4YFLF

Crystal structure of vh1-46 germline-derived cd4-binding site-directed antibody 1b2530 in complex with hiv-1 clade a/e 93th057 gp120
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
224
structure length
221
Chain Sequence
b'QLEQSGTAVRKPGASVTLSCQASGYNFVKYIIHWVRQKPGLGFEWVGMIDPYRGRPWSAHKFQGRLSLSRDTSMEILYMTLTSLKSDDTATYFCARAEAASDSHSRPIMFDHWGQGSLVTVSSASTKGPSVFPLAPSSKGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160,Enve
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 18
structure length 221
sequence length 224
chains with identical sequence H
ec nomenclature
pdb deposition date 2015-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yflF02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yflF01
2B4CC 1JI1A 1LO0H 5I1LA 4ODTL 3BW9B 5EC1A 2NX5B 2EE2A 3U0TB 3S6CA 1G7HA 1S7TB 2UZIL 4X8JA 5GGSB 5IVXE 4OZ4A 3GMRA 4M9PA 1WBYA 5AEAA 4PJIA 15C8L 1EO7A 3P0GB 3FCTB 2VXUH 2HA1A 3P73A 5F96H 4U1LA 1HHIA 1B9ZA 2VAJA 3VH8B 4GS7B 2VZUA 4NKOA 2EE9A 1GOFA 3BSZH 4FQCH 5K9QG 3MJ8B 5D2LB 4BZ2H 4QY8A 5CD5D 3MROA 4F33B 3C08L 4UINL 2DDQH 1G0XA 4LPXA 4PD4J 4Z7QF 3OKMA 4MNGB 1EMTH 1KPUB 3QWOB 3UJTL 2VSDA 3QEQB 2DS4A 1NANI 3ARXA 1NFIB 2VDML 4PJ9C 4TTDC 4KDTC 2F74B 4QNPF 1KGCE 4XNQA 5KTEL 4LDOB 5D7IF 3HCVB 3OR7A 2JJSA 2I9LA 3C6LA 2YC1A 3NFSH 3O4LB 4U49A 3RPIA 3CFJA 3PABB 2FX9L 2HJFB 5M94B 1D5MB 2XA8L 1R3IL 1I1AD 4OLZL 1NAML 3MCLH 4BFGA 3QCTL 1X5IA 4PGBA 1CGXA 1G7QA 1IMHC 4QRQB 1I9RL 2BMKB 4MB5A 3O6MH 4L1HA 4ONGH 4WWKA 2GSIB 2X6MA 1V7MH 5DVLA 2V2WA 2X4PB 3TCLB 5T3XD 1KCKA 3PL6A 3RX5A 1CXKA 3C8KB 3VXUB 1VEPA 1KEGL 4KFZC 4ZSOE 1GGIL 5T5FL 1LE5A 3WN5C 1MJUH 2VLKD 1OCWH 1LHZA 3I2CL 4N8PA 1EEQA 3SCMC 2JJTA 2NYYD 3T0EE 4HD9A 4JQVA 1JP5A 3QUYB 4PJDB 1FN4A 3QAZB 3FJTA 3NTCH 5B4MD 1B6UA 1GAFL 1X7QA 4PGJA 2DQUH 4A2LA 4X99B 1N0LA 5JNYB 3VRLF 3QDGD 4K7FB 3DUHA 1NEZG 1FIGL 3KPLA 4PBVC 5IMOA 2P5WE 3N1PC 2W60B 3P4OB 4LPWA 4M1DH 4HUKB 3FOLA 3KDMA 1TETH 1T6WA 2G2RA 3SKJL 2NY4C 5J3HD 4I0PB 1S7VB 3LQAH 3BIKA 5HHPA 2FIRT 4XCCH 5JW4M 1B2WL 1UG9A 4JVUA 2Z93A 2OTPA 5CCKL 1AJ7H 1RJYB 4E5XB 3QO0A 1DBBH 3VRJB 2G5BA 4DKEH 4FTVE 4GW5B 2OX5A 2YN5A 3OX8A 1OVZA 3OJVC 2VLRB 3MBEC 4OZIF 1MCPL 1V05A 3L3KA 4KRPB 4YHOL 1QG3A 3CZFA 3IDIA 4L9DA 2L7JA 1T4KA 5JPMA 3RL2A 1BFVL 5I30H 4NQSB 4AK1A 2X4NA 1UQSA 3NCJL 2C3GA 4GAJL 1PEWA 1KIQA 3BI9X 5E4IA 1IRAY 1J8HB 1U8QA 4G7YH 2ZCLL 3KPQB 4NZRH 3WS6C 4FQHA 5HVFB 5C0NC 4GAYB 3DVIA 3CVIH 4HXBL 2R0ZL 4Y5VB 3S88H 2HH0H 1BHGA 5J8OA 5CBEB 5DJZA 5L7XL 4OLYL 4N5ED 1YEDB 2BDNL 2VLKA 3X14A 2WLYA 4R4NC 4Y4KD 4D94A 4P4KB 3JWDH 3BW9A 2DI8A 2W0FB 1FGNH 5CJ5A 1HEZA 5HGBB 4HT1L 1GZPA 1S7TA 4WV1C 1ZLSH 3ALPA 4Y2DD 4AQOA 1MCWM 4Z8FH 3TO4D 3DARA 3G6AB 2DQIL 3QDJE 5LGHL 1R5VB 4NNPH 3QDGA 1FNAA 4QXGH 3F7VA 4MNHA 5IB4B 2NY6B 2ADIA 1SJEB 3SJVE 5IFHL 2B7DT 2QHRL 3ES6A 3MJ8A 1B4RA 5TGBA 1PKQB 1UJ3B 4F33A 5C2BH 1JL8A 3MRFB 3GBLA 4PYHA 3W5MA 3LS4H 5BVJB 5I15H 5I2IA 2VB5A 4MNGA 2Q1EA 3QWOA 5B38B 4NZJA 3QEQA 2QQLL 3C6SB 4GFTB 4I8DA 3QO1B 4P2CG 3BGFB 1FNGA 2VLRD 3TH4T 3B8YA 2XWTA 4OF0A 4TVSa 2H3NB 4A6YL 3K8LA 4JY6B 3I84A 3R4DA 3PABA 1F4XH 4HWEH 3AXLA 2WBKA 3H7LA 3MLUL 4F15B 1I8KB 2BMKA 4MAUH 5C6PB 4GBXC 1RJCA 2X4PA 1CK0L 4F57L 2KDGA 3TCLA 1U3JA 4XHQA 4OD3H 5IW1A 2AQ2A 2YEZB 4NFDA 5EUKB 3C8KA 5I8EB 3TIEA 5JPNB 1EEZB 5I16B 2EDQA 2EYRB 3UAJC 1C7SA 3V6OE 4Z78A 5I1HL 2NXYB 4AIZA 3V7AE 2R4SH 5FUCE 4PJEA 4PJDA 4Y4KA 4MCYA 3V4UH 3DBXA 2VO5A 3OJ2C 2P24A 3KPOA 5I18H 3HE7B 4Z5RB 1XEDA 5EPMB 5EBWB 2JTDA 3BP6A 3PJSA 4X99A 4Y2DA 5JNYA 3DYMA 3G5XA 5F9AC 1XGUA 3TO4A 1ZT1B 3C2SA 3P0YH 1BEYL 3MRCA 5HGDA 2NXZB 2BY1A 4ZXBB 2BRRL 4MWFA 3U0WL 4UILL 3PWNA 2W60A 4BFIA 5E2TL 1MFCH 3L7FA 3IDGA 1NFDE 1FSKC 1A7RL 1RZFH 2AERT 1G7MB 4I0PA 1HIML 4EDWL 1UACH 5TDNA 5M95B 4N9GA 4O00A 3TIDB 2GJJA 4ORZC 1IM9B 1WZKA 4I77L 4APQC 2E27L 1RJYA 4PRPB 1MHPH 1P4BL 3KPTA 4GW5A 2H45A 3IS0X 4F7CB 3Q2CA 2VLRA 4HUXA 3HS0B 4F2MB 1JNJA 4GT7A 2X70B 1INQB 1YEHL 2NZIA 1DLFL 3GSNA 4G80A 4HCRL 2YK1H 1L7IH 5JHLL 4HK0B 5ESVB 4EOWL 1MEXL 5MHSD 