4YEJA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
molecule keywords Tail spike protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yejA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yejA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yejA02
4XNFA 2ODLA 5AMVA 2UVEA 4XLCA 4YEJA 2O1DA 1QJVA 4MR0A 1X0CA 2UVFA 2INUA 2X3HA 3JURA 4C2LA 2NTQA 1IDKA 3SUCA 3B8YA 2X6WA 1BN8A 4OJLA 4XLAA 1O88A 1IDJA 3GQ9A 1O8GA 4PMHA 4Z06A 1IA5A 3GQ8A 4OZYA 3KRGA 1OFMA 4U49A 2O0WA 2VBKA 1CZFA 4Z03A 1OOCA 3VMWA 4OZZA 2PYGA 4XMYA 2EWEA 4YZQA 1K5CA 3ZPPA 3GRHA 4YZAA 1O8EA 4URRA 5C1CA 3ZSCA 1WMRA 1KCDA 1OFLA 4XM3A 2VJIA 4AVZA 4OJ6A 5C1EA 4W8QA 3VSTA 1AIRA 1QCXA 2PYHA 2BSPA 1PXZA 1RU4A 2NZMA 2IQ7A 2X6XA 2NSTA 1O8KA 2O0VA 2VBEA 4Z05A 1OGMX 4YZXA 4XLEA 3B90A 4EW9A 2INVA 2PECA 3VSUA 1KTWA 1O8LA 4XL9A 2X6YA 3GQ7A 4XONA 3VMVA 3VSVA 4XKVA 1DBGA 2QXZA 3FY3A 3WWGA 2NTBA 2O04A 1PE9A 4NK8A 4XKWA 1O8DA 1VBLA 3EQNA 4HWVA 1JTAA 1PLUA 1RWRA 4XLFA 4XOPA 3LMWA 1DBOA 4NK6A 2Z8GA 4W8TA 2QY1A 2NT9A 1O8MA 4OJPA 4U4BA 1EE6A 4W8SA 1O8FA 3B4NA 4XORA 2NSPA 4W8RA 1OGOX 1KCCA 4XQFA 1O8IA 4YZ0A 4XN0A 4XLHA 1H80A 1RMGA 1GQ8A 3EQOA 1XG2A 3T9GA 4I84A 4OJOA 1NHCA 2NT6A 1BHEA 1JRGA 4XR6A 2NTPA 1IB4A 2VJJA 4XN3A 1O8HA 3GQAA 4XOTA 2X85A 4OJ5A 2VBMA 2QX3A 4MXNA 3UW0A 1O8JA 2O17A 1HG8A 4YELA
chains in the Genus database with same CATH superfamily
5DSZA 5F4MA 2O6WA 2ZNYA 3FDYA 5EG0A 4UZFA 4B44A 1Q7YD 3VYSB 1PKVA 1M1KD 2HKOA 1BW5A 2R7ZJ 5HZAA 3K4CA 2E1NA 3PIPF 5BS6A 2VPRA 1Y56A 2VT2A 3ABUA 4GRIA 3CCJB 1TTYA 3M8JA 4FQGA 2PLFA 1K73D 5EYRA 1K8FA 4JRAC 3HIFA 5HNHA 3A01B 5B1AH 3OS2A 4E4HA 1QHGA 2XV4S 4YIFA 3CCMB 2A05A 1J75A 4MTDA 4TMVA 3ZN0A 3W5VA 2NTQA 2VNIA 3W2IA 1CGPA 4GYIA 4FASD 2B0LA 2HDNB 3L1PA 1SD5A 3M1EA 1KU3A 2ZBKA 4Z06A 4FK8A 4TT3A 4UAJA 2E1MB 1YG2A 2MA3A 3ZN1A 4CSWA 4ESJA 3WE2A 2CJJA 2LH9A 4U49A 3D5LA 1F60A 3VMWA 3BR5A 4B09A 2E71A 5F1RA 1MIJA 3MKYB 2Y0SA 2K4BA 2X1CA 2DOEA 1IN4A 2DDAA 3ZPLA 1D2EA 4XBFA 3FKSA 3JU4A 2R7OA 3KP4A 3J81K 1R49A 1WH5A 2M7BA 1K5CA 3IC7A 3GTLJ 1O3RA 1ELOA 5LGUA 4Y7CA 4A0YA 3JX8A 3CUQB 2AO9A 3KLNA 5CVRA 1WDTA 4IRHA 1SFXA 3J7AY 2HKXA 3DTEA 2F5EA 3F23A 1K6YA 3WU2C 2F4NA 3I55I 2KIFA 5IP9J 5CJ9A 1BPLA 4TMZA 2RAEA 1XMXA 4GQNA 4TSFA 4XD7A 4IO9F 3VDXA 4CYCB 2C4TA 1S7OA 2INVA 2ELJA 2QTLA 1A36A 1IJFA 2YWFA 4JOMA 4BJ5C 1YJNI 1ZKGA 3GQ7A 2BSAA 3VMVA 4G94A 3B6AA 2J5PA 2X48A 1K83J 4I0AA 1NJID 1HVXA 1SANA 1VNDA 2LKSA 4C3IJ 1PP8F 1RUOA 2HDDA 1YI2B 4J19A 1CLWA 4NK8A 4LIUA 1ETXA 2ICWG 3OIQA 5EZHA 3BP8A 3ABTA 3BDDA 2V1NA 5LEKA 3LMWA 4RB3C 3E5UA 4MQ9F 2Z8GA 3HKZA 3LAJA 4A93J 2XC1A 3HSFA 4U4BA 3Q9VA 4EJOA 5L3CA 2RQPA 1KK3A 4XQFA 3UKGA 1QA1A 3E5QA 1EP2B 1JHHA 2D1HA 1N08A 1YW8A 2X9DA 3OE7A 2OF7A 2W1OA 1GQ8A 3MAJA 2HVQA 1U8BA 2QMUA 3W5UA 3CC2B 3DCFA 1TWHJ 4XN3A 1SVMA 2L9NA 4G12A 4E7LA 3G2BA 3LSJA 1LE8B 1UB9A 1UG0A 4A12A 4BL0B 1H8AC 1VQOB 4C9YA 3K70D 2VBMA 3K4BA 1B23P 4CICA 3CO7C 1TSPA 4JP0A 3SLDA 5HS7A 1USTA 5JLWA 1F20A 2V5IA 2L9VA 4I0BA 1FBQA 3I71A 2F6CA 2V7XA 1BI1A 3CDHA 4QVJA 2H1LA 3EPZA 3OV8A 5TV2A 1LFUP 3CCLB 2KVOA 3KL9A 1VQMI 1W0KA 2F5CA 1P7IA 2L7KA 1VQ7I 5L3FA 2O6GE 3E0JB 1Z7UA 4M6YA 1VQ4I 5DN6A 4RB1A 4MR0A 4O6JA 1JA0A 3V76A 1U9OA 6PAXA 2ZL6A 2NXNB 3HDDA 2ZZGA 3CJTB 2HU9A 3GZNB 4CH7A 2DMUA 2R7SA 2NVTJ 4PJMA 2FEZA 1G8XA 4KISA 1KYZA 4MYUA 1VQ8B 1MMAA 1TW3A 3OR2C 4ZC3A 3O2PE 3C3WA 4JK1X 1ITYA 1UG2A 1V0FA 4Z1MA 1WOSA 4M3EA 5IOYA 1S6LA 2GIVA 3IKTA 1JXSA 3GQ8A 2F5DA 4HX8A 2DQLA 2AQFA 3ERED 3HRSA 1VQ6I 4Z03A 5CDFA 1X3ZB 1ZAOA 3PSSA 4X0CA 1T98A 3WTWC 4BHCA 2CGPA 4HF0A 4L5EA 3L7WA 3JRFA 3DKYA 1MNDA 4ZYEA 3IH2A 3FF5A 3BC9A 2KJBA 1V3FA 1DUXC 2BVMA 1I6XA 3LOCA 3TO9A 1ETWA 4C3HJ 3JSOA 3G73A 5IYWA 1UD4A 4XM3A 1D1CA 3E6BA 1A31A 2GXBA 2VFPA 1ON2A 1QCXA 2HS5A 1P9QC 3CMMA 3ZMZA 1RR7A 3PSIA 2VE9A 3P27A 2D45A 2X6XA 4IX7A 2Z1DA 2K4JA 2P7VB 1EF4A 1KQ8A 5IYNA 2TDXA 2VJ4A 4AIKA 2CK3A 1OMIA 3SEQA 2FD5A 2VBWA 3OW7A 4XLEA 2WY8Q 4UHTA 4NHJA 2Z6BD 4YZXA 2LP0A 3H9JA 3PUFA 4W97A 4A5MA 4ENKA 3BOQA 2W82A 4NNJA 4ACBA 4YCQA 5JVTA 2KKOA 4M3BA 1HKQA 3D5RC 4XONA 4WK8F 3P4GA 3HJEA 1FNCA 3S32A 3QU6A 2O04A 3TBIA 2YR2A 3B82A 4M3DA 3HPHA 3RSNA 4EEFG 4R71A 5TISC 2B0RA 3JTGA 4NC8A 3LA2A 1QH0A 3AGQA 3OS1A 2LKPA 3OYFA 3CDLA 1YJ9I 3HC7A 4Z4WA 4XOPA 1LJ9A 1ZR2A 3K2AA 5HNFA 4NK6A 4ENMA 3GX4X 3E6MA 5JI6A 3JRGA 5BNGA 1H9TA 2HQAA 3EYIA 2DIEA 2NYXA 5AIPA 4BU2A 4IHYA 1PJ6A 1W2BB 1QVGB 1B9MA 1BX1A 1W9XA 4XORA 2XT2A 2F48A 4LOCA 3CJRB 1BC8C 1I27A 1KK1A 4M6XA 1DDIA 5D6FA 1I5ZA 5DD8A 4E7JA 2Q6OA 2WZNA 1OR7A 2LF7A 2A6EF 2ZJ2A 3H36A 4P9SA 2OTLI 3BPVA 1N78A 3GVLA 1R1UA 2RN7A 2IAIA 4KMFA 1I3AA 2VONA 1OISA 2K9SA 2NTPA 2GWRA 2JRTA 3IWZA 1FSEA 4GCVA 1JJ8C 5H59A 3V7RA 1OKRA 1MBKA 1N07A 1ONVA 5A88A 1WJFA 3UW0A 1IB0A 3ZMUA 3TMOA 3MHPA 1TW2A 2EA4A 4RB0A 4KMUX 2DY1A 2E19A 2EIXA 4RDLA 1WSUA 1K61A 4MYTA 2XAUA 3GZ5A 3R6SA 3CB4A 4HLYA 2BM1A 1YX5A 2K40A 4U0VA 4HNTA 1E1QA 1X1DA 1W34A 2EFOA 3T53B 2QBYB 2CW0F 4AF7A 2ZMEC 2E2HJ 2FQ3A 4ZYHA 1X0CA 3A0BC 2QF7A 1A35A 3OS0A 2K27A 3S8PA 2IP2A 4YFOA 1MMGA 1SMYF 4MEXF 3E5XA 1COWA 1QA2A 1WP6A 1AIPA 3HSEA 4Q4ZF 3A1PA 2EV0A 1R00A 2PMUA 2M87A 3LA3A 3Q39A 4Y13A 2R0QC 1VI0A 3F6VA 4ETSA 1ZN2A 4OMYA 2AS5F 3BZ6A 4QV2A 3CUQC 4QLCU 1ETVA 4QPQA 1TQMA 5DUIA 3LVBA 4C2UA 1X3UA 1K4SA 2EZIA 1KQ5A 1E1RA 2FXAA 5FJ8J 5FKKA 3OL3A 1S5LC 2E7XA 2L0KA 2DK5A 2VBUA 1IGNA 1RQPA 2F43A 3Q38A 4NBSA 1TC3C 2Z99A 4P25A 2E34A 1ZG1A 2JDIA 2PYHA 4HX7A 2VYQA 1JT6A 1J2XA 3FM5A 2NVYJ 2GJKA 1FOWA 2QZAA 4KUMA 2ECBA 4ESFA 1ZRFA 4U0WA 2ID3A 1XDUA 1LDKB 2PMZA 3CCUB 1KQSB 3VR6A 3BZCA 2QDXA 1KTWA 1Z3YA 2X6YA 2PMZN 3LSGA 1BI2A 2HQRA 2K02A 4LLLA 2LK2A 5H6QA 3ZQIA 3R4KA 2VUMJ 1YYVA 1PVEA 2QXZA 1DGRM 2IS6A 4G9YA 1UMKA 4EQQA 2DFHA 2OBRA 2VNKA 1GV5A 2N8GA 2DJIA 4WF2A 4P9UA 1OPCA 2WC2A 1GHCA 3WTSC 1KA8A 1Q1HA 1QQIA 3EDPA 2XEXA 3LNNA 3KEQA 3ZXSA 4CZCA 2AHOA 1W7PA 2XIGA 1DBOA 1G3SA 2HVRA 3OOUA 2CU7A 5FRMA 3T51B 2JA7J 1W5CC 4EMSA 2BEOA 3JRBA 2ZJPF 1D8TA 2C77A 2PJRA 1VQ6B 3B4NA 3I9V2 4XIDA 1YITB 4CO8A 1ZG5A 1KCCA 1ETOA 4IKFA 4IQ4A 4FTHA 2WJYA 2DYSH 4X8IA 4NQWB 1JE8A 2GA2A 4XN0A 2O8KA 5LFAA 2I1LA 4MIMA 2W48A 2LVSA 4U7DA 3H9QA 1DQUA 4A3JJ 4PGGA 1LLZA 1B4AA 3LMMA 1EJ9A 5TR9A 5L3GA 4PFPA 4HSRA 4YFKF 3ESWB 3TH0A 1VQNB 4PABA 2ZFUA 2CG4A 4DBQA 5F0HA 2BY2A 5HVQC 1TYXA 2UWMA 1EFRA 2VBTA 3FK7A 2LD5A 1K9MD 3BTJA 1HG8A 3VYUB 3FXJA 4UNOA 1M1EB 4MNUA 2WAEA 3TOBA 4RAGA 3TGNA 2JN6A 3CCUI 3SQVA 1OCPA 1UMQA 1OHHA 4ZGNB 5CVJA 2NOGA 2HEOA 4RD2A 3Q0VA 4IRGA 3QP5A 2JIZA 2DA5A 2DBBA 1GAQA 2OBSA 5KW9A 2QGUA 4IZZA 5ILVA 2ECCA 2DW4A 2XPUA 1JJ2B 2FQ4A 4QPOA 1QVUA 2IOUG 2O3FA 3K7AJ 3IV5A 4RM0A 3ABKH 2C4UA 4KJZA 2RDPA 9ANTA 1KMHA 1S7EA 1MD0A 1N75A 4YRVA 2VC0A 3GW2A 4IQJA 4XLAA 2LRDA 1IDJA 1D1BA 3FZVA 4II3A 3L2CA 3SZPA 1HSJA 2M5SA 2MLKA 4M9ZA 1PUFB 2NV4A 3QQAA 3P9KA 4N9HA 4BYYA 2RC4A 2O0WA 4G8XA 5C4XJ 4RDJA 3MVPA 3BPXA 3D26A 1OJLA 1CF7A 3TO6A 5LGTA 1FMWA 3H3VK 3WGGA 2LF8A 4P96A 4L8JA 3WTXC 4XMYA 3DLLF 3GXOA 4A0XA 2EWEA 3DBHB 3IAM2 4XSZF 2V4JC 2ETHA 2K9LA 4ESBA 3A8JA 1WQ2A 1S29A 3S1NJ 3FXLA 1OYYA 5FA6A 4F3QA 3AAFA 2VJIA 3KZYA 2IGMA 4O3MA 5L3DA 3SFIA 4YFXF 3OYEA 5ICCA 3RZDJ 1D8KA 3GTQJ 1RU4A 2NZMA 3ZMTA 1QFYA 2BV6A 2QQ9A 2VJ5A 2PX9A 4KIGA 3RPUD 1ENHA 2H1KA 1N0UA 2VOPA 2PE3A 1SD6A 3CUOA 4RAFA 5D8KB 2X53S 3C1DA 2WAQA 5AONA 4A3BJ 2V9VA 2V4DA 2EFPA 3JQRA 3WBKA 2EQRA 4YAFA 5BSXA 3SDGA 2JJ1A 4NB5A 3WTTC 2A6TA 2DMQA 3F8BA 4FCYA 4OMZA 2KZVA 2XGXA 3VSVA 3HOTA 3ZBUA 3SYJA 2ZC2A 3PA1A 4GFBA 3U1KA 1QNTA 4C43A 4IXAA 4YIRX 4BQQA 3A35A 1YIOA 1YW7A 2BGCA 2DTRA 2C5BA 4KITB 3FXOA 1T6XA 1O3TA 2DA7A 4TKOB 3V7CA 1BW6A 3B8HA 3LSHA 3MCAA 3EYYA 3BQZA 3PL8A 5HLTA 4HIZA 2NPFA 4EATA 5E17F 4OAYA 1SFKA 3N6ZA 4DBRA 2HNHA 5J1RA 4W8RA 2W00A 2C2WA 4X7FA 3U6BA 4YHBA 1FNNA 2ELKA 3S15J 3QFCA 3PVDA 4YALA 1QZEA 3Q0WA 3L00A 1XS9A 2R5YA 1SKQA 3K4JA 4KT5C 3DQVC 5IT9Z 2VFQA 1NHAA 2WA0A 1JHFA 1R58A 2MFZA 3M7GA 1ZTRA 5HLIA 2HYFA 2FMLA 2Q6IA 2XAHA 4BY1J 3PSFA 5DNSA 2QQAA 4R1HA 5J47A 1YLFA 2DFEA 2KIQA 5JR3A 2QX3A 2CF4A 1XDSA 2D5VA 5H20A 1R5GA 1FIAA 4M3FA 1NB9A 2CWEA 1XG1A 3WNDA 4KA4A 1YJWI 2D9RA 2M0MA 2ZMEB 3FX3A 1LVAA 1ZM3A 4AU7A 5EJCA 4WQMA 3OYJA 1YI2I 1U5TB 2XRNA 4LB5A 3OYMA 3HGYA 3JQQA 4RD4A 4E7HA 2ZSIB 2UVEA 3WU1B 3FXUA 2W57A 4S05A 1TBXA 1EH6A 5FKMA 3GTKJ 2P6TA 2JA6J 1R6RA 5FRNA 2R9VA 3QFRA 4D5CA 1WHUA 2NS8A 3KYCB 2E2IJ 4LMYA 1IDZA 2VODA 2E1BA 3PA2A 4JYKA 4QUZA 3JRCA 1I39A 3F9KA 3C2BA 3MCZA 2QBYA 4FE7A 3X2QH 1K78B 3OW2B 2BBYA 3H5NA 1W5TA 3CUQA 3R61A 5FLXZ 2QSGX 1VQ5B 2M4KA 4UY8I 1T6YA 2BM7A 1QG0A 1T5EA 4CUGA 3CC4I 2IS1A 1Z1DA 4A0ZA 3KRGA 1VF7A 4N3GA 4HBLA 4G7ZF 3SLNA 2BHZA 1W0JA 1W7PB 2STTA 5C4JJ 2DA6A 2BVLA 4B48A 4NBQA 3QSYA 1WPKA 1MBHA 2JRMA 4ZDOA 1YHQB 4WCGA 3BROA 4BQAA 5D4RA 3U1DA 3DWLE 3QP6A 1PUFA 2NNNA 4L9TA 1TNTA 4BNCA 1DDGA 2CFXA 2W7ZA 4GYGA 2LYCA 2EZKA 3OYCA 3PUMA 4W8QA 1AIRA 1Z3XA 2XAJA 1IJWC 1WGXA 2RC5A 4ROXA 4AYBA 5M3FJ 1J09A 1RZ4A 1WI3A 2JJ2A 1VQ4B 3WY9A 1VQ7B 2IRFG 1Z6RA 2YWGA 3CCRB 1U8RA 5LBQA 1SD4A 2MW8A 3HXLA 2X0KA 2ZZEA 5EEGA 4IVNA 2IA1A 5J4YA 2MABA 4YIIA 1ZRDA 5E6TA 4ZYGA 1LQ1A 3I4NJ 1JGSA 3ZC3A 3KP6A 3DBLB 3GTMJ 4X0GA 1T39A 1BN5A 2M8EA 2W85A 1NTCA 2W6IA 3OOCA 1YE9A 2XB5A 5FKLA 3FXKA 4UXNA 1ON1A 1DU6A 3CMYA 4HV5A 4I7HA 5DEQA 4BE2A 1REPC 1BX0A 1HCRA 3ZQ7A 2IBDA 1Z6TA 4PC3A 1JTAA 3I59B 4P5OA 4ZYAA 3S2DJ 5ERIA 2GXAA 2V9KA 4F93B 1WH7A 4OAZA 1XSXA 4XICA 4LB6B 2IXSA 1FMVA 4HZFA 3JSPA 1MDMA 2CW5A 4U9UA 2M4GA 3V7AA 1FJLA 4N3NA 2DMTA 3DU6A 1QPIA 4XKCA 1VQPI 3H3ZA 1L1IA 4C30A 2VPLA 1QGPA 5BOXA 4U88A 3RQIA 3EQOA 3ASQA 1Z7LA 4I84A 4P26A 3CCSB 2WB1A 1TTTA 4IEJA 4M74A 2I10A 2F3LA 1EFTA 1CQXA 5FLMJ 4U87A 3IAS2 1MABA 1EZGA 4AC0A 1LLWA 2K9MA 4O5VA 4X06A 3HOVJ 1YJWB 2BYVE 2DDBA 3I3LA 4BJTA 4JX4A 4YELA 5J3OA 2DYRH 1VQKB 5A89A 5CQGA 2KDZA 1XB2A 5E3OA 1H88C 4G6QA 1N05A 3S3OA 1YIJB 4CCLA 3CC2I 2JQ7A 3J7AO 1FX0A 3B78A 1I1SA 3DBRB 3NARA 4I99C 2AHQA 2EBIA 1JKRC 3EUKL 4CCOA 1UD8A 4ZDLA 1O57A 4LITA 4E7SA 1TNSA 2HLDA 1KZHA 5GP9A 1D3YA 3CCYA 5D5WB 1TT0A 1S72B 2HOEA 3FKJA 1H89C 2L7MP 5HODA 2B7CA 4ZCMA 2VC1A 2L4AA 3VYTB 1KK0A 2PN6A 2V7WA 2IPQX 2KHMA 3JW4A 2EWNA 3HPGA 5CLSA 3OZVA 3DP7A 3A03A 4B3FX 5E1XA 3QPTA 3RYRA 1YFHA 3RIRA 3LQRA 2DQRA 2R7TA 1DPRA 1R1VA 5HLGA 3ZQLA 2YX7A 4YG2F 3KETA 2PFBA 1WSRA 5KK1A 1G7RA 1DGWY 2OZ6A 1S3JA 3PM1A 2PLYA 1S4MA 4IPAA 4WXCA 2RGVA 3BG9A 3GIRA 1O8EA 2KJCA 1QUEA 4EGYA 