4YEJA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
molecule keywords Tail spike protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yejA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yejA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yejA02
1WMRA 2O17A 1O8LA 1O8DA 3VMVA 1KCDA 2X6YA 4YZXA 1BN8A 4YELA 3LMWA 2QX3A 1OOCA 5C1CA 2Z8GA 3ZPPA 1O8HA 4XM3A 2IQ7A 1O8IA 2O0VA 3WWGA 2PYGA 2VBKA 1PE9A 1CZFA 2PYHA 3B90A 2NT6A 4OJLA 1O8JA 3T9GA 4YZAA 2NT9A 4W8TA 4XOPA 2NTPA 3KRGA 4XN3A 4MR0A 3UW0A 4NK6A 3VSTA 1OGOX 5C1EA 2VJJA 3GQAA 2VJIA 4XMYA 4YEJA 2INUA 1O8EA 1JRGA 4XQFA 1OFMA 2O0WA 4AVZA 2X6WA 2INVA 2NSPA 3VMWA 2NSTA 1X0CA 4W8QA 2VBMA 4YZ0A 2X85A 1JTAA 4PMHA 2X6XA 4XLCA 4XLEA 1DBOA 1HG8A 4URRA 2X3HA 3EQOA 3GQ8A 4Z06A 2NTBA 3EQNA 4OZYA 3VSVA 2ODLA 1IDJA 1O8KA 1VBLA 4YZQA 4XNFA 2QXZA 4OJPA 4XL9A 1QCXA 3JURA 2O04A 1IA5A 3VSUA 4EW9A 1OGMX 2NTQA 4OJ6A 1IDKA 1KTWA 1KCCA 2BSPA 4XKWA 1O8GA 4I84A 1GQ8A 1AIRA 4OJ5A 3GRHA 1O8MA 4U4BA 4XOTA 2NZMA 4W8SA 1QJVA 4XONA 1O88A 2UVFA 3B4NA 4OZZA 1DBGA 4XR6A 2EWEA 3B8YA 3GQ7A 1PLUA 4OJOA 1PXZA 2VBEA 4NK8A 4W8RA 4Z03A 1XG2A 3GQ9A 4C2LA 1K5CA 5AMVA 3SUCA 4XLFA 1RMGA 4XKVA 4MXNA 2PECA 1BHEA 1RU4A 4Z05A 1O8FA 1IB4A 1RWRA 2QY1A 3ZSCA 1NHCA 1H80A 1EE6A 4XLAA 1OFLA 4HWVA 4U49A 4XN0A 2O1DA 2UVEA 4XORA 4XLHA 3FY3A
chains in the Genus database with same CATH superfamily
4X0CA 4A3BJ 3G1LA 3R6SA 2QQAA 3PO2J 3LMWA 2KT0A 4N9IA 2R5ZB 1Z0XA 4A3IJ 1XSXA 2Y31A 1OR7A 1XMKA 3L2WA 1UG2A 4YG2F 2R7WA 2ECBA 2TDXA 2M5SA 4TKOB 5EEAA 4BJTA 1U9NA 2JN6A 3ISPA 1G59A 5IT9Z 2DBBA 4M6VA 4BQOA 2VBKA 2EWNA 2P3MA 1XC5A 4AYBA 1YIJB 2NT6A 4FN5A 1EP3B 5F4OA 2VFQA 5K7FA 3Q9SA 4I01A 4RPBA 4W1UA 5FA6A 3A2KA 4IQ4A 1OPCA 2V6CA 3OWTA 3RTRA 3QSYA 5DDGA 3S16J 2LK2A 2XSJC 5IYPA 3CMAI 2RGVA 4M3DA 1RIOH 1OGJA 1PYVA 4XN3A 3A35A 3CW2A 3B6AA 1N77A 3LSHA 4WX9A 4RDUA 3WGGA 3HSFA 3P27A 5L3GA 3FXUA 3NWTA 3GQAA 3RIQA 2Z9OA 3KZZA 1Z6TA 1O8EA 1ZKGA 3HHGA 3MKLA 3J81k 2YX4A 2ZITA 5TISC 3G2BA 2P5KA 1MSFC 4Q48A 4IOAF 2JA2A 4BDYA 3W2EA 1DP7P 3V76A 3HSEA 5D8KB 4XRSA 4HX4A 3F72A 4UB8C 1X1CA 4FISA 2VUMJ 3HOWJ 5M3FJ 3BJAA 2VOOA 5CQEA 2X3HA 3GTPJ 1V3FA 3ZC3A 1LM1A 3W3CA 2UV1A 3FXKA 1IDYA 2EIJH 2GQFA 2BOLA 5ILVA 1VTNC 4WZKA 3V7AA 4A3EJ 1SD5A 2F4NA 4UY8I 1VBLA 4YZQA 5J3LA 5FKOA 2LH9A 5J8CA 3HPHA 3GTGJ 2NPFA 4QSHA 1I39A 5LRSA 1WH5A 1B72B 2E35A 1FMWA 5FKKA 3H9GA 3FX3A 4YAWA 1ON2A 1SVLA 1IV6A 2R7XA 3MCAA 2IGMA 1S6LA 4ENJA 1ZGJA 2LDUA 4Y3OA 3LA2A 1Z7LA 2DT6A 1QZEA 3BTJA 3PETA 3WGHA 5FFZA 2KIQA 3OOUA 2CBXA 3HB9A 2JTVA 4HV5A 2WTEA 2X1DA 1KQ5A 2EA4A 4IJAA 3CC2B 2DY1A 1R6RA 2HYJA 3PENA 4W8SA 1EKEA 2DDBA 2VFPA 5J35A 4K2EA 4BPRA 3GZ6A 3EQLF 2JPCA 3RJPA 1PLUA 4ANJA 4RAYA 1B59A 1FDRA 3LQQA 3HG9A 2AS5F 3NAWA 1FT9A 3GO5A 4XSXF 3JSOA 4M9XA 2XV4S 2NS8A 2YU3A 3I56I 1R4NB 1WKMA 2V9KA 1ZREA 4X06A 1ZELA 2CQNA 4RM0A 2J5OA 3KEYA 1HKSA 3JAMZ 4FK8A 1FBSA 3AK5A 2ZTNA 2H94A 2ME0A 4FHTA 3VYRB 1J0RA 2A05A 3IH4A 1R5GA 3DWLE 5CLSA 1Q9SA 1GAWA 3VYUB 4AYBN 1FNDA 3GFJA 2MYSA 1ELOA 2VFMA 2QGGA 4PGHA 1JUSA 3ZOBA 4PGGA 2FSWA 1IV8A 4YIRX 3ESWB 3L7WA 4A3JJ 1O8LA 4CA0A 2W57A 4BBSJ 3H09A 1G7TA 2LRDA 2Z99A 1WSVA 3MD2A 3OYDA 1Q1HA 2Y9YA 3W2FA 3DKYA 5F4MA 3PIOF 1Z7UA 2O3FA 1F4KA 2H8WA 2GJKA 1VJSA 1JB9A 3D5RC 2W48A 3CMAB 1KK1A 3IH3A 2XROA 5HKKA 2UZKA 4WF2A 3CC4I 1M1KD 4LB5A 3S3MA 4YZAA 4GYGA 5TR9A 2V1NA 1JKOC 3KEQA 3H5NA 1VLOA 3MFKA 4A2UA 1YFHA 4E70A 3CCJB 2Y75A 4W8TA 4Z4RA 5EEHA 4UVBA 3A3GA 3I56B 2LC2A 3H35A 1Q86D 3FKIJ 3ML3A 2FF4A 3G73A 5E1WA 1VLYA 5HS7A 2ID3A 4G6QA 2JMWA 1OGOX 1JKPC 3CDLA 1R1VA 4G8XA 1IJWC 5JVGF 1QA6A 2E5NA 2E19A 5DD8A 1EZGA 4RB2C 3FBIB 1BI2A 1W34A 3L2VA 3GTLJ 2EFQA 1KQ8A 1B8IB 1XQBA 3ZIAA 4C0SA 1SKYB 2QQ8A 4F93B 5LGTA 1LKXA 2GM4A 3S1QJ 2WZNA 3DTEA 4C3JJ 1IJFA 1K78A 1HG8A 3K4CA 1YQAA 3LNNA 3LJYA 5KK1A 3PVDA 4JMQA 3RKWA 1VQOI 1KZLA 1RR7A 1T33A 2O5RA 2VKEA 4IHTA 3QE2A 4OZYA 1WGXA 5DN6A 3JCUC 4IRGA 2LNBA 5ILUA 1PUFA 4ZZDA 3LSIA 1HSJA 1YITI 3GTMJ 3JURA 5HS8A 1RUNA 1VQKI 3CJRB 3TL4X 1R9TJ 3ZCOA 2E2IJ 1QUFA 2H6CA 5FROA 3VMFA 5J1YA 2PMHA 4UV8A 3SJZA 2CQXA 2HKOA 5JVTA 2DFFA 3SKBA 1UD4A 1UFMA 3WBJA 4HV6A 4A3FJ 5F0HA 1AOYA 2BSPA 5LD2C 1ZN2A 4UB6C 1A6IA 4XKWA 1V0EA 2XNDA 1T0FC 1O8GA 3I64A 2XZPA 1HA3A 2QEXB 2FJ1A 2VXZA 3KIOA 1IAWA 2L4AA 2K5CA 1SFUA 3VSKA 1I6HJ 5DCMA 4NDLA 1NG6A 5TGTA 4IRIA 4OP7A 3M8FA 3WTVC 2VKHA 3F21A 1PJRA 3FXQA 2P6SA 1T6ZA 1WTHD 3B4NA 1V5EA 2VT2A 3GSIA 5LEJA 2QQ9A 2XVCA 4BNCA 3LSPA 3K4JA 4YALA 2PEXA 2X9DA 3SZPA 4W8RA 3VNVA 2AQFA 1KONA 1Y1WJ 1BX0A 1N0VC 1W0TA 4UXNA 3OY9A 1N8RD 3U1DA 5K5QA 3M1EA 4PC6A 3JSPA 5B66C 1LNWA 2IGOA 4XKVA 1YRNB 1RU4A 2EIXA 1OCRH 3QFCA 1ZRCA 3LWFA 2M1BA 1VF7A 4MTEA 3GVAA 1IDZA 2CC2A 2AQEA 3HAGA 3DU5A 2B5OA 4QPQA 4E7IA 4QLCU 1K9MD 3G4SI 3BY2A 3IC7A 2CW0F 3HRTA 2CV2A 3OW7A 2MGQA 1W4MA 1BA5A 1LE8B 2JA8J 3OZWA 1OFEA 4DW6A 5D5VB 1H89C 5HLIA 3EYYA 5FL7A 4YEIA 1VF9A 1UB9A 3BR2A 3B73A 4HQMA 2NYXA 3WHCA 4DK1A 2DYRH 2ZMEC 1T98A 1W7PB 2YPRA 2WJYA 1X1PA 3E0JB 3O3KA 1UHWA 5E6TA 1S72B 1PJ5A 2F1LA 3OYLA 2M30A 1JTXA 1S4MA 4BEHA 4RB3C 3OR2C 3CRZA 2L02A 4OOIA 4I7HA 4NBSA 1IGNA 4N4OB 3A02A 1P6RA 4PK4A 4ACBA 2A61A 3V4GA 1F36A 2NTPA 1QRYA 5CPRB 2CV1A 3HKZA 4BXUA 5HLHA 2K9QA 1ZRFA 1AMOA 3O8HA 1QRCA 4BS9A 4HX7A 4LITA 2DMPA 2PMZN 2LZJA 1XMXA 2ESNA 3ABUA 4XSZF 4OMYA 1MMSA 4G1BA 4RCZA 4X7EA 1YJNI 1K8AD 1LVKA 3CP8A 3ZN1A 1VQPI 2HTSA 1HA8A 4BYYA 2B0LA 2O0WA 4EMSA 5L3EA 4ESFA 1R23A 5GTIC 4YHBA 2OCCH 2QA4B 4RLQA 4F7ZA 5JFRA 3JAMK 3HDDA 2AXTC 2FBKA 4UHTA 2OTLI 1F5TA 1DABA 3K10A 3KETA 2HOAA 1DGRM 3K1PA 1GDTA 1VQMB 3FDYA 1LPQA 3ZN0A 1T8IA 1IJEA 4RBOA 2GZWA 2ELKA 1RRJA 2EINH 2OBRA 3E5UA 1BI1A 1OLTA 3S2WA 3WGIA 1E3OC 4MYTA 4UZFA 1VQ9B 4XK4A 1ZM4A 1L3LA 1UMKA 3BR6A 5IOYA 1TWAJ 2MBFA 3QOPA 4GRIA 3BDDA 1OFDA 3RPUA 3BJOA 1HW2A 2V1UA 4QUZA 3W2IA 1IA5A 2O7OA 1E62A 1CGPA 3VEPA 3LL7A 2Q6OA 1LDDA 1YRNA 1QG0A 3CJNA 1OGMX 4PJMA 4DYRA 3ULQB 5IYNA 1VQ6B 4AUXA 2KJBA 2GA2A 3WU0A 1KTWA 3T0YA 3DPTA 1J59A 1G3YA 5F1RA 4HSRA 1XSVA 4MFEA 2JSPA 2NNNA 2V7VA 4V2FA 3R0AA 3KEOA 2V7FA 2DLLA 3MEXA 2OJED 2BM0A 4QVAA 2LF7A 1NTCA 2KVOA 2UXNA 3NARA 3RY8A 2F5EA 3A01A 2Y48A 3BR3A 3RKXA 4MEYF 2K9LA 1LB2A 5IYWA 2ZL6A 4HF2A 2F5CA 1TL8A 1BR2A 1GV5A 1JUPA 4PJNA 1VZ0A 4KJZA 3E97A 4DBRA 1ETOA 4Z4WA 4RGUA 1XGNA 1FOKA 2KP6A 3JRAA 2R5YA 3ZQ7A 4Q7JB 3KYCB 1RQRA 4MXNA 1LDKB 3IH2A 1I3AA 1RWRA 3BH4A 1U5TB 2NS7A 1KTVA 4U49A 1YI2I 3Q0VA 3BTCA 3T56B 5C4JJ 2QF7A 3BTIA 4IX7A 2IT0A 2VB6A 1F20A 1GVDA 2DJNA 4RLZA 1YW9A 4BHBA 5C44J 3ZUGA 1ULYA 3S15J 3VMVA 2PMUA 4HAMA 1YS7A 4RD2A 1HF0A 5DTDA 4HNTA 1W5CC 4ZYHA 5ICGA 3PSIA 2OU2A 3AKZA 4E7KA 3CD6B 1A6QA 1GT0C 1XCVA 3K4MA 1APLC 4HSTA 2BY0A 5M3MJ 3B02A 4RAZA 5JMCB 3K1NA 4II3A 2C6YA 1B1BA 2EILH 3HL2A 2EZKA 5DV5A 1B23P 1CZFA 4PSXA 5FKMA 1YE9A 2FMYA 1YW8A 4FE7A 1UD3A 1O8JA 1GJRA 1X3WB 3MKYB 2VBSA 3A03A 3HUGA 4CYCB 2DK5A 2NXNB 3IL2A 2NT9A 5DS9A 3HSRA 4P12A 3DFGA 5M5YJ 3VFZA 4UUTA 5CVIA 2KRFA 4JP0A 3K70C 3JQQA 2PE3A 3AVVA 3H5RA 3G6EI 4H4KC 5F1JA 1KMHA 5E3MA 3HOSA 3ECOA 4XMYA 1TW2A 5FO1A 4A3CJ 3KZYA 4RM3A 4D5FA 1LUJB 1Z3XA 2VI6A 3G71B 2EZIA 3LAPA 3W5UA 4AF6A 2IRFG 5CQGA 4MEXF 3BG3A 2GWRA 1F60A 4Z4SA 2ZNYA 3OYAA 1REPC 1EP2B 5K7ZA 1Z91A 1W0JA 2XZOA 4OMZA 2YUHA 2CUJA 1V5VA 4U0VA 4A69C 4KKUA 1QZYA 4DYQA 2VNJA 2XGJA 3WTXC 2NVQJ 3VSVA 2GPJA 1SAUA 2G7UA 3W6JB 1R71A 3S14J 1O8KA 2JSCA 2FX0A 4KITB 4CQJA 2PMDA 3REOA 3FIWA 4D7NA 1XGOA 2R7QA 3E3VA 3QPSA 1V0FA 1TT5B 2HCJB 3Q39A 1OKRA 2R7RA 1VQ4B 2EV0A 4BEHB 3VSUA 1E63A 1E3XA 4P6YA 5DSZA 1GUUA 2HVSA 2XTWA 1YLFA 5H5JA 2FA5A 1Z21A 2WAEA 2YS9A 1IZ1A 2D9RA 3AL0B 3ELKA 3KP3A 4FX4A 1A35A 2QTZA 1UG0A 1G7RA 1QPMA 4M72A 3NWSA 3ASNH 3BR1A 1BW6A 3N90A 5IYRA 4EV0A 2CW7A 1SFXA 2KIFA 3S2DJ 1Z1DA 2CJJA 2VPLA 1FLIA 4FCYA 2K9MA 4X7FA 4HDVA 3EYIA 1P4XA 1HVXA 4NK8A 4RJLA 1R49A 4C2LA 4LD5A 1K5CA 1ZG3A 4L9VA 4XLNF 4PC1A 3PM1A 3COAC 4J00A 4TV7A 4A5MA 3OYBA 1U3EM 2BZTA 1SM4A 2DOEA 4IHSA 5TV2A 4D9JA 1NHCA 1Y8RB 1QQ1A 2QVOA 4Z2YA 5KAIC 3W2HA 2IOUG 4ZDLA 4ASUA 2LY2A 5HS9A 3PQKA 5D8LB 4P3IA 2DMQA 3PSSA 2DFIA 1I3QJ 3SYTA 2BV3A 4HYEA 1E1QA 1HDPA 2K4JA 3HGYA 3GX4X 3LSGA 2QA4I 3JRIA 4ZC3A 5IP6A 2EH3A 5DCMB 1I5ZA 2K9NA 2OYNA 2DA7A 1ZG1A 3AGPA 4MQVA 5DD4A 1PJ6A 2NV4A 4LG0B 3A01B 1AIPA 2K3FA 2HOEA 3RZOJ 3ZMSA 2BGIA 5D4RA 2VNIA 4DYCA 5FRMA 4KKTA 4QIWN 1XDSA 4BE2A 2COMA 2H8RA 1YW7A 4Y13A 1GXPA 2KKOA 1H88C 2PYHA 3V7SA 3PSZA 2CV0A 2BM5A 5TY0A 3T9GA 4IO9F 2I10A 2VYQA 4KA4A 2BGJA 3PUFA 2EFNA 4JYKA 2BV6A 3DU1X 2IEKA 1WCMJ 3QU3A 5H6RA 1UD2A 4MR0A 2XASA 3W6VA 3BH6B 4ZGNB 2QBYB 2HQRA 2HDWA 3P5JA 3SEZA 4PDKA 4B3XA 2DOFA 2XRNA 2K40A 2DFHA 1JHFA 1R22A 3HTUA 3K4LA 4NUBA 4YEJA 4C2TA 2HZTA 5ED4A 1KYZA 2XF6A 3QPLA 4AIKA 4I99C 4CGZA 3KL9A 3AVTA 4YZ0A 1X2NA 2E1MC 4NQWA 5JLWA 1FZPB 2NVYJ 4YFNF 1MBGA 5CVRA 3MZHA 1A04A 3HIFA 1VQ8I 1G6NA 2W85A 2VQHA 4D5CA 3TP0A 3L2CA 2VQGA 1FEXA 1IDJA 3Q0UA 2QXZA 2V5IA 4U88A 4XRSG 3QPTA 1QCXA 3MMYB 3FISA 3ECHA 3RDIA 1U2WA 3HRUA 2OA4A 4HF0A 1S0UA 3D1NI 3IHUA 2QZAA 4RLFA 3E6CC 3GZNB 3PUBA 3S1NJ 2UUZA 3GW2A 1BOBA 4X07A 5EJCA 4E7SA 3BC9A 1WOOA 2VFOA 1X4PA 4DZJA 3ZQGA 3H5AA 1ZGAA 5LLQA 3TBIA 2K27A 4AD9A 5LGUA 1D5YA 3SLNA 4V2GA 5FD6A 1TYUA 3QYFA 3TO9A 2ESHA 2HPIA 2YR2A 4HX8A 2VBXA 2W24A 1O8MA 3GQBA 3M1CA 2M2EA 3BNWA 3GRHA 1W7PA 2AO9A 4L18B 1WVRA 1D0ZA 3E5QA 4BU2A 4KNYA 2UVFA 4OOXA 4WXDA 5BMZA 5LHHA 4CCMA 3OYNA 4DQKA 3F8MA 3U6BA 1ETXA 1K61A 2P5VA 4ZGQB 1TC3C 3TGNA 4OWRB 4X7CA 1FNNA 1O7FA 3SUCA 1E3PA 1UD8A 3FKJA 4RD6A 4ZYAA 2OD5A 1OCPA 3N6ZA 3LSRA 5LGNA 1BR1A 4EM1A 2EV5A 1H80A 3FXOA 3T51B 1NK3P 4DBQA 3IAM2 3ZQCA 3SZTA 1ZAOA 4YXWA 3CCRB 3OSGA 3IRRA 4RAFA 2ZL5A 1MMNA 5HOOA 2VOPA 3QFSA 3V42A 4JX4A 1TYXA 4E0FA 2DDAA 4MHGA 3D26A 2E1NA 2IAIA 4RGRA 4EJVA 2Y0MA 2OPTA 1RKTA 2PBIA 5IOZA 1RR8C 1O3SA 3Q5FA 1GLNA 2CUFA 3TW7A 1AKHB 2O61A 1KRHA 4DK0A 1DPUA 1K4SA 2A3SA 5GAHJ 3FBNB 1A5JA 4EM0B 4LK1F 4E7ZA 3C2GA 5F6FA 4P9UA 1RQPA 4MFDA 2VPRA 1Y0RA 1WJFA 2XF7A 1R4MB 4V02C 3DPUA 4YIFA 4A3DJ 1KK3A 3DV8A 3JU4A 3BY1A 4E4HA 3ONQA 1QGYA 4TN1A 3M07A 2Y30A 1BMFA 1RESA 3SZEA 4M9ZA 3RCOA 1BW5A 3FXJA 3SYJA 1XGMA 1FRQA 2ZZEA 1S7OA 1MMAA 2L0KA 3HEFA 5BNGA 1MDMB 3SJPA 1JJ8C 3V7CA 4OOVA 1MABA 4A0XA 2BHYA 4M4SA 5E18F 2QM3A 4S0HB 1ENHA 3KLNA 2O6GE 3VSTA 2ECCA 1J09A 3BJ6A 1OJLA 1MRZA 3B6CA 5HDGA 1K4ZA 2XT4A 3LSTA 2E2HJ 2V7UA 3QP6A 4LOCA 1PUFB 2XGXA 3UR3C 1V54H 2BY3A 3HOZJ 1WRJA 4HA8A 3EDPA 