4YEJA

Tailspike protein double mutant d339a/e372q of e. coli bacteriophage hk620 in complex with pentasaccharide
Total Genus 231
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
231
sequence length
597
structure length
597
Chain Sequence
b'QFRAIIESPEGAGHVGYQYRRNTGSTMRMVSDVLDERVSLWDFHCDPSGNVIQPGPNVDSRQYLQAAIDYVSSNGGGTITIPAGYTWYLGSYGVGGIAGHSGIIQLRSNVNLNIEGRIHLSPFFDLKPFQVFVGFDNGDPASSGNLENCHIYGHGVVDFGGYEFGASSQLRNGVAFGRSYNCSVTGITFQNGDVTWAITLGWNGYGSNCYVRKCRFINLVNSSVNAAHSTVYVNCPYSGVESCYFSMSSSFARNIACSVQLHQHDTFYRGSTVNGYCRGAYVVMHAAEAAGAGSYAYNMQVENNIAVIYGQFVILGSDVTATVSGHLNDVIVSGNIVSIGERAAFSAPFGAFIDIGPDNSGASNVQDIQRVLVTGNSFYAPANITDSAAITLRANLNGCTFIANNFDCRYMVYNAPGTTSPVVQNLVWDKSNVIGGTHANQRAGQNLFDMQFASVVNSTIEVQLSCEDLSMFSCILFPASCQLSYSKITVDSAWTKSMSNTAVFEGNQQAGANVYVSYPATVNLTSYNTQGAVPFFSTDTNYAWVTSAYSLSINENLDFSPPATYTNKANGQLVGVGYNEIGGVRSVSVRLMLQRQV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Tail spike protein
publication title Enthalpic cost of water removal from a hydrophobic glucose binding cavity on HK620 tailspike protein.
rcsb
source organism Enterobacteria phage hk620
molecule tags Metal binding protein
total genus 231
structure length 597
sequence length 597
ec nomenclature
pdb deposition date 2015-02-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18781 Phage_spike_2 Phage spike trimer
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.2070 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4yejA01
2.40.30.250 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Elongation Factor Tu (Ef-tu); domain 3 4yejA03
2.160.20.10 Mainly Beta 3 Solenoid Pectate Lyase C-like Single-stranded right-handed beta-helix, Pectin lyase-like 4yejA02
1O8KA 1HG8A 2QXZA 1O8IA 1IA5A 4OJ5A 3VSTA 1VBLA 3GQ8A 1KCCA 4XKVA 1DBGA 1PE9A 2NTBA 4NK6A 5C1CA 2NSTA 4C2LA 1DBOA 1JTAA 2IQ7A 1PXZA 4Z06A 2NT9A 2INUA 2X3HA 1WMRA 1IB4A 4XORA 2PYHA 2VJIA 4XN3A 4Z05A 4XN0A 2QY1A 4OJ6A 1XG2A 1CZFA 1O8MA 3UW0A 1EE6A 4OJOA 2NTPA 3B4NA 4OZYA 3EQOA 4XLAA 1NHCA 2O17A 1JRGA 3GRHA 1KTWA 2NSPA 1PLUA 1RMGA 2NZMA 3KRGA 1O8FA 1O8DA 4W8QA 5C1EA 2O1DA 3T9GA 2X6YA 3ZPPA 4W8TA 4XONA 2NT6A 5AMVA 4XMYA 3JURA 1K5CA 3VMWA 3GQ7A 4U49A 3VSUA 2INVA 2EWEA 4XKWA 4XLFA 3GQAA 3LMWA 1KCDA 2VBKA 3SUCA 3VMVA 2O04A 1X0CA 2X6XA 4U4BA 2UVEA 4XLEA 4XOPA 4OZZA 2VBEA 4W8SA 1O88A 4URRA 2X6WA 1O8JA 3GQ9A 4HWVA 1QJVA 4XR6A 3VSVA 4AVZA 2PECA 4NK8A 4XQFA 4XNFA 2UVFA 2X85A 1OGMX 1OOCA 1BHEA 1RWRA 4YZAA 4YEJA 4XM3A 3B90A 1O8HA 4OJPA 3ZSCA 4YZ0A 4PMHA 4YZQA 4XL9A 3FY3A 1GQ8A 2O0VA 1OFLA 1QCXA 2NTQA 2VJJA 1RU4A 2QX3A 1H80A 4MR0A 4YELA 2BSPA 4EW9A 1OFMA 1IDKA 3B8YA 2Z8GA 2PYGA 1O8LA 1O8GA 2O0WA 2VBMA 4I84A 4XLCA 1IDJA 4Z03A 2ODLA 4MXNA 1OGOX 1AIRA 4XOTA 3EQNA 4OJLA 1O8EA 4XLHA 4YZXA 4W8RA 1BN8A 3WWGA
chains in the Genus database with same CATH superfamily
3A1PA 3MN2A 3WGHA 2BV6A 2BPOA 2D1HA 3NAUA 4N9IA 4KN4X 2FU4A 3LFUA 2BW3A 2L9NA 5C1CA 3FXRA 4RM3A 3ERMA 5D6EA 3U1KA 1MMNA 2VOPA 1SD7A 1PXZA 4Z06A 1WDTA 5ILVA 3I9V2 3K0LA 4HF0A 1X3ZB 3JCUC 3T53B 1G3WA 2VASA 3K4MA 3VYSB 4EJVA 1MIJA 2QTZA 4F55A 3CCQI 1E1RA 1F4KA 2RC4A 1E64A 4L9JA 2HOSA 1XSDA 2VNJA 4M3FA 3TP3A 5E3OA 1J7KA 4LLGF 5EDNA 1PJ5A 2FBHA 2VXDA 2OBSA 4PJ0C 1LQ1A 2NSPA 4KDPA 3H0GJ 4JQFA 1I3QJ 2E1MB 4IX7A 3OW7A 4W8QA 4OPWA 3AG4H 2XV4S 4RCZA 2ZL5A 3OW2B 2X6YA 3LSJA 4NC8A 4A3KJ 3PFIA 1KYZA 3ONQA 3KP6A 3VWBA 3HOYJ 3OEEA 3GF2A 3BC8A 5AMVA 4XMYA 4ENMA 1WPCA 5DUKA 5HS8A 3P26A 1K5CA 3IHUA 1K8FA 1OFEA 4RGUA 1RR7A 2NVYJ 3SQNA 4BE1A 1B8IB 5FLXK 4L5EA 2ZBUA 1LLWA 3JAMK 2NVQJ 3OZWA 3RKQA 2VC0A 1VQ7B 2V7TA 1KZLA 4GYGA 2F43A 4LOCA 4EJUA 3HRSA 2R7ZJ 1F1ZA 1FC3A 1O8JA 2JUGA 4RD6A 2QKMB 4BXXJ 1F5TA 1EH7A 1OJLA 4UZFA 1JTXA 2V1DA 1KMHA 2DOFA 3VNUA 4X6AJ 4MGRA 5IK2A 1DDGA 3S3NA 5DCFA 3HOTA 1S5LC 2ELHA 2FOWA 3GMEA 2XGEA 3MAJA 4R1HA 4XM3A 4ZYDA 1XTAA 1SEUA 9ANTA 2R6HA 3B82A 3C2BA 3ZSCA 2BVMA 4BBSJ 2JA7J 3CDHA 4CZCA 3CCVI 1H89C 2EFOA 1GQ8A 3TQNA 4FN5A 3K10A 1Y39A 4MO7A 4IXAA 1YO5C 3S1MJ 3K1PA 3W2EA 4ABZA 1RU4A 3MQ0A 3LSRA 4MR0A 4KKSA 2PLYA 4M4SA 3OZVA 4G1VA 1D3YA 2HS5A 3S2HJ 4B3XA 2K02A 3EYYA 2XAHA 3F6OA 4NUBA 4ACBA 2DK5A 1Q81D 5JLWA 1R49A 4OU0A 1HSJA 1O8GA 1CQTA 1RQPA 3S1QJ 2ODLA 4Y13A 2Y75A 2IS1A 1GT0C 4KN7X 2DA5A 2FRHA 2ZCWA 4E7LA 4M6XA 1E3HA 2QM3A 2HTSA 1GLNA 1PJ6A 2XRLA 1O8EA 1U9NA 5HLTA 1Q1VA 4JBAA 1N78A 1OFCX 3GVKA 1S6LA 2IGOA 2IGNA 4LITA 3D26A 4GQNA 1ETWA 3QPLA 1O8IA 1VI0A 1WP6A 3VSTA 2D5VA 4LB5A 3O2PE 2JPBA 1LE8B 5F0CA 1TNSA 2JVHA 4X0CA 1WMRA 1YQAA 2HDWA 1T95A 3K70C 1JKRC 3FK6A 3ROUA 3HOVJ 2DPUA 3M1EA 2HDDA 1ZREA 3DQVC 3FXKA 2HQ5A 4JP0A 2Z5UA 5L3GA 2STWA 4C9YA 3N4MA 2V26A 1V0EA 3CCJI 1H88C 1DABA 2W6JA 1Z3XA 3F3XA 1EH6A 1R5HA 4B09A 4I01A 1O3SA 3MZYA 1VQ4B 1FTTA 2DMPA 1AU7A 4RMNA 4PC3A 2Z16A 1QGPA 4BXFA 3ZQCA 1ZGAA 2K27A 5CVRA 5B1BH 4MQVA 4ZJZA 2JJ1A 5DS0A 3PFYA 3WTYC 3JRBA 1XG2A 1R22A 2ZMEC 2JMWA 4B43A 3I0TA 2XTWA 2WADA 4DJAA 2F4MB 3GFIA 4OMYA 2NTPA 4OJOA 3MKZA 3OYMA 3HKZA 4Z4WA 4OWRB 1G6NA 4CCKA 1WPKA 5DCMA 2NOGA 4XICA 1QX4A 1QRYA 1VQ5I 1YG2A 3HYIA 3GYHX 5JMCB 1L1IA 1LKXA 1R1TA 3OWTA 1VQ5B 1PJRA 2H09A 1YW9A 1GVDA 4YFOA 4ZH4F 1IJFA 3JURA 3DKYA 3H3ZA 3W5VA 1SMTA 4X7EA 1YITI 1QVTA 2VFQA 1P6RA 4NBQA 2P5KA 4XKWA 3ZIAA 1Z77A 2BN4A 3I5UA 1VQOB 2L4MA 1X0CA 1W5SA 1YRNB 5CVIA 1TQPA 2LLKA 2CU7A 3BDDA 2QVOA 3WBJA 1YITB 4U4BA 1P92A 4XOPA 1B1BA 5JHUA 1GVJA 3OS2A 3GIRA 5L3FA 1O88A 2BYVE 1YYVA 4D1QA 3L00A 1XE1A 3MMYB 3GQ9A 2MH9A 2L4AA 4RM2A 1YJWI 2OAZA 1S72I 2VXZA 1X3UA 4E6KG 2NVXJ 1BX0A 2VFPA 2IJLA 2CUFA 2E2JJ 1YJWB 2MYSA 4YZAA 3TBIA 1WHUA 1S72B 1SFKA 2DFEA 3CMEB 2W6IA 3F72A 1KU9A 1RKTA 2PBIA 4AVPA 2F1MA 2ECCA 3ZXSA 3CC7I 1SVMA 3A01A 1BOBA 1FNMA 1OFLA 3JTHA 4E70A 2DTZA 1K83J 3CP8A 4BQOA 1QZZA 4CHUA 1NRKA 1KA8A 5DM7F 5ILSA 4Q5SF 3CC7B 2BSPA 1DP7P 1BR1A 3HZJA 3TMOA 2IBDA 3K1NA 1X1DA 4MTDA 1YFHA 2VUMJ 4RD0A 1I6HJ 1NH3A 2C2WA 3WU1B 3VYUB 1R9TJ 2DYIA 3F8BA 2JJ7A 3HGGA 4PJNA 4F7ZA 3OYBA 2O0WA 2B0LA 5FFZA 1V5FA 2X9DA 1K6YA 1A8PA 3I56I 2IPQX 2CSOA 3PUNA 4M0LA 1JGSA 2GA2A 3DDYA 1FRNA 2AXTC 2ELKA 2R3SA 2X6OA 3B6CA 4XOTA 4IVNA 5LHGA 2JT1A 2Y48A 1U9OA 4BJ5C 5ICEA 3I56B 2WV0A 4ASNA 1O3RA 2X1CA 3E3VA 1EJ9A 2W57A 1VZ0A 3WTXC 4IQJA 5M5WJ 4LD5A 4OJ5A 1SD4A 2XGJA 1TL8A 1Z9CA 4XLNF 2G0YA 2M0CA 5FLXZ 2TDXA 3E6MA 1DDIA 3KEWA 2K85A 2G0EA 4F92B 3JU4A 2DA1A 2M1BA 1JNYA 1ON1A 2F48A 3A4CA 2YWHA 3ZMTA 1IDYA 2EJRA 3BR1A 2M87A 2N8GA 1OR7A 5ICGA 3CTAA 3DPUA 1X58A 2Q8KA 4Z1MA 3JTGA 3ABTA 1H0MA 5H6QA 3SZGA 1QFZA 3QRFF 4HRIA 1EZGA 2DW4A 1CGPA 4PGHA 1NG6A 5KVRA 1X3WB 2W00A 2JA8J 1N05A 3NWSA 4XSXF 4BJ6C 3WTUC 4C3IJ 2NS0A 2M5WA 4EM1A 4OZYA 1GHCA 2QUFA 2QZ8A 3VSLA 1MJBA 3WGIA 1N06A 3HIFA 3R0AA 4F52A 1OQYA 3FBNB 3HSEA 4TT3A 1USSA 1ZK8A 3SHFA 3OYCA 3Q6RA 2VB6A 4M3EA 2IXSA 1W87A 5HDGA 2HR3A 3LFKA 2R5ZA 2WYRA 2M8GX 5K7ZA 1P4XA 2VE9A 1QFJA 1TNTA 1T5EA 1M90D 1U0JA 1NB9A 4Y4RA 1XGSA 4HF1A 3SXYA 4LIUA 2L9RA 1ETYA 1QRCA 3JRHA 2IA1A 1QFYA 4GYIA 1T0FC 5IP9J 2C6YA 2UVEA 4A3GJ 2O0YA 1WSVA 2J7KA 2DCEA 4HQMA 1D5YA 3C7JA 3SEQA 5LMZA 3CJRB 5LD2C 3PUMA 4GFBA 4UUSB 4MYTA 4LIVA 4FK8A 2Q0OA 1SVOA 4RB3C 5HDKA 5GAHJ 1OYYA 3JR9A 2EFWA 1Y56A 4RPDA 2CQ7A 2WAFA 3BH4A 1NB0A 3H5RA 1J59A 1AA7A 2BGJA 4PSXA 4HNTA 4Y3OA 3ZR8X 4XL9A 5ED4A 2O0VA 1DP3A 3QPTA 1K4ZA 1IUFA 2ZJ2A 4G5GA 1G3TA 4A2UA 4A5NA 3CJTB 3ZQGA 4CSWA 4ZTFA 5E1XA 2LP0A 3ZCOA 1TWCJ 2DOEA 2O8XA 4KJZA 3ISXA 1VQPB 2KKOA 3BJ6A 3CDLA 2XZOA 4D0PA 2BMWA 2GJKA 1MRZA 1KQ5A 4HQEA 1YJ9I 1RI7A 1H9GA 5E18F 1PUEE 3ZGKA 4BEHA 4ETSA 4RB2C 2FE3A 1Q1HA 5LRSA 5M5YJ 1USTA 3DU5A 4Y17A 3E6BA 3PIPF 1ITYA 2LNBA 1YJ9B 2X0KA 4LFUA 3KP3A 4RAZA 1MJAA 1B72B 1RZ4A 2VNKA 2G7UA 2XASA 4U88A 2ESHA 1FX0A 1Z91A 1BA5A 1A6IA 5FO1A 3EUAA 4P9UA 4RD3A 1X1BA 3LSGA 2XC1A 2VN2A 3OSFA 1MBKA 4OINF 4I76A 2GZWA 2YUSA 3OMYA 5EGOA 4KMFA 5E8IA 1EF4A 3S16J 3JQRA 4X7DA 2BM5A 1D8JA 2EV5A 4MNUA 5M3FJ 1A31A 5DSZA 1ZAOA 2Y0MA 4G8XA 3CCRI 2ZTGA 3H5AA 2IP2A 3CCEB 2IQ7A 1POGA 2R9VA 1E0EA 2CUZA 5F64A 4EGYA 5LGNA 2OK7A 3Q3SA 3HJEA 1UD8A 3DF8A 2VBZA 1YLOA 2KDOA 3B8HA 3BPVA 2P8TA 3V4GA 1CZFA 5FD5A 5IT9K 3WTSC 2H8WA 3BCFA 4PFPA 5DS9A 2V4DA 1QU3A 3AVVA 1QQ1A 1T39A 1K8AD 3WG7H 2O9LA 2PJRA 4ZTJA 3I64A 1XS9A 2ZBVA 3AAFA 4J00A 3KP5A 1FBQA 1X2NA 3ERED 4QPQA 2FX0A 4C3JJ 3L2WA 1LJ9A 3ASSA 1Y0NA 5HKKA 2VODA 5DV5A 4HIZA 2ZXHA 5IOZA 4BY1J 2EB7A 1BW5A 1DGRM 2I10A 4UUTA 3GQ7A 2K86A 4HNVA 1MW7A 1SMYF 2EWEA 2DN0A 1WCMJ 1MH4A 3SLDA 4ZDLA 4K2EA 1N75A 3I59A 1PP8F 2BSAA 3JRIA 1VQ8B 1YHQB 4UB6C 1X1CA 4AWXB 1IAWA 4RDKA 3ASOH 2P7VB 3SJMA 2BM6A 1LPQA 2V79A 2J5PA 3KYDB 2OK8A 5L46A 4AYBA 5KSWB 2DA2A 2DI3A 2DIEA 2JVGA 1MNEA 3M1CA 4AIKA 4BDYA 4IHWA 5F1RA 4ESFA 5J8CA 2H1LA 3TL4X 2X85A 5CPRB 1WJEA 1MDMA 3FXOA 2K9NA 4WQMA 1X4OA 3VO2A 3PIOF 1ZARA 5L3EA 1Y0UA 1VQMI 1G3SA 1XSVA 4O5VA 5IYRA 4ZC3A 4UUVA 4KICA 5FGMA 4YCQA 4I09A 1A6QA 1UHMA 4N9HA 3FY3A 1WJCA 5B5EC 2DETA 1OLTA 2VI6A 1VQMB 3DPTA 4ITVA 1ACIA 4Z4UA 4P5OA 1MKMA 3BR5A 1H80A 5HS9A 4YELA 5A2QK 3LJYA 1G7TA 3A8KA 2VT2A 4CCOA 3OYDA 2OBPA 4HLXA 1FSEA 3ECHA 3JQQA 2ZSHB 2C5HA 4Z4ZA 3OOPA 4H9GA 1RKWA 2EFQA 2FUG2 4PC7A 4L9TA 5FD6A 4IOAF 5F08A 2L7MP 3Q9SA 4TMWA 4XLCA 3LOCA 1JUSA 4MQ9F 3TO9A 1RIOH 2QEXB 1FYMA 1JHHA 4G9YA 2BVLA 3H1CA 4OMZA 3DKWA 3I71A 3J7AY 2HVRA 2Y30A 2KIMA 2L0KA 3QOEA 4I2OA 1X1AA 2XUBA 2NNYA 3K4KA 3M4OJ 2VBUA 4Y52J 2X3UA 2QBYB 3BPXA 4LLLA 3SZEA 1OPCA 1RPWA 3F23A 1REPC 4BQNA 1XCVA 2CO5A 3GTPJ 1KK2A 1YX2A 3GQ8A 4KH3A 3UR3C 1I18A 4BY7J 4S05A 4JRAC 4NK6A 1WQ2A 4QLCU 3AVTA 1AKHB 1FNBA 2V7XA 3Q9VA 2IVMA 2L2OA 1JTAA 2EWNA 3ABKH 5HOOA 1B9NA 4HDVA 1JKOC 1VQLI 1Q9SA 1LFPA 3H9QA 4BGDA 2VKDA 1CF7B 4LK1F 3RKWA 4X7FA 1KQSB 2FQ3A 3H9GA 4ESJA 1VQLB 1GV2A 2CJJA 1RETA 3TOBA 1NG7A 2Y9YA 1LE8A 1GAWA 4TKOB 3VODA 1IXSB 2O03A 3VOEA 1EE6A 2R7VA 2XSDC 3B4NA 3V76A 4KIBA 3E7LA 1P7JA 1GXPA 2DJNA 1VQNI 1MMSA 1WH7A 5BOXA 2V7VA 1TP4A 1FRQA 2MABA 4PJLA 2IRFG 3BC9A 1Q7YD 2NAZA 1EP2B 1VQNB 2ESNA 1SFEA 3MKWB 2R92J 2RVCA 3QP6A 3LQEA 2E1NA 4G6DA 2O5RA 1HF0A 3JRDA 3CO7C 1COWA 3SZTA 1R71A 4DBQA 3J81k 1KCDA 5DEQA 5A88A 4FXUA 1PDNC 4GGGA 2ZL6A 5HZAA 5CVUA 4BH9A 4EEFG 2DDAA 1BI3A 3OYEA 2HQAA 1UD2A 4KYWA 2XT4A 3ZZTA 4A3LJ 2Z6BD 4I7HA 3BCDA 2PECA 4NK8A 3OS1A 1JA0A 4L0YB 5K5RA 3VR6A 2R93J 4H0EA 1ZG5A 4JX4A 5JLXA 3IL2A 3A2KA 5JHFA 2LG4A 3G2BA 3S93A 1TQIA 3V42A 4FCYA 2CBXA 3RKXA 4DNRB 5CQEA 1O3TA 1HVXA 3ISPA 4V2FA 2R7RA 1OCTC 1YRNA 3HOXJ 1OR7C 3HG9A 1SFOJ 1ETQA 1PUFB 4YXWA 3OYFA 2HYGD 1DQUA 2L9SA 2H27A 3GTQJ 1AIPA 1TVCA 2QX3A 3DEWA 5EEGA 3VB2A 4FETA 2EIJH 3K4CA 1UG2A 3PNTA 4IRIA 4KITB 1EXMA 2M5SA 