5IT9K 3LSKA 2VIXA 1IN5A 3C2GA 5AIQA 4ENNA 1QX4A 3ASPA 3CJNA 1E0EA 2IQ7A 4LFUA 4E0FA 2EB7A 3ECHA 3S2WA 2UXXA 1R1TA 4P9FA 4CDGA 2KP6A 1FTZA 1EFCA 2MSYA 3N05A 3F8FA 3P7NA 2FA5A 3QU3A 2Q8KA 4FE4A 1ZH5A 2WR8A 3IRRA 3L2QA 5D5XB 5F4OA 3CJQB 5FFXA 3CXCB 2H8WA 1YJNB 3AVVA 4C0SA 4U0YA 4BH9A 1U0JA 3HOWJ 1YOVB 1U5TA 5GPAA 4V2FA 2MH9A 1K28D 2P81A 1R22A 2WV0A 1GVDA 5IYCJ 1Z05A 4AM3A 2BGIA 2YU3A 2ZSHB 1HLVA 2ZXIA 5FFZA 2KQRA 2Y9ZA 4LIVA 1CF7B 1SEUA 1N8RD 4N4NB 5D5VB 3OJWA 3IHUA 3T0YA 3H0GJ 4UV8A 4BEHA 3OSGA 2HDCA 1A6IA 2HFHA 2HOAA 2Z5UA 4WWVA 4W8SA 1O8FA 3V42A 2JT1A 2QLZA 1QVTA 3SHFA 3HRUA 1T8IA 3GUDA 4LLGF 1AU7A 3OZWA 4RA2A 3OYDA 4Z4UA 3AGPA 2VFMA 4GGGA 3HB9A 3MFKA 3CF2A 2CQXA 1MNMC 4OIQF 2FUG2 3G1MA 1IW7F 3OYNA 2OPTA 4RS8A 3AVUA 2A61A 1R9TJ 3E20A 1FLIA 3G05A 3J80K 4BQNA 1IHMA 4UVCA 2KZGA 5LGNA 2DYIA 3S3MA 1OFDA 2H94A 4KN7X 3M1CA 3CESA 1UD2A 3QOEA 3DPLC 1ZR4A 3FIWA 1OGIA 2M9HA 2RQQA 2I5UA 1W0TA 1B1BA 2JVGA 3HZJA 1CNEA 4Y9UA 2ODLA 3ECOA 3IRQA 2BM4A 3I0TA 3K4MA 3PENA 5AMVA 2GK7A 2J5OA 2L02A 4PUSA 5A2QK 4Z4YA 3FWEA 2A3SA 3CCJI 2CNDA 4J0QA 2ME6A 1E79A 4IOCF 4PDKA 4FWTA 4UB6C 1OFCX 4UUSB 2K86A 1YHQI 2L7ZA 3ZPNA 4BAYA 2KRFA 5K7HA 2FBIA 2Q6KA 4AIDA 1EFUA 4OIPF 2VQLA 5EMNA 2DO7A 1SVOA 1YITI 1R71A 3NAUA 4OJLA 2COMA 1OCCH 1XQBA 2XASA 1G3WA 3G6EI 3KPHA 4B3XA 5EG0B 3FKIJ 4I09A 1TL8A 3WG9A 3CCVI 3BY2A 3OJXA 2L9SA 2P5LC 4Z4VA 1WORA 5KVRA 3HOXJ 2ZL7A 3RJPA 3Q9SA 1YX2A 2DT5A 5HDKA 1T33A 4UUTA 1P4XA 1K8AD 3SZEA 2JZYA 1XGOA 2M0CA 3FHNA 4XRFA 3HTSB 3GLXA 1OCZH 4UUVA 3LO8A 3CCQB 2F5FA 1B8IB 4RAYA 1JKOC 5ILUA 1FTTA 1TWAJ 1Y1VJ 3DV8A 3OEEA 1FBSA 1N77A 3QPLA 1E62A 2E5ZA 4G1BA 4OIRF 1W1WE 2YWEA 1D8JA 1Z77A 2DU9A 2V7VA 1KQ0A 1D5VA 1LVKA 4IOAF 4UZEA 2GXGA 2RV8A 3U21A 3EUHA 1XMKA 3VEPA 4XLPF 5FO5A 3R0JA 3W5HA 3H5RA 4OM9A 1SAXA 2LC2A 4HX4A 4L0YB 1PJ5A 2F1MA 2CUEA 3GQBA 2BY3A 1SKYB 2CO5A 2PECA 2DCEA 1LUJB 2QE7A 3W6JB 4IHVA 4DQLA 3F3XA 1RESA 2Y2ZA 1SD7A 3PQJA 2VKVA 1EP1B 1VQ5I 4OPSA 4HYEA 1DBGA 2H6BA 5BPDA 4G1VA 3AL0C 2EFQA 3LFUA 1FRQA 4GDFA 3JTHA 1K4TA 1G6NA 3WG7H 3O8HA 1KONA 2DI3A 3ZGKA 2LY1A 2W84A 1O3SA 5GPCA 2ZJRF 2L4MA 4FX0A 4A6EA 1Y0YA 4RCYA 1WJCA 1JKQC 3OPOA 4W8TA 1MGTA 1PYVA 1LE8A 1I3QJ 1HA8A 3OP1A 3NWTA 2OQGA 4Z4TA 1W5SA 5J1YA 1MMNA 4G5GA 1LB2A 1G2HA 3M3YJ 2XZLA 2LLKA 2WAQN 4TMWA 2M7AA 2PQ8A 1T6ZA 2WSSA 2V1DA 3IUOA 3KEOA 4EJWA 1O8IA 3KP7A 2JSCA 5JVGF 3ERMA 1GXPA 1BQEA 2L3DA 3BQYA 2NNYA 3KCCA 1BHEA 1B59A 4KIFA 2BXYA 4CXFA 3CRZA 4XOTA 4HE5A 1BOAA 1AWCA 2X85A 3L9FA 1WOPA 4ZCLA 4ZV4A 2DA1A 2O17A 2BM0A 2MC4A 4XNFA 3GCMA 3GMEA 5F08A 2EFWA 4NUBA 1YS6A 5EEAA 2F5VA 2BM6A 2QYUA 4AIJA 1ZGWA 3Q3AA 1MMSA 2KLOA 4X1EA 4EGZA 1B6AA 2JSPA 1HDPA 2O1DA 2FU4A 4PSWA 3GVAA 2QKMB 1JT0A 3ZUGA 3HOZJ 4AVPA 1ULYA 3F8CA 2I8DA 1BR2A 3RKYA 4ASNA 3QOPA 1FPQA 2JK3A 2E2JJ 1S72I 2BZTA 2Q2EB 3A3BA 3LQEA 1JKPC 3I56I 3S17J 2R7VA 1W0UA 3Q3SA 2ZTNA 2LR8A 3SDBA 4B4DA 3A4CA 4BPRA 4Z4RA 1P2FA 3I54A 4V19K 1W87A 1T95A 1KJZA 3J81k 4XK4A 3WGHA 5LLQA 3R6KA 3DFGA 4X7EA 1Q9SA 3HM5A 4D7NA 2QTZA 3GO5A 1TYWA 3DEWA 2XAGA 2EIKH 2V26A 2W24A 3T8RA 3SEZA 3A1YA 2Y69H 1HW1A 4BGDA 5C44J 5LRSA 3BJAA 5M5YJ 1R23A 3SKBA 4FETA 1P4AA 1KQ9A 4AWXB 1X58A 3CCEB 1IO2A 1OFLA 4IL6C 3ZZTA 3U6KA 4RD1A 2IA2A 1XC5A 3H9GA 4MHGA 2GOXB 1PDNC 1TWGJ 4A3MJ 3E1YE 3ISPA 2O0VA 4KICA 2JJ7A 2QQ8A 3EQLF 1H0MA 4Z05A 3CQZJ 4RBOA 1AMOA 1VQ9I 1FBUA 1NBMA 3CCQI 2NS0A 3DU5A 5LRRA 4BUPA 5JLXA 1Z91A 3A01A 3ULQB 1D0ZA 2EV5A 4OOVA 1Q81D 1RI7A 1ZK8A 3VSUA 2QUFA 4XL9A 3CMEI 5FKOA 4HNUA 1XCVA 3CMAB 2R6HA 4B43A 1G7SA 2FMYA 5THXA 3TO7A 1T38A 2C78A 4PFOA 1QZYA 4HRIA 1V54H 1B72A 4Y33A 1HSTA 4X7DA 3S1MJ 4CCJA 2CRGA 1WPCA 4XKWA 1VQ9B 1WI9A 1ZELA 5C3EJ 3JRAA 4M71A 1I6HJ 1B72B 3AVTA 1YO5C 4PC7A 4OOSA 3SXYA 1QU3A 5TJJA 2C6YA 4JX6A 5FO0A 1FNDA 2FX0A 3OEHA 1P4WA 5BPIA 2KFDA 2X1EA 5K7FA 3ZZ0A 2QWWA 4R79A 2JTVA 5H2FC 1V5FA 3DTIA 1QPMA 2P5VA 4UVAA 1U3EM 4A3DJ 1RIOH 4Y9RA 3ZOBA 3WBJA 2VBYA 5A2QZ 3JRDA 1PJRA 2KIMA 2VE8A 4HLXA 5IYDJ 2L9RA 2Y0SN 3HTUA 1RKTA 3QYEA 2V7UA 3WTZA 1MDMB 3H9NA 3HGGA 4L9VA 1RETA 2CV1A 3GQAA 2BF4A 2DT6A 2WB1N 1E3XA 4OJ5A 1HKTA 1H8EA 3H1CA 3HHGA 2O8XA 1J7KA 3OY9A 1MH4A 5HS8A 3J80Z 2CQNA 1HW2A 3FXQA 2XZPA 1SM4A 4Q48A 4HDUA 1JB9A 4OPVA 5B1BH 3WXMA 5E8GA 4V02C 4CYDA 3DKXA 3A8KA 2D1VA 1X4PA 4EH1A 2R7FA 3AFHA 4OU0A 2XAFA 4D5FA 3H92A 1VHOA 2MBFA 1EH8A 2WAFA 4KKSA 4IW3B 2FNPA 3W2FA 3AVXA 3U2RA 3GVKA 4NC6A 3Q6RA 1USSA 2DMPA 2R7UA 2OTJI 3B8YA 4XKBA 1XSDA 2JVHA 1GXQA 2DFIA 2WADA 4JX5A 1UFMA 1DPUA 3JRHA 1Z9CA 3GQ9A 4IHWA 2BOLA 4FN5A 2FVGA 3BR6A 1TYVA 1IJEA 2GAUA 2IS4A 1VHEA 3L09A 3PNTA 1U2RA 3I4PA 3JAMZ 1ZARA 2CFOA 5GV7A 1OFMA 2G0YA 1OOCA 2ACJA 3CPWB 1QZZA 2ESNA 4OZZA 4G6IA 1Y6IA 2A5YB 5CPRB 4B3GA 4LJZF 3V8KA 4MEYF 3KE2A 2OC6A 4ZZDA 3U9GA 1LEAA 4FXUA 1UD5A 3LNQA 4EJTA 3K9TA 3ZQCA 2Y9YA 2BMWA 1KCDA 5C1EA 2K85A 2E1OA 2LREA 2PIAA 4ASUA 2QA4B 2BSPA 2PMDA 2HYGD 4E70A 2VN2A 2VASA 2XKPA 2R5ZB 5HDGA 1XE1A 1G4DA 1UHSA 5ICFA 2VB6A 1GJRA 1BBYA 1X1PA 5FD5A 3BTCA 3PQKA 3ZMVA 3AL0B 3S1QJ 5KNLA 2FJ1A 1T2KA 3LYCA 1QO0D 3CPXA 2X3UA 2RC6A 2MG4A 3ML6A 2BE5F 2CBXA 1D0XA 4LG0A 4CHUA 1WJBA 4FISA 5GAGJ 1RNLA 3A8IA 2HTSA 3P5JA 1WRJA 2IW5A 2X51A 1LEBA 1TLLA 3NE5B 3A3GA 4P12A 2XSDC 5DCFA 4DZPA 4FT8A 4AUXA 3IP4B 4HV6A 4WX9A 5KSWB 2P6SA 2QY1A 4Z4SA 4N9IA 3FPKA 4KIBA 3OYKA 3BJOA 3N4MA 2NVQJ 3FJOA 2DERA 3U2QA 1WFXA 3V8LA 5ED4A 2GM4A 5GV8A 4OOXA 3TP0A 2BW3A 1H80A 4Z6YA 1SFEA 2VKDA 2BV3A 2XPVA 2LDUA 2XOKA 4OJOA 2B5OA 4HPQA 1HC8A 2K5CA 3BR3A 2XF6A 1W35A 4YAWA 5B3SH 2XDVA 1O8HA 1U5TC 1XTAA 2RKHA 2OCEA 2GIZA 5DV5A 5E8IA 4CQJA 3CLOA 1KC8D 3OYBA 2IGKA 4RJLA 1X4OA 5L46A 1R5HA 1ZGAA 4IHXA 5F0CA 2XB0X 2A69F 5FB2A 5DS0A 2GQQA 4OINF 1P7JA 1FC3A 1WKMA 2VZLA 3ES9A 5LMZA 4OIOF 4LG0B 3C7JA 4BE1A 1NH3A 5IP7J 1ZREA 3MZ8A 4HG2A 3AVWA 1T0FA 1F43A 1ZM4A 2UVFA 3JURA 2DA4A 3GFLA 5JHUA 3PSZA 2ZB9A 3DEUA 3WGIA 1SFUA 3PETA 1BJKA 3BWGA 2GREA 1GV2A 1VZ0A 1HZEA 3KX2A 1T08B 2Q1ZB 3RKXA 3P9IA 4QTRA 1QVFB 1ETYA 2OV7A 3OSFA 1MSFC 1BN8A 2E7WA 5DUKA 3ZQHA 2Y30A 5LEJA 3BCBA 5LHIA 3BY1A 1O8GA 2J8IA 5F0FA 1JGGA 4BS9A 2GBYA 1FYLA 4OWRB 3CCEI 5K5OA 2ZJQF 2XNDA 4UZUA 2E60A 4LK1F 3PO3J 5GTHC 2DN0A 4EM1A 1TWCJ 3CP2A 4D7MA 5KHDA 2X6OA 1TQIA 3BC8A 4C2TA 1QFZA 3CCRI 5CKTA 2L5QA 2DTZA 2Y48A 3VSKA 3GRHA 4YZAA 4G7HF 2G0EA 3BLYA 4YFNF 1RR8C 3M8FA 4QSHA 2BVNA 3ZIAA 4OJ6A 2IVMA 4RM2A 2XTXA 5HOOA 1U6GA 2NSTA 2ADUA 4X6AJ 1FEXA 1OGMX 1OLTA 2IGOA 5H5JA 3HOSA 2PI0A 4I02A 3B90A 3WTUC 2XROA 4B3AA 5J4VA 2E35A 4C2MJ 2OQRA 1OGJA 2V9PA 1IUYA 1SC7A 3NB2A 2HQ5A 3OIPA 3I59A 4DNTB 1O8LA 4KKUA 4G6TB 4KH3A 1I1GA 4IHSA 4K1XA 5IOZA 2R7WA 3WWGA 1BIBA 1IXRC 2B7BA 5H6RA 4D1QA 1Y0NA 4BDZA 3GFIA 2KPMA 2M8GX 5TGTA 3OIOA 2GQFA 3OYHA 3N97A 1FYMA 1A6QA 4PJLA 1YRNA 2PMHA 3DPUA 4M9SA 2V7QA 5IYQA 2WWYA 1O8MA 2VL8A 2EJRA 3CP8A 5TRDA 1S8NA 1LNWA 1UCRA 1GLNA 2F4IA 2VKEA 2FOKA 4WZTA 3RPUA 1KYWA 2CH0A 3RI4A 1HDDC 2E1RA 1E3OC 4PGOA 2D2WA 3HUGA 1DDNA 1EP3B 1ZGJA 3J81Z 4BE0A 1OYIA 5F1JA 2E36A 3F22A 3T9GA 2HZTA 4ABZA 1NHCA 2H8RA 3RKWA 1FWZA 2HZDA 3E7LA 3GWZA 3GTOJ 5ILSA 1IAWA 4MTEA 2M34A 2NS7A 4BXFA 3G71B 3MN2A 2O61A 1WJEA 2QKLB 2O0YA 3NEUA 2OA4A 3FK6A 5F64A 1TUIA 2CW7A 3PUBA 4KN4X 4HW0A 3PJRA 2CUFA 3L2VA 2W6JA 1KK2A 4MGRA 2BX6A 2STWA 1WJDA 3ABLH 3H0DA 5B6IA 1T0FC 3GF2A 3GFJA 1E63A 4PJJA 2A68F 2NOJB 4RB2C 2VKHA 4G7OF 1GAWA 1O7FA 5GADJ 3KIOA 4PJNA 1V0EA 3DTKA 1IUFA 1D1AA 4HAMA 1IDKA 3ASOH 5K5RA 1LFBA 1G7CA 2CYYA 3ELKA 3PUNA 1MW7A 1X2MA 2DT7B 2V31A 1DARA 5AN9A 1FZPB 1BC7C 2EPFA 3VFZA 3GLLA 1NRKA 4P3IA 4OPOA 5HZBA 5HDNA 5E3MA 1I18A 1BI3A 2CW8A 4XRMA 3RQ4A 5FKNA 1IA5A 2JN9A 5J40A 4WXDA 3RYPA 3DEEA 3EUHC 3SJPA 2H6CA 2ZBUA 3NQOA 3E97A 1CZFA 1X1BA 1WJAA 3BT9A 2VQHA 1UAAA 1FY7A 3BR2A 4RAZA 4BKXA 1RUNA 1WVRA 1ZLJA 4MQVA 1RRJA 3K70C 3QFTA 1JUSA 1R4MB 1FX7A 1VQKI 2MLGA 2JA5J 4FHTA 2V1XA 3HHHA 1XCBA 2GPJA 2OJED 2ZBVA 1BM9A 1TZLA 2GOMA 3OKXA 2XZOA 3GTGJ 3W6KB 3LQ6A 4IJAA 2XF5A 1PXZA 2FOWA 1VTNC 3K69A 1YX3A 1G3YA 2EZHA 3HRMA 3GSIA 4A3CJ 3BG3A 3P26A 2NVUB 2LBFB 2E1CA 4M1KA 1MJ9A 1QRCA 2KIUA 1WWXA 1OR7C 3T56B 5FROA 1J59A 5IP6A 4RGSA 3RKQA 3K2ZA 1B2RA 3LSPA 4XKVA 3HEFA 2VBZA 3PFYA 1CQTA 5E20A 4G6DA 1SFOJ 3VNVA 2VBXA 1Y0UA 5E79C 3BZKA 3COAC 1LPQA 4LBZA 1M90D 4HWVA 4D9JA 1R7JA 4EM2A 1FOXA 2JPCA 3VO1A 1RWRA 4DYCA 1Y0RA 3MD2A 4NDLA 3G71I 4QHYA 4Y4RA 2F4MB 5CVVA 5DM7F 4TMTA 3TKYA 1QHHD 3PO2J 4ANJA 4EM0B 2XGEA 2PG4A 4BJ6C 3FMRA 1ORKA 2WYRA 1H9GA 4YAOA 4CA0A 2DCUA 3HUGB 1E3ZA 4ACAA 4XLHA 1RMGA 3FBNB 3TL4X 4ENJA 1O3QA 1TWFJ 4OOIA 1OCTC 3CCSI 3E6DA 2X8KA 4P6VF 3WNCA 3ZMDA 1QA3A 1YLOA 3ZR8X 1WTHD 1J9IA 1VQLB 4BEHB 3JREA 4QFMA 4DNRB 2VI6A 4A69C 2YX4A 3LAPA 1U2WA 1ZQ3P 1VQNI 3N90A 4MXNA 3WU0A 1DABA 3A0HC 2VNJA 5IK2A 1IRFA 3ZP5A 1O8JA 4M73A 4X05A 2DLLA 1HA3A 4G7XA 1R5NA 2V6EA 2P3MA 5J35A 5J6XA 3G6EB 2Q6LA 3M07A 3V4GA 3F8MA 4ON0A 4XLCA 2R92J 2O9LA 3W6VA 4LK0F 1DG1G 4DK1A 3REOA 4ZTJA 4HQEA 5D6EA 3BJ6A 2D3NA 1BMFA 1E3HA 4RCZA 4F91B 1IRGA 1S7AA 4PC1A 3CC4B 4TMXA 4A3KJ 2XKOA 5K1YA 4F52A 1HF0A 4PAAA 2QM3A 2EZLA 2R7DA 1XSVA 3CD6B 4ZYDA 5BQTA 2ZZFA 2BM5A 2DAOA 2JWTA 3LSRA 4MFEA 1R5ID 1MBEA 2ZCWA 1R4NB 3QWLA 1E17A 1UHMA 1FOYA 2Z3YA 2BW3B 2ISYA 5FLXK 4H9GA 5EEHA 3I53A 4YC5A 2QYOA 3L2UA 1AOYA 2KL4A 3WODF 4OZYA 2HPIA 1KU9A 2CV2A 1UJ8A 2DETA 3O8GA 2HXIA 2VOOA 1XPXA 2EIMH 1QQ1A 4RGUA 1GVHA 2VLAA 3SQNA 4PGHA 4DIQA 1XGNA 5K5QA 2E1MC 4L0ZB 3BH7B 3ZPPA 1ZYRF 1GO2A 4TN1A 1OB0A 3IH3A 2YS9A 4BHBA 2R93J 1WU8A 1KZLA 1X19A 3M9AA 4OPWA 3ONUA 3BCAA 1TP4A 2R5YB 2YPRA 3J7ZI 3GBGA 4XLNF 3G1OA 3CLQA 5JLVC 1K78A 2EFNA 3S1RJ 5L3BA 1P6RA 4WZEA 3BG5A 2LBFA 3SYTA 3I64A 4JQFA 2HQNA 4UUSA 1F5TA 1QA6A 1A5JA 3ABMH 1W36D 2ZO4A 2VFNA 2DA2A 1XD7A 3DXJF 3BCDA 1YS7A 4CCNA 3KEWA 1TVCA 2CRVA 5FNZA 4PK4A 4Z2YA 3FY3A 4P1VA 4QIWN 2EH3A 1IRZA 2YWHA 2QSFX 2ZFWA 4LGWA 2PJPA 3QFSA 4M3GA 3SFZA 1Q82D 3EQNA 1IC8A 3BR0A 4M0LA 1D0YA 2OBPA 4DJAA 3EETA 3A02A 1GT0C 4BDYA 4IRIA 3ZMSA 1BJAA 2LTPA 2QEXB 2BY1A 3KP5A 1EE6A 2AXLA 1SMTA 2FBHA 4PC6A 1MRZA 3T8TA 2R5ZA 1TT5B 1E64A 4I76A 4A3IJ 1K4ZA 2MGQA 2VXDA 3H3UA 4Y7NJ 3HBLA 4GXOA 4HSTA 5F27A 3W3CA 1FOKA 5ICGA 5GAHJ 1OQYA 2OD5A 3KP2A 1QUFA 1F9NA 5DCMB 1AKHA 3KFWX 3M4OJ 3H35A 4XR6A 2FNAA 4PZJA 2NRAC 3Q6QA 3K1PA 3LA7A 4D0PA 3D0SA 4CZZA 4A3LJ 2BPOA 1IG7A 4HF2A 2OU2A 3S93A 4BXUA 3WQZA 4LD5A 3JRIA 1XX5A 4AYBN 2DXIA 4A3EJ 1HXDA 4XSXF 3RDIA 3AG3H 5GAEJ 3KYLA 4MLOA 4P2NA 5LD2C 2K3PA 3OYLA 5DDGA 