5BS6 A;  3KLO A;  1PP7 U;  2AHO A;  2P3M A;  4J01 A;  1W2B B;  6PAX A;  1W7P A;  1XD7 A;  3C3W A;  3GXO A;  2M5W A;  3K4B A;  3JRH A;  1ELO A;  1BA5 A;  4KKS A;  2BM6 A;  1LEA A;  3W2V A;  4BS9 A;  3P4G A;  2V79 A;  2VLA A;  1KA8 A;  2VNJ A;  4KUM A;  2XAH A;  2KQR A;  3G71 B;  4C2L A;  3FJO A;  4C2M J;  3LSI A;  2H8W A;  5M5Y J;  4Q5S F;  5HXB A;  3TDZ C;  2J7K A;  5B1B H;  1UD8 A;  4M9S A;  3W5H A;  2YSR A;  3JTH A;  1FRQ A;  3QYF A;  2HOA A;  2KZG A;  3HUG A;  4OZY A;  4QLC U;  5LGT A;  2K9N A;  2O9L A;  4J00 A;  2ZZF A;  4ZTJ A;  3QOP A;  2Y48 A;  5DCF A;  4C30 A;  5JFR A;  1VQO I;  2Y0S A;  1KYW A;  1EH6 A;  2L9R A;  3GWZ A;  3LQQ A;  2DOE A;  1OLT A;  3N05 A;  1TWC J;  5IOY A;  2DXI A;  5H5J A;  5CJ9 A;  4F7D A;  2V6C A;  2KKO A;  2L01 A;  1JHH A;  4OPV A;  3DU5 A;  4GRI A;  1GXQ A;  5FD5 A;  2QTZ A;  4DNR B;  2WJV A;  2ELK A;  1WH5 A;  4N4N B;  2NST A;  1R6R A;  1G3Y A;  4Y15 A;  1GXP A;  3A03 A;  5LHG A;  4P55 A;  5B5E C;  5LRS A;  1VQK I;  1TLH B;  2L4A A;  4RGS A;  2UXX A;  4AYB N;  3IRR A;  1XC5 A;  3Q9V A;  3LFK A;  1BPL A;  2YU3 A;  1COW A;  2DEU A;  3JUR A;  5J40 A;  5J8F A;  2V1N A;  3CXC B;  5JVT A;  1T0F A;  3H0G J;  2BN4 A;  4RS8 A;  4N3G A;  3WND A;  2XAS A;  4ZYA A;  1R5I D;  3FK7 A;  5IP7 J;  1U8R A;  3A01 B;  3CJT B;  2HFH A;  1M1E B;  1IRX A;  1W0U A;  3D5R C;  4NCN A;  4WF2 A;  4N3N A;  1YI2 I;  2C4T A;  1ON1 A;  2V7W A;  2GLO A;  2VNK A;  1W35 A;  4B4D A;  2JRM A;  3MQ0 A;  1TVC A;  2X3H A;  2XAQ A;  3F8B A;  2VQL A;  2IA0 A;  2M3A A;  5FO0 A;  4IKF A;  1K6O A;  5EJC A;  2ZTG A;  1VQ7 B;  5F1J A;  1VQ4 I;  2EFP A;  1X3U A;  4ZGQ B;  3J7Y J;  1WJC A;  2DA1 A;  2DTR A;  3BG7 A;  4DK1 A;  1P7I A;  1A36 A;  1VQ8 B;  4AIH A;  3R0A A;  2ECC A;  4WXD A;  1VJS A;  3S2W A;  2HI3 A;  5JHU A;  3WXM A;  2V26 A;  3E1Y E;  4YXW A;  2BM5 A;  2M8G X;  3BQY A;  4HDV A;  3WNB A;  2B7C A;  5E3L A;  5KVR A;  2WBM A;  4ZJZ A;  2WPD A;  1OFM A;  2EFW A;  3B02 A;  3QAH A;  2DFE A;  2LZJ A;  1I7P A;  3OL4 A;  1IN8 A;  1KK2 A;  4HWV A;  1D0Z A;  1X58 A;  3FHN A;  1DAB A;  2ZBU A;  1S7O A;  4RD3 A;  4OJ6 A;  1OPC A;  4HA8 A;  1Y0Y A;  2HOT A;  3GCM A;  3F72 A;  4RD6 A;  1E3H A;  2DOF A;  1WSV A;  3I3L A;  1CQT A;  3ZMT A;  1B2R A;  1QA3 A;  1SEU A;  2UZK A;  1POG A;  2Z6B D;  3CCS B;  3VSV A;  1TQM A;  2NT6 A;  5IYP A;  2AO9 A;  2XC7 A;  2XKO A;  1IF1 A;  4HST A;  5FO1 A;  2QSF X;  4UUT A;  2G7H A;  3GTL J;  2FOW A;  4AM3 A;  4JMQ A;  1PXZ A;  2G0E A;  4WZL A;  3BH6 B;  3COA C;  4CXF A;  2CRV A;  2W00 A;  4DZJ A;  1NG7 A;  1WVR A;  2PMD A;  1LLW A;  3W3C A;  2L7K A;  3RTR A;  4II3 A;  2LYC A;  2RC4 A;  3PEN A;  2F5C A;  2PN6 A;  5E18 F;  1BN5 A;  1XFO A;  1LDK B;  1JA0 A;  3QPL A;  2V4J C;  4B48 A;  1W5T A;  3Q0W A;  2PEX A;  4BDZ A;  4U7B A;  5GPA A;  1AKH B;  2GBY A;  2P0W A;  2YX7 A;  3LSG A;  2ISZ A;  2DY1 A;  3BG3 A;  3L2W A;  3OYK A;  3Q39 A;  3HGG A;  3X2Q H;  2AHQ A;  1Z05 A;  3ZQC A;  1IGN A;  4ZDO A;  5TR9 A;  4XID A;  3PO2 J;  1FIP A;  3LQ6 A;  5E3N A;  1Y56 A;  3QP6 A;  3MKW B;  1PLU A;  3CO6 C;  2OU2 A;  1T6S A;  3DFG A;  3SJZ A;  1LM1 A;  1Z6T A;  3CME B;  4FHT A;  2C6Y A;  4A6E A;  2J5P A;  4IHW A;  4M2L A;  1XSX A;  1YLF A;  5A2Q K;  1H8H A;  3KP4 A;  2X9D A;  4P26 