1J09A 3E20A 5HODA 2DQRA 3PSZA 3C2HA 3DXJF 3PENA 1MGTA 2LVSA 5AIPA 3FHZA 4XLPF 2LY1A 2GA1A 4LK0F 4OPSA 1HXDA 4Q4ZF 2ZO4A 4IHVA 1EP1B 3BH7B 3WU2C 3ZQFA 2NS8A 3AVUA 2CH0A 3PO2J 5M5XJ 1LDJA 2WY8Q 2VNHA 1ZELA 1OMIA 1E3XA 3BR6A 5LEJA 2OF7A 3WWGA 1FIPA 3BTCA 2XAQA 3RTRA 2JA6J 1BC8C 3HB9A 1HW1A 2LF8A 4ZCMA 4II2A 2AQEA 5L3DA 4BQQA 1W1WE 4PJMA 3QOPA 1EWYA 5BSXA 3GEZA 2DMNA 2CK3A 4QUZA 3GLXA 2DA4A 1U8RA 3LNNA 4D9JA 1H8HA 2DODA 2XNJA 3E5XA 1FTZA 1JKQC 2M0MA 5IP6A 1I39A 2NS7A 2VE8A 3GCMA 2M2EA 3SJZA 4W1UA 3GFJA 3LQ6A 3K4JA 3W2VA 3G05A 2PMHA 2OCCH 2Q1ZB 2GQQA 4HX4A 1T2KA 2GBYA 1H42A 1T0FA 2YS9A 5F6FA 1XMAA 2CW8A 4MFDA 1OB2A 1S7OA 1ONVA 2C4TA 3BNWA 3A0HC 3Q5FA 4DBRA 3D1NI 2FXAA 1X2MA 3WNDA 1P4WA 2Q2EA 2ZFUA 3TO7A 1W5CC 2L54A 2PE3A 4IHYA 4DYRA 1U5TB 2CMPA 4N0BA 4F3QA 1PKVA 2KVOA 1O8DA 2WWYA 1ETKA 1UHWA 2FOKA 2RN7A 3O8GA 1XDUA 3F0CA 3SFIA 5A2QZ 4AF6A 3K69A 1XMXA 3VMFA 5HNHA 1HKQA 4N4OB 3IRQA 3HC7A 2EZLA 2KISA 1UMQA 1SKYB 1ZRCA 2AHOA 4AF7A 4HBLA 4RD1A 4UVBA 2C4UA 4CYCA 3T56B 1EFCA 2VBKA 3OS0A 1EFRA 2BV3A 2M4GA 1FPQA 4G7WA 3P4GA 3A1YA 3JX8A 4XLEA 3WQZA 2Y0SA 1U2WA 2YWGA 1R4NB 2LYCA 2LBFB 3ZPLA 2CGPA 2VKHA 2GXGA 3PVDA 2R4GA 1QJVA 2W24A 3CCQB 3RYRA 1W7PA 4BQAA 4EQQA 2I8DA 2JZYA 2FD5A 2LY9A 4A12A 2OYNA 1QHHD 3QPSA 1FY7A 1R1VA 2DTRA 3FKIJ 1ZH5A 3QFSA 2CQXA 3SYJA 1VTNC 1KK0A 3R6JA 4HDUA 3RIRA 1ZR4A 4YZ0A 2CW0F 2X48A 4QSHA 1HZEA 2B5OA 3HGYA 1U78A 2DXIA 3KP2A 2EZKA 4BNCA 2XEXA 2E60A 4KKUA 4YAUA 1GXQA 2MC4A 2WR8A 5FO5A 1TYVA 2BY1A 3DLLF 5KW9A 2QMUA 4UUSA 1U5TC 5CVJA 1OISA 5ICFA 3ZQQA 1IC8A 2W25A 3B8YA 4M2LA 2Z8GA 4IKFA 4G6QA 5J1YA 2AXLA 4IO9F 3I53A 3KE2A 5GP9A 4GCVA 4DYQA 2E35A 1WSUA 4P3IA 2XF7A 2VBMA 1Y1WJ 1IO2A 2ZXIA 4BKXA 2QN6A 2IS6A 1GDTA 2ZFWA 1X4PA 1W9XA 4YAFA 4Y7CA 1KZHA 4XRMA 2BXYA 1E1QA 1FJLA 1ELOA 1NDHA 4OOVA 2KRCA 4HF2A 4XQFA 4N3NA 1DPRA 2V6EA 2HGCA 2C78A 3MKLA 2LZJA 2FVGA 3SKBA 4Z4YA 1ERDA 3CCVB 3CLQA 2E1MC 2DO7A 2QSFX 5FRNA 5CLSA 1H9TA 4XKVA 5FFXA 3BG5A 1OGJA 3OSGA 4B1RA 1P7IA 4LBVA 1RRJA 2MSYA 2VFMA 3A35A 3PA1A 3GO5A 1WI9A 3LSHA 3AL0B 4X05A 4DK0A 3CXCB 2GLOA 2OCEA 2DY1A 3BG6A 4BJTA 4C2MJ 4XN3A 4M74A 3F6VA 3FXQA 4WK8F 1QA1A 2O6GE 4Z05A 2VC1A 1MBHA 1J9ZA 3ONUA 2CW7A 2WA0A 4HE6A 3WBKA 3MCZA 1GAQA 1EA3A 2K7LA 1OB5A 2FBKA 3IC7A 2DJIA 2BVNA 3DWLE 3EQOA 3CCYA 2NNNA 2XAGA 1HSTA 4KMUX 2BZTA 3F8NA 1DUXC 1S0UA 2Y0SN 2BY3A 2HOEA 4BYYA 3QODA 3MZ8A 4B47A 2OZUA 4AIDA 4ZZDA 3ZMDA 1NK2P 4C2TA 2K4JA 1T6YA 5J8FA 2A3SA 5B1AH 2JA5J 2KZGA 3RZDJ 2X1DA 2R7XA 1FBUA 4KT5C 4UV9A 2D1VA 3VNVA 2R5YA 2O04A 3R0JA 3CCJB 4WX9A 3PO3J 2XT2A 2X6XA 2E7WA 2HEOA 4K1XA 1U8BA 1IW7F 4KUMA 5F04A 5D8KB 3GQBA 4URRA 3WTVC 1QA2A 2A68F 1R23A 4XR6A 4J01A 4Z2YA 1QNTA 3GTOJ 1MNDA 1FLIA 2A6EF 1MABA 1LB2A 3TW7A 3ZPNA 3DCFA 5HXBA 1R5NA 2KLOA 1A5JA 4NC6A 2P81A 2GPJA 2ADUA 1CNFA 2LDUA 1B9MA 1O8HA 4E0FA 4O3MA 3FIWA 4QIWN 1I1GA 1WORA 2PQ8A 3DTIA 4U7DA 3H36A 4OPOA 1Z05A 1ZR2A 2VQGA 3K2AA 4KIGA 4A3DJ 4QTRA 2LR8A 4ON0A 3U9GA 1VQKI 3ZMZA 1BR2A 3H0DA 2ZJQF 2NVTJ 1WJAA 2M7BA 1RQRA 1K78B 3GWZA 1HLVA 4CUGA 2YX4A 3KIOA 3AKZA 1VQKB 3OL4A 3IH4A 2STTA 3FJOA 2NPFA 1TBXA 3I54A 4Y15A 2OZ6A 3KEOA 3DBLB 3ECOA 4C2UA 3F8FA 4Z03A 3TP0A 4RGXA 2V7WA 3GVJA 3I3LA 2K9LA 4YEIA 2HI3A 1YS6A 3FF5A 2BX6A 1TT5B 3U2QA 4BDZA 2L5QA 2XVCA 2QKLB 3HRTA 3HXLA 4PGGA 3H3VK 4QHYA 4NQWB 5E3NA 2QA4I 2VPLA 1TQMA 5C44J 3PSSA 2EFGA 1O8KA 2CRGA 1KGSA 1ZG3A 1BR4A 4HX8A 2KDZA 5B6IA 2X53S 5BNGA 1UHSA 1VBLA 2QA4B 3TH0A 4J0QA 1SD5A 1MBFA 1P2FA 1W5TA 4RAFA 2ZZEA 1WJ5A 1IN8A 1FOWA 5LEKA 1KCCA 4P6YA 1BIAA 2MA3A 1JE8A 2GJRA 2KP6A 3W2AA 3CPXA 4C2LA 2EIMH 2ZNYA 2HOTA 4I0BA 3TOAA 1BBYA 3L2QA 1V0FA 1IB4A 5EG0A 3ASPA 1F60A 2GAUA 3N6ZA 2COMA 2WJYA 1LLZA 4PJJA 3FMRA 3PNVA 1MZBA 4OJ6A 1F20A 1UCRA 3K7AJ 4D5CA 2HCJB 1BI0A 2FEZA 2HYFA 2J8IA 1O8MA 5C3EJ 3ML3A 1HKSA 2LREA 2M8EA 3LSPA 1AKHA 2A69F 2TCTA 3LSTA 4YIRX 2RKHA 2IW5A 1YS7A 2VBSA 1FNCA 3V7CA 4A0YA 2FNPA 1SAXA 3W5HA 5F0HA 2NXNB 3JAMZ 4X0GA 2A6TA 2E36A 2L7FP 3FDYA 3GZNB 4A3JJ 3T5XA 2QGGA 4Y9RA 1VQ6I 1E3PA 4G7ZF 2PFBA 5LLQA 2JA2A 3DTKA 1NBMA 2NV4A 1J0RA 1IV8A 3M8FA 4LG0B 4RM0A 1ZYRF 1SFUA 3OP1A 3WNBA 3ZMVA 2Z9OA 1YW8A 1TLHB 4RS8A 3WG9A 3ZRGA 5JVGF 1VQ6B 2ECBA 2V31A 5TR9A 2XAFA 4O6JA 1TYWA 3WTWC 2NRAC 3SUCA 2G9WA 2Y31A 1D2EA 3N05A 5KHDA 3K9TA 2KFDA 1KQ9A 2PIAA 4U7BA 4TN1A 4YALA 4XIDA 4KFCA 1IHMA 3DV8A 2W82A 3LO8A 3KP4A 2V9VA 3KX2A 5FA6A 2KRFA 3OJXA 1R5OA 4PC6A 4YAWA 2VL8A 1QPIA 1MMDA 3RPUD 1QBJA 3I4NJ 2XROA 2BW3B 3ABUA 1XB4A 4WZKA 4PSWA 4YFNF 1E17A 4GO1A 1OOCA 4YEJA 1STZA 4Y33A 3LAJA 5K5OA 4OJPA 1TWHJ 4U0VA 3WNCA 1IJWC 2KJCA 4S04A 1IGNA 4WWCA 1JJ6C 3OJWA 3SQVA 4MYUA 3W2HA 1QCXA 3BCBA 1IDZA 5LHHA 2P3MA 5FKOA 3O6BB 3KETA 1W35A 1JJ2B 4PUSA 2VT3A 3TDUC 1G8XA 5GV8A 1KRHA 4A69C 1UMKA 4P1VA 3GZ6A 3D0SA 3HRUA 1WVRA 2IA0A 1J75A 3W5UA 2ME0A 3OAAA 3REOA 2LOOA 3EUHC 3FKSA 3CC2I 5L3BA 5EZHA 4OPVA 3M9AA 3Q0WA 2F4NA 1K28D 3IP4B 3OOCA 4ZCIA 1D1NA 2F5VA 1S9HA 2FA5A 1PUFA 2CQNA 2TRTA 1PE9A 2WSSA 5FLMJ 5THXA 1KK3A 2ZZGA 2WAQN 1NTCA 2BY2A 2QDXA 4BHPA 2JN6A 2EV0A 2XAUA 2YX7A 4RGSA 1BN8A 3A8JA 5CYVA 3A3BA 4LBYA 2EK5A 1KYWA 2KMUA 3OE7A 3CMMA 1J5YA 4IPAA 2CS3A 3HUGB 3V7AA 2QQ8A 4I98B 4KNYA 1QVFB 2ISYA 3BQZA 3LA7A 1WI3A 5D6FA 2NTBA 3AVYA 1IUYA 4ZYHA 1Y8QB 3RCOA 1XGNA 1YLFA 3C1DA 4A3CJ 4UNOA 3K4LA 2CV1A 3S15J 2PN6A 4FT8A 2WB1N 3OYIA 2PYHA 1T08B 1UD6A 1R5BA 3CUQB 3W2FA 3GFLA 3GBGA 3N90A 4Q7JB 1VFCA 3PETA 3SFZA 2QY1A 4EJTA 2DA3A 3QE2A 4LC0A 4UAJA 4B44A 1J9IA 1UG0A 3K4BA 4ZGNB 1JHFA 2COBA 4HE5A 1E79A 3F21A 2RV8A 3VPRA 3GUDA 5DDGA 2LF7A 1JUMA 2BE5F 3FM5A 1MH3A 1P4AA 2K3PA 4ZYGA 2W48A 2HQNA 1G7SA 6PAXA 3ZQ7A 4NB5A 4XONA 1FMWA 3AGPA 2DT7B 2EA2A 2E34A 4PDKA 1QZEA 4XRSG 3G1OA 2I1LA 1BIBA 3ELKA 5D5XB 2XPUA 3S1NJ 2INVA 4UHTA 1ETVA 4MLOA 3CCRB 2KQRA 5LGUA 1E2XA 1V3FA 5DN6A 5H6RA 2MC3A 4I6ZA 1OFDA 2D3NA 4NCNA 5IYDJ 4ROXA 2XNDA 1CLWA 2M7AA 2FF4A 1U5TA 1S29A 3FXUA 5H20A 1VLOA 2VQCA 2VBEA 2M30A 3JRFA 1LFUP 3KZZA 1BMFA 2YU9J 5J1RA 4RAGA 4ASUA 3DKXA 2VOOA 2JTVA 5CVVA 1Y0RA 4QPOA 3M8EA 3ZN0A 2VQLA 3GTGJ 3OEHA 1HKTA 2RQPA 2FSWA 1M1KD 2VONA 4IW3B 4RD4A 3W2IA 1RWRA 2DK8A 2F2EA 4XKBA 5F4JA 4CICA 4TMZA 4MEXF 2VYQA 1TTTA 4A3IJ 1KJZA 3FHNA 3QU6A 4HV5A 2D9RA 1QVGB 1LEBA 3BROA 3F8CA 2XGXA 2R7SA 3ASRA 1ZQ3P 2JN9A 2EIKH 4CO8A 4ANJA 4BE0A 3GLLA 1RESA 2V4JC 1XD7A 3CJNA 3PQKA 1VF9A 1BI2A 2KZVA 5C4XJ 3JW4A 2YR2A 3IKVA 2RGVA 3BQYA 4G1BA 5JR3A 1E62A 5HLHA 3W6KB 1LM1A 1ZKGA 5KNLA 2Y2ZA 4P2NA 3JRCA 5CKTA 5K5QA 1B8IA 1H85A 4C3HJ 4WXCA 3QP5A 3BCAA 3T0YA 3OFNA 1JA1A 1ZLJA 2HZDA 3ASNH 2RNJA 3V7SA 2JIZA 1ZHFA 1AOYA 2VKEA 1IN5A 1JT0A 1GO2A 1IB0A 2V1NA 3C18A 4OAYA 3BTLA 1IN6A 4BHCA 1VJSA 3OYNA 3CPWB 4L18B 1WXRA 4FTHA 4AUXA 1V55H 1H8AC 3DLAA 3RJPA 2OD5A 1W0TA 2G7HA 3MD2A 2LKXA 3HRMA 1ZG1A 3Q3AA 4FE7A 3ZC3A 4FWTA 1VQ9I 1QA6A 1IV6A 1TSPA 4IL6C 3J7ZI 2GM4A 5JLVC 4P26A 3E0JB 2P7CB 1L0OC 2K9QA 5FO0A 3SLNA 4NC7A 1F9NA 2XOKA 1VQ9B 4OAZA 4P1WA 3T8RA 4XORA 4C0SA 1Z0XA 1U6GA 3WTTC 5AONA 4ENKA 4LBWA 4ZCLA 2PEXA 3ULQB 2A5YB 1WRJA 2OUMA 1VLYA 4FX0A 4IZZA 3LVBA 1B59A 4F7DA 3BJAA 1HCRA 1FSHA 2XHKA 3MHPA 2JSPA 2GK6A 3A01B 4Z4RA 3CF2A 2L02A 4ZV4A 2M9HA 1JTYA 2QLZA 2HDNB 3P9KA 3L2UA 4FHTA 1KTWA 1ETXA 3KEQA 3NRVA 3ASQA 5E8GA 3AGQA 3KRGA 4IHSA 3D5SC 2H8RA 1WJDA 2QQBA 2AO9A 4L5IA 4B3AA 1G2HA 2VBYA 3G1LA 4CCLA 2NT6A 3H92A 3DEEA 2QSGX 2E2HJ 1T6SA 2IAIA 1WSRA 4U49A 3NEUA 1XDSA 4LMYA 1YOVB 4D7NA 2IT0A 3OZUA 2DMUA 1WTHD 3A8IA 4XLFA 5C1EA 1DGWY 1FYKA 3VMVA 2R7WA 1HA8A 4ACAA 1S3JA 4WXHA 3RPQA 1LNWA 3IAS2 2AHQA 1BI1A 4TV7A 2O61A 3UNGC 1HW2A 1WJBA 1ENHA 5E1ZB 2DQLA 5IYBJ 2IEKA 3B78A 4ZGQB 2EH3A 1XN7A 4HOBA 4RLFA 3HSFA 3P9IA 3V8KA 3F8MA 3V7RA 2DA6A 3ZMUA 2PMZN 1KU3A 4KIFA 2WZNA 2OV7A 4MFEA 4A3MJ 4DZPA 3IH2A 1D0XA 3DEUA 3I58A 1FYLA 4OOSA 5TJJA 2JDIA 3QYEA 5GPCA 5FRMA 4G7OF 4CCNA 3VYTB 4RPBA 4M9XA 2ZL7A 1XG1A 2XAJA 4X7CA 1I5ZA 5J4YA 3P5JA 1OB0A 2K4BA 4D5FA 4I02A 1PVEA 2Q6OA 5GTHC 1D1CA 1FEXA 3PQJA 2D2WA 4HZFA 2IS2A 2E2IJ 1K6OA 2D3LA 4AD9A 3HPGA 2MFZA 1IRZA 5D5UB 1QVUA 2R7FA 1WFXA 5LGTA 1IRXA 2CFOA 2KIFA 3J80K 3UKGA 4EMSA 4CXFA 3SEJA 4M71A 1UD4A 1O7LA 1FWZA 4ESBA 1C0WA 4FISA 3SDBA 2V9PA 3E6DA 3KL9A 5IY5H 3M8JA 4YZXA 2ACJA 3IV5A 2DA7A 3LL7A 4TMXA 4JK1X 4X1EA 4P22A 5E79C 1K78A 1O4XA 3U21A 4WZLA 4RB0A 2ISZA 3WYAA 5HZBA 4HSTA 1QGZA 1W0JA 2KPMA 2DOAA 2AS5F 1IN7A 1UFMA 3ML6A 3NARA 1D0ZA 2OPTA 4U0WA 2QCOA 4YDTA 1U3EM 2FNAA 3GFMA 3AG1H 5E20A 4CCMA 5IT9Z 1S8NA 3G3ZA 1IXCA 3MMPA 2P6TA 3KPHA 2HKXA 3J7YJ 4DQKA 4NQWA 2OTLI 4U0YA 3O3KA 2W85A 3BWGA 3PUFA 4GDFA 4IOCF 4P25A 2OTLB 5TV2A 4QFMA 1FOYA 3FZVA 4G12A 5F4OA 3PJRA 3CESA 4LJZF 4UVCA 4QV2A 4IHXA 3GRHA 2W4SA 2JRMA 2H1KA 5F1JA 3QYBA 2J5OA 2KRHA 1XGMA 2XZLA 3CUOA 3L2RA 3S32A 4HV6A 2O1DA 2H94A 4X8IA 1V5GA 1ZRFA 5LBQA 1QUEA 1ZLKA 1TWFJ 2QENA 4UXNA 4P9SA 4BEHB 1CNEA 1BC7C 3NWTA 1LVAA 4CH7A 3S3OA 5H59A 2X1EA 4RCYA 5GV7A 1ORKA 3LMWA 4YC5A 2HQRA 1NJID 2O7OA 3GVLA 3FKJA 3SEZA 1WOPA 2VKVA 2DYRH 3NQOA 2V5IA 4OIRF 1T56A 1JXSA 1YIOA 3I4MJ 1IXRC 1LDKB 5BPDA 4F93B 1JKPC 3M3YJ 3EYIA 4X07A 3BZCA 2WZPP 3HM5A 3EUHA 3VYRB 4WZEA 4HYEA 5FKKA 5EGOB 2CW5A 4EATA 2HWVA 2D45A 2LD5A 1TW2A 4F91B 2X51A 4L5JA 4M9ZA 4B48A 2QE7A 3WE2A 2DEUA 2ICWG 5EYRA 1FDRA 4P96A 4KA4A 2A07F 2QYUA 4UV8A 3SDGA 1G7CA 3FMQA 2XC7A 2MD5A 5KAIC 4IQ4A 1OCZH 5TRDA 1TUIA 2NOJB 1D8TA 4WZTA 4B3FX 1JT6A 1HOMA 2QWWA 3G1MA 2IGMA 1D8KA 2E5NA 3E5QA 4MIMA 4BHBA 5DUIA 2VQHA 1ULYA 3R60A 2IOUG 5L3CA 2BM0A 4RDLA 1XGOA 3OR1C 5J6XA 2EIXA 2PJRB 3SJPA 4FQGA 4P6VF 4BE2A 2K9SA 2ZXJA 2CC2A 2Q6KA 2HXIA 4BUPA 4I84A 3LWFA 2XB5A 4DNTB 1BLIA 5IT3A 2W7ZA 1ZRDA 4PGOA 3WY9A 1K4TA 3BTJA 4G94A 1OGOX 5KK1A 3BR0A 1TYUA 1YI2I 1D1BA 2ZC2A 3OYHA 2CV2A 1XC5A 4OJLA 4XLHA 2ETHA 2FMLA 3QWLA 3TW6A 1GR1A 4W8RA 1GUUA 2DCUA 3ZBTA 1EP3B 4UVAA 1YI2B 1HG8A 3FBIB 2E1OA 3I59B 3W2GA 2Q6IA 4S0HB 1QGAA 2OC6A 1SVLA 4M6VA 1RNLA 1T6ZA 2F1LA 3QQAA 3GZ5A 2V9KA 4LGWA 4EM2A 3CRZA 3AG3H 3OIOA 4PC2A 3OV8A 4A3FJ 2NT9A 1BQEA 3U1DA 1JGGA 1MSEC 3I1FA 1Z6TA 5DYMA 5FJ8J 2GK7A 4CQJA 1ZTRA 3V8JA 2A6HF 3S2WA 1MDMB 3S14J 5EEHA 4RD2A 2L7KA 3ABMH 5CDFA 4BXUA 2MLKA 3MVPA 1OKRA 4AIJA 1VQ7I 1GJRA 1QGYA 2GOXB 1EFUA 3JSPA 1X1PA 3HUGA 3F22A 2OU2A 4HAMA 4IEJA 3GTMJ 4HA8A 4Q48A 3GSIA 2BM7A 1DARA 3IUOA 3QFTA 2XDVA 1FOKA 5IYNA 1JRGA 1WWXA 1E63A 3P7NA 2OQGA 3IH3A 4JX5A 3BP8A 4Y7NJ 2EZIA 2E1CA 1WGXA 3GVAA 5CQGA 2Q6LA 2ZKZA 3SY2A 2AQFA 3NE5B 5J47A 3CUQA 4NNJA 3T9GA 3ZPPA 2YWEA 3BG7A 4W8TA 2E5ZA 2GIVA 4OOIA 5ICCA 3HOZJ 2V1UA 4M1KA 4GRIA 4J19A 1B72A 3W6JB 1BPLA 1RUNA 3CQZJ 3VMWA 5FIUA 1Q86D 3RZOJ 4MHGA 5IP7J 1FBSA 1KQ0A 3OOUA 3D5LA 4U9UA 5K7FA 4E7ZA 