1JUMA 1KTVA 2M3AA 2EA2A 2QGGA 4PC2A 2OTLB 1O8DA 3RTRA 4AC9A 2OUMA 2DK8A 2DA3A 1ZRCA 3ASRA 1QJVA 4HNVA 1ETQA 2P0WA 3LL7A 3G4SB 2DOFA 3FBIB 5FGMA 4PSXA 3FHZA 1X3WB 1W36C 3OR1C 1ETKA 2ESHA 1GDTA 1S0UA 2A5WA 4CYCA 3FMSA 3HKZN 3G3ZA 4B8XA 1T56A 1RC9A 5EGOB 1C0WA 3CF5F 4XRSA 4M72A 1U9NA 4AIHA 1HKSA 2IEKA 3KZIC 2GJPA 4B1RA 4L18B 4RD0A 4F7DA 2VFOA 2O5RA 1MNEA 2V79A 1LDDA 3BG7A 5DYMA 3HYIA 4FX4A 2ISZA 3OAAA 5D5UB 2KRHA 5FD6A 1Y8RB 1B8IA 4YDTA 1JUPA 3AK5A 1MJBA 2GA1A 2TCTA 4E7KA 5KCMA 3W2AA 2QZ8A 3KLOA 3GFMA 2K9QA 3MMPA 3S2HJ 1FT9A 3K1MA 2DODA 1E43A 2PYGA 1K7AA 2MD5A 3M8EA 3OYAA 2FBKA 1BL0A 1W7PD 2W4SA 1VLOA 3SY2A 2XRLA 4RLQA 2QN6A 2PEXA 4UV9A 2MD0A 2OZUA 1VQPB 2ME0A 2M1BA 4AVZA 2VT3A 1P92A 4KNYA 3VSTA 4ZDPA 3QODA 4DQ2A 2A07F 2Q2EA 1N0VC 3F6OA 3SJMA 2VBEA 2XGCA 4GO1A 3BR1A 3MMYB 2RREA 4BQOA 5E18F 4RM3A 1JNYA 1QFJA 3ZQQA 3S14J 1RPWA 3Q5FA 2M5WA 4EV0A 2KT0A 3R60A 1WOOA 4KFCA 1BA5A 4QWQA 2XGDA 5FIUA 4MO7A 1B9NA 1IZ1A 2HI3A 2Y31A 1NG7A 2H27A 3D5SC 1UD6A 4TV7A 1H8HA 2Y0MA 3V8JA 4JBAA 4KKTA 1IF1A 1Q1VA 2MYSA 3O3KA 2QQBA 2HCJB 3HOUJ 3GEZA 4X7CA 4AF6A 3NWSA 3MZHA 1VLYA 5KAFC 4BXXJ 1X2NA 1MMDA 4RGXA 1KD1D 4OJPA 2DFFA 1H42A 2HVSA 2NSPA 1EA3A 3DPTA 4W1UA 3BTLA 3ISXA 1BI0A 1L0OC 2A6HF 2VQGA 4E6KG 4X07A 1ZLKA 1FIPA 3BH4A 1IN6A 2O7OA 3K1NA 2HR3A 1HW5A 3CCLI 3C18A 3KEYA 2LG4A 3WTVC 1JJ6C 1ZM2A 2ZL5A 4I01A 3WHBA 2XGJA 5IPAA 1PUEE 5BMZA 1XG2A 3G4SI 2QENA 4P1WA 3L2WA 1K6OA 4DQKA 2PJRB 1VJSA 1MBJA 1EKEA 1Y39A 4EJVA 1YJ9B 2K7LA 2OCCH 3ONYA 2HMAA 3O6BB 1D5YA 1IDYA 2MH2A 2WZPP 3HRTA 2R7RA 1AHDP 1QBJA 3D1NI 2P8TA 2ZKZA 3TDUC 2KISA 5DM6F 5E1WA 3UNGC 1A8PA 1Z0XA 3SZGA 3Q0UA 2J8KA 1BR1A 1V5GA 1FP2A 3VPRA 4EVIA 3E6CC 2VNHA 2K9NA 2CC2A 3RPQA 5J8CA 1F36A 2ID6A 5CVUA 1FRNA 4A3FJ 1EWYA 4Y3OA 1RQRA 5IYPA 1ZHFA 3W2GA 2G7HA 2INUA 2X3HA 3ZCOA 2OK8A 1FNBA 3ZRGA 2BXZA 1OCRH 4II2A 2IGNA 3MKWB 3QYBA 5LHGA 2QVOA 2M30A 2QEXI 3KZZA 4J01A 5M5XJ 4HE6A 5DS9A 5IYBJ 2OYNA 4KT6A 5D8LB 5IY5H 1Y8QB 2XHKA 2V7TA 4MFDA 5BSYA 5D4SA 3RY8A 4F92B 3L2RA 1SVLA 1FNMA 1AA7A 2X4HA 3ML3A 2VBKA 3S16J 4RPBA 2H09A 5F6FA 3GTPJ 1OYWA 2COBA 3VOEA 2DOGA 4S04A 1IV8A 2JUCA 4Q7JB 2LNBA 2P4WA 1OCOH 3JAMK 3OFNA 2FRHA 2BGJA 1MBFA 4G7WA 5F4JA 4URRA 3FPPA 3ZSCA 5C1CA 3K4NA 2Z9OA 1GUUA 1EV7A 3GYHX 3JR9A 2HTJA 2NVXJ 3OYGA 1WJ5A 4I2OA 3QPSA 3MEXA 3ASSA 1Z67A 5EGOA 2XSJC 2LY2A 3GZ6A 1FYKA 4EW9A 2CSOA 4HDVA 1BLIA 1LM1A 1I50J 2BHYA 2LZJA 5JFRA 1FSHA 3R6JA 4K2EA 3LSMA 3TW7A 2LKXA 1G7TA 2ZXJA 1K79A 1I7PA 1TQPA 3AKZA 5GTIC 1VBLA 2ZMEA 1ZG3A 4LLNA 3VB2A 4Y17A 2DPUA 2GLOA 2BN4A 2JUGA 1Y1WJ 2DMNA 3BY6A 4XLFA 2OK7A 4M6VA 1HOMA 3E3VA 2ELHA 1J0RA 2X0LA 3FXMA 4RLFA 4DNCA 2LFBA 2D3LA 5FLVA 2ZXHA 2OTJB 2HWVA 1HF2A 3BNWA 1FDRA 3QE2A 1RKWA 2KMUA 1NK3P 5IYRA 1UZCA 4Q5SF 5B5EC 1UD3A 1MJAA 3V7SA 2HOSA 4M4SA 1D1NA 4DZJA 1DU0A 3SEJA 2ZITA 2CV0A 4Z4ZA 2NT6A 4LBWA 4LBVA 4Y15A 2UXNA 2HXOA 2LMDA 4B47A 1POGA 2B9SA 4RMNA 3TQNA 3ZQGA 5A8AA 4DOZA 4WWCA 2Z33A 5LHHA 2HPMA 3BH6B 4BACA 4IHTA 1VQ8I 3CC7I 1U78A 2VXZA 3IL2A 1O7LA 3DKWA 3CMAI 3CO6C 1YTYA 2HOTA 2X1DA 2GZWA 4C3JJ 3ZZUA 3C2HA 3VWBA 4H0EA 3IKVA 4ZCIA 2VBVA 2JA8J 2LOOA 4YEJA 5FL7A 1VQLI 4Y52J 4Q47A 3TOAA 2PBIA 3OWTA 4LG3A 4BBRJ 2DPDA 5IT3A 2IT0A 2L01A 4A6DA 5DD4A 4A2UA 3G1LA 2UUZA 2VQCA 1HBXG 1XGMA 2RNJA 1PJ7A 4I6ZA 1R5BA 3SUCA 4C2LA 4DYQA 1IN8A 4WZLA 2L54A 3NRVA 1KU2A 2DEUA 5J1UA 5EZGA 4NC7A 3TW6A 3DDYA 1EA0A 4DGWB 2M2EA 1VF9A 2Q0OA 2XVCA 1GR1A 3OZUA 4N0BA 4DK0A 1UELB 1BR4A 2CQQA 3A2KA 1BJZA 3FMQA 1EH7A 2V7FA 4E7ZA 1Z21A 2L7FP 3VMFA 1STZA 5CVIA 2Y75A 2YUSA 1JTXA 5J8FA 3QRFF 4DYRA 1O4XA 3T5XA 3LFKA 4ZH4F 3ROUA 3CC7B 2QCOA 1OB5A 3LJYA 2XT4A 2WY7Q 3HSRA 5DTDA 1QGYA 4IF4A 1QGZA 3OYIA 3K4KA 3W2HA 1SAUA 4CCMA 1GVJA 1WCMJ 1J9ZA 4ZTFA 1V5VA 1IXCA 1MZBA 3HG9A 1T6SA 2DOAA 4RDUA 3TEDA 4HF1A 1ZM9A 2XF7A 3R0AA 2ZZQA 3PFIA 4HEA2 3FM3A 2R7XA 2OBTA 1WSVA 4P55A 3VYRB 3FISA 2QSHX 2XTWA 2YUHA 4P3YA 3PNYA 4A5NA 4CCKA 4F55A 2XNJA 4RDKA 3RIQA 3CMEB 3AG4H 1TLHB 1VFCA 4RD6A 3NAWA 2AQEA 5JMCB 1QRBA 1H85A 1NK2P 4BHPA 2WBMA 1JI8A 2NTBA 4QVAA 1R36A 1LFPA 5M3MJ 4RLZA 2Z2SB 1VQMB 2ZXWH 3LWFA 5KAIC 2CUZA 4UVBA 2WPDA 2NAZA 2G7UA 3VODA 1HQCA 2R4GA 4M2LA 1WXRA 5E3LA 2EINH 3BCFA 1ODDA 4L9JA 2V6CA 2NT9A 1G3TA 4WZKA 1IN7A 4ZZLA 5DCMA 1AKHB 1OFEA 4LC0A 2JA2A 1ACIA 3K10A 3RZOJ 2XNCA 2F4OB 3TDZC 1EXMA 1IV6A 4YZ0A 3MZYA 4S0HB 2ZTGA 5L3EA 2B63J 2RNGA 3P9CA 5EF6A 1E2XA 2LSOA 5E3NA 2P5KA 2EV6A 4I98B 1UHWA 2LY9A 1DP3A 1QGAA 1XFOA 3W2EA 2XTYA 3MQ0A 3I55B 1JRGA 1IB4A 2CQ7A 4L5IA 2VJJA 5EDNA 3F72A 3DLAA 3TP3A 2ZNZA 3T1BA 1X1CA 5HXBA 3RCOA 2TRTA 5CYVA 4XRSG 2HDWA 3SZTA 3CW2A 4KYWA 3CTAA 2E5NA 2OAZA 2R3SA 3I56B 2C5HA 1JA1A 2QA4I 5B66C 4KDPA 1J5YA 1FP1D 2J7KA 3CCMI 3IH4A 4OP7A 3GTJJ 3ASTA 3W2VA 2M45A 2WJVA 3CDIA 2XPWA 4AD9A 3LSIA 1XN7A 5F04A 5ICEA 4NCNA 4YAUA 2HGCA 3HAGA 4UB8C 4CGZA 4LBYA 4B4CA 3K0LA 2YU9J 1KU7A 1NDHA 5J3LA 2P7CB 2XUBA 1PP7U 4U7BA 2O03A 2AXTC 3AG1H 3PNVA 5HS9A 3VSLA 1BIAA 3WE3A 2X6WA 3GVJA 2GJRA 1ZUNB 5JBQA 2FX3A 1KRHA 2D74A 2GK6A 3B6CA 1S9HA 1O88A 2G9WA 3H5AA 4HQMA 2FF4A 4PMHA 4V2GA 3FXRA 3F0CA 2XAQA 4H4KC 1XMAA 4F7ZA 4E7IA 5HKKA 2EILH 1W4MA 1R5OA 3S3NA 4L5JA 4P22A 3HL2A 3CCVB 3SJZA 3BQJA 4J00A 2EIJH 1WZ2A 1MKMA 2KDOA 3B02A 3ZBTA 1I8DA 3AVYA 3WTYC 1LDJA 3EUAA 5TY0A 1V4RA 4YZQA 3MKLA 4M9XA 2XC7A 3MKZA 2FE3A 4R8HA 1MBGA 3F21A 4EJUA 1NG6A 3K6GA 1DP7P 1NB0A 2EFGA 1APLC 1WMRA 2CUJA 4L9NA 4N4OB 3I5UA 3UR3C 2F1LA 1XGSA 4DW6A 3VNUA 5JHFA 2WV1A 3KYDB 4A3GJ 1O8KA 4YXWA 2IJLA 4BY7J 1XB4A 3H09A 1LKXA 1OB2A 1CNFA 2UZKA 3BTIA 1MH3A 1YRNB 1QRYA 4WXHA 1ERDA 3H94A 3I1FA 1IXSB 4PCQA 1MSEC 1IRXA 3ZQFA 2JPBA 5M5WJ 3ONQA 1TYUA 4RGRA 3WNBA 1BOBA 1YIJI 2V1UA 1N06A 3I58A 2W7NA 1PE9A 1V5EA 3OL4A 5K7ZA 3IWFA 3PIOF 2UV1A 2MC3A 1YQAA 3W2WA 3LQQA 3CD6I 2HYJA 3J7YJ 2JMWA 1PLUA 2CMPA 1A04A 2B7EA 5E1ZB 2Z16A 1VQOI 2RVCA 5FO1A 3KP3A 2IS2A 1F1ZA 3I4MJ 2CQKA 3QPHA 3JQPA 4RD3A 3ASNH 1V55H 3QYFA 4ZGQB 1KGSA 2W25A 2K3FA 3DF8A 3MWMA 3LSTA 4HOBA 1OGOX 1X1AA 2L2OA 3B73A 2F2EA 3BG6A 4NQWA 2EK5A 3CZ6A 3WYAA 3QAHA 1G59A 4ITVA 3WHCA 2IA0A 3OMYA 2KRCA 3DU1X 3F8NA 1JTYA 3OOPA 1YW9A 3K4LA 5CQEA 4M53A 1E3PA 4YEIA 3JCUC 4P6YA 4ZJZA 3E1SA 1P4MA 1L3LA 4BBSJ 4RPDA 2CS3A 4HA8A 2BY0A 2FSWA 4JMQA 3VO2A 3AG2H 2VBSA 3HOYJ 5HLHA 2R7QA 2DJNA 2YSRA 1F4KA 1Q86D 4PJ0C 2WTEA 1N25A
chains in the Genus database with same CATH topology
4MLOA 5LD2C 2K3PA 2M0MA 3OYLA 3FDYA 2M3AA 4AU7A 4B44A 3OYJA 3VYSB 1PKVA 3RTRA 3OYMA 2UVEA 3DKXA 2ZSIB 4E7HA 2OUMA 1X4PA 3K4CA 3AFHA 1Y56A 4GRIA 1QJVA 2P0WA 4YZXA 2WAFA 3LL7A 3M8JA 4KKSA 3FBIB 1R6RA 1W36C 4PSXA 5FRNA 5HNHA 2R9VA 3OR1C 3GVKA 3OS2A 2A5WA 4E4HA 1QHGA 2NTQA 2E1BA 2R7UA 3B8YA 3F9KA 4XKBA 2JVHA 4FASD 2GJPA 2WADA 3H5NA 2O5RA 1MNEA 3BG7A 3GQ9A 2BOLA 2M4KA 3OAAA 2IS4A 4Z06A 2KRHA 4TT3A 1T5EA 4CUGA 2E1MB 3PNTA 4CSWA 2IS1A 3KRGA 1VF7A 2CFOA 5KCMA 2LH9A 4E7KA 3W2AA 1OFMA 4U49A 1OOCA 3D5LA 3VMWA 1W0JA 2BVLA 4B48A 1Y6IA 3MKYB 2Y0SA 1E43A 5CPRB 4G6IA 2X1CA 4ZDOA 4B3GA 3OYAA 2OC6A 3FKSA 3JU4A 4FXUA 2R7OA 1K5CA 1UD5A 3DWLE 2M7BA 2W4SA 4RLQA 2MD0A 1KCDA 2LYCA 4AVZA 5C1EA 3OYCA 4W8QA 3VSTA 2LREA 1Z3XA 4ZDPA 4ASUA 1AIRA 3QODA 3J7AY 2BSPA 4AYBA 1J09A 3DTEA 2VASA 2JJ2A 1K6YA 2VBEA 1BPLA 4TSFA 4XD7A 3MMYB 4BQOA 2RREA 4GQNA 4RM3A 3ZQQA 2VB6A 3VDXA 3AL0B 2INVA 2ELJA 5KNLA 3HXLA 2ZZEA 4JOMA 4BJ5C 2MABA 3GQ7A 3VMVA 4X0GA 2W6IA 3OOCA 1YE9A 1D0XA 1HVXA 1NG7A 1WJBA 3D5SC 1UD6A 1H8HA 4NK8A 4KKTA 2X51A 4LIUA 4BE2A 3A3GA 2MYSA 3NE5B 3OIQA 3NWSA 1JTAA 4OJOA 2V1NA 3LMWA 3IP4B 1VLYA 4P5OA 2Z8GA 2QY1A 4ZYAA 3HKZA 1MMDA 2V9KA 4F93B 4OAZA 4OJPA 4U4BA 3OYKA 2HVSA 2NSPA 1EA3A 2IXSA 1FMVA 3DPTA 1WFXA 2M4GA 2VQGA 4E6KG 4XQFA 3BH4A 3DU6A 2BW3A 4XKCA 1H80A 3KEYA 2LG4A 3OE7A 2VKDA 2XGJA 4C30A 2W1OA 2VPLA 1GQ8A 3EQOA 2HVQA 1Z7LA 2XOKA 1XG2A 4HPQA 4I84A 2K5CA 2WB1A 2XF6A 4P1WA 3L2WA 2PJRB 1VJSA 2XDVA 4XN3A 2L9NA 4E7LA 1O8HA 3G2BA 1UG0A 1MABA 4U87A 3IAS2 4BL0B 3OYBA 2IGKA 4C9YA 3K70D 2VBMA 1X4OA 2K9MA 3K4BA 2WZPP 2R7RA 3I3LA 4BJTA 4YELA 5CQGA 2F6CA 3S3OA 3UNGC 3SZGA 3EPZA 1BR1A 4CCLA 1V5GA 4BE1A 2KVOA 1W0KA 2L7KA 1FX0A 4MR0A 3E0JB 5DN6A 4HG2A 4Y3OA 3EUKL 4CCOA 1UD8A 2UVFA 2INUA 4ZDLA 2X3HA 3JURA 4LITA 4E7SA 2HLDA 3ZCOA 2ZZGA 2HU9A 4CH7A 1TT0A 1VZ0A 3ZRGA 2R7SA 3FKJA 3KX2A 2Q1ZB 1HZEA 4II2A 4PJMA 2IGNA 1G8XA 2OV7A 3QYBA 3MKWB 4KISA 3VYTB 1BN8A 2KHMA 1MMAA 3BCBA 3OR2C 4ZC3A 4J01A 1O8GA 3HPGA 4KT6A 4Z1MA 4BS9A 1V0FA 4OWRB 2XNDA 4F92B 4UZUA 3GQ8A 4B3FX 3L2RA 2E60A 2AQFA 1AA7A 2VBKA 4Z03A 2R7TA 5CDFA 3CP2A 5KHDA 3BC8A 1DGWY 3DKYA 4C2TA 3OFNA 1MNDA 3BC9A 5CKTA 2L5QA 3VSKA 2BVMA 4G7WA 3GRHA 4YZAA 3BLYA 1O8EA 3FPPA 4URRA 3ZSCA 3K4NA 1UD4A 5C1CA 3LSKA 2VIXA 3C2GA 4XM3A 3ZIAA 1D1CA 4OJ6A 4RM2A 1E0EA 1QCXA 1P9QC 3CMMA 5HOOA 3PSIA 3OYGA 1WJ5A 2IQ7A 2X6XA 4IX7A 2Z1DA 2NSTA 4E0FA 2VJ4A 2CK3A 1OGMX 1OLTA 2IGOA 2LY2A 2XSJC 3SEQA 4XLEA 2WY8Q 3HOSA 2KP6A 2Z6BD 3OW7A 3B90A 4EW9A 3N05A 3H9JA 1BLIA 4NNJA 2W82A 2LZJA 3OIPA 4DNTB 3L2QA 1O8LA 4KKUA 3CJQB 3D5RC 4G6TB 4XONA 3LSMA 1U0JA 2R7WA 3WWGA 3S32A 2O04A 4D1QA 3TBIA 3AKZA 4BDZA 3HPHA 1K28D 3RSNA 2KPMA 1VBLA 4NC8A 2ZSHB 3OS1A 5TGTA 3OYFA 2JUGA 2ZXIA 2KQRA 3HC7A 3OYHA 4XLFA 4XOPA 4LIVA 5HNFA 4NK6A 4N4NB 4PJLA 4BEHA 2DIEA 2HQAA 3DPUA 2V7QA 4RLFA 4BU2A 1O8MA 2VL8A 3CP8A 2D3LA 4W8SA 1O8FA 3V42A 2ZXHA 4XORA 1W9XA 1GLNA 3CJRB 2F4IA 2KMUA 3OYDA 2CH0A 4E7JA 1UD3A 3CF2A 2FUG2 3OYNA 4BE0A 3T9GA 2CV0A 1N78A 3G05A 3GVLA 1NHCA 2NT6A 4BQNA 2HZDA 2NTPA 4B47A 3S3MA 4RMNA 4BXFA 4DOZA 3M1CA 1WJEA 2QKLB 3CESA 3QOEA 3DPLC 4BACA 2HPMA 1UD2A 1WJFA 3UW0A 2VXZA 3TMOA 2RQQA 2CW7A 2JVGA 2ODLA 2X1DA 3PUBA 3PJRA 3L2VA 2W6JA 3C2HA 3K4MA 2XAUA 5AMVA 3VWBA 1WJDA 2GK7A 3H0DA 2LOOA 1YX5A 1T0FC 4PUSA 4YEJA 5FL7A 4HNTA 1E1QA 1X1DA 4PJJA 3OWTA 4LG3A 3T53B 1E79A 2NOJB 2VKHA 1V0EA 4PJNA 3DTKA 2UUZA 2VQCA 3ZPNA 1X0CA 1D1AA 3OS0A 4C2LA 3SUCA 1IDKA 3S8PA 1MW7A 2DT7B 1MMGA 2VQLA 2V31A 1COWA 1WP6A 1NRKA 4OJLA 4NC7A 3DDYA 1I18A 2CW8A 4DGWB 4B3XA 3RQ4A 4DK0A 1IA5A 1UELB 1BR4A 3A2KA 3DEEA 3EUHC 2V7FA 2L9SA 4E7ZA 1Z21A 1CZFA 1X1BA 1WJAA 2VQHA 1UAAA 4QPQA 3K70C 4C2UA 3FHNA 1E1RA 3OL3A 2WY7Q 3OEEA 1TZLA 1N77A 2GOMA 2F43A 2E5ZA 2XZOA 3OYIA 3K4KA 2JDIA 2PYHA 1SAUA 2XF5A 4CCMA 1PXZA 1LVKA 4ZTFA 3U21A 1YX3A 3HG9A 2DOAA 2GJKA 2XF7A 3H5RA 2LC2A 2LBFB 2ZZQA 2F1MA 4HEA2 3GQBA 2R7XA 1SKYB 1LDKB 3VYRB 2DCEA 2PMZA 2QE7A 3T56B 1OR7C 3VR6A 2PECA 3PNYA 1KTWA 5FROA 4CCKA 4F55A 1Z3YA 