1MHEB 3GZKA 3HNVL 3THML 1JHTB 1K9TA 3V5HA 4N8CL 4N0YH 2O5XH 3B2VL 2IBBA 3QEHB 4O9HH 1AC0A 4OQTL 1J8HA 4P5TD 3GSOB 3F7YA 4KHXH 1UGNA 5A2FA 4J4PD 3ZLQC 5DFTA 2XZCH 3SE3C 4PV9A 4PRPE 1QSVA 4U1SB 4NRXB 1MAKA 3U7WL 4XAKD 1H15B 3C5ZD 2D9QB 5FYJH 3H9SB 3DX8B 2W0FA 4WI9A 3OBAA 5E8NA 4ZTPH 4Y16D 1F4WL 4LCWD 4LLQB 4M7KH 2AGJH 4L3CA 5FHAH 2IAMC 5D7IA 4OCWH 1IGIH 1HZHL 1OTSC 5BQ7B 1JCKA 2Z8WC 1JPSH 3VXME 3GNML 1Z9LA 4KZEL 1FH5H 4K94H 4JANB 1QBMH 1KTDA 1SJEA 3WFDH 1U91B 1PKQA 1UJ3A 3C60C 3ARUA 3MRFA 1AKJD 2C3HA 4HIIB 1WGOA 3UTSD 4ZD3L 5BVJA 5B8CA 3DUUA 1GVIA 1PLGL 2UVEA 3RWJA 2NY1B 3GMMA 1LP9F 3QO1A 1J18A 4HFUH 4PRAB 2D7QA 2YWZA 3CSYA 4LU5L 3BGAA 1XGYL 4PJGE 4AH2B 2KQNA 4K8RL 1OARH 4X4YA 3LQMA 5EORL 1FC1A 5FGBA 3ILQC 4PJ5B 1MI5B 2FO4A 2WUCH 2VN7A 3CU1A 3EOBB 4I3GA 5CSZA 4F80A 5D1QB 1I8KA 3L6FB 4PJ7E 5C1MB 2G5RA 3J8F7 4P5TA 5HHQA 5ADOH 3SDYL 3ORJA 3I50H 5I8EA 5EUKA 3NCFB 5AAWA 1U8KB 5DD6B 4OZFA 3GIZH 4FZEH 4PGDB 1WZ1H 4LPYA 3VXNB 5JA8B 5KVFH 2HYMA 5D6DC 3C5ZA 3SKOA 3FZUD 1S7WB 2FCBA 3EO0B 4DGVH 5EPMA 4KDWA 1W72H 4Y88A 3QDME 4P49A 5EBWA 5ESAB 4Y16A 5FM4A 2O5YH 4LCWA 4RNRB 4WI8A 1A47A 2CIIB 4OZIA 2PKDA 1IKFL 1DUZB 4HH9B 3D87B 3EHBD 3CGTA 4I4WB 3S5LG 2BCKA 2EKSB 4NQDD 1WCBB 2C5DC 4RX4D 4RFOL 4UQ2B 4WEMB 3L3HA 2EYSB 1ND0A 1NAKL 3UPRB 5LAXB 5HYSG 3PUCA 4MVBD 3T1WA 1G7MA 1MCQA 3F6IA 1IM3B 1JFQH 1UCBH 3TIDA 1AKJA 4HH8A 1IM9A 1SY6H 1W0VA 3UTSA 1D6VL 1UWEH 4RZCB 3RQ3A 1VGEL 3UZEA 5GS2D 1IC5H 3GSVA 2OL3B 3MLVH 3DIFA 3WNMA 4LIQL 3C6LC 1QNZH 6FABL 4F2MA 1A1MA 5C86A 2BVPB 2X70A 1INQA 4LEXH 4PJ5D 4Z77B 3TV3L 4ZFFA 1MHEA 2OP4H 1HH6B 2AJ3A 3DHMA 2VZSA 1A6ZA 3GSOA 1ZA6B 4RGOL 4RMSA 1QYGL 4ZOEA 3VDBA 3IAQA 1D5XB 2Z91B 4Y1AD 5DMYA 3CLFL 3PL6C 4S1QL 1OTUC 1LDSA 1HXMB 3ILPB 4LARL 4J3WA 1F3DH 3PGCB 3PP3H 4M7JL 3TBYB 4F8QA 1QFWM 3H9SA 3DX8A 2GJ6E 2Z35B 4CMMA 2YRPA 5C09B 1Z9OA 2MPAH 4XI5D 2R29H 5GGUB 2BERA 2M8XA 1ZLVH 3V4PH 5KANI 5ENWB 2XY2A 4PUBH 2OYPA 2JELL 4LSVH 4FNLL 5SWZD 5BQ7A 1D3CA 5E2WL 4BH7B 3MGOA 4Q9RL 1BVKA 1FCGA 1S5IH 3RGVB 3D0LB 4DOHB 4Q6IB 4LKXA 2BNQD 1IZKA 3UC0H 4PD4K 4RX4A 4R26L 4Q0XL 2JB6A 3HPLB 4ONHA 5J57B 3ULUL 4HIIA 2AJUH 3TWCH 4CJ0A 2Y36L 3K80A 3HC0A 1BAFH 2WP3O 3Q6GL 5DTFA 4PRAA 3QXWA 1SHMA 3K4AA 3RNKB 4NKIH 3I75B 2VMFA 3LB6C 4L8DA 5ILTL 1S9WA 1XF4A 2CK0H 4IHOA 2ZCHH 4PJ5A 2GK0B 4K3EL 3ROOA 3P30L 3EOBA 1FRGL 3TA3B 5D1QA 1WFNA 3L6FA 2WAHA 3E6FA 2Q86A 2PO6B 3G5VB 2QR0B 4JRXE 3FKUS 1CD9B 2X42A 3HE6C 4F7TB 4QRRD 3ULVC 3ESUF 3H9ZA 4XPBH 4ZUWB 1REIA 5H2BA 5CFHA 4FS0A 2CR3A 3WNPA 3CXHJ 2AJXL 4PGDA 1HE7A 5BS0D 3ZMRA 4ZO7A 3VXNA 2B39A 1KC5L 4XC1L 1TZIA 2NYYC 4GJTB 4LHUB 1HHHA 2DLFL 3ROLB 3N85L 1KN4H 4GMTH 3ZYZA 2JJUA 2JF1A 5ESAA 1CTOA 3U7YL 3QDAA 2CIIA 3RI5K 1DUZA 3MFFB 3ARFB 4L8SB 2AJYL 4U1NA 1YEKH 5E7FA 3BIAX 4GS7C 2C4XA 3WLBB 4Z18A 5CJBA 4MQXC 2IH1B 4R4BB 2EYSA 1YPZE 4JFOB 3UPRA 35C8L 2QEJA 1G84A 4K71B 4DFIA 4I13B 1A2YB 1HYSD 2AK1L 2V17H 3TEUA 1FL3A 1FPTH 1WC7B 2MSPA 1KV3A 1YEGH 1MQKL 3KLAA 1KJ2L 2WWMC 5T3XL 3WV0A 2BVPA 4Z77A 3VI3F 5JTWA 1AXTH 1QSFB 4OAWB 4AQ1B 1QBLH 4ISVB 4P2YA 4X6CA 3BPCB 5IESL 1HH6A 1AY1H 3Q6FA 3W9DB 2BHZA 4DGIH 5MEND 1RZJC 3DSFH 4G8GD 1JYWA 5J89A 3NZ8B 5GGTA 1I9IH 5EOTA 4O2CB 1T20B 3H2WA 5HHXH 1D5XA 2Z91A 3N06B 3H0TB 3UMTA 4LP5A 5C7XH 1WJ3A 1F6FB 3ILPA 4FQ2H 3ZKNC 2YMXH 3X3FL 2VLJB 3PGCA 1KB5H 3G5YA 4G8IB 2VLMD 1IGCL 2MHAB 2P7TB 3TBYA 3JTTB 3QUYC 4POZC 4U4BA 3EYUH 3OZ9L 3QAZC 1LP9A 1AO7E 4C4KO 4LAQL 3IDNA 5GGUA 1MOEA 4MD4B 2FEDC 5F9DC 1R24A 2BVQB 2H8PB 1QQDA 4ZAKD 2XN9E 1NGZB 1A7NL 5I1GH 1AGBB 4BH7A 5FKPA 1DLHB 1H0DA 2D31B 1CN4A 2DL9A 3L3GB 5CEZD 2Z9TA 1MJJB 1WUNT 3FQXA 1OF2A 5HGAB 4I0PC 5IMLA 1C1EH 3GMOB 5HYJE 3ZT6A 5MEPB 3CCHA 2QQNL 4PLKC 1LEGB 3HAEH 4CVUA 3S97C 2ZPKL 4C59B 1YEFH 5DQJB 3I85A 1JGUL 2V6HA 1AR1D 5EU4B 4HJGB 4KRPC 3V4VL 4E41B 4UOW1 4OV5A 3MLSL 1FDLL 1S78C 1TJIH 4R6UA 5DD1L 1CDYA 2HKFH 3ZTJH 1KN2H 2BXYA 3D85D 3LN5B 1VACA 4NO0D 5L9DL 1MRDL 4JPWL 1YJDL 4JY5H 5ACMA 3U36A 2PO6A 2ZG1A 3G5VA 2QR0A 3GIVA 5IGXL 2FLRT 2B1AL 2AXGB 2DLHA 4Y5VC 4F7TA 2VXSL 