3QU3A 1D5VA 1W36D 3J80Z 3H9NA 3LA3A 4QVAA 1FP2A 2BEOA 2NYXA 3HOWJ 2X8KA 1KK1A 4U87A 4DNCA 1P9QC 4C30A 1FOXA 5C4JJ 2ZMEB 2QQ9A 2XF6A 4NDLA 4E7HA 5E17F 2VBTA 2DDBA 4BL0B 3ZN1A 3FK7A 3KYLA 3JRGA 2E1BA 2HXOA 1HA3A 1OCPA 3W2WA 4JOMA 1XSXA 1HDPA 1A04A 4LB6B 3Q39A 4MEYF 3GTJJ 4UZEA 4OM9A 1V4RA 3BR3A 2L01A 4YAOA 3V8LA 5F0FA 5GPAA 4ZDPA 2LKSA 3K6GA 1YX5A 2C5BA 2F5EA 3EETA 3LMMA 4CZZA 5TISC 3WGGA 3MKYB 3BY1A 1B23P 5D4RA 1HQCA 2P4WA 2CUJA 4PABA 1AMOA 3RQ4A 4FX4A 2BOLA 3GXOA 1IDKA 1KONA 3U2RA 3QSYA 4A3EJ 1Y0YA 1TLLA 4WF2A 3AL0C 2EBIA 3BG3A 4E4HA 2HLDA 1QQIA 3CCUI 4E7SA 1VQ4I 4M9SA 3JREA 3KLOA 3LA2A 3FMSA 2L9VA 2O8KA 1KD1D 3I4PA 2KHMA 5JFRA 1ZGWA 3S2DJ 2YSRA 2RDPA 5TGTA 1N0UA 3CCUB 1R00A 3QAHA 5FROA 4R79A 2Z33A 1FNDA 1OGIA 1QRBA 2ZZFA 1WH5A 2LMDA 3H35A 3CZ6A 2EPFA 2BY0A 2QQAA 5ERIA 4AC0A 2R7OA 1FZPB 2OBRA 4BPRA 3O8HA 4BS9A 1P4MA 1IA5A 2LK2A 2E1RA 5D8LB 1W0KA 3E5UA 2QZAA 2CYYA 3HL2A 4G6IA 5AIQA 2HZTA 4IHTA 4BU2A 5TY0A 1JUPA 1Z6RA 1FNNA 2VFNA 1DBGA 1BM9A 3OYAA 2P5VA 2H6CA 2PG4A 1QO0D 1YJNI 1UELB 2B7CA 2W84A 3L7WA 1K9MD 2EFPA 2F5CA 2HNHA 3L2CA 1VF7A 1VQOI 2EV6A 3JQPA 2E19A 1FP1D 2ZZQA 3EUKL 2W7NA 1MBJA 1T38A 1GVHA 1YJNB 4AU7A 2V1XA 5E1WA 3MZHA 2GJPA 4RLQA 4DYCA 3GX4X 3K4NA 3WODF 1RUOA 2VZLA 3OL3A 2DLLA 2XKOA 1IRGA 3QFRA 2CRVA 1E3ZA 2FX3A 4HX7A 1V5EA 2BHZA 3FXLA 3WXMA 3BJOA 2QGUA 4XLAA 2O17A 2C77A 2HYJA 1O3QA 3EDPA 5JBQA 2P5LC 2JJ2A 2ZB9A 3CMEI 3P27A 5DTDA 5EZGA 3KZYA 1K73D 4HLYA 4WCGA 5IYPA 1EV7A 3E1SA 3K1MA 4B8XA 3G73A 2VBWA 2WAQA 3Q38A 5FKLA 2HDCA 1AHDP 3CLOA 3S1RJ 1UB9A 3ESWB 4LG3A 2CNDA 3VSUA 1I50J 2GIZA 3PL8A 3T8TA 2J8KA 1MJ9A 1Z1DA 2CG4A 2QBYA 5IYCJ 1QH0A 1FT9A 2YWFA 2YUHA 5FNZA 2JRTA 4OIOF 4RA2A 3SYTA 3H09A 1ZM4A 4OZZA 3CD6I 2NVUB 2X6WA 2XPVA 3ABLH 5B66C 4YRVA 1N77A 2VBVA 2GXAA 3W6VA 3A3GA 2HVQA 1ON2A 3EPZA 2OA4A 3W3CA 1KU7A 3LQQA 3VSVA 3CD6B 3CC4I 2WB1A 3TEDA 1CF7A 3QYFA 2Z3YA 2RC6A 2DPDA 1R36A 2HPMA 2UUZA 4LLNA 1I7PA 1F43A 3MCAA 2CQKA 1ZUNB 3H5NA 2R7TA 3CC4B 3G4SI 4M73A 1OCRH 2LSOA 4PMHA 5F4MA 1N07A 4E7IA 1LVKA 1K79A 1SD6A 3KP7A 3JSOA 1VHOA 2HMAA 1I8DA 4RGRA 4RLZA 3T51B 5ILUA 2UXXA 1NK3P 4B3GA 2VJJA 3ASTA 3G4SB 5FKMA 2VLAA 2MLGA 4P55A 3ZQLA 2XGDA 4DGWB 1LUJB 3LNQA 5J35A 3RDIA 2B9SA 2PJPA 2R7UA 2MD0A 2EILH 2GQFA 3ONYA 3OKXA 4PAAA 2F5FA 1SC7A 2X4HA 4BACA 5FB2A 2K5CA 1O8LA 3HKZN 4ENJA 1KTVA 1HW5A 2B63J 4XRFA 1TW3A 2Q2EB 3A02A 3IAM2 3H94A 3Q6QA 1HDDC 3WU0A 1K4SA 2UWMA 5HDNA 3I55I 2A5WA 2V6CA 2XPWA 4Z4TA 3SZPA 3RQIA 3HPHA 2F3LA 3RI4A 5A89A 3L09A 4DW6A 1AIRA 3I55B 5J40A 3BY2A 2UZKA 1YW7A 2B7EA 4EJWA 4RDJA 4B4CA 5HLGA 4XSZF 3LSIA 2CWEA 3N97A 4XRSA 3ZP5A 1CQXA 1G3YA 1B6AA 4CYCB 3RKYA 1YTYA 2XTXA 1GV5A 3BZ6A 5HNFA 3AG2H 1N25A 4A0XA 2MGQA 5D4SA 5LFAA 2IGKA 2ZJPF 3B73A 5HLIA 1XPXA 4Y9UA 3RSNA 3OY9A 1R6RA 2NSTA 1ZN2A 5BMZA 5J3LA 1U2RA 3IWFA 1OYWA 3CMAI 3DU6A 1BJAA 4I0AA 1W7PB 3ZQIA 4UY8I 1T6XA 2INUA 2VJ5A 3BZKA 1T8IA 2X3HA 1OYIA 4TMTA 2VJIA 5J1UA 2DMQA 4II3A 4N4NB 4EGZA 3CMAB 1Z7UA 3CC2B 1Z21A 1DPUA 3OPOA 1R1UA 4XN0A 3VSKA 1UJ8A 1S4MA 3K70D 2LY2A 1TTYA 2VNIA 3ZBUA 5LRRA 4V02C 4GXOA 3VDXA 4EM0B 3G71I 1JB9A 1DU0A 4L9NA 4R8HA 2XGCA 3C3WA 4W97A 1R4MB 1I1SA 5DNSA 2GXBA 1VNDA 1R5GA 3H3UA 2CF4A 5IOYA 4DOZA 2HU9A 3G71B 1X19A 2WC2A 2XSJC 3M7GA 2R7DA 3E1YE 1O8FA 4RDUA 5BPIA 3WE3A 1S7AA 1TWGJ 2DT5A 2XNCA 3R6KA 2OJED 3ZZUA 3HOUJ 4NBSA 4A93J 4Z6YA 2VBXA 4P9FA 1VQPI 3FPKA 3DP7A 3IKTA 3HTSB 2R0QC 4E7JA 3U6KA 2RC5A 5FKNA 2YU3A 3L2VA 1H8EA 4OP7A 3VO1A 1ZM2A 5IYWA 2O6WA 4QWQA 1ZM3A 4HWVA 1BL0A 5KCMA 1KU2A 2LRDA 2ELJA 2VJ4A 4MTEA 1OGMX 5BS6A 2QYOA 2BM1A 2PMUA 3B90A 4KT6A 2JPCA 3DFGA 3KLNA 4A6EA 1QUFA 2X0LA 2JSCA 3BOQA 4M6YA 4DQ2A 2MG4A 1NHAA 3B02A 5J4VA 2A05A 5D5WB 2QSHX 4WWVA 2ZNZA 4M3GA 4M3DA 1K61A 2PLFA 2XKPA 1SAUA 5FL7A 3TDZC 5GADJ 1RR8C 3MWMA 1AWCA 1B4AA 1IN4A 1W4MA 1QHGA 2XRNA 1K7AA 1TC3C 1WJFA 1OFMA 4JX6A 2F5DA 2OQRA 3KEYA 4DZJA 4DK1A 3Q0UA 2BGIA 3CCSI 2PYGA 2HTJA 2DU9A 1Y6IA 3WHBA 1L3LA 2XF5A 1DDNA 2ZJRF 4ZYEA 3CUQC 3CCSB 2GREA 1WU8A 2KIUA 2JK3A 4IJAA 3U6BA 3ZOBA 1LEAA 4R71A 1SANA 2MH2A 2ME6A 1TZLA 1B2RA 3COAC 4CGZA 4CCJA 3OIPA 3GW2A 3PM1A 2KIQA 2ZTNA 1XQBA 1OCCH 1PLUA 3BH6B 2LTPA 4ZDOA 2BGCA 1BJZA 3PA2A 4UZUA 5K1YA 2LBFA 5JVTA 5DM6F 1D1AA 3LYCA 2M4KA 2HVSA 1LDDA 2KT0A 4HPQA 3S17J 1SFXA 3C2GA 3PSFA 5EMNA 2R5YB 5J3OA 2PMZA 3BTIA 2WAEA 2R7QA 5EF6A 1IG7A 1JJ8C 1UZCA 4TSFA 5BQTA 1G4DA 2JQ7A 2F6CA 3NB2A 1E3OC 1DBOA 5DCMB 1Y1VJ 1W34A 3CF5F 1JI8A 4QVJA 2ZITA 1Z3YA 2M45A 4JYKA 3RPUA 1VQ8I 4YFKF 1IF1A 1YHQI 2OTJI 1MMGA 1QZYA 2P6SA 3HTUA 2ZSIB 2LKPA 5DD8A 4E7KA 4P3YA 4AM3A 3TO6A 3A03A 3R4KA 4PFOA 2OTJB 1TYXA 4JMQA 4I99C 2PX9A 5M3MJ 3QFCA 3UW0A 3AVWA 2Z1DA 3DBHB 1XFOA 1I27A 1IZ1A 2RQQA 1XB2A 4YG2F 2V7UA 4IRHA 3P9CA 2EFNA 1QG0A 1NHCA 3CP2A 2XB0X 2VPRA 4XKCA 2BM4A 2NZMA 3MFKA 2WTEA 3J81K 2YPRA 3HDDA 2K3FA 2BBYA 1KC8D 4BAYA 4N3GA 4WXDA 4EJOA 2DMTA 1UD5A 1OHHA 3MEXA 4Q47A 1APLC 3E6CC 2LFBA 4V19K 2WV1A 2FBIA 1YX3A 2XTYA 3PUBA 3LAPA 1MD0A 1WZ2A 2DOGA 3S8PA 3GQAA 1R5ID 3EQLF 3K2ZA 4CA0A 4A3BJ 3HBLA 2FJ1A 1SM4A 1OCOH 2WJVA 2DT6A 4OIQF 1BX1A 2FQ4A 1BW6A 2L3DA 2DYSH 4TMVA 2DERA 4AVZA 2QEXI 1N8RD 5K7HA 5IPAA 1FMVA 3FXJA 4PZJA 4XNFA 4P12A 2UVFA 2L7ZA 2ID6A 2K40A 2ZBKA 3L1PA 1BHEA 2D74A 5DD4A 1R58A 4EVIA 3CCLI 1O7FA 3OIQA 3D5RC 5F27A 1MBGA 2Y9ZA 2FMYA 2LH9A 3ES9A 2B0RA 5EG0B 1IRFA 2VIXA 2ZMEA 1QA3A 3CCLB 1HBXG 2NTQA 1BJKA 1MBEA 4HSRA 2HPIA 4PK4A 1KQ8A 1ODDA 3A0BC 3QPHA 3BY6A 2M34A 4M53A 4V2GA 1WKMA 1I3AA 1FIAA 1V54H 2A61A 2KJBA 2EQRA 3X2QH 3GTKJ 2EINH 4B4DA 3KCCA 1ETOA 1Z7LA 1MNMC 2DFHA 1EFTA 4RAYA 3JRAA 2PI0A 3ZMSA 2F4IA 4XK4A 2UXNA 3CW2A 4RJLA 5H5JA 3G6EI 3HOSA 4MXNA 3F9KA 5HS7A 1Z67A 2RAEA 3KZIC 3HHHA 1G7RA 3H9JA 1Q82D 4YFXF 5GAGJ 2RREA 3T1BA 3EQNA 2ZXWH 4HG2A 1QPMA 3G6EB 3OR2C 4YHBA 5HVQC 2HOAA 4G7XA 3M07A 4L8JA 2QXZA 1TWAJ 2K9MA 3R6SA 4ENNA 2DBBA 3LQRA 1W7PD 5BSYA 4G6TB 3RIQA 2JUCA 3CDIA 1EH8A 2HFHA 5LHIA 1Y8RB 4DIQA 2V7QA 1HF2A 3WTZA 1T33A 3DBRB 3R61A 5IYQA 2Z2SB 4H4KC 2M3AA 4YIIA 5D5VB 1UAAA 4OIPF 3CB4A 2DFIA 3CO6C 4AYBN 2UV1A 4EV0A 1S7EA 4UB8C 5B3SH 1A35A 2BF4A 1BOAA 2BXZA 3CCEI 4XD7A 3Q0VA 3E97A 2R5ZB 2OBTA 1E43A 3FISA 5EEAA 1ZM9A 3BT9A 2QF7A 3AVXA 2O3FA 1J2XA 5JI6A 4A5MA 3BQJA 1MMAA 1W0UA 4NHJA 4M3BA 2HKOA 2XZPA 3PSIA 4M72A 4OOXA 3FWEA 2BHYA 4HW0A 1N08A 4G7HF 5EJCA 2GWRA 3VFZA 3OYKA 2Y69H 2B7BA 4DQLA 1W36C 4C43A 3ZUGA 3WHCA 1WOSA 4KKTA 1G59A 1RMGA 4L9VA 2F4OB 3BLYA 3TKYA 5H2FC 1D0YA 4L0ZB 3HAGA 3IWZA 3PNYA 4FASD 5E3MA 3IRRA 2WPDA 3OYLA 1M1EB 2KL4A 1A36A 2IA2A 1DG1G 2EA4A 1EA0A 3AFHA 1T98A 2LC2A 1ZGJA 4XBFA 3TGNA 4A6DA 1XX5A 2DAOA 3HHGA 2IS4A 5CJ9A 1VHEA 3L9FA 1O57A 1YIJI 5FLVA 3RYPA 4X06A 2MW8A 4CYDA 1RC9A 3BG9A 1R7JA 3CJQB 4CDGA 5GAEJ 3HEFA 1PP7U 2CV0A 3AK5A 4W8SA 1I6XA 4PC1A 1YIJB 4BBRJ 3FX3A 4HEA2 3FM3A 4YIFA 4ZZLA 4RB1A 2JWTA 3KYCB 3OYGA 1HC8A 2ID3A 3FXMA 3BR2A 2EZHA 1EKEA 5A8AA 3B6AA 5AN9A 2CQQA 2PMDA 3OYJA 3ZZ0A 2RNGA 2I5UA 2E7XA 1LFBA 2WY7Q 3KFWX 4AC9A 1WOOA 3CMYA 4A0ZA 4EH1A 2E71A 3ZQHA 4YZQA 3LSMA 1PYVA 2CUEA 1IJEA 3DPLC 4D7MA 1MSFC 1XMKA 5GTIC 4LBZA 1FX7A 4ZYAA 5KAFC 2VFOA 1TT0A 1DU6A 4PCQA 3LSKA 4Z4SA 2V7FA 1PJ7A 2P0WA 2WBMA 3J7AO 1V5VA 3NAWA 4KISA 4EW9A 2MBFA 2GOMA 3FPPA 4AIHA 5E6TA 4FE4A 4IRGA 1SKQA 1BN5A 3HSRA 3DU1X 4IF4A 2CFXA 1N0VC 4LG0A 3S3MA 1XCBA 3CCMI 1IDJA 4RBOA 4HNUA 1UD3A 1F36A 2QTLA 3J81Z 2Z99A 2XIGA 3RY8A 3VEPA 1W2BB 2DFFA 3CCMB 1YE9A 2W1OA 3DTEA 4Z4VA 3GTLJ 2H6BA 5E3LA
chains in the Genus database with same CATH topology
4BS9A 1IA5A 2KMUA 3OE7A 3CMMA 1W0KA 3HL2A 4BQNA 2CS3A 3HUGB 4G6IA 4BU2A 3GQ8A 3LFUA 3UR3C 1I18A 2BW3A 1DBGA 2L9NA 2NTBA 4NK6A 5C1CA 4RM3A 3OYAA 1JTAA 2L2OA 3RCOA 1MMNA 1UELB 1PXZA 4Z06A 5HOOA 3K4LA 2CV1A 2HNHA 3I9V2 1VF7A 1LFPA 3H9QA 4BGDA 2VKDA 3OYIA 2PYHA 1UD6A 2ZZQA 3EUKL 3GBGA 2W7NA 3H9GA 4AU7A 3T53B 2VASA 3K4MA 3VYSB 2GJPA 4RLQA 2QY1A 3K4NA 1NG7A 4F55A 3OL3A 4TKOB 4B44A 1E1RA 1UG0A 3K4BA 1EE6A 1E3ZA 2R7VA 1V5EA 1E79A 3B4NA 4XLAA 2O17A 2VXDA 2NSPA 2K3PA 4JQFA 4IX7A 2E1MB 2JJ2A 3OW7A 4W8QA 3BC9A 2MABA 4PJLA 2X6YA 4NC8A 3E1SA 3ONQA 3VWBA 4XONA 1FMWA 3OEEA 2DT7B 2WAQA 3MKWB 3BC8A 5AMVA 4XMYA 1WPCA 1K5CA 4LG3A 3VSUA 2INVA 2O5RA 4MLOA 3PL8A 1COWA 2KQRA 4DBQA 4BE1A 1KCDA 5DN6A 4FXUA 2D3NA 3SYTA 2XNDA 2M7AA 4OZZA 3OYEA 2VBEA 2HQAA 2VQCA 1KZLA 2X6WA 4YRVA 1UD2A 1N77A 2F43A 1O8JA 2Z6BD 2JUGA 3A3GA 2HVQA 1BMFA 2QKMB 3EPZA 3W3CA 3VSVA 3BCDA 2PECA 4NK8A 1KMHA 3OS1A 4ASUA 3DKXA 2WB1A 3VR6A 3QYFA 4QPOA 5IK2A 3A2KA 2VQLA 3S3NA 3OEHA 5JHFA 2HPMA 3HOTA 2UUZA 2LG4A 3G2BA 3S93A 4XKBA 4XM3A 1RWRA 3V42A 3ZSCA 3H5NA 2R7TA 5CQEA 1HVXA 4DNRB 2R7RA 4PMHA 2BVMA 4E7IA 1LVKA 1OR7C 3FHNA 3HG9A 4CZCA 1GQ8A 4YXWA 1I8DA 3T51B 3OYFA 3K10A 4B3GA 2VJJA 2R7SA 1DQUA 2L9SA 2VLAA 1RU4A 2QX3A 4MR0A 4DGWB 4ANJA 4BE0A 4KKSA 2R7UA 2MD0A 4FETA 3PNTA 3K4CA 2V4JC 4BACA 4KITB 4B3XA 2KZVA 2K5CA 2M5SA 1J09A 1O8LA 4NUBA 3C2HA 2Q2EB 3IAM2 3H94A 1O8GA 2UWMA 2LY1A 5KNLA 2A5WA 2ODLA 2IS1A 5CKTA 3HPHA 4E7LA 2CH0A 3BCAA 1GLNA 3OFNA 1AIRA 2WY8Q 1O8EA 2HZDA 1ZELA 1E3XA 5HLTA 2JIZA 1N78A 3WWGA 3GVKA 3LSIA 3RTRA 2IGNA 2IGOA 4LITA 2V1NA 4OAYA 4GQNA 1VJSA 3OYNA 4II2A 2AQEA 4BQQA 5HNFA 1WP6A 1O8IA 3VSTA 4PJMA 3DLAA 2JVHA 3MD2A 2IGKA 5LFAA 2CK3A 3LNNA 2HDWA 1T95A 4D9JA 3RSNA 3OY9A 3K70C 1H8HA 1R6RA 2NSTA 2M0MA 3DQVC 3E0JB 3DU6A 4NC7A 2INUA 2VJ5A 2XOKA 2X3HA 4C9YA 1V0EA 2V26A 4OAZA 4P1WA 4XORA 2VJIA 1Z3XA 2W6JA 4II3A 4N4NB 3K4JA 3W2VA 1Z21A 3G05A 2Q1ZB 4RMNA 3OPOA 2Z16A 4BXFA 2JJ1A 2OUMA 4XN0A 3VSKA 4ZJZA 1VLYA 3PFYA 1XG2A 2CW8A 4IZZA 4B43A 2JSPA 2WADA 4DJAA 2GK6A 4OJOA 3K70D 2LY2A 3CF2A 3MKZA 4DBRA 3OYMA 3HKZA 2NTPA 4OWRB 4CCKA 3VDXA 2ZFUA 3L2UA 1KTWA 3KRGA 1O8DA 2CMPA 4F3QA 1PKVA 2KVOA 3D5SC 4DOZA 2HU9A 1LKXA 1WJDA 1X19A 3OWTA 1PJRA 2XSJC 4CCLA 2NT6A 3DEEA 3JURA 3DKYA 5HNHA 4N4OB 3HC7A 4U49A 1SKYB 1WTHD 4XKWA 4XLFA 3T56B 1DGWY 3ZIAA 5C1EA 2VBKA 3OS0A 3VMVA 2R7WA 1HA8A 1EFRA 1X0CA 2M4GA 4E7JA 3IAS2 4G7WA 3A1YA 3UNGC 4U4BA 1WJBA 4XLEA 4XOPA 3WQZA 2Y0SA 3L2VA 1H8EA 3OS2A 1O88A 2LYCA 2LBFB 4D1QA 2VKHA 3MMYB 4RLFA 3GQ9A 4HWVA 1QJVA 2R4GA 4RM2A 5KCMA 2LRDA 2I8DA 2VXZA 4E6KG 2ELJA 2VJ4A 1QHHD 1OGMX 2OV7A 2MYSA 4YZAA 3TBIA 3B90A 1D0XA 1SFKA 4KT6A 4YZ0A 2JDIA 2W6IA 3QYEA 5FRMA 4CCNA 3VYTB 2F1MA 1HZEA 3ZXSA 1OFLA 1BOBA 2DXIA 1OB0A 1SAUA 5FL7A 3CP8A 2E60A 4BQOA 4KKUA 1NRKA 2MC4A 1D1CA 2BSPA 1QHGA 2IS2A 1OFMA 1WJFA 1BR1A 3KEYA 2D3LA 3TMOA 3ZQQA 4DK1A 3HPGA 3B8YA 1X1DA 2MFZA 2PYGA 4IKFA 2Z8GA 3VYUB 4PJNA 1Y6IA 3OYBA 1WFXA 2O0WA 2XF7A 1V5FA 2XF5A 2VBMA 1K6YA 2ZXIA 1IRXA 2CFOA 2IS6A 1X4PA 1W9XA 1UD4A 1E1QA 1TZLA 3DDYA 3SDBA 4XOTA 