A;  2CSO A;  3PUF A;  2XUB A;  4IHS A;  1PJ7 A;  4K1X A;  2HWV A;  4AF6 A;  2FXA A;  4WXC A;  3LA2 A;  5JLV C;  3Q0V A;  3U9G A;  2CUE A;  3VMF A;  3S32 A;  4L5I A;  3BT9 A;  3GF2 A;  4HNV A;  4E7K A;  3NB2 A;  2M2E A;  1FNM A;  4M6X A;  4YDT A;  2DPD A;  5LRR A;  1R58 A;  1V55 H;  2OPT A;  4PGH A;  1VQ7 I;  2ADU A;  2AXL A;  4FK8 A;  4LBV A;  2INV A;  3W2H A;  5HZB A;  1VI0 A;  1MBJ A;  3GQB A;  2L2O A;  4ZYH A;  3AST A;  2KRC A;  1O3R A;  4BXF A;  2VBY A;  2VFQ A;  1VQ8 I;  4YAW A;  3K10 A;  3W2F A;  3LA7 A;  5C44 J;  3GVJ A;  5D5W B;  2X6Y A;  4PFO A;  3RKY A;  1TQI A;  1H9T A;  1QGZ A;  2OBP A;  4Z4U A;  4NNJ A;  1W36 D;  1TTY A;  3BC8 A;  2Q6K A;  4TT3 A;  2GRE A;  3SZT A;  4CCM A;  3HOV J;  1RU4 A;  4LD5 A;  2ZFU A;  2BY0 A;  1WFX A;  2QQ8 A;  2Q2E B;  4OWR B;  1MH4 A;  3TP0 A;  4D7N A;  3VSU A;  1HVX A;  4OZZ A;  4XN0 A;  4FCY A;  1OFL A;  3A8J A;  3J7Z I;  5F0F A;  1SKY B;  3KIO A;  4X7E A;  1ZRC A;  3KX2 A;  3D0S A;  2HZT A;  3BY2 A;  2Z3Y A;  1S7E A;  1B8I A;  4Z03 A;  1I39 A;  3OOU A;  4X05 A;  2X0L A;  4RA2 A;  5IYQ A;  4B47 A;  1E3X A;  4M3F A;  4EVI A;  2E60 A;  3DEE A;  3RKW A;  3WBK A;  3CF5 F;  3KP3 A;  1JJ2 B;  4BJT A;  3W6V A;  5HDK A;  1TYV A;  1U8B A;  5F4O A;  2WY8 Q;  1ODD A;  3C7J A;  3EQO A;  2DOG A;  3PFY A;  2WR8 A;  4XN3 A;  2KMU A;  4RGR A;  1Z7U A;  3ECO A;  4E7Z A;  2RKH A;  2CGP A;  2DMU A;  1IUF A;  2YPR A;  1D8T A;  4YG2 F;  2CH0 A;  2DMQ A;  3F8F A;  4E7L A;  2R7W A;  4XL9 A;  1F9N A;  3G1M A;  3LFU A;  2X3U A;  5DCM B;  3CMY A;  4CYD A;  3E5X A;  4LIT A;  1AKH A;  2Z16 A;  5KW9 A;  4L9T A;  5F0H A;  1SM4 A;  2K85 A;  3RPU D;  3Q3A A;  3QFR A;  1OCZ H;  4BY1 J;  3ASR A;  4F55 A;  2COB A;  2VFP A;  3OYA A;  2W82 A;  1E63 A;  2E2I J;  2HEO A;  3EUK L;  1WPC A;  4A5N A;  3WY9 A;  5TY0 A;  2I5U A;  1OFC X;  2R7D A;  3ZP5 A;  2STW A;  1XMA A;  1X1D A;  3LSJ A;  3SHF A;  3QRF F;  4AUX A;  1QA6 A;  3CJN A;  2O6G E;  1YX5 A;  1D0Y A;  5THX A;  5DUI A;  3BCD A;  2HQA A;  3FMS A;  5KSW B;  3LMW A;  1V4R A;  3H9J A;  2JTV A;  2HQ5 A;  2OZ6 A;  4M3B A;  2JPC A;  2BVN A;  4TN1 A;  3VO2 A;  3EPZ A;  2I1L A;  5IT9 Z;  3CCL B;  4M53 A;  3GLL A;  2KJB A;  4PAB A;  1UMQ A;  2LC2 A;  4EM0 B;  3BR1 A;  1QGA A;  2NSP A;  3ZZ0 A;  1X3Z B;  1Y0R A;  4PC1 A;  2O5R A;  5CYV A;  4LLG F;  3CRZ A;  2ZZE A;  4OJP A;  1EJ9 A;  5FO5 A;  3QPH A;  3GTG J;  4MEY F;  1XGS A;  2ACJ A;  3N4M A;  1OR7 C;  1YQA A;  3CUO A;  2R7T A;  4IHY A;  3CD6 B;  1PE9 A;  4U49 A;  2A69 F;  3TL4 X;  3LJY A;  2GAU A;  2MG4 A;  4FTH A;  1BQE A;  3ZMZ A;  4RPB A;  1SVL A;  2XC1 A;  3DPU A;  2RQP A;  3H9G A;  4I7H A;  4BAY A;  1F4K A;  3GTJ J;  2O7O A;  4ENK A;  4L5E A;  3BCA A;  1AIP A;  3JQR A;  1R23 A;  2NRA C;  4UZF A;  3CC4 B;  2LFB A;  2ME6 A;  2V31 A;  1HKS A;  1G7S A;  2FNA A;  5F27 A;  2HMA A;  2Q2E A;  4ETS A;  1D1C A;  1OGJ A;  3ES9 A;  3ASS A;  2AQE A;  4IW3 B;  2XF5 A;  3S1M J;  1ZEL A;  4HNT A;  1OHH A;  4YZX A;  3H09 A;  5CVI A;  3E6D A;  4A93 J;  1ZR4 A;  4OMY A;  3HSR A;  1O7L A;  3L00 A;  4LG3 A;  4U9U A;  3MZ8 A;  1F1Z A;  4CUG A;  1T39 A;  4OJL A;  3IWZ A;  3OP1 A;  2X8K A;  1CLW A;  4YEL A;  3AG2 H;  4IVN A;  3PSI A;  4OOV A;  1QBJ A;  3KEW A;  1TBX A;  3MCZ A;  4G9Y A;  2HZD A;  