2X6YA 3LSGA 4XKVA 2AQEA 1DBGA 2QXZA 3PFYA 1DGRM 2IS6A 1JI8A 2WBMA 2NTBA 3AL0C 3LFUA 1LFPA 2DJIA 2Z2SB 4HWVA 4D9JA 2CUZA 1KONA 3ZGKA 2WPDA 2LY1A 1RWRA 3LNNA 2R4GA 3MD2A 3ZXSA 1WJCA 4CZCA 1DBOA 4Y4RA 2HVRA 3OPOA 4W8TA 3OOUA 1PYVA 5FRMA 3BCFA 1HA8A 1QHHD 3NWTA 4ANJA 3T51B 2NT9A 1MMNA 4BJ6C 2PJRA 3B4NA 3I9V2 2JA2A 2XZLA 3K10A 2M7AA 4CA0A 2WSSA 1KCCA 4IKFA 4IQ4A 2WJYA 3IUOA 3HUGB 1O8IA 1E3ZA 4NQWB 2ZTGA 4YZ0A 4XN0A 4XLHA 2RNGA 3FBNB 1RMGA 5LFAA 3TL4X 2X8KA 3H9QA 1DQUA 1DP3A 3ZR8X 3LMMA 1BHEA 1WTHD 1JRGA 1IB4A 2VJJA 4PFPA 4BEHB 3DLAA 4HSRA 4XOTA 4DNRB 1X1CA 3RCOA 2ZFUA 2HDWA 2X85A 4DBQA 2E5NA 4MXNA 5HVQC 5IK2A 1O8JA 2O17A 2UWMA 1EFRA 2MC4A 1HG8A 4XNFA 4G7XA 3VYUB 4NUBA 2V6EA 2WAEA 2F5VA 3W2VA 2WJVA 1OHHA 4XLCA 2KLOA 4DK1A 4ZTJA 2JSPA 3LSIA 2JIZA 2D3NA 2O1DA 4PSWA 1BMFA 3HAGA 2QKMB 2PYGA 4IZZA 4F91B 4QPOA 2I8DA 1BR2A 4F52A 4U7BA 3PNVA 3VSLA 2X6WA 4KJZA 2GJRA 2ZZFA 1KMHA 3GVJA 3A3BA 2Q2EB 1N75A 2R7VA 2ZTNA 2GK6A 4YRVA 4IQJA 1S9HA 4XLAA 3SDBA 1O88A 2BW3B 3A4CA 2LRDA 1IDJA 3H5AA 4PMHA 3L2UA 1D1BA 4II3A 1T95A 4H4KC 2M5SA 2KL4A 4E7IA 5HKKA 4OZYA 4P22A 2HPIA 3S3NA 2CV2A 3HL2A 2O0WA 4J00A 2V26A 2KDOA 3SEZA 1FMWA 1I8DA 3A1YA 2VLAA 4L8JA 3EUAA 4BGDA 4XMYA 4DIQA 2EWEA 4YZQA 2E1MC 3IAM2 2XC7A 2V4JC 2K9LA 4FETA 3MKZA 3ZPPA 1NG6A 3K6GA 1OB0A 4F3QA 1WMRA 1KZLA 1X19A 2CUJA 4N4OB 2VJIA 1OFLA 3BCAA 2IGMA 3UR3C 3OYEA 1RU4A 3H9GA 3GBGA 2GOXB 5JHFA 2NZMA 2VJ5A 1O8KA 3RPUD 2O0VA 4YXWA 4Z05A 1NBMA 2X53S 1LKXA 2LBFA 2WAQA 3DU5A 3SYTA 4BUPA 2V4DA 1ERDA 1D0ZA 4JQFA 3H94A 3VSUA 2JJ1A 4XL9A 2A6TA 4HNUA 1W36D 2KZVA 4B43A 1IRXA 3BCDA 3HOTA 3VSVA 4CCNA 4PFOA 4HRIA 3KEWA 4Y33A 3ONQA 4PK4A 3FY3A 1BOBA 4BQQA 3A35A 4CCJA 2W7NA 1PE9A 1WPCA 1V5EA 3OL4A 4XKWA 1ZELA 1O8DA 2UV1A 3W2WA 3EQNA 4KITB 1QU3A 1D0YA 4DJAA 4TKOB 1PLUA 2CMPA 3LSHA 3OEHA 2Z16A 3PL8A 5HLTA 2IS2A 4BDYA 4HIZA 2X1EA 4EATA 4R79A 4OAYA 1SFKA 1V5FA 3DTIA 2HNHA 3QYFA 4DBRA 1EE6A 4W8RA 2W00A 1OGOX 1X1AA 2L2OA 2VXDA 3BG6A 3K4JA 1PJRA 3CZ6A 3DQVC 4HSTA 2WA0A 3W3CA 1G59A 4ITVA 3QYEA 3OMYA 2MFZA 2KRCA 3K4LA 5CQEA 3H35A 4XR6A 2CV1A 4ZJZA 3E1SA 3GQAA 2DT6A 2CS3A 3PSFA 1E3XA 3S93A 4JMQA 3WQZA 4OJ5A 1H8EA 2QX3A 2R7QA 4OZZA 3OY9A 2DXIA 2XZPA 3KYLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XNF A;  2ODL A;  5AMV A;  2UVE A;  4XLC A;  4YEJ A;  2O1D A;  1QJV A;  4MR0 A;  1X0C A;  2UVF A;  2INU A;  2X3H A;  3JUR A;  4C2L A;  2NTQ A;  1IDK A;  3SUC A;  3B8Y A;  2X6W A;  1BN8 A;  4OJL A;  4XLA A;  1O88 A;  1IDJ A;  3GQ9 A;  1O8G A;  4PMH A;  4Z06 A;  1IA5 A;  3GQ8 A;  4OZY A;  3KRG A;  1OFM A;  4U49 A;  2O0W A;  2VBK A;  1CZF A;  4Z03 A;  1OOC A;  3VMW A;  4OZZ A;  2PYG A;  4XMY A;  2EWE A;  4YZQ A;  1K5C A;  3ZPP A;  3GRH A;  4YZA A;  1O8E A;  4URR A;  5C1C A;  3ZSC A;  1WMR A;  1KCD A;  1OFL A;  4XM3 A;  2VJI A;  4AVZ A;  4OJ6 A;  5C1E A;  4W8Q A;  3VST A;  1AIR A;  1QCX A;  2PYH A;  2BSP A;  1PXZ A;  1RU4 A;  2NZM A;  2IQ7 A;  2X6X A;  2NST A;  1O8K A;  2O0V A;  2VBE A;  4Z05 A;  1OGM X;  4YZX A;  4XLE A;  3B90 A;  4EW9 A;  2INV A;  2PEC A;  3VSU A;  1KTW A;  1O8L A;  4XL9 A;  2X6Y A;  3GQ7 A;  4XON A;  3VMV A;  3VSV A;  4XKV A;  1DBG A;  2QXZ A;  3FY3 A;  3WWG A;  2NTB A;  2O04 A;  1PE9 A;  4NK8 A;  4XKW A;  1O8D A;  1VBL A;  3EQN A;  4HWV A;  1JTA A;  1PLU A;  1RWR A;  4XLF A;  4XOP A;  3LMW A;  1DBO A;  4NK6 A;  2Z8G A;  4W8T A;  2QY1 A;  2NT9 A;  1O8M A;  4OJP A;  4U4B A;  1EE6 A;  4W8S A;  1O8F A;  3B4N A;  4XOR A;  2NSP A;  4W8R A;  1OGO X;  1KCC A;  4XQF A;  1O8I A;  4YZ0 A;  4XN0 A;  4XLH A;  1H80 A;  1RMG A;  1GQ8 A;  3EQO A;  1XG2 A;  3T9G A;  4I84 A;  4OJO A;  1NHC A;  2NT6 A;  1BHE A;  1JRG A;  4XR6 A;  2NTP A;  1IB4 A;  2VJJ A;  4XN3 A;  1O8H A;  3GQA A;  4XOT A;  2X85 A;  4OJ5 A;  2VBM A;  2QX3 A;  4MXN A;  3UW0 A;  1O8J A;  2O17 A;  1HG8 A;  4YEL A; 
#chains in the Genus database with same CATH topology
 5DSZ A;  5F4M A;  2O6W A;  2ZNY A;  3FDY A;  5EG0 A;  4UZF A;  4B44 A;  1Q7Y D;  3VYS B;  1PKV A;  1M1K D;  2HKO A;  1BW5 A;  2R7Z J;  5HZA A;  3K4C A;  2E1N A;  3PIP F;  5BS6 A;  2VPR A;  1Y56 A;  2VT2 A;  3ABU A;  4GRI A;  3CCJ B;  1TTY A;  3M8J A;  4FQG A;  2PLF A;  1K73 D;  5EYR A;  1K8F A;  4JRA C;  3HIF A;  5HNH A;  3A01 B;  5B1A H;  3OS2 A;  4E4H A;  1QHG A;  2XV4 S;  4YIF A;  3CCM B;  2A05 A;  1J75 A;  4MTD A;  4TMV A;  3ZN0 A;  3W5V A;  2NTQ A;  2VNI A;  3W2I A;  1CGP A;  4GYI A;  4FAS D;  2B0L A;  2HDN B;  3L1P A;  1SD5 A;  3M1E A;  1KU3 A;  2ZBK A;  4Z06 A;  4FK8 A;  4TT3 A;  4UAJ A;  2E1M B;  1YG2 A;  2MA3 A;  3ZN1 A;  4CSW A;  4ESJ A;  3WE2 A;  2CJJ A;  2LH9 A;  4U49 A;  3D5L A;  1F60 A;  3VMW A;  3BR5 A;  4B09 A;  2E71 A;  5F1R A;  1MIJ A;  3MKY B;  2Y0S A;  2K4B A;  2X1C A;  2DOE A;  1IN4 A;  2DDA A;  3ZPL A;  1D2E A;  4XBF A;  3FKS A;  3JU4 A;  2R7O A;  3KP4 A;  3J81 K;  1R49 A;  1WH5 A;  2M7B A;  1K5C A;  3IC7 A;  3GTL J;  1O3R A;  1ELO A;  5LGU A;  4Y7C A;  4A0Y A;  3JX8 A;  3CUQ B;  2AO9 A;  3KLN A;  5CVR A;  1WDT A;  4IRH A;  1SFX A;  3J7A Y;  2HKX A;  3DTE A;  2F5E A;  3F23 A;  1K6Y A;  3WU2 C;  2F4N A;  3I55 I;  2KIF A;  5IP9 J;  5CJ9 A;  1BPL A;  4TMZ A;  2RAE A;  1XMX A;  4GQN A;  4TSF A;  4XD7 A;  4IO9 F;  3VDX A;  4CYC B;  2C4T A;  1S7O A;  2INV A;  2ELJ A;  2QTL A;  1A36 A;  1IJF A;  2YWF A;  4JOM A;  4BJ5 C;  1YJN I;  1ZKG A;  3GQ7 A;  2BSA A;  3VMV A;  4G94 A;  3B6A A;  2J5P A;  2X48 A;  1K83 J;  4I0A A;  1NJI D;  1HVX A;  1SAN A;  1VND A;  2LKS A;  4C3I J;  1PP8 F;  1RUO A;  2HDD A;  1YI2 B;  4J19 A;  1CLW A;  4NK8 A;  4LIU A;  1ETX A;  2ICW G;  3OIQ A;  5EZH A;  3BP8 A;  3ABT A;  3BDD A;  2V1N A;  5LEK A;  3LMW A;  4RB3 C;  3E5U A;  4MQ9 F;  2Z8G A;  3HKZ A;  3LAJ A;  4A93 J;  2XC1 A;  3HSF A;  4U4B A;  3Q9V A;  4EJO A;  5L3C A;  2RQP A;  1KK3 A;  4XQF A;  3UKG A;  1QA1 A;  3E5Q A;  1EP2 B;  1JHH A;  2D1H A;  1N08 A;  1YW8 A;  2X9D A;  3OE7 A;  2OF7 A;  2W1O A;  1GQ8 A;  3MAJ A;  2HVQ A;  1U8B A;  2QMU A;  3W5U A;  3CC2 B;  3DCF A;  1TWH J;  4XN3 A;  1SVM A;  2L9N A;  4G12 A;  4E7L A;  3G2B A;  3LSJ A;  1LE8 B;  1UB9 A;  1UG0 A;  4A12 A;  4BL0 B;  1H8A C;  1VQO B;  4C9Y A;  3K70 D;  2VBM A;  3K4B A;  1B23 P;  4CIC A;  3CO7 C;  1TSP A;  4JP0 A;  3SLD A;  5HS7 A;  1UST A;  5JLW A;  1F20 A;  2V5I A;  2L9V A;  4I0B A;  1FBQ A;  3I71 A;  2F6C A;  2V7X A;  1BI1 A;  3CDH A;  4QVJ A;  2H1L A;  3EPZ A;  3OV8 A;  5TV2 A;  1LFU P;  3CCL B;  2KVO A;  3KL9 A;  1VQM I;  1W0K A;  2F5C A;  1P7I A;  2L7K A;  1VQ7 I;  5L3F A;  2O6G E;  3E0J B;  1Z7U A;  4M6Y A;  1VQ4 I;  5DN6 A;  4RB1 A;  4MR0 A;  4O6J A;  1JA0 A;  3V76 A;  1U9O A;  6PAX A;  2ZL6 A;  2NXN B;  3HDD A;  2ZZG A;  3CJT B;  2HU9 A;  3GZN B;  4CH7 A;  2DMU A;  2R7S A;  2NVT J;  4PJM A;  2FEZ A;  1G8X A;  4KIS A;  1KYZ A;  4MYU A;  1VQ8 B;  1MMA A;  1TW3 A;  3OR2 C;  4ZC3 A;  3O2P E;  3C3W A;  4JK1 X;  1ITY A;  1UG2 A;  1V0F A;  4Z1M A;  1WOS A;  4M3E A;  5IOY A;  1S6L A;  2GIV A;  3IKT A;  1JXS A;  3GQ8 A;  2F5D A;  4HX8 A;  2DQL A;  2AQF A;  3ERE D;  3HRS A;  1VQ6 I;  4Z03 A;  5CDF A;  1X3Z B;  1ZAO A;  3PSS A;  4X0C A;  1T98 A;  3WTW C;  4BHC A;  2CGP A;  4HF0 A;  4L5E A;  3L7W A;  3JRF A;  3DKY A;  1MND A;  4ZYE A;  3IH2 A;  3FF5 A;  3BC9 A;  2KJB A;  1V3F A;  1DUX C;  2BVM A;  1I6X A;  3LOC A;  3TO9 A;  1ETW A;  4C3H J;  3JSO A;  3G73 A;  5IYW A;  1UD4 A;  4XM3 A;  1D1C A;  3E6B A;  1A31 A;  2GXB A;  2VFP A;  1ON2 A;  1QCX A;  2HS5 A;  1P9Q C;  3CMM A;  3ZMZ A;  1RR7 A;  3PSI A;  2VE9 A;  3P27 A;  2D45 A;  2X6X A;  4IX7 A;  2Z1D A;  2K4J A;  2P7V B;  1EF4 A;  1KQ8 A;  5IYN A;  2TDX A;  2VJ4 A;  4AIK A;  2CK3 A;  1OMI A;  3SEQ A;  2FD5 A;  2VBW A;  3OW7 A;  4XLE A;  2WY8 Q;  4UHT A;  4NHJ A;  2Z6B D;  4YZX A;  2LP0 A;  3H9J A;  3PUF A;  4W97 A;  4A5M A;  4ENK A;  3BOQ A;  2W82 A;  4NNJ A;  4ACB A;  4YCQ A;  5JVT A;  2KKO A;  4M3B A;  1HKQ A;  3D5R C;  4XON A;  4WK8 F;  3P4G A;  3HJE A;  1FNC A;  3S32 A;  3QU6 A;  2O04 A;  3TBI A;  2YR2 A;  3B82 A;  4M3D A;  3HPH A;  3RSN A;  4EEF G;  4R71 A;  5TIS C;  2B0R A;  3JTG A;  4NC8 A;  3LA2 A;  1QH0 A;  3AGQ A;  3OS1 A;  2LKP A;  3OYF A;  3CDL A;  1YJ9 I;  3HC7 A;  4Z4W A;  4XOP A;  1LJ9 A;  1ZR2 A;  3K2A A;  5HNF A;  4NK6 A;  4ENM A;  3GX4 X;  3E6M A;  5JI6 A;  3JRG A;  5BNG A;  1H9T A;  2HQA A;  3EYI A;  2DIE A;  2NYX A;  5AIP A;  4BU2 A;  4IHY A;  1PJ6 A;  1W2B B;  1QVG B;  1B9M A;  1BX1 A;  1W9X A;  4XOR A;  2XT2 A;  2F48 A;  4LOC A;  3CJR B;  1BC8 C;  1I27 A;  1KK1 A;  4M6X A;  1DDI A;  5D6F A;  1I5Z A;  5DD8 A;  4E7J A;  2Q6O A;  2WZN A;  1OR7 A;  2LF7 A;  2A6E F;  2ZJ2 A;  3H36 A;  4P9S A;  2OTL I;  3BPV A;  1N78 A;  3GVL A;  1R1U A;  2RN7 A;  2IAI A;  4KMF A;  1I3A A;  2VON A;  1OIS A;  2K9S A;  2NTP A;  2GWR A;  2JRT A;  3IWZ A;  1FSE A;  4GCV A;  1JJ8 C;  5H59 A;  3V7R A;  1OKR A;  1MBK A;  1N07 A;  1ONV A;  5A88 A;  1WJF A;  3UW0 A;  1IB0 A;  3ZMU A;  3TMO A;  3MHP A;  1TW2 A;  2EA4 A;  4RB0 A;  4KMU X;  2DY1 A;  2E19 A;  2EIX A;  4RDL A;  1WSU A;  1K61 A;  4MYT A;  2XAU A;  3GZ5 A;  3R6S A;  3CB4 A;  4HLY A;  2BM1 A;  1YX5 A;  2K40 A;  4U0V A;  4HNT A;  1E1Q A;  1X1D A;  1W34 A;  2EFO A;  3T53 B;  2QBY B;  2CW0 F;  4AF7 A;  2ZME C;  2E2H J;  2FQ3 A;  4ZYH A;  1X0C A;  3A0B C;  2QF7 A;  1A35 A;  3OS0 A;  2K27 A;  3S8P A;  2IP2 A;  4YFO A;  1MMG A;  1SMY F;  4MEX F;  3E5X A;  1COW A;  1QA2 A;  1WP6 A;  1AIP A;  3HSE A;  4Q4Z F;  3A1P A;  2EV0 A;  1R00 A;  2PMU A;  2M87 A;  3LA3 A;  3Q39 A;  4Y13 A;  2R0Q C;  1VI0 A;  3F6V A;  4ETS A;  1ZN2 A;  4OMY A;  2AS5 F;  3BZ6 A;  4QV2 A;  3CUQ C;  4QLC U;  1ETV A;  4QPQ A;  1TQM A;  5DUI A;  3LVB A;  4C2U A;  1X3U A;  1K4S A;  2EZI A;  1KQ5 A;  1E1R A;  2FXA A;  5FJ8 J;  5FKK A;  3OL3 A;  1S5L C;  2E7X A;  2L0K A;  2DK5 A;  2VBU A;  1IGN A;  1RQP A;  2F43 A;  3Q38 A;  4NBS A;  1TC3 C;  2Z99 A;  4P25 A;  2E34 A;  1ZG1 A;  2JDI A;  2PYH A;  4HX7 A;  2VYQ A;  1JT6 A;  1J2X A;  3FM5 A;  2NVY J;  2GJK A;  1FOW A;  2QZA A;  4KUM A;  2ECB A;  4ESF A;  1ZRF A;  4U0W A;  2ID3 A;  1XDU A;  1LDK B;  2PMZ A;  3CCU B;  1KQS B;  3VR6 A;  3BZC A;  2QDX A;  1KTW A;  1Z3Y A;  2X6Y A;  2PMZ N;  3LSG A;  1BI2 A;  2HQR A;  2K02 A;  4LLL A;  2LK2 A;  5H6Q A;  3ZQI A;  3R4K A;  2VUM J;  1YYV A;  1PVE A;  