4CCJA 3OIPA 2ZTNA 3M8JA 4BJ5C 4YZXA 2KRCA 3LL7A 4ZDOA 4XQFA 4UZUA 2X1CA 2LBFA 4P22A 1D1AA 2M4KA 1VZ0A 2HVSA 2V6EA 3U21A 4IQJA 4HPQA 3PSFA 3C2GA 4HSTA 2LZJA 4OJ5A 2XGJA 1ERDA 1W0JA 2KPMA 2DOAA 2PMZA 1D0ZA 2E1MC 3KEWA 5FRNA 2WAEA 2R7QA 4F92B 4XKVA 3JU4A 4TSFA 4CCMA 2F6CA 3A4CA 3A35A 1DBOA 3AL0B 4DK0A 3LSHA 1JI8A 1Z3YA 3BG6A 4BJTA 3DPUA 4Z1MA 1MMGA 4XN3A 4Z05A 3SZGA 2ZSIB 2CW7A 2WA0A 4E7KA 4HRIA 4PFOA 1NG6A 2W00A 4JMQA 1EA3A 3NWSA 4BJ6C 3UW0A 3PJRA 2Z1DA 3CESA 2RQQA 2DJIA 3DWLE 4OZYA 3EQOA 1NHCA 3VSLA 3GRHA 3CP2A 2W4SA 4F52A 4XKCA 3FBNB 4TT3A 3QYBA 2NZMA 2KRHA 2XZLA 3OYCA 3L2RA 2VB6A 3S32A 2IXSA 3QODA 2O1DA 1V5GA 4B47A 1UD5A 4C2TA 1OHHA 1T5EA 4BEHB 3NWTA 4CH7A 1U0JA 3S3OA 4Y4RA 2X1EA 2X1DA 4LIUA 2R7XA 1YX3A 3PUBA 3LMWA 3GQAA 3S8PA 2O04A 3GVLA 1T0FC 3FKJA 3SEZA 4CA0A 2X6XA 2UVEA 2WJVA 3GQBA 2DT6A 1LDKB 2WZPP 2DCEA 4F93B 4URRA 4XR6A 3SEQA 3VYRB 4J01A 4AVZA 3CJRB 1FMVA 5LD2C 1MNDA 4EATA 4XNFA 1MABA 4LIVA 2UVFA 4F91B 3ZPNA 2X51A 2KLOA 4B48A 1BHEA 2QE7A 1Y56A 3BH4A 2WAFA 3OIQA 4E0FA 1O8HA 3D5RC 3H5RA 1AA7A 4PSXA 4HNTA 2LH9A 4Y3OA 3DTIA 4XL9A 3ZR8X 2O0VA 2XC7A 2VIXA 4IQ4A 1DP3A 2NTQA 2NOJB 2VQGA 4HSRA 2HPIA 4CSWA 4ZTFA 4B3FX 4PK4A 3ZCOA 2IGMA 4KJZA 1BR2A 2E5NA 3H0DA 2XZOA 1WJAA 2VQHA 2M7BA 2GJKA 4CUGA 3AKZA 3OR1C 3OL4A 2PJRB 1Z7LA 3ZGKA 4BEHA 4BE2A 4BUPA 4I84A 2F4IA 3DU5A 4C2UA 4Z03A 4DNTB 1BLIA 3HOSA 3GVJA 3F9KA 2K9LA 3I3LA 4MXNA 1OGOX 4BDZA 2CV2A 1D1BA 3OYHA 3H9JA 2L5QA 3EQNA 2RREA 2QKLB 3HXLA 4OJLA 4XLHA 4HG2A 4NQWB 4W8RA 3OR2C 1FX0A 2VPLA 5HVQC 4G7XA 3EUAA 1O8KA 1HG8A 3FBIB 4L8JA 1X1BA 1BR4A 2K9MA 3LSGA 2QXZA 4G6TB 2X53S 1VBLA 3OMYA 2ZZEA 2OC6A 1WJ5A 4DIQA 2V7QA 1KCCA 2V9KA 1PE9A 2Z2SB 4H4KC 2M3AA 2GJRA 2KP6A 1UAAA 3W2AA 4C2LA 2IQ7A 2ZTGA 3H5AA 2UV1A 3L2QA 2NT9A 1V0FA 2R9VA 1E0EA 2CUZA 1WMRA 1IB4A 2GK7A 4XD7A 1UD8A 2WJYA 2L7KA 5CDFA 2KDOA 1E43A 4PJJA 2GOXB 3PNVA 4OJ6A 1CZFA 1MMAA 2XZPA 3BCFA 3PSIA 1O8MA 4PFPA 3OYKA 2V4DA 2LREA 1QU3A 1W36C 3IUOA 2PJRA 2XDVA 4ZTJA 1JRGA 4J00A 2ZZGA 4KKTA 1G59A 1PLUA 1RMGA 3BLYA 5CQGA 4QPQA 1O8FA 3L2WA 1D0YA 4X0GA 2A6TA 2AQFA 3FDYA 3HAGA 4NNJA 3NE5B 3PNYA 4FASD 3T9GA 3ZPPA 2WPDA 3OYLA 3BG7A 2KL4A 5HKKA 2E5ZA 4W8TA 2JA2A 3DTKA 1NBMA 4HIZA 2ZXHA 4GRIA 1BPLA 3VMWA 1DGRM 3GQ7A 3AFHA 1MW7A 3ZRGA 2LC2A 2EWEA 3OOUA 3D5LA 2IS4A 2V31A 4ZDLA 4E7ZA 1W36D 3SUCA 1N75A 3CJQB 2CV0A 3N05A 2X8KA 4U87A 5KHDA 1X1CA 1P9QC 4C30A 4W8SA 2XF6A 4E7HA 4BL0B 4U7BA 4HEA2 3KYLA 4AYBA 2E1BA 2W82A 3KX2A 2DIEA 2JVGA 1MNEA 3OYGA 3M1CA 4BDYA 3W2WA 4JOMA 2VL8A 1MMDA 3RPUD 2X85A 5CPRB 1WJEA 2BW3B 3TL4X 1OOCA 3OYJA 1X4OA 4PSWA 2RNGA 4YEJA 4Y33A 4OJPA 2WY7Q 4YZQA 4ZC3A 3LSMA 4ZDPA 1PYVA 3FY3A 3K6GA 1YX5A 1QCXA 3DPLC 3BCBA 1WJCA 3LMMA 1OLTA 3MKYB 3DPTA 4ITVA 4ZYAA 1TT0A 4P5OA 4PUSA 3LSKA 2CUJA 2V7FA 1H80A 1G8XA 3RQ4A 4YELA 2P0WA 2WBMA 4EW9A 2BOLA 4KISA 1IDKA 3FPPA 2GOMA 1KONA 4CCOA 3OYDA 3OAAA 2ZSHB 2LOOA 3AL0C 4E4HA 3EUHC 2HLDA 3FKSA 2FUG2 4E7SA 1K28D 3IP4B 3S3MA 4XLCA 3OOCA 1IDJA 2F5VA 1S9HA 2KHMA 4HNUA 1UD3A 5TGTA 2WSSA 5FROA 4R79A 2BVLA 2ZZFA 3H35A 1YE9A 3J7AY 2HVRA 2W1OA 3CZ6A 3QOEA 3DTEA 2XAUA 2R7OA 1X1AA 1BN8A 3K4KA 3A3BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1O8K A;  1HG8 A;  2QXZ A;  1O8I A;  1IA5 A;  4OJ5 A;  3VST A;  1VBL A;  3GQ8 A;  1KCC A;  4XKV A;  1DBG A;  1PE9 A;  2NTB A;  4NK6 A;  5C1C A;  2NST A;  4C2L A;  1DBO A;  1JTA A;  2IQ7 A;  1PXZ A;  4Z06 A;  2NT9 A;  2INU A;  2X3H A;  1WMR A;  1IB4 A;  4XOR A;  2PYH A;  2VJI A;  4XN3 A;  4Z05 A;  4XN0 A;  2QY1 A;  4OJ6 A;  1XG2 A;  1CZF A;  1O8M A;  3UW0 A;  1EE6 A;  4OJO A;  2NTP A;  3B4N A;  4OZY A;  3EQO A;  4XLA A;  1NHC A;  2O17 A;  1JRG A;  3GRH A;  1KTW A;  2NSP A;  1PLU A;  1RMG A;  2NZM A;  3KRG A;  1O8F A;  1O8D A;  4W8Q A;  5C1E A;  2O1D A;  3T9G A;  2X6Y A;  3ZPP A;  4W8T A;  4XON A;  2NT6 A;  5AMV A;  4XMY A;  3JUR A;  1K5C A;  3VMW A;  3GQ7 A;  4U49 A;  3VSU A;  2INV A;  2EWE A;  4XKW A;  4XLF A;  3GQA A;  3LMW A;  1KCD A;  2VBK A;  3SUC A;  3VMV A;  2O04 A;  1X0C A;  2X6X A;  4U4B A;  2UVE A;  4XLE A;  4XOP A;  4OZZ A;  2VBE A;  4W8S A;  1O88 A;  4URR A;  2X6W A;  1O8J A;  3GQ9 A;  4HWV A;  1QJV A;  4XR6 A;  3VSV A;  4AVZ A;  2PEC A;  4NK8 A;  4XQF A;  4XNF A;  2UVF A;  2X85 A;  1OGM X;  1OOC A;  1BHE A;  1RWR A;  4YZA A;  4YEJ A;  4XM3 A;  3B90 A;  1O8H A;  4OJP A;  3ZSC A;  4YZ0 A;  4PMH A;  4YZQ A;  4XL9 A;  3FY3 A;  1GQ8 A;  2O0V A;  1OFL A;  1QCX A;  2NTQ A;  2VJJ A;  1RU4 A;  2QX3 A;  1H80 A;  4MR0 A;  4YEL A;  2BSP A;  4EW9 A;  1OFM A;  1IDK A;  3B8Y A;  2Z8G A;  2PYG A;  1O8L A;  1O8G A;  2O0W A;  2VBM A;  4I84 A;  4XLC A;  1IDJ A;  4Z03 A;  2ODL A;  4MXN A;  1OGO X;  1AIR A;  4XOT A;  3EQN A;  4OJL A;  1O8E A;  4XLH A;  4YZX A;  4W8R A;  1BN8 A;  3WWG A; 
#chains in the Genus database with same CATH topology
 3A1P A;  3MN2 A;  3WGH A;  2BV6 A;  2BPO A;  2D1H A;  3NAU A;  4N9I A;  4KN4 X;  2FU4 A;  3LFU A;  2BW3 A;  2L9N A;  5C1C A;  3FXR A;  4RM3 A;  3ERM A;  5D6E A;  3U1K A;  1MMN A;  2VOP A;  1SD7 A;  1PXZ A;  4Z06 A;  1WDT A;  5ILV A;  3I9V 2;  3K0L A;  4HF0 A;  1X3Z B;  3JCU C;  3T53 B;  1G3W A;  2VAS A;  3K4M A;  3VYS B;  4EJV A;  1MIJ A;  2QTZ A;  4F55 A;  3CCQ I;  1E1R A;  1F4K A;  2RC4 A;  1E64 A;  4L9J A;  2HOS A;  1XSD A;  2VNJ A;  4M3F A;  3TP3 A;  5E3O A;  1J7K A;  4LLG F;  5EDN A;  1PJ5 A;  2FBH A;  2VXD A;  2OBS A;  4PJ0 C;  1LQ1 A;  2NSP A;  4KDP A;  3H0G J;  4JQF A;  1I3Q J;  2E1M B;  4IX7 A;  3OW7 A;  4W8Q A;  4OPW A;  3AG4 H;  2XV4 S;  4RCZ A;  2ZL5 A;  3OW2 B;  2X6Y A;  3LSJ A;  4NC8 A;  4A3K J;  3PFI A;  1KYZ A;  3ONQ A;  3KP6 A;  3VWB A;  3HOY J;  3OEE A;  3GF2 A;  3BC8 A;  5AMV A;  4XMY A;  4ENM A;  1WPC A;  5DUK A;  5HS8 A;  3P26 A;  1K5C A;  3IHU A;  1K8F A;  1OFE A;  4RGU A;  1RR7 A;  2NVY J;  3SQN A;  4BE1 A;  1B8I B;  5FLX K;  4L5E A;  2ZBU A;  1LLW A;  3JAM K;  2NVQ J;  3OZW A;  3RKQ A;  2VC0 A;  1VQ7 B;  2V7T A;  1KZL A;  4GYG A;  2F43 A;  4LOC A;  4EJU A;  3HRS A;  2R7Z J;  1F1Z A;  1FC3 A;  1O8J A;  2JUG A;  4RD6 A;  2QKM B;  4BXX J;  1F5T A;  1EH7 A;  1OJL A;  4UZF A;  1JTX A;  2V1D A;  1KMH A;  2DOF A;  3VNU A;  4X6A J;  4MGR A;  5IK2 A;  1DDG A;  3S3N A;  5DCF A;  3HOT A;  1S5L C;  2ELH A;  2FOW A;  3GME A;  2XGE A;  3MAJ A;  4R1H A;  4XM3 A;  4ZYD A;  1XTA A;  1SEU A;  9ANT A;  2R6H A;  3B82 A;  3C2B A;  3ZSC A;  2BVM A;  4BBS J;  2JA7 J;  3CDH A;  4CZC A;  3CCV I;  1H89 C;  2EFO A;  1GQ8 A;  3TQN A;  4FN5 A;  3K10 A;  1Y39 A;  4MO7 A;  4IXA A;  1YO5 C;  3S1M J;  3K1P A;  3W2E A;  4ABZ A;  1RU4 A;  3MQ0 A;  3LSR A;  4MR0 A;  4KKS A;  2PLY A;  4M4S A;  3OZV A;  4G1V A;  1D3Y A;  2HS5 A;  3S2H J;  4B3X A;  2K02 A;  3EYY A;  2XAH A;  3F6O A;  4NUB A;  4ACB A;  2DK5 A;  1Q81 D;  5JLW A;  1R49 A;  4OU0 A;  1HSJ A;  1O8G A;  1CQT A;  1RQP A;  3S1Q J;  2ODL A;  4Y13 A;  2Y75 A;  2IS1 A;  1GT0 C;  4KN7 X;  2DA5 A;  2FRH A;  2ZCW A;  4E7L A;  4M6X A;  1E3H A;  2QM3 A;  2HTS A;  1GLN A;  1PJ6 A;  2XRL A;  1O8E A;  1U9N A;  5HLT A;  1Q1V A;  4JBA A;  1N78 A;  1OFC X;  3GVK A;  1S6L A;  2IGO A;  2IGN A;  4LIT A;  3D26 A;  4GQN A;  1ETW A;  3QPL A;  1O8I A;  1VI0 A;  1WP6 A;  3VST A;  2D5V A;  4LB5 A;  3O2P E;  2JPB A;  1LE8 B;  5F0C A;  1TNS A;  2JVH A;  4X0C A;  1WMR A;  1YQA A;  2HDW A;  1T95 A;  3K70 C;  1JKR C;  3FK6 A;  3ROU A;  3HOV J;  2DPU A;  3M1E A;  2HDD A;  1ZRE A;  3DQV C;  3FXK A;  2HQ5 A;  4JP0 A;  2Z5U A;  5L3G A;  2STW A;  4C9Y A;  3N4M A;  2V26 A;  1V0E A;  3CCJ I;  1H88 C;  1DAB A;  2W6J A;  1Z3X A;  3F3X A;  1EH6 A;  1R5H A;  4B09 A;  4I01 A;  1O3S A;  3MZY A;  1VQ4 B;  1FTT A;  2DMP A;  1AU7 A;  4RMN A;  4PC3 A;  2Z16 A;  1QGP A;  4BXF A;  3ZQC A;  1ZGA A;  2K27 A;  5CVR A;  5B1B H;  4MQV A;  4ZJZ A;  2JJ1 A;  5DS0 A;  3PFY A;  3WTY C;  3JRB A;  1XG2 A;  1R22 A;  2ZME C;  2JMW A;  4B43 A;  3I0T A;  2XTW A;  2WAD A;  4DJA A;  2F4M B;  3GFI A;  4OMY A;  2NTP A;  4OJO A;  3MKZ A;  3OYM A;  3HKZ A;  4Z4W A;  4OWR B;  1G6N A;  4CCK A;  1WPK A;  5DCM A;  2NOG A;  4XIC A;  1QX4 A;  1QRY A;  1VQ5 I;  1YG2 A;  3HYI A;  3GYH X;  5JMC B;  1L1I A;  1LKX A;  1R1T A;  3OWT A;  1VQ5 B;  1PJR A;  2H09 A;  1YW9 A;  1GVD A;  4YFO A;  4ZH4 F;  1IJF A;  3JUR A;  3DKY A;  3H3Z A;  3W5V A;  1SMT A;  4X7E A;  1YIT I;  1QVT A;  2VFQ A;  1P6R A;  4NBQ A;  2P5K A;  4XKW A;  3ZIA A;  1Z77 A;  2BN4 A;  3I5U A;  1VQO B;  2L4M A;  1X0C A;  1W5S A;  1YRN B;  5CVI A;  1TQP A;  2LLK A;  2CU7 A;  3BDD A;  2QVO A;  3WBJ A;  1YIT B;  4U4B A;  1P92 A;  4XOP A;  1B1B A;  5JHU A;  1GVJ A;  3OS2 A;  3GIR A;  5L3F A;  1O88 A;  2BYV E;  1YYV A;  4D1Q A;  3L00 A;  1XE1 A;  3MMY B;  3GQ9 A;  2MH9 A;  2L4A A;  4RM2 A;  1YJW I;  2OAZ A;  1S72 I;  2VXZ A;  1X3U A;  4E6K G;  2NVX J;  1BX0 A;  2VFP A;  2IJL A;  2CUF A;  2E2J J;  1YJW B;  2MYS A;  4YZA A;  3TBI A;  1WHU A;  1S72 B;  1SFK A;  2DFE A;  3CME B;  2W6I A;  3F72 A;  1KU9 A;  1RKT A;  2PBI A;  4AVP A;  2F1M A;  2ECC A;  3ZXS A;  3CC7 I;  1SVM A;  3A01 A;  1BOB A;  1FNM A;  1OFL A;  3JTH A;  4E70 A;  2DTZ A;  1K83 J;  3CP8 A;  4BQO A;  1QZZ A;  4CHU A;  1NRK A;  1KA8 A;  5DM7 F;  5ILS A;  4Q5S F;  3CC7 B;  2BSP A;  1DP7 P;  1BR1 A;  3HZJ A;  3TMO A;  2IBD A;  3K1N A;  1X1D A;  4MTD A;  1YFH A;  2VUM J;  4RD0 A;  1I6H J;  1NH3 A;  2C2W A;  3WU1 B;  3VYU B;  1R9T J;  2DYI A;  3F8B A;  2JJ7 A;  3HGG A;  4PJN A;  4F7Z A;  3OYB A;  2O0W A;  2B0L A;  5FFZ A;  1V5F A;  2X9D A;  1K6Y A;  1A8P A;  3I56 I;  2IPQ X;  2CSO A;  3PUN A;  4M0L A;  1JGS A;  2GA2 A;  3DDY A;  1FRN A;  2AXT C;  2ELK A;  2R3S A;  2X6O A;  3B6C A;  4XOT A;  4IVN A;  5LHG A;  2JT1 A;  2Y48 A;  1U9O A;  4BJ5 C;  5ICE A;  3I56 B;  2WV0 A;  4ASN A;  1O3R A;  2X1C A;  3E3V A;  1EJ9 A;  2W57 A;  1VZ0 A;  3WTX C;  4IQJ A;  5M5W J;  4LD5 A;  4OJ5 A;  1SD4 A;  2XGJ A;  1TL8 A;  1Z9C A;  4XLN F;  2G0Y A;  2M0C A;  5FLX Z;  2TDX A;  3E6M A;  1DDI A;  3KEW A;  2K85 A;  2G0E A;  4F92 B;  3JU4 A;  2DA1 A;  2M1B A;  1JNY A;  1ON1 A;  2F48 A;  3A4C A;  2YWH A;  3ZMT A;  1IDY A;  2EJR A;  3BR1 A;  2M87 A;  2N8G A;  1OR7 A;  5ICG A;  3CTA A;  3DPU A;  1X58 A;  2Q8K A;  4Z1M A;  3JTG A;  3ABT A;  1H0M A;  5H6Q A;  3SZG A;  1QFZ A;  3QRF F;  4HRI A;  1EZG A;  2DW4 A;  1CGP A;  4PGH A;  1NG6 A;  5KVR A;  1X3W B;  2W00 A;  2JA8 J;  1N05 A;  3NWS A;  4XSX F;  4BJ6 C;  3WTU C;  4C3I J;  2NS0 A;  2M5W A;  4EM1 A;  4OZY A;  1GHC A;  2QUF A;  2QZ8 A;  3VSL A;  1MJB A;  3WGI A;  1N06 