1IXS B;  3PNY A;  3OYN A;  1UHW A;  1B72 A;  5FB2 A;  4ENM A;  3GVK A;  4Z1M A;  2Z9O A;  2V7U A;  3CCE B;  1H8A C;  4UXN A;  4C9Y A;  3CZ6 A;  4U88 A;  3ZQQ A;  1T6Z A;  2KRF A;  3W6K B;  2OBR A;  1Z3Y A;  9ANT A;  4MYT A;  4WWV A;  3TDU C;  2TCT A;  1HBX G;  1BLI A;  2VQG A;  2BW3 B;  3W5U A;  4YC5 A;  1FIA A;  1SFX A;  3PSF A;  4PC6 A;  3W2G A;  4DOZ A;  2BM0 A;  1O8D A;  3SZP A;  2ODL A;  1JT6 A;  3CJR B;  3SQN A;  3SYT A;  2DMP A;  3ZOB A;  3J7A Y;  2VJ4 A;  3BPX A;  2LMD A;  1FMV A;  2BVL A;  3FZV A;  3IHU A;  5L3E A;  1N05 A;  4E0F A;  3OYL A;  1TWG J;  2W6J A;  3ZUG A;  3K4C A;  2WZN A;  3B78 A;  3H9N A;  3W2A A;  1JKR C;  1YS6 A;  3RPU A;  1TP4 A;  1FP2 A;  2DTZ A;  3JCU C;  4BU2 A;  1J9Z A;  4A3G J;  3SEJ A;  3ERE D;  3MZH A;  3KYD B;  5IT3 A;  1ZRF A;  2V7Q A;  2P7C B;  4ESB A;  3L2R A;  1FYM A;  4KKU A;  1JUP A;  2E19 A;  2QMU A;  1QVF B;  5C1C A;  1OCP A;  4FQG A;  3OMY A;  4XSZ F;  1RWR A;  4PCQ A;  3CCL I;  5E3M A;  3BWG A;  3K2A A;  3GZN B;  5L3F A;  1S0U A;  4U4B A;  2D1V A;  2QTL A;  3F3X A;  4BHC A;  1MMS A;  4PC7 A;  2V7X A;  1E0E A;  4ZCI A;  3OWT A;  3NAW A;  4XKW A;  3S1Q J;  2C78 A;  1Y0U A;  2P8T A;  4HE6 A;  3VDX A;  2W6I A;  3HJE A;  4W1U A;  4C3J J;  3T9G A;  1Y8R B;  2F48 A;  2GK7 A;  2V9V A;  4WZE A;  4OM9 A;  3H0D A;  3WGH A;  4E7S A;  3CD6 I;  2PIA A;  1TT5 B;  5BPI A;  3CCQ B;  2BYV E;  1MW7 A;  2A5Y B;  3U6K A;  1FBS A;  2QKM B;  1SAN A;  3EYY A;  2ZL5 A;  3G3Z A;  1ZTR A;  2Y75 A;  3VYS B;  5E17 F;  1JUS A;  2XZP A;  5H59 A;  4IZZ A;  3S8P A;  4G1V A;  2ELJ A;  2FMY A;  2VQH A;  4AVP A;  4YCQ A;  1RNL A;  1VQP B;  3PUN A;  2KT0 A;  2BV3 A;  3V7A A;  3CC4 I;  4ZCL A;  4O5V A;  5J3L A;  2E2J J;  1NG6 A;  2KRH A;  2IGN A;  1MSF C;  5B3S H;  2K5C A;  3B73 A;  4ENJ A;  1PVE A;  1WOO A;  3Q6R A;  3CF2 A;  4XLH A;  5ICC A;  5D6F A;  2OBT A;  1E62 A;  2PBI A;  4NK6 A;  2EZL A;  3K1N A;  3O3K A;  4WCG A;  2WSS A;  2EB7 A;  3OY9 A;  3ZIA A;  1O8F A;  2XAJ A;  3OIO A;  4S04 A;  4XM3 A;  1YHQ B;  2Z8G A;  3RKX A;  1PKV A;  1RIO H;  3QFT A;  5F08 A;  5H20 A;  2K40 A;  3HAG A;  2E1O A;  1R49 A;  4C2T A;  3JRD A;  1IC8 A;  1QPI A;  3KZZ A;  5K7F A;  4HQE A;  4NC8 A;  1QPM A;  3WTU C;  3BG5 A;  3EDP A;  3CCE I;  1ZM2 A;  1QGY A;  4EQQ A;  1OKR A;  4PJM A;  4AC0 A;  3V8K A;  2PFB A;  2WAD A;  3VYR B;  1XB4 A;  4Y4R A;  3P5J A;  2V4D A;  5ILU A;  4P22 A;  3R0J A;  1KU3 A;  4YFK F;  1HKT A;  2BVM A;  4OAZ A;  4BQN A;  3M4O J;  4WZK A;  3L2U A;  3T56 B;  1LE8 B;  3G6E B;  2IS2 A;  2ZFW A;  2DT7 B;  4AVZ A;  5K5Q A;  1LFU P;  1J9I A;  2DO7 A;  3ZN1 A;  2R92 J;  2W4S A;  4E6K G;  4ESJ A;  1MMD A;  2QEX B;  2FBH A;  1PJ5 A;  3K0L A;  1W1W E;  2EIN H;  3KET A;  1D5V A;  4XSX F;  1ITY A;  2ZZQ A;  2BM4 A;  2W57 A;  2O17 A;  1S6L A;  2QA4 B;  2L7F P;  3G2B A;  1RR8 C;  4MFD A;  5FLV A;  3UNG C;  3VB2 A;  4B3F X;  1QHG A;  2KIF A;  2DW4 A;  1KU7 A;  1IN4 A;  2JJ1 A;  4Z4R A;  3CCU B;  2KIU A;  1EH7 A;  3ZZU A;  1JUM A;  3ROU A;  3LSK A;  4ANJ A;  2V1X A;  3DEU A;  3HRT A;  1VQ6 B;  2QM3 A;  5D4S A;  5TV2 A;  3HBL A;  2BSA A;  2VBE A;  3SUC A;  4DQL A;  3LL7 A;  5DN6 A;  4Y13 A;  2DDB A;  4MTE A;  4Q47 A;  3HRU A;  3BRO A;  1QQI A;  2PI0 A;  4RB3 C;  2Q6I A;  2BSP A;  1DUX C;  