3W5HA 4OU0A 4ZYDA 4HPQA 1EXMA 4HLXA 2XTYA 2X6XA 2DA4A 2TCTA 1MDMA 2KMUA 4IXAA 1I7PA 1XDUA 2EZHA 3G1OA 1STZA 3F9KA 1IN5A 2E36A 1KQ0A 2HI3A 2XB5A 3GBGA 2P0WA 1KU7A 4HRIA 3DLLF 3SHFA 4B09A 4XL9A 4D1QA 4MTDA 2IA0A 3QRFF 1DUXC 5THXA 4TMVA 3OIQA 3O2PE 3CCMB 1VQ5I 3LSKA 4BH9A 2Z33A 2PJRA 2KRCA 2XPWA 2ZMEA 3MN2A 3PUMA 4RPDA 5KSWB 2Q8KA 2MLKA 3CCSI 2VN2A 4C2MJ 2GLOA 2HWVA 3PL8A 2RREA 4O6JA 4XRFA 3LA3A 2CF4A 1D3YA 1TP4A 3EUHC 4AM3A 5L46A 3DLAA 3E5XA 1UAAA 2BSAA 1R58A 2OCEA 1G3TA 3CCUB 3WTWC 3WXMA 1KQ9A 2XC1A 2EFOA 4U7DA 4IKFA 2JA7J 3CDHA 4FTHA 1XCBA 4CH7A 1SVOA 2K02A 5HDNA 3W5VA 1K79A 3A1YA 1IN4A 3T5XA 3WE2A 1K83J 1LEAA 2X0LA 4M3GA 1I1SA 5GV8A 5HZBA 4P1VA 3EUHA 2WZPP 4Z03A 1XG2A 2DW4A 3F22A 1EP1B 2M7BA 2WC2A 3DTKA 2QKLB 1PVEA 4G6IA 4KYWA 3LFKA 2XT2A 5BOXA 2HS5A 3BP8A 4OIPF 1KQSB 3VR6A 1KC8D 2JJ2A 4EJOA 5IT9K 2V1DA 2QSFX 4I0BA 2DMNA 2WB1N 1EFUA 4YFKF 3HOXJ 3MHPA 4F52A 3PIPF 4BY1J 3CCMI 5EF6A 5CVJA 1DPRA 2C78A 1BC7C 5E3NA 1UZCA 1WMRA 2F2EA 4CCOA 4KN4X 3J7ZI 2X6YA 1X1AA 3I58A 1DU0A 3C7JA 3MCZA 2KIUA 3C2HA 2X4HA 2BXZA 1Y0NA 3MVPA 4ZJZA 1UD5A 5M5XJ 1O57A 2XDVA 3FHZA 2C4UA 3EPZA 1I27A 2OQRA 5C3EJ 1MBJA 1R36A 1O4XA 3ASPA 2IQ7A 2QDXA 4NCNA 1J75A 3NQOA 2DA5A 3B90A 4KDPA 3SY2A 4X05A 2OAZA 2R7OA 2R6HA 2LBFB 4P25A 4B1RA 2A69F 2CQKA 1VQNI 2R7UA 2VODA 4U7BA 4PFPA 3CO7C 4BJ5C 2M4GA 1JA0A 3F6OA 2BEOA 1XFOA 2ZBKA 4B44A 1NB9A 2OTJB 2Y69H 4XD7A 2K4BA 3NEUA 2J5PA 4F55A 1E3ZA 4S05A 1FOYA 4N3NA 4ABZA 1IRXA 2CG4A 2MG4A 2V9PA 4UUVA 3GTKJ 1JRGA 1SEUA 1DG1G 1JJ2B 5GP9A 1ZM3A 2IJLA 1N25A 3LFUA 4M3EA 3BQJA 1TLHB 1ERDA 3BT9A 3HUGB 2PFBA 2BBYA 2RN7A 3GTQJ 5ERIA 2F1MA 4E7JA 2CSOA 3SLDA 2I8DA 2VBWA 5F0CA 2XKPA 2XEXA 2A6HF 2EFPA 1XPXA 2Z3YA 2GA1A 3C2BA 1U5TA 4C3IJ 1D1BA 3TQNA 1YJWI 1G7SA 2HQNA 2BVNA 1T08B 1W1WE 4MO7A 5HNFA 2ODLA 2LG4A 4BQAA 4N0BA 3U1KA 2W82A 1MGTA 2GK7A 1FNBA 3LNQA 3WNCA 1TTTA 3PFYA 3ZP5A 1WPKA 2VLAA 1BX1A 3LVBA 1CF7B 2IGNA 5C4XJ 3PQJA 2YWFA 2E60A 4GYIA 4QFMA 4L9NA 3K1MA 1T6SA 2P8TA 5E1ZB 4BL0B 1MZBA 2ZFUA 3BG7A 4A3MJ 4CCJA 3GUDA 1BI0A 1WJ5A 3GMEA 2E1CA 3O6BB 1MBKA 3JTGA 5LHGA 3CCQI 4M3FA 3WTYC 1U78A 2FRHA 4KIGA 2H1KA 1N05A 4ZCMA 3OAAA 5D5XB 1ON1A 1L1IA 4YAOA 3OW2B 4LLGF 1FX7A 3VYTB 3GLXA 3BQYA 4CICA 1MKMA 2E7XA 3CZ6A 3HTSB 3ZQQA 2FU4A 3OYMA 5IPAA 2BM1A 2BVMA 1SFEA 3NAUA 3CC2I 4XLFA 3PO3J 2N8GA 3JQRA 1X3UA 2VJ5A 2XPVA 3A0HC 4P96A 3LO8A 3E1YE 2KRHA 1IB4A 1EFTA 1T6XA 3OIOA 3CF2A 2VNKA 3WE3A 5JI6A 3AFHA 4DNCA 1VI0A 5GPCA 1U5TC 4Y7NJ 3ABTA 3I59B 4EEFG 3NE5B 3P4GA 3F23A 2WAQN 4WXCA 4Y17A 1LFPA 3FY3A 3I9V2 2FQ3A 1I18A 1HW1A 2W25A 4RM2A 4AIHA 1OYWA 3WTZA 3WHBA 4P1WA 1SFOJ 1YITB 3DCFA 5EG0A 4M73A 3LQRA 2BHZA 2QX3A 4L5EA 3MQ0A 4KIFA 3TO7A 2E2JJ 5HXBA 1K4TA 3WNBA 4FT8A 3EETA 1YJNB 3CTAA 2Z8GA 4BQQA 5KHDA 1SAXA 2JVGA 4ASNA 2L4MA 5F0FA 5EZHA 1HDDC 2XAFA 3QYEA 4Z4ZA 1PE9A 2DEUA 2R3SA 4ENNA 2Q2EA 1VNDA 3TOAA 3K2AA 1FIAA 1ZLJA 3P7NA 4HQEA 4Y9UA 1FC3A 2HDDA 1B2RA 4RA2A 4UUSB 3WQZA 3KRGA 3H3VK 1VHEA 1KK2A 1GV2A 1YO5C 1FOWA 2FVGA 3F6VA 2XIGA 5L3DA 1FPQA 1E64A 1YHQB 3ZQHA 4JRAC 4NC7A 1Z77A 3WU2C 4AC0A 4DGWB 3BROA 1NHAA 4NB5A 4NQWB 4AVZA 4AIDA 2V7QA 4OIOF 2ZKZA 1N07A 4KT5C 3RKYA 1WWXA 4UZEA 1IG7A 1Y0YA 3BWGA 4ROXA 1TWFJ 2HQ5A 3I4PA 2L7ZA 2D1HA 2D5VA 1T56A 4IHVA 3WU1B 1S5LC 1C0WA 1KA8A 4Z06A 1FOXA 2QWWA 3G3ZA 4D7MA 4XNFA 4QTRA 3BLYA 2COBA 3E6DA 4AWXB 4RD0A 2DN0A 3CCEI 4I6ZA 3L00A 1EA3A 2D74A 5DM6F 2OBTA 2NTBA 2FQ4A 2QUFA 1P4AA 2C5HA 3RIRA 4M6YA 2STTA 3OEEA 1IDKA 2AHQA 2BY2A 4CYCA 2LKXA 4PC3A 3OYFA 3B8HA 4I84A 3PA1A 2FBHA 1GQ8A 2EIMH 4OAYA 3CB4A 5GAGJ 2EK5A 2DYSH 1DDIA 3G1MA 3DBHB 5AIPA 1S9HA 4XIDA 3OYGA 1NDHA 2B0RA 1EH8A 4OZZA 3MZYA 4JK1X 3QFTA 3VSLA 3J7YJ 4XR6A 1ZGWA 3OYJA 3H36A 2ISZA 2D3NA 1MIJA 2R0QC 1BL0A 2G0EA 3DBRB 2LVSA 2GAUA 3OL3A 1WI9A 5CDFA 1N06A 4UV9A 3OSFA 4KMFA 4GCVA 3S2HJ 2WA0A 3PNYA 3VPRA 3ASRA 1Y6IA 2ZJ2A 2G7HA 1EA0A 2XC7A 3ZZ0A 1JGGA 1YX3A 2W4SA 4LC0A 2E1RA 4UZUA 3QODA 4OIRF 2V7XA 4YIIA 2OQGA 2R7SA 1FWZA 4L5JA 4RB0A 2LREA 3CUQB 3LMMA 1IUYA 1YJ9B 3S17J 3T8TA 4A3GJ 3E7LA 2WJVA 2HOSA 4LIVA 4B4DA 2CW5A 3KPHA 2YX7A 4IHXA 3AVYA 3RYRA 4M0LA 4FE4A 3NB2A 3WBKA 1O8HA 2BXYA 1YOVB 2VT3A 1OISA 1Q82D 3KP2A 2OK7A 1A36A 3CCSB 3R6JA 4OOSA 1DGWY 1HQCA 3J81Z 1DDGA 5B1AH 2L5QA 2OUMA 3RZDJ 4GXOA 1WH7A 2O9LA 2M0CA 2WAFA 1WJBA 1JUMA 1D0YA 2L3DA 4TMZA 4AVPA 4B48A 4CO8A 4U87A 2R5ZA 5J47A 3H92A 1OCZH 1PKVA 2FNAA 1SFKA 2QZ8A 4BKXA 1OHHA 3OP1A 3IAS2 5J40A 2KDZA 2INUA 5CKTA 1RNLA 2ZSHB 4IZZA 1TQMA 1X3ZB 2HZDA 2XAUA 2QGUA 3ONUA 4XQFA 3CCVI 1XMAA 5BQTA 3TEDA 1V4RA 1KU9A 2LR8A 2GXAA 2XAJA 2ISYA 3SDBA 5LFAA 1H42A 2L9SA 3HOUJ 2YU9J 1WPCA 3WG7H 4W8QA 4OPVA 2MC4A 1QX4A 2DAOA 1X58A 1JGSA 1MD0A 2EV6A 3ZMDA 3ASTA 1VQKB 1Z6RA 2CYYA 3K4NA 4BBRJ 3HYIA 1A31A 3PJRA 2NRAC 4KISA 5IYBJ 2VIXA 4HLYA 1MW7A 3EUAA 3RPQA 2IS1A 5CYVA 5DS0A 3SEJA 4I09A 1YLOA 3VDXA 1QH0A 4DIQA 3RQIA 3U6KA 1CNFA 1W36C 3W2VA 2W00A 4U0WA 4B3FX 4DJAA 1SD4A 3DEEA 2HNHA 1RUOA 2H27A 2GXBA 4FASD 2RC6A 3DDYA 2QLZA 1MBFA 1D1NA 4N4NB 1AHDP 4Y4RA 4UVCA 2OTJI 1KCCA 2FOWA 1NH3A 3UKGA 2LMDA 1GR1A 2BVLA 1ITYA 2XRLA 3PNVA 4TT3A 4U4BA 2J8KA 5ILSA 3KX2A 1PUEE 1EH6A 3KLOA 1IN8A 2ZXJA 3WODF 4XLPF 3U21A 4NHJA 2ID6A 1QGPA 1Y8QB 3T1BA 1WOSA 2M9HA 4OPSA 1MNDA 2LF8A 1PP7U 2BPOA 1I8DA 1TBXA 3K4BA 2CRGA 3CPXA 1FYKA 3RPUD 1TWCJ 2VC0A 3LSJA 3JRCA 1W5TA 5EGOA 4ETSA 3GCMA 1VQ9I 3M7GA 1DP3A 1YJWB 2QYUA 2HGCA 2KZGA 3CQZJ 4FWTA 1D8JA 3HPGA 4J19A 4BE0A 2I5UA 1BN5A 3QYBA 1N78A 4Y15A 5F04A 1RZ4A 2E34A 4HF1A 2R7TA 3K9TA 4M74A 1L0OC 1U0JA 4Z1MA 1NRKA 4E6KG 4IHYA 3Q38A 2RQQA 5B3SH 1K78B 3ASQA 1BOAA 4YZXA 2LSOA 3GTOJ 4AU7A 4CCLA 1HSTA 2CUEA 5KCMA 3NRVA 3Q6RA 5IP7J 1SD7A 4A0YA 4ZZLA 1MNEA 3OEHA 3BZ6A 4I0AA 2LFBA 4Y33A 2O8XA 1ZRDA 3ABMH 4LG0A 1H8HA 2BE5F 1VHOA 3SEQA 2D3LA 2QTLA 3GFIA 3JRBA 4YDTA 4OJLA 2DA2A 4KFCA 1W35A 2V7WA 2DT5A 5D6EA 4WQMA 1QBJA 2HR3A 1IW7F 2HEOA 2NOJB 2EIKH 1AKHA 3BH7B 2CW8A 3KP5A 1B8IA 2PMZA 1G4DA 2WBMA 1WXRA 2VJIA 1IXSB 2Y0SA 1ZLKA 1H85A 1F1ZA 3I3LA 2C4TA 5HLTA 2KZVA 3SDGA 3MKWB 2F5VA 2M8GX 3Q9VA 2R7DA 4JX5A 5AONA 1XE1A 2VQCA 2XGEA 2LBFA 2ZXIA 4YRVA 4ESJA 1I1GA 3P9KA 3CCJI 3B82A 2XGCA 1X0CA 1MBHA 1BI3A 3IP4B 2W1OA 2VASA 4IL6C 3C3WA 4ZDOA 4Y9RA 4X1EA 1YX5A 5K1YA 1XB2A 4JOMA 3ZPLA 2ZXHA 3CCVB 3EQOA 1JT0A 3CCQB 2Q2EB 2QQBA 2CO5A 2VBYA 2ETHA 1R1UA 3A3BA 2ZBUA 3QP5A 2IW5A 2M8EA 4GDFA 4M3BA 1WDTA 1COWA 2WV1A 4J0QA 4WXHA 2KIMA 4PUSA 2UWMA 3OZVA 3ZBUA 4ZH4F 5F08A 1W87A 4KIBA 2DTZA 3OR1C 4MIMA 1ONVA 3V7RA 2PIAA 3OJXA 1TSPA 3ZMVA 4RGSA 2MFZA 4B43A 1SC7A 2A5WA 3FF5A 4WK8F 4Z6YA 2PQ8A 2CFXA 1G8XA 3I71A 1ZK8A 4OINF 5EMNA 1U6GA 1OYIA 1LDJA 2K86A 3N05A 4XOTA 4IOCF 4ZV4A 1EWYA 5E3LA 3H94A 4PJJA 2EZLA 3I0TA 4CXFA 2FEZA 2HVRA 5A8AA 1ZTRA 3DEUA 1U8BA 2IS4A 4IEJA 3OYHA 1IXCA 3C18A 3OYIA 4Z4YA 4Q47A 3KP4A 2VC1A 1F9NA 3OYCA 3TOBA 3FPPA 1BJZA 1XGSA 2F6CA 1T0FA 3H3UA 3H9JA 4BHCA 2LY1A 2ZZFA 3ERED 1YI2B 3GQ9A 2JUGA 4NC8A 4NNJA 1KCDA 1SMYF 2HDNB 3VYSB 1TLLA 2HKXA 2L2OA 5E20A 2CQ7A 3E6MA 4L9TA 2ZJRF 5DEQA 5E1XA 3QPHA 5HLGA 4X0GA 5FLVA 1NG7A 1ZUNB 2CH0A 3K69A 3I4NJ 4XICA 3DKWA 1FTZA 1D1AA 4RD3A 5IK2A 5A88A 2F43A 2E7WA 3I5UA 1LFUP 1MJBA 4L0YB 1QVFB 2HU9A 5H20A 2XTXA 4OPWA 3LAJA 3ZBTA 2RC5A 4DNRB 5B5EC 3BCBA 2L7KA 1WHUA 2E1OA 1YHQI 1R5BA 3N97A 3OJWA 3OYEA 3FXRA 5J1UA 3MZ8A 3S8PA 2QMUA 2Z1DA 1ZQ3P 3HOVJ 2ZTGA 3IKTA 5M5WJ 2HPMA 2CRVA 5L3FA 2DODA 1XTAA 2V6EA 1WJEA 5DNSA 2VNHA 3TKYA 4EJWA 1QA3A 2IS2A 5JLVC 2KL4A 2Q1ZB 2I1LA 3SQVA 1LEBA 1E1RA 1U2RA 4PC2A 1T95A 2DQRA 3ZRGA 4P26A 4JBAA 4ZCIA 4R71A 2K9SA 4PC7A 2F3LA 2QBYA 3LOCA 3AG4H 2XKOA 2AXLA 3E1SA 4YCQA 1BR4A 2FUG2 1BLIA 1NB0A 1N75A 2KDOA 2L9VA 2GBYA 3H9QA 1B9MA 2VXDA 1FNMA 1B72A 5GV7A 3RYPA 2IA2A 2VBVA 1P7JA 2M0MA 2L54A 2JIZA 4II2A 3OKXA 2Z2SB 2RV8A 5B1BH 2X6WA 2INVA 1OR7C 3I1FA 1IN6A 3BPVA 2HTJA 3H3ZA 2KFDA 1RKWA 4I76A 1FY7A 4WWCA 4H0EA 2X85A 2XOKA 1D8TA 3AVUA 3CC4B 1GHCA 2L9NA 4BY7J 3CC7B 4XLEA 4LBZA 4YAFA 1OCCH 2NAZA 2QYOA 5HNHA 3CCUI 1VQ8B 3P26A 2VE9A 4BACA 3ZGKA 2KQRA 1VFCA 2XNCA 1T2KA 3VWBA 3DBLB 4RCYA 3AVXA 3F8BA 1VQ7B 2R92J 2L7FP 4CCNA 5EGOB 9ANTA 3H9NA 3BG9A 2BGCA 2DCUA 1WOPA 1R5HA 3CMYA 1USSA 4G7HF 1J9IA 2WR8A 3IWZA 1WP6A 2DO7A 2NS0A 3BQZA 1T5EA 4Y52J 1BIAA 3JTHA 4ON0A 2ZJPF 1O7LA 2C77A 5ICCA 1TW3A 3BZKA 4E7LA 1POGA 4M71A 3CD6I 1X19A 2F4MB 3DU6A 3VODA 4X7DA 4UNOA 2NZMA 2KHMA 5LEKA 4V19K 2F5DA 2MD5A 2WY8Q 2Q6IA 1O88A 1DBGA 3SQNA 3I55B 4EATA 2R7ZJ 1YIOA 1BQEA 4QWQA 5E8IA 1YTYA 3BZCA 1W5SA 4EVIA 1N08A 4IHWA 1PXZA 2L9RA 1E79A 1BC8C 1LLZA 1DARA 4AC9A 4GFBA 1XSDA 4ITVA 5GAEJ 4ENMA 2PECA 3JRFA 5FLMJ 2QSHX 2Y2ZA 4G6TB 4M6XA 1O3RA 3JX8A 4LLLA 3ZSCA 4LBWA 4OJ5A 1UHMA 3HXLA 4F92B 2H1LA 4OM9A 4O5VA 2M4KA 1KJZA 3BG6A 1MH3A 1S7EA 3CCRI 4EH1A 3ZQLA 4YFOA 2B7EA 2IXSA 4C2UA 3CUOA 3VB2A 4C9YA 3GVLA 5FD5A 1Z3YA 2JQ7A 2GQQA 3OFNA 2XGDA 2ZMEB 1ZM9A 1BN8A 1IUFA 1EV7A 2JT1A 2H09A 2L01A 2GIZA 5LRRA 5DM7F 1TYVA 3CJQB 5H59A 4OPOA 3HGGA 3BR5A 1QFYA 2CNDA 5AIQA 1H0MA 4KKSA 4R79A 4P3YA 3I59A 1JI8A 2V7TA 3WWGA 3ONYA 2HLDA 3HM5A 4Z4UA 1OB0A 1UJ8A 2M34A 1XG1A 3A0BC 3P9CA 3HBLA 4ENKA 5K5OA 4AIJA 4YC5A 2V31A 2M7AA 3WG9A 4XOPA 2B9SA 4R1HA 3WTTC 2PJRB 5D6FA 4NK6A 4K1XA 4QVJA 1X1DA 3FKSA 4MQ9F 2JA5J 2OTLB 1Y1VJ 1UCRA 1FSEA 2D1VA 2ZB9A 1ETWA 2D2WA 2VE8A 3ROUA 1IHMA 2FX3A 1W0KA 1E0EA 4M1KA 1SANA 1ZHFA 2K3PA 4IW3B 4F3QA 1OFCX 1O3QA 3TH0A 1JKRC 2DOGA 1QFJA 1HW5A 3WNDA 1HC8A 1FX0A 3TP3A 4RAGA 3K4KA 3ERMA 3ZMUA 3L09A 3O8GA 3WY9A 1EF4A 5FRNA 2RVCA 1TVCA 2D45A 1TQIA 1HZEA 2ZL7A 2LP0A 1TYWA 4OJPA 1QA1A 3CPWB 4F7DA 4P9FA 4PJLA 2QN6A 2BM7A 3ZMZA 4QHYA 3GVKA 1U9OA 5B6IA 4HDUA 2DERA 1QPIA 3AAFA 3F3XA 2LD5A 2IA1A 5FGMA 3OOPA 4L9JA 3V8JA 3V8LA 4U0YA 5ICFA 1YYVA 3EUKL 1H8AC 4OJ6A 1K6OA 2XHKA 4G94A 4RS8A 3OE7A 2W6IA 3QQAA 1MJAA 1IN7A 4RD1A 5BS6A 2M3AA 3AG3H 3FHNA 4EJTA 5HDKA 5A89A 3Q6QA 4LBYA 5FNZA 4FXUA 3L1PA 1WJCA 1TNSA 2HYGD 4PAAA 4KUMA 1FJLA 3Q0WA 2XAHA 3JW4A 4HNVA 2F48A 2ACJA 2LKPA 1YS6A 1U8RA 1XD7A 2DK8A 3KFWX 4L8JA 1XN7A 1ACIA 3LQ6A 3V8KA 4CCKA 4DOZA 3CP2A 1BHEA 2Z16A 2OC6A 1QA2A 1DDNA 2LY9A 4BHPA 1JT6A 4HNUA 1NK2P 1IRGA 1E43A 1GAQA 2OK8A 4P6VF 3E6BA 1EFRA 3GIRA 4RDLA 2VQLA 1P7IA 2KISA 3S93A 4TMXA 2YUSA 5KAFC 4ZTFA 2O1DA 2FMLA 3S3OA 3ABLH 3BR0A 3R4KA 1IRFA 1CQXA 4N9HA 4G6DA 4P55A 2DI3A 2O17A 1O8DA 4OIQF 3CLOA 2VBTA 1S7AA 5F64A 2ZJQF 5TJJA 1QZZA 2HQAA 2PN6A 1ODDA 3BG5A 1KZHA 4KH3A 5FFXA 2QCOA 2VZLA 3W6KB 1JHHA 3B78A 1O8IA 