2QXZ A;  1DGR M;  2IS6 A;  4G9Y A;  1UMK A;  4EQQ A;  2DFH A;  2OBR A;  2VNK A;  1GV5 A;  2N8G A;  2DJI A;  4WF2 A;  4P9U A;  1OPC A;  2WC2 A;  1GHC A;  3WTS C;  1KA8 A;  1Q1H A;  1QQI A;  3EDP A;  2XEX A;  3LNN A;  3KEQ A;  3ZXS A;  4CZC A;  2AHO A;  1W7P A;  2XIG A;  1DBO A;  1G3S A;  2HVR A;  3OOU A;  2CU7 A;  5FRM A;  3T51 B;  2JA7 J;  1W5C C;  4EMS A;  2BEO A;  3JRB A;  2ZJP F;  1D8T A;  2C77 A;  2PJR A;  1VQ6 B;  3B4N A;  3I9V 2;  4XID A;  1YIT B;  4CO8 A;  1ZG5 A;  1KCC A;  1ETO A;  4IKF A;  4IQ4 A;  4FTH A;  2WJY A;  2DYS H;  4X8I A;  4NQW B;  1JE8 A;  2GA2 A;  4XN0 A;  2O8K A;  5LFA A;  2I1L A;  4MIM A;  2W48 A;  2LVS A;  4U7D A;  3H9Q A;  1DQU A;  4A3J J;  4PGG A;  1LLZ A;  1B4A A;  3LMM A;  1EJ9 A;  5TR9 A;  5L3G A;  4PFP A;  4HSR A;  4YFK F;  3ESW B;  3TH0 A;  1VQN B;  4PAB A;  2ZFU A;  2CG4 A;  4DBQ A;  5F0H A;  2BY2 A;  5HVQ C;  1TYX A;  2UWM A;  1EFR A;  2VBT A;  3FK7 A;  2LD5 A;  1K9M D;  3BTJ A;  1HG8 A;  3VYU B;  3FXJ A;  4UNO A;  1M1E B;  4MNU A;  2WAE A;  3TOB A;  4RAG A;  3TGN A;  2JN6 A;  3CCU I;  3SQV A;  1OCP A;  1UMQ A;  1OHH A;  4ZGN B;  5CVJ A;  2NOG A;  2HEO A;  4RD2 A;  3Q0V A;  4IRG A;  3QP5 A;  2JIZ A;  2DA5 A;  2DBB A;  1GAQ A;  2OBS A;  5KW9 A;  2QGU A;  4IZZ A;  5ILV A;  2ECC A;  2DW4 A;  2XPU A;  1JJ2 B;  2FQ4 A;  4QPO A;  1QVU A;  2IOU G;  2O3F A;  3K7A J;  3IV5 A;  4RM0 A;  3ABK H;  2C4U A;  4KJZ A;  2RDP A;  9ANT A;  1KMH A;  1S7E A;  1MD0 A;  1N75 A;  4YRV A;  2VC0 A;  3GW2 A;  4IQJ A;  4XLA A;  2LRD A;  1IDJ A;  1D1B A;  3FZV A;  4II3 A;  3L2C A;  3SZP A;  1HSJ A;  2M5S A;  2MLK A;  4M9Z A;  1PUF B;  2NV4 A;  3QQA A;  3P9K A;  4N9H A;  4BYY A;  2RC4 A;  2O0W A;  4G8X A;  5C4X J;  4RDJ A;  3MVP A;  3BPX A;  3D26 A;  1OJL A;  1CF7 A;  3TO6 A;  5LGT A;  1FMW A;  3H3V K;  3WGG A;  2LF8 A;  4P96 A;  4L8J A;  3WTX C;  4XMY A;  3DLL F;  3GXO A;  4A0X A;  2EWE A;  3DBH B;  3IAM 2;  4XSZ F;  2V4J C;  2ETH A;  2K9L A;  4ESB A;  3A8J A;  1WQ2 A;  1S29 A;  3S1N J;  3FXL A;  1OYY A;  5FA6 A;  4F3Q A;  3AAF A;  2VJI A;  3KZY A;  2IGM A;  4O3M A;  5L3D A;  3SFI A;  4YFX F;  3OYE A;  5ICC A;  3RZD J;  1D8K A;  3GTQ J;  1RU4 A;  2NZM A;  3ZMT A;  1QFY A;  2BV6 A;  2QQ9 A;  2VJ5 A;  2PX9 A;  4KIG A;  3RPU D;  1ENH A;  2H1K A;  1N0U A;  2VOP A;  2PE3 A;  1SD6 A;  3CUO A;  4RAF A;  5D8K B;  2X53 S;  3C1D A;  2WAQ A;  5AON A;  4A3B J;  2V9V A;  2V4D A;  2EFP A;  3JQR A;  3WBK A;  2EQR A;  4YAF A;  5BSX A;  3SDG A;  2JJ1 A;  4NB5 A;  3WTT C;  2A6T A;  2DMQ A;  3F8B A;  4FCY A;  4OMZ A;  2KZV A;  2XGX A;  3VSV A;  3HOT A;  3ZBU A;  3SYJ A;  2ZC2 A;  3PA1 A;  4GFB A;  3U1K A;  1QNT A;  4C43 A;  4IXA A;  4YIR X;  4BQQ A;  3A35 A;  1YIO A;  1YW7 A;  2BGC A;  2DTR A;  2C5B A;  4KIT B;  3FXO A;  1T6X A;  1O3T A;  2DA7 A;  4TKO B;  3V7C A;  1BW6 A;  3B8H A;  3LSH A;  3MCA A;  3EYY A;  3BQZ A;  3PL8 A;  5HLT A;  4HIZ A;  2NPF A;  4EAT A;  5E17 F;  4OAY A;  1SFK A;  3N6Z A;  4DBR A;  2HNH A;  5J1R A;  4W8R A;  2W00 A;  2C2W A;  4X7F A;  3U6B A;  4YHB A;  1FNN A;  2ELK A;  3S15 J;  3QFC A;  3PVD A;  4YAL A;  1QZE A;  3Q0W A;  3L00 A;  1XS9 A;  2R5Y A;  1SKQ A;  3K4J A;  4KT5 C;  3DQV C;  5IT9 Z;  2VFQ A;  1NHA A;  2WA0 A;  1JHF A;  1R58 A;  2MFZ A;  3M7G A;  1ZTR A;  5HLI A;  2HYF A;  2FML A;  2Q6I A;  2XAH A;  4BY1 J;  3PSF A;  5DNS A;  2QQA A;  4R1H A;  5J47 A;  1YLF A;  2DFE A;  2KIQ A;  5JR3 A;  2QX3 A;  2CF4 A;  1XDS A;  2D5V A;  5H20 A;  1R5G A;  1FIA A;  4M3F A;  1NB9 A;  2CWE A;  1XG1 A;  3WND A;  4KA4 A;  1YJW I;  2D9R A;  2M0M A;  2ZME B;  3FX3 A;  1LVA A;  1ZM3 A;  4AU7 A;  5EJC A;  4WQM A;  3OYJ A;  1YI2 I;  1U5T B;  2XRN A;  4LB5 A;  3OYM A;  3HGY A;  3JQQ A;  4RD4 A;  4E7H A;  2ZSI B;  2UVE A;  3WU1 B;  3FXU A;  2W57 A;  4S05 A;  1TBX A;  1EH6 A;  5FKM A;  3GTK J;  2P6T A;  2JA6 J;  1R6R A;  5FRN A;  2R9V A;  3QFR A;  4D5C A;  1WHU A;  2NS8 A;  3KYC B;  2E2I J;  4LMY A;  1IDZ A;  2VOD A;  2E1B A;  3PA2 A;  4JYK A;  4QUZ A;  3JRC A;  1I39 A;  3F9K A;  3C2B A;  3MCZ A;  2QBY A;  4FE7 A;  3X2Q H;  1K78 B;  3OW2 B;  2BBY A;  3H5N A;  1W5T A;  3CUQ A;  3R61 A;  5FLX Z;  2QSG X;  1VQ5 B;  2M4K A;  4UY8 I;  1T6Y A;  2BM7 A;  1QG0 A;  1T5E A;  4CUG A;  3CC4 I;  2IS1 A;  1Z1D A;  4A0Z A;  3KRG A;  1VF7 A;  4N3G A;  4HBL A;  4G7Z F;  3SLN A;  2BHZ A;  1W0J A;  1W7P B;  2STT A;  5C4J J;  2DA6 A;  2BVL A;  4B48 A;  4NBQ A;  3QSY A;  1WPK A;  1MBH A;  2JRM A;  4ZDO A;  1YHQ B;  4WCG A;  3BRO A;  4BQA A;  5D4R A;  3U1D A;  3DWL E;  3QP6 A;  1PUF A;  2NNN A;  4L9T A;  1TNT A;  4BNC A;  1DDG A;  2CFX A;  2W7Z A;  4GYG A;  2LYC A;  2EZK A;  3OYC A;  3PUM A;  4W8Q A;  1AIR A;  1Z3X A;  2XAJ A;  1IJW C;  1WGX A;  2RC5 A;  4ROX A;  4AYB A;  5M3F J;  1J09 A;  1RZ4 A;  1WI3 A;  2JJ2 A;  1VQ4 B;  3WY9 A;  1VQ7 B;  2IRF G;  1Z6R A;  2YWG A;  3CCR B;  1U8R A;  5LBQ A;  1SD4 A;  2MW8 A;  3HXL A;  2X0K A;  2ZZE A;  5EEG A;  4IVN A;  2IA1 A;  5J4Y A;  2MAB A;  4YII A;  1ZRD A;  5E6T A;  4ZYG A;  1LQ1 A;  3I4N J;  1JGS A;  3ZC3 A;  3KP6 A;  3DBL B;  3GTM J;  4X0G A;  1T39 A;  1BN5 A;  2M8E A;  2W85 A;  1NTC A;  2W6I A;  3OOC A;  1YE9 A;  2XB5 A;  5FKL A;  3FXK A;  4UXN A;  1ON1 A;  1DU6 A;  3CMY A;  4HV5 A;  4I7H A;  5DEQ A;  4BE2 A;  1REP C;  1BX0 A;  1HCR A;  3ZQ7 A;  2IBD A;  1Z6T A;  4PC3 A;  1JTA A;  3I59 B;  4P5O A;  4ZYA A;  3S2D J;  5ERI A;  2GXA A;  2V9K A;  4F93 B;  1WH7 A;  4OAZ A;  1XSX A;  4XIC A;  4LB6 B;  2IXS A;  1FMV A;  4HZF A;  3JSP A;  1MDM A;  2CW5 A;  4U9U A;  2M4G A;  3V7A A;  1FJL A;  4N3N A;  2DMT A;  3DU6 A;  1QPI A;  4XKC A;  1VQP I;  3H3Z A;  1L1I A;  4C30 A;  2VPL A;  1QGP A;  5BOX A;  4U88 A;  3RQI A;  3EQO A;  3ASQ A;  1Z7L A;  4I84 A;  4P26 A;  3CCS B;  2WB1 A;  1TTT A;  4IEJ A;  4M74 A;  2I10 A;  2F3L A;  1EFT A;  1CQX A;  5FLM J;  4U87 A;  3IAS 2;  1MAB A;  1EZG A;  4AC0 A;  1LLW A;  2K9M A;  4O5V A;  4X06 A;  3HOV J;  1YJW B;  2BYV E;  2DDB A;  3I3L A;  4BJT A;  4JX4 A;  4YEL A;  5J3O A;  2DYR H;  1VQK B;  5A89 A;  5CQG A;  2KDZ A;  1XB2 A;  5E3O A;  1H88 C;  4G6Q A;  1N05 A;  3S3O A;  1YIJ B;  4CCL A;  3CC2 I;  2JQ7 A;  3J7A O;  1FX0 A;  3B78 A;  1I1S A;  3DBR B;  3NAR A;  4I99 C;  2AHQ A;  2EBI A;  1JKR C;  3EUK L;  4CCO A;  1UD8 A;  4ZDL A;  1O57 A;  4LIT A;  4E7S A;  1TNS A;  2HLD A;  1KZH A;  5GP9 A;  1D3Y A;  3CCY A;  5D5W B;  1TT0 A;  1S72 B;  2HOE A;  3FKJ A;  1H89 C;  2L7M P;  5HOD A;  2B7C A;  4ZCM A;  2VC1 A;  2L4A A;  3VYT B;  1KK0 A;  2PN6 A;  2V7W A;  2IPQ X;  2KHM A;  3JW4 A;  2EWN A;  3HPG A;  5CLS A;  3OZV A;  3DP7 A;  3A03 A;  4B3F X;  5E1X A;  3QPT A;  3RYR A;  1YFH A;  3RIR A;  3LQR A;  2DQR A;  2R7T A;  1DPR A;  1R1V A;  5HLG A;  3ZQL A;  2YX7 A;  4YG2 F;  3KET A;  2PFB A;  1WSR A;  5KK1 A;  1G7R A;  1DGW Y;  2OZ6 A;  1S3J A;  3PM1 A;  2PLY A;  1S4M A;  4IPA A;  4WXC A;  2RGV A;  3BG9 A;  3GIR A;  1O8E A;  2KJC A;  1QUE A;  4EGY A;  5IT9 K;  3LSK A;  2VIX A;  1IN5 A;  3C2G A;  5AIQ A;  4ENN A;  1QX4 A;  3ASP A;  3CJN A;  1E0E A;  2IQ7 A;  4LFU A;  4E0F A;  2EB7 A;  3ECH A;  3S2W A;  2UXX A;  1R1T A;  4P9F A;  4CDG A;  2KP6 A;  1FTZ A;  1EFC A;  2MSY A;  3N05 A;  3F8F A;  3P7N A;  2FA5 A;  3QU3 A;  2Q8K A;  4FE4 A;  1ZH5 A;  2WR8 A;  3IRR A;  3L2Q A;  5D5X B;  5F4O A;  3CJQ B;  5FFX A;  3CXC B;  2H8W A;  1YJN B;  3AVV A;  4C0S A;  4U0Y A;  4BH9 A;  1U0J A;  3HOW J;  1YOV B;  1U5T A;  5GPA A;  4V2F A;  2MH9 A;  1K28 D;  2P81 A;  1R22 A;  2WV0 A;  1GVD A;  5IYC J;  1Z05 A;  4AM3 A;  2BGI A;  2YU3 A;  2ZSH B;  1HLV A;  2ZXI A;  5FFZ A;  2KQR A;  2Y9Z A;  4LIV A;  1CF7 B;  1SEU A;  1N8R D;  4N4N B;  5D5V B;  3OJW A;  3IHU A;  3T0Y A;  3H0G J;  4UV8 A;  4BEH A;  3OSG A;  2HDC A;  1A6I A;  2HFH A;  2HOA A;  2Z5U A;  4WWV A;  4W8S A;  1O8F A;  3V42 A;  2JT1 A;  2QLZ A;  1QVT A;  3SHF A;  3HRU A;  1T8I A;  3GUD A;  4LLG F;  1AU7 A;  3OZW A;  4RA2 A;  3OYD A;  4Z4U A;  3AGP A;  2VFM A;  4GGG A;  3HB9 A;  3MFK A;  3CF2 A;  2CQX A;  1MNM C;  4OIQ F;  2FUG 2;  3G1M A;  1IW7 F;  3OYN A;  2OPT A;  4RS8 A;  3AVU A;  2A61 A;  1R9T J;  3E20 A;  1FLI A;  3G05 A;  3J80 K;  4BQN A;  1IHM A;  4UVC A;  2KZG A;  5LGN A;  2DYI A;  3S3M A;  1OFD A;  2H94 A;  4KN7 X;  3M1C A;  3CES A;  1UD2 A;  3QOE A;  3DPL C;  1ZR4 A;  3FIW A;  1OGI A;  2M9H A;  2RQQ A;  2I5U A;  1W0T A;  1B1B A;  2JVG A;  3HZJ A;  1CNE A;  4Y9U A;  2ODL A;  3ECO A;  3IRQ A;  2BM4 A;  3I0T A;  3K4M A;  3PEN A;  5AMV A;  2GK7 A;  2J5O A;  2L02 A;  4PUS A;  5A2Q K;  4Z4Y A;  3FWE A;  2A3S A;  3CCJ I;  2CND A;  4J0Q A;  2ME6 A;  1E79 A;  4IOC F;  4PDK A;  4FWT A;  4UB6 C;  1OFC X;  4UUS B;  2K86 A;  1YHQ I;  2L7Z A;  3ZPN A;  4BAY A;  2KRF A;  5K7H A;  2FBI A;  2Q6K A;  4AID A;  1EFU A;  4OIP F;  2VQL A;  5EMN A;  2DO7 A;  1SVO A;  1YIT I;  1R71 A;  3NAU A;  4OJL A;  2COM A;  1OCC H;  1XQB A;  2XAS A;  1G3W A;  3G6E I;  3KPH A;  4B3X A;  5EG0 B;  3FKI J;  4I09 A;  1TL8 A;  3WG9 A;  3CCV I;  3BY2 A;  3OJX A;  2L9S A;  2P5L C;  4Z4V A;  1WOR A;  5KVR A;  3HOX J;  2ZL7 A;  3RJP A;  3Q9S A;  1YX2 A;  2DT5 A;  5HDK A;  1T33 A;  4UUT A;  1P4X A;  1K8A D;  3SZE A;  2JZY A;  1XGO A;  2M0C A;  3FHN A;  4XRF A;  3HTS B;  3GLX A;  1OCZ H;  4UUV A;  3LO8 A;  3CCQ B;  2F5F A;  1B8I B;  4RAY A;  1JKO C;  5ILU A;  1FTT A;  1TWA J;  1Y1V J;  3DV8 A;  3OEE A;  1FBS A;  1N77 A;  3QPL A;  1E62 A;  2E5Z A;  4G1B A;  4OIR F;  1W1W E;  2YWE A;  1D8J A;  1Z77 A;  2DU9 A;  2V7V A;  1KQ0 A;  1D5V A;  1LVK A;  4IOA F;  4UZE A;  2GXG A;  2RV8 A;  3U21 A;  3EUH A;  1XMK A;  3VEP A;  4XLP F;  5FO5 A;  3R0J A;  3W5H A;  3H5R A;  4OM9 A;  1SAX A;  2LC2 A;  4HX4 A;  4L0Y B;  1PJ5 A;  2F1M A;  2CUE A;  3GQB A;  2BY3 A;  1SKY B;  2CO5 A;  2PEC A;  2DCE A;  1LUJ B;  2QE7 A;  3W6J B;  4IHV A;  4DQL A;  3F3X A;  1RES A;  2Y2Z A;  1SD7 A;  3PQJ A;  2VKV A;  1EP1 B;  1VQ5 I;  4OPS A;  4HYE A;  1DBG A;  2H6B A;  5BPD A;  4G1V A;  3AL0 C;  2EFQ A;  3LFU A;  1FRQ A;  4GDF A;  3JTH A;  1K4T A;  1G6N A;  3WG7 H;  3O8H A;  1KON A;  2DI3 A;  3ZGK A;  2LY1 A;  2W84 A;  1O3S A;  5GPC A;  2ZJR F;  2L4M A;  4FX0 A;  4A6E A;  1Y0Y A;  4RCY A;  1WJC A;  1JKQ C;  3OPO A;  4W8T A;  1MGT A;  1PYV A;  1LE8 A;  1I3Q J;  1HA8 A;  3OP1 A;  3NWT A;  2OQG A;  