1IDJ A;  1RKW A;  4RDL A;  4OIN F;  4KIC A;  1W34 A;  2H6C A;  1J0R A;  1SFE A;  3V8J A;  2K4J A;  3R61 A;  1QGP A;  1YYV A;  3BTJ A;  2QYU A;  1FY7 A;  2KDZ A;  4IL6 C;  3AGQ A;  3O8G A;  3ZRG A;  2JA7 J;  4OPW A;  1NK3 P;  3OL3 A;  2GA1 A;  3CCQ I;  1TL8 A;  2QZA A;  1YRN A;  1E3Z A;  3TW6 A;  4B3G A;  2UXN A;  1DBG A;  3GZ5 A;  3ONU A;  5JMC B;  3DP7 A;  1VHE A;  5IT9 K;  1Q1H A;  1GVH A;  1E64 A;  3CJQ B;  3ASN H;  4X8I A;  5IOZ A;  4WZT A;  1BL0 A;  3IC7 A;  1K79 A;  5IP6 A;  1VQP I;  1WJB A;  1JKO C;  1AIR A;  2Z5U A;  1ZK8 A;  3BG9 A;  1KJZ A;  2PMZ N;  4BE2 A;  2DPU A;  1TZL A;  2HYJ A;  3DTK A;  4JX6 A;  2OYN A;  2XTX A;  4HV6 A;  1LFB A;  2NOJ B;  2OQR A;  3NWS A;  1V0E A;  2XOK A;  4ACA A;  3SKB A;  4HLX A;  3I53 A;  1XG2 A;  4IHX A;  4P3I A;  1Z3X A;  1SD6 A;  2VXZ A;  1OB2 A;  4L18 B;  4NQW A;  1WH7 A;  3OZU A;  5J3O A;  3T8T A;  2FSW A;  4GO1 A;  3SDG A;  3ECH A;  4V2G A;  1JKP C;  3HB9 A;  3AG4 H;  4A3M J;  3TW7 A;  4G7Z F;  1WOS A;  3AGP A;  1H89 C;  1YHQ I;  2R5Z A;  1UD4 A;  1I3A A;  1J75 A;  2JSC A;  3PM1 A;  4PJL A;  1Q81 D;  5FL7 A;  1P2F A;  3A02 A;  1VBL A;  3H3Z A;  4WX9 A;  1MJB A;  1V54 H;  2NVQ J;  2O61 A;  2WA0 A;  2PYH A;  2ESH A;  3P26 A;  5HNF A;  2V7T A;  4X07 A;  1P4X A;  5F6F A;  2IA2 A;  3VEP A;  1I6H J;  1KU9 A;  4JQF A;  1T08 B;  3SFZ A;  3WTT C;  1ZLJ A;  4HLY A;  1JJ6 C;  1RQP A;  2HR3 A;  2PYG A;  1U78 A;  2E1M C;  4DK0 A;  2K4B A;  2A5W A;  1FEX A;  3VWB A;  1F36 A;  2DDA A;  5HLI A;  2X85 A;  1JT0 A;  3GSI A;  1F5T A;  1U2W A;  1BC8 C;  1RR7 A;  4UVC A;  1I50 J;  3FM5 A;  4XNF A;  3ZQG A;  4E7J A;  3KL9 A;  2X4H A;  2D5V A;  3AVX A;  2M9H A;  2H09 A;  1XSV A;  2XRO A;  2QEX I;  4B3A A;  5E8G A;  1QH0 A;  2WZP P;  3M07 A;  4EM2 A;  1FOW A;  2QA4 I;  3WNC A;  1BM9 A;  4NC7 A;  3WYA A;  2CS3 A;  3S3O A;  2EZI A;  4ROX A;  3OOP A;  2E7W A;  3CCU I;  2J5O A;  1FMW A;  3C1D A;  2WAE A;  5KNL A;  3RKQ A;  3DKX A;  1XQB A;  1K7A A;  1ZQ3 P;  2NTP A;  1VQ6 I;  1E17 A;  3MMP A;  2VQC A;  1PYV A;  4LK0 F;  5FLX Z;  3VST A;  4D7M A;  1W0J A;  1WU8 A;  2BF4 A;  4BHB A;  2MD5 A;  3OZW A;  1T0F C;  1H8E A;  1X4P A;  4XLA A;  1JHF A;  3BJA A;  1SD7 A;  1XMK A;  1ZGA A;  2B9S A;  1A31 A;  2VFN A;  4PMH A;  5GV8 A;  1EFU A;  2BZT A;  2LF7 A;  4EGZ A;  2EFG A;  4HE5 A;  4DQ2 A;  4RM3 A;  3CMM A;  2ZIT A;  2HDW A;  1FP1 D;  2O8X A;  5BMZ A;  3B4N A;  2EV0 A;  2ELH A;  3HTS B;  4NHJ A;  2CQX A;  2J8K A;  2XVC A;  4PGO A;  2NPF A;  3K1P A;  3MZY A;  5J6X A;  4FN5 A;  4PC3 A;  4RM2 A;  2CV1 A;  2Z1D A;  2VFO A;  4HDU A;  2YS9 A;  1K61 A;  1MJ9 A;  4FE7 A;  1RI7 A;  3LST A;  4CZZ A;  4WXH A;  5ILV A;  3C2G A;  4HX7 A;  2XF6 A;  4HX4 A;  2ZJ2 A;  3ZQL A;  2JUC A;  1MDM B;  3BR3 A;  2RQQ A;  2OK8 A;  1HA8 A;  1QRY A;  3OJW A;  1R5B A;  4MO7 A;  3JRC A;  1AU7 A;  4IXA A;  1IN6 A;  2D74 A;  1I18 A;  2F4I A;  4E4H A;  2QY1 A;  2NVU B;  3C18 A;  4EW9 A;  2CW8 A;  3G05 A;  3ZPL A;  3WU2 C;  3PQJ A;  1HKQ A;  2DJN A;  3DKW A;  5M5W J;  1ZR2 A;  1KQS B;  3RPQ A;  1R5H A;  1NHC A;  4Y52 J;  1FYK A;  2VBT A;  4YZQ A;  4U0V A;  3F6O A;  2EA4 A;  3GQ9 A;  3K2Z A;  1VLY A;  3PSZ A;  4I76 A;  5ILS A;  3LVB A;  2F4O B;  4XKV A;  4EH1 A;  4CCO A;  3BG6 A;  2P7V B;  3CCR B;  2P5V