4ZUVB 3S4SG 4XWGL 3CFBB 1E6OL 5CKGA 1BJ8A 1I3UA 3DGGB 5IB1B 5F7LB 2Q3AA 2W9LA 4P4KC 4PY7A 4ZDHB 4D2NA 4N9OB 1CWVA 1T80A 4LHUA 1I9JH 3ROLA 3LH2H 2NTSP 3GSRB 5DA4A 2COQA 4IM8A 1Q0XL 3SGJA 1FO0L 1A7PL 3IS1X 4ODTH 2OS7A 4Z7WE 2BSRA 3MUJA 4ZAKA 2UZIH 3RZCD 3O41A 1RFDL 4XWOC 3UZVB 3MJ9A 2C9AA 1BFTA 3IDUA 1T1WB 3KLHD 4ZNCD 1BJ1J 5HI3D 2NY6C 5TE6L 15C8H 4TUKL 5DZNA 1GPOL 1EJOL 4HV8B 4JFOA 1UJ3C 4BK4A 5JXEC 3MLXL 3PGFL 4LCCA 2AAVA 1SBSL 3RWIB 3WNOA 1C5DB 4YHPB 1PEZA 4DTGL 1A2YA 2FX7L 3BGFC 4FMFA 3C08H 4UINH 1LILA 1C12B 4LQFL 1WC7A 3DWTA 3RKDC 3HB3C 1Z9MA 5E2UL 3UJTH 3MRJA 3PWPE 2R39A 2PNDA 2VDMH 5CZVL 1T2XA 2Q7NA 3GKWL 5F3HA 2HP4A 1CXEA 3KVQA 3T0VA 3VG0L 5KTEH 2YD2A 2LQRA 2ADJB 2EDOA 4NSKB 4IDLA 1IAOB 3D85A 2FX9H 3V6FB 4NO0A 5SX5K 2XA8H 3NZ8A 5J06A 1T7XA 4J7RA 1R3IH 2QTEA 4N8VA 4OLZH 1NAMH 3QCTH 1I9RH 3OPZL 4PY8J 4HAGA 2QHLA 3MREA 4KROD 4ELKA 1XGRB 5HY9B 2NXYC 1EHNA 2VLJA 4POYA 1AGCB 2H2PD 1DVFB 4YBQD 1KEGH 1AIFB 2UY6A 3QXVA 1GGIH 5T5FH 2EICA 3WLWC 1YUHB 3HE7C 3I2CH 4LNRB 5C0BE 1BOGB 4LQ1A 2H8PA 1NGZA 5B3JF 4NRZB 2NXZC 5C0GA 1GAFH 4ZXBC 3GBML 3RZCA 5EIQA 4WGWB 1JHLL 1MJJA 2VZTA 2Z31D 4HULB 2X4UA 1SQ2N 1JPFB 3IXTB 3MRKB 4PP1C 3T2PA 5HHOB 3QFDB 4PGZA 1FIGH 4O5LL 3B5HA 4XCEB 4XNXL 5C0JB 5CKAA 2Y72A 1UWGH 5T3ZD 3HZKB 1OGAE 2QV2A 2BZDA 1CZ8H 3SKJH 3TH2T 1LEGA 3V0WL 1FV1B 3O11B 1S8DB 4LIQE 4EQ2A 3QI9D 5DQJA 4QHUA 3G04B 4C58B 3BP4B 1B2WH 2CJUL 4OKDA 5J1AA 5CCKH 3PHOB 4PY8I 1U9KA 2NPLX 4XGZA 1I1CA 4PTUB 4ZFZA 2CGRL 4PJ8D 4XPGL 1BF2A 1WZLA 3LN5A 5F44A 1MCPH 3L9RA 4NM4H 4ZO9A 4YHOH 1A4JA 2E6QA 1BFVH 1N64L 3NCJH 2ESVB 3UTQA 4GAJH 4KUCF 1Q38A 4R7NB 4ZUVA 4Q2ZB 4JFQB 1MVUB 4BQ9A 4X9IA 4Z7OE 5HI4C 1J1PL 4HXBH 2R0ZH 2HFEB 3HKFA 1JPGA 5EN2B 3P40A 3KJ6L 5GS0H 5FYLL 5L7XH 4OLYH 2BDNH 3CSBA 4KI5D 4NQCD 1WTLA 1JIBA 3GMLB 2XY1A 3X11A 2BNRE 4ZOAA 4HT1H 1NDGB 3R0NA 5JXAL 5MEQB 2OQJB 2ESVE 4GW1B 3BUYB 2KKQA 5F9OL 3HZYA 4HV8A 2Z31A 1H3VA 1RPQA 3TLRA 1JV5B 2C7UB 4MVBC 1A6VL 4HKXA 5IFHH 2QHRH 4YHPA 2NY1C 1BZ9A 1L6ZA 3CFKB 4KJWD 5EIVA 3DURB 1VSCA 1OL0A 4CVXA 1JN6A 2BVTA 3QI9A 1NBYB 4N0FB 2APWA 2GFBB 4QGYA 3BEWA 3D18B 1UEMA 4H8WL 5JHDD 3LKPB 5B21A 4PJCB 1SJXA 4PJ8A 5D1QC 4A6YH 1IAOA 4MJ5B 1IC7H 5EBMB 3MLUH 4JAMB 3UJJL 4G9DB 2IADB 4P9HL 1I9EA 1CK0H 2AJZB 4F57H 4POUB 4HPYL 4HWNA 4OCRL 4PG2A 1G9MC 4JM4L 4WDIB 1LVEA 1U95A 4RDQF 2CKBL 5IEKB 1CLOL 4DJMA 3VFSB 2WZPD 1YUHA 4K9EL 1S7UA 5I1HH 1MFAL 4MYWB 4XI5C 1KJ2B 4XBGB 4NQCA 2A9NL 1BOGA 1ACZA 2NZ9C 2VZVA 1MFEL 4NQEB 3QUXD 4NRZA 4UB0L 3WFHB 1ED3B 1CICD 4IDJL 4ENED 3S36L 4ZPTA 2YS4A 2J6EL 4HS8L 4CAGA 3V7AG 1RHFA 1BEYH 5ADPL 1JPFA 3G6JE 3IXTA 5HHOA 5CEXA 4Y5XA 3QFDA 5F7DA 2FHCA 3U0WH 3O9WB 1H3TA 4UILH 1U8PB 5FYKD 4LBEB 1VKXA 5FGCE 3HZKA 4U3HA 5E2TH 4ODBD 2IAND 3MCKB 2BSTA 2IFFL 3KPSE 2EECA 2F9BT 4UT9L 4NWUL 3REWB 1A9BB 1FV1A 5BMFL 1S8DA 1HIMH 4EDWH 4JN2A 3GMPB 3IFPA 5T3XE 1M7DA 3G04A 3HMXA 1JGEB 1NANH 4I77H 3PHOA 2E27H 2V7NA 3O2DA 4NPYA 3SKUD 1PGRB 1P4BH 2YD3A 5IHBA 1X5XA 2IALB 5JHDA 1AGEB 1ZWIA 3AROA 1JYNA 5E24E 5TF0A 3QNYA 2WMPA 5IBLC 4HCRH 1YEHH 3OMZA 3IJHB 1DLFH 4GOSA 4OCMC 4NBYB 2Y7QB 2GSGB 2EIBA 4HXAL 4EOWH 1MEXH 1DBJL 5C0AD 3HNVH 5D1XB 3THMH 4N8CH 3CXHK 3B2VH 4OQTH 4JFQA 1BVLB 5D6CB 2WIIB 3AU1A 2J8UF 2HFEA 3WHXB 5EN2A 3KYAA 1J0KA 3DETD 5I1CL 1WCQA 1O7VA 1BP3B 4LLMB 4PRDA 1O5DT 4LSUL 3U7WH 3ZE2F 4X83A 4NQED 1PYWA 3P77A 4OGYL 3RPKA 4YFDB 2X4SB 1OAZL 3QUXA 1F4WH 5AD0A 3AS0A 5MEQA 1S9KC 2BVOB 4GW1A 4HIXL 3RGVC 4XBPB 1CICA 1TIUA 4Q6IC 1CQKA 1HZHH 2IBGA 3O9WD 4DKAA 3GNMH 3K2MC 4O58L 4KUCD 5CJXA 1JV5A 4KZEH 1URLA 1A0QL 2C7UA 5I1IL 4XVTL 3K8KA 2AXJA 3LHPL 1HYSC 4LP4A 4UIMB 4ZD3H 4RISL 4ETQB 1PLGH 3WDJA 2A73B 3D9AL 4OI8A 3HFML 3D18A 5GRXG 3DPBA 5E0QA 4LU5H 4M3JA 4PJEE 3WNNA 3DECA 1XGYH 2FJHB 4EBQL 5KSUB 4HX1B 4K8RH 1J9CT 1KCSL 5EORH 1RD6A 1XF3A 1OAUL 4NQXB 2PO6C 4Z76B 5D1XD 3O2WL 4YBLB 2YXMA 2ENSA 2HTLC 3B9KB 5IUSA 1J7VR 5C0AA 2IADA 3M07A 3LRHA 2AJZA 4DKDC 2ZUVA 1T7ZA 2P47B 2VJXA 3LSOB 3VFWB 4RQQB 3SDYH 3P9LA 3VFSA 4H5SB 1CE1H 4M61B 2R9HC 4LOUC 1NCTA 4UU9B 