4YFAA

Structure of n-acylhomoserine lactone acylase macq in complex with decanoic acid
Total Genus 56
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
56
sequence length
167
structure length
167
Chain Sequence
TYSAEIRRTTMGVPHIKAGNWGSAGYGFGYVQAQDNLCTMADSFLTYRGERSRHLGGSAQLVYNSTLGRPRNIDSDFFHRHVISDEAVDRTMAAQPAKLLQMVEGFAAGYNRYVREAKAGGSAHAACRSEAWVQPITARDVWRRIYAANLAGGYSNFAEAIANAQPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Protein related to penicillin acylase
publication title Bifunctional quorum-quenching and antibiotic-acylase MacQ forms a 170-kDa capsule-shaped molecule containing spacer polypeptides
pubmed doi rcsb
source organism Acidovorax sp. mr-s7
molecule tags Hydrolase
total genus 56
structure length 167
sequence length 167
chains with identical sequence D, G, J
ec nomenclature
pdb deposition date 2015-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.439.10 Mainly Alpha Orthogonal Bundle Penicillin Amidohydrolase; domain 1 Penicillin Amidohydrolase, domain 1 4yfaA00
4M1JA 4WKVA 1GM7A 4WKUA 1AI7A 1JVZA 3ML0A 4HSTA 1CP9A 2ADVA 1KEHA 2WYDA 4BTHA 1KECA 1GK0A 3JTRA 3JTQA 1GK9A 1K5SA 1GM8A 1PNMA 4E57A 1JW0A 1PNLA 1K5QA 2AE5A 2WYCA 4K2GA 4WKTA 1GK1A 1GM9A 1AI6A 1AJQA 4K2FA 4YFAA 3SRAA 3SRCA 1AI4A 1FXVA 1H2GA 1FM2A 1OR0A 2AE4A 1PNKA 3L94A 4E56A 1E3AA 1K7DA 4PELA 1GKFA 2AE3A 4YF9A 1JX9A 1FXHA 1AJNA 2WYEA 3SRBA 4HSRA 4WKSA 4PEMA 1GHDA 4E55A 3K3WA 2WYBA 1AJPA 1AI5A 3S8RA 4YFBA 3L91A
chains in the Genus database with same CATH superfamily
4M1JA 4WKVA 1GM7A 4WKUA 1AI7A 1JVZA 3ML0A 4HSTA 1CP9A 2ADVA 1KEHA 2WYDA 4BTHA 1KECA 1GK0A 3JTRA 3JTQA 1GK9A 1K5SA 1GM8A 1PNMA 4E57A 1JW0A 1PNLA 1K5QA 2AE5A 2WYCA 4K2GA 4WKTA 1GK1A 1GM9A 1AI6A 1AJQA 4K2FA 4YFAA 3SRAA 3SRCA 1AI4A 1FXVA 1H2GA 1FM2A 1OR0A 2AE4A 1PNKA 3L94A 4BWCA 4E56A 1E3AA 1K7DA 4PELA 1GKFA 2AE3A 3FGTA 4YF9A 3FGRA 1JX9A 1FXHA 1AJNA 2WYEA 3SRBA 4HSRA 4WKSA 4PEMA 1GHDA 4E55A 3K3WA 2WYBA 1AJPA 1AI5A 3S8RA 4YFBA 3L91A
chains in the Genus database with same CATH topology