A;  3HIF A;  3R0A A;  4F52 A;  1OQY A;  3FBN B;  3HSE A;  4TT3 A;  1USS A;  1ZK8 A;  3SHF A;  3OYC A;  3Q6R A;  2VB6 A;  4M3E A;  2IXS A;  1W87 A;  5HDG A;  2HR3 A;  3LFK A;  2R5Z A;  2WYR A;  2M8G X;  5K7Z A;  1P4X A;  2VE9 A;  1QFJ A;  1TNT A;  1T5E A;  1M90 D;  1U0J A;  1NB9 A;  4Y4R A;  1XGS A;  4HF1 A;  3SXY A;  4LIU A;  2L9R A;  1ETY A;  1QRC A;  3JRH A;  2IA1 A;  1QFY A;  4GYI A;  1T0F C;  5IP9 J;  2C6Y A;  2UVE A;  4A3G J;  2O0Y A;  1WSV A;  2J7K A;  2DCE A;  4HQM A;  1D5Y A;  3C7J A;  3SEQ A;  5LMZ A;  3CJR B;  5LD2 C;  3PUM A;  4GFB A;  4UUS B;  4MYT A;  4LIV A;  4FK8 A;  2Q0O A;  1SVO A;  4RB3 C;  5HDK A;  5GAH J;  1OYY A;  3JR9 A;  2EFW A;  1Y56 A;  4RPD A;  2CQ7 A;  2WAF A;  3BH4 A;  1NB0 A;  3H5R A;  1J59 A;  1AA7 A;  2BGJ A;  4PSX A;  4HNT A;  4Y3O A;  3ZR8 X;  4XL9 A;  5ED4 A;  2O0V A;  1DP3 A;  3QPT A;  1K4Z A;  1IUF A;  2ZJ2 A;  4G5G A;  1G3T A;  4A2U A;  4A5N A;  3CJT B;  3ZQG A;  4CSW A;  4ZTF A;  5E1X A;  2LP0 A;  3ZCO A;  1TWC J;  2DOE A;  2O8X A;  4KJZ A;  3ISX A;  1VQP B;  2KKO A;  3BJ6 A;  3CDL A;  2XZO A;  4D0P A;  2BMW A;  2GJK A;  1MRZ A;  1KQ5 A;  4HQE A;  1YJ9 I;  1RI7 A;  1H9G A;  5E18 F;  1PUE E;  3ZGK A;  4BEH A;  4ETS A;  4RB2 C;  2FE3 A;  1Q1H A;  5LRS A;  5M5Y J;  1UST A;  3DU5 A;  4Y17 A;  3E6B A;  3PIP F;  1ITY A;  2LNB A;  1YJ9 B;  2X0K A;  4LFU A;  3KP3 A;  4RAZ A;  1MJA A;  1B72 B;  1RZ4 A;  2VNK A;  2G7U A;  2XAS A;  4U88 A;  2ESH A;  1FX0 A;  1Z91 A;  1BA5 A;  1A6I A;  5FO1 A;  3EUA A;  4P9U A;  4RD3 A;  1X1B A;  3LSG A;  2XC1 A;  2VN2 A;  3OSF A;  1MBK A;  4OIN F;  4I76 A;  2GZW A;  2YUS A;  3OMY A;  5EGO A;  4KMF A;  5E8I A;  1EF4 A;  3S16 J;  3JQR A;  4X7D A;  2BM5 A;  1D8J A;  2EV5 A;  4MNU A;  5M3F J;  1A31 A;  5DSZ A;  1ZAO A;  2Y0M A;  4G8X A;  3CCR I;  2ZTG A;  3H5A A;  2IP2 A;  3CCE B;  2IQ7 A;  1POG A;  2R9V A;  1E0E A;  2CUZ A;  5F64 A;  4EGY A;  5LGN A;  2OK7 A;  3Q3S A;  3HJE A;  1UD8 A;  3DF8 A;  2VBZ A;  1YLO A;  2KDO A;  3B8H A;  3BPV A;  2P8T A;  3V4G A;  1CZF A;  5FD5 A;  5IT9 K;  3WTS C;  2H8W A;  3BCF A;  4PFP A;  5DS9 A;  2V4D A;  1QU3 A;  3AVV A;  1QQ1 A;  1T39 A;  1K8A D;  3WG7 H;  2O9L A;  2PJR A;  4ZTJ A;  3I64 A;  1XS9 A;  2ZBV A;  3AAF A;  4J00 A;  3KP5 A;  1FBQ A;  1X2N A;  3ERE D;  4QPQ A;  2FX0 A;  4C3J J;  3L2W A;  1LJ9 A;  3ASS A;  1Y0N A;  5HKK A;  2VOD A;  5DV5 A;  4HIZ A;  2ZXH A;  5IOZ A;  4BY1 J;  2EB7 A;  1BW5 A;  1DGR M;  2I10 A;  4UUT A;  3GQ7 A;  2K86 A;  4HNV A;  1MW7 A;  1SMY F;  2EWE A;  2DN0 A;  1WCM J;  1MH4 A;  3SLD A;  4ZDL A;  4K2E A;  1N75 A;  3I59 A;  1PP8 F;  2BSA A;  3JRI A;  1VQ8 B;  1YHQ B;  4UB6 C;  1X1C A;  4AWX B;  1IAW A;  4RDK A;  3ASO H;  2P7V B;  3SJM A;  2BM6 A;  1LPQ A;  2V79 A;  2J5P A;  3KYD B;  2OK8 A;  5L46 A;  4AYB A;  5KSW B;  2DA2 A;  2DI3 A;  2DIE A;  2JVG A;  1MNE A;  3M1C A;  4AIK A;  4BDY A;  4IHW A;  5F1R A;  4ESF A;  5J8C A;  2H1L A;  3TL4 X;  2X85 A;  5CPR B;  1WJE A;  1MDM A;  3FXO A;  2K9N A;  4WQM A;  1X4O A;  3VO2 A;  3PIO F;  1ZAR A;  5L3E A;  1Y0U A;  1VQM I;  1G3S A;  1XSV A;  4O5V A;  5IYR A;  4ZC3 A;  4UUV A;  4KIC A;  5FGM A;  4YCQ A;  4I09 A;  1A6Q A;  1UHM A;  4N9H A;  3FY3 A;  1WJC A;  5B5E C;  2DET A;  1OLT A;  2VI6 A;  1VQM B;  3DPT A;  4ITV A;  1ACI A;  4Z4U A;  4P5O A;  1MKM A;  3BR5 A;  1H80 A;  5HS9 A;  4YEL A;  5A2Q K;  3LJY A;  1G7T A;  3A8K A;  2VT2 A;  4CCO A;  3OYD A;  2OBP A;  4HLX A;  1FSE A;  3ECH A;  3JQQ A;  2ZSH B;  2C5H A;  4Z4Z A;  3OOP A;  4H9G A;  1RKW A;  2EFQ A;  2FUG 2;  4PC7 A;  4L9T A;  5FD6 A;  4IOA F;  5F08 A;  2L7M P;  3Q9S A;  4TMW A;  4XLC A;  3LOC A;  1JUS A;  4MQ9 F;  3TO9 A;  1RIO H;  2QEX B;  1FYM A;  1JHH A;  4G9Y A;  2BVL A;  3H1C A;  4OMZ A;  3DKW A;  3I71 A;  3J7A Y;  2HVR A;  2Y30 A;  2KIM A;  2L0K A;  3QOE A;  4I2O A;  1X1A A;  2XUB A;  2NNY A;  3K4K A;  3M4O J;  2VBU A;  4Y52 J;  2X3U A;  2QBY B;  3BPX A;  4LLL A;  3SZE A;  1OPC A;  1RPW A;  3F23 A;  1REP C;  4BQN A;  1XCV A;  2CO5 A;  3GTP J;  1KK2 A;  1YX2 A;  3GQ8 A;  4KH3 A;  3UR3 C;  1I18 A;  4BY7 J;  4S05 A;  4JRA C;  4NK6 A;  1WQ2 A;  4QLC U;  3AVT A;  1AKH B;  1FNB A;  2V7X A;  3Q9V A;  2IVM A;  2L2O A;  1JTA A;  2EWN A;  3ABK H;  5HOO A;  1B9N A;  4HDV A;  1JKO C;  1VQL I;  1Q9S A;  1LFP A;  3H9Q A;  4BGD A;  2VKD A;  1CF7 B;  4LK1 F;  3RKW A;  4X7F A;  1KQS B;  2FQ3 A;  3H9G A;  4ESJ A;  1VQL B;  1GV2 A;  2CJJ A;  1RET A;  3TOB A;  1NG7 A;  2Y9Y A;  1LE8 A;  1GAW A;  4TKO B;  3VOD A;  1IXS B;  2O03 A;  3VOE A;  1EE6 A;  2R7V A;  2XSD C;  3B4N A;  3V76 A;  4KIB A;  3E7L A;  1P7J A;  1GXP A;  2DJN A;  1VQN I;  1MMS A;  1WH7 A;  5BOX A;  2V7V A;  1TP4 A;  1FRQ A;  2MAB A;  4PJL A;  2IRF G;  3BC9 A;  1Q7Y D;  2NAZ A;  1EP2 B;  1VQN B;  2ESN A;  1SFE A;  3MKW B;  2R92 J;  2RVC A;  3QP6 A;  3LQE A;  2E1N A;  4G6D A;  2O5R A;  1HF0 A;  3JRD A;  3CO7 C;  1COW A;  3SZT A;  1R71 A;  4DBQ A;  3J81 k;  1KCD A;  5DEQ A;  5A88 A;  4FXU A;  1PDN C;  4GGG A;  2ZL6 A;  5HZA A;  5CVU A;  4BH9 A;  4EEF G;  2DDA A;  1BI3 A;  3OYE A;  2HQA A;  1UD2 A;  4KYW A;  2XT4 A;  3ZZT A;  4A3L J;  2Z6B D;  4I7H A;  3BCD A;  2PEC A;  4NK8 A;  3OS1 A;  1JA0 A;  4L0Y B;  5K5R A;  3VR6 A;  2R93 J;  4H0E A;  1ZG5 A;  4JX4 A;  5JLX A;  3IL2 A;  3A2K A;  5JHF A;  2LG4 A;  3G2B A;  3S93 A;  1TQI A;  3V42 A;  4FCY A;  2CBX A;  3RKX A;  4DNR B;  5CQE A;  1O3T A;  1HVX A;  3ISP A;  4V2F A;  2R7R A;  1OCT C;  1YRN A;  3HOX J;  1OR7 C;  3HG9 A;  1SFO J;  1ETQ A;  1PUF B;  4YXW A;  3OYF A;  2HYG D;  1DQU A;  2L9S A;  2H27 A;  3GTQ J;  1AIP A;  1TVC A;  2QX3 A;  3DEW A;  5EEG A;  3VB2 A;  4FET A;  2EIJ H;  3K4C A;  1UG2 A;  3PNT A;  4IRI A;  4KIT B;  1EXM A;  2M5S A;  1J09 A;  3E20 A;  5HOD A;  2DQR A;  3PSZ A;  3C2H A;  3DXJ F;  3PEN A;  1MGT A;  2LVS A;  5AIP A;  3FHZ A;  4XLP F;  2LY1 A;  2GA1 A;  4LK0 F;  4OPS A;  1HXD A;  4Q4Z F;  2ZO4 A;  4IHV A;  1EP1 B;  3BH7 B;  3WU2 C;  3ZQF A;  2NS8 A;  3AVU A;  2CH0 A;  3PO2 J;  5M5X J;  1LDJ A;  2WY8 Q;  2VNH A;  1ZEL A;  1OMI A;  1E3X A;  3BR6 A;  5LEJ A;  2OF7 A;  3WWG A;  1FIP A;  3BTC A;  2XAQ A;  3RTR A;  2JA6 J;  1BC8 C;  3HB9 A;  1HW1 A;  2LF8 A;  4ZCM A;  4II2 A;  2AQE A;  5L3D A;  4BQQ A;  1W1W E;  4PJM A;  3QOP A;  1EWY A;  5BSX A;  3GEZ A;  2DMN A;  2CK3 A;  4QUZ A;  3GLX A;  2DA4 A;  1U8R A;  3LNN A;  4D9J A;  1H8H A;  2DOD A;  2XNJ A;  3E5X A;  1FTZ A;  1JKQ C;  2M0M A;  5IP6 A;  1I39 A;  2NS7 A;  2VE8 A;  3GCM A;  2M2E A;  3SJZ A;  4W1U A;  3GFJ A;  3LQ6 A;  3K4J A;  3W2V A;  3G05 A;  2PMH A;  2OCC H;  2Q1Z B;  2GQQ A;  4HX4 A;  1T2K A;  2GBY A;  1H42 A;  1T0F A;  2YS9 A;  5F6F A;  1XMA A;  2CW8 A;  4MFD A;  1OB2 A;  1S7O A;  1ONV A;  2C4T A;  3BNW A;  3A0H C;  3Q5F A;  4DBR A;  3D1N I;  2FXA A;  1X2M A;  3WND A;  1P4W A;  2Q2E A;  2ZFU A;  3TO7 A;  1W5C C;  2L54 A;  2PE3 A;  4IHY A;  4DYR A;  1U5T B;  2CMP A;  4N0B A;  4F3Q A;  1PKV A;  2KVO A;  1O8D A;  2WWY A;  1ETK A;  1UHW A;  2FOK A;  2RN7 A;  3O8G A;  1XDU A;  3F0C A;  3SFI A;  5A2Q Z;  4AF6 A;  3K69 A;  1XMX A;  3VMF A;  5HNH A;  1HKQ A;  4N4O B;  3IRQ A;  3HC7 A;  2EZL A;  2KIS A;  1UMQ A;  1SKY B;  1ZRC A;  2AHO A;  4AF7 A;  4HBL A;  4RD1 A;  4UVB A;  2C4U A;  4CYC A;  3T56 B;  1EFC A;  2VBK A;  3OS0 A;  1EFR A;  2BV3 A;  2M4G A;  1FPQ A;  4G7W A;  3P4G A;  3A1Y A;  3JX8 A;  4XLE A;  3WQZ A;  2Y0S A;  1U2W A;  2YWG A;  1R4N B;  2LYC A;  2LBF B;  3ZPL A;  2CGP A;  2VKH A;  2GXG A;  3PVD A;  2R4G A;  1QJV A;  2W24 A;  3CCQ B;  3RYR A;  1W7P A;  4BQA A;  4EQQ A;  2I8D A;  2JZY A;  2FD5 A;  2LY9 A;  4A12 A;  2OYN A;  1QHH D;  3QPS A;  1FY7 A;  1R1V A;  2DTR A;  3FKI J;  1ZH5 A;  3QFS A;  2CQX A;  3SYJ A;  1VTN C;  1KK0 A;  3R6J A;  4HDU A;  3RIR A;  1ZR4 A;  4YZ0 A;  2CW0 F;  2X48 A;  4QSH A;  1HZE A;  2B5O A;  3HGY A;  1U78 A;  2DXI A;  3KP2 A;  2EZK A;  4BNC A;  2XEX A;  2E60 A;  4KKU A;  4YAU A;  1GXQ A;  2MC4 A;  2WR8 A;  5FO5 A;  1TYV A;  2BY1 A;  3DLL F;  5KW9 A;  2QMU A;  4UUS A;  1U5T C;  5CVJ A;  1OIS A;  5ICF A;  3ZQQ A;  1IC8 A;  2W25 A;  3B8Y A;  4M2L A;  2Z8G A;  4IKF A;  4G6Q A;  5J1Y A;  2AXL A;  4IO9 F;  3I53 A;  3KE2 A;  5GP9 A;  4GCV A;  4DYQ A;  2E35 A;  1WSU A;  4P3I A;  2XF7 A;  2VBM A;  1Y1W J;  1IO2 A;  2ZXI A;  4BKX A;  2QN6 A;  2IS6 A;  1GDT A;  2ZFW A;  1X4P A;  1W9X A;  4YAF A;  4Y7C A;  1KZH A;  4XRM A;  2BXY A;  1E1Q A;  1FJL A;  1ELO A;  1NDH A;  4OOV A;  2KRC A;  4HF2 A;  4XQF A;  4N3N A;  1DPR A;  2V6E A;  2HGC A;  2C78 A;  3MKL A;  2LZJ A;  2FVG A;  3SKB A;  4Z4Y A;  1ERD A;  3CCV B;  3CLQ A;  2E1M C;  2DO7 A;  2QSF X;  5FRN A;  5CLS A;  1H9T A;  4XKV A;  5FFX A;  3BG5 A;  1OGJ A;  3OSG A;  4B1R A;  1P7I A;  4LBV A;  1RRJ A;  2MSY A;  2VFM A;  3A35 A;  3PA1 A;  3GO5 A;  1WI9 A;  3LSH A;  3AL0 B;  4X05 A;  4DK0 A;  3CXC B;  2GLO A;  2OCE A;  2DY1 A;  3BG6 A;  4BJT A;  4C2M J;  4XN3 A;  4M74 A;  3F6V A;  3FXQ A;  4WK8 F;  1QA1 A;  2O6G E;  4Z05 A;  2VC1 A;  1MBH A;  1J9Z A;  3ONU A;  2CW7 A;  2WA0 A;  4HE6 A;  3WBK A;  3MCZ A;  1GAQ A;  1EA3 A;  2K7L A;  1OB5 A;  2FBK A;  3IC7 A;  2DJI A;  2BVN A;  3DWL E;  3EQO A;  3CCY A;  2NNN A;  2XAG A;  1HST A;  4KMU X;  2BZT A;  3F8N A;  1DUX C;  1S0U A;  2Y0S N;  2BY3 A;  2HOE A;  4BYY A;  3QOD A;  3MZ8 A;  4B47 A;  2OZU A;  4AID A;  4ZZD A;  3ZMD A;  1NK2 P;  4C2T A;  2K4J A;  1T6Y A;  5J8F A;  2A3S A;  5B1A H;  2JA5 J;  2KZG A;  3RZD J;  2X1D A;  2R7X A;  1FBU A;  4KT5 C;  4UV9 A;  2D1V A;  3VNV A;  2R5Y A;  2O04 A;  3R0J A;  3CCJ B;  4WX9 A;  3PO3 J;  2XT2 A;  2X6X A;  2E7W A;  2HEO A;  4K1X A;  1U8B A;  1IW7 F;  4KUM A;  5F04 A;  5D8K B;  3GQB A;  4URR A;  3WTV C;  1QA2 A;  2A68 F;  1R23 A;  4XR6 A;  4J01 A;  4Z2Y A;  1QNT A;  3GTO J;  1MND A;  1FLI A;  2A6E F;  1MAB A;  1LB2 A;  3TW7 A;  3ZPN A;  3DCF A;  5HXB A;  1R5N A;  2KLO A;  1A5J A;  4NC6 A;  2P81 A;  2GPJ A;  2ADU A;  1CNF A;  2LDU A;  1B9M A;  1O8H A;  4E0F A;  4O3M A;  3FIW A;  4QIW N;  1I1G A;  1WOR A;  2PQ8 A;  3DTI A;  4U7D A;  3H36 A;  4OPO A;  1Z05 A;  1ZR2 A;  2VQG A;  3K2A A;  4KIG A;  4A3D J;  4QTR A;  2LR8 A;  4ON0 A;  3U9G A;  1VQK I;  3ZMZ A;  1BR2 A;  3H0D A;  2ZJQ F;  2NVT J;  1WJA A;  2M7B A;  1RQR A;  1K78 B;  3GWZ A;  1HLV A;  4CUG A;  2YX4 A;  3KIO A;  3AKZ A;  1VQK B;  3OL4 A;  3IH4 A;  2STT A;  3FJO A;  2NPF A;  1TBX A;  3I54 A;  4Y15 A;  2OZ6 A;  3KEO A;  3DBL B;  3ECO A;  4C2U A;  3F8F A;  4Z03 