1I4FA 4UBDC 1FYTD 1WICA 5JO5B 4NQEA 4HKBB 4BM7A 2P1YA 5I19L 4PLNC 4L8SC 1FG2B 3WFHA 1I8IA 4X9BA 3CFEB 5DD5L 5BRZB 5CJQL 3MUGB 2A83B 3VD9A 1IKFH 1BIIB 1OPGH 3O9WA 3P4NA 1SBBA 5IMKA 4F7EB 4K71C 4QRPB 4RFOH 2CLZB 3MCKA 3LPWA 4NCC2 2FYYB 1NUGA 1FZKB 2A6JB 3L5IA 1ZHBB 4DAGL 1OOAA 4LSPL 1D6VH 3MOAL 1VGEH 3Q5TA 4GG8A 1P4LA 2QSCL 1LO4L 3ARBD 3KPRD 1MFNA 3NN8B 3CVHA 1UM5L 4OM1L 2PF6A 4LIQH 1N0XL 6FABH 5IEHB 2X4TA 1DQLH 3HG1D 4P99A 1LMKA 3IJHA 4QNPE 3TV3H 4P48A 3TBSB 1YEJL 4YDIL 3VCLA 1ZTXL 1FNEA 5D7IE 2Y7QA 3WFCL 1PQZB 4XNZB 1K85A 3N50A 2Q7YA 1IAMA 2VLLB 5DJYA 1QRND 5MP6L 5D1XA 3VJ6B 1U92B 1TZGL 2OM5A 4GSDL 4HUWA 4MA7L 3KYKL 4I48A 4RGOH 1QYGH 3SGDI 5E5RB 3CLFH 3GSWA 4WHDA 4S1QH 4ZFGL 5FA3B 2ZUSA 2R1YA 3PWJA 4LARH 4MQ7B 5CEZL 4LLMA 3W82A 2AEWA 3NACL 2VR4A 3ZSTA 4NC0B 3G9VA 5K9KB 5E8PA 1GGUA 2XZAL 4G9FB 4M7JH 2BC4B 4UTAL 4XXDA 1OSZB 5GGQH 1A5FL 2H32B 5A2KH 2UYLB 2FNBA 3WMSA 4BSWB 1FYTA 2X4SA 5TE4L 4QCIB 5BRZD 5CBAB 4GMSL 5ESQB 2BVOA 3NPZB 5FF6B 5F7YC 2JELH 2VYRE 4FNLH 4YDJA 4TSCL 5E2WH 3DV4B 4Q9RH 5ICZB 5MHSE 5DRZB 4GO6B 4Q9QH 3VRLE 1UKTA 4R2GB 5TE7L 3SPVA 3QZWB 4R26H 4Q0XH 2YKLL 2H9GB 3BZFB 5FGRA 3IGAA 4XRCB 4QXUL 2OR9L 4UIMA 3VFPB 4OUUA 1AQKL 4ETQA 2Y36H 2F19L 2QQKL 2J88L 2IPTL 3PDOB 1IT9L 3Q6GH 1N3NB 3RL1B 5IF0B 3HN3A 4XAKE 5DEGB 2EDYA 2FJHA 3KPRA 4U6YB 5ISZD 3GRWA 5DMGC 3HI5L 1J0IA 3FONB 3HG1A 1XZ0A 4LCWE 2IPKA 4K3EH 1H3WM 1T83A 3P30H 4OZIE 2VERN 3B9KA 4M62L 5IIEB 3LKQA 4CU7A 3AC0A 4I9WD 1CFNB 2YBRA 4LCUA 1K5NA 4KROC 2EDWA 5DRWA 2DQDL 3LSOA 3VFWA 4RQQA 2HG5B 3O6FD 5ANMA 5EIIB 4JZNB 4AZ8A 4KK9C 1TVBB 1A7BA 2FL5A 1EBPA 5J13C 2YRLA 4P2QD 3NIGF 4LLUA 2AJXH 4TOYL 4H5SA 1LD9B 3TZVD 3UTSE 4PJBB 3V0AC 4ODWB 1KC5H 1BD2B 4XC1H 3JWNC 4OGAC 1A21A 4BQCA 4F58L 5JO5A 1BX2B 3RU8L 2DLFH 1D5IL 4HKBA 2P44B 3N85H 5ACZA 1FG2A 3GJEB 3U7YH 2VKWA 5DS8B 5BRZA 5C2UB 1MCSA 2XYCA 5CHNB 1J5OL 1WT5A 1SVCP 2AJYH 1J8KA 2NTFA 2CDFB 4F7EA 2W91A 2YUWA 2EDFA 2OCFD 4L29B 1ZA3B 1MWAL 5DJDA 3SKNA 2FYYA 5GZOD 35C8H 1CGYA 2CLVB 4XP5L 4JJ5B 2VDOL 3GBNL 2J8UA 3TBTB 3SDCD 4S1DD 3RWHB 3UEZA 1K8IB 1KIUA 1UH4A 3W0WB 3LY6A 3ALWA 2YHGA 2AK1H 3N1GC 3M1BB 4JVWA 5C3LD 3OV6A 2DKSA 4YDLB 3NN8A 4GXUN 1MQKH 3FFDB 3D25B 1KJ2H 5T3XH 1U58A 2LVCA 4OI9A 4YDKL 1NJ9A 4O2EA 1D9KD 1KCVL 1ORSB 4ZOCA 5DI8B 5E2VL 2BOCA 3TT1H 1U92A 5IESH 5DMKA 4D8PA 4OGZA 5CEYA 4JM2D 2NLJB 3VGFA 3W0WE 4NQDE 1DVFC 4XTRD 2DQJL 3O6FA 1EK3A 5C07E 3DOSA 4MQ7A 4RMTA 5EBLB 3X3FH 1FGVL 4P2QA 5EOCL 5I8OL 1IGCH 5HD8C 1HDMB 3OZ9H 2H32A 2FIKB 4CBPA 4LAJH 4JN1L 4LAQH 5C6TL 1MCFA 4LL9A 4P2OD 1EPFA 5LKNA 1WQVT 2XTJB 3LPFA 5LQBL 3RWDB 5ICZA 3VD7A 3VXRB 2Q6WA 1A02N 4PRIB 2GEEA 4OFIA 2VDRL 2X4QA 1A1NB 5DDHB 2HFGL 3BZFA 2IJ0C 1EXUB 2R15A 4XRCA 3X12B 4Y1AE 3VFPA 3K81A 2W59A 3SDCA 2QQNH 3HI6L 3OAUH 1VFAA 5EZOL 1N3NA 1OTTD 3KYNB 4FQXB 2ZPKH 4V1DD 5KSVB 1JGUH 5DEGA 1VADA 3QBTB 3AREB 3WJJA 3V4VH 4MXQC 5K9OA 1I3RB 4EI5B 1Q72L 3NCMA 3OKDB 4W6XB 2CXKA 1FDLH 3MLSH 5DD1H 1DANT 1M05B 2ILLA 3TJEL 1D9KA 4KGJA 3WKMH 5L9DH 1MRDH 5SWZE 3T2NL 4JPWH 4B41A 1YJDH 1CFNA 5IBUG 3RY6A 5IGXH 2W9DL 3ULUC 2PTUA 2B1AH 9CGTA 1N2RB 5E00A 1FZJA 2VXSH 3AS2A 1QFHA 5EIIA 5F7KC 5T5NG 4XZUB 3QUZD 2BNQE 4XWGH 2V9RA 3U7AA 5I66B 1F4AA 1X5LA 1E6OH 1ZT4A 4P3DB 4H1LB 1LD9A 3OQ3B 4XPTL 1FLRL 5JW4R 1BD2A 5EU6B 4TRPL 3OAZK 3QSKB 5J6GB 1XF2B 2I9TA 1BX2A 3Q3GA 3BZ4A 5F88B 3T4YB 2K1MA 1ZVSB 3RIFF 1OP5K 4EIZC 3ULSB 2F8VA 1FO0H 1A7PH 5F71A 1UJTA 3ZHDA 3VXRD 3O2DL 2EO1A 1NMAL 3QHTC 5E8OB 2O61B 4KKCD 1RFDH 4X6CE 4JFZL 4D0CB 5CJXC 4HKJA 1CE6B 3DSNA 5CIPB 3KHOA 5TE6H 3HUJE 2ZSWB 4TUKH 4L29A 2MCG1 1ZA3A 1GPOH 1EJOH 3JUYA 3MR9B 3MRDB 4ZTOL 3E6HB 2CLVA 2L0DA 5F1SA 4JJ5A 4MNQD 3MLXH 1VFUA 3PGFH 4QRRE 1KCRL 1SBSH 3ARDB 2CRZA 4HAFA 4Z7VA 4Q97A 2XOTA 4K23L 4DTGH 2FX7H 3T0BA 2NY2D 5IW6A 4M6OL 5BS0E 1F6AB 4LQFH 5DK3A 1KLUB 4V1DA 4PPTA 5E2UH 3D25A 4JFFB 4ZUSA 1LP9E 2QSVA 3SY0B 4EI5D 2DM3A 4FQIH 1DE4B 5CZVH 1WWBX 2Z0BA 3GKWH 1N6VA 4LMQE 2OLDA 3LKNB 4XCFH 3VG0H 3E1F1 4OSUL 1ORSA 3CSPA 4PJFA 3S8WA 5DRNA 1MAML 1WFOA 4KU1A 3QPXL 