2DTRA 2DCEA 2FE3A 4BGDA 1PJ7A 3KYDB 2Q6LA 2J8IA 1WSRA 2X48A 3DPLC 2EQRA 6PAXA 4LBVA 3OS0A 4UVAA 2LOOA 2IP2A 5FLXZ 1FSHA 3VNUA 1HXDA 1IF1A 3QWLA 4Y7CA 2WYRA 3X2QH 3Q3AA 4PSWA 2V26A 1LLWA 2M5WA 3BOQA 2ELHA 1IC8A 2EBIA 1J2XA 3LSMA 3F8CA 5EYRA 1BJKA 3GEZA 3W2WA 2ZZQA 5FIUA 4IPAA 4H9GA 2GOMA 2R93J 4ACAA 5L3CA 2HYFA 3ZQIA 1R1TA 5CJ9A 5EG0B 2X3UA 1XB4A 1RC9A 1J9ZA 2PG4A 2JZYA 5LHIA 4YAUA 2VBMA 4OAZA 1G7CA 2O6WA 2DA3A 3JRDA 3FM5A 2CU7A 1JTYA 4URRA 3CMEI 2LYCA 3FK6A 3QOEA 4IVNA 3U9GA 1OB2A 2ZC2A 2IPQX 2MH2A 2P81A 1W9XA 1SMTA 2UXXA 4IF4A 1OQYA 2HOTA 3I4MJ 5EDNA 4PGOA 3EQNA 2HVQA 4P22A 2WV0A 4ESBA 2G9WA 1JNYA 3VO2A 4KT6A 4QPOA 2RDPA 3CO6C 4LJZF 4R8HA 3RKQA 1MJ9A 4XKCA 4NBQA 3TMOA 3OYKA 2XAGA 3GTJJ 4G1VA 1FMVA 4HEA2 5FKLA 1PDNC 1UELB 5JHFA 1MNMC 2JRTA 4X6AJ 2NNYA 1TT0A 2OV7A 1CF7A 4GO1A 2M45A 2X53S 2DPUA 3M4OJ 3MWMA 2BW3B 3BY6A 3A8KA 3KZIC 2BN4A 4BUPA 2B63J 5HZAA 1B4AA 2EB7A 2K85A 3ISXA 2R7FA 1ZH5A 1G3SA 2P5LC 3GXOA 1FBQA 3JRHA 1RPWA 2RKHA 3I55I 2ZZGA 1M1EB 2W7NA 3I53A 4EGZA 5LBQA 3K6GA 2F4OB 4I2OA 1Z9CA 1P9QC 3OOCA 4BXFA 5J8FA 5BPIA 2V4JC 3ZMTA 5AMVA 2RC4A 1FRNA 3CESA 3PFIA 2ELJA 2W6JA 1KGSA 2K7LA 1QO0D 2XUBA 3HRMA 1K8FA 1OGIA 2QY1A 1MBEA 1TWHJ 2QEXI 1O3TA 3G6EB 3ML6A 4XN0A 1R7JA 3KE2A 2DMUA 3FWEA 4CUGA 1ZARA 1FP2A 3HJEA 4P9SA 4XORA 3N4MA 2EA2A 1ZR2A 1V5FA 1JE8A 2PI0A 1TZLA 4YFXF 4HIZA 2ZO4A 1ETVA 4Q4ZF 1XX5A 5E17F 3ZXSA 1IRZA 1N0UA 4YELA 2EJRA 2RNJA 2PX9A 3ZR8X 2XSDC 5C1CA 4XM3A 4LIUA 4N3GA 4IRHA 5GTHC 3FMSA 2R9VA 2Q0OA 3J7AO 2O0VA 2E1BA 3CC7I 1JXSA 3JR9A 2PYGA 5E3OA 2CMPA 2JPBA 2PJPA 4JX6A 3W2AA 4UUSA 1WQ2A 1J5YA 1QNTA 2XF5A 1XS9A 3FK7A 2Q6KA 1S8NA 2DETA 4BXXJ 1T6YA 3G05A 3F8FA 1KU3A 2JUCA 2F4IA 3R6KA 2KJCA 3FZVA 5J1RA 5KNLA 1Q1VA 2BM4A 4Z4VA 3UW0A 3GF2A 3DTIA 5C1EA 2B7BA 2XB0X 4FX0A 5DYMA 2VONA 3CCYA 3TW6A 3DF8A 1EFCA 1VQNB 1K28D 3CMEB 4BDZA 3A1PA 3BC8A 3ABKH 1QQIA 2KLOA 2PLYA 4WWVA 1HKQA 2E1MB 2ZSIB 4LK0F 2NSPA 3M9AA 2V4DA 4GQNA 1ETYA 3I54A 1X4OA 1QGAA 3M8JA 2FXAA 2NVUB 4B3AA 4LB6B 2HDCA 1Q7YD 1JTAA 1RI7A 1ZYRF 1UD6A 4XLCA 5J4YA 3F8NA 3KP7A 1S3JA 3W2GA 1WJAA 2C5BA 5BSXA 3VO1A 2STWA 2AHOA 4B47A 2JA6J 1Z05A 3FPKA 4GGGA 3HOYJ 4J01A 2DA1A 1QHGA 4A6DA 1D2EA 5L3BA 2WADA 2GJPA 3PUNA 2MC3A 1WZ2A 1IXRC 3GVJA 1LJ9A 2GOXB 3BCAA 5ICEA 2VKDA 4HE5A 3FMQA 3IV5A 3UNGC 1ETKA 1H9GA 1W36D 3DEWA 1D0XA 3IUOA 3Q3SA 1VQPB 2DJIA 3BTLA 2W84A 2P6TA 1LVAA 3RQ4A 1HF2A 2NTQA 1ZR4A 2DIEA 4Z4TA 3F0CA 3SJMA 2R7VA 1USTA 3KP6A 5EEGA 5FO5A 2JJ7A 4A0ZA 4O3MA 4TMTA 1BPLA 3L2QA 1QHHD 4UAJA 3KYLA 2CWEA 3FXLA 2WWYA 3OL4A 3QU6A 3GWZA 2Y9ZA 1LQ1A 3AGQA 1R00A 2KPMA 1AIRA 3ASOH 1QVUA 1S29A 3CJTB 4EM2A 5A2QZ 1AU7A 3M3YJ 2V1XA 4XONA 4KMUX 3ZQFA 2L7MP 3WTUC 1A8PA 1QJVA 2R5YB 1P4WA 4RB1A 3HRSA 1LE8A 2MLGA 4D0PA 4A93J 2EWEA 3B8YA 2V9VA 3R60A 4MNUA 4OJOA 1P92A 2JVHA 5FO0A 1E17A 2B7CA 1V55H 3DQVC 4PFOA 4XKBA 4RDJA 4WCGA 4HE6A 2DQLA 3J7AY 4LG3A 3TO6A 1QGZA 3AG1H 1W0UA 2CK3A 3E20A 2MA3A 2DFEA 1AA7A 2WY7Q 1M90D 2NOGA 3GZ5A 1TTYA 4Z05A 1VQ6I 3PA2A 4X8IA 1KD1D 1I50J 1EE6A 1OFLA 1W2BB 1VQ5B 1K6YA 2WAQA 1T39A 3G4SB 2JK3A 4F91B 3AVWA 2YWEA 3JREA 3GFLA 2BW3A 2GXGA 3OS1A 2VBUA 4XRMA 2YWHA 3FXMA 1YJ9I 2E71A 2Z6BD 2XPUA 4FQGA 4G7XA 2RAEA 4XBFA 1VQ7I 2IBDA 2XNJA 5TRDA 4KICA 3U2QA 1BJAA 2P7VB 4CZZA 4BE1A 5AN9A 2NVXJ 3SFIA 2FOKA 2QKMB 2TRTA 3GYHX 3ZPPA 1YG2A 3GLLA 2LTPA 3CXCB 1PP8F 4CZCA 2VKVA 4Q5SF 5GPAA 1CQTA 1F43A 1R5NA 2A68F 1WI3A 4HBLA 5GADJ 1K7AA 1TQPA 2VBZA 2O0YA 2FD5A 5FKNA 2GJRA 1ZM2A 4WZTA 5IYCJ 2BX6A 2BYVE 4RDKA 5K7HA 2ADUA 4A12A 2QSGX 2VL8A 4RD4A 2X1EA 1MH4A 2DU9A 3K2ZA 1HOMA 3L9FA 5FJ8J 1KK0A 2IVMA 5FB2A 4ZTJA 2VJJA 3QAHA 1IB0A 5K5RA 2X6OA 4PCQA 5A2QK 3DXJF 5JLXA 4ZDPA 4HW0A 1OFMA 1MSEC 4PABA 2GK6A 4QV2A 3VMWA 1WU8A 2QE7A 3D5SC 1NJID 2Z5UA 1H9TA 4WZLA 1OB5A 4M9SA 1D8KA 1E2XA 1CNEA 4I98B 2WPDA 1FYLA 1Q81D 3LYCA 5D5WB 2LKSA 5IYDJ 3A8IA 2DXIA 1DQUA 1FP1D 4LFUA 3JQPA 4DQ2A 2M87A 3GQ8A 5KVRA 1BIBA 4L0ZB 3J80Z 2GREA 3SXYA 2FNPA 1J7KA 4A6EA 2C2WA 3D0SA 1YX2A 3CDIA 4FETA 4C3HJ 2MABA 1D5VA 2HFHA 4LMYA 1MMDA 2JJ1A 5BSYA 3BCFA 2NVTJ 5CVUA 2MSYA 2A5YB 2O04A 2CFOA 5E8GA 3KCCA 4PZJA 5H2FC 1ORKA 5J6XA 1OCTC 5J3OA 5HODA 2DOAA 3RSNA 2P7CB 2P4WA 3ZPNA 2JDIA 2MW8A 2ZXWH 4U9UA 5EZGA 1FNCA 2O03A 2JWTA 1S72I 4A5NA 1ETQA 3HZJA 3SFZA 1QVGB 4P2NA 3OPOA 2OZ6A 4RMNA 4M53A 3PNTA 5E79C 4IQJA 1FIPA 2W7ZA 1E3HA 4HZFA 2MD0A 3SZGA 1TUIA 3C1DA 5D5UB 2LLKA 2HXIA 1WORA 1Y39A 3CF5F 2CS3A 5F4JA 1WSUA 4ZCLA 2VBEA 2E5ZA 3GFMA 4DZPA 1Y0UA 3J80K 4W97A 1VQ4I 3ZZTA 2A6TA 5F27A 1X2MA 1R5ID 3BPXA 1FTTA 2X1CA 5IYQA 1MMGA 2VFNA 4MYUA 3CUQA 2A07F 1FYMA 2CGPA 3S1MJ 3L2RA 1O8FA 2BMWA 2EPFA 1HKTA 2FBIA 2DYIA 4HWVA 2EFGA 3OZUA 4TSFA 5DUKA 1T38A 4B8XA 1V5GA 3S32A 3A4CA 1X1BA 4XLHA 3CCLB 4CYDA 1EJ9A 2ZFWA 3OV8A 4CHUA 2OF7A 3CUQC 1SD6A 5KW9A 1Y56A 5JR3A 3H0GJ 4DNTB 2DA6A 3FMRA 1GVJA 3HKZN 3TDUC 1YIJI 2O8KA 2GIVA 2RQPA 3L2UA 4G5GA 4CDGA 4M2LA 4G9YA 1VQOB 4B3GA 1OOCA 2G0YA 4L5IA 4TMWA 1VQLB 1Z67A 1QU3A 2HXOA 5IY5H 2CQQA 4DQLA 3WTSC 1KU2A 1G3WA 4ZYGA 3ES9A 3CLQA 3HHHA 3P9IA 2X0KA 2IS6A 4A3LJ 2YWGA 4EQQA 3HC7A 3M8EA 3H0DA 5HVQC 2ZNZA 1BBYA 2VJ4A 3IRQA 1AWCA 4LLNA 3IWFA 1QFZA 2QENA 4EGYA 1QRBA 2XAQA 3OMYA 3T53B 4LGWA 5DUIA 4G7OF 2ICWG 1TNTA 1UHSA 4NC6A 2R4GA 4BJ6C 1QUEA 3D5LA 4S04A 3BCDA 1FBUA 3K7AJ 4G12A 5J4VA 2WB1A 2CUZA 3JRGA 3R61A 3AG2H 3OIPA 1GXQA 1GVHA 3MKZA 1JJ6C 3LQEA 3CCLI 1JA1A 3MMPA 3PSFA 2ZCWA 5CVVA 2NSTA 3RI4A 1WFXA 4G7WA 4E7HA 4PMHA 3OS2A 1IO2A 3DKXA 1H8EA 5IT3A 1DBOA 3CCEB 5D4SA 4PJ0C 1B6AA 1RETA 2A6EF 2DT7B 1W7PD 4G7ZF 1HBXG 3WYAA 1GO2A 2WSSA 4JQFA 3U2RA 4WZEA 2J7KA 4I02A 1VQLI 1TWGJ 2V79A 3QFRA 2F5FA 2X51A 4KN7X 3IKVA 2JN9A 2PLFA 2ME6A 2X8KA 3R0JA 4MLOA 5BPDA 1BM9A 5H6QA 2JRMA 4BAYA 4HG2A 1NBMA 1OMIA 4BQNA 2BM6A 4EW9A 3AL0C 3FJOA 1WJDA 4P5OA 1UMQA 3DP7A 4RGXA 1I6XA 1VQMI 5JBQA 3LA7A 3ZZUA 2Y0SN 3H1CA 3S1RJ 2EFWA 3A8JA 1CLWA 1KYWA 3T8RA 1G2HA 1P2FA 1OCOH 4C30A 1ZG5A 2OBPA 2IGKA 4MGRA 3HOTA 1HCRA 1P4MA 3GQ7A 2XZLA 1D1CA 3S3NA 3KEWA 3MAJA 3K0LA 4HOBA 5JHUA 5FLXK 2RNGA 2BY1A 4B4CA 1EH7A 1B9NA 2YSRA 3G71I 1LFBA 2ZBVA 1RMGA 3J81K 2H6BA 2OZUA 4CSWA 4EJUA 3K70D 2DMTA 1HLVA 1OYYA 2BF4A 1QVTA 3FM3A 4AF7A 2OBSA 2MH9A 4XLAA 4C43A 2DPDA 3VOEA 1SVMA 1SKQA 3CMMA 1DU6A 5LMZA 1JKQC 2HMAA 4ZYEA 3ASSA 1K73D 2UVEA 5DCFA 4A3KJ 1R5OA 5IP9J 3TDZC
chains in the Genus database with same CATH topology
2WJVA 2O17A 3LSGA 4LIVA 1O8DA 4ZC3A 3LMWA 2HQAA 3L2WA 1O8HA 2R7WA 5FRMA 4KKTA 2M5SA 4BE2A 4TKOB 4BJTA 1O8IA 1G59A 4BQOA 2VBKA 2PYHA 1DGWY 2DCEA 4AYBA 2CV0A 2NT6A 2L5QA 4BGDA 2OUMA 3T9GA 2WAFA 1WJBA 3DPLC 1D0YA 3A2KA 4IQ4A 3RTRA 3OS0A 3OWTA 2LOOA 4B48A 4U87A 2XSJC 3A35A 4PSWA 2V26A 1PYVA 4XN3A 1UD2A 4MR0A 1N77A 3LSHA 1PKVA 2HDWA 3SEZA 4B3XA 1SFKA 3LSMA 1OHHA 3GQAA 3IAS2 3NWTA 3W2WA 4YEJA 3K4LA 4C2TA 4NUBA 2ZZQA 2INUA 5CKTA 2GOMA 2ZSHB 4IZZA 2HZDA 2XAUA 1O8EA 4XQFA 2XF6A 3G2BA 2JA2A 4BDYA 5LFAA 3SDBA 4W8QA 2L9SA 1WPCA 2VBMA 4YZ0A 4OAZA 2MC4A 2E1MC 1X1CA 4URRA 2LYCA 5CQEA 3QOEA 3K4NA 2X3HA 2VQHA 3PJRA 4KISA 3W3CA 1W9XA 2UV1A 3EQNA 2BOLA 2VIXA 2HVQA 2VQGA 4P22A 4YZQA 1IDJA 1MW7A 3EUAA 2IS1A 1VBLA 2QXZA 4KT6A 4QPOA 2LH9A 1QCXA 3HPHA 3MMYB 3VDXA 4XKCA 3TMOA 3OYKA 4DIQA 4RLFA 3W2VA 3PUBA 1FMWA 1FMVA 2UUZA 4HEA2 1BOBA 2W00A 3H9GA 4B3FX 1UELB 4E7SA 2R7XA 4DJAA 3BC9A 5JHFA 3DEEA 1X4PA 2IGMA 2HNHA 4Y3OA 4FASD 1TT0A 2OV7A 3H5AA 3DDYA 1Z7LA 2DT6A 2X53S 4N4NB 4Y4RA 2BW3B 3TBIA 1KCCA 3OOUA 4BUPA 1W36C 3QYFA 2BVLA 2HPIA 2X1DA 3PNVA 4TT3A 3GRHA 1O8MA 3GQBA 3M1CA 4U4BA 3KX2A 1D0ZA 1R6RA 3U21A 4BU2A 4W8SA 2UVFA 2ZZGA 1MNDA 2W7NA 1I8DA 4CCMA 3K4BA 3OYNA 1PLUA 3K6GA 4ANJA 3RPUD 1P9QC 3OOCA 3HG9A 4BXFA 2V4JC 4OWRB 5AMVA 3SUCA 1DP3A 3CESA 3FKJA 2V9KA 4ZYAA 2ELJA 1UD8A 2W6JA 1ZELA 3HPGA 4BE0A 3KEYA 1BR1A 2QY1A 2ZTNA 1H80A 3QYBA 3T51B 3VYRB 4DBQA 1N78A 3IAM2 4XN0A 3DWLE 3VYUB 4YXWA 4CUGA 2MYSA 4XORA 1MMNA 5HOOA 2R7TA 1V5FA 3V42A 4HIZA 1TZLA 1U0JA 4E0FA 4Z1MA 1NRKA 4E6KG 1O8LA 4CA0A 2RQQA 2WZPP 1KCDA 3ZXSA 2LRDA 4YZXA 1GLNA 4YELA 4DK0A 3MD2A 4AU7A 4CCLA 3OYDA 5KCMA 3ZR8X 1BLIA 3FBNB 3DKYA 5C1CA 1MNEA 4E7ZA 3C2GA 4XM3A 3OEHA 4LIUA 2GJKA 1VJSA 4Y33A 3D5RC 1H8HA 1WJFA 2XF7A 2R9VA 2O0VA 3DPUA 2E1BA 3SEQA 2D3LA 2PYGA 3JU4A 4E4HA 3ONQA 5HKKA 2CMPA 4OJLA 3S3MA 4YZAA 1BMFA 3W2AA 2V1NA 2XF5A 3RCOA 3H5NA 2ZZEA 3G05A 1MMAA 2F4IA 4W8TA 3A3GA 2NOJB 2LC2A 3H35A 5KNLA 1MABA 3UW0A 2CW8A 1VLYA 2PMZA 2WBMA 3DTIA 1OGOX 1J09A 5C1EA 3VSTA 2VJIA 2Y0SA 3I3LA 1K28D 2E5NA 4BDZA 5HLTA 2KZVA 3UR3C 3BC8A 2F5VA 2KLOA 3MKWB 2E1MB 3FBIB 2ZSIB 2VQCA 2NSPA 2LBFA 2ZXIA 4YRVA 3L2VA 2V4DA 4GQNA 1X0CA 1X4OA 3ZIAA 3M8JA 1SKYB 4HPQA 4F93B 3IP4B 1JTAA 1LKXA 2VASA 2W1OA 2X6XA 4ZDOA 1UD6A 4XLCA 1YX5A 3DTEA 4JOMA 1HG8A 2ZXHA 3K4CA 3LNNA 1WJAA 3EQOA 2KMUA 4JMQA 2Q2EB 1KZLA 2O5RA 4B47A 4OZYA 4J01A 5DN6A 1QHGA 3F9KA 3GBGA 3A3BA 2P0WA 3LSIA 4HRIA 2WADA 2GJPA 4XL9A 4D1QA 3GVJA 3JURA 2GOXB 3BCAA 2VKDA 3CJRB 3TL4X 1COWA 3OIQA 3UNGC 3ZCOA 1W36D 3IUOA 1D0XA 4PUSA 5FROA 2UWMA 3LSKA 2DJIA 2PJRA 2KRCA 3OR1C 3RQ4A 2NTQA 2DIEA 2R7VA 1UD4A 2MFZA 4B43A 2A5WA 3PL8A 2RREA 1BPLA 3L2QA 5LD2C 1QHHD 2XNDA 4XKWA 1V0EA 2BSPA 3EUHC 1T0FC 1G8XA 2XZPA 3KYLA 3DLAA 1O8GA 1UAAA 2VXZA 3OL4A 1AIRA 4OJ5A 2KPMA 2K5CA 4XOTA 3N05A 3VSKA 1NG6A 4IKFA 3H94A 4PJJA 5TGTA 4CH7A 2HVRA 1QJVA 2VKHA 4XONA 1PJRA 1WTHD 3B4NA 3A1YA 1V5EA 2IS4A 3OYHA 2EWEA 3OYIA 3B8YA 4OJOA 3OYCA 3K4JA 2JVHA 4W8RA 4PFOA 3DQVC 4XKBA 2AQFA 2F6CA 2ZZFA 1KONA 3H9JA 3FPPA 4Z03A 2LY1A 3J7AY 4LG3A 4G6IA 1XG2A 2JUGA 2M7BA 3DTKA 2QKLB 4NC8A 4NNJA 3OY9A 3VYSB 2CK3A 2WY7Q 2L2OA 1AA7A 2IGOA 4XKVA 3VR6A 2JJ2A 1RU4A 4Z05A 1VF7A 4X0GA 2AQEA 3HAGA 3DU5A 1EE6A 1OFLA 4QPQA 1NG7A 4F52A 2CH0A 1K6YA 2CV2A 2WAQA 3OW7A 1D1AA 4F91B 5IK2A 2BW3A 3OS1A 2F43A 2Z6BD 4G7XA 2HU9A 4CCOA 1WMRA 4DNRB 2X6YA 1X1AA 3BCBA 2L7KA 5FL7A 3C2HA 4ZJZA 1UD5A 3OYEA 4BE1A 2XDVA 3S8PA 2Z1DA 2QKMB 2ZTGA 4DK1A 3ZPPA 3EPZA 2HPMA 2IQ7A 2WJYA 3E0JB 4CZCA 2V6EA 1WJEA 3OYLA 2IS2A 3B90A 2KL4A 2Q1ZB 4BEHA 3OR2C 2R7OA 1E1RA 2GJRA 2LBFB 1T95A 3ZRGA 4N4OB 4PK4A 2R7UA 4U7BA 3E1SA 4PFPA 2NTPA 1BR4A 2FUG2 2VL8A 2M4GA 3HKZA 1N75A 2KDOA 2X1EA 5CPRB 4BJ5C 2CV1A 4B44A 4XD7A 3H9QA 2VXDA 4ZTJA 4BS9A 2VJJA 4LITA 4F55A 1E3ZA 2LZJA 2M0MA 1IRXA 4ZDPA 1LVKA 3CP8A 1HA8A 1JRGA 2JIZA 4II2A 1OFMA 2O0WA 2Z2SB 2X6WA 3LFUA 2GK6A 2INVA 3VMWA 1OR7C 2QE7A 3D5SC 1ERDA 3HUGB 2XOKA 4RLQA 2X85A 2WPDA 2L9NA 4XLEA 2F1MA 4E7JA 3K10A 1DGRM 