A;  2AS5 F;  2PLF A;  3UW0 A;  2NNN A;  2D45 A;  2V7V A;  5ICF A;  1TWF J;  2P5K A;  1XSD A;  2QZ8 A;  2VC0 A;  2HVS A;  2OK7 A;  2HYG D;  2F1L A;  1LKX A;  3B90 A;  2E1R A;  1K8F A;  1HOM A;  4HF1 A;  4L0Y B;  4P1V A;  4ZZL A;  2O8K A;  2EZH A;  4XOP A;  2NVY J;  3KE2 A;  2DBB A;  5E1X A;  1FBQ A;  2C4U A;  1E2X A;  4HQM A;  2I10 A;  5DD8 A;  2GJP A;  2GQF A;  2IGM A;  5D5U B;  1JRG A;  1KQ0 A;  2LVS A;  2X53 S;  2ZTN A;  3ML3 A;  2HXI A;  4YEI A;  2L54 A;  2DI3 A;  2ZNZ A;  3CDH A;  1IHM A;  3K4L A;  2HU9 A;  1X19 A;  2W48 A;  4IHV A;  2NOG A;  5HKK A;  1D8J A;  1LVK A;  1HA3 A;  4HPQ A;  4RDK A;  1YX3 A;  3FDY A;  1MBK A;  2A6T A;  4PJ0 C;  1BW5 A;  4P5O A;  1FOY A;  2OZU A;  1DPR A;  3CP2 A;  3DPL C;  2DFF A;  1UCR A;  1K83 J;  4F7Z A;  5JR3 A;  4X0G A;  1GDT A;  2HDN B;  2EZK A;  4BJ6 C;  1UD5 A;  2LKS A;  1SMY F;  2KIS A;  2F4M B;  2JPB A;  3ZMU A;  4QHY A;  1VQN B;  3NRV A;  1V5G A;  1N77 A;  1R9T J;  2BY2 A;  2JWT A;  2VON A;  2WB1 A;  1O3S A;  1E3O C;  4HOB A;  1MAB A;  1QCX A;  1I1G A;  4CA0 A;  3DPT A;  3DWL E;  4XR6 A;  1A8P A;  1Z77 A;  1E1Q A;  2HVQ A;  1XTA A;  4A69 C;  4G12 A;  4YIR X;  1LVA A;  1YX2 A;  2CW5 A;  2ZJP F;  4IO9 F;  2IRF G;  1RQR A;  2LF8 A;  3SY2 A;  3NWT A;  4I0A A;  2BHY A;  1ZGW A;  2CU7 A;  1Q82 D;  2L5Q A;  2GZW A;  4G7W A;  4QTR A;  2FX0 A;  1EFR A;  2PMH A;  1DBO A;  2XGC A;  4Y33 A;  3H1C A;  2PLY A;  3BNW A;  1ZN2 A;  1IDK A;  1VQ5 B;  4P6V F;  5AN9 A;  3H5A A;  5EG0 A;  1B8I B;  3GIR A;  2P6S A;  4Z4T A;  1Z6R A;  2XSJ C;  4MNU A;  4RD1 A;  1J5Y A;  2M45 A;  4BY7 J;  5LGN A;  2V1D A;  1VQM B;  1DP7 P;  4RDU A;  2K9L A;  2RV8 A;  3QPT A;  2A61 A;  3F23 A;  4XON A;  3S15 J;  4CO8 A;  2QUF A;  1IJW C;  3OJX A;  5DM7 F;  4W8Q A;  3ZMS A;  3T51 B;  3DU1 X;  3AKZ A;  3HSE A;  3DF8 A;  3FY3 A;  3G71 I;  3ZQ7 A;  3BJ6 A;  1MDM A;  2EWE A;  4KN4 X;  4X7C A;  3WTV C;  3HM5 A;  3LOC A;  2X0K A;  3FPP A;  1VQL B;  4B09 A;  4P3Y A;  5ERI A;  4G94 A;  3RDI A;  1GUU A;  2EIJ H;  4UHT A;  4QPQ A;  2DA2 A;  4BAC A;  2G9W A;  2IT0 A;  3S2D J;  2R7F A;  1XMX A;  1KK3 A;  4LGW A;  3CCR I;  1R5O A;  1OCT C;  5D5V B;  5EZH A;  1JGS A;  3TKY A;  2K3F A;  4A0Z A;  2YWF A;  1O57 A;  1TSP A;  3SEQ A;  3M8J A;  3T53 B;  1O8J A;  2XNC A;  3I9V 2;  1BI1 A;  3IUO A;  3PVD A;  1K4Z A;  5B66 C;  4A5M A;  2ZL7 A;  3KRG A;  2HPI A;  1K4S A;  1BMF A;  3OW7 A;  3S1N J;  5CDF A;  1YG2 A;  2ZC2 A;  1MJA A;  1RMG A;  5FLM J;  2W7Z A;  2IXS A;  1VQ9 B;  2NS7 A;  3CCY A;  1WXR A;  2LKP A;  4M6V A;  1L3L A;  2QQ9 A;  3NAR A;  4O3M A;  1OCO H;  3DKY A;  3FMR A;  3U2R A;  3DBR B;  2DER A;  2JQ7 A;  4E70 A;  1QRB A;  3E3V A;  2E35 A;  2DA7 A;  2YWH A;  2MC3 A;  4ZDP A;  3OPO A;  2L9N A;  3I54 A;  3E6B A;  1FNB A;  1S5L C;  1T95 A;  1YS7 A;  4HV5 A;  4IJA A;  4F52 A;  2YX4 A;  3GQA A;  2INU A;  4AC9 A;  1A6I A;  4LG0 A;  1TW3 A;  2CMP A;  2XPW A;  2FJ1 A;  3ML6 A;  4RAG A;  5GTI C;  4MTD A;  1W9X A;  2WAQ N;  2DT6 A;  1HSJ A;  4ZCM A;  2ZKZ A;  3S14 J;  1ZH5 A;  1GVD A;  2FQ3 A;  3W2I A;  2VKV A;  3BZC A;  3IAS 2;  3KEQ A;  3FX3 A;  5AON A;  2ZNY A;  5E1W A;  4CCL A;  1VQN I;  1GAQ A;  2W7N A;  2QWW A;  3OYD A;  4KN7 X;  2CV0 A;  1ZGJ A;  2EH3 A;  4A3K J;  1JJ8 C;  3S3N A;  4KA4 A;  