4WW1B 4EVNB 4K55A 3CMGA 1UCTA 1HSBB 2J4WH 2GTZB 2R4RL 5GRJL 1S7RA 5EZIL 1QZ1A 3ZO0A 3MC0A 3VW3L 3OPZH 3CDCA 3QUZA 5HSFA 4LPTA 1EAPA 2HVJA 3WDIA 4XPHL 4MAYB 5GGRY 1ES0B 5FYKL 1BQHB 4PTTB 2X09A 3HR5B 1HI6B 1PD6A 4GLRH 5SV3A 2XKSA 1TZHB 1INDL 4E9LA 1NL0L 4EZMA 5D96B 1SEBA 1UWXH 1I3GL 3ARWA 2IQ9L 2JCCF 3RWDA 3O9WC 3GBMH 3VXRA 2NW2A 4MD0B 1JHLH 1K4CB 4UTBH 4WFHE 4JPKL 3DUSB 4MHHI 5MENE 4G8GE 5JW3L 5D72L 5DDHA 4O5LH 2LU7A 1EXUA 4NKDB 4XNXH 4WHTB 5BOPA 4U6HA 1JWUB 3GMNB 4DZ8B 3HNTL 5D7KE 3W5NA 4JB9L 3V0WH 5KOVC 3KYNA 4OBRA 1YY9C 4LSTL 4PV8A 4ZS6D 3RAJL 2VLME 2CJUH 4FHBD 2NR6C 4WI5A 3LPGA 3OSKA 2JE8A 4ZOBA 1YA5A 4EI5A 2OTWB 2MNUA 4X98B 3BKYL 2CGRH 2CDGB 3Q5YA 1M05A 4WWID 1CIDA 4WI2A 5D1XC 4XPGH 4JFHD 4LEOA 1CDGA 2HN7A 4YX2L 2C1OB 5JOFA 3WNKA 1N64H 1N2RA 2N1KA 1FVEB 5D7JD 5CEZE 2A0LC 4P57B 1MRFL 1R3KA 3FL7A 4M6NL 1JMZA 1V3MA 2OZ4L 1JZ7A 4IOFD 3WUWG 2ZG3A 1A1OB 1J1PH 1ZHKB 5GGRB 3WIHA 3QFJB 4I5BB 1YY8A 2HRPL 1GZQA 3T4YA 1F4YH 1CT8B 1HSAB 3ULSA 2D3VA 2ICEB 3A6OA 3HR6A 1YJDC 2KZ1B 2X4RA 3S96B 3ZDZF 2NY0B 5F21B 2DMCA 1BM3L 2O61A 5C9KA 3RZWA 4P2RD 5E7BA 3CVHL 4X4ME 3VFRB 1EIBA 5CIPA 2DQEL 2ZSWA 5F9OH 1U93A 1X5JA 5FO9B 2PTTB 2QQQA 5IHZB 1A6VH 1DN2A 3QFJE 4MSWA 1LO3L 1MLCA 1RY7B 3MUHL 5B39B 4N0CC 3EUUA 4HWBL 1ZLUK 5D93B 3VGHA 1F6AA 3MJ7A 2I26N 5F3BB 2V7HA 2XKNB 1PZUB 4HIHA 1DE4A 1QBBA 3ZSSA 1I1FA 5JA9A 1FQ9C 4H8WH 4XVUC 4JRYB 4YBLC 4JCLA 2AV7B 5KSBB 1W8NA 2YD7A 4MA3A 3B9KC 4JFYB 4J6RL 4EVNA 3GJFH 4Z0XA 1JNHB 1O7SA 3Q1SH 5IG7B 4AMKL 1K2DB 3UPAA 3UJJH 3QXTA 4QRSB 5DHVB 4P9HH 5D7JA 1LEKA 3C5SB 3BYYA 4HPYH 3FAWA 1L7TL 4PLJD 1TXKA 4OCRH 3T08A 4PRBB 4MAYA 4F7PA 4JM4H 2DJ4A 5D70L 2DWDB 4PTTA 4WUUB 3HR5A 2CKBH 3MO1A 1CLOH 4RAVB 4K9EH 1E4XI 1GOHA 1FAIL 1MFAH 2AKRB 3MRNA 2V2TB 1TZHA 1TJGL 5F70A 1DQML 2A9NH 5TQ2L 3O81A 1MFEH 4O02L 4WFGE 5DGRA 2BNUB 1AHWB 4QRTB 4U1MB 3V7MA 5K9JL 5GS2H 1VPOL 4IDJH 3S36H 1YMMB 4MD0A 2J6EH 4HS8H 1K4CA 4X7TB 1PKOA 4OM0L 5ADPH 4MJIB 5EC2B 3WFZA 5F7NC 2BHYA 5EU7E 2CK2A 4NHUA 4PJXF 3EJYD 1JWUA 1T5WB 2IFFH 3VXSD 2KZWA 3GMNA 4DZ8A 4U0RB 4UT9H 4NWUH 5BMFH 5LXGL 1FFPB 1RVFL 1RJLB 4L4TB 1EFQA 4YHLH 4EN3B 1G7IB 4CU8A 2OTWA 3IAPA 4XNZC 1YMHA 3LEXB 1ZK9A 2J8HA 3OKKA 1P7QD 5H94B 2RHEA 1DZBA 2C1OA 1BZ7A 4GXUM 4HXAH 4PBXA 1NGQL 2H2SD 2WW8A 1DBJH 4JEGB 4MS8D 3QQ4B 4RIRB 3WEXA 4M1CD 3CH8A 1Z5LA 4G7VH 3PIQB 1ZHKA 3V0VA 5JW5B 1LDPL 4KV5F 5I1CH 4KK6C 5DEFB 4MB4A 2GQHA 4GQPH 4G6AC 2X1QA 4U7MA 2VL5B 3UTZB 4LSUH 4Y19E 4GRWE 5F1NA 3ZE0F 3MODL 4XHJC 5JIPA 1NCUA 4OGYH 1N8ZB 3MRRB 5TQ0L 2Y1VA 3L5XL 4KKLC 1OAZH 4LGRB 5JIHA 3MNZB 3MMEB 4HIXH 3VFRA 2UUDK 3VFMB 5FB8A 2MOVA 1OP3H 5JZ7D 5FO9A 2VXVL 2EEBA 1QFWL 2RB8A 4L5FL 4O58H 1MCCA 5IHZA 5GRVK 5I1IH 4Z7UB 2GCYB 5IR1B 4XVTH 2DM4A 4I18B 3VXSA 4Z0BL 3ARVA 4BZYA 3MACL 1ERNA 4LKCA 4RISH 1QVOB 3D9AH 1F3JA 4ELMF 2XKNA 1RIUL 2BXZA 3WJJC 3HFMH 3LIZL 4ONGL 3RVWC 2OXGA 4KI5E 4NQCE 3LKRA 1NKOA 1DDHB 1F3RB 2AV7A 4Q6YA 4EBQH 3QIBD 4JFYA 1BREA 1KCSH 2PYEB 1ZAGA 3EOAB 4NWTL 1OAUH 1G6RA 3RY6C 2JCCA 4NJAL 5KVMC 4HFWB 3O2WH 5IG7A 3NIDF 1GCFA 3L7EA 1FYHB 1WLHA 3MCG1 1DL7L 1GHFL 4S10A 5D5MF 1UVQB 4OZGF 3BIBX 3C5SA 5GRYA 1FVDB 1HHJB 1YNLL 4PJXB 3VRIB 1J1XL 5CLWA 5SWQA 4X4XB 5IV2A 5L2KB 3JWOL 3MLTB 1NBQA 2BJML 5GHWL 3FB8A 5I19H 2EDHA 3QYCA 5JHDE 5HXMA 4EUPA 4AY0A 3PNWB 5KANG 5DD5H 5CJQH 2YXFA 3T65B 1B0GA 3PV6B 4JY4A 2RCSL 1AJ7L 4FA8A 1T0NB 4MJIA 2QSTA 4G8EB 3RRQA 5C0RH 3PXHA 3C9NB 1G9NC 3HTLX 2GIYA 5I76B 4JZOB 1T5WA 4QEGA 3TO2A 4P4RB 2DKMA 4Q9BA 1T66D 4YDLC 1GL4B 5FKAA 4DAGH 1JJUA 4LSPH 3QNZB 3SE9L 4UT7L 2BVUA 3MOAH 2CO7B 1IGYA 2JIXB 2QSCH 1LO4H 1QR1A 1UM5H 4OM1H 5IB5A 2HH0L 3STZB 3LEXA 1N0XH 2E7MA 4G8FB 4V2BA 5IT2L 4OLWL 5JOPD 5IJVB 1A9EB 1YEJH 4YDIH 3WFCH 1ZTXH 3DGCR 3U48A 5GRUL 4PP2A 4QTHB 3FFCD 2GUOA 4JHWL 5FM5O 5MP6H 1PDKA 1TZGH 2IQAA 1CL7L 5CZXD 5BW7C 1LNUB 3RUGE 4RIRA 4MA7H 3KYKH 3P9WB 2XWJB 1A6AB 5FYKE 4JKMA 1IGJA 5DT1L 4ZFGH 1ZANL 3O8XB 1CFBA 4ZFOL 2IANE 5IHUL 5H37H 4NFBA 5DEFA 5CEZH 3CH1B 2RGSA 3JV6B 3NACH 4M8QB 3UTZA 1UXWA 2XZAH 5JLZB 4UTAH 1Q9OB 