2I8DA 2DXIA 1DQUA 3FDYA 3GQ8A 5HNHA 2NTBA 1OLTA 1D1BA 5HNFA 3ZGKA 2KQRA 2LG4A 4FETA 4BACA 3VWBA 2ODLA 2MABA 2W82A 4GRIA 2GK7A 1MMDA 2JJ1A 3BCFA 2O04A 3PFYA 4CCNA 1IA5A 2VLAA 2CFOA 2IGNA 3LL7A 2DOAA 3RSNA 1WP6A 2E60A 1OGMX 3ZPNA 1T5EA 4PJMA 2JDIA 1KTWA 3DPTA 4BL0B 4HSRA 4RMNA 3OPOA 2ZFUA 3BG7A 2JSPA 3PNTA 4CCJA 4E7LA 4IQJA 1WJ5A 1X19A 2V7FA 3DU6A 2KVOA 2NZMA 2MD0A 3SZGA 2KHMA 1O88A 2WY8Q 3OAAA 1DBGA 4EATA 2K9LA 3VYTB 2CS3A 1PXZA 2VBEA 2E5ZA 3CZ6A 1E79A 1BR2A 3ZQQA 4PJNA 1VZ0A 2A6TA 3OYMA 4KJZA 4DBRA 2BVMA 2X1CA 4XLFA 1MMGA 2KP6A 2VJ5A 4ITVA 4MXNA 1LDKB 2PECA 3L2RA 2KRHA 1O8FA 4G6TB 1IB4A 1RWRA 3ZSCA 3BH4A 3CF2A 3HXLA 4F92B 4HWVA 4U49A 4TSFA 3T56B 2M4KA 4IX7A 3AFHA 1V5GA 3BG6A 3S32A 3NE5B 3A4CA 2VB6A 1X1BA 4XLHA 4C2UA 2IXSA 3FY3A 1LFPA 3I9V2 1I18A 4C9YA 4RM2A 3GVLA 3OFNA 1Y56A 1Z3YA 4P1WA 3GQ9A 3VMVA 4DNTB 1BN8A 4HNTA 3AKZA 3PSIA 2QX3A 3L2UA 4E7KA 4B3GA 1OOCA 3CJQB 2Z8GA 3K4MA 4HSTA 4BQQA 5KHDA 2JVGA 4II3A 1QU3A 4KKSA 4R79A 3HL2A 3WWGA 1JI8A 1PE9A 1CZFA 3QYEA 4PSXA 1UD3A 1YE9A 2HLDA 2IS6A 1OB0A 3HC7A 3H0DA 1O8JA 5HVQC 3MKYB 2NT9A 2VJ4A 2V31A 2M7AA 4XOPA 3KRGA 3OMYA 3T53B 3WQZA 3K70C 2PJRB 4NK6A 2R4GA 3H5RA 1X1DA 4H4KC 4BJ6C 1KMHA 3HOSA 3FKSA 3D5LA 4XMYA 3BCDA 4RM3A 2WB1A 2CUZA 4NC7A 3OIPA 1Z3XA 4DGWB 4NQWB 3MKZA 4AVZA 1E0EA 1W0KA 3PSFA 2V7QA 2K3PA 5CQGA 4F3QA 2NSTA 1WFXA 4G7WA 3OYAA 4E7HA 4PMHA 3OS2A 1W0JA 3DKXA 1H8EA 2XZOA 1FX0A 1DBOA 3K4KA 2CUJA 2DT7B 4KKUA 2WSSA 4JQFA 4Z06A 5FRNA 2XGJA 3VSVA 1HZEA 1SAUA 2X51A 1O8KA 4XNFA 4KITB 4OJPA 3BLYA 2X8KA 4PJLA 2R7QA 1V0FA 4MLOA 2R7RA 3GVKA 4BEHB 3VSUA 1EA3A 1E3XA 4HG2A 1NBMA 2HVSA 4BQNA 4EW9A 3AL0C 1WJDA 4P5OA 3OEEA 3EUKL 1Z21A 2WAEA 4OJ6A 1IDKA 3AL0B 3OYFA 2W6IA 3OE7A 2M3AA 3FHNA 4I84A 1GQ8A 1UG0A 4OAYA 4FXUA 3NWSA 1WJCA 1S9HA 4C30A 3OYGA 2CW7A 2IGKA 4OZZA 2VPLA 3VSLA 4XR6A 3OYJA 3HOTA 2D3NA 3GQ7A 2XZLA 1D1CA 3S3NA 2K9MA 3KEWA 1HVXA 4NK8A 4L8JA 3OL3A 5CDFA 2RNGA 4C2LA 1K5CA 4DOZA 4CCKA 2WA0A 3PNYA 1Y6IA 4J00A 1RMGA 4CSWA 2XC7A 3CP2A 3OYBA 3K70D 1BHEA 2Z16A 2OC6A 4HNUA 1E43A 1YX3A 4D9JA 2W4SA 1NHCA 1EFRA 2VQLA 4XLAA 3QODA 3S93A 4UZUA 4ZDLA 3CMMA 4ZTFA 4ASUA 2LY2A 2R7SA 2O1DA 3S3OA 2UVEA 2LREA 3LMMA 3SYTA 4E7IA 1E1QA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1WMR A;  2O17 A;  1O8L A;  1O8D A;  3VMV A;  1KCD A;  2X6Y A;  4YZX A;  1BN8 A;  4YEL A;  3LMW A;  2QX3 A;  1OOC A;  5C1C A;  2Z8G A;  3ZPP A;  1O8H A;  4XM3 A;  2IQ7 A;  1O8I A;  2O0V A;  3WWG A;  2PYG A;  2VBK A;  1PE9 A;  1CZF A;  2PYH A;  3B90 A;  2NT6 A;  4OJL A;  1O8J A;  3T9G A;  4YZA A;  2NT9 A;  4W8T A;  4XOP A;  2NTP A;  3KRG A;  4XN3 A;  4MR0 A;  3UW0 A;  4NK6 A;  3VST A;  1OGO X;  5C1E A;  2VJJ A;  3GQA A;  2VJI A;  4XMY A;  4YEJ A;  2INU A;  1O8E A;  1JRG A;  4XQF A;  1OFM A;  2O0W A;  4AVZ A;  2X6W A;  2INV A;  2NSP A;  3VMW A;  2NST A;  1X0C A;  4W8Q A;  2VBM A;  4YZ0 A;  2X85 A;  1JTA A;  4PMH A;  2X6X A;  4XLC A;  4XLE A;  1DBO A;  1HG8 A;  4URR A;  2X3H A;  3EQO A;  3GQ8 A;  4Z06 A;  2NTB A;  3EQN A;  4OZY A;  3VSV A;  2ODL A;  1IDJ A;  1O8K A;  1VBL A;  4YZQ A;  4XNF A;  2QXZ A;  4OJP A;  4XL9 A;  1QCX A;  3JUR A;  2O04 A;  1IA5 A;  3VSU A;  4EW9 A;  1OGM X;  2NTQ A;  4OJ6 A;  1IDK A;  1KTW A;  1KCC A;  2BSP A;  4XKW A;  1O8G A;  4I84 A;  1GQ8 A;  1AIR A;  4OJ5 A;  3GRH A;  1O8M A;  4U4B A;  4XOT A;  2NZM A;  4W8S A;  1QJV A;  4XON A;  1O88 A;  2UVF A;  3B4N A;  4OZZ A;  1DBG A;  4XR6 A;  2EWE A;  3B8Y A;  3GQ7 A;  1PLU A;  4OJO A;  1PXZ A;  2VBE A;  4NK8 A;  4W8R A;  4Z03 A;  1XG2 A;  3GQ9 A;  4C2L A;  1K5C A;  5AMV A;  3SUC A;  4XLF A;  1RMG A;  4XKV A;  4MXN A;  2PEC A;  1BHE A;  1RU4 A;  4Z05 A;  1O8F A;  1IB4 A;  1RWR A;  2QY1 A;  3ZSC A;  1NHC A;  1H80 A;  1EE6 A;  4XLA A;  1OFL A;  4HWV A;  4U49 A;  4XN0 A;  2O1D A;  2UVE A;  4XOR A;  4XLH A;  3FY3 A; 
#chains in the Genus database with same CATH topology
 4X0C A;  4A3B J;  3G1L A;  3R6S A;  2QQA A;  3PO2 J;  3LMW A;  2KT0 A;  4N9I A;  2R5Z B;  1Z0X A;  4A3I J;  1XSX A;  2Y31 A;  1OR7 A;  1XMK A;  3L2W A;  1UG2 A;  4YG2 F;  2R7W A;  2ECB A;  2TDX A;  2M5S A;  4TKO B;  5EEA A;  4BJT A;  1U9N A;  2JN6 A;  3ISP A;  1G59 A;  5IT9 Z;  2DBB A;  4M6V A;  4BQO A;  2VBK A;  2EWN A;  2P3M A;  1XC5 A;  4AYB A;  1YIJ B;  2NT6 A;  4FN5 A;  1EP3 B;  5F4O A;  2VFQ A;  5K7F A;  3Q9S A;  4I01 A;  4RPB A;  4W1U A;  5FA6 A;  3A2K A;  4IQ4 A;  1OPC A;  2V6C A;  3OWT A;  3RTR A;  3QSY A;  5DDG A;  3S16 J;  2LK2 A;  2XSJ C;  5IYP A;  3CMA I;  2RGV A;  4M3D A;  1RIO H;  1OGJ A;  1PYV A;  4XN3 A;  3A35 A;  3CW2 A;  3B6A A;  1N77 A;  3LSH A;  4WX9 A;  4RDU A;  3WGG A;  3HSF A;  3P27 A;  5L3G A;  3FXU A;  3NWT A;  3GQA A;  3RIQ A;  2Z9O A;  3KZZ A;  1Z6T A;  1O8E A;  1ZKG A;  3HHG A;  3MKL A;  3J81 k;  2YX4 A;  2ZIT A;  5TIS C;  3G2B A;  2P5K A;  1MSF C;  4Q48 A;  4IOA F;  2JA2 A;  4BDY A;  3W2E A;  1DP7 P;  3V76 A;  3HSE A;  5D8K B;  4XRS A;  4HX4 A;  3F72 A;  4UB8 C;  1X1C A;  4FIS A;  2VUM J;  3HOW J;  5M3F J;  3BJA A;  2VOO A;  5CQE A;  2X3H A;  3GTP J;  1V3F A;  3ZC3 A;  1LM1 A;  3W3C A;  2UV1 A;  3FXK A;  1IDY A;  2EIJ H;  2GQF A;  2BOL A;  5ILV A;  1VTN C;  4WZK A;  3V7A A;  4A3E J;  1SD5 A;  2F4N A;  4UY8 I;  1VBL A;  4YZQ A;  5J3L A;  5FKO A;  2LH9 A;  5J8C A;  3HPH A;  3GTG J;  2NPF A;  4QSH A;  1I39 A;  5LRS A;  1WH5 A;  1B72 B;  2E35 A;  1FMW A;  5FKK A;  3H9G A;  3FX3 A;  4YAW A;  1ON2 A;  1SVL A;  1IV6 A;  2R7X A;  3MCA A;  2IGM A;  1S6L A;  4ENJ A;  1ZGJ A;  2LDU A;  4Y3O A;  3LA2 A;  1Z7L A;  2DT6 A;  1QZE A;  3BTJ A;  3PET A;  3WGH A;  5FFZ A;  2KIQ A;  3OOU A;  2CBX A;  3HB9 A;  2JTV A;  4HV5 A;  2WTE A;  2X1D A;  1KQ5 A;  2EA4 A;  4IJA A;  3CC2 B;  2DY1 A;  1R6R A;  2HYJ A;  3PEN A;  4W8S A;  1EKE A;  2DDB A;  2VFP A;  5J35 A;  4K2E A;  4BPR A;  3GZ6 A;  3EQL F;  2JPC A;  3RJP A;  1PLU A;  4ANJ A;  4RAY A;  1B59 A;  1FDR A;  3LQQ A;  3HG9 A;  2AS5 F;  3NAW A;  1FT9 A;  3GO5 A;  4XSX F;  3JSO A;  4M9X A;  2XV4 S;  2NS8 A;  2YU3 A;  3I56 I;  1R4N B;  1WKM A;  2V9K A;  1ZRE A;  4X06 A;  1ZEL A;  2CQN A;  4RM0 A;  2J5O A;  3KEY A;  1HKS A;  3JAM Z;  4FK8 A;  1FBS A;  3AK5 A;  2ZTN A;  2H94 A;  2ME0 A;  4FHT A;  3VYR B;  1J0R A;  2A05 A;  3IH4 A;  1R5G A;  3DWL E;  5CLS A;  1Q9S A;  1GAW A;  3VYU B;  4AYB N;  1FND A;  3GFJ A;  2MYS A;  1ELO A;  2VFM A;  2QGG A;  4PGH A;  1JUS A;  3ZOB A;  4PGG A;  2FSW A;  1IV8 A;  4YIR X;  3ESW B;  3L7W A;  4A3J J;  1O8L A;  4CA0 A;  2W57 A;  4BBS J;  3H09 A;  1G7T A;  2LRD A;  2Z99 A;  1WSV A;  3MD2 A;  3OYD A;  1Q1H A;  2Y9Y A;  3W2F A;  3DKY A;  5F4M A;  3PIO F;  1Z7U A;  2O3F A;  1F4K A;  2H8W A;  2GJK A;  1VJS A;  1JB9 A;  3D5R C;  2W48 A;  3CMA B;  1KK1 A;  3IH3 A;  2XRO A;  5HKK A;  2UZK A;  4WF2 A;  3CC4 I;  1M1K D;  4LB5 A;  3S3M A;  4YZA A;  4GYG A;  5TR9 A;  2V1N A;  1JKO C;  3KEQ A;  3H5N A;  1VLO A;  3MFK A;  4A2U A;  1YFH A;  4E70 A;  3CCJ B;  2Y75 A;  4W8T A;  4Z4R A;  5EEH A;  4UVB A;  3A3G A;  3I56 B;  2LC2 A;  3H35 A;  1Q86 D;  3FKI J;  3ML3 A;  2FF4 A;  3G73 A;  5E1W A;  1VLY A;  5HS7 A;  2ID3 A;  4G6Q A;  2JMW A;  1OGO X;  1JKP C;  3CDL A;  1R1V A;  4G8X A;  1IJW C;  5JVG F;  1QA6 A;  2E5N A;  2E19 A;  5DD8 A;  1EZG A;  4RB2 C;  3FBI B;  1BI2 A;  1W34 A;  3L2V A;  3GTL J;  2EFQ A;  1KQ8 A;  1B8I B;  1XQB A;  3ZIA A;  4C0S A;  1SKY B;  2QQ8 A;  4F93 B;  5LGT A;  1LKX A;  2GM4 A;  3S1Q J;  2WZN A;  3DTE A;  4C3J J;  1IJF A;  1K78 A;  1HG8 A;  3K4C A;  1YQA A;  3LNN A;  3LJY A;  5KK1 A;  3PVD A;  4JMQ A;  3RKW A;  1VQO I;  1KZL A;  1RR7 A;  1T33 A;  2O5R A;  2VKE A;  4IHT A;  3QE2 A;  4OZY A;  1WGX A;  5DN6 A;  3JCU C;  4IRG A;  2LNB A;  5ILU A;  1PUF A;  4ZZD A;  3LSI A;  1HSJ A;  1YIT I;  3GTM J;  3JUR A;  5HS8 A;  1RUN A;  1VQK I;  3CJR B;  3TL4 X;  1R9T J;  3ZCO A;  2E2I J;  1QUF A;  2H6C A;  5FRO A;  3VMF A;  5J1Y A;  2PMH A;  4UV8 A;  3SJZ A;  2CQX A;  2HKO A;  5JVT A;  2DFF A;  3SKB A;  1UD4 A;  1UFM A;  3WBJ A;  4HV6 A;  4A3F J;  5F0H A;  1AOY A;  2BSP A;  5LD2 C;  1ZN2 A;  4UB6 C;  1A6I A;  4XKW A;  1V0E A;  2XND A;  1T0F C;  1O8G A;  3I64 A;  2XZP A;  1HA3 A;  2QEX B;  2FJ1 A;  2VXZ A;  3KIO A;  1IAW A;  2L4A A;  2K5C A;  1SFU A;  3VSK A;  1I6H J;  5DCM A;  4NDL A;  1NG6 A;  5TGT A;  4IRI A;  4OP7 A;  3M8F A;  3WTV C;  2VKH A;  3F21 A;  1PJR A;  3FXQ A;  2P6S A;  1T6Z A;  1WTH D;  3B4N A;  1V5E A;  2VT2 A;  3GSI A;  5LEJ A;  2QQ9 A;  2XVC A;  4BNC A;  3LSP A;  3K4J A;  4YAL A;  2PEX A;  2X9D A;  3SZP A;  4W8R A;  3VNV A;  2AQF A;  1KON A;  1Y1W J;  1BX0 A;  1N0V C;  1W0T A;  4UXN A;  3OY9 A;  1N8R D;  3U1D A;  5K5Q A;  3M1E A;  4PC6 A;  3JSP A;  5B66 C;  1LNW A;  2IGO A;  4XKV A;  1YRN B;  1RU4 A;  2EIX A;  1OCR H;  3QFC A;  1ZRC A;  3LWF A;  2M1B A;  1VF7 A;  4MTE A;  3GVA A;  1IDZ A;  2CC2 A;  2AQE A;  3HAG A;  3DU5 A;  2B5O A;  4QPQ A;  4E7I A;  4QLC U;  1K9M D;  3G4S I;  3BY2 A;  3IC7 A;  2CW0 F;  3HRT A;  2CV2 A;  3OW7 A;  2MGQ A;  1W4M A;  1BA5 A;  1LE8 B;  2JA8 J;  3OZW A;  1OFE A;  4DW6 A;  5D5V B;  1H89 C;  5HLI A;  3EYY A;  5FL7 A;  4YEI A;  1VF9 A;  1UB9 A;  3BR2 A;  3B73 A;  4HQM A;  2NYX A;  3WHC A;  4DK1 A;  2DYR H;  2ZME C;  1T98 A;  1W7P B;  2YPR A;  2WJY A;  1X1P A;  3E0J B;  3O3K A;  1UHW A;  5E6T A;  1S72 B;  1PJ5 A;  2F1L A;  3OYL A;  2M30 A;  1JTX A;  1S4M A;  4BEH A;  4RB3 C;  3OR2 C;  3CRZ A;  2L02 A;  4OOI A;  4I7H A;  4NBS A;  1IGN A;  4N4O B;  3A02 A;  1P6R A;  4PK4 A;  4ACB A;  2A61 A;  3V4G A;  1F36 A;  2NTP A;  1QRY A;  5CPR B;  2CV1 A;  3HKZ A;  4BXU A;  5HLH A;  2K9Q A;  1ZRF A;  1AMO A;  3O8H A;  1QRC A;  4BS9 A;  4HX7 A;  4LIT A;  2DMP A;  2PMZ N;  2LZJ A;  1XMX A;  2ESN A;  3ABU A;  4XSZ F;  4OMY A;  1MMS A;  4G1B A;  4RCZ A;  4X7E A;  1YJN I;  1K8A D;  1LVK A;  3CP8 A;  3ZN1 A;  1VQP I;  2HTS A;  1HA8 A;  4BYY A;  2B0L A;  2O0W A;  4EMS A;  5L3E A;  4ESF A;  1R23 A;  5GTI C;  4YHB A;  2OCC H;  2QA4 B;  4RLQ A;  4F7Z A;  5JFR A;  3JAM K;  3HDD A;  2AXT C;  2FBK A;  4UHT A;  2OTL I;  1F5T A;  1DAB A;  3K10 A;  3KET A;  2HOA A;  1DGR M;  3K1P A;  1GDT A;  1VQM B;  3FDY A;  1LPQ A;  3ZN0 A;  1T8I A;  1IJE A;  4RBO A;  2GZW A;  2ELK A;  1RRJ A;  2EIN H;  2OBR A;  3E5U A;  1BI1 A;  1OLT A;  3S2W A;  3WGI A;  1E3O C;  4MYT A;  