3VO1 A;  1WI9 A;  1M90 D;  3HOW J;  1R5G A;  3QOD A;  3S3M A;  3AG1 H;  5J4Y A;  4KNY A;  1A5J A;  1IV8 A;  2MSY A;  1IW7 F;  2MH9 A;  1XN7 A;  1RZ4 A;  3F8C A;  2DA3 A;  3HOT A;  1GT0 C;  4ZV4 A;  1IA5 A;  1UAA A;  3H9Q A;  2VBS A;  3PNT A;  2ZJR F;  3HOS A;  3GX4 X;  1FJL A;  1VQ5 I;  5FLX K;  3DCF A;  2W84 A;  3M7G A;  1O8L A;  3GO5 A;  1UHM A;  2UVF A;  1EP3 B;  2Q6L A;  1TT0 A;  3A1P A;  1FX0 A;  1VQM I;  1TYW A;  5C3E J;  1VF9 A;  4IOA F;  3CCS I;  3DBL B;  4EAT A;  3FXU A; 
#chains in the Genus database with same CATH homology
 1VZ0 A;  2CV2 A;  3W2A A;  3NE5 B;  4CSW A;  3HXL A;  4BU2 A;  3VYT B;  3JU4 A;  4BQQ A;  4KKT A;  4TSF A;  1W36 C;  4U49 A;  3VSV A;  3D5S C;  1K6Y A;  1MND A;  2UWM A;  3OFN A;  2V7Q A;  2KLO A;  1NBM A;  5HOO A;  4BEH A;  3L2R A;  4KIS A;  4KKU A;  4BE0 A;  3PL8 A;  2XAU A;  3OR2 C;  2LH9 A;  3HC7 A;  3SEZ A;  1DGR M;  1D1B A;  1E1R A;  3OAA A;  5C1C A;  1O8H A;  4BDY A;  2VJI A;  2IGO A;  3OMY A;  1JTA A;  1D0X A;  1RWR A;  4OJO A;  4XLE A;  2E1M B;  1QJV A;  1O8E A;  2IGK A;  5C1E A;  4PFP A;  2E1B A;  4R79 A;  3HUG B;  4U4B A;  3DQV C;  2VJJ A;  1E0E A;  3OWT A;  4XOR A;  1E79 A;  4XKW A;  1V0F A;  3MKY B;  3OEE A;  3A4C A;  3VDX A;  2W6I A;  1BOB A;  1O8M A;  3T9G A;  2VPL A;  2MFZ A;  4G7X A;  2GK7 A;  4XOT A;  3AL0 B;  1Y6I A;  5CKT A;  2XF7 A;  4RLF A;  4E7S A;  3H0D A;  2NTQ A;  1MW7 A;  4F93 B;  1UG0 A;  2KP6 A;  2QKM B;  3A1Y A;  4DIQ A;  4RLQ A;  3VYU B;  2Z2S B;  3VYS B;  4BEH B;  2XZP A;  2F43 A;  1KON A;  3S8P A;  4IZZ A;  2ELJ A;  2VQH A;  2R7Q A;  3OYH A;  4FAS D;  4C2U A;  4W8S A;  4IX7 A;  1P9Q C;  4XKC A;  3L2V A;  3OYE A;  3BCB A;  2FUG 2;  1HZE A;  1DP3 A;  1NG6 A;  2KRH A;  3OIP A;  1KCD A;  2IGN A;  3AFH A;  2GJR A;  2K5C A;  3EUA A;  1OGM X;  1PJR A;  2L9S A;  3CF2 A;  3TMO A;  4XLH A;  3BLY A;  4U87 A;  3K4N A;  4B43 A;  3AL0 C;  1UD3 A;  2KDO A;  4NK6 A;  3OS0 A;  4BQO A;  3VSK A;  2WSS A;  2LBF A;  3OY9 A;  3GRH A;  3ZIA A;  1O8F A;  2Z8G A;  4XM3 A;  2LRD A;  3DTE A;  4H4K C;  1PKV A;  2WAQ A;  2M7A A;  2PEC A;  4DBR A;  5FRO A;  3HAG A;  1Z21 A;  4C2T A;  4L8J A;  3B8Y A;  4HRI A;  4NC8 A;  3EQN A;  3LNN A;  5CQG A;  2IS4 A;  1V5E A;  2KL4 A;  4PJM A;  1T5E A;  2IQ7 A;  1O8K A;  2WAD A;  3VYR B;  3OR1 C;  3ZGK A;  4Y4R A;  3DLA A;  3RSN A;  1BR1 A;  5LFA A;  3K70 C;  2V4D A;  2QXZ A;  4P22 A;  4E7H A;  3A3G A;  3LSH A;  1MNE A;  2BVM A;  3PUB A;  4OAZ A;  4HSR A;  4BQN A;  3L2U A;  5LD2 C;  3T56 B;  2IS2 A;  4AVZ A;  2DT7 B;  1OOC A;  4HG2 A;  2VL8 A;  2W4S A;  2CUZ A;  4E6K G;  1MMD A;  4CZC A;  3ZPP A;  2CUJ A;  2DJI A;  2UUZ A;  2ZZQ A;  4DNT B;  1X1B A;  4B44 A;  2O17 A;  1WP6 A;  2KHM A;  3G2B A;  3W2W A;  3UNG C;  4JOM A;  2KZV A;  1QHG A;  2IS6 A;  4B3F X;  2JJ1 A;  1N75 A;  4J01 A;  2UV1 A;  3LSK A;  3K4K A;  4ANJ A;  3OYB A;  3K4B A;  5TGT A;  3L2Q A;  4KKS A;  4YRV A;  2PJR B;  2VBE A;  4G6I A;  3SUC A;  2MC4 A;  3W2V A;  3LL7 A;  4BS9 A;  2VLA A;  2VKH A;  5DN6 A;  3E0J B;  2JVG A;  2KQR A;  4RMN A;  4C2L A;  3LSI A;  2Q1Z B;  2F6C A;  2BSP A;  1IDJ A;  1BN8 A;  1UD8 A;  2UVE A;  2OV7 A;  2V7F A;  3QYF A;  4OZY A;  2LY1 A;  4FXU A;  2WY7 Q;  2X1E A;  4II2 A;  4J00 A;  2R7U A;  3ZRG A;  4ZTJ A;  2ZZF A;  1EA3 