1A5FH 2XTJC 2Z4QB 3STBA 1AD0B 3TBVB 5TE4H 4K07A 1EA9C 3MNZA 1JMXA 5I8CA 3TNNB 3M17B 5D2NA 1S7SB 4JFPB 1KTLA 3SDAD 3V5KA 1JGDB 2E9BA 2YUZA 4TSCH 1OY3B 3VI4F 2DIBA 3SE8L 1RIVL 1EFXB 4WFFE 2GCYA 3DMMB 1OB1B 5TE7H 2A6DB 5D5MB 2YKLH 1J05A 4FQXC 1ONQB 4KJPD 4ZNEA 4QXUH 2OR9H 4Y89A 1AXSB 4BH8B 1G9EA 5DJAB 1CU4L 2BOBB 2F19H 2QQKH 4S2SA 5H35A 2IPTH 3BQUB 5CJ8A 5CZKA 1IT9H 4EI5C 1ZHNB 5IWLA 3BP5B 2ZUQB 1DDHA 2KUTA 3I02A 3FQUA 3IKKA 2PYEA 4GKSB 3HI5H 4OZFG 4YGVA 1HH9A 4HFWA 1CGUA 3ZKMC 1QSED 4X7SL 3FFCA 1A8JH 4RGMB 3WS3B 4KJYB 4G43B 2YZ8A 3BGMB 1FVDA 3E0GA 2DQDH 2Z8VC 1HHJA 1UZ8A 3VFUB 4PJXA 3ZDXF 3WSQL 3OHXB 3KPPA 4PJAF 3ALXA 4RGNB 4O51A 2A6KA 4XPAL 3EYQD 1IEAB 5HHMD 4C56E 5L2KA 1DBAL 4AIXA 5TJWK 3DXAD 4HWUA 4QOKD 1M7XA 1JI2A 3HC4L 4MDIB 1FFOA 1V3LA 5C0IB 3RU8H 1D5IH 5E08L 5HYQB 4HDIB 3AMLA 5E1AB 3RWGB 1BFOA 4XPFH 5EUOF 3VFTA 3GHEL 4X5XB 5FK9A 3T65A 3GSUB 6CGTA 3F58L 3RHWF 4LCIL 1J5OH 2FBOJ 1MNUL 2QKIB 3NFNB 3IVKB 1U8MA 3DMMD 4LLWA 2F8OA 3ARDC 1TQBB 4KWUA 4PJ9D 3VWKB 3ESVF 4PYGA 1MWAH 1NUNB 1NDMA 4TTDD 4ZYKB 4P4RA 5I8KL 1U8IA 1RIHL 4XP5H 2VDOH 1J12A 1X5AA 3RDTB 2X10A 3D39B 1A4KB 1IEBA 4NDMB 5D9SB 1QO3B 4HUNB 3D6GA 2A6IB 2JIXA 1P69B 1I85C 3MV7D 3LRSB 2GITB 1JZ5A 5J0BA 2A74B 3WFBL 2APFA 1FYTE 2VZ1A 4OLUL 1VEOA 2V5RA 4YDKH 1BBJA 5IJVA 1KULA 4F37K 5BV7L 1XCQA 1KCVH 1C08B 4IRJB 5E2VH 4QTHA 1P6AB 3QPQC 3O3EA 4PRNB 2RR3A 1LNUA 1ZLWH 1MHCB 25C8L 2E6PA 3DO7A 1YECL 1A6AA 1TFHA 3KLDA 4L3ED 5F6HJ 3SCMD 4MAYC 3O8XA 4JGJA 2AK4D 2DQJH 4RGND 4RFEB 2V5YA 3FO2B 4GKNA 2VDKL 2P5EB 1FGVH 2X44D 4M8QA 4TUOB 3HZVB 5JLZA 1VCAA 2ZSVB 1FH5L 1BZQK 2PYFB 3LZFL 3I6KB 5D96C 1F4HA 3G08B 4P5KB 4ELMA 3DXAA 1AD0A 4HKZB 4JN1H 1Y6KR 4MJ2A 4WI4A 5C6TH 3KPRE 2FJFB 4AENB 4HK3N 1MPAL 2HLAB 3M17A 4PG9B 3STLB 2VE6A 1T1ZB 3QIUB 4KK8C 4U2YA 1NGYA 4GRWH 3HG1E 3OGCA 3CDYA 1JGDA 2NY4D 1SJHA 4EJ1C 5LQBH 4XCYB 1MH5A 5IFJB 3PWLA 5SWSB 5DQDL 1QRNE 1R3JB 2G9HA 5CUSL 3DMMA 3B6SA 1MRCL 1OB1A 4ZPVA 3NIFE 4TUJA 2VDRH 1LEIB 2DQHL 5D5MA 4OZGA 1OQXA 2HFGH 4KDTA 5ANME 3S5LB 4LCYA 4BH8A 1I1YB 1EHAA 3MBED 4LSDA 2BOBA 4YZFF 2FEEL 2NMSA 4UDUB 4PJAB 5HYSB 1KFAL 5EZOH 1OM3L 2NW3B 4LSRL 5F6HI 1U8NB 4LRNH 3BP5A 1X4ZA 3RI5F 3MV7A 4X6DA 3VWJB 3LV3B 3IFOB 5KW9L 4GKSA 1N7ML 4IRJD 5GISL 1Q72H 3IDMA 5GS3A 4ACPA 1IGFL 1N6QL 5EUOB 3TJEH 2P8PA 5EFIA 2OMBA 2EC8A 1CGWA 1CLCA 3T2NH 3WS3A 2ZZUT 4KJYA 3CDGB 3EOTL 4NZDA 2W9DH 4R4ND 3RKPA 1OD9A 1RZKL 1ZHLB 4RBPK 1ADQA 3VFUA 4L3EA 5FO7B 3OHXA 4LVOB 1QOKA 2AK4A 4OZHF 2EKJA 1B0RA 5I0DA 2J8UE 3DX7B 1HN1A 1A6TB 3UBXB 1IEAA 4XPTH 1FLRH 2EYTB 4TRPH 1I3VA 2NY0C 4PREB 4Y5YB 3IKCB 4OQ1A 1S7XB 2VUOA 5HYQA 1T0PB 4HDIA 3VFOB 2XACC 2MCPL 3ZE2E 1W0WA 2DQCL 5F1IA 4OF5A 4PGEA 4FQJL 1UCBL 4R90H 4P23D 5FUZL 5H8DA 5ISZE 1UWEL 3O2DH 1NMAH 1P1ZB 3FOMA 4MD5A 5J12B 3WNLA 4JFZH 5DURB 4WEUD 1B90A 1ZLUH 4XVJL 3KLSA 2JJVA 2YUXA 2XWBB 3IXAB 5E95B 3NCYS 4ZTOH 3O3AA 1YNKL 3WBDA 5D93C 3U46A 3RDTA 3O45B 3D39A 5T1KB 1QTYT 1A4KA 1J11A 4NDMA 5D9SA 1KCRH 4I2XE 1B4JL 1SYVB 4K23H 3MBEA 3U4AA 4F9PC 5FOBB 4P2QE 4M6OH 4L8CA 1EUTA 3KR3L 3E3QE 1AQDB 4U7KA 4GBXD 2APVA 4X4ZA 1Y18A 5FO8A 2GK2A 5I1KL 5I6XB 1Y6NR 4JFED 4OSUH 4XP6L 2R2CA 1C08A 4IRJA 1MAMH 3DLQR 3CFDB 3QPXH 2FECL 4Y0GA 3UAJD 4QRUA 2DJSA 3EJJX 3HZMA 3ET9F 2R4RH 5GRJH 4M93B 3V79C 2J8OA 3D1MC 3VE0B 2PCPA 2FRGP 1EO8L 5EZIH 2R29L 1Q9WB 3VW3H 4P59L 3DVNB 2AQ1A 2X4OB 4PUBL 2XQYK 1ZVHA 1JBJA 4FQLL 5JDSA 1JRHL 1JZ6A 4H25A 4XPHH 3KYMB 3HZVA 4TUOA 5L2JB 3BDBA 4KVNL 1RV6X 1JYXA 3CUPB 1WBXA 5FYKH 3I6KA 3G08A 4P5KA 1TJHL 1AHWC 2O5ZL 5C08B 3U4EB 4HKZA 3G5ZB 2R23A 3FT3A 2FJFA 1LO5A 3LKSB 4AENA 2H41A 1PZ5B 1INDH 2HLAA 4LDLB 5GGVL 2UV3A 5F97E 1NL0H 1ZKAA 3STLA 1CDUA 1UZ6E 1YQ2A 5JOEA 1VFOA 5IOPA 5MERA 4P23A 4HC1L 1I3GH 5JZ7C 5D71L 3LKOA 5INCA 5ICXA 1Z9SA 4APQD 3FTGB 3D69B 4EXPX 4JPKH 4U0RC 1KPVA 3WHE1 5JW3H 5D72H 3MUY1 1HQ4A 2E7CA 3AS1A 4NT6A 2ARJQ 3B43A 1I1YA 1I7TA 5I1AA 4EN3C 4UDUA 3HNTH 4PS4L 1CD1B 4GG6F 2B5IB 4LSTH 5IKCA 2NW3A 2VWEE 3RAJH 1AGFB 3MV8B 1HOCB 3EFFB 1DUYB 3VWJA 3V6ZB 3LV3A 4YHKL 1PVHA 