4UZF A;  1VQ9 B;  4XK4 A;  1ZM4 A;  1L3L A;  1UMK A;  3BR6 A;  5IOY A;  1TWA J;  2MBF A;  3QOP A;  4GRI A;  3BDD A;  1OFD A;  3RPU A;  3BJO A;  1HW2 A;  2V1U A;  4QUZ A;  3W2I A;  1IA5 A;  2O7O A;  1E62 A;  1CGP A;  3VEP A;  3LL7 A;  2Q6O A;  1LDD A;  1YRN A;  1QG0 A;  3CJN A;  1OGM X;  4PJM A;  4DYR A;  3ULQ B;  5IYN A;  1VQ6 B;  4AUX A;  2KJB A;  2GA2 A;  3WU0 A;  1KTW A;  3T0Y A;  3DPT A;  1J59 A;  1G3Y A;  5F1R A;  4HSR A;  1XSV A;  4MFE A;  2JSP A;  2NNN A;  2V7V A;  4V2F A;  3R0A A;  3KEO A;  2V7F A;  2DLL A;  3MEX A;  2OJE D;  2BM0 A;  4QVA A;  2LF7 A;  1NTC A;  2KVO A;  2UXN A;  3NAR A;  3RY8 A;  2F5E A;  3A01 A;  2Y48 A;  3BR3 A;  3RKX A;  4MEY F;  2K9L A;  1LB2 A;  5IYW A;  2ZL6 A;  4HF2 A;  2F5C A;  1TL8 A;  1BR2 A;  1GV5 A;  1JUP A;  4PJN A;  1VZ0 A;  4KJZ A;  3E97 A;  4DBR A;  1ETO A;  4Z4W A;  4RGU A;  1XGN A;  1FOK A;  2KP6 A;  3JRA A;  2R5Y A;  3ZQ7 A;  4Q7J B;  3KYC B;  1RQR A;  4MXN A;  1LDK B;  3IH2 A;  1I3A A;  1RWR A;  3BH4 A;  1U5T B;  2NS7 A;  1KTV A;  4U49 A;  1YI2 I;  3Q0V A;  3BTC A;  3T56 B;  5C4J J;  2QF7 A;  3BTI A;  4IX7 A;  2IT0 A;  2VB6 A;  1F20 A;  1GVD A;  2DJN A;  4RLZ A;  1YW9 A;  4BHB A;  5C44 J;  3ZUG A;  1ULY A;  3S15 J;  3VMV A;  2PMU A;  4HAM A;  1YS7 A;  4RD2 A;  1HF0 A;  5DTD A;  4HNT A;  1W5C C;  4ZYH A;  5ICG A;  3PSI A;  2OU2 A;  3AKZ A;  4E7K A;  3CD6 B;  1A6Q A;  1GT0 C;  1XCV A;  3K4M A;  1APL C;  4HST A;  2BY0 A;  5M3M J;  3B02 A;  4RAZ A;  5JMC B;  3K1N A;  4II3 A;  2C6Y A;  1B1B A;  2EIL H;  3HL2 A;  2EZK A;  5DV5 A;  1B23 P;  1CZF A;  4PSX A;  5FKM A;  1YE9 A;  2FMY A;  1YW8 A;  4FE7 A;  1UD3 A;  1O8J A;  1GJR A;  1X3W B;  3MKY B;  2VBS A;  3A03 A;  3HUG A;  4CYC B;  2DK5 A;  2NXN B;  3IL2 A;  2NT9 A;  5DS9 A;  3HSR A;  4P12 A;  3DFG A;  5M5Y J;  3VFZ A;  4UUT A;  5CVI A;  2KRF A;  4JP0 A;  3K70 C;  3JQQ A;  2PE3 A;  3AVV A;  3H5R A;  3G6E I;  4H4K C;  5F1J A;  1KMH A;  5E3M A;  3HOS A;  3ECO A;  4XMY A;  1TW2 A;  5FO1 A;  4A3C J;  3KZY A;  4RM3 A;  4D5F A;  1LUJ B;  1Z3X A;  2VI6 A;  3G71 B;  2EZI A;  3LAP A;  3W5U A;  4AF6 A;  2IRF G;  5CQG A;  4MEX F;  3BG3 A;  2GWR A;  1F60 A;  4Z4S A;  2ZNY A;  3OYA A;  1REP C;  1EP2 B;  5K7Z A;  1Z91 A;  1W0J A;  2XZO A;  4OMZ A;  2YUH A;  2CUJ A;  1V5V A;  4U0V A;  4A69 C;  4KKU A;  1QZY A;  4DYQ A;  2VNJ A;  2XGJ A;  3WTX C;  2NVQ J;  3VSV A;  2GPJ A;  1SAU A;  2G7U A;  3W6J B;  1R71 A;  3S14 J;  1O8K A;  2JSC A;  2FX0 A;  4KIT B;  4CQJ A;  2PMD A;  3REO A;  3FIW A;  4D7N A;  1XGO A;  2R7Q A;  3E3V A;  3QPS A;  1V0F A;  1TT5 B;  2HCJ B;  3Q39 A;  1OKR A;  2R7R A;  1VQ4 B;  2EV0 A;  4BEH B;  3VSU A;  1E63 A;  1E3X A;  4P6Y A;  5DSZ A;  1GUU A;  2HVS A;  2XTW A;  1YLF A;  5H5J A;  2FA5 A;  1Z21 A;  2WAE A;  2YS9 A;  1IZ1 A;  2D9R A;  3AL0 B;  3ELK A;  3KP3 A;  4FX4 A;  1A35 A;  2QTZ A;  1UG0 A;  1G7R A;  1QPM A;  4M72 A;  3NWS A;  3ASN H;  3BR1 A;  1BW6 A;  3N90 A;  5IYR A;  4EV0 A;  2CW7 A;  1SFX A;  2KIF A;  3S2D J;  1Z1D A;  2CJJ A;  2VPL A;  1FLI A;  4FCY A;  2K9M A;  4X7F A;  4HDV A;  3EYI A;  1P4X A;  1HVX A;  4NK8 A;  4RJL A;  1R49 A;  4C2L A;  4LD5 A;  1K5C A;  1ZG3 A;  4L9V A;  4XLN F;  4PC1 A;  3PM1 A;  3COA C;  4J00 A;  4TV7 A;  4A5M A;  3OYB A;  1U3E M;  2BZT A;  1SM4 A;  2DOE A;  4IHS A;  5TV2 A;  4D9J A;  1NHC A;  1Y8R B;  1QQ1 A;  2QVO A;  4Z2Y A;  5KAI C;  3W2H A;  2IOU G;  4ZDL A;  4ASU A;  2LY2 A;  5HS9 A;  3PQK A;  5D8L B;  4P3I A;  2DMQ A;  3PSS A;  2DFI A;  1I3Q J;  3SYT A;  2BV3 A;  4HYE A;  1E1Q A;  1HDP A;  2K4J A;  3HGY A;  3GX4 X;  3LSG A;  2QA4 I;  3JRI A;  4ZC3 A;  5IP6 A;  2EH3 A;  5DCM B;  1I5Z A;  2K9N A;  2OYN A;  2DA7 A;  1ZG1 A;  3AGP A;  4MQV A;  5DD4 A;  1PJ6 A;  2NV4 A;  4LG0 B;  3A01 B;  1AIP A;  2K3F A;  2HOE A;  3RZO J;  3ZMS A;  2BGI A;  5D4R A;  2VNI A;  4DYC A;  5FRM A;  4KKT A;  4QIW N;  1XDS A;  4BE2 A;  2COM A;  2H8R A;  1YW7 A;  4Y13 A;  1GXP A;  2KKO A;  1H88 C;  2PYH A;  3V7S A;  3PSZ A;  2CV0 A;  2BM5 A;  5TY0 A;  3T9G A;  4IO9 F;  2I10 A;  2VYQ A;  4KA4 A;  2BGJ A;  3PUF A;  2EFN A;  4JYK A;  2BV6 A;  3DU1 X;  2IEK A;  1WCM J;  3QU3 A;  5H6R A;  1UD2 A;  4MR0 A;  2XAS A;  3W6V A;  3BH6 B;  4ZGN B;  2QBY B;  2HQR A;  2HDW A;  3P5J A;  3SEZ A;  4PDK A;  4B3X A;  2DOF A;  2XRN A;  2K40 A;  2DFH A;  1JHF A;  1R22 A;  3HTU A;  3K4L A;  4NUB A;  4YEJ A;  4C2T A;  2HZT A;  5ED4 A;  1KYZ A;  2XF6 A;  3QPL A;  4AIK A;  4I99 C;  4CGZ A;  3KL9 A;  3AVT A;  4YZ0 A;  1X2N A;  2E1M C;  4NQW A;  5JLW A;  1FZP B;  2NVY J;  4YFN F;  1MBG A;  5CVR A;  3MZH A;  1A04 A;  3HIF A;  1VQ8 I;  1G6N A;  2W85 A;  2VQH A;  4D5C A;  3TP0 A;  3L2C A;  2VQG A;  1FEX A;  1IDJ A;  3Q0U A;  2QXZ A;  2V5I A;  4U88 A;  4XRS G;  3QPT A;  1QCX A;  3MMY B;  3FIS A;  3ECH A;  3RDI A;  1U2W A;  3HRU A;  2OA4 A;  4HF0 A;  1S0U A;  3D1N I;  3IHU A;  2QZA A;  4RLF A;  3E6C C;  3GZN B;  3PUB A;  3S1N J;  2UUZ A;  3GW2 A;  1BOB A;  4X07 A;  5EJC A;  4E7S A;  3BC9 A;  1WOO A;  2VFO A;  1X4P A;  4DZJ A;  3ZQG A;  3H5A A;  1ZGA A;  5LLQ A;  3TBI A;  2K27 A;  4AD9 A;  5LGU A;  1D5Y A;  3SLN A;  4V2G A;  5FD6 A;  1TYU A;  3QYF A;  3TO9 A;  2ESH A;  2HPI A;  2YR2 A;  4HX8 A;  2VBX A;  2W24 A;  1O8M A;  3GQB A;  3M1C A;  2M2E A;  3BNW A;  3GRH A;  1W7P A;  2AO9 A;  4L18 B;  1WVR A;  1D0Z A;  3E5Q A;  4BU2 A;  4KNY A;  2UVF A;  4OOX A;  4WXD A;  5BMZ A;  5LHH A;  4CCM A;  3OYN A;  4DQK A;  3F8M A;  3U6B A;  1ETX A;  1K61 A;  2P5V A;  4ZGQ B;  1TC3 C;  3TGN A;  4OWR B;  4X7C A;  1FNN A;  1O7F A;  3SUC A;  1E3P A;  1UD8 A;  3FKJ A;  4RD6 A;  4ZYA A;  2OD5 A;  1OCP A;  3N6Z A;  3LSR A;  5LGN A;  1BR1 A;  4EM1 A;  2EV5 A;  1H80 A;  3FXO A;  3T51 B;  1NK3 P;  4DBQ A;  3IAM 2;  3ZQC A;  3SZT A;  1ZAO A;  4YXW A;  3CCR B;  3OSG A;  3IRR A;  4RAF A;  2ZL5 A;  1MMN A;  5HOO A;  2VOP A;  3QFS A;  3V42 A;  4JX4 A;  1TYX A;  4E0F A;  2DDA A;  4MHG A;  3D26 A;  2E1N A;  2IAI A;  4RGR A;  4EJV A;  2Y0M A;  2OPT A;  1RKT A;  2PBI A;  5IOZ A;  1RR8 C;  1O3S A;  3Q5F A;  1GLN A;  2CUF A;  3TW7 A;  1AKH B;  2O61 A;  1KRH A;  4DK0 A;  1DPU A;  1K4S A;  2A3S A;  5GAH J;  3FBN B;  1A5J A;  4EM0 B;  4LK1 F;  4E7Z A;  3C2G A;  5F6F A;  4P9U A;  1RQP A;  4MFD A;  2VPR A;  1Y0R A;  1WJF A;  2XF7 A;  1R4M B;  4V02 C;  3DPU A;  4YIF A;  4A3D J;  1KK3 A;  3DV8 A;  3JU4 A;  3BY1 A;  4E4H A;  3ONQ A;  1QGY A;  4TN1 A;  3M07 A;  2Y30 A;  1BMF A;  1RES A;  3SZE A;  4M9Z A;  3RCO A;  1BW5 A;  3FXJ A;  3SYJ A;  1XGM A;  1FRQ A;  2ZZE A;  1S7O A;  1MMA A;  2L0K A;  3HEF A;  5BNG A;  1MDM B;  3SJP A;  1JJ8 C;  3V7C A;  4OOV A;  1MAB A;  4A0X A;  2BHY A;  4M4S A;  5E18 F;  2QM3 A;  4S0H B;  1ENH A;  3KLN A;  2O6G E;  3VST A;  2ECC A;  1J09 A;  3BJ6 A;  1OJL A;  1MRZ A;  3B6C A;  5HDG A;  1K4Z A;  2XT4 A;  3LST A;  2E2H J;  2V7U A;  3QP6 A;  4LOC A;  1PUF B;  2XGX A;  3UR3 C;  1V54 H;  2BY3 A;  3HOZ J;  1WRJ A;  4HA8 A;  3EDP A;  3W5H A;  4OU0 A;  4ZYD A;  4HPQ A;  1EXM A;  4HLX A;  2XTY A;  2X6X A;  2DA4 A;  2TCT A;  1MDM A;  2KMU A;  4IXA A;  1I7P A;  1XDU A;  2EZH A;  3G1O A;  1STZ A;  3F9K A;  1IN5 A;  2E36 A;  1KQ0 A;  2HI3 A;  2XB5 A;  3GBG A;  2P0W A;  1KU7 A;  4HRI A;  3DLL F;  3SHF A;  4B09 A;  4XL9 A;  4D1Q A;  4MTD A;  2IA0 A;  3QRF F;  1DUX C;  5THX A;  4TMV A;  3OIQ A;  3O2P E;  3CCM B;  1VQ5 I;  3LSK A;  4BH9 A;  2Z33 A;  2PJR A;  2KRC A;  2XPW A;  2ZME A;  3MN2 A;  3PUM A;  4RPD A;  5KSW B;  2Q8K A;  2MLK A;  3CCS I;  2VN2 A;  4C2M J;  2GLO A;  2HWV A;  3PL8 A;  2RRE A;  4O6J A;  4XRF A;  3LA3 A;  2CF4 A;  1D3Y A;  1TP4 A;  3EUH C;  4AM3 A;  5L46 A;  3DLA A;  3E5X A;  1UAA A;  2BSA A;  1R58 A;  2OCE A;  1G3T A;  3CCU B;  3WTW C;  3WXM A;  1KQ9 A;  2XC1 A;  2EFO A;  4U7D A;  4IKF A;  2JA7 J;  3CDH A;  4FTH A;  1XCB A;  4CH7 A;  1SVO A;  2K02 A;  5HDN A;  3W5V A;  1K79 A;  3A1Y A;  1IN4 A;  3T5X A;  3WE2 A;  1K83 J;  1LEA A;  2X0L A;  4M3G A;  1I1S A;  5GV8 A;  5HZB A;  4P1V A;  3EUH A;  2WZP P;  4Z03 A;  1XG2 A;  2DW4 A;  3F22 A;  1EP1 B;  2M7B A;  2WC2 A;  3DTK A;  2QKL B;  1PVE A;  4G6I A;  4KYW A;  3LFK A;  2XT2 A;  5BOX A;  2HS5 A;  3BP8 A;  4OIP F;  1KQS B;  3VR6 A;  1KC8 D;  2JJ2 A;  4EJO A;  5IT9 K;  2V1D A;  2QSF X;  4I0B A;  2DMN A;  2WB1 N;  1EFU A;  4YFK F;  3HOX J;  3MHP A;  4F52 A;  3PIP F;  4BY1 J;  3CCM I;  5EF6 A;  5CVJ A;  1DPR A;  2C78 A;  1BC7 C;  5E3N A;  1UZC A;  1WMR A;  2F2E A;  4CCO A;  4KN4 X;  3J7Z I;  2X6Y A;  1X1A A;  3I58 A;  1DU0 A;  3C7J A;  3MCZ A;  2KIU A;  3C2H A;  2X4H A;  2BXZ A;  1Y0N A;  3MVP A;  4ZJZ A;  1UD5 A;  5M5X J;  1O57 A;  2XDV A;  3FHZ A;  2C4U A;  3EPZ A;  1I27 A;  2OQR A;  5C3E J;  1MBJ A;  1R36 A;  1O4X A;  3ASP A;  2IQ7 A;  2QDX A;  4NCN A;  1J75 A;  3NQO A;  2DA5 A;  3B90 A;  4KDP A;  3SY2 A;  4X05 A;  2OAZ A;  2R7O A;  2R6H A;  2LBF B;  4P25 A;  4B1R A;  2A69 F;  2CQK A;  1VQN I;  2R7U A;  2VOD A;  4U7B A;  4PFP A;  3CO7 C;  4BJ5 C;  2M4G A;  1JA0 A;  3F6O A;  2BEO A;  1XFO A;  2ZBK A;  4B44 A;  1NB9 A;  2OTJ B;  2Y69 H;  4XD7 A;  2K4B A;  3NEU A;  2J5P A;  4F55 A;  1E3Z A;  4S05 A;  1FOY A;  4N3N A;  4ABZ A;  1IRX A;  2CG4 A;  2MG4 A;  2V9P A;  4UUV A;  3GTK J;  1JRG A;  1SEU A;  1DG1 G;  1JJ2 B;  5GP9 A;  1ZM3 A;  2IJL A;  1N25 A;  3LFU A;  4M3E A;  3BQJ A;  1TLH B;  1ERD A;  3BT9 A;  3HUG B;  2PFB A;  2BBY A;  2RN7 A;  3GTQ J;  5ERI A;  2F1M A;  4E7J A;  2CSO A;  3SLD A;  2I8D A;  2VBW A;  5F0C A;  2XKP A;  2XEX A;  2A6H F;  2EFP A;  1XPX A;  2Z3Y A;  2GA1 A;  3C2B A;  1U5T A;  4C3I J;  1D1B A;  3TQN A;  1YJW I;  1G7S A;  2HQN A;  2BVN A;  1T08 B;  1W1W E;  4MO7 A;  5HNF A;  2ODL A;  2LG4 A;  4BQA A;  4N0B A;  3U1K A;  2W82 A;  1MGT A;  2GK7 A;  1FNB A;  3LNQ A;  3WNC A;  1TTT A;  3PFY A;  3ZP5 A;  1WPK A;  2VLA A;  1BX1 A;  3LVB A;  1CF7 B;  2IGN A;  5C4X J;  3PQJ A;  2YWF A;  2E60 A;  4GYI A;  4QFM A;  4L9N A;  3K1M A;  1T6S A;  2P8T A;  5E1Z B;  4BL0 B;  1MZB A;  2ZFU A;  3BG7 A;  4A3M J;  4CCJ A;  3GUD A;  1BI0 A;  1WJ5 A;  3GME A;  2E1C A;  3O6B B;  1MBK A;  3JTG A;  5LHG A;  3CCQ I;  4M3F A;  3WTY C;  1U78 A;  2FRH A;  4KIG A;  2H1K A;  1N05 A;  4ZCM A;  3OAA A;  5D5X B;  1ON1 A;  1L1I A;  4YAO A;  3OW2 B;  4LLG F;  1FX7 A;  3VYT B;  3GLX A;  3BQY A;  4CIC A;  