4Z4T A;  1W5S A;  5J1Y A;  1MMN A;  4G5G A;  1LB2 A;  1G2H A;  3M3Y J;  2XZL A;  2LLK A;  2WAQ N;  4TMW A;  2M7A A;  2PQ8 A;  1T6Z A;  2WSS A;  2V1D A;  3IUO A;  3KEO A;  4EJW A;  1O8I A;  3KP7 A;  2JSC A;  5JVG F;  3ERM A;  1GXP A;  1BQE A;  2L3D A;  3BQY A;  2NNY A;  3KCC A;  1BHE A;  1B59 A;  4KIF A;  2BXY A;  4CXF A;  3CRZ A;  4XOT A;  4HE5 A;  1BOA A;  1AWC A;  2X85 A;  3L9F A;  1WOP A;  4ZCL A;  4ZV4 A;  2DA1 A;  2O17 A;  2BM0 A;  2MC4 A;  4XNF A;  3GCM A;  3GME A;  5F08 A;  2EFW A;  4NUB A;  1YS6 A;  5EEA A;  2F5V A;  2BM6 A;  2QYU A;  4AIJ A;  1ZGW A;  3Q3A A;  1MMS A;  2KLO A;  4X1E A;  4EGZ A;  1B6A A;  2JSP A;  1HDP A;  2O1D A;  2FU4 A;  4PSW A;  3GVA A;  2QKM B;  1JT0 A;  3ZUG A;  3HOZ J;  4AVP A;  1ULY A;  3F8C A;  2I8D A;  1BR2 A;  3RKY A;  4ASN A;  3QOP A;  1FPQ A;  2JK3 A;  2E2J J;  1S72 I;  2BZT A;  2Q2E B;  3A3B A;  3LQE A;  1JKP C;  3I56 I;  3S17 J;  2R7V A;  1W0U A;  3Q3S A;  2ZTN A;  2LR8 A;  3SDB A;  4B4D A;  3A4C A;  4BPR A;  4Z4R A;  1P2F A;  3I54 A;  4V19 K;  1W87 A;  1T95 A;  1KJZ A;  3J81 k;  4XK4 A;  3WGH A;  5LLQ A;  3R6K A;  3DFG A;  4X7E A;  1Q9S A;  3HM5 A;  4D7N A;  2QTZ A;  3GO5 A;  1TYW A;  3DEW A;  2XAG A;  2EIK H;  2V26 A;  2W24 A;  3T8R A;  3SEZ A;  3A1Y A;  2Y69 H;  1HW1 A;  4BGD A;  5C44 J;  5LRS A;  3BJA A;  5M5Y J;  1R23 A;  3SKB A;  4FET A;  1P4A A;  1KQ9 A;  4AWX B;  1X58 A;  3CCE B;  1IO2 A;  1OFL A;  4IL6 C;  3ZZT A;  3U6K A;  4RD1 A;  2IA2 A;  1XC5 A;  3H9G A;  4MHG A;  2GOX B;  1PDN C;  1TWG J;  4A3M J;  3E1Y E;  3ISP A;  2O0V A;  4KIC A;  2JJ7 A;  2QQ8 A;  3EQL F;  1H0M A;  4Z05 A;  3CQZ J;  4RBO A;  1AMO A;  1VQ9 I;  1FBU A;  1NBM A;  3CCQ I;  2NS0 A;  3DU5 A;  5LRR A;  4BUP A;  5JLX A;  1Z91 A;  3A01 A;  3ULQ B;  1D0Z A;  2EV5 A;  4OOV A;  1Q81 D;  1RI7 A;  1ZK8 A;  3VSU A;  2QUF A;  4XL9 A;  3CME I;  5FKO A;  4HNU A;  1XCV A;  3CMA B;  2R6H A;  4B43 A;  1G7S A;  2FMY A;  5THX A;  3TO7 A;  1T38 A;  2C78 A;  4PFO A;  1QZY A;  4HRI A;  1V54 H;  1B72 A;  4Y33 A;  1HST A;  4X7D A;  3S1M J;  4CCJ A;  2CRG A;  1WPC A;  4XKW A;  1VQ9 B;  1WI9 A;  1ZEL A;  5C3E J;  3JRA A;  4M71 A;  1I6H J;  1B72 B;  3AVT A;  1YO5 C;  4PC7 A;  4OOS A;  3SXY A;  1QU3 A;  5TJJ A;  2C6Y A;  4JX6 A;  5FO0 A;  1FND A;  2FX0 A;  3OEH A;  1P4W A;  5BPI A;  2KFD A;  2X1E A;  5K7F A;  3ZZ0 A;  2QWW A;  4R79 A;  2JTV A;  5H2F C;  1V5F A;  3DTI A;  1QPM A;  2P5V A;  4UVA A;  1U3E M;  4A3D J;  1RIO H;  4Y9R A;  3ZOB A;  3WBJ A;  2VBY A;  5A2Q Z;  3JRD A;  1PJR A;  2KIM A;  2VE8 A;  4HLX A;  5IYD J;  2L9R A;  2Y0S N;  3HTU A;  1RKT A;  3QYE A;  2V7U A;  3WTZ A;  1MDM B;  3H9N A;  3HGG A;  4L9V A;  1RET A;  2CV1 A;  3GQA A;  2BF4 A;  2DT6 A;  2WB1 N;  1E3X A;  4OJ5 A;  1HKT A;  1H8E A;  3H1C A;  3HHG A;  2O8X A;  1J7K A;  3OY9 A;  1MH4 A;  5HS8 A;  3J80 Z;  2CQN A;  1HW2 A;  3FXQ A;  2XZP A;  1SM4 A;  4Q48 A;  4HDU A;  1JB9 A;  4OPV A;  5B1B H;  3WXM A;  5E8G A;  4V02 C;  4CYD A;  3DKX A;  3A8K A;  2D1V A;  1X4P A;  4EH1 A;  2R7F A;  3AFH A;  4OU0 A;  2XAF A;  4D5F A;  3H92 A;  1VHO A;  2MBF A;  1EH8 A;  2WAF A;  4KKS A;  4IW3 B;  2FNP A;  3W2F A;  3AVX A;  3U2R A;  3GVK A;  4NC6 A;  3Q6R A;  1USS A;  2DMP A;  2R7U A;  2OTJ I;  3B8Y A;  4XKB A;  1XSD A;  2JVH A;  1GXQ A;  2DFI A;  2WAD A;  4JX5 A;  1UFM A;  1DPU A;  3JRH A;  1Z9C A;  3GQ9 A;  4IHW A;  2BOL A;  4FN5 A;  2FVG A;  3BR6 A;  1TYV A;  1IJE A;  2GAU A;  2IS4 A;  1VHE A;  3L09 A;  3PNT A;  1U2R A;  3I4P A;  3JAM Z;  1ZAR A;  2CFO A;  5GV7 A;  1OFM A;  2G0Y A;  1OOC A;  2ACJ A;  3CPW B;  1QZZ A;  2ESN A;  4OZZ A;  4G6I A;  1Y6I A;  2A5Y B;  5CPR B;  4B3G A;  4LJZ F;  3V8K A;  4MEY F;  3KE2 A;  2OC6 A;  4ZZD A;  3U9G A;  1LEA A;  4FXU A;  1UD5 A;  3LNQ A;  4EJT A;  3K9T A;  3ZQC A;  2Y9Y A;  2BMW A;  1KCD A;  5C1E A;  2K85 A;  2E1O A;  2LRE A;  2PIA A;  4ASU A;  2QA4 B;  2BSP A;  2PMD A;  2HYG D;  4E70 A;  2VN2 A;  2VAS A;  2XKP A;  2R5Z B;  5HDG A;  1XE1 A;  1G4D A;  1UHS A;  5ICF A;  2VB6 A;  1GJR A;  1BBY A;  1X1P A;  5FD5 A;  3BTC A;  3PQK A;  3ZMV A;  3AL0 B;  3S1Q J;  5KNL A;  2FJ1 A;  1T2K A;  3LYC A;  1QO0 D;  3CPX A;  2X3U A;  2RC6 A;  2MG4 A;  3ML6 A;  2BE5 F;  2CBX A;  1D0X A;  4LG0 A;  4CHU A;  1WJB A;  4FIS A;  5GAG J;  1RNL A;  3A8I A;  2HTS A;  3P5J A;  1WRJ A;  2IW5 A;  2X51 A;  1LEB A;  1TLL A;  3NE5 B;  3A3G A;  4P12 A;  2XSD C;  5DCF A;  4DZP A;  4FT8 A;  4AUX A;  3IP4 B;  4HV6 A;  4WX9 A;  5KSW B;  2P6S A;  2QY1 A;  4Z4S A;  4N9I A;  3FPK A;  4KIB A;  3OYK A;  3BJO A;  3N4M A;  2NVQ J;  3FJO A;  2DER A;  3U2Q A;  1WFX A;  3V8L A;  5ED4 A;  2GM4 A;  5GV8 A;  4OOX A;  3TP0 A;  2BW3 A;  1H80 A;  4Z6Y A;  1SFE A;  2VKD A;  2BV3 A;  2XPV A;  2LDU A;  2XOK A;  4OJO A;  2B5O A;  4HPQ A;  1HC8 A;  2K5C A;  3BR3 A;  2XF6 A;  1W35 A;  4YAW A;  5B3S H;  2XDV A;  1O8H A;  1U5T C;  1XTA A;  2RKH A;  2OCE A;  2GIZ A;  5DV5 A;  5E8I A;  4CQJ A;  3CLO A;  1KC8 D;  3OYB A;  2IGK A;  4RJL A;  1X4O A;  5L46 A;  1R5H A;  1ZGA A;  4IHX A;  5F0C A;  2XB0 X;  2A69 F;  5FB2 A;  5DS0 A;  2GQQ A;  4OIN F;  1P7J A;  1FC3 A;  1WKM A;  2VZL A;  3ES9 A;  5LMZ A;  4OIO F;  4LG0 B;  3C7J A;  4BE1 A;  1NH3 A;  5IP7 J;  1ZRE A;  3MZ8 A;  4HG2 A;  3AVW A;  1T0F A;  1F43 A;  1ZM4 A;  2UVF A;  3JUR A;  2DA4 A;  3GFL A;  5JHU A;  3PSZ A;  2ZB9 A;  3DEU A;  3WGI A;  1SFU A;  3PET A;  1BJK A;  3BWG A;  2GRE A;  1GV2 A;  1VZ0 A;  1HZE A;  3KX2 A;  1T08 B;  2Q1Z B;  3RKX A;  3P9I A;  4QTR A;  1QVF B;  1ETY A;  2OV7 A;  3OSF A;  1MSF C;  1BN8 A;  2E7W A;  5DUK A;  3ZQH A;  2Y30 A;  5LEJ A;  3BCB A;  5LHI A;  3BY1 A;  1O8G A;  2J8I A;  5F0F A;  1JGG A;  4BS9 A;  2GBY A;  1FYL A;  4OWR B;  3CCE I;  5K5O A;  2ZJQ F;  2XND A;  4UZU A;  2E60 A;  4LK1 F;  3PO3 J;  5GTH C;  2DN0 A;  4EM1 A;  1TWC J;  3CP2 A;  4D7M A;  5KHD A;  2X6O A;  1TQI A;  3BC8 A;  4C2T A;  1QFZ A;  3CCR I;  5CKT A;  2L5Q A;  2DTZ A;  2Y48 A;  3VSK A;  3GRH A;  4YZA A;  4G7H F;  2G0E A;  3BLY A;  4YFN F;  1RR8 C;  3M8F A;  4QSH A;  2BVN A;  3ZIA A;  4OJ6 A;  2IVM A;  4RM2 A;  2XTX A;  5HOO A;  1U6G A;  2NST A;  2ADU A;  4X6A J;  1FEX A;  1OGM X;  1OLT A;  2IGO A;  5H5J A;  3HOS A;  2PI0 A;  4I02 A;  3B90 A;  3WTU C;  2XRO A;  4B3A A;  5J4V A;  2E35 A;  4C2M J;  2OQR A;  1OGJ A;  2V9P A;  1IUY A;  1SC7 A;  3NB2 A;  2HQ5 A;  3OIP A;  3I59 A;  4DNT B;  1O8L A;  4KKU A;  4G6T B;  4KH3 A;  1I1G A;  4IHS A;  4K1X A;  5IOZ A;  2R7W A;  3WWG A;  1BIB A;  1IXR C;  2B7B A;  5H6R A;  4D1Q A;  1Y0N A;  4BDZ A;  3GFI A;  2KPM A;  2M8G X;  5TGT A;  3OIO A;  2GQF A;  3OYH A;  3N97 A;  1FYM A;  1A6Q A;  4PJL A;  1YRN A;  2PMH A;  3DPU A;  4M9S A;  2V7Q A;  5IYQ A;  2WWY A;  1O8M A;  2VL8 A;  2EJR A;  3CP8 A;  5TRD A;  1S8N A;  1LNW A;  1UCR A;  1GLN A;  2F4I A;  2VKE A;  2FOK A;  4WZT A;  3RPU A;  1KYW A;  2CH0 A;  3RI4 A;  1HDD C;  2E1R A;  1E3O C;  4PGO A;  2D2W A;  3HUG A;  1DDN A;  1EP3 B;  1ZGJ A;  3J81 Z;  4BE0 A;  1OYI A;  5F1J A;  2E36 A;  3F22 A;  3T9G A;  2HZT A;  4ABZ A;  1NHC A;  2H8R A;  3RKW A;  1FWZ A;  2HZD A;  3E7L A;  3GWZ A;  3GTO J;  5ILS A;  1IAW A;  4MTE A;  2M34 A;  2NS7 A;  4BXF A;  3G71 B;  3MN2 A;  2O61 A;  1WJE A;  2QKL B;  2O0Y A;  3NEU A;  2OA4 A;  3FK6 A;  5F64 A;  1TUI A;  2CW7 A;  3PUB A;  4KN4 X;  4HW0 A;  3PJR A;  2CUF A;  3L2V A;  2W6J A;  1KK2 A;  4MGR A;  2BX6 A;  2STW A;  1WJD A;  3ABL H;  3H0D A;  5B6I A;  1T0F C;  3GF2 A;  3GFJ A;  1E63 A;  4PJJ A;  2A68 F;  2NOJ B;  4RB2 C;  2VKH A;  4G7O F;  1GAW A;  1O7F A;  5GAD J;  3KIO A;  4PJN A;  1V0E A;  3DTK A;  1IUF A;  1D1A A;  4HAM A;  1IDK A;  3ASO H;  5K5R A;  1LFB A;  1G7C A;  2CYY A;  3ELK A;  3PUN A;  1MW7 A;  1X2M A;  2DT7 B;  2V31 A;  1DAR A;  5AN9 A;  1FZP B;  1BC7 C;  2EPF A;  3VFZ A;  3GLL A;  1NRK A;  4P3I A;  4OPO A;  5HZB A;  5HDN A;  5E3M A;  1I18 A;  1BI3 A;  2CW8 A;  4XRM A;  3RQ4 A;  5FKN A;  1IA5 A;  2JN9 A;  5J40 A;  4WXD A;  3RYP A;  3DEE A;  3EUH C;  3SJP A;  2H6C A;  2ZBU A;  3NQO A;  3E97 A;  1CZF A;  1X1B A;  1WJA A;  3BT9 A;  2VQH A;  1UAA A;  1FY7 A;  3BR2 A;  4RAZ A;  4BKX A;  1RUN A;  1WVR A;  1ZLJ A;  4MQV A;  1RRJ A;  3K70 C;  3QFT A;  1JUS A;  1R4M B;  1FX7 A;  1VQK I;  2MLG A;  2JA5 J;  4FHT A;  2V1X A;  3HHH A;  1XCB A;  2GPJ A;  2OJE D;  2ZBV A;  1BM9 A;  1TZL A;  2GOM A;  3OKX A;  2XZO A;  3GTG J;  3W6K B;  3LQ6 A;  4IJA A;  2XF5 A;  1PXZ A;  2FOW A;  1VTN C;  3K69 A;  1YX3 A;  1G3Y A;  2EZH A;  3HRM A;  3GSI A;  4A3C J;  3BG3 A;  3P26 A;  2NVU B;  2LBF B;  2E1C A;  4M1K A;  1MJ9 A;  1QRC A;  2KIU A;  1WWX A;  1OR7 C;  3T56 B;  5FRO A;  1J59 A;  5IP6 A;  4RGS A;  3RKQ A;  3K2Z A;  1B2R A;  3LSP A;  4XKV A;  3HEF A;  2VBZ A;  3PFY A;  1CQT A;  5E20 A;  4G6D A;  1SFO J;  3VNV A;  2VBX A;  1Y0U A;  5E79 C;  3BZK A;  3COA C;  1LPQ A;  4LBZ A;  1M90 D;  4HWV A;  4D9J A;  1R7J A;  4EM2 A;  1FOX A;  2JPC A;  3VO1 A;  1RWR A;  4DYC A;  1Y0R A;  3MD2 A;  4NDL A;  3G71 I;  4QHY A;  4Y4R A;  2F4M B;  5CVV A;  5DM7 F;  4TMT A;  3TKY A;  1QHH D;  3PO2 J;  4ANJ A;  4EM0 B;  2XGE A;  2PG4 A;  4BJ6 C;  3FMR A;  1ORK A;  2WYR A;  1H9G A;  4YAO A;  4CA0 A;  2DCU A;  3HUG B;  1E3Z A;  4ACA A;  4XLH A;  1RMG A;  3FBN B;  3TL4 X;  4ENJ A;  1O3Q A;  1TWF J;  4OOI A;  1OCT C;  3CCS I;  3E6D A;  2X8K A;  4P6V F;  3WNC A;  3ZMD A;  1QA3 A;  1YLO A;  3ZR8 X;  1WTH D;  1J9I A;  1VQL B;  4BEH B;  3JRE A;  4QFM A;  4DNR B;  2VI6 A;  4A69 C;  2YX4 A;  3LAP A;  1U2W A;  1ZQ3 P;  1VQN I;  3N90 A;  4MXN A;  3WU0 A;  1DAB A;  3A0H C;  2VNJ A;  5IK2 A;  1IRF A;  3ZP5 A;  1O8J A;  4M73 A;  4X05 A;  2DLL A;  1HA3 A;  4G7X A;  1R5N A;  2V6E A;  2P3M A;  5J35 A;  5J6X A;  3G6E B;  2Q6L A;  3M07 A;  3V4G A;  3F8M A;  4ON0 A;  4XLC A;  2R92 J;  2O9L A;  3W6V A;  4LK0 F;  1DG1 G;  4DK1 A;  3REO A;  4ZTJ A;  4HQE A;  5D6E A;  3BJ6 A;  2D3N A;  1BMF A;  1E3H A;  4RCZ A;  4F91 B;  1IRG A;  1S7A A;  4PC1 A;  3CC4 B;  4TMX A;  4A3K J;  2XKO A;  5K1Y A;  4F52 A;  1HF0 A;  4PAA A;  2QM3 A;  2EZL A;  2R7D A;  1XSV A;  3CD6 B;  4ZYD A;  5BQT A;  2ZZF A;  2BM5 A;  2DAO A;  2JWT A;  3LSR A;  4MFE A;  1R5I D;  1MBE A;  2ZCW A;  1R4N B;  3QWL A;  1E17 A;  1UHM A;  1FOY A;  2Z3Y A;  2BW3 B;  2ISY A;  5FLX K;  4H9G A;  5EEH