A;  3TP0 A;  4RGX A;  2V7W A;  3GVJ A;  3I3L A;  2K9L A;  4YEI A;  2HI3 A;  1YS6 A;  3FF5 A;  2BX6 A;  1TT5 B;  3U2Q A;  4BDZ A;  2L5Q A;  2XVC A;  2QKL B;  3HRT A;  3HXL A;  4PGG A;  3H3V K;  4QHY A;  4NQW B;  5E3N A;  2QA4 I;  2VPL A;  1TQM A;  5C44 J;  3PSS A;  2EFG A;  1O8K A;  2CRG A;  1KGS A;  1ZG3 A;  1BR4 A;  4HX8 A;  2KDZ A;  5B6I A;  2X53 S;  5BNG A;  1UHS A;  1VBL A;  2QA4 B;  3TH0 A;  4J0Q A;  1SD5 A;  1MBF A;  1P2F A;  1W5T A;  4RAF A;  2ZZE A;  1WJ5 A;  1IN8 A;  1FOW A;  5LEK A;  1KCC A;  4P6Y A;  1BIA A;  2MA3 A;  1JE8 A;  2GJR A;  2KP6 A;  3W2A A;  3CPX A;  4C2L A;  2EIM H;  2ZNY A;  2HOT A;  4I0B A;  3TOA A;  1BBY A;  3L2Q A;  1V0F A;  1IB4 A;  5EG0 A;  3ASP A;  1F60 A;  2GAU A;  3N6Z A;  2COM A;  2WJY A;  1LLZ A;  4PJJ A;  3FMR A;  3PNV A;  1MZB A;  4OJ6 A;  1F20 A;  1UCR A;  3K7A J;  4D5C A;  2HCJ B;  1BI0 A;  2FEZ A;  2HYF A;  2J8I A;  1O8M A;  5C3E J;  3ML3 A;  1HKS A;  2LRE A;  2M8E A;  3LSP A;  1AKH A;  2A69 F;  2TCT A;  3LST A;  4YIR X;  2RKH A;  2IW5 A;  1YS7 A;  2VBS A;  1FNC A;  3V7C A;  4A0Y A;  2FNP A;  1SAX A;  3W5H A;  5F0H A;  2NXN B;  3JAM Z;  4X0G A;  2A6T A;  2E36 A;  2L7F P;  3FDY A;  3GZN B;  4A3J J;  3T5X A;  2QGG A;  4Y9R A;  1VQ6 I;  1E3P A;  4G7Z F;  2PFB A;  5LLQ A;  2JA2 A;  3DTK A;  1NBM A;  2NV4 A;  1J0R A;  1IV8 A;  3M8F A;  4LG0 B;  4RM0 A;  1ZYR F;  1SFU A;  3OP1 A;  3WNB A;  3ZMV A;  2Z9O A;  1YW8 A;  1TLH B;  4RS8 A;  3WG9 A;  3ZRG A;  5JVG F;  1VQ6 B;  2ECB A;  2V31 A;  5TR9 A;  2XAF A;  4O6J A;  1TYW A;  3WTW C;  2NRA C;  3SUC A;  2G9W A;  2Y31 A;  1D2E A;  3N05 A;  5KHD A;  3K9T A;  2KFD A;  1KQ9 A;  2PIA A;  4U7B A;  4TN1 A;  4YAL A;  4XID A;  4KFC A;  1IHM A;  3DV8 A;  2W82 A;  3LO8 A;  3KP4 A;  2V9V A;  3KX2 A;  5FA6 A;  2KRF A;  3OJX A;  1R5O A;  4PC6 A;  4YAW A;  2VL8 A;  1QPI A;  1MMD A;  3RPU D;  1QBJ A;  3I4N J;  2XRO A;  2BW3 B;  3ABU A;  1XB4 A;  4WZK A;  4PSW A;  4YFN F;  1E17 A;  4GO1 A;  1OOC A;  4YEJ A;  1STZ A;  4Y33 A;  3LAJ A;  5K5O A;  4OJP A;  1TWH J;  4U0V A;  3WNC A;  1IJW C;  2KJC A;  4S04 A;  1IGN A;  4WWC A;  1JJ6 C;  3OJW A;  3SQV A;  4MYU A;  3W2H A;  1QCX A;  3BCB A;  1IDZ A;  5LHH A;  2P3M A;  5FKO A;  3O6B B;  3KET A;  1W35 A;  1JJ2 B;  4PUS A;  2VT3 A;  3TDU C;  1G8X A;  5GV8 A;  1KRH A;  4A69 C;  1UMK A;  4P1V A;  3GZ6 A;  3D0S A;  3HRU A;  1WVR A;  2IA0 A;  1J75 A;  3W5U A;  2ME0 A;  3OAA A;  3REO A;  2LOO A;  3EUH C;  3FKS A;  3CC2 I;  5L3B A;  5EZH A;  4OPV A;  3M9A A;  3Q0W A;  2F4N A;  1K28 D;  3IP4 B;  3OOC A;  4ZCI A;  1D1N A;  2F5V A;  1S9H A;  2FA5 A;  1PUF A;  2CQN A;  2TRT A;  1PE9 A;  2WSS A;  5FLM J;  5THX A;  1KK3 A;  2ZZG A;  2WAQ N;  1NTC A;  2BY2 A;  2QDX A;  4BHP A;  2JN6 A;  2EV0 A;  2XAU A;  2YX7 A;  4RGS A;  1BN8 A;  3A8J A;  5CYV A;  3A3B A;  4LBY A;  2EK5 A;  1KYW A;  2KMU A;  3OE7 A;  3CMM A;  1J5Y A;  4IPA A;  2CS3 A;  3HUG B;  3V7A A;  2QQ8 A;  4I98 B;  4KNY A;  1QVF B;  2ISY A;  3BQZ A;  3LA7 A;  1WI3 A;  5D6F A;  2NTB A;  3AVY A;  1IUY A;  4ZYH A;  1Y8Q B;  3RCO A;  1XGN A;  1YLF A;  3C1D A;  4A3C J;  4UNO A;  3K4L A;  2CV1 A;  3S15 J;  2PN6 A;  4FT8 A;  2WB1 N;  3OYI A;  2PYH A;  1T08 B;  1UD6 A;  1R5B A;  3CUQ B;  3W2F A;  3GFL A;  3GBG A;  3N90 A;  4Q7J B;  1VFC A;  3PET A;  3SFZ A;  2QY1 A;  4EJT A;  2DA3 A;  3QE2 A;  4LC0 A;  4UAJ A;  4B44 A;  1J9I A;  1UG0 A;  3K4B A;  4ZGN B;  1JHF A;  2COB A;  4HE5 A;  1E79 A;  3F21 A;  2RV8 A;  3VPR A;  3GUD A;  5DDG A;  2LF7 A;  1JUM A;  2BE5 F;  3FM5 A;  1MH3 A;  1P4A A;  2K3P A;  4ZYG A;  2W48 A;  2HQN A;  1G7S A;  6PAX A;  3ZQ7 A;  4NB5 A;  4XON A;  1FMW A;  3AGP A;  2DT7 B;  2EA2 A;  2E34 A;  4PDK A;  1QZE A;  4XRS G;  3G1O A;  2I1L A;  1BIB A;  3ELK A;  5D5X B;  2XPU A;  3S1N J;  2INV A;  4UHT A;  1ETV A;  4MLO A;  3CCR B;  2KQR A;  5LGU A;  1E2X A;  1V3F A;  5DN6 A;  5H6R A;  2MC3 A;  4I6Z A;  1OFD A;  2D3N A;  4NCN A;  5IYD J;  4ROX A;  2XND A;  1CLW A;  2M7A A;  2FF4 A;  1U5T A;  1S29 A;  3FXU A;  5H20 A;  1VLO A;  2VQC A;  2VBE A;  2M30 A;  3JRF A;  1LFU P;  3KZZ A;  1BMF A;  2YU9 J;  5J1R A;  4RAG A;  4ASU A;  3DKX A;  2VOO A;  2JTV A;  5CVV A;  1Y0R A;  4QPO A;  3M8E A;  3ZN0 A;  2VQL A;  3GTG J;  3OEH A;  1HKT A;  2RQP A;  2FSW A;  1M1K D;  2VON A;  4IW3 B;  4RD4 A;  3W2I A;  1RWR A;  2DK8 A;  2F2E A;  4XKB A;  5F4J A;  4CIC A;  4TMZ A;  4MEX F;  2VYQ A;  1TTT A;  4A3I J;  1KJZ A;  3FHN A;  3QU6 A;  4HV5 A;  2D9R A;  1QVG B;  1LEB A;  3BRO A;  3F8C A;  2XGX A;  2R7S A;  3ASR A;  1ZQ3 P;  2JN9 A;  2EIK H;  4CO8 A;  4ANJ A;  4BE0 A;  3GLL A;  1RES A;  2V4J C;  1XD7 A;  3CJN A;  3PQK A;  1VF9 A;  1BI2 A;  2KZV A;  5C4X J;  3JW4 A;  2YR2 A;  3IKV A;  2RGV A;  3BQY A;  4G1B A;  5JR3 A;  1E62 A;  5HLH A;  3W6K B;  1LM1 A;  1ZKG A;  5KNL A;  2Y2Z A;  4P2N A;  3JRC A;  5CKT A;  5K5Q A;  1B8I A;  1H85 A;  4C3H J;  4WXC A;  3QP5 A;  3BCA A;  3T0Y A;  3OFN A;  1JA1 A;  1ZLJ A;  2HZD A;  3ASN H;  2RNJ A;  3V7S A;  2JIZ A;  1ZHF A;  1AOY A;  2VKE A;  1IN5 A;  1JT0 A;  1GO2 A;  1IB0 A;  2V1N A;  3C18 A;  4OAY A;  3BTL A;  1IN6 A;  4BHC A;  1VJS A;  3OYN A;  3CPW B;  4L18 B;  1WXR A;  4FTH A;  4AUX A;  1V55 H;  1H8A C;  3DLA A;  3RJP A;  2OD5 A;  1W0T A;  2G7H A;  3MD2 A;  2LKX A;  3HRM A;  1ZG1 A;  3Q3A A;  4FE7 A;  3ZC3 A;  4FWT A;  1VQ9 I;  1QA6 A;  1IV6 A;  1TSP A;  4IL6 C;  3J7Z I;  2GM4 A;  5JLV C;  4P26 A;  3E0J B;  2P7C B;  1L0O C;  2K9Q A;  5FO0 A;  3SLN A;  4NC7 A;  1F9N A;  2XOK A;  1VQ9 B;  4OAZ A;  4P1W A;  3T8R A;  4XOR A;  4C0S A;  1Z0X A;  1U6G A;  3WTT C;  5AON A;  4ENK A;  4LBW A;  4ZCL A;  2PEX A;  3ULQ B;  2A5Y B;  1WRJ A;  2OUM A;  1VLY A;  4FX0 A;  4IZZ A;  3LVB A;  1B59 A;  4F7D A;  3BJA A;  1HCR A;  1FSH A;  2XHK A;  3MHP A;  2JSP A;  2GK6 A;  3A01 B;  4Z4R A;  3CF2 A;  2L02 A;  4ZV4 A;  2M9H A;  1JTY A;  2QLZ A;  2HDN B;  3P9K A;  3L2U A;  4FHT A;  1KTW A;  1ETX A;  3KEQ A;  3NRV A;  3ASQ A;  5E8G A;  3AGQ A;  3KRG A;  4IHS A;  3D5S C;  2H8R A;  1WJD A;  2QQB A;  2AO9 A;  4L5I A;  4B3A A;  1G2H A;  2VBY A;  3G1L A;  4CCL A;  2NT6 A;  3H92 A;  3DEE A;  2QSG X;  2E2H J;  1T6S A;  2IAI A;  1WSR A;  4U49 A;  3NEU A;  1XDS A;  4LMY A;  1YOV B;  4D7N A;  2IT0 A;  3OZU A;  2DMU A;  1WTH D;  3A8I A;  4XLF A;  5C1E A;  1DGW Y;  1FYK A;  3VMV A;  2R7W A;  1HA8 A;  4ACA A;  1S3J A;  4WXH A;  3RPQ A;  1LNW A;  3IAS 2;  2AHQ A;  1BI1 A;  4TV7 A;  2O61 A;  3UNG C;  1HW2 A;  1WJB A;  1ENH A;  5E1Z B;  2DQL A;  5IYB J;  2IEK A;  3B78 A;  4ZGQ B;  2EH3 A;  1XN7 A;  4HOB A;  4RLF A;  3HSF A;  3P9I A;  3V8K A;  3F8M A;  3V7R A;  2DA6 A;  3ZMU A;  2PMZ N;  1KU3 A;  4KIF A;  2WZN A;  2OV7 A;  4MFE A;  4A3M J;  4DZP A;  3IH2 A;  1D0X A;  3DEU A;  3I58 A;  1FYL A;  4OOS A;  5TJJ A;  2JDI A;  3QYE A;  5GPC A;  5FRM A;  4G7O F;  4CCN A;  3VYT B;  4RPB A;  4M9X A;  2ZL7 A;  1XG1 A;  2XAJ A;  4X7C A;  1I5Z A;  5J4Y A;  3P5J A;  1OB0 A;  2K4B A;  4D5F A;  4I02 A;  1PVE A;  2Q6O A;  5GTH C;  1D1C A;  1FEX A;  3PQJ A;  2D2W A;  4HZF A;  2IS2 A;  2E2I J;  1K6O A;  2D3L A;  4AD9 A;  3HPG A;  2MFZ A;  1IRZ A;  5D5U B;  1QVU A;  2R7F A;  1WFX A;  5LGT A;  1IRX A;  2CFO A;  2KIF A;  3J80 K;  3UKG A;  4EMS A;  4CXF A;  3SEJ A;  4M71 A;  1UD4 A;  1O7L A;  1FWZ A;  4ESB A;  1C0W A;  4FIS A;  3SDB A;  2V9P A;  3E6D A;  3KL9 A;  5IY5 H;  3M8J A;  4YZX A;  2ACJ A;  3IV5 A;  2DA7 A;  3LL7 A;  4TMX A;  4JK1 X;  4X1E A;  4P22 A;  5E79 C;  1K78 A;  1O4X A;  3U21 A;  4WZL A;  4RB0 A;  2ISZ A;  3WYA A;  5HZB A;  4HST A;  1QGZ A;  1W0J A;  2KPM A;  2DOA A;  2AS5 F;  1IN7 A;  1UFM A;  3ML6 A;  3NAR A;  1D0Z A;  2OPT A;  4U0W A;  2QCO A;  4YDT A;  1U3E M;  2FNA A;  3GFM A;  3AG1 H;  5E20 A;  4CCM A;  5IT9 Z;  1S8N A;  3G3Z A;  1IXC A;  3MMP A;  2P6T A;  3KPH A;  2HKX A;  3J7Y J;  4DQK A;  4NQW A;  2OTL I;  4U0Y A;  3O3K A;  2W85 A;  3BWG A;  3PUF A;  4GDF A;  4IOC F;  4P25 A;  2OTL B;  5TV2 A;  4QFM A;  1FOY A;  3FZV A;  4G12 A;  5F4O A;  3PJR A;  3CES A;  4LJZ F;  4UVC A;  4QV2 A;  4IHX A;  3GRH A;  2W4S A;  2JRM A;  2H1K A;  5F1J A;  3QYB A;  2J5O A;  2KRH A;  1XGM A;  2XZL A;  3CUO A;  3L2R A;  3S32 A;  4HV6 A;  2O1D A;  2H94 A;  4X8I A;  1V5G A;  1ZRF A;  5LBQ A;  1QUE A;  1ZLK A;  1TWF J;  2QEN A;  4UXN A;  4P9S A;  4BEH B;  1CNE A;  1BC7 C;  3NWT A;  1LVA A;  4CH7 A;  3S3O A;  5H59 A;  2X1E A;  4RCY A;  5GV7 A;  1ORK A;  3LMW A;  4YC5 A;  2HQR A;  1NJI D;  2O7O A;  3GVL A;  3FKJ A;  3SEZ A;  1WOP A;  2VKV A;  2DYR H;  3NQO A;  2V5I A;  4OIR F;  1T56 A;  1JXS A;  1YIO A;  3I4M J;  1IXR C;  1LDK B;  5BPD A;  4F93 B;  1JKP C;  3M3Y J;  3EYI A;  4X07 A;  3BZC A;  2WZP P;  3HM5 A;  3EUH A;  3VYR B;  4WZE A;  4HYE A;  5FKK A;  5EGO B;  2CW5 A;  4EAT A;  2HWV A;  2D45 A;  2LD5 A;  1TW2 A;  4F91 B;  2X51 A;  4L5J A;  4M9Z A;  4B48 A;  2QE7 A;  3WE2 A;  2DEU A;  2ICW G;  5EYR A;  1FDR A;  4P96 A;  4KA4 A;  2A07 F;  2QYU A;  4UV8 A;  3SDG A;  1G7C A;  3FMQ A;  2XC7 A;  2MD5 A;  5KAI C;  4IQ4 A;  1OCZ H;  5TRD A;  1TUI A;  2NOJ B;  1D8T A;  4WZT A;  4B3F X;  1JT6 A;  1HOM A;  2QWW A;  3G1M A;  2IGM A;  1D8K A;  2E5N A;  3E5Q A;  4MIM A;  4BHB A;  5DUI A;  2VQH A;  1ULY A;  3R60 A;  2IOU G;  5L3C A;  2BM0 A;  4RDL A;  1XGO A;  3OR1 C;  5J6X A;  2EIX A;  2PJR B;  3SJP A;  4FQG A;  4P6V F;  4BE2 A;  2K9S A;  2ZXJ A;  2CC2 A;  2Q6K A;  2HXI A;  4BUP A;  4I84 A;  3LWF A;  2XB5 A;  4DNT B;  1BLI A;  5IT3 A;  2W7Z A;  1ZRD A;  4PGO A;  3WY9 A;  1K4T A;  3BTJ A;  4G94 A;  1OGO X;  5KK1 A;  3BR0 A;  1TYU A;  1YI2 I;  1D1B A;  2ZC2 A;  3OYH A;  2CV2 A;  1XC5 A;  4OJL A;  4XLH A;  2ETH A;  2FML A;  3QWL A;  3TW6 A;  1GR1 A;  4W8R A;  1GUU A;  2DCU A;  3ZBT A;  1EP3 B;  4UVA A;  1YI2 B;  1HG8 A;  3FBI B;  2E1O A;  3I59 B;  3W2G A;  2Q6I A;  4S0H B;  1QGA A;  2OC6 A;  1SVL A;  4M6V A;  1RNL A;  1T6Z A;  2F1L A;  3QQA A;  3GZ5 A;  2V9K A;  4LGW A;  4EM2 A;  3CRZ A;  3AG3 H;  3OIO A;  4PC2 A;  3OV8 A;  4A3F J;  2NT9 A;  1BQE A;  3U1D A;  1JGG A;  1MSE C;  3I1F A;  1Z6T A;  5DYM A;  5FJ8 J;  2GK7 A;  4CQJ A;  1ZTR A;  3V8J A;  2A6H F;  3S2W A;  1MDM B;  3S14 J;  5EEH A;  4RD2 A;  2L7K A;  3ABM H;  5CDF A;  4BXU A;  2MLK A;  3MVP A;  1OKR A;  4AIJ A;  1VQ7 I;  1GJR A;  1QGY A;  2GOX B;  1EFU A;  3JSP A;  1X1P A;  3HUG A;  3F22 A;  2OU2 A;  4HAM A;  4IEJ A;  3GTM J;  4HA8 A;  4Q48 A;  3GSI A;  2BM7 A;  1DAR A;  3IUO A;  3QFT A;  2XDV A;  1FOK A;  5IYN