1MKM A;  2E7X A;  3CZ6 A;  3HTS B;  3ZQQ A;  2FU4 A;  3OYM A;  5IPA A;  2BM1 A;  2BVM A;  1SFE A;  3NAU A;  3CC2 I;  4XLF A;  3PO3 J;  2N8G A;  3JQR A;  1X3U A;  2VJ5 A;  2XPV A;  3A0H C;  4P96 A;  3LO8 A;  3E1Y E;  2KRH A;  1IB4 A;  1EFT A;  1T6X A;  3OIO A;  3CF2 A;  2VNK A;  3WE3 A;  5JI6 A;  3AFH A;  4DNC A;  1VI0 A;  5GPC A;  1U5T C;  4Y7N J;  3ABT A;  3I59 B;  4EEF G;  3NE5 B;  3P4G A;  3F23 A;  2WAQ N;  4WXC A;  4Y17 A;  1LFP A;  3FY3 A;  3I9V 2;  2FQ3 A;  1I18 A;  1HW1 A;  2W25 A;  4RM2 A;  4AIH A;  1OYW A;  3WTZ A;  3WHB A;  4P1W A;  1SFO J;  1YIT B;  3DCF A;  5EG0 A;  4M73 A;  3LQR A;  2BHZ A;  2QX3 A;  4L5E A;  3MQ0 A;  4KIF A;  3TO7 A;  2E2J J;  5HXB A;  1K4T A;  3WNB A;  4FT8 A;  3EET A;  1YJN B;  3CTA A;  2Z8G A;  4BQQ A;  5KHD A;  1SAX A;  2JVG A;  4ASN A;  2L4M A;  5F0F A;  5EZH A;  1HDD C;  2XAF A;  3QYE A;  4Z4Z A;  1PE9 A;  2DEU A;  2R3S A;  4ENN A;  2Q2E A;  1VND A;  3TOA A;  3K2A A;  1FIA A;  1ZLJ A;  3P7N A;  4HQE A;  4Y9U A;  1FC3 A;  2HDD A;  1B2R A;  4RA2 A;  4UUS B;  3WQZ A;  3KRG A;  3H3V K;  1VHE A;  1KK2 A;  1GV2 A;  1YO5 C;  1FOW A;  2FVG A;  3F6V A;  2XIG A;  5L3D A;  1FPQ A;  1E64 A;  1YHQ B;  3ZQH A;  4JRA C;  4NC7 A;  1Z77 A;  3WU2 C;  4AC0 A;  4DGW B;  3BRO A;  1NHA A;  4NB5 A;  4NQW B;  4AVZ A;  4AID A;  2V7Q A;  4OIO F;  2ZKZ A;  1N07 A;  4KT5 C;  3RKY A;  1WWX A;  4UZE A;  1IG7 A;  1Y0Y A;  3BWG A;  4ROX A;  1TWF J;  2HQ5 A;  3I4P A;  2L7Z A;  2D1H A;  2D5V A;  1T56 A;  4IHV A;  3WU1 B;  1S5L C;  1C0W A;  1KA8 A;  4Z06 A;  1FOX A;  2QWW A;  3G3Z A;  4D7M A;  4XNF A;  4QTR A;  3BLY A;  2COB A;  3E6D A;  4AWX B;  4RD0 A;  2DN0 A;  3CCE I;  4I6Z A;  3L00 A;  1EA3 A;  2D74 A;  5DM6 F;  2OBT A;  2NTB A;  2FQ4 A;  2QUF A;  1P4A A;  2C5H A;  3RIR A;  4M6Y A;  2STT A;  3OEE A;  1IDK A;  2AHQ A;  2BY2 A;  4CYC A;  2LKX A;  4PC3 A;  3OYF A;  3B8H A;  4I84 A;  3PA1 A;  2FBH A;  1GQ8 A;  2EIM H;  4OAY A;  3CB4 A;  5GAG J;  2EK5 A;  2DYS H;  1DDI A;  3G1M A;  3DBH B;  5AIP A;  1S9H A;  4XID A;  3OYG A;  1NDH A;  2B0R A;  1EH8 A;  4OZZ A;  3MZY A;  4JK1 X;  3QFT A;  3VSL A;  3J7Y J;  4XR6 A;  1ZGW A;  3OYJ A;  3H36 A;  2ISZ A;  2D3N A;  1MIJ A;  2R0Q C;  1BL0 A;  2G0E A;  3DBR B;  2LVS A;  2GAU A;  3OL3 A;  1WI9 A;  5CDF A;  1N06 A;  4UV9 A;  3OSF A;  4KMF A;  4GCV A;  3S2H J;  2WA0 A;  3PNY A;  3VPR A;  3ASR A;  1Y6I A;  2ZJ2 A;  2G7H A;  1EA0 A;  2XC7 A;  3ZZ0 A;  1JGG A;  1YX3 A;  2W4S A;  4LC0 A;  2E1R A;  4UZU A;  3QOD A;  4OIR F;  2V7X A;  4YII A;  2OQG A;  2R7S A;  1FWZ A;  4L5J A;  4RB0 A;  2LRE A;  3CUQ B;  3LMM A;  1IUY A;  1YJ9 B;  3S17 J;  3T8T A;  4A3G J;  3E7L A;  2WJV A;  2HOS A;  4LIV A;  4B4D A;  2CW5 A;  3KPH A;  2YX7 A;  4IHX A;  3AVY A;  3RYR A;  4M0L A;  4FE4 A;  3NB2 A;  3WBK A;  1O8H A;  2BXY A;  1YOV B;  2VT3 A;  1OIS A;  1Q82 D;  3KP2 A;  2OK7 A;  1A36 A;  3CCS B;  3R6J A;  4OOS A;  1DGW Y;  1HQC A;  3J81 Z;  1DDG A;  5B1A H;  2L5Q A;  2OUM A;  3RZD J;  4GXO A;  1WH7 A;  2O9L A;  2M0C A;  2WAF A;  1WJB A;  1JUM A;  1D0Y A;  2L3D A;  4TMZ A;  4AVP A;  4B48 A;  4CO8 A;  4U87 A;  2R5Z A;  5J47 A;  3H92 A;  1OCZ H;  1PKV A;  2FNA A;  1SFK A;  2QZ8 A;  4BKX A;  1OHH A;  3OP1 A;  3IAS 2;  5J40 A;  2KDZ A;  2INU A;  5CKT A;  1RNL A;  2ZSH B;  4IZZ A;  1TQM A;  1X3Z B;  2HZD A;  2XAU A;  2QGU A;  3ONU A;  4XQF A;  3CCV I;  1XMA A;  5BQT A;  3TED A;  1V4R A;  1KU9 A;  2LR8 A;  2GXA A;  2XAJ A;  2ISY A;  3SDB A;  5LFA A;  1H42 A;  2L9S A;  3HOU J;  2YU9 J;  1WPC A;  3WG7 H;  4W8Q A;  4OPV A;  2MC4 A;  1QX4 A;  2DAO A;  1X58 A;  1JGS A;  1MD0 A;  2EV6 A;  3ZMD A;  3AST A;  1VQK B;  1Z6R A;  2CYY A;  3K4N A;  4BBR J;  3HYI A;  1A31 A;  3PJR A;  2NRA C;  4KIS A;  5IYB J;  2VIX A;  4HLY A;  1MW7 A;  3EUA A;  3RPQ A;  2IS1 A;  5CYV A;  5DS0 A;  3SEJ A;  4I09 A;  1YLO A;  3VDX A;  1QH0 A;  4DIQ A;  3RQI A;  3U6K A;  1CNF A;  1W36 C;  3W2V A;  2W00 A;  4U0W A;  4B3F X;  4DJA A;  1SD4 A;  3DEE A;  2HNH A;  1RUO A;  2H27 A;  2GXB A;  4FAS D;  2RC6 A;  3DDY A;  2QLZ A;  1MBF A;  1D1N A;  4N4N B;  1AHD P;  4Y4R A;  4UVC A;  2OTJ I;  1KCC A;  2FOW A;  1NH3 A;  3UKG A;  2LMD A;  1GR1 A;  2BVL A;  1ITY A;  2XRL A;  3PNV A;  4TT3 A;  4U4B A;  2J8K A;  5ILS A;  3KX2 A;  1PUE E;  1EH6 A;  3KLO A;  1IN8 A;  2ZXJ A;  3WOD F;  4XLP F;  3U21 A;  4NHJ A;  2ID6 A;  1QGP A;  1Y8Q B;  3T1B A;  1WOS A;  2M9H A;  4OPS A;  1MND A;  2LF8 A;  1PP7 U;  2BPO A;  1I8D A;  1TBX A;  3K4B A;  2CRG A;  3CPX A;  1FYK A;  3RPU D;  1TWC J;  2VC0 A;  3LSJ A;  3JRC A;  1W5T A;  5EGO A;  4ETS A;  3GCM A;  1VQ9 I;  3M7G A;  1DP3 A;  1YJW B;  2QYU A;  2HGC A;  2KZG A;  3CQZ J;  4FWT A;  1D8J A;  3HPG A;  4J19 A;  4BE0 A;  2I5U A;  1BN5 A;  3QYB A;  1N78 A;  4Y15 A;  5F04 A;  1RZ4 A;  2E34 A;  4HF1 A;  2R7T A;  3K9T A;  4M74 A;  1L0O C;  1U0J A;  4Z1M A;  1NRK A;  4E6K G;  4IHY A;  3Q38 A;  2RQQ A;  5B3S H;  1K78 B;  3ASQ A;  1BOA A;  4YZX A;  2LSO A;  3GTO J;  4AU7 A;  4CCL A;  1HST A;  2CUE A;  5KCM A;  3NRV A;  3Q6R A;  5IP7 J;  1SD7 A;  4A0Y A;  4ZZL A;  1MNE A;  3OEH A;  3BZ6 A;  4I0A A;  2LFB A;  4Y33 A;  2O8X A;  1ZRD A;  3ABM H;  4LG0 A;  1H8H A;  2BE5 F;  1VHO A;  3SEQ A;  2D3L A;  2QTL A;  3GFI A;  3JRB A;  4YDT A;  4OJL A;  2DA2 A;  4KFC A;  1W35 A;  2V7W A;  2DT5 A;  5D6E A;  4WQM A;  1QBJ A;  2HR3 A;  1IW7 F;  2HEO A;  2NOJ B;  2EIK H;  1AKH A;  3BH7 B;  2CW8 A;  3KP5 A;  1B8I A;  2PMZ A;  1G4D A;  2WBM A;  1WXR A;  2VJI A;  1IXS B;  2Y0S A;  1ZLK A;  1H85 A;  1F1Z A;  3I3L A;  2C4T A;  5HLT A;  2KZV A;  3SDG A;  3MKW B;  2F5V A;  2M8G X;  3Q9V A;  2R7D A;  4JX5 A;  5AON A;  1XE1 A;  2VQC A;  2XGE A;  2LBF A;  2ZXI A;  4YRV A;  4ESJ A;  1I1G A;  3P9K A;  3CCJ I;  3B82 A;  2XGC A;  1X0C A;  1MBH A;  1BI3 A;  3IP4 B;  2W1O A;  2VAS A;  4IL6 C;  3C3W A;  4ZDO A;  4Y9R A;  4X1E A;  1YX5 A;  5K1Y A;  1XB2 A;  4JOM A;  3ZPL A;  2ZXH A;  3CCV B;  3EQO A;  1JT0 A;  3CCQ B;  2Q2E B;  2QQB A;  2CO5 A;  2VBY A;  2ETH A;  1R1U A;  3A3B A;  2ZBU A;  3QP5 A;  2IW5 A;  2M8E A;  4GDF A;  4M3B A;  1WDT A;  1COW A;  2WV1 A;  4J0Q A;  4WXH A;  2KIM A;  4PUS A;  2UWM A;  3OZV A;  3ZBU A;  4ZH4 F;  5F08 A;  1W87 A;  4KIB A;  2DTZ A;  3OR1 C;  4MIM A;  1ONV A;  3V7R A;  2PIA A;  3OJX A;  1TSP A;  3ZMV A;  4RGS A;  2MFZ A;  4B43 A;  1SC7 A;  2A5W A;  3FF5 A;  4WK8 F;  4Z6Y A;  2PQ8 A;  2CFX A;  1G8X A;  3I71 A;  1ZK8 A;  4OIN F;  5EMN A;  1U6G A;  1OYI A;  1LDJ A;  2K86 A;  3N05 A;  4XOT A;  4IOC F;  4ZV4 A;  1EWY A;  5E3L A;  3H94 A;  4PJJ A;  2EZL A;  3I0T A;  4CXF A;  2FEZ A;  2HVR A;  5A8A A;  1ZTR A;  3DEU A;  1U8B A;  2IS4 A;  4IEJ A;  3OYH A;  1IXC A;  3C18 A;  3OYI A;  4Z4Y A;  4Q47 A;  3KP4 A;  2VC1 A;  1F9N A;  3OYC A;  3TOB A;  3FPP A;  1BJZ A;  1XGS A;  2F6C A;  1T0F A;  3H3U A;  3H9J A;  4BHC A;  2LY1 A;  2ZZF A;  3ERE D;  1YI2 B;  3GQ9 A;  2JUG A;  4NC8 A;  4NNJ A;  1KCD A;  1SMY F;  2HDN B;  3VYS B;  1TLL A;  2HKX A;  2L2O A;  5E20 A;  2CQ7 A;  3E6M A;  4L9T A;  2ZJR F;  5DEQ A;  5E1X A;  3QPH A;  5HLG A;  4X0G A;  5FLV A;  1NG7 A;  1ZUN B;  2CH0 A;  3K69 A;  3I4N J;  4XIC A;  3DKW A;  1FTZ A;  1D1A A;  4RD3 A;  5IK2 A;  5A88 A;  2F43 A;  2E7W A;  3I5U A;  1LFU P;  1MJB A;  4L0Y B;  1QVF B;  2HU9 A;  5H20 A;  2XTX A;  4OPW A;  3LAJ A;  3ZBT A;  2RC5 A;  4DNR B;  5B5E C;  3BCB A;  2L7K A;  1WHU A;  2E1O A;  1YHQ I;  1R5B A;  3N97 A;  3OJW A;  3OYE A;  3FXR A;  5J1U A;  3MZ8 A;  3S8P A;  2QMU A;  2Z1D A;  1ZQ3 P;  3HOV J;  2ZTG A;  3IKT A;  5M5W J;  2HPM A;  2CRV A;  5L3F A;  2DOD A;  1XTA A;  2V6E A;  1WJE A;  5DNS A;  2VNH A;  3TKY A;  4EJW A;  1QA3 A;  2IS2 A;  5JLV C;  2KL4 A;  2Q1Z B;  2I1L A;  3SQV A;  1LEB A;  1E1R A;  1U2R A;  4PC2 A;  1T95 A;  2DQR A;  3ZRG A;  4P26 A;  4JBA A;  4ZCI A;  4R71 A;  2K9S A;  4PC7 A;  2F3L A;  2QBY A;  3LOC A;  3AG4 H;  2XKO A;  2AXL A;  3E1S A;  4YCQ A;  1BR4 A;  2FUG 2;  1BLI A;  1NB0 A;  1N75 A;  2KDO A;  2L9V A;  2GBY A;  3H9Q A;  1B9M A;  2VXD A;  1FNM A;  1B72 A;  5GV7 A;  3RYP A;  2IA2 A;  2VBV A;  1P7J A;  2M0M A;  2L54 A;  2JIZ A;  4II2 A;  3OKX A;  2Z2S B;  2RV8 A;  5B1B H;  2X6W A;  2INV A;  1OR7 C;  3I1F A;  1IN6 A;  3BPV A;  2HTJ A;  3H3Z A;  2KFD A;  1RKW A;  4I76 A;  1FY7 A;  4WWC A;  4H0E A;  2X85 A;  2XOK A;  1D8T A;  3AVU A;  3CC4 B;  1GHC A;  2L9N A;  4BY7 J;  3CC7 B;  4XLE A;  4LBZ A;  4YAF A;  1OCC H;  2NAZ A;  2QYO A;  5HNH A;  3CCU I;  1VQ8 B;  3P26 A;  2VE9 A;  4BAC A;  3ZGK A;  2KQR A;  1VFC A;  2XNC A;  1T2K A;  3VWB A;  3DBL B;  4RCY A;  3AVX A;  3F8B A;  1VQ7 B;  2R92 J;  2L7F P;  4CCN A;  5EGO B;  9ANT A;  3H9N A;  3BG9 A;  2BGC A;  2DCU A;  1WOP A;  1R5H A;  3CMY A;  1USS A;  4G7H F;  1J9I A;  2WR8 A;  3IWZ A;  1WP6 A;  2DO7 A;  2NS0 A;  3BQZ A;  1T5E A;  4Y52 J;  1BIA A;  3JTH A;  4ON0 A;  2ZJP F;  1O7L A;  2C77 A;  5ICC A;  1TW3 A;  3BZK A;  4E7L A;  1POG A;  4M71 A;  3CD6 I;  1X19 A;  2F4M B;  3DU6 A;  3VOD A;  4X7D A;  4UNO A;  2NZM A;  2KHM A;  5LEK A;  4V19 K;  2F5D A;  2MD5 A;  2WY8 Q;  2Q6I A;  1O88 A;  1DBG A;  3SQN A;  3I55 B;  4EAT A;  2R7Z J;  1YIO A;  1BQE A;  4QWQ A;  5E8I A;  1YTY A;  3BZC A;  1W5S A;  4EVI A;  1N08 A;  4IHW A;  1PXZ A;  2L9R A;  1E79 A;  1BC8 C;  1LLZ A;  1DAR A;  4AC9 A;  4GFB A;  1XSD A;  4ITV A;  5GAE J;  4ENM A;  2PEC A;  3JRF A;  5FLM J;  2QSH X;  2Y2Z A;  4G6T B;  4M6X A;  1O3R A;  3JX8 A;  4LLL A;  3ZSC A;  4LBW A;  4OJ5 A;  1UHM A;  3HXL A;  4F92 B;  2H1L A;  4OM9 A;  4O5V A;  2M4K A;  1KJZ A;  3BG6 A;  1MH3 A;  1S7E A;  3CCR I;  4EH1 A;  3ZQL A;  4YFO A;  2B7E A;  2IXS A;  4C2U A;  3CUO A;  3VB2 A;  4C9Y A;  3GVL A;  5FD5 A;  1Z3Y A;  2JQ7 A;  2GQQ A;  3OFN A;  2XGD A;  2ZME B;  1ZM9 A;  1BN8 A;  1IUF A;  1EV7 A;  2JT1 A;  2H09 A;  2L01 A;  2GIZ A;  5LRR A;  5DM7 F;  1TYV A;  3CJQ B;  5H59 A;  4OPO A;  3HGG A;  3BR5 A;  1QFY A;  2CND A;  5AIQ A;  1H0M A;  4KKS A;  4R79 A;  4P3Y A;  3I59 A;  1JI8 A;  2V7T A;  3WWG A;  3ONY A;  2HLD A;  3HM5 A;  4Z4U A;  1OB0 A;  1UJ8 A;  2M34 A;  1XG1 A;  3A0B C;  3P9C A;  3HBL A;  4ENK A;  5K5O A;  4AIJ A;  4YC5 A;  2V31 A;  2M7A A;  3WG9 A;  4XOP A;  2B9S A;  4R1H A;  3WTT C;  2PJR B;  5D6F A;  4NK6 A;  4K1X A;  4QVJ A;  1X1D A;  3FKS A;  4MQ9 