A;  3I53 A;  4YC5 A;  2QYO A;  3L2U A;  1AOY A;  2KL4 A;  3WOD F;  4OZY A;  2HPI A;  1KU9 A;  2CV2 A;  1UJ8 A;  2DET A;  3O8G A;  2HXI A;  2VOO A;  1XPX A;  2EIM H;  1QQ1 A;  4RGU A;  1GVH A;  2VLA A;  3SQN A;  4PGH A;  4DIQ A;  1XGN A;  5K5Q A;  2E1M C;  4L0Z B;  3BH7 B;  3ZPP A;  1ZYR F;  1GO2 A;  4TN1 A;  1OB0 A;  3IH3 A;  2YS9 A;  4BHB A;  2R93 J;  1WU8 A;  1KZL A;  1X19 A;  3M9A A;  4OPW A;  3ONU A;  3BCA A;  1TP4 A;  2R5Y B;  2YPR A;  3J7Z I;  3GBG A;  4XLN F;  3G1O A;  3CLQ A;  5JLV C;  1K78 A;  2EFN A;  3S1R J;  5L3B A;  1P6R A;  4WZE A;  3BG5 A;  2LBF A;  3SYT A;  3I64 A;  4JQF A;  2HQN A;  4UUS A;  1F5T A;  1QA6 A;  1A5J A;  3ABM H;  1W36 D;  2ZO4 A;  2VFN A;  2DA2 A;  1XD7 A;  3DXJ F;  3BCD A;  1YS7 A;  4CCN A;  3KEW A;  1TVC A;  2CRV A;  5FNZ A;  4PK4 A;  4Z2Y A;  3FY3 A;  4P1V A;  4QIW N;  2EH3 A;  1IRZ A;  2YWH A;  2QSF X;  2ZFW A;  4LGW A;  2PJP A;  3QFS A;  4M3G A;  3SFZ A;  1Q82 D;  3EQN A;  1IC8 A;  3BR0 A;  4M0L A;  1D0Y A;  2OBP A;  4DJA A;  3EET A;  3A02 A;  1GT0 C;  4BDY A;  4IRI A;  3ZMS A;  1BJA A;  2LTP A;  2QEX B;  2BY1 A;  3KP5 A;  1EE6 A;  2AXL A;  1SMT A;  2FBH A;  4PC6 A;  1MRZ A;  3T8T A;  2R5Z A;  1TT5 B;  1E64 A;  4I76 A;  4A3I J;  1K4Z A;  2MGQ A;  2VXD A;  3H3U A;  4Y7N J;  3HBL A;  4GXO A;  4HST A;  5F27 A;  3W3C A;  1FOK A;  5ICG A;  5GAH J;  1OQY A;  2OD5 A;  3KP2 A;  1QUF A;  1F9N A;  5DCM B;  1AKH A;  3KFW X;  3M4O J;  3H35 A;  4XR6 A;  2FNA A;  4PZJ A;  2NRA C;  3Q6Q A;  3K1P A;  3LA7 A;  4D0P A;  3D0S A;  4CZZ A;  4A3L J;  2BPO A;  1IG7 A;  4HF2 A;  2OU2 A;  3S93 A;  4BXU A;  3WQZ A;  4LD5 A;  3JRI A;  1XX5 A;  4AYB N;  2DXI A;  4A3E J;  1HXD A;  4XSX F;  3RDI A;  3AG3 H;  5GAE J;  3KYL A;  4MLO A;  4P2N A;  5LD2 C;  2K3P A;  3OYL A;  5DDG A;  1JUM A;  1KTV A;  2M3A A;  2EA2 A;  2QGG A;  4PC2 A;  2OTL B;  1O8D A;  3RTR A;  4AC9 A;  2OUM A;  2DK8 A;  2DA3 A;  1ZRC A;  3ASR A;  1QJV A;  4HNV A;  1ETQ A;  2P0W A;  3LL7 A;  3G4S B;  2DOF A;  3FBI B;  5FGM A;  4PSX A;  3FHZ A;  1X3W B;  1W36 C;  3OR1 C;  1ETK A;  2ESH A;  1GDT A;  1S0U A;  2A5W A;  4CYC A;  3FMS A;  3HKZ N;  3G3Z A;  4B8X A;  1T56 A;  1RC9 A;  5EGO B;  1C0W A;  3CF5 F;  4XRS A;  4M72 A;  1U9N A;  4AIH A;  1HKS A;  2IEK A;  3KZI C;  2GJP A;  4B1R A;  4L18 B;  4RD0 A;  4F7D A;  2VFO A;  2O5R A;  1MNE A;  2V79 A;  1LDD A;  3BG7 A;  5DYM A;  3HYI A;  4FX4 A;  2ISZ A;  3OAA A;  5D5U B;  2KRH A;  5FD6 A;  1Y8R B;  1B8I A;  4YDT A;  1JUP A;  3AK5 A;  1MJB A;  2GA1 A;  2TCT A;  4E7K A;  5KCM A;  3W2A A;  2QZ8 A;  3KLO A;  3GFM A;  2K9Q A;  3MMP A;  3S2H J;  1FT9 A;  3K1M A;  2DOD A;  1E43 A;  2PYG A;  1K7A A;  2MD5 A;  3M8E A;  3OYA A;  2FBK A;  1BL0 A;  1W7P D;  2W4S A;  1VLO A;  3SY2 A;  2XRL A;  4RLQ A;  2QN6 A;  2PEX A;  4UV9 A;  2MD0 A;  2OZU A;  1VQP B;  2ME0 A;  2M1B A;  4AVZ A;  2VT3 A;  1P92 A;  4KNY A;  3VST A;  4ZDP A;  3QOD A;  4DQ2 A;  2A07 F;  2Q2E A;  1N0V C;  3F6O A;  3SJM A;  2VBE A;  2XGC A;  4GO1 A;  3BR1 A;  3MMY B;  2RRE A;  4BQO A;  5E18 F;  4RM3 A;  1JNY A;  1QFJ A;  3ZQQ A;  3S14 J;  1RPW A;  3Q5F A;  2M5W A;  4EV0 A;  2KT0 A;  3R60 A;  1WOO A;  4KFC A;  1BA5 A;  4QWQ A;  2XGD A;  5FIU A;  4MO7 A;  1B9N A;  1IZ1 A;  2HI3 A;  2Y31 A;  1NG7 A;  2H27 A;  3D5S C;  1UD6 A;  4TV7 A;  1H8H A;  2Y0M A;  3V8J A;  4JBA A;  4KKT A;  1IF1 A;  1Q1V A;  2MYS A;  3O3K A;  2QQB A;  2HCJ B;  3HOU J;  3GEZ A;  4X7C A;  4AF6 A;  3NWS A;  3MZH A;  1VLY A;  5KAF C;  4BXX J;  1X2N A;  1MMD A;  4RGX A;  1KD1 D;  4OJP A;  2DFF A;  1H42 A;  2HVS A;  2NSP A;  1EA3 A;  3DPT A;  4W1U A;  3BTL A;  3ISX A;  1BI0 A;  1L0O C;  2A6H F;  2VQG A;  4E6K G;  4X07 A;  1ZLK A;  1FIP A;  3BH4 A;  1IN6 A;  2O7O A;  3K1N A;  2HR3 A;  1HW5 A;  3CCL I;  3C18 A;  3KEY A;  2LG4 A;  3WTV C;  1JJ6 C;  1ZM2 A;  2ZL5 A;  4I01 A;  3WHB A;  2XGJ A;  5IPA A;  1PUE E;  5BMZ A;  1XG2 A;  3G4S I;  2QEN A;  4P1W A;  3L2W A;  1K6O A;  4DQK A;  2PJR B;  1VJS A;  1MBJ A;  1EKE A;  1Y39 A;  4EJV A;  1YJ9 B;  2K7L A;  2OCC H;  3ONY A;  2HMA A;  3O6B B;  1D5Y A;  1IDY A;  2MH2 A;  2WZP P;  3HRT A;  2R7R A;  1AHD P;  1QBJ A;  3D1N I;  2P8T A;  2ZKZ A;  3TDU C;  2KIS A;  5DM6 F;  5E1W A;  3UNG C;  1A8P A;  1Z0X A;  3SZG A;  3Q0U A;  2J8K A;  1BR1 A;  1V5G A;  1FP2 A;  3VPR A;  4EVI A;  3E6C C;  2VNH A;  2K9N A;  2CC2 A;  3RPQ A;  5J8C A;  1F36 A;  2ID6 A;  5CVU A;  1FRN A;  4A3F J;  1EWY A;  4Y3O A;  1RQR A;  5IYP A;  1ZHF A;  3W2G A;  2G7H A;  2INU A;  2X3H A;  3ZCO A;  2OK8 A;  1FNB A;  3ZRG A;  2BXZ A;  1OCR H;  4II2 A;  2IGN A;  3MKW B;  3QYB A;  5LHG A;  2QVO A;  2M30 A;  2QEX I;  3KZZ A;  4J01 A;  5M5X J;  4HE6 A;  5DS9 A;  5IYB J;  2OYN A;  4KT6 A;  5D8L B;  5IY5 H;  1Y8Q B;  2XHK A;  2V7T A;  4MFD A;  5BSY A;  5D4S A;  3RY8 A;  4F92 B;  3L2R A;  1SVL A;  1FNM A;  1AA7 A;  2X4H A;  3ML3 A;  2VBK A;  3S16 J;  4RPB A;  2H09 A;  5F6F A;  3GTP J;  1OYW A;  2COB A;  3VOE A;  2DOG A;  4S04 A;  1IV8 A;  2JUC A;  4Q7J B;  2LNB A;  2P4W A;  1OCO H;  3JAM K;  3OFN A;  2FRH A;  2BGJ A;  1MBF A;  4G7W A;  5F4J A;  4URR A;  3FPP A;  3ZSC A;  5C1C A;  3K4N A;  2Z9O A;  1GUU A;  1EV7 A;  3GYH X;  3JR9 A;  2HTJ A;  2NVX J;  3OYG A;  1WJ5 A;  4I2O A;  3QPS A;  3MEX A;  3ASS A;  1Z67 A;  5EGO A;  2XSJ C;  2LY2 A;  3GZ6 A;  1FYK A;  4EW9 A;  2CSO A;  4HDV A;  1BLI A;  1LM1 A;  1I50 J;  2BHY A;  2LZJ A;  5JFR A;  1FSH A;  3R6J A;  4K2E A;  3LSM A;  3TW7 A;  2LKX A;  1G7T A;  2ZXJ A;  1K79 A;  1I7P A;  1TQP A;  3AKZ A;  5GTI C;  1VBL A;  2ZME A;  1ZG3 A;  4LLN A;  3VB2 A;  4Y17 A;  2DPU A;  2GLO A;  2BN4 A;  2JUG A;  1Y1W J;  2DMN A;  3BY6 A;  4XLF A;  2OK7 A;  4M6V A;  1HOM A;  3E3V A;  2ELH A;  1J0R A;  2X0L A;  3FXM A;  4RLF A;  4DNC A;  2LFB A;  2D3L A;  5FLV A;  2ZXH A;  2OTJ B;  2HWV A;  1HF2 A;  3BNW A;  1FDR A;  3QE2 A;  1RKW A;  2KMU A;  1NK3 P;  5IYR A;  1UZC A;  4Q5S F;  5B5E C;  1UD3 A;  1MJA A;  3V7S A;  2HOS A;  4M4S A;  1D1N A;  4DZJ A;  1DU0 A;  3SEJ A;  2ZIT A;  2CV0 A;  4Z4Z A;  2NT6 A;  4LBW A;  4LBV A;  4Y15 A;  2UXN A;  2HXO A;  2LMD A;  4B47 A;  1POG A;  2B9S A;  4RMN A;  3TQN A;  3ZQG A;  5A8A A;  4DOZ A;  4WWC A;  2Z33 A;  5LHH A;  2HPM A;  3BH6 B;  4BAC A;  4IHT A;  1VQ8 I;  3CC7 I;  1U78 A;  2VXZ A;  3IL2 A;  1O7L A;  3DKW A;  3CMA I;  3CO6 C;  1YTY A;  2HOT A;  2X1D A;  2GZW A;  4C3J J;  3ZZU A;  3C2H A;  3VWB A;  4H0E A;  3IKV A;  4ZCI A;  2VBV A;  2JA8 J;  2LOO A;  4YEJ A;  5FL7 A;  1VQL I;  4Y52 J;  4Q47 A;  3TOA A;  2PBI A;  3OWT A;  4LG3 A;  4BBR J;  2DPD A;  5IT3 A;  2IT0 A;  2L01 A;  4A6D A;  5DD4 A;  4A2U A;  3G1L A;  2UUZ A;  2VQC A;  1HBX G;  1XGM A;  2RNJ A;  1PJ7 A;  4I6Z A;  1R5B A;  3SUC A;  4C2L A;  4DYQ A;  1IN8 A;  4WZL A;  2L54 A;  3NRV A;  1KU2 A;  2DEU A;  5J1U A;  5EZG A;  4NC7 A;  3TW6 A;  3DDY A;  1EA0 A;  4DGW B;  2M2E A;  1VF9 A;  2Q0O A;  2XVC A;  1GR1 A;  3OZU A;  4N0B A;  4DK0 A;  1UEL B;  1BR4 A;  2CQQ A;  3A2K A;  1BJZ A;  3FMQ A;  1EH7 A;  2V7F A;  4E7Z A;  1Z21 A;  2L7F P;  3VMF A;  1STZ A;  5CVI A;  2Y75 A;  2YUS A;  1JTX A;  5J8F A;  3QRF F;  4DYR A;  1O4X A;  3T5X A;  3LFK A;  4ZH4 F;  3ROU A;  3CC7 B;  2QCO A;  1OB5 A;  3LJY A;  2XT4 A;  2WY7 Q;  3HSR A;  5DTD A;  1QGY A;  4IF4 A;  1QGZ A;  3OYI A;  3K4K A;  3W2H A;  1SAU A;  4CCM A;  1GVJ A;  1WCM J;  1J9Z A;  4ZTF A;  1V5V A;  1IXC A;  1MZB A;  3HG9 A;  1T6S A;  2DOA A;  4RDU A;  3TED A;  4HF1 A;  1ZM9 A;  2XF7 A;  3R0A A;  2ZZQ A;  3PFI A;  4HEA 2;  3FM3 A;  2R7X A;  2OBT A;  1WSV A;  4P55 A;  3VYR B;  3FIS A;  2QSH X;  2XTW A;  2YUH A;  4P3Y A;  3PNY A;  4A5N A;  4CCK A;  4F55 A;  2XNJ A;  4RDK A;  3RIQ A;  3CME B;  3AG4 H;  1TLH B;  1VFC A;  4RD6 A;  3NAW A;  2AQE A;  5JMC B;  1QRB A;  1H85 A;  1NK2 P;  4BHP A;  2WBM A;  1JI8 A;  2NTB A;  4QVA A;  1R36 A;  1LFP A;  5M3M J;  4RLZ A;  2Z2S B;  1VQM B;  2ZXW H;  3LWF A;  5KAI C;  2CUZ A;  4UVB A;  2WPD A;  2NAZ A;  2G7U A;  3VOD A;  1HQC A;  2R4G A;  4M2L A;  1WXR A;  5E3L A;  2EIN H;  3BCF A;  1ODD A;  4L9J A;  2V6C A;  2NT9 A;  1G3T A;  4WZK A;  1IN7 A;  4ZZL A;  5DCM A;  1AKH B;  1OFE A;  4LC0 A;  2JA2 A;  1ACI A;  3K10 A;  3RZO J;  2XNC A;  2F4O B;  3TDZ C;  1EXM A;  1IV6 A;  4YZ0 A;  3MZY A;  4S0H B;  2ZTG A;  5L3E A;  2B63 J;  2RNG A;  3P9C A;  5EF6 A;  1E2X A;  2LSO A;  5E3N A;  2P5K A;  2EV6 A;  4I98 B;  1UHW A;  2LY9 A;  1DP3 A;  1QGA A;  1XFO A;  3W2E A;  2XTY A;  3MQ0 A;  3I55 B;  1JRG A;  1IB4 A;  2CQ7 A;  4L5I A;  2VJJ A;  5EDN A;  3F72 A;  3DLA A;  3TP3 A;  2ZNZ A;  3T1B A;  1X1C A;  5HXB A;  3RCO A;  2TRT A;  5CYV A;  4XRS G;  2HDW A;  3SZT A;  3CW2 A;  4KYW A;  3CTA A;  2E5N A;  2OAZ A;  2R3S A;  3I56 B;  2C5H A;  1JA1 A;  2QA4 I;  5B66 C;  4KDP A;  1J5Y A;  1FP1 D;  2J7K A;  3CCM I;  3IH4 A;  4OP7 A;  3GTJ J;  3AST A;  3W2V A;  2M45 A;  2WJV A;  3CDI A;  2XPW A;  4AD9 A;  3LSI A;  1XN7 A;  5F04 A;  5ICE A;  4NCN A;  4YAU A;  2HGC A;  3HAG A;  4UB8 C;  4CGZ A;  4LBY A;  4B4C A;  3K0L A;  2YU9 J;  1KU7 A;  1NDH A;  5J3L A;  2P7C B;  2XUB A;  1PP7 U;  4U7B A;  2O03 A;  2AXT C;  3AG1 H;  3PNV A;  5HS9 A;  3VSL A;  1BIA A;  3WE3 A;  2X6W A;  3GVJ A;  2GJR A;  1ZUN B;  5JBQ A;  2FX3 A;  1KRH A;  2D74 A;  2GK6 A;  3B6C A;  1S9H A;  1O88 A;  2G9W A;  3H5A A;  4HQM A;  2FF4 A;  4PMH A;  4V2G A;  3FXR A;  3F0C A;  2XAQ A;  4H4K C;  1XMA A;  4F7Z A;  4E7I A;  5HKK A;  2EIL H;  1W4M A;  1R5O A;  3S3N A;  4L5J A;  4P22 A;  3HL2 A;  3CCV B;  3SJZ A;  3BQJ A;  4J00 A;  2EIJ H;  1WZ2 A;  1MKM A;  2KDO A;  3B02 A;  3ZBT A;  1I8D A;  3AVY A;  3WTY C;  1LDJ A;  3EUA A;  5TY0 A;  1V4R A;  4YZQ A;  3MKL A;  4M9X A;  2XC7 A;  3MKZ A;  2FE3 A;  4R8H A;  1MBG A;  3F21 A;  4EJU A;  1NG6 A;  3K6G A;  1DP7 P;  1NB0 A;  2EFG A;  1APL C;  1WMR A;  2CUJ A;  4L9N A;  4N4O B;  3I5U A;  3UR3 C;  2F1L A;  1XGS A;  4DW6 A;  3VNU A;  5JHF A;  2WV1 A;  3KYD B;  4A3G J;  1O8K A;  4YXW A;  2IJL A;  4BY7 J;  1XB4 A;  3H09 A;  1LKX A;  1OB2 A;  1CNF A;  2UZK A;  3BTI A;  1MH3 A;  1YRN B;  1QRY A;  4WXH A;  1ERD A;  3H94 A;  3I1F A;  1IXS B;  4PCQ A;  1MSE C;  1IRX A;  3ZQF A;  2JPB A;  5M5W J;  3ONQ A;  1TYU A;  4RGR A;  3WNB A;  1BOB A;  1YIJ I;  2V1U A;  1N06 A;  3I58 A;  2W7N A;  1PE9 A;  1V5E A;  3OL4 A;  5K7Z A;  3IWF A;  3PIO F;  2UV1 A;  2MC3 A;  1YQA A;  3W2W A;  3LQQ A;  3CD6 I;  2HYJ A;  3J7Y J;  2JMW A;  1PLU A;  2CMP A;  1A04 A;  2B7E A;  5E1Z B;  2Z16 A;  1VQO I;  2RVC A;  5FO1 A;  3KP3 A;  2IS2 A;  1F1Z A;  3I4M J;  2CQK A;  3QPH A;  3JQP A;  4RD3 A;  3ASN H;  1V55 H;  3QYF A;  4ZGQ B;  1KGS A;  2W25 A;  2K3F A;  3DF8 A;  3MWM A;  3LST A;  4HOB A;  1OGO X;  1X1A A;  2L2O A;  3B73 A;  2F2E A;  3BG6 A;  4NQW A;  2EK5 A;  3CZ6 A;  3WYA A;  3QAH A;  1G59 A;  4ITV A;  3WHC A;  2IA0 A;  3OMY A;  2KRC A;  3DU1 X;  3F8N A;  1JTY A;  3OOP A;  1YW9 A;  3K4L A;  5CQE A;  4M53 A;  1E3P A;  4YEI A;  3JCU C;  4P6Y A;  4ZJZ A;  3E1S A;  1P4M A;  1L3L A;  4BBS J;  4RPD A;  2CS3 A;  4HA8 A;  2BY0 A;  2FSW A;  4JMQ A;  3VO2 A;  3AG2 H;  2VBS A;  3HOY J;  5HLH A;  2R7Q A;  2DJN A;  2YSR A;  1F4K A;  1Q86 D;  4PJ0 C;  2WTE A;  1N25 A; 