A;  1JRG A;  1WWX A;  1E63 A;  3P7N A;  2OQG A;  3IH3 A;  4JX5 A;  3BP8 A;  4Y7N J;  2EZI A;  2E1C A;  1WGX A;  3GVA A;  5CQG A;  2Q6L A;  2ZKZ A;  3SY2 A;  2AQF A;  3NE5 B;  5J47 A;  3CUQ A;  4NNJ A;  3T9G A;  3ZPP A;  2YWE A;  3BG7 A;  4W8T A;  2E5Z A;  2GIV A;  4OOI A;  5ICC A;  3HOZ J;  2V1U A;  4M1K A;  4GRI A;  4J19 A;  1B72 A;  3W6J B;  1BPL A;  1RUN A;  3CQZ J;  3VMW A;  5FIU A;  1Q86 D;  3RZO J;  4MHG A;  5IP7 J;  1FBS A;  1KQ0 A;  3OOU A;  3D5L A;  4U9U A;  5K7F A;  4E7Z A;  3QU3 A;  1D5V A;  1W36 D;  3J80 Z;  3H9N A;  3LA3 A;  4QVA A;  1FP2 A;  2BEO A;  2NYX A;  3HOW J;  2X8K A;  1KK1 A;  4U87 A;  4DNC A;  1P9Q C;  4C30 A;  1FOX A;  5C4J J;  2ZME B;  2QQ9 A;  2XF6 A;  4NDL A;  4E7H A;  5E17 F;  2VBT A;  2DDB A;  4BL0 B;  3ZN1 A;  3FK7 A;  3KYL A;  3JRG A;  2E1B A;  2HXO A;  1HA3 A;  1OCP A;  3W2W A;  4JOM A;  1XSX A;  1HDP A;  1A04 A;  4LB6 B;  3Q39 A;  4MEY F;  3GTJ J;  4UZE A;  4OM9 A;  1V4R A;  3BR3 A;  2L01 A;  4YAO A;  3V8L A;  5F0F A;  5GPA A;  4ZDP A;  2LKS A;  3K6G A;  1YX5 A;  2C5B A;  2F5E A;  3EET A;  3LMM A;  4CZZ A;  5TIS C;  3WGG A;  3MKY B;  3BY1 A;  1B23 P;  5D4R A;  1HQC A;  2P4W A;  2CUJ A;  4PAB A;  1AMO A;  3RQ4 A;  4FX4 A;  2BOL A;  3GXO A;  1IDK A;  1KON A;  3U2R A;  3QSY A;  4A3E J;  1Y0Y A;  1TLL A;  4WF2 A;  3AL0 C;  2EBI A;  3BG3 A;  4E4H A;  2HLD A;  1QQI A;  3CCU I;  4E7S A;  1VQ4 I;  4M9S A;  3JRE A;  3KLO A;  3LA2 A;  3FMS A;  2L9V A;  2O8K A;  1KD1 D;  3I4P A;  2KHM A;  5JFR A;  1ZGW A;  3S2D J;  2YSR A;  2RDP A;  5TGT A;  1N0U A;  3CCU B;  1R00 A;  3QAH A;  5FRO A;  4R79 A;  2Z33 A;  1FND A;  1OGI A;  1QRB A;  2ZZF A;  1WH5 A;  2LMD A;  3H35 A;  3CZ6 A;  2EPF A;  2BY0 A;  2QQA A;  5ERI A;  4AC0 A;  2R7O A;  1FZP B;  2OBR A;  4BPR A;  3O8H A;  4BS9 A;  1P4M A;  1IA5 A;  2LK2 A;  2E1R A;  5D8L B;  1W0K A;  3E5U A;  2QZA A;  2CYY A;  3HL2 A;  4G6I A;  5AIQ A;  2HZT A;  4IHT A;  4BU2 A;  5TY0 A;  1JUP A;  1Z6R A;  1FNN A;  2VFN A;  1DBG A;  1BM9 A;  3OYA A;  2P5V A;  2H6C A;  2PG4 A;  1QO0 D;  1YJN I;  1UEL B;  2B7C A;  2W84 A;  3L7W A;  1K9M D;  2EFP A;  2F5C A;  2HNH A;  3L2C A;  1VF7 A;  1VQO I;  2EV6 A;  3JQP A;  2E19 A;  1FP1 D;  2ZZQ A;  3EUK L;  2W7N A;  1MBJ A;  1T38 A;  1GVH A;  1YJN B;  4AU7 A;  2V1X A;  5E1W A;  3MZH A;  2GJP A;  4RLQ A;  4DYC A;  3GX4 X;  3K4N A;  3WOD F;  1RUO A;  2VZL A;  3OL3 A;  2DLL A;  2XKO A;  1IRG A;  3QFR A;  2CRV A;  1E3Z A;  2FX3 A;  4HX7 A;  1V5E A;  2BHZ A;  3FXL A;  3WXM A;  3BJO A;  2QGU A;  4XLA A;  2O17 A;  2C77 A;  2HYJ A;  1O3Q A;  3EDP A;  5JBQ A;  2P5L C;  2JJ2 A;  2ZB9 A;  3CME I;  3P27 A;  5DTD A;  5EZG A;  3KZY A;  1K73 D;  4HLY A;  4WCG A;  5IYP A;  1EV7 A;  3E1S A;  3K1M A;  4B8X A;  3G73 A;  2VBW A;  2WAQ A;  3Q38 A;  5FKL A;  2HDC A;  1AHD P;  3CLO A;  3S1R J;  1UB9 A;  3ESW B;  4LG3 A;  2CND A;  3VSU A;  1I50 J;  2GIZ A;  3PL8 A;  3T8T A;  2J8K A;  1MJ9 A;  1Z1D A;  2CG4 A;  2QBY A;  5IYC J;  1QH0 A;  1FT9 A;  2YWF A;  2YUH A;  5FNZ A;  2JRT A;  4OIO F;  4RA2 A;  3SYT A;  3H09 A;  1ZM4 A;  4OZZ A;  3CD6 I;  2NVU B;  2X6W A;  2XPV A;  3ABL H;  5B66 C;  4YRV A;  1N77 A;  2VBV A;  2GXA A;  3W6V A;  3A3G A;  2HVQ A;  1ON2 A;  3EPZ A;  2OA4 A;  3W3C A;  1KU7 A;  3LQQ A;  3VSV A;  3CD6 B;  3CC4 I;  2WB1 A;  3TED A;  1CF7 A;  3QYF A;  2Z3Y A;  2RC6 A;  2DPD A;  1R36 A;  2HPM A;  2UUZ A;  4LLN A;  1I7P A;  1F43 A;  3MCA A;  2CQK A;  1ZUN B;  3H5N A;  2R7T A;  3CC4 B;  3G4S I;  4M73 A;  1OCR H;  2LSO A;  4PMH A;  5F4M A;  1N07 A;  4E7I A;  1LVK A;  1K79 A;  1SD6 A;  3KP7 A;  3JSO A;  1VHO A;  2HMA A;  1I8D A;  4RGR A;  4RLZ A;  3T51 B;  5ILU A;  2UXX A;  1NK3 P;  4B3G A;  2VJJ A;  3AST A;  3G4S B;  5FKM A;  2VLA A;  2MLG A;  4P55 A;  3ZQL A;  2XGD A;  4DGW B;  1LUJ B;  3LNQ A;  5J35 A;  3RDI A;  2B9S A;  2PJP A;  2R7U A;  2MD0 A;  2EIL H;  2GQF A;  3ONY A;  3OKX A;  4PAA A;  2F5F A;  1SC7 A;  2X4H A;  4BAC A;  5FB2 A;  2K5C A;  1O8L A;  3HKZ N;  4ENJ A;  1KTV A;  1HW5 A;  2B63 J;  4XRF A;  1TW3 A;  2Q2E B;  3A02 A;  3IAM 2;  3H94 A;  3Q6Q A;  1HDD C;  3WU0 A;  1K4S A;  2UWM A;  5HDN A;  3I55 I;  2A5W A;  2V6C A;  2XPW A;  4Z4T A;  3SZP A;  3RQI A;  3HPH A;  2F3L A;  3RI4 A;  5A89 A;  3L09 A;  4DW6 A;  1AIR A;  3I55 B;  5J40 A;  3BY2 A;  2UZK A;  1YW7 A;  2B7E A;  4EJW A;  4RDJ A;  4B4C A;  5HLG A;  4XSZ F;  3LSI A;  2CWE A;  3N97 A;  4XRS A;  3ZP5 A;  1CQX A;  1G3Y A;  1B6A A;  4CYC B;  3RKY A;  1YTY A;  2XTX A;  1GV5 A;  3BZ6 A;  5HNF A;  3AG2 H;  1N25 A;  4A0X A;  2MGQ A;  5D4S A;  5LFA A;  2IGK A;  2ZJP F;  3B73 A;  5HLI A;  1XPX A;  4Y9U A;  3RSN A;  3OY9 A;  1R6R A;  2NST A;  1ZN2 A;  5BMZ A;  5J3L A;  1U2R A;  3IWF A;  1OYW A;  3CMA I;  3DU6 A;  1BJA A;  4I0A A;  1W7P B;  3ZQI A;  4UY8 I;  1T6X A;  2INU A;  2VJ5 A;  3BZK A;  1T8I A;  2X3H A;  1OYI A;  4TMT A;  2VJI A;  5J1U A;  2DMQ A;  4II3 A;  4N4N B;  4EGZ A;  3CMA B;  1Z7U A;  3CC2 B;  1Z21 A;  1DPU A;  3OPO A;  1R1U A;  4XN0 A;  3VSK A;  1UJ8 A;  1S4M A;  3K70 D;  2LY2 A;  1TTY A;  2VNI A;  3ZBU A;  5LRR A;  4V02 C;  4GXO A;  3VDX A;  4EM0 B;  3G71 I;  1JB9 A;  1DU0 A;  4L9N A;  4R8H A;  2XGC A;  3C3W A;  4W97 A;  1R4M B;  1I1S A;  5DNS A;  2GXB A;  1VND A;  1R5G A;  3H3U A;  2CF4 A;  5IOY A;  4DOZ A;  2HU9 A;  3G71 B;  1X19 A;  2WC2 A;  2XSJ C;  3M7G A;  2R7D A;  3E1Y E;  1O8F A;  4RDU A;  5BPI A;  3WE3 A;  1S7A A;  1TWG J;  2DT5 A;  2XNC A;  3R6K A;  2OJE D;  3ZZU A;  3HOU J;  4NBS A;  4A93 J;  4Z6Y A;  2VBX A;  4P9F A;  1VQP I;  3FPK A;  3DP7 A;  3IKT A;  3HTS B;  2R0Q C;  4E7J A;  3U6K A;  2RC5 A;  5FKN A;  2YU3 A;  3L2V A;  1H8E A;  4OP7 A;  3VO1 A;  1ZM2 A;  5IYW A;  2O6W A;  4QWQ A;  1ZM3 A;  4HWV A;  1BL0 A;  5KCM A;  1KU2 A;  2LRD A;  2ELJ A;  2VJ4 A;  4MTE A;  1OGM X;  5BS6 A;  2QYO A;  2BM1 A;  2PMU A;  3B90 A;  4KT6 A;  2JPC A;  3DFG A;  3KLN A;  4A6E A;  1QUF A;  2X0L A;  2JSC A;  3BOQ A;  4M6Y A;  4DQ2 A;  2MG4 A;  1NHA A;  3B02 A;  5J4V A;  2A05 A;  5D5W B;  2QSH X;  4WWV A;  2ZNZ A;  4M3G A;  4M3D A;  1K61 A;  2PLF A;  2XKP A;  1SAU A;  5FL7 A;  3TDZ C;  5GAD J;  1RR8 C;  3MWM A;  1AWC A;  1B4A A;  1IN4 A;  1W4M A;  1QHG A;  2XRN A;  1K7A A;  1TC3 C;  1WJF A;  1OFM A;  4JX6 A;  2F5D A;  2OQR A;  3KEY A;  4DZJ A;  4DK1 A;  3Q0U A;  2BGI A;  3CCS I;  2PYG A;  2HTJ A;  2DU9 A;  1Y6I A;  3WHB A;  1L3L A;  2XF5 A;  1DDN A;  2ZJR F;  4ZYE A;  3CUQ C;  3CCS B;  2GRE A;  1WU8 A;  2KIU A;  2JK3 A;  4IJA A;  3U6B A;  3ZOB A;  1LEA A;  4R71 A;  1SAN A;  2MH2 A;  2ME6 A;  1TZL A;  1B2R A;  3COA C;  4CGZ A;  4CCJ A;  3OIP A;  3GW2 A;  3PM1 A;  2KIQ A;  2ZTN A;  1XQB A;  1OCC H;  1PLU A;  3BH6 B;  2LTP A;  4ZDO A;  2BGC A;  1BJZ A;  3PA2 A;  4UZU A;  5K1Y A;  2LBF A;  5JVT A;  5DM6 F;  1D1A A;  3LYC A;  2M4K A;  2HVS A;  1LDD A;  2KT0 A;  4HPQ A;  3S17 J;  1SFX A;  3C2G A;  3PSF A;  5EMN A;  2R5Y B;  5J3O A;  2PMZ A;  3BTI A;  2WAE A;  2R7Q A;  5EF6 A;  1IG7 A;  1JJ8 C;  1UZC A;  4TSF A;  5BQT A;  1G4D A;  2JQ7 A;  2F6C A;  3NB2 A;  1E3O C;  1DBO A;  5DCM B;  1Y1V J;  1W34 A;  3CF5 F;  1JI8 A;  4QVJ A;  2ZIT A;  1Z3Y A;  2M45 A;  4JYK A;  3RPU A;  1VQ8 I;  4YFK F;  1IF1 A;  1YHQ I;  2OTJ I;  1MMG A;  1QZY A;  2P6S A;  3HTU A;  2ZSI B;  2LKP A;  5DD8 A;  4E7K A;  4P3Y A;  4AM3 A;  3TO6 A;  3A03 A;  3R4K A;  4PFO A;  2OTJ B;  1TYX A;  4JMQ A;  4I99 C;  2PX9 A;  5M3M J;  3QFC A;  3UW0 A;  3AVW A;  2Z1D A;  3DBH B;  1XFO A;  1I27 A;  1IZ1 A;  2RQQ A;  1XB2 A;  4YG2 F;  2V7U A;  4IRH A;  3P9C A;  2EFN A;  1QG0 A;  1NHC A;  3CP2 A;  2XB0 X;  2VPR A;  4XKC A;  2BM4 A;  2NZM A;  3MFK A;  2WTE A;  3J81 K;  2YPR A;  3HDD A;  2K3F A;  2BBY A;  1KC8 D;  4BAY A;  4N3G A;  4WXD A;  4EJO A;  2DMT A;  1UD5 A;  1OHH A;  3MEX A;  4Q47 A;  1APL C;  3E6C C;  2LFB A;  4V19 K;  2WV1 A;  2FBI A;  1YX3 A;  2XTY A;  3PUB A;  3LAP A;  1MD0 A;  1WZ2 A;  2DOG A;  3S8P A;  3GQA A;  1R5I D;  3EQL F;  3K2Z A;  4CA0 A;  4A3B J;  3HBL A;  2FJ1 A;  1SM4 A;  1OCO H;  2WJV A;  2DT6 A;  4OIQ F;  1BX1 A;  2FQ4 A;  1BW6 A;  2L3D A;  2DYS H;  4TMV A;  2DER A;  4AVZ A;  2QEX I;  1N8R D;  5K7H A;  5IPA A;  1FMV A;  3FXJ A;  4PZJ A;  4XNF A;  4P12 A;  2UVF A;  2L7Z A;  2ID6 A;  2K40 A;  2ZBK A;  3L1P A;  1BHE A;  2D74 A;  5DD4 A;  1R58 A;  4EVI A;  3CCL I;  1O7F A;  3OIQ A;  3D5R C;  5F27 A;  1MBG A;  2Y9Z A;  2FMY A;  2LH9 A;  3ES9 A;  2B0R A;  5EG0 B;  1IRF A;  2VIX A;  2ZME A;  1QA3 A;  3CCL B;  1HBX G;  2NTQ A;  1BJK A;  1MBE A;  4HSR A;  2HPI A;  4PK4 A;  1KQ8 A;  1ODD A;  3A0B C;  3QPH A;  3BY6 A;  2M34 A;  4M53 A;  4V2G A;  1WKM A;  1I3A A;  1FIA A;  1V54 H;  2A61 A;  2KJB A;  2EQR A;  3X2Q H;  3GTK J;  2EIN H;  4B4D A;  3KCC A;  1ETO A;  1Z7L A;  1MNM C;  2DFH A;  1EFT A;  4RAY A;  3JRA A;  2PI0 A;  3ZMS A;  2F4I A;  4XK4 A;  2UXN A;  3CW2 A;  4RJL A;  5H5J A;  3G6E I;  3HOS A;  4MXN A;  3F9K A;  5HS7 A;  1Z67 A;  2RAE A;  3KZI C;  3HHH A;  1G7R A;  3H9J A;  1Q82 D;  4YFX F;  5GAG J;  2RRE A;  3T1B A;  3EQN A;  2ZXW H;  4HG2 A;  1QPM A;  3G6E B;  3OR2 C;  4YHB A;  5HVQ C;  2HOA A;  4G7X A;  3M07 A;  4L8J A;  2QXZ A;  1TWA J;  2K9M A;  3R6S A;  4ENN A;  2DBB A;  3LQR A;  1W7P D;  5BSY A;  4G6T B;  3RIQ A;  2JUC A;  3CDI A;  1EH8 A;  2HFH A;  5LHI A;  1Y8R B;  4DIQ A;  2V7Q A;  1HF2 A;  3WTZ A;  1T33 A;  3DBR B;  3R61 A;  5IYQ A;  2Z2S B;  4H4K C;  2M3A A;  4YII A;  5D5V B;  1UAA A;  4OIP F;  3CB4 A;  2DFI A;  3CO6 C;  4AYB N;  2UV1 A;  4EV0 A;  1S7E A;  4UB8 C;  5B3S H;  1A35 A;  2BF4 A;  1BOA A;  2BXZ A;  3CCE I;  4XD7 A;  3Q0V A;  3E97 A;  2R5Z B;  2OBT A;  1E43 A;  3FIS A;  5EEA A;  1ZM9 A;  3BT9 A;  2QF7 A;  3AVX A;  2O3F A;  1J2X A;  5JI6 A;  4A5M A;  3BQJ A;  1MMA A;  1W0U A;  4NHJ A;  4M3B A;  2HKO A;  2XZP A;  3PSI A;  4M72 A;  4OOX A;  3FWE A;  2BHY A;  4HW0 A;  1N08 A;  4G7H F;  5EJC A;  2GWR A;  3VFZ A;  3OYK A;  2Y69 H;  2B7B A;  4DQL A;  1W36 C;  4C43 A;  3ZUG A;  3WHC A;  1WOS A;  4KKT A;  1G59 A;  1RMG A;  4L9V A;  2F4O B;  3BLY A;  3TKY A;  5H2F C;  1D0Y A;  4L0Z B;  3HAG A;  3IWZ A;  3PNY A;  4FAS D;  5E3M A;  3IRR A;  2WPD A;  3OYL A;  1M1E B;  2KL4 A;  1A36 A;  2IA2 A;  1DG1 G;  2EA4 A;  1EA0 A;  3AFH A;  1T98 A;  2LC2 A;  1ZGJ A;  4XBF A;  3TGN A;  4A6D A;  1XX5 A;  2DAO A;  3HHG A;  2IS4 A;  5CJ9 A;  1VHE A;  3L9F A;  1O57 A;  1YIJ I;  5FLV A;  3RYP A;  4X06 A;  2MW8 A;  4CYD A;  1RC9 A;  3BG9 A;  1R7J A;  3CJQ B;  4CDG A;  5GAE J;  3HEF A;  1PP7 U;  2CV0 A;  3AK5 A;  4W8S A;  1I6X A;  4PC1 A;  1YIJ B;  4BBR J;  3FX3 A;  4HEA 2;  3FM3 A;  4YIF A;  4ZZL A;  4RB1 A;  2JWT A;  3KYC B;  3OYG A;  1HC8 A;  2ID3 A;  3FXM A;  3BR2 A;  2EZH A;  1EKE A;  5A8A A;  3B6A A;  5AN9 A;  2CQQ A;  2PMD A;  3OYJ A;  3ZZ0 A;  2RNG A;  2I5U A;  2E7X A;  1LFB A;  2WY7 Q;  3KFW X;  4AC9 A;  1WOO A;  3CMY A;  4A0Z A;  4EH1 A;  2E71 A;  3ZQH A;  4YZQ A;  3LSM A;  1PYV A;  2CUE A;  1IJE A;  3DPL C;  4D7M A;  1MSF C;  1XMK A;  5GTI C;  4LBZ A;  1FX7 A;  4ZYA A;  5KAF C;  2VFO A;  1TT0 A;  1DU6 A;  4PCQ A;  3LSK A;  4Z4S A;  2V7F A;  1PJ7 A;  2P0W A;  2WBM A;  3J7A O;  1V5V A;  3NAW A;  4KIS A;  4EW9 A;  2MBF A;  2GOM A;  3FPP A;  4AIH A;  5E6T A;  4FE4 A;  4IRG A;  1SKQ A;  1BN5 A;  3HSR A;  3DU1 X;  4IF4 A;  2CFX A;  1N0V C;  4LG0 A;  3S3M A;  1XCB A;  3CCM I;  1IDJ A;  4RBO A;  4HNU A;  1UD3 A;  1F36 A;  2QTL A;  3J81 Z;  2Z99 A;  2XIG A;  3RY8 A;  3VEP A;  1W2B B;  2DFF A;  3CCM B;  1YE9 A;  2W1O A;  3DTE A;  4Z4V A;  3GTL J;  2H6B A;  5E3L A; 