4M1JA 4WKVA 1GM7A 4WKUA 1AI7A 1JVZA 3ML0A 4HSTA 1CP9A 2ADVA 1KEHA 2WYDA 4BTHA 1KECA 1GK0A 3JTRA 3JTQA 1GK9A 1K5SA 1GM8A 1PNMA 4E57A 1JW0A 1PNLA 1K5QA 2AE5A 2WYCA 4K2GA 4WKTA 1GK1A 1GM9A 1AI6A 1AJQA 4K2FA 4YFAA 3SRAA 3SRCA 1AI4A 1FXVA 1H2GA 1FM2A 1OR0A 2AE4A 1PNKA 3L94A 4E56A 1E3AA 1K7DA 4PELA 1GKFA 2AE3A 4YF9A 1JX9A 1FXHA 1AJNA 2WYEA 3SRBA 4HSRA 4WKSA 4PEMA 1GHDA 4E55A 3K3WA 2WYBA 1AJPA 1AI5A 3S8RA 4YFBA 3L91A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M1J A;  4WKV A;  1GM7 A;  4WKU A;  1AI7 A;  1JVZ A;  3ML0 A;  4HST A;  1CP9 A;  2ADV A;  1KEH A;  2WYD A;  4BTH A;  1KEC A;  1GK0 A;  3JTR A;  3JTQ A;  1GK9 A;  1K5S A;  1GM8 A;  1PNM A;  4E57 A;  1JW0 A;  1PNL A;  1K5Q A;  2AE5 A;  2WYC A;  4K2G A;  4WKT A;  1GK1 A;  1GM9 A;  1AI6 A;  1AJQ A;  4K2F A;  4YFA A;  3SRA A;  3SRC A;  1AI4 A;  1FXV A;  1H2G A;  1FM2 A;  1OR0 A;  2AE4 A;  1PNK A;  3L94 A;  4E56 A;  1E3A A;  1K7D A;  4PEL A;  1GKF A;  2AE3 A;  4YF9 A;  1JX9 A;  1FXH A;  1AJN A;  2WYE A;  3SRB A;  4HSR A;  4WKS A;  4PEM A;  1GHD A;  4E55 A;  3K3W A;  2WYB A;  1AJP A;  1AI5 A;  3S8R A;  4YFB A;  3L91 A; 
#chains in the Genus database with same CATH topology
 4M1J A;  4WKV A;  1GM7 A;  4WKU A;  1AI7 A;  1JVZ A;  3ML0 A;  4HST A;  1CP9 A;  2ADV A;  1KEH A;  2WYD A;  4BTH A;  1KEC A;  1GK0 A;  3JTR A;  3JTQ A;  1GK9 A;  1K5S A;  1GM8 A;  1PNM A;  4E57 A;  1JW0 A;  1PNL A;  1K5Q A;  2AE5 A;  2WYC A;  4K2G A;  4WKT A;  1GK1 A;  1GM9 A;  1AI6 A;  1AJQ A;  4K2F A;  4YFA A;  3SRA A;  3SRC A;  1AI4 A;  1FXV A;  1H2G A;  1FM2 A;  1OR0 A;  2AE4 A;  1PNK A;  3L94 A;  4BWC A;  4E56 A;  1E3A A;  1K7D A;  4PEL A;  1GKF A;  2AE3 A;  3FGT A;  4YF9 A;  3FGR A;  1JX9 A;  1FXH A;  1AJN A;  2WYE A;  3SRB A;  4HSR A;  4WKS A;  4PEM A;  1GHD A;  4E55 A;  3K3W A;  2WYB A;  1AJP A;  1AI5 A;  3S8R A;  4YFB A;  3L91 A; 
#chains in the Genus database with same CATH homology
 4M1J A;  4WKV A;  1GM7 A;  4WKU A;  1AI7 A;  1JVZ A;  3ML0 A;  4HST A;  1CP9 A;  2ADV A;  1KEH A;  2WYD A;  4BTH A;  1KEC A;  1GK0 A;  3JTR A;  3JTQ A;  1GK9 A;  1K5S A;  1GM8 A;  1PNM A;  4E57 A;  1JW0 A;  1PNL A;  1K5Q A;  2AE5 A;  2WYC A;  4K2G A;  4WKT A;  1GK1 A;  1GM9 A;  1AI6 A;  1AJQ A;  4K2F A;  4YFA A;  3SRA A;  3SRC A;  1AI4 A;  1FXV A;  1H2G A;  1FM2 A;  1OR0 A;  2AE4 A;  1PNK A;  3L94 A;  4E56 A;  1E3A A;  1K7D A;  4PEL A;  1GKF A;  2AE3 A;  4YF9 A;  1JX9 A;  1FXH A;  1AJN A;  2WYE A;  3SRB A;  4HSR A;  4WKS A;  4PEM A;  1GHD A;  4E55 A;  3K3W A;  2WYB A;  1AJP A;  1AI5 A;  3S8R A;  4YFB A;  3L91 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...