A;  4C30 A;  4D9J A;  3OL3 A;  2Y0S A;  4QPO A;  4B3G A;  1E3Z A;  1OLT A;  3N05 A;  1GLN A;  4PUS A;  2E5N A;  2DXI A;  1DBG A;  2GOX B;  3FBI B;  1J09 A;  2X51 A;  2CK3 A;  3CJQ B;  3DU5 A;  4GRI A;  4DNR B;  3BCF A;  2WJV A;  4P1W A;  3HKZ A;  4XD7 A;  4N4N B;  1WJB A;  1R6R A;  4BGD A;  1AIR A;  2NST A;  1K28 D;  3IP4 B;  4BE2 A;  1TZL A;  3DTK A;  2VXD A;  1WJA A;  2E5Z A;  2LY2 A;  5HLT A;  3V42 A;  1YE9 A;  2NOJ B;  3NWS A;  3TBI A;  1V0E A;  2XOK A;  1G8X A;  1XG2 A;  3WWG A;  4G6T B;  4OAY A;  1Z3X A;  2V6E A;  1BPL A;  2VXZ A;  1COW A;  3JUR A;  2K9M A;  2K3P A;  2X6W A;  2V1N A;  1WJD A;  4HIZ A;  4PSX A;  2XZO A;  3GVL A;  1OB0 A;  4ZYA A;  3GQ7 A;  1QU3 A;  2M7B A;  5JHF A;  1BHE A;  1UD4 A;  3KEY A;  4CCJ A;  1IRX A;  4PJL A;  3D5R C;  2VAS A;  4E7I A;  5FL7 A;  2DOA A;  1E43 A;  1VBL A;  2X3H A;  4N4O B;  3CES A;  2VQL A;  2MAB A;  2M3A A;  2WA0 A;  2RRE A;  5CQE A;  2PYH A;  5HNF A;  3KYL A;  4IKF A;  4F91 B;  2ZTG A;  2CW7 A;  4MXN A;  4JQF A;  1X4O A;  2PYG A;  2E1M C;  1WJC A;  3BG7 A;  4DK0 A;  4DK1 A;  2A5W A;  3VWB A;  2X85 A;  2NT9 A;  1MMG A;  2LOO A;  1VJS A;  2QX3 A;  3SDB A;  4KIT B;  4W8T A;  2V26 A;  4YXW A;  4XNF A;  4E7J A;  1X1C A;  4NQW B;  3FBN B;  2WBM A;  4ZJZ A;  2WPD A;  1OFM A;  2VJ5 A;  3OIQ A;  2LZJ A;  2WZP P;  3OL4 A;  4XQF A;  4HWV A;  1D0Z A;  4AU7 A;  4BUP A;  3FHN A;  4W8R A;  2R7R A;  4ZDL A;  4NC7 A;  4OJ6 A;  4CCK A;  4URR A;  2CS3 A;  4Z05 A;  4DGW B;  3S3O A;  4HEA 2;  1BR2 A;  2F1M A;  3I3L A;  3HPG A;  1FMW A;  2Z6B D;  4MLO A;  2WAE A;  2ZSH B;  3K4J A;  3QYB A;  5KNL A;  3DKX A;  2XC7 A;  2QE7 A;  2NT6 A;  2NTP A;  2OUM A;  4HST A;  2X1C A;  2HPM A;  2VQC A;  1PYV A;  3VST A;  4JMQ A;  1UD2 A;  1PXZ A;  1W0J A;  1X0C A;  1NRK A;  2W00 A;  1NG7 A;  2JUG A;  1T0F C;  2XDV A;  1H8E A;  3W3C A;  2L7K A;  3RTR A;  4II3 A;  2LYC A;  1X4P A;  4XLA A;  2PJR A;  2OC6 A;  3VSL A;  1G59 A;  2RNG A;  4PMH A;  3H5R A;  3FKS A;  1LDK B;  3MMY B;  1I8D A;  2V4J C;  2GK6 A;  4B48 A;  5IK2 A;  2GJK A;  4RM3 A;  4BDZ A;  4U7B A;  5AMV A;  3CMM A;  2P0W A;  2HDW A;  1X1A A;  3LSG A;  3B4N A;  3L2W A;  3OYK A;  2QKL B;  4ZDO A;  1DGW Y;  3OE7 A;  4RM2 A;  2CV1 A;  4YEJ A;  1Y56 A;  2Z1D A;  1U0J A;  3MKW B;  1PLU A;  3QYE A;  5HVQ C;  5KHD A;  3IAM 2;  2GOM A;  2VIX A;  3C2G A;  3LSM A;  2XF6 A;  2JSP A;  3MKZ A;  2RQQ A;  2WJY A;  1HA8 A;  3OYI A;  2O1D A;  1BR4 A;  1I18 A;  1H8H A;  3ZSC A;  2F4I A;  3H35 A;  4E4H A;  2JJ2 A;  2QY1 A;  1MMN A;  4EW9 A;  4XMY A;  2CW8 A;  2PMZ A;  5FRN A;  4BE1 A;  2KVO A;  3U21 A;  3G05 A;  1SFK A;  2VBK A;  2D3N A;  2WAF A;  1CZF A;  1NHC A;  4AYB A;  4YZQ A;  3S32 A;  2HLD A;  3GQ9 A;  4E7K A;  1KZL A;  1VLY A;  4XKV A;  1LFP A;  3UW0 A;  2ZXH A;  3BG6 A;  4CCO A;  1O8G A;  2INV A;  4XLC A;  2HVS A;  1LKX A;  2M4K A;  3B90 A;  3GQB A;  2L2O A;  2KRC A;  4BXF A;  1DQU A;  4XOP A;  4B3X A;  2R7X A;  3A35 A;  1ERD A;  2VB6 A;  3K10 A;  4XLF A;  3GVJ A;  4KJZ A;  2CFO A;  2IGM A;  2X6Y A;  4PFO A;  2GJP A;  1JRG A;  2X53 S;  2ZTN A;  4NNJ A;  1W36 D;  3BC8 A;  4TT3 A;  4CCM A;  3VMW A;  1RU4 A;  2KPM A;  3HG9 A;  2ZFU A;  3K4L A;  1WFX A;  2HU9 A;  1V5F A;  2Q2E B;  4OWR B;  3ZR8 X;  2HVR A;  4I84 A;  1X19 A;  