3IFOA 5I17A 1MJ7L 1XF5B 4GBXA 4DK6A 5IB3A 3WHE0 3B9EA 4HIEB 2W07A 5EUOA 4JFEA 1BJMA 1Q9KB 1G7LB 2DQFB 3GMQB 4YX2H 1KNOB 4RWHA 1I8MA 2V2XA 4LHUG 2D7MA 3A6BL 1ZHLA 3EO1B 1CS6A 1KIRA 2W1NA 1CFTA 3CAFA 5FO7A 4AL8L 1MRFH 4N0UB 3R1GH 4XXCC 4M6NH 4QWWC 5FEBA 2OZ4H 2R56L 1MFBL 4U0QB 5DQ9A 3W9EB 5K93A 2IAMD 1A6TA 3QUML 4Z7VE 1YEKL 4OIBA 5FM5M 5FYJU 3UBXA 5IVXF 1OTSD 3UTTD 4JKPL 5H37G 3OTTA 4PREA 1IAII 3IKCA 1WBZB 2HRPH 1MCLA 4V1DE 3VFOA 3KXFD 1NC4B 2R2HB 3H6JA 4BA8A 2OJEB 5DF0A 2AEPL 2E9WA 3C60D 1BM3H 4PJFE 2BVEA 1A14L 3TC9A 3EDJA 3CVHH 1CGSL 3QEUB 1L0YA 2DQEH 1CGTA 1OW0C 5L8KB 5IQ9B 5BZDB 3O45A 4KHTL 5T1KA 3VXTB 1A6WL 3FN0L 1EGJL 3DTXB 1PG7L 1LO3H 2ZOKB 4HIJB 2WQRA 2OTUB 3D3VB 3AMKA 1KOAA 5DK2B 3ILQD 4HWBH 4GUPA 5IWLC 4XAWL 4ONFL 4YC2B 2F53D 4N8VG 4RA0C 4X5WB 5D2LF 4JHBA 2XNAB 4G6KL 4MX7A 1ETZA 3TFKC 1QA9B 3WIFA 3PGDB 4J6RH 3MA7B 1RHHB 2A9ML 4U33A 2IBZX 4YHNB 3W11C 3DX9B 1IFHL 4RFNB 5CZXC 1HQRB 2VUYA 4NO2B 4I0CC 2ZUYA 1FNLA 3KNBA 1NCNA 4AMKH 2CRIA 4AT6A 5I74B 1N59A 3D3VE 3ZKSD 3V2AR 2Y9RT 5D7LE 5CSBA 3DRQB 1CDCA 1MHHB 3QH3B 1GC1C 1L9MA 3OJDA 1A3RL 4MNQE 5DJXA 2XV6B 1PFCA 5D70H 2AJVL 3NIGE 3UTTA 1F58L 5C08A 3U4EA 2Q8BL 2HWZL 1F97A 3F8UB 3LKSA 3KXFA 1TJGH 5E5MB 5TQ2H 1PY4A 4O02H 3QNXB 5BV7B 2EE6A 5K9JH 5J11B 5HYFA 1PY9A 2EC9T 4YXHL 1VPOH 3KWWB 3FTGA 5HVWA 3D69A 1U0QA 5JQHC 2YRZA 3CLEH 2ED9A 4GRLB 5EU3B 1DQQB 3V52L 3MNWA 3NCCB 1U8JA 5IMMB 5TF1L 2H26B 5JMOC 3ME0A 4YO0B 1UFUA 1CD1A 4OZHA 4PGCB 4GH7B 5LXGH 1RVFH 1V5JA 3EYFB 1MFDH 2F8XC 3MV8A 3IJSB 5DMJB 1X6LA 2YPLE 4BYHA 2FH6A 2ARJA 2E7LC 2F53A 3KG5A 5HJ3B 3WIIL 1XF5A 1AE6L 4X5LA 2EIZB 4HIEA 1OTUD 4U1HB 1MY5A 2DQFA 3GMQA 1S5HB 3OXSA 3QCUL 3JV4B 1Y0LB 1NGQH 1BECA 2ZOLB 5HPMB 3O8XC 3X13B 2XPGA 4L8BA 5D6DA 4TSAL 2VZOA 4YIQA 3WUWA 3KJ4B 4Q7DA 5HHVL 1NEUA 2SEBB 3HPJB 3EYQC 1AGDB 3VFGL 1D5BB 1LDPH 3O3BA 2X05A 3BHBB 4DZBB 4M6ML 3WL9A 2ITCB 2R2HA 2EIDA 5DRXA 1NSNL 1F8TL 2BRQA 2B2XH 1XGPA 3MODH 3MGAA 3U0PB 4RCAA 4AEFA 4YBHA 5ICYA 3BH8B 4JFDE 5TQ0H 3L5XH 1QKZL 3EYVB 3QEUA 4GKZB 2F15A 4JFHE 2WBWB 3DMMC 2PXYB 3EAKA 3NBNA 4ZSOB 2VXVH 2OR7A 1TVHB 1QFWH 1FJ1B 3OGOE 1W72B 4L5FH 4FMKA 4OCXL 3LB6D 3ARGB 1MCBA 1WFUA 5A2JH 1XIWB 2ZOKA 3DTXA 4HIJA 5E6IB 3T0EB 2OTUA 3GB7A 3BQUC 5DK2A 4Z0BH 3MACH 2ZUQC 5EO0B 2B4CL 1RIUH 5DJ2B 4X5WA 2CD0A 3LIZH 3L3DB 4BFEA 3RVUD 3F5WA 3IU3B 2XNAA 5C9JA 5KN5A 3HE6D 4U31A 3ULVD 3UBXI 5CP3H 2P5WB 3PGDA 3MA7A 3H9HB 4YHNA 4KKNA 4F3FB 4RGMC 5T1MB 2WBJB 4NWTH 4WTZA 4BSVB 3KHQA 3JUZA 2X1WL 4NJAH 4WHYG 4P2RE 3MYJA 1I8LA 3VU2A 3Q5OA 3RWEA 4WU7A 1DL7H 2NX5D 1GHFH 4WO4B 4RGNC 3ETBF 3DRQA 2VABA 4R7DB 1U41A 3QH3A 3OB0H 3GSXB 4OLVL 3BE1L 1YNLH 4FTVB 4U1IB 3FHAA 5ABDE 1C16B 4BUGA 1J1XH 1T7VA 4B7IA 1IAIL 2XIDA 1UB6B 4YDVA 4GG6A 4KAQL 4PB0H 4NN5B 3JWOH 1UWGL 4MQXD 2F54B 5DUML 1RZIB 2WINB 3MLYL 2YSSB 2BJMH 1CZ8L 5GHWH 1FFRA 3WJLC 1KSRA 3L5JA 3V5DB 3QEQD 2AXFB 1TQBC 3KWWA 3VWKC 12E8L 1FIEA 2RCSH 4KC3B 1YN6B 5E9DE 3I3EA 4JKWA 4GRLA 4BELD 3DO3A 3RDTC 4X0KB 1XCTA 3O4LD 3T0ED 2JB5L 2WWMD 4YO0A 4NM4L 5GSVB 1KG0B 4P9ML 1HHKB 2P8MA 1L0QA 2F54E 1ADQL 5IVXA 3SE9H 4UT7H 5CWSB 3QDJB 5HJ3A 2LVEA 3W39B 3BEVB 5DFVC 1T21B 4IRJC 3DV6A 3IFNL 4JFXA 3VXUD 3HE6A 4U1HA 5IT2H 3ZKND 4YXKL 4OLWH 5GS0L 1S5HA 3SJVB 3JV4A 5GRUH 1Y0LA 4OI7A 1CFVL 2ZOLA 4JHWH 5ELIA 5HPMA 3QUYD 4L9LB 2VL4A 4POZD 4U3CA 5GJSL 3X13A 1CL7H 4QT5B 4EKXA 2NX5A 1UH2A 4NBXB 5SV4A 2AQ3A 3U0TA 2ZUXA 2FEDD 3T3PF 5GS1B 1BVZA 3W81A 1P4IH 5DT1H 3FQWB 5GGSA 1ZANH 1AGDA 1D5BA 5IHUH 3VXSE 5BXFB 1EAJA 4BZ1L 2DMBA 3FCTA 5FIEA 3I3BA 3OKEB 4HMEA 2WUBL 2ITCA 1NMCB 3VH8A 2K7QA 4L4VB 5DD3H 5J4MA 3QIUC 5IM7B 1RK1B 4P23C 5D2LA 4I0PD 3QXAB 4NRYB 5I75B 4U6XB 3EYVA 5DJ8B 3AS3A 5I1DB 1KPUA 4PLKD 1K4DB 4R9HA 4FFVD 1NFIA 2UY7A 1TVHA 1FJ1A 1IGTB 2F74A 3SE8H 4WI7A 1RIVH 4X6FB 3UYRL 4IS6B 4HWZB 3ARGA 2ATPB 3BH9B 3HCVA 4KRPD 4PJGF 3O4LA 5E6IA 3T0EA 1S78D 2HJFA 1QSZA 4D9RD 1IC7L 4QHNB 1D5MA 3TF7C 4L4VE 5EO0A 3K2UL 1CU4H 1J8HD 4J3SA 1WFTA 4QRQA 5D1ZB 3VWJC 2GSIA 3MJGX 2ICWB 3IU3A 5BO1L 5HPOA 4LLAA 1CXIA 3DYOA 1SY6A 