#chains in the Genus database with same CATH homology
 4MLO A;  5LD2 C;  2K3P A;  2M0M A;  3OYL A;  3FDY A;  2M3A A;  4AU7 A;  4B44 A;  3OYJ A;  3VYS B;  1PKV A;  3RTR A;  3OYM A;  2UVE A;  3DKX A;  2ZSI B;  4E7H A;  2OUM A;  1X4P A;  3K4C A;  3AFH A;  1Y56 A;  4GRI A;  1QJV A;  2P0W A;  4YZX A;  2WAF A;  3LL7 A;  3M8J A;  4KKS A;  3FBI B;  1R6R A;  1W36 C;  4PSX A;  5FRN A;  5HNH A;  2R9V A;  3OR1 C;  3GVK A;  3OS2 A;  2A5W A;  4E4H A;  1QHG A;  2NTQ A;  2E1B A;  2R7U A;  3B8Y A;  3F9K A;  4XKB A;  2JVH A;  4FAS D;  2GJP A;  2WAD A;  3H5N A;  2O5R A;  1MNE A;  3BG7 A;  3GQ9 A;  2BOL A;  2M4K A;  3OAA A;  2IS4 A;  4Z06 A;  2KRH A;  4TT3 A;  1T5E A;  4CUG A;  2E1M B;  3PNT A;  4CSW A;  2IS1 A;  3KRG A;  1VF7 A;  2CFO A;  5KCM A;  2LH9 A;  4E7K A;  3W2A A;  1OFM A;  4U49 A;  1OOC A;  3D5L A;  3VMW A;  1W0J A;  2BVL A;  4B48 A;  1Y6I A;  3MKY B;  2Y0S A;  1E43 A;  5CPR B;  4G6I A;  2X1C A;  4ZDO A;  4B3G A;  3OYA A;  2OC6 A;  3FKS A;  3JU4 A;  4FXU A;  2R7O A;  1K5C A;  1UD5 A;  3DWL E;  2M7B A;  2W4S A;  4RLQ A;  2MD0 A;  1KCD A;  2LYC A;  4AVZ A;  5C1E A;  3OYC A;  4W8Q A;  3VST A;  2LRE A;  1Z3X A;  4ZDP A;  4ASU A;  1AIR A;  3QOD A;  3J7A Y;  2BSP A;  4AYB A;  1J09 A;  3DTE A;  2VAS A;  2JJ2 A;  1K6Y A;  2VBE A;  1BPL A;  4TSF A;  4XD7 A;  3MMY B;  4BQO A;  2RRE A;  4GQN A;  4RM3 A;  3ZQQ A;  2VB6 A;  3VDX A;  3AL0 B;  2INV A;  2ELJ A;  5KNL A;  3HXL A;  2ZZE A;  4JOM A;  4BJ5 C;  2MAB A;  3GQ7 A;  3VMV A;  4X0G A;  2W6I A;  3OOC A;  1YE9 A;  1D0X A;  1HVX A;  1NG7 A;  1WJB A;  3D5S C;  1UD6 A;  1H8H A;  4NK8 A;  4KKT A;  2X51 A;  4LIU A;  4BE2 A;  3A3G A;  2MYS A;  3NE5 B;  3OIQ A;  3NWS A;  1JTA A;  4OJO A;  2V1N A;  3LMW A;  3IP4 B;  1VLY A;  4P5O A;  2Z8G A;  2QY1 A;  4ZYA A;  3HKZ A;  1MMD A;  2V9K A;  4F93 B;  4OAZ A;  4OJP A;  4U4B A;  3OYK A;  2HVS A;  2NSP A;  1EA3 A;  2IXS A;  1FMV A;  3DPT A;  1WFX A;  2M4G A;  2VQG A;  4E6K G;  4XQF A;  3BH4 A;  3DU6 A;  2BW3 A;  4XKC A;  1H80 A;  3KEY A;  2LG4 A;  3OE7 A;  2VKD A;  2XGJ A;  4C30 A;  2W1O A;  2VPL A;  1GQ8 A;  3EQO A;  2HVQ A;  1Z7L A;  2XOK A;  1XG2 A;  4HPQ A;  4I84 A;  2K5C A;  2WB1 A;  2XF6 A;  4P1W A;  3L2W A;  2PJR B;  1VJS A;  2XDV A;  4XN3 A;  2L9N A;  4E7L A;  1O8H A;  3G2B A;  1UG0 A;  1MAB A;  4U87 A;  3IAS 2;  4BL0 B;  3OYB A;  2IGK A;  4C9Y A;  3K70 D;  2VBM A;  1X4O A;  2K9M A;  3K4B A;  2WZP P;  2R7R A;  3I3L A;  4BJT A;  4YEL A;  5CQG A;  2F6C A;  3S3O A;  3UNG C;  3SZG A;  3EPZ A;  1BR1 A;  4CCL A;  1V5G A;  4BE1 A;  2KVO A;  1W0K A;  2L7K A;  1FX0 A;  4MR0 A;  3E0J B;  5DN6 A;  4HG2 A;  4Y3O A;  3EUK L;  4CCO A;  1UD8 A;  2UVF A;  2INU A;  4ZDL A;  2X3H A;  3JUR A;  4LIT A;  4E7S A;  2HLD A;  3ZCO A;  2ZZG A;  2HU9 A;  4CH7 A;  1TT0 A;  1VZ0 A;  3ZRG A;  2R7S A;  3FKJ A;  3KX2 A;  2Q1Z B;  1HZE A;  4II2 A;  4PJM A;  2IGN A;  1G8X A;  2OV7 A;  3QYB A;  3MKW B;  4KIS A;  3VYT B;  1BN8 A;  2KHM A;  1MMA A;  3BCB A;  3OR2 C;  4ZC3 A;  4J01 A;  1O8G A;  3HPG A;  4KT6 A;  4Z1M A;  4BS9 A;  1V0F A;  4OWR B;  2XND A;  4F92 B;  4UZU A;  3GQ8 A;  4B3F X;  3L2R A;  2E60 A;  2AQF A;  1AA7 A;  2VBK A;  4Z03 A;  2R7T A;  5CDF A;  3CP2 A;  5KHD A;  3BC8 A;  1DGW Y;  3DKY A;  4C2T A;  3OFN A;  1MND A;  3BC9 A;  5CKT A;  2L5Q A;  3VSK A;  2BVM A;  4G7W A;  3GRH A;  4YZA A;  3BLY A;  1O8E A;  3FPP A;  4URR A;  3ZSC A;  3K4N A;  1UD4 A;  5C1C A;  3LSK A;  2VIX A;  3C2G A;  4XM3 A;  3ZIA A;  1D1C A;  4OJ6 A;  4RM2 A;  1E0E A;  1QCX A;  1P9Q C;  3CMM A;  5HOO A;  3PSI A;  3OYG A;  1WJ5 A;  2IQ7 A;  2X6X A;  4IX7 A;  2Z1D A;  2NST A;  4E0F A;  2VJ4 A;  2CK3 A;  1OGM X;  1OLT A;  2IGO A;  2LY2 A;  2XSJ C;  3SEQ A;  4XLE A;  2WY8 Q;  3HOS A;  2KP6 A;  2Z6B D;  3OW7 A;  3B90 A;  4EW9 A;  3N05 A;  3H9J A;  1BLI A;  4NNJ A;  2W82 A;  2LZJ A;  3OIP A;  4DNT B;  3L2Q A;  1O8L A;  4KKU A;  3CJQ B;  3D5R C;  4G6T B;  4XON A;  3LSM A;  1U0J A;  2R7W A;  3WWG A;  3S32 A;  2O04 A;  4D1Q A;  3TBI A;  3AKZ A;  4BDZ A;  3HPH A;  1K28 D;  3RSN A;  2KPM A;  1VBL A;  4NC8 A;  2ZSH B;  3OS1 A;  5TGT A;  3OYF A;  2JUG A;  2ZXI A;  2KQR A;  3HC7 A;  3OYH A;  4XLF A;  4XOP A;  4LIV A;  5HNF A;  4NK6 A;  4N4N B;  4PJL A;  4BEH A;  2DIE A;  2HQA A;  3DPU A;  2V7Q A;  4RLF A;  4BU2 A;  1O8M A;  2VL8 A;  3CP8 A;  2D3L A;  4W8S A;  1O8F A;  3V42 A;  2ZXH A;  4XOR A;  1W9X A;  1GLN A;  3CJR B;  2F4I A;  2KMU A;  3OYD A;  2CH0 A;  4E7J A;  1UD3 A;  3CF2 A;  2FUG 2;  3OYN A;  4BE0 A;  3T9G A;  2CV0 A;  1N78 A;  3G05 A;  3GVL A;  1NHC A;  2NT6 A;  4BQN A;  2HZD A;  2NTP A;  4B47 A;  3S3M A;  4RMN A;  4BXF A;  4DOZ A;  3M1C A;  1WJE A;  2QKL B;  3CES A;  3QOE A;  3DPL C;  4BAC A;  2HPM A;  1UD2 A;  1WJF A;  3UW0 A;  2VXZ A;  3TMO A;  2RQQ A;  2CW7 A;  2JVG A;  2ODL A;  2X1D A;  3PUB A;  3PJR A;  3L2V A;  2W6J A;  3C2H A;  3K4M A;  2XAU A;  5AMV A;  3VWB A;  1WJD A;  2GK7 A;  3H0D A;  2LOO A;  1YX5 A;  1T0F C;  4PUS A;  4YEJ A;  5FL7 A;  4HNT A;  1E1Q A;  1X1D A;  4PJJ A;  3OWT A;  4LG3 A;  3T53 B;  1E79 A;  2NOJ B;  2VKH A;  1V0E A;  4PJN A;  3DTK A;  2UUZ A;  2VQC A;  3ZPN A;  1X0C A;  1D1A A;  3OS0 A;  4C2L A;  3SUC A;  1IDK A;  3S8P A;  1MW7 A;  2DT7 B;  1MMG A;  2VQL A;  2V31 A;  1COW A;  1WP6 A;  1NRK A;  4OJL A;  4NC7 A;  3DDY A;  1I18 A;  2CW8 A;  4DGW B;  4B3X A;  3RQ4 A;  4DK0 A;  1IA5 A;  1UEL B;  1BR4 A;  3A2K A;  3DEE A;  3EUH C;  2V7F A;  2L9S A;  4E7Z A;  1Z21 A;  1CZF A;  1X1B A;  1WJA A;  2VQH A;  1UAA A;  4QPQ A;  3K70 C;  4C2U A;  3FHN A;  1E1R A;  3OL3 A;  2WY7 Q;  3OEE A;  1TZL A;  1N77 A;  2GOM A;  2F43 A;  2E5Z A;  2XZO A;  3OYI A;  3K4K A;  2JDI A;  2PYH A;  1SAU A;  2XF5 A;  4CCM A;  1PXZ A;  1LVK A;  4ZTF A;  3U21 A;  1YX3 A;  3HG9 A;  2DOA A;  2GJK A;  2XF7 A;  3H5R A;  2LC2 A;  2LBF B;  2ZZQ A;  2F1M A;  4HEA 2;  3GQB A;  2R7X A;  1SKY B;  1LDK B;  3VYR B;  2DCE A;  2PMZ A;  2QE7 A;  3T56 B;  1OR7 C;  3VR6 A;  2PEC A;  3PNY A;  1KTW A;  5FRO A;  4CCK A;  4F55 A;  1Z3Y A;  2X6Y A;  3LSG A;  4XKV A;  2AQE A;  1DBG A;  2QXZ A;  3PFY A;  1DGR M;  2IS6 A;  1JI8 A;  2WBM A;  2NTB A;  3AL0 C;  3LFU A;  1LFP A;  2DJI A;  2Z2S B;  4HWV A;  4D9J A;  2CUZ A;  1KON A;  3ZGK A;  2WPD A;  2LY1 A;  1RWR A;  3LNN A;  2R4G A;  3MD2 A;  3ZXS A;  1WJC A;  4CZC A;  1DBO A;  4Y4R A;  2HVR A;  3OPO A;  4W8T A;  3OOU A;  1PYV A;  5FRM A;  3BCF A;  1HA8 A;  1QHH D;  3NWT A;  4ANJ A;  3T51 B;  2NT9 A;  1MMN A;  4BJ6 C;  2PJR A;  3B4N A;  3I9V 2;  2JA2 A;  2XZL A;  3K10 A;  2M7A A;  4CA0 A;  2WSS A;  1KCC A;  4IKF A;  4IQ4 A;  2WJY A;  3IUO A;  3HUG B;  1O8I A;  1E3Z A;  4NQW B;  2ZTG A;  4YZ0 A;  4XN0 A;  4XLH A;  2RNG A;  3FBN B;  1RMG A;  5LFA A;  3TL4 X;  2X8K A;  3H9Q A;  1DQU A;  1DP3 A;  3ZR8 X;  3LMM A;  1BHE A;  1WTH D;  1JRG A;  1IB4 A;  2VJJ A;  4PFP A;  4BEH B;  3DLA A;  4HSR A;  4XOT A;  4DNR B;  1X1C A;  3RCO A;  2ZFU A;  2HDW A;  2X85 A;  4DBQ A;  2E5N A;  4MXN A;  5HVQ C;  5IK2 A;  1O8J A;  2O17 A;  2UWM A;  1EFR A;  2MC4 A;  1HG8 A;  4XNF A;  4G7X A;  3VYU B;  4NUB A;  2V6E A;  2WAE A;  2F5V A;  3W2V A;  2WJV A;  1OHH A;  4XLC A;  2KLO A;  4DK1 A;  4ZTJ A;  2JSP A;  3LSI A;  2JIZ A;  2D3N A;  2O1D A;  4PSW A;  1BMF A;  3HAG A;  2QKM B;  2PYG A;  4IZZ A;  4F91 B;  4QPO A;  2I8D A;  1BR2 A;  4F52 A;  4U7B A;  3PNV A;  3VSL A;  2X6W A;  4KJZ A;  2GJR A;  2ZZF A;  1KMH A;  3GVJ A;  3A3B A;  2Q2E B;  1N75 A;  2R7V A;  2ZTN A;  2GK6 A;  4YRV A;  4IQJ A;  1S9H A;  4XLA A;  3SDB A;  1O88 A;  2BW3 B;  3A4C A;  2LRD A;  1IDJ A;  3H5A A;  4PMH A;  3L2U A;  1D1B A;  4II3 A;  1T95 A;  4H4K C;  2M5S A;  2KL4 A;  4E7I A;  5HKK A;  4OZY A;  4P22 A;  2HPI A;  3S3N A;  2CV2 A;  3HL2 A;  2O0W A;  4J00 A;  2V26 A;  2KDO A;  3SEZ A;  1FMW A;  1I8D A;  3A1Y A;  2VLA A;  4L8J A;  3EUA A;  4BGD A;  4XMY A;  4DIQ A;  2EWE A;  4YZQ A;  2E1M C;  3IAM 2;  2XC7 A;  2V4J C;  2K9L A;  4FET A;  3MKZ A;  3ZPP A;  1NG6 A;  3K6G A;  1OB0 A;  4F3Q A;  1WMR A;  1KZL A;  1X19 A;  2CUJ A;  4N4O B;  2VJI A;  1OFL A;  3BCA A;  2IGM A;  3UR3 C;  3OYE A;  1RU4 A;  3H9G A;  3GBG A;  2GOX B;  5JHF A;  2NZM A;  2VJ5 A;  1O8K A;  3RPU D;  2O0V A;  4YXW A;  4Z05 A;  1NBM A;  2X53 S;  1LKX A;  2LBF A;  2WAQ A;  3DU5 A;  3SYT A;  4BUP A;  2V4D A;  1ERD A;  1D0Z A;  4JQF A;  3H94 A;  3VSU A;  2JJ1 A;  4XL9 A;  2A6T A;  4HNU A;  1W36 D;  2KZV A;  4B43 A;  1IRX A;  3BCD A;  3HOT A;  3VSV A;  4CCN A;  4PFO A;  4HRI A;  3KEW A;  4Y33 A;  3ONQ A;  4PK4 A;  3FY3 A;  1BOB A;  4BQQ A;  3A35 A;  4CCJ A;  2W7N A;  1PE9 A;  1WPC A;  1V5E A;  3OL4 A;  4XKW A;  1ZEL A;  1O8D A;  2UV1 A;  3W2W A;  3EQN A;  4KIT B;  1QU3 A;  1D0Y A;  4DJA A;  4TKO B;  1PLU A;  2CMP A;  3LSH A;  3OEH A;  2Z16 A;  3PL8 A;  5HLT A;  2IS2 A;  4BDY A;  4HIZ A;  2X1E A;  4EAT A;  4R79 A;  4OAY A;  1SFK A;  1V5F A;  3DTI A;  2HNH A;  3QYF A;  4DBR A;  1EE6 A;  4W8R A;  2W00 A;  1OGO X;  1X1A A;  2L2O A;  2VXD A;  3BG6 A;  3K4J A;  1PJR A;  3CZ6 A;  3DQV C;  4HST A;  2WA0 A;  3W3C A;  1G59 A;  4ITV A;  3QYE A;  3OMY A;  2MFZ A;  2KRC A;  3K4L A;  5CQE A;  3H35 A;  4XR6 A;  2CV1 A;  4ZJZ A;  3E1S A;  3GQA A;  2DT6 A;  2CS3 A;  3PSF A;  1E3X A;  3S93 A;  4JMQ A;  3WQZ A;  4OJ5 A;  1H8E A;  2QX3 A;  2R7Q A;  4OZZ A;  3OY9 A;  2DXI A;  2XZP A;  3KYL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...