1HVX A;  4OZZ A;  4XN0 A;  5HKK A;  1OFL A;  4ITV A;  2O0V A;  1SKY B;  1LVK A;  1EE6 A;  4HPQ A;  4ZC3 A;  1YX3 A;  3KX2 A;  1SAU A;  3FDY A;  2A6T A;  2NZM A;  4P5O A;  4Z03 A;  3OOU A;  2DIE A;  3DPL C;  3CP2 A;  1GQ8 A;  4B47 A;  4X0G A;  1E3X A;  4XKB A;  3BH4 A;  2X6X A;  5CPR B;  4BJ6 C;  1UD5 A;  1K5C A;  3C2H A;  1AA7 A;  2E60 A;  3DEE A;  2X1D A;  1V5G A;  4DBQ A;  1N77 A;  1UD6 A;  2WB1 A;  3FKJ A;  4BJT A;  1MAB A;  1O88 A;  1QCX A;  1WMR A;  3M1C A;  4CA0 A;  3PNV A;  3E1S A;  3DPT A;  3DWL E;  4XR6 A;  1N78 A;  3F9K A;  2WY8 Q;  3DDY A;  1E1Q A;  2HVQ A;  3EQO A;  4F3Q A;  3PFY A;  4PJN A;  4XN3 A;  2XND A;  2KMU A;  2BOL A;  4ZTF A;  2DCE A;  3S93 A;  4E7Z A;  3NWT A;  4YZA A;  2L5Q A;  3DTI A;  4G7W A;  3QOE A;  1W0K A;  1EFR A;  1DBO A;  4Y33 A;  2CH0 A;  1Z7L A;  4PK4 A;  4E7L A;  1MMA A;  1IDK A;  2R7O A;  4XL9 A;  2R7W A;  2O04 A;  3LFU A;  5KCM A;  3H5A A;  3ZXS A;  1WJE A;  2AQF A;  2XSJ C;  4LIT A;  2Z16 A;  3OYJ A;  3LMM A;  3RPU D;  1JI8 A;  1HG8 A;  4F55 A;  1KMH A;  2K9L A;  3OYA A;  3ZPN A;  2W82 A;  4KT6 A;  3EUK L;  1WPC A;  4XON A;  3VMV A;  2HNH A;  1QHH D;  4W8Q A;  3T51 B;  3AKZ A;  1X1D A;  3FY3 A;  4OJ5 A;  2NTB A;  1WJF A;  1YX5 A;  1D0Y A;  3BCD A;  2EWE A;  2HQA A;  2LG4 A;  4HNU A;  3LMW A;  3H9J A;  4DJA A;  3BC9 A;  5HNH A;  3FPP A;  3OYM A;  3EPZ A;  3VR6 A;  4BL0 B;  3K4M A;  3RQ4 A;  4Z06 A;  2V9K A;  4QPQ A;  3OEH A;  1OGO X;  4BAC A;  3GBG A;  4IQJ A;  2ZXI A;  2JDI A;  4IQ4 A;  3K70 D;  2M0M A;  2LC2 A;  1WTH D;  1O8I A;  3OYC A;  2NSP A;  5FRM A;  3HPH A;  1S9H A;  2O5R A;  3SEQ A;  3M8J A;  3T53 B;  1O8J A;  3I9V 2;  3IUO A;  2VKD A;  2MD0 A;  3PJR A;  3H94 A;  1KTW A;  3KRG A;  4GQN A;  2HPI A;  2JIZ A;  1BMF A;  2R7S A;  2ZZE A;  3OW7 A;  4OJP A;  4CCN A;  3ZCO A;  5CDF A;  1D1A A;  1RMG A;  2IXS A;  2R7T A;  1OR7 C;  1PE9 A;  3CP8 A;  4UZU A;  3DKY A;  3DU6 A;  3TL4 X;  4YZ0 A;  4TKO B;  2I8D A;  1IB4 A;  3OS2 A;  3DPU A;  3H9G A;  4ZDP A;  3OPO A;  2L9N A;  3EUH C;  4NK8 A;  1WJ5 A;  4PJJ A;  1T95 A;  2LRE A;  3BCA A;  4F52 A;  3WQZ A;  2F5V A;  4BJ5 C;  3H5N A;  3A3B A;  2XGJ A;  2INU A;  3GQA A;  3SZG A;  2CMP A;  2V31 A;  4D1Q A;  1W9X A;  2BW3 A;  2LBF B;  1D1C A;  2DT6 A;  2R9V A;  3ONQ A;  2AQE A;  2XF5 A;  4FET A;  1ZEL A;  4HNT A;  1OHH A;  2ZZG A;  3IAS 2;  2W1O A;  4YZX A;  2O0W A;  3K6G A;  4CCL A;  3RCO A;  2R7V A;  4LG3 A;  2W7N A;  3OYD A;  2CV0 A;  4CUG A;  1H80 A;  4OJL A;  3D5L A;  3S3N A;  2X8K A;  4YEL A;  3PSI A;  2JVH A;  3KEW A;  3OS1 A;  3MD2 A;  3QOD A;  3OYN A;  3S3M A;  2HZD A;  3PNY A;  1VF7 A;  2R4G A;  3GVK A;  4Z1M A;  4LIV A;  2XZL A;  2VBM A;  1KCC A;  4MR0 A;  4C9Y A;  4ASU A;  3OYG A;  3HOT A;  3CZ6 A;  3GQ8 A;  3ZQQ A;  1IA5 A;  2ZSI B;  1UAA A;  3H9Q A;  4NUB A;  1Z3Y A;  2JA2 A;  2M4G A;  3PNT A;  3HOS A;  2D3L A;  2M5S A;  4LIU A;  3OYF A;  2IS1 A;  1BLI A;  2VQG A;  3OOC A;  2BW3 B;  1O8L A;  3UR3 C;  3PSF A;  4DOZ A;  1O8D A;  2ODL A;  2UVF A;  3A2K A;  1TT0 A;  4Y3O A;  4PSW A;  1FX0 A;  3CJR B;  3SYT A;  3J7A Y;  2VJ4 A;  2MYS A;  1FMV A;  2BVL A;  4F92 B;  4CH7 A;  3HL2 A;  4E0F A;  3VSU A;  3OYL A;  1UEL B;  2W6J A;  4EAT A;  3K4C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...