F;  2JA5 J;  2OTL B;  1Y1V J;  1UCR A;  1FSE A;  2D1V A;  2ZB9 A;  1ETW A;  2D2W A;  2VE8 A;  3ROU A;  1IHM A;  2FX3 A;  1W0K A;  1E0E A;  4M1K A;  1SAN A;  1ZHF A;  2K3P A;  4IW3 B;  4F3Q A;  1OFC X;  1O3Q A;  3TH0 A;  1JKR C;  2DOG A;  1QFJ A;  1HW5 A;  3WND A;  1HC8 A;  1FX0 A;  3TP3 A;  4RAG A;  3K4K A;  3ERM A;  3ZMU A;  3L09 A;  3O8G A;  3WY9 A;  1EF4 A;  5FRN A;  2RVC A;  1TVC A;  2D45 A;  1TQI A;  1HZE A;  2ZL7 A;  2LP0 A;  1TYW A;  4OJP A;  1QA1 A;  3CPW B;  4F7D A;  4P9F A;  4PJL A;  2QN6 A;  2BM7 A;  3ZMZ A;  4QHY A;  3GVK A;  1U9O A;  5B6I A;  4HDU A;  2DER A;  1QPI A;  3AAF A;  3F3X A;  2LD5 A;  2IA1 A;  5FGM A;  3OOP A;  4L9J A;  3V8J A;  3V8L A;  4U0Y A;  5ICF A;  1YYV A;  3EUK L;  1H8A C;  4OJ6 A;  1K6O A;  2XHK A;  4G94 A;  4RS8 A;  3OE7 A;  2W6I A;  3QQA A;  1MJA A;  1IN7 A;  4RD1 A;  5BS6 A;  2M3A A;  3AG3 H;  3FHN A;  4EJT A;  5HDK A;  5A89 A;  3Q6Q A;  4LBY A;  5FNZ A;  4FXU A;  3L1P A;  1WJC A;  1TNS A;  2HYG D;  4PAA A;  4KUM A;  1FJL A;  3Q0W A;  2XAH A;  3JW4 A;  4HNV A;  2F48 A;  2ACJ A;  2LKP A;  1YS6 A;  1U8R A;  1XD7 A;  2DK8 A;  3KFW X;  4L8J A;  1XN7 A;  1ACI A;  3LQ6 A;  3V8K A;  4CCK A;  4DOZ A;  3CP2 A;  1BHE A;  2Z16 A;  2OC6 A;  1QA2 A;  1DDN A;  2LY9 A;  4BHP A;  1JT6 A;  4HNU A;  1NK2 P;  1IRG A;  1E43 A;  1GAQ A;  2OK8 A;  4P6V F;  3E6B A;  1EFR A;  3GIR A;  4RDL A;  2VQL A;  1P7I A;  2KIS A;  3S93 A;  4TMX A;  2YUS A;  5KAF C;  4ZTF A;  2O1D A;  2FML A;  3S3O A;  3ABL H;  3BR0 A;  3R4K A;  1IRF A;  1CQX A;  4N9H A;  4G6D A;  4P55 A;  2DI3 A;  2O17 A;  1O8D A;  4OIQ F;  3CLO A;  2VBT A;  1S7A A;  5F64 A;  2ZJQ F;  5TJJ A;  1QZZ A;  2HQA A;  2PN6 A;  1ODD A;  3BG5 A;  1KZH A;  4KH3 A;  5FFX A;  2QCO A;  2VZL A;  3W6K B;  1JHH A;  3B78 A;  1O8I A;  2DTR A;  2DCE A;  2FE3 A;  4BGD A;  1PJ7 A;  3KYD B;  2Q6L A;  2J8I A;  1WSR A;  2X48 A;  3DPL C;  2EQR A;  6PAX A;  4LBV A;  3OS0 A;  4UVA A;  2LOO A;  2IP2 A;  5FLX Z;  1FSH A;  3VNU A;  1HXD A;  1IF1 A;  3QWL A;  4Y7C A;  2WYR A;  3X2Q H;  3Q3A A;  4PSW A;  2V26 A;  1LLW A;  2M5W A;  3BOQ A;  2ELH A;  1IC8 A;  2EBI A;  1J2X A;  3LSM A;  3F8C A;  5EYR A;  1BJK A;  3GEZ A;  3W2W A;  2ZZQ A;  5FIU A;  4IPA A;  4H9G A;  2GOM A;  2R93 J;  4ACA A;  5L3C A;  2HYF A;  3ZQI A;  1R1T A;  5CJ9 A;  5EG0 B;  2X3U A;  1XB4 A;  1RC9 A;  1J9Z A;  2PG4 A;  2JZY A;  5LHI A;  4YAU A;  2VBM A;  4OAZ A;  1G7C A;  2O6W A;  2DA3 A;  3JRD A;  3FM5 A;  2CU7 A;  1JTY A;  4URR A;  3CME I;  2LYC A;  3FK6 A;  3QOE A;  4IVN A;  3U9G A;  1OB2 A;  2ZC2 A;  2IPQ X;  2MH2 A;  2P81 A;  1W9X A;  1SMT A;  2UXX A;  4IF4 A;  1OQY A;  2HOT A;  3I4M J;  5EDN A;  4PGO A;  3EQN A;  2HVQ A;  4P22 A;  2WV0 A;  4ESB A;  2G9W A;  1JNY A;  3VO2 A;  4KT6 A;  4QPO A;  2RDP A;  3CO6 C;  4LJZ F;  4R8H A;  3RKQ A;  1MJ9 A;  4XKC A;  4NBQ A;  3TMO A;  3OYK A;  2XAG A;  3GTJ J;  4G1V A;  1FMV A;  4HEA 2;  5FKL A;  1PDN C;  1UEL B;  5JHF A;  1MNM C;  2JRT A;  4X6A J;  2NNY A;  1TT0 A;  2OV7 A;  1CF7 A;  4GO1 A;  2M45 A;  2X53 S;  2DPU A;  3M4O J;  3MWM A;  2BW3 B;  3BY6 A;  3A8K A;  3KZI C;  2BN4 A;  4BUP A;  2B63 J;  5HZA A;  1B4A A;  2EB7 A;  2K85 A;  3ISX A;  2R7F A;  1ZH5 A;  1G3S A;  2P5L C;  3GXO A;  1FBQ A;  3JRH A;  1RPW A;  2RKH A;  3I55 I;  2ZZG A;  1M1E B;  2W7N A;  3I53 A;  4EGZ A;  5LBQ A;  3K6G A;  2F4O B;  4I2O A;  1Z9C A;  1P9Q C;  3OOC A;  4BXF A;  5J8F A;  5BPI A;  2V4J C;  3ZMT A;  5AMV A;  2RC4 A;  1FRN A;  3CES A;  3PFI A;  2ELJ A;  2W6J A;  1KGS A;  2K7L A;  1QO0 D;  2XUB A;  3HRM A;  1K8F A;  1OGI A;  2QY1 A;  1MBE A;  1TWH J;  2QEX I;  1O3T A;  3G6E B;  3ML6 A;  4XN0 A;  1R7J A;  3KE2 A;  2DMU A;  3FWE A;  4CUG A;  1ZAR A;  1FP2 A;  3HJE A;  4P9S A;  4XOR A;  3N4M A;  2EA2 A;  1ZR2 A;  1V5F A;  1JE8 A;  2PI0 A;  1TZL A;  4YFX F;  4HIZ A;  2ZO4 A;  1ETV A;  4Q4Z F;  1XX5 A;  5E17 F;  3ZXS A;  1IRZ A;  1N0U A;  4YEL A;  2EJR A;  2RNJ A;  2PX9 A;  3ZR8 X;  2XSD C;  5C1C A;  4XM3 A;  4LIU A;  4N3G A;  4IRH A;  5GTH C;  3FMS A;  2R9V A;  2Q0O A;  3J7A O;  2O0V A;  2E1B A;  3CC7 I;  1JXS A;  3JR9 A;  2PYG A;  5E3O A;  2CMP A;  2JPB A;  2PJP A;  4JX6 A;  3W2A A;  4UUS A;  1WQ2 A;  1J5Y A;  1QNT A;  2XF5 A;  1XS9 A;  3FK7 A;  2Q6K A;  1S8N A;  2DET A;  4BXX J;  1T6Y A;  3G05 A;  3F8F A;  1KU3 A;  2JUC A;  2F4I A;  3R6K A;  2KJC A;  3FZV A;  5J1R A;  5KNL A;  1Q1V A;  2BM4 A;  4Z4V A;  3UW0 A;  3GF2 A;  3DTI A;  5C1E A;  2B7B A;  2XB0 X;  4FX0 A;  5DYM A;  2VON A;  3CCY A;  3TW6 A;  3DF8 A;  1EFC A;  1VQN B;  1K28 D;  3CME B;  4BDZ A;  3A1P A;  3BC8 A;  3ABK H;  1QQI A;  2KLO A;  2PLY A;  4WWV A;  1HKQ A;  2E1M B;  2ZSI B;  4LK0 F;  2NSP A;  3M9A A;  2V4D A;  4GQN A;  1ETY A;  3I54 A;  1X4O A;  1QGA A;  3M8J A;  2FXA A;  2NVU B;  4B3A A;  4LB6 B;  2HDC A;  1Q7Y D;  1JTA A;  1RI7 A;  1ZYR F;  1UD6 A;  4XLC A;  5J4Y A;  3F8N A;  3KP7 A;  1S3J A;  3W2G A;  1WJA A;  2C5B A;  5BSX A;  3VO1 A;  2STW A;  2AHO A;  4B47 A;  2JA6 J;  1Z05 A;  3FPK A;  4GGG A;  3HOY J;  4J01 A;  2DA1 A;  1QHG A;  4A6D A;  1D2E A;  5L3B A;  2WAD A;  2GJP A;  3PUN A;  2MC3 A;  1WZ2 A;  1IXR C;  3GVJ A;  1LJ9 A;  2GOX B;  3BCA A;  5ICE A;  2VKD A;  4HE5 A;  3FMQ A;  3IV5 A;  3UNG C;  1ETK A;  1H9G A;  1W36 D;  3DEW A;  1D0X A;  3IUO A;  3Q3S A;  1VQP B;  2DJI A;  3BTL A;  2W84 A;  2P6T A;  1LVA A;  3RQ4 A;  1HF2 A;  2NTQ A;  1ZR4 A;  2DIE A;  4Z4T A;  3F0C A;  3SJM A;  2R7V A;  1UST A;  3KP6 A;  5EEG A;  5FO5 A;  2JJ7 A;  4A0Z A;  4O3M A;  4TMT A;  1BPL A;  3L2Q A;  1QHH D;  4UAJ A;  3KYL A;  2CWE A;  3FXL A;  2WWY A;  3OL4 A;  3QU6 A;  3GWZ A;  2Y9Z A;  1LQ1 A;  3AGQ A;  1R00 A;  2KPM A;  1AIR A;  3ASO H;  1QVU A;  1S29 A;  3CJT B;  4EM2 A;  5A2Q Z;  1AU7 A;  3M3Y J;  2V1X A;  4XON A;  4KMU X;  3ZQF A;  2L7M P;  3WTU C;  1A8P A;  1QJV A;  2R5Y B;  1P4W A;  4RB1 A;  3HRS A;  1LE8 A;  2MLG A;  4D0P A;  4A93 J;  2EWE A;  3B8Y A;  2V9V A;  3R60 A;  4MNU A;  4OJO A;  1P92 A;  2JVH A;  5FO0 A;  1E17 A;  2B7C A;  1V55 H;  3DQV C;  4PFO A;  4XKB A;  4RDJ A;  4WCG A;  4HE6 A;  2DQL A;  3J7A Y;  4LG3 A;  3TO6 A;  1QGZ A;  3AG1 H;  1W0U A;  2CK3 A;  3E20 A;  2MA3 A;  2DFE A;  1AA7 A;  2WY7 Q;  1M90 D;  2NOG A;  3GZ5 A;  1TTY A;  4Z05 A;  1VQ6 I;  3PA2 A;  4X8I A;  1KD1 D;  1I50 J;  1EE6 A;  1OFL A;  1W2B B;  1VQ5 B;  1K6Y A;  2WAQ A;  1T39 A;  3G4S B;  2JK3 A;  4F91 B;  3AVW A;  2YWE A;  3JRE A;  3GFL A;  2BW3 A;  2GXG A;  3OS1 A;  2VBU A;  4XRM A;  2YWH A;  3FXM A;  1YJ9 I;  2E71 A;  2Z6B D;  2XPU A;  4FQG A;  4G7X A;  2RAE A;  4XBF A;  1VQ7 I;  2IBD A;  2XNJ A;  5TRD A;  4KIC A;  3U2Q A;  1BJA A;  2P7V B;  4CZZ A;  4BE1 A;  5AN9 A;  2NVX J;  3SFI A;  2FOK A;  2QKM B;  2TRT A;  3GYH X;  3ZPP A;  1YG2 A;  3GLL A;  2LTP A;  3CXC B;  1PP8 F;  4CZC A;  2VKV A;  4Q5S F;  5GPA A;  1CQT A;  1F43 A;  1R5N A;  2A68 F;  1WI3 A;  4HBL A;  5GAD J;  1K7A A;  1TQP A;  2VBZ A;  2O0Y A;  2FD5 A;  5FKN A;  2GJR A;  1ZM2 A;  4WZT A;  5IYC J;  2BX6 A;  2BYV E;  4RDK A;  5K7H A;  2ADU A;  4A12 A;  2QSG X;  2VL8 A;  4RD4 A;  2X1E A;  1MH4 A;  2DU9 A;  3K2Z A;  1HOM A;  3L9F A;  5FJ8 J;  1KK0 A;  2IVM A;  5FB2 A;  4ZTJ A;  2VJJ A;  3QAH A;  1IB0 A;  5K5R A;  2X6O A;  4PCQ A;  5A2Q K;  3DXJ F;  5JLX A;  4ZDP A;  4HW0 A;  1OFM A;  1MSE C;  4PAB A;  2GK6 A;  4QV2 A;  3VMW A;  1WU8 A;  2QE7 A;  3D5S C;  1NJI D;  2Z5U A;  1H9T A;  4WZL A;  1OB5 A;  4M9S A;  1D8K A;  1E2X A;  1CNE A;  4I98 B;  2WPD A;  1FYL A;  1Q81 D;  3LYC A;  5D5W B;  2LKS A;  5IYD J;  3A8I A;  2DXI A;  1DQU A;  1FP1 D;  4LFU A;  3JQP A;  4DQ2 A;  2M87 A;  3GQ8 A;  5KVR A;  1BIB A;  4L0Z B;  3J80 Z;  2GRE A;  3SXY A;  2FNP A;  1J7K A;  4A6E A;  2C2W A;  3D0S A;  1YX2 A;  3CDI A;  4FET A;  4C3H J;  2MAB A;  1D5V A;  2HFH A;  4LMY A;  1MMD A;  2JJ1 A;  5BSY A;  3BCF A;  2NVT J;  5CVU A;  2MSY A;  2A5Y B;  2O04 A;  2CFO A;  5E8G A;  3KCC A;  4PZJ A;  5H2F C;  1ORK A;  5J6X A;  1OCT C;  5J3O A;  5HOD A;  2DOA A;  3RSN A;  2P7C B;  2P4W A;  3ZPN A;  2JDI A;  2MW8 A;  2ZXW H;  4U9U A;  5EZG A;  1FNC A;  2O03 A;  2JWT A;  1S72 I;  4A5N A;  1ETQ A;  3HZJ A;  3SFZ A;  1QVG B;  4P2N A;  3OPO A;  2OZ6 A;  4RMN A;  4M53 A;  3PNT A;  5E79 C;  4IQJ A;  1FIP A;  2W7Z A;  1E3H A;  4HZF A;  2MD0 A;  3SZG A;  1TUI A;  3C1D A;  5D5U B;  2LLK A;  2HXI A;  1WOR A;  1Y39 A;  3CF5 F;  2CS3 A;  5F4J A;  1WSU A;  4ZCL A;  2VBE A;  2E5Z A;  3GFM A;  4DZP A;  1Y0U A;  3J80 K;  4W97 A;  1VQ4 I;  3ZZT A;  2A6T A;  5F27 A;  1X2M A;  1R5I D;  3BPX A;  1FTT A;  2X1C A;  5IYQ A;  1MMG A;  2VFN A;  4MYU A;  3CUQ A;  2A07 F;  1FYM A;  2CGP A;  3S1M J;  3L2R A;  1O8F A;  2BMW A;  2EPF A;  1HKT A;  2FBI A;  2DYI A;  4HWV A;  2EFG A;  3OZU A;  4TSF A;  5DUK A;  1T38 A;  4B8X A;  1V5G A;  3S32 A;  3A4C A;  1X1B A;  4XLH A;  3CCL B;  4CYD A;  1EJ9 A;  2ZFW A;  3OV8 A;  4CHU A;  2OF7 A;  3CUQ C;  1SD6 A;  5KW9 A;  1Y56 A;  5JR3 A;  3H0G J;  4DNT B;  2DA6 A;  3FMR A;  1GVJ A;  3HKZ N;  3TDU C;  1YIJ I;  2O8K A;  2GIV A;  2RQP A;  3L2U A;  4G5G A;  4CDG A;  4M2L A;  4G9Y A;  1VQO B;  4B3G A;  1OOC A;  2G0Y A;  4L5I A;  4TMW A;  1VQL B;  1Z67 A;  1QU3 A;  2HXO A;  5IY5 H;  2CQQ A;  4DQL A;  3WTS C;  1KU2 A;  1G3W A;  4ZYG A;  3ES9 A;  3CLQ A;  3HHH A;  3P9I A;  2X0K A;  2IS6 A;  4A3L J;  2YWG A;  4EQQ A;  3HC7 A;  3M8E A;  3H0D A;  5HVQ C;  2ZNZ A;  1BBY A;  2VJ4 A;  3IRQ A;  1AWC A;  4LLN A;  3IWF A;  1QFZ A;  2QEN A;  4EGY A;  1QRB A;  2XAQ A;  3OMY A;  3T53 B;  4LGW A;  5DUI A;  4G7O F;  2ICW G;  1TNT A;  1UHS A;  4NC6 A;  2R4G A;  4BJ6 C;  1QUE A;  3D5L A;  4S04 A;  3BCD A;  1FBU A;  3K7A J;  4G12 A;  5J4V A;  2WB1 A;  2CUZ A;  3JRG A;  3R61 A;  3AG2 H;  3OIP A;  1GXQ A;  1GVH A;  3MKZ A;  1JJ6 C;  3LQE A;  3CCL I;  1JA1 A;  3MMP A;  3PSF A;  2ZCW A;  5CVV A;  2NST A;  3RI4 A;  1WFX A;  4G7W A;  4E7H A;  4PMH A;  3OS2 A;  1IO2 A;  3DKX A;  1H8E A;  5IT3 A;  1DBO A;  3CCE B;  5D4S A;  4PJ0 C;  1B6A A;  1RET A;  2A6E F;  2DT7 B;  1W7P D;  4G7Z F;  1HBX G;  3WYA A;  1GO2 A;  2WSS A;  4JQF A;  3U2R A;  4WZE A;  2J7K A;  4I02 A;  1VQL I;  1TWG J;  2V79 A;  3QFR A;  2F5F A;  2X51 A;  4KN7 X;  3IKV A;  2JN9 A;  2PLF A;  2ME6 A;  2X8K A;  3R0J A;  4MLO A;  5BPD A;  1BM9 A;  5H6Q A;  2JRM A;  4BAY A;  4HG2 A;  1NBM A;  1OMI A;  4BQN A;  2BM6 A;  4EW9 A;  3AL0 C;  3FJO A;  1WJD A;  4P5O A;  1UMQ A;  3DP7 A;  4RGX A;  1I6X A;  1VQM I;  5JBQ A;  3LA7 A;  3ZZU A;  2Y0S N;  3H1C A;  3S1R J;  2EFW A;  3A8J A;  1CLW A;  1KYW A;  3T8R A;  1G2H A;  1P2F A;  1OCO H;  4C30 A;  1ZG5 A;  2OBP A;  2IGK A;  4MGR A;  3HOT A;  1HCR A;  1P4M A;  3GQ7 A;  2XZL A;  1D1C A;  3S3N A;  3KEW A;  3MAJ A;  3K0L A;  4HOB A;  5JHU A;  5FLX K;  2RNG A;  2BY1 A;  4B4C A;  1EH7 A;  1B9N A;  2YSR A;  3G71 I;  1LFB A;  2ZBV A;  1RMG A;  3J81 K;  2H6B A;  2OZU A;  4CSW A;  4EJU A;  3K70 D;  2DMT A;  1HLV A;  1OYY A;  2BF4 A;  1QVT A;  3FM3 A;  4AF7 A;  2OBS A;  2MH9 A;  4XLA A;  4C43 A;  2DPD A;  3VOE A;  1SVM A;  1SKQ A;  3CMM A;  1DU6 A;  5LMZ A;  1JKQ C;  2HMA A;  4ZYE A;  3ASS A;  1K73 D;  2UVE A;  5DCF A;  4A3K J;  1R5O A;  5IP9 J;  3TDZ C; 