#chains in the Genus database with same CATH homology
 4BS9 A;  1IA5 A;  2KMU A;  3OE7 A;  3CMM A;  1W0K A;  3HL2 A;  4BQN A;  2CS3 A;  3HUG B;  4G6I A;  4BU2 A;  3GQ8 A;  3LFU A;  3UR3 C;  1I18 A;  2BW3 A;  1DBG A;  2L9N A;  2NTB A;  4NK6 A;  5C1C A;  4RM3 A;  3OYA A;  1JTA A;  2L2O A;  3RCO A;  1MMN A;  1UEL B;  1PXZ A;  4Z06 A;  5HOO A;  3K4L A;  2CV1 A;  2HNH A;  3I9V 2;  1VF7 A;  1LFP A;  3H9Q A;  4BGD A;  2VKD A;  3OYI A;  2PYH A;  1UD6 A;  2ZZQ A;  3EUK L;  3GBG A;  2W7N A;  3H9G A;  4AU7 A;  3T53 B;  2VAS A;  3K4M A;  3VYS B;  2GJP A;  4RLQ A;  2QY1 A;  3K4N A;  1NG7 A;  4F55 A;  3OL3 A;  4TKO B;  4B44 A;  1E1R A;  1UG0 A;  3K4B A;  1EE6 A;  1E3Z A;  2R7V A;  1V5E A;  1E79 A;  3B4N A;  4XLA A;  2O17 A;  2VXD A;  2NSP A;  2K3P A;  4JQF A;  4IX7 A;  2E1M B;  2JJ2 A;  3OW7 A;  4W8Q A;  3BC9 A;  2MAB A;  4PJL A;  2X6Y A;  4NC8 A;  3E1S A;  3ONQ A;  3VWB A;  4XON A;  1FMW A;  3OEE A;  2DT7 B;  2WAQ A;  3MKW B;  3BC8 A;  5AMV A;  4XMY A;  1WPC A;  1K5C A;  4LG3 A;  3VSU A;  2INV A;  2O5R A;  4MLO A;  3PL8 A;  1COW A;  2KQR A;  4DBQ A;  4BE1 A;  1KCD A;  5DN6 A;  4FXU A;  2D3N A;  3SYT A;  2XND A;  2M7A A;  4OZZ A;  3OYE A;  2VBE A;  2HQA A;  2VQC A;  1KZL A;  2X6W A;  4YRV A;  1UD2 A;  1N77 A;  2F43 A;  1O8J A;  2Z6B D;  2JUG A;  3A3G A;  2HVQ A;  1BMF A;  2QKM B;  3EPZ A;  3W3C A;  3VSV A;  3BCD A;  2PEC A;  4NK8 A;  1KMH A;  3OS1 A;  4ASU A;  3DKX A;  2WB1 A;  3VR6 A;  3QYF A;  4QPO A;  5IK2 A;  3A2K A;  2VQL A;  3S3N A;  3OEH A;  5JHF A;  2HPM A;  3HOT A;  2UUZ A;  2LG4 A;  3G2B A;  3S93 A;  4XKB A;  4XM3 A;  1RWR A;  3V42 A;  3ZSC A;  3H5N A;  2R7T A;  5CQE A;  1HVX A;  4DNR B;  2R7R A;  4PMH A;  2BVM A;  4E7I A;  1LVK A;  1OR7 C;  3FHN A;  3HG9 A;  4CZC A;  1GQ8 A;  4YXW A;  1I8D A;  3T51 B;  3OYF A;  3K10 A;  4B3G A;  2VJJ A;  2R7S A;  1DQU A;  2L9S A;  2VLA A;  1RU4 A;  2QX3 A;  4MR0 A;  4DGW B;  4ANJ A;  4BE0 A;  4KKS A;  2R7U A;  2MD0 A;  4FET A;  3PNT A;  3K4C A;  2V4J C;  4BAC A;  4KIT B;  4B3X A;  2KZV A;  2K5C A;  2M5S A;  1J09 A;  1O8L A;  4NUB A;  3C2H A;  2Q2E B;  3IAM 2;  3H94 A;  1O8G A;  2UWM A;  2LY1 A;  5KNL A;  2A5W A;  2ODL A;  2IS1 A;  5CKT A;  3HPH A;  4E7L A;  2CH0 A;  3BCA A;  1GLN A;  3OFN A;  1AIR A;  2WY8 Q;  1O8E A;  2HZD A;  1ZEL A;  1E3X A;  5HLT A;  2JIZ A;  1N78 A;  3WWG A;  3GVK A;  3LSI A;  3RTR A;  2IGN A;  2IGO A;  4LIT A;  2V1N A;  4OAY A;  4GQN A;  1VJS A;  3OYN A;  4II2 A;  2AQE A;  4BQQ A;  5HNF A;  1WP6 A;  1O8I A;  3VST A;  4PJM A;  3DLA A;  2JVH A;  3MD2 A;  2IGK A;  5LFA A;  2CK3 A;  3LNN A;  2HDW A;  1T95 A;  4D9J A;  3RSN A;  3OY9 A;  3K70 C;  1H8H A;  1R6R A;  2NST A;  2M0M A;  3DQV C;  3E0J B;  3DU6 A;  4NC7 A;  2INU A;  2VJ5 A;  2XOK A;  2X3H A;  4C9Y A;  1V0E A;  2V26 A;  4OAZ A;  4P1W A;  4XOR A;  2VJI A;  1Z3X A;  2W6J A;  4II3 A;  4N4N B;  3K4J A;  3W2V A;  1Z21 A;  3G05 A;  2Q1Z B;  4RMN A;  3OPO A;  2Z16 A;  4BXF A;  2JJ1 A;  2OUM A;  4XN0 A;  3VSK A;  4ZJZ A;  1VLY A;  3PFY A;  1XG2 A;  2CW8 A;  4IZZ A;  4B43 A;  2JSP A;  2WAD A;  4DJA A;  2GK6 A;  4OJO A;  3K70 D;  2LY2 A;  3CF2 A;  3MKZ A;  4DBR A;  3OYM A;  3HKZ A;  2NTP A;  4OWR B;  4CCK A;  3VDX A;  2ZFU A;  3L2U A;  1KTW A;  3KRG A;  1O8D A;  2CMP A;  4F3Q A;  1PKV A;  2KVO A;  3D5S C;  4DOZ A;  2HU9 A;  1LKX A;  1WJD A;  1X19 A;  3OWT A;  1PJR A;  2XSJ C;  4CCL A;  2NT6 A;  3DEE A;  3JUR A;  3DKY A;  5HNH A;  4N4O B;  3HC7 A;  4U49 A;  1SKY B;  1WTH D;  4XKW A;  4XLF A;  3T56 B;  1DGW Y;  3ZIA A;  5C1E A;  2VBK A;  3OS0 A;  3VMV A;  2R7W A;  1HA8 A;  1EFR A;  1X0C A;  2M4G A;  4E7J A;  3IAS 2;  4G7W A;  3A1Y A;  3UNG C;  4U4B A;  1WJB A;  4XLE A;  4XOP A;  3WQZ A;  2Y0S A;  3L2V A;  1H8E A;  3OS2 A;  1O88 A;  2LYC A;  2LBF B;  4D1Q A;  2VKH A;  3MMY B;  4RLF A;  3GQ9 A;  4HWV A;  1QJV A;  2R4G A;  4RM2 A;  5KCM A;  2LRD A;  2I8D A;  2VXZ A;  4E6K G;  2ELJ A;  2VJ4 A;  1QHH D;  1OGM X;  2OV7 A;  2MYS A;  4YZA A;  3TBI A;  3B90 A;  1D0X A;  1SFK A;  4KT6 A;  4YZ0 A;  2JDI A;  2W6I A;  3QYE A;  5FRM A;  4CCN A;  3VYT B;  2F1M A;  1HZE A;  3ZXS A;  1OFL A;  1BOB A;  2DXI A;  1OB0 A;  1SAU A;  5FL7 A;  3CP8 A;  2E60 A;  4BQO A;  4KKU A;  1NRK A;  2MC4 A;  1D1C A;  2BSP A;  1QHG A;  2IS2 A;  1OFM A;  1WJF A;  1BR1 A;  3KEY A;  2D3L A;  3TMO A;  3ZQQ A;  4DK1 A;  3HPG A;  3B8Y A;  1X1D A;  2MFZ A;  2PYG A;  4IKF A;  2Z8G A;  3VYU B;  4PJN A;  1Y6I A;  3OYB A;  1WFX A;  2O0W A;  2XF7 A;  1V5F A;  2XF5 A;  2VBM A;  1K6Y A;  2ZXI A;  1IRX A;  2CFO A;  2IS6 A;  1X4P A;  1W9X A;  1UD4 A;  1E1Q A;  1TZL A;  3DDY A;  3SDB A;  4XOT A;  4CCJ A;  3OIP A;  2ZTN A;  3M8J A;  4BJ5 C;  4YZX A;  2KRC A;  3LL7 A;  4ZDO A;  4XQF A;  4UZU A;  2X1C A;  2LBF A;  4P22 A;  1D1A A;  2M4K A;  1VZ0 A;  2HVS A;  2V6E A;  3U21 A;  4IQJ A;  4HPQ A;  3PSF A;  3C2G A;  4HST A;  2LZJ A;  4OJ5 A;  2XGJ A;  1ERD A;  1W0J A;  2KPM A;  2DOA A;  2PMZ A;  1D0Z A;  2E1M C;  3KEW A;  5FRN A;  2WAE A;  2R7Q A;  4F92 B;  4XKV A;  3JU4 A;  4TSF A;  4CCM A;  2F6C A;  3A4C A;  3A35 A;  1DBO A;  3AL0 B;  4DK0 A;  3LSH A;  1JI8 A;  1Z3Y A;  3BG6 A;  4BJT A;  3DPU A;  4Z1M A;  1MMG A;  4XN3 A;  4Z05 A;  3SZG A;  2ZSI B;  2CW7 A;  2WA0 A;  4E7K A;  4HRI A;  4PFO A;  1NG6 A;  2W00 A;  4JMQ A;  1EA3 A;  3NWS A;  4BJ6 C;  3UW0 A;  3PJR A;  2Z1D A;  3CES A;  2RQQ A;  2DJI A;  3DWL E;  4OZY A;  3EQO A;  1NHC A;  3VSL A;  3GRH A;  3CP2 A;  2W4S A;  4F52 A;  4XKC A;  3FBN B;  4TT3 A;  3QYB A;  2NZM A;  2KRH A;  2XZL A;  3OYC A;  3L2R A;  2VB6 A;  3S32 A;  2IXS A;  3QOD A;  2O1D A;  1V5G A;  4B47 A;  1UD5 A;  4C2T A;  1OHH A;  1T5E A;  4BEH B;  3NWT A;  4CH7 A;  1U0J A;  3S3O A;  4Y4R A;  2X1E A;  2X1D A;  4LIU A;  2R7X A;  1YX3 A;  3PUB A;  3LMW A;  3GQA A;  3S8P A;  2O04 A;  3GVL A;  1T0F C;  3FKJ A;  3SEZ A;  4CA0 A;  2X6X A;  2UVE A;  2WJV A;  3GQB A;  2DT6 A;  1LDK B;  2WZP P;  2DCE A;  4F93 B;  4URR A;  4XR6 A;  3SEQ A;  3VYR B;  4J01 A;  4AVZ A;  3CJR B;  1FMV A;  5LD2 C;  1MND A;  4EAT A;  4XNF A;  1MAB A;  4LIV A;  2UVF A;  4F91 B;  3ZPN A;  2X51 A;  2KLO A;  4B48 A;  1BHE A;  2QE7 A;  1Y56 A;  3BH4 A;  2WAF A;  3OIQ A;  4E0F A;  1O8H A;  3D5R C;  3H5R A;  1AA7 A;  4PSX A;  4HNT A;  2LH9 A;  4Y3O A;  3DTI A;  4XL9 A;  3ZR8 X;  2O0V A;  2XC7 A;  2VIX A;  4IQ4 A;  1DP3 A;  2NTQ A;  2NOJ B;  2VQG A;  4HSR A;  2HPI A;  4CSW A;  4ZTF A;  4B3F X;  4PK4 A;  3ZCO A;  2IGM A;  4KJZ A;  1BR2 A;  2E5N A;  3H0D A;  2XZO A;  1WJA A;  2VQH A;  2M7B A;  2GJK A;  4CUG A;  3AKZ A;  3OR1 C;  3OL4 A;  2PJR B;  1Z7L A;  3ZGK A;  4BEH A;  4BE2 A;  4BUP A;  4I84 A;  2F4I A;  3DU5 A;  4C2U A;  4Z03 A;  4DNT B;  1BLI A;  3HOS A;  3GVJ A;  3F9K A;  2K9L A;  3I3L A;  4MXN A;  1OGO X;  4BDZ A;  2CV2 A;  1D1B A;  3OYH A;  3H9J A;  2L5Q A;  3EQN A;  2RRE A;  2QKL B;  3HXL A;  4OJL A;  4XLH A;  4HG2 A;  4NQW B;  4W8R A;  3OR2 C;  1FX0 A;  2VPL A;  5HVQ C;  4G7X A;  3EUA A;  1O8K A;  1HG8 A;  3FBI B;  4L8J A;  1X1B A;  1BR4 A;  2K9M A;  3LSG A;  2QXZ A;  4G6T B;  2X53 S;  1VBL A;  3OMY A;  2ZZE A;  2OC6 A;  1WJ5 A;  4DIQ A;  2V7Q A;  1KCC A;  2V9K A;  1PE9 A;  2Z2S B;  4H4K C;  2M3A A;  2GJR A;  2KP6 A;  1UAA A;  3W2A A;  4C2L A;  2IQ7 A;  2ZTG A;  3H5A A;  2UV1 A;  3L2Q A;  2NT9 A;  1V0F A;  2R9V A;  1E0E A;  2CUZ A;  1WMR A;  1IB4 A;  2GK7 A;  4XD7 A;  1UD8 A;  2WJY A;  2L7K A;  5CDF A;  2KDO A;  1E43 A;  4PJJ A;  2GOX B;  3PNV A;  4OJ6 A;  1CZF A;  1MMA A;  2XZP A;  3BCF A;  3PSI A;  1O8M A;  4PFP A;  3OYK A;  2V4D A;  2LRE A;  1QU3 A;  1W36 C;  3IUO A;  2PJR A;  2XDV A;  4ZTJ A;  1JRG A;  4J00 A;  2ZZG A;  4KKT A;  1G59 A;  1PLU A;  1RMG A;  3BLY A;  5CQG A;  4QPQ A;  1O8F A;  3L2W A;  1D0Y A;  4X0G A;  2A6T A;  2AQF A;  3FDY A;  3HAG A;  4NNJ A;  3NE5 B;  3PNY A;  4FAS D;  3T9G A;  3ZPP A;  2WPD A;  3OYL A;  3BG7 A;  2KL4 A;  5HKK A;  2E5Z A;  4W8T A;  2JA2 A;  3DTK A;  1NBM A;  4HIZ A;  2ZXH A;  4GRI A;  1BPL A;  3VMW A;  1DGR M;  3GQ7 A;  3AFH A;  1MW7 A;  3ZRG A;  2LC2 A;  2EWE A;  3OOU A;  3D5L A;  2IS4 A;  2V31 A;  4ZDL A;  4E7Z A;  1W36 D;  3SUC A;  1N75 A;  3CJQ B;  2CV0 A;  3N05 A;  2X8K A;  4U87 A;  5KHD A;  1X1C A;  1P9Q C;  4C30 A;  4W8S A;  2XF6 A;  4E7H A;  4BL0 B;  4U7B A;  4HEA 2;  3KYL A;  4AYB A;  2E1B A;  2W82 A;  3KX2 A;  2DIE A;  2JVG A;  1MNE A;  3OYG A;  3M1C A;  4BDY A;  3W2W A;  4JOM A;  2VL8 A;  1MMD A;  3RPU D;  2X85 A;  5CPR B;  1WJE A;  2BW3 B;  3TL4 X;  1OOC A;  3OYJ A;  1X4O A;  4PSW A;  2RNG A;  4YEJ A;  4Y33 A;  4OJP A;  2WY7 Q;  4YZQ A;  4ZC3 A;  3LSM A;  4ZDP A;  1PYV A;  3FY3 A;  3K6G A;  1YX5 A;  1QCX A;  3DPL C;  3BCB A;  1WJC A;  3LMM A;  1OLT A;  3MKY B;  3DPT A;  4ITV A;  4ZYA A;  1TT0 A;  4P5O A;  4PUS A;  3LSK A;  2CUJ A;  2V7F A;  1H80 A;  1G8X A;  3RQ4 A;  4YEL A;  2P0W A;  2WBM A;  4EW9 A;  2BOL A;  4KIS A;  1IDK A;  3FPP A;  2GOM A;  1KON A;  4CCO A;  3OYD A;  3OAA A;  2ZSH B;  2LOO A;  3AL0 C;  4E4H A;  3EUH C;  2HLD A;  3FKS A;  2FUG 2;  4E7S A;  1K28 D;  3IP4 B;  3S3M A;  4XLC A;  3OOC A;  1IDJ A;  2F5V A;  1S9H A;  2KHM A;  4HNU A;  1UD3 A;  5TGT A;  2WSS A;  5FRO A;  4R79 A;  2BVL A;  2ZZF A;  3H35 A;  1YE9 A;  3J7A Y;  2HVR A;  2W1O A;  3CZ6 A;  3QOE A;  3DTE A;  2XAU A;  2R7O A;  1X1A A;  1BN8 A;  3K4K A;  3A3B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...