#chains in the Genus database with same CATH homology
 2WJV A;  2O17 A;  3LSG A;  4LIV A;  1O8D A;  4ZC3 A;  3LMW A;  2HQA A;  3L2W A;  1O8H A;  2R7W A;  5FRM A;  4KKT A;  2M5S A;  4BE2 A;  4TKO B;  4BJT A;  1O8I A;  1G59 A;  4BQO A;  2VBK A;  2PYH A;  1DGW Y;  2DCE A;  4AYB A;  2CV0 A;  2NT6 A;  2L5Q A;  4BGD A;  2OUM A;  3T9G A;  2WAF A;  1WJB A;  3DPL C;  1D0Y A;  3A2K A;  4IQ4 A;  3RTR A;  3OS0 A;  3OWT A;  2LOO A;  4B48 A;  4U87 A;  2XSJ C;  3A35 A;  4PSW A;  2V26 A;  1PYV A;  4XN3 A;  1UD2 A;  4MR0 A;  1N77 A;  3LSH A;  1PKV A;  2HDW A;  3SEZ A;  4B3X A;  1SFK A;  3LSM A;  1OHH A;  3GQA A;  3IAS 2;  3NWT A;  3W2W A;  4YEJ A;  3K4L A;  4C2T A;  4NUB A;  2ZZQ A;  2INU A;  5CKT A;  2GOM A;  2ZSH B;  4IZZ A;  2HZD A;  2XAU A;  1O8E A;  4XQF A;  2XF6 A;  3G2B A;  2JA2 A;  4BDY A;  5LFA A;  3SDB A;  4W8Q A;  2L9S A;  1WPC A;  2VBM A;  4YZ0 A;  4OAZ A;  2MC4 A;  2E1M C;  1X1C A;  4URR A;  2LYC A;  5CQE A;  3QOE A;  3K4N A;  2X3H A;  2VQH A;  3PJR A;  4KIS A;  3W3C A;  1W9X A;  2UV1 A;  3EQN A;  2BOL A;  2VIX A;  2HVQ A;  2VQG A;  4P22 A;  4YZQ A;  1IDJ A;  1MW7 A;  3EUA A;  2IS1 A;  1VBL A;  2QXZ A;  4KT6 A;  4QPO A;  2LH9 A;  1QCX A;  3HPH A;  3MMY B;  3VDX A;  4XKC A;  3TMO A;  3OYK A;  4DIQ A;  4RLF A;  3W2V A;  3PUB A;  1FMW A;  1FMV A;  2UUZ A;  4HEA 2;  1BOB A;  2W00 A;  3H9G A;  4B3F X;  1UEL B;  4E7S A;  2R7X A;  4DJA A;  3BC9 A;  5JHF A;  3DEE A;  1X4P A;  2IGM A;  2HNH A;  4Y3O A;  4FAS D;  1TT0 A;  2OV7 A;  3H5A A;  3DDY A;  1Z7L A;  2DT6 A;  2X53 S;  4N4N B;  4Y4R A;  2BW3 B;  3TBI A;  1KCC A;  3OOU A;  4BUP A;  1W36 C;  3QYF A;  2BVL A;  2HPI A;  2X1D A;  3PNV A;  4TT3 A;  3GRH A;  1O8M A;  3GQB A;  3M1C A;  4U4B A;  3KX2 A;  1D0Z A;  1R6R A;  3U21 A;  4BU2 A;  4W8S A;  2UVF A;  2ZZG A;  1MND A;  2W7N A;  1I8D A;  4CCM A;  3K4B A;  3OYN A;  1PLU A;  3K6G A;  4ANJ A;  3RPU D;  1P9Q C;  3OOC A;  3HG9 A;  4BXF A;  2V4J C;  4OWR B;  5AMV A;  3SUC A;  1DP3 A;  3CES A;  3FKJ A;  2V9K A;  4ZYA A;  2ELJ A;  1UD8 A;  2W6J A;  1ZEL A;  3HPG A;  4BE0 A;  3KEY A;  1BR1 A;  2QY1 A;  2ZTN A;  1H80 A;  3QYB A;  3T51 B;  3VYR B;  4DBQ A;  1N78 A;  3IAM 2;  4XN0 A;  3DWL E;  3VYU B;  4YXW A;  4CUG A;  2MYS A;  4XOR A;  1MMN A;  5HOO A;  2R7T A;  1V5F A;  3V42 A;  4HIZ A;  1TZL A;  1U0J A;  4E0F A;  4Z1M A;  1NRK A;  4E6K G;  1O8L A;  4CA0 A;  2RQQ A;  2WZP P;  1KCD A;  3ZXS A;  2LRD A;  4YZX A;  1GLN A;  4YEL A;  4DK0 A;  3MD2 A;  4AU7 A;  4CCL A;  3OYD A;  5KCM A;  3ZR8 X;  1BLI A;  3FBN B;  3DKY A;  5C1C A;  1MNE A;  4E7Z A;  3C2G A;  4XM3 A;  3OEH A;  4LIU A;  2GJK A;  1VJS A;  4Y33 A;  3D5R C;  1H8H A;  1WJF A;  2XF7 A;  2R9V A;  2O0V A;  3DPU A;  2E1B A;  3SEQ A;  2D3L A;  2PYG A;  3JU4 A;  4E4H A;  3ONQ A;  5HKK A;  2CMP A;  4OJL A;  3S3M A;  4YZA A;  1BMF A;  3W2A A;  2V1N A;  2XF5 A;  3RCO A;  3H5N A;  2ZZE A;  3G05 A;  1MMA A;  2F4I A;  4W8T A;  3A3G A;  2NOJ B;  2LC2 A;  3H35 A;  5KNL A;  1MAB A;  3UW0 A;  2CW8 A;  1VLY A;  2PMZ A;  2WBM A;  3DTI A;  1OGO X;  1J09 A;  5C1E A;  3VST A;  2VJI A;  2Y0S A;  3I3L A;  1K28 D;  2E5N A;  4BDZ A;  5HLT A;  2KZV A;  3UR3 C;  3BC8 A;  2F5V A;  2KLO A;  3MKW B;  2E1M B;  3FBI B;  2ZSI B;  2VQC A;  2NSP A;  2LBF A;  2ZXI A;  4YRV A;  3L2V A;  2V4D A;  4GQN A;  1X0C A;  1X4O A;  3ZIA A;  3M8J A;  1SKY B;  4HPQ A;  4F93 B;  3IP4 B;  1JTA A;  1LKX A;  2VAS A;  2W1O A;  2X6X A;  4ZDO A;  1UD6 A;  4XLC A;  1YX5 A;  3DTE A;  4JOM A;  1HG8 A;  2ZXH A;  3K4C A;  3LNN A;  1WJA A;  3EQO A;  2KMU A;  4JMQ A;  2Q2E B;  1KZL A;  2O5R A;  4B47 A;  4OZY A;  4J01 A;  5DN6 A;  1QHG A;  3F9K A;  3GBG A;  3A3B A;  2P0W A;  3LSI A;  4HRI A;  2WAD A;  2GJP A;  4XL9 A;  4D1Q A;  3GVJ A;  3JUR A;  2GOX B;  3BCA A;  2VKD A;  3CJR B;  3TL4 X;  1COW A;  3OIQ A;  3UNG C;  3ZCO A;  1W36 D;  3IUO A;  1D0X A;  4PUS A;  5FRO A;  2UWM A;  3LSK A;  2DJI A;  2PJR A;  2KRC A;  3OR1 C;  3RQ4 A;  2NTQ A;  2DIE A;  2R7V A;  1UD4 A;  2MFZ A;  4B43 A;  2A5W A;  3PL8 A;  2RRE A;  1BPL A;  3L2Q A;  5LD2 C;  1QHH D;  2XND A;  4XKW A;  1V0E A;  2BSP A;  3EUH C;  1T0F C;  1G8X A;  2XZP A;  3KYL A;  3DLA A;  1O8G A;  1UAA A;  2VXZ A;  3OL4 A;  1AIR A;  4OJ5 A;  2KPM A;  2K5C A;  4XOT A;  3N05 A;  3VSK A;  1NG6 A;  4IKF A;  3H94 A;  4PJJ A;  5TGT A;  4CH7 A;  2HVR A;  1QJV A;  2VKH A;  4XON A;  1PJR A;  1WTH D;  3B4N A;  3A1Y A;  1V5E A;  2IS4 A;  3OYH A;  2EWE A;  3OYI A;  3B8Y A;  4OJO A;  3OYC A;  3K4J A;  2JVH A;  4W8R A;  4PFO A;  3DQV C;  4XKB A;  2AQF A;  2F6C A;  2ZZF A;  1KON A;  3H9J A;  3FPP A;  4Z03 A;  2LY1 A;  3J7A Y;  4LG3 A;  4G6I A;  1XG2 A;  2JUG A;  2M7B A;  3DTK A;  2QKL B;  4NC8 A;  4NNJ A;  3OY9 A;  3VYS B;  2CK3 A;  2WY7 Q;  2L2O A;  1AA7 A;  2IGO A;  4XKV A;  3VR6 A;  2JJ2 A;  1RU4 A;  4Z05 A;  1VF7 A;  4X0G A;  2AQE A;  3HAG A;  3DU5 A;  1EE6 A;  1OFL A;  4QPQ A;  1NG7 A;  4F52 A;  2CH0 A;  1K6Y A;  2CV2 A;  2WAQ A;  3OW7 A;  1D1A A;  4F91 B;  5IK2 A;  2BW3 A;  3OS1 A;  2F43 A;  2Z6B D;  4G7X A;  2HU9 A;  4CCO A;  1WMR A;  4DNR B;  2X6Y A;  1X1A A;  3BCB A;  2L7K A;  5FL7 A;  3C2H A;  4ZJZ A;  1UD5 A;  3OYE A;  4BE1 A;  2XDV A;  3S8P A;  2Z1D A;  2QKM B;  2ZTG A;  4DK1 A;  3ZPP A;  3EPZ A;  2HPM A;  2IQ7 A;  2WJY A;  3E0J B;  4CZC A;  2V6E A;  1WJE A;  3OYL A;  2IS2 A;  3B90 A;  2KL4 A;  2Q1Z B;  4BEH A;  3OR2 C;  2R7O A;  1E1R A;  2GJR A;  2LBF B;  1T95 A;  3ZRG A;  4N4O B;  4PK4 A;  2R7U A;  4U7B A;  3E1S A;  4PFP A;  2NTP A;  1BR4 A;  2FUG 2;  2VL8 A;  2M4G A;  3HKZ A;  1N75 A;  2KDO A;  2X1E A;  5CPR B;  4BJ5 C;  2CV1 A;  4B44 A;  4XD7 A;  3H9Q A;  2VXD A;  4ZTJ A;  4BS9 A;  2VJJ A;  4LIT A;  4F55 A;  1E3Z A;  2LZJ A;  2M0M A;  1IRX A;  4ZDP A;  1LVK A;  3CP8 A;  1HA8 A;  1JRG A;  2JIZ A;  4II2 A;  1OFM A;  2O0W A;  2Z2S B;  2X6W A;  3LFU A;  2GK6 A;  2INV A;  3VMW A;  1OR7 C;  2QE7 A;  3D5S C;  1ERD A;  3HUG B;  2XOK A;  4RLQ A;  2X85 A;  2WPD A;  2L9N A;  4XLE A;  2F1M A;  4E7J A;  3K10 A;  1DGR M;  2I8D A;  2DXI A;  1DQU A;  3FDY A;  3GQ8 A;  5HNH A;  2NTB A;  1OLT A;  1D1B A;  5HNF A;  3ZGK A;  2KQR A;  2LG4 A;  4FET A;  4BAC A;  3VWB A;  2ODL A;  2MAB A;  2W82 A;  4GRI A;  2GK7 A;  1MMD A;  2JJ1 A;  3BCF A;  2O04 A;  3PFY A;  4CCN A;  1IA5 A;  2VLA A;  2CFO A;  2IGN A;  3LL7 A;  2DOA A;  3RSN A;  1WP6 A;  2E60 A;  1OGM X;  3ZPN A;  1T5E A;  4PJM A;  2JDI A;  1KTW A;  3DPT A;  4BL0 B;  4HSR A;  4RMN A;  3OPO A;  2ZFU A;  3BG7 A;  2JSP A;  3PNT A;  4CCJ A;  4E7L A;  4IQJ A;  1WJ5 A;  1X19 A;  2V7F A;  3DU6 A;  2KVO A;  2NZM A;  2MD0 A;  3SZG A;  2KHM A;  1O88 A;  2WY8 Q;  3OAA A;  1DBG A;  4EAT A;  2K9L A;  3VYT B;  2CS3 A;  1PXZ A;  2VBE A;  2E5Z A;  3CZ6 A;  1E79 A;  1BR2 A;  3ZQQ A;  4PJN A;  1VZ0 A;  2A6T A;  3OYM A;  4KJZ A;  4DBR A;  2BVM A;  2X1C A;  4XLF A;  1MMG A;  2KP6 A;  2VJ5 A;  4ITV A;  4MXN A;  1LDK B;  2PEC A;  3L2R A;  2KRH A;  1O8F A;  4G6T B;  1IB4 A;  1RWR A;  3ZSC A;  3BH4 A;  3CF2 A;  3HXL A;  4F92 B;  4HWV A;  4U49 A;  4TSF A;  3T56 B;  2M4K A;  4IX7 A;  3AFH A;  1V5G A;  3BG6 A;  3S32 A;  3NE5 B;  3A4C A;  2VB6 A;  1X1B A;  4XLH A;  4C2U A;  2IXS A;  3FY3 A;  1LFP A;  3I9V 2;  1I18 A;  4C9Y A;  4RM2 A;  3GVL A;  3OFN A;  1Y56 A;  1Z3Y A;  4P1W A;  3GQ9 A;  3VMV A;  4DNT B;  1BN8 A;  4HNT A;  3AKZ A;  3PSI A;  2QX3 A;  3L2U A;  4E7K A;  4B3G A;  1OOC A;  3CJQ B;  2Z8G A;  3K4M A;  4HST A;  4BQQ A;  5KHD A;  2JVG A;  4II3 A;  1QU3 A;  4KKS A;  4R79 A;  3HL2 A;  3WWG A;  1JI8 A;  1PE9 A;  1CZF A;  3QYE A;  4PSX A;  1UD3 A;  1YE9 A;  2HLD A;  2IS6 A;  1OB0 A;  3HC7 A;  3H0D A;  1O8J A;  5HVQ C;  3MKY B;  2NT9 A;  2VJ4 A;  2V31 A;  2M7A A;  4XOP A;  3KRG A;  3OMY A;  3T53 B;  3WQZ A;  3K70 C;  2PJR B;  4NK6 A;  2R4G A;  3H5R A;  1X1D A;  4H4K C;  4BJ6 C;  1KMH A;  3HOS A;  3FKS A;  3D5L A;  4XMY A;  3BCD A;  4RM3 A;  2WB1 A;  2CUZ A;  4NC7 A;  3OIP A;  1Z3X A;  4DGW B;  4NQW B;  3MKZ A;  4AVZ A;  1E0E A;  1W0K A;  3PSF A;  2V7Q A;  2K3P A;  5CQG A;  4F3Q A;  2NST A;  1WFX A;  4G7W A;  3OYA A;  4E7H A;  4PMH A;  3OS2 A;  1W0J A;  3DKX A;  1H8E A;  2XZO A;  1FX0 A;  1DBO A;  3K4K A;  2CUJ A;  2DT7 B;  4KKU A;  2WSS A;  4JQF A;  4Z06 A;  5FRN A;  2XGJ A;  3VSV A;  1HZE A;  1SAU A;  2X51 A;  1O8K A;  4XNF A;  4KIT B;  4OJP A;  3BLY A;  2X8K A;  4PJL A;  2R7Q A;  1V0F A;  4MLO A;  2R7R A;  3GVK A;  4BEH B;  3VSU A;  1EA3 A;  1E3X A;  4HG2 A;  1NBM A;  2HVS A;  4BQN A;  4EW9 A;  3AL0 C;  1WJD A;  4P5O A;  3OEE A;  3EUK L;  1Z21 A;  2WAE A;  4OJ6 A;  1IDK A;  3AL0 B;  3OYF A;  2W6I A;  3OE7 A;  2M3A A;  3FHN A;  4I84 A;  1GQ8 A;  1UG0 A;  4OAY A;  4FXU A;  3NWS A;  1WJC A;  1S9H A;  4C30 A;  3OYG A;  2CW7 A;  2IGK A;  4OZZ A;  2VPL A;  3VSL A;  4XR6 A;  3OYJ A;  3HOT A;  2D3N A;  3GQ7 A;  2XZL A;  1D1C A;  3S3N A;  2K9M A;  3KEW A;  1HVX A;  4NK8 A;  4L8J A;  3OL3 A;  5CDF A;  2RNG A;  4C2L A;  1K5C A;  4DOZ A;  4CCK A;  2WA0 A;  3PNY A;  1Y6I A;  4J00 A;  1RMG A;  4CSW A;  2XC7 A;  3CP2 A;  3OYB A;  3K70 D;  1BHE A;  2Z16 A;  2OC6 A;  4HNU A;  1E43 A;  1YX3 A;  4D9J A;  2W4S A;  1NHC A;  1EFR A;  2VQL A;  4XLA A;  3QOD A;  3S93 A;  4UZU A;  4ZDL A;  3CMM A;  4ZTF A;  4ASU A;  2LY2 A;  2R7S A;  2O1D A;  3S3O A;  2UVE A;  2LRE A;  3LMM A;  3SYT A;  4E7I A;  1E1Q A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...