3VXUA 3H9HA 1CBVL 4NKMB 1JF1B 3NPSB 3H3PH 2ZG2A 1BIHA 1NFDB 4XBEL 4ODXB 4P4KD 5B22A 2AV1B 4LVOC 4X7SH 3FB7B 1E27B 3QUYA 4R7DA 3KPMB 4ZQKB 3S36X 3AB0B 3WSQH 4U1IA 1C16A 2R1WB 4KGLA 4M7ZB 3FO9B 4U1JB 3LN4B 4Y5YC 1F02I 2EDBA 4K7FA 4LLYB 3BZEB 4TVPD 1UB6A 4XWOD 4XPAH 3OAYK 4IJ3B 1DBAH 2NY6D 4P3WA 3P4OA 3ZKQD 1ZSDB 4BQBA 2AEQL 3HC4H 4NN7B 1RZIA 4W70A 2WINA 5IFAL 1DQJB 4NZUL 5E08H 3IF1B 5J12C 5JXED 1KB5B 4HGKC 1S7VA 2VSCA 4KPHL 3ZDZE 3GHEH 4J3XA 3MRLB 3PWUB 3F58H 4LCIH 4E5XA 1MNUH 3VRJA 3RKDD 3HB3D 4O2FB 4X0KA 3QRFM 2DKUA 2ID5A 5I8KH 3U2SB 1RIHH 5GSVA 3TJHC 4JLRB 1KG0A 2FSEB 1HHKA 4NQSA 2VKXA 4K7PH 2LTQB 3BN9C 5I6XC 1OGTB 2YZ1A 1W8OA 3W39A 3BEVA 3KPQA 3LQAC 4NNXB 2WP3T 4GAYA 5DLML 2ED7A 3VXMB 2BY0A 3HRZB 3ZE1F 1A64A 4Y5VA 3WFBH 1BWMA 5CBEA 4OLUH 1YQVL 3HAEB 2NXYD 5BV7H 4M93C 4FFZL 3OG6B 1YEDA 4PBWD 5D2NE 4RSVA 1X4YA 4N1HB 3O3DB 4MJ6B 1VEMA 3WLWD 4AEHL 4BFBD 2YWYA 4P4KA 4QT5A 4MDJB 2D0FA 3HE7D 25C8H 4I1NB 5HGBA 1YECH 5T1LB 3FQWA 3MGTB 4M3KB 3G6AA 5GIRB 4WI3A 4YAQB 5SX4I 4LLVB 5BXFA 4PJGB 2NXZD 2VDKH 4ZNEE 1R5VA 3AY4A 4ZXBD 1QD0A 4H88L 5F1OB 5F7UA 4KXZH 3IDJB 5C0EB 1EH9A 5ITFB 3LZFH 2VR5A 1U3HB 5IB4A 4PP1D 5EBGA 3Q0HA 5IM7A 1RK1A 2HMIC 1XR9B 1HXYB 2CRYA 3QXAA 4PJ7B 3QIWB 4NRYA 4PRHE 2YD1A 5TDPB 1TTFA 2DQTL 5DJ8A 5CGYC 4ZO6A 1IM9D 1MPAH 4B7LA 5JXEA 4YR6B 3JWDC 5B38A 4RMWA 1IGML 4PRPD 3C6SA 5C8JB 7FABL 3UPCA 5ACLA 5JOPE 4TTGA 5IB2B 4RRPA 4RDQG 4PB9L 1FZOB 2C3VB 3NVQA 5C70A 4NN6B 5DQDH 1EEUA 3V6OA 5LGKA 4IS6A 3FFCE 5CUSH 1MRCH 3QDHA 2YOCA 2H3NA 2DQHH 4JY6A 2V9QA 4JG1L 2B5IC 2DM2A 5HGHB 4QHNA 3BZDA 3TYFB 3QDMB 1T0MB 4IIQB 5D1ZA 4FQ1L 1KFAH 3IRZA 5CD3B 3K7UA 3VXMD 1OM3H 3LD8B 4Y4HB 4LSRH 5F8RC 5DC9B 2W38A 3OWEA 1WAAE 1MCOL 5J56B 5ALCH 4EQ3A 2YEZA 4X6EB 5JPNA 4HSQA 1EEZA 5I16A 5KW9H 3T0DA 1VFBB 4JDVB 1N7MH 1JF1A 2EYRA 2VQ1B 5GISH 5HI4D 3CC5B 1CE1L 1IGFH 4JQXA 1N6QH 1GXEA 1H8OA 4FZ8L 3TN0B 3H9SD 2HJLB 3K1DA 1J1OL 4P46B 2H1PL 4UDTB 3EOTH 5CMAB 2ADFL 3HE7A 4PJHE 1RZKH 4Z5RA 3KPMA 4HJ0C 3QP3A 5DVNA 4ALAH 2DD8H 1ZT1A 4XB8A 3BZEA 3PWVB 1OPGL 2VR9A 1NAMB 4ZXBA 3IYLW 4CVZB 5F8QC 1YYLL 2MCPH 3ZE0E 3IF1A 2DQCH 1KB5A 4C4KT 2FJGB 4WNQB 3FN3A 4FG6D 4FQJH 1QUNA 1RSFA 5FUZH 3PWUA 2NY1D 3DRTB 1CFQB 4PRPA 4Y7MA 3BD4A 4G6FB 5JDJA 3VD5A 1WIOA 1QSEE 1PBYA 4F7CA 3GM8A 4XVJH 4HUUB 4R4FL 3HS0A 2I07B 1YEEL 4MHHG 1DQLL 3U2SA 3ECBB 5DO2C 1YNKH 1MI5D 2GJ6B 4JG0L 1DFBL 5FA4B 4HK0A 4YC2C 5ESVA 3B3IB 2VAAB 5D1QD 3D2UB 1JHTA 1RI8A 1B4JH 4M03A 3QEHA 2W0LA 3FRUB 1RJZB 2GKIA 4I3RL 3FMGL 3KR3H 2W65B 4LPCA 5HHME 3VXMA 3HRZA 1CG9B 5AYUL 1FL5B 3RHWK 4ELME 3DXAE 4QOKE 5IBTH 4QGTA 2Y06L 1NC2B 5I1KH 4U1SA 3HAEA 3ZTNL 3BRGC 4RFNC 2HTKC 4DN3L 4J8RB 2DN7A 4NRXA 4XP6H 4OFDA 3MRGB 1I8LC 3BVNB 5I74C 1H15A 5GGQL 3KS0J 3MLRL 1EO8H 2CRMA 4LLQA 1HINL 2NZ9D 2AABL 4XNMB 5CP7B 4P59H 4LLVA 4OZGE 4JO4L 4PJGA 1VENA 4XP9L 4FQLH 1JRHH 1VGKB 1OAQL 3P2TA 4EDXB 4FOMA 3IDJA 1J0YA 5C0EA 1EHLL 4KVNH 5T33L 2V9TA 4Q9QL 2X9YA 2ZNWA 4JANA 1U3HA 4HLZH 5KS9E 5HDBF 1TJHH 1U91A 5BV7C 2O5ZH 1OT2A 3VG9B 5J11C 3MV7E 4X6DE 4JRXB 5AYQA 2DMKA 5GGVH 5DK0B 3AFLA 5C8JA 4HC1H 2HFFB 4GRLC 2C3VA 2VZ3A 2PW2B 4HS6B 5D71H 3RJDA 1SMOA 1M71B 1DCLA 2QL1A 4AH2A 1WEJL 5DA0B 3QHZL 4G42B 5IROA 1G6RH 1JNNL 5IP4A 1MI5A 4K94C 1P84K 1QLEL 3RTQB 3F7RA 5KSAB 5IBLD 1JUFB 1H3UA 4IIQA 4PS4H 5CD3A 4LRIA 3MA9L 3UX9B 4JPVL 3ARTA 3P11L 4RAUB 1G0YR 2QADB 3RVUC 4HLJA 3OXRB 5C0CB 4UT6L 4ETYA 3IJYB 4YHKH 1U8KA 5DD6A 1MJ7H 2V5TA 2UWEE 3HA0A 3HMWL 1U8OB 1T2QL 1YPZB 2D7PA 4WUKL 1AD9B 1OAYL 3KPNB 2GJZB 4FXKB 2Q76B 4LF3B 5C09D 4JKKA 3KJ4C 4U2ZA 1S7WA 3EO0A 3A6BH 2FBJH 43CAB 2VQTA 3LEYL 1I1RA 3D5OF 4RNRA 3U79A 4A6YB 4AL8H 1CDIA 1JE6A 4QKXB 1KENL 4DW2L 5DJCB 2R56H 3H8NA 1MFBH 4HH9A 2DLGA 1VHPA 1NAMA 3QUMH 5C0CE 4I4WA 3RGVD 2EKSA 1HCFX 4HS3B 1WCBA 4JKPH 3LEVL 4UQ2A 3VFNB 2WNGA 1HNFA 4JRXD 5LAXA 3D0VB 1R3LB 2FJGA 1IM3A 2AEPH 4L1DA 2PXYC 5AZ2L 1JK8B 4RZCA 3DRTA 1CFQA 3SDXB 5EZJB 3ZDYF 1A14H 3P9MB 1Z6JT 4A2MA 4KZDL 1Q9LB 2OL3A 1CGSH 1U8LB 3ARGC 3AM8C 2HRLA 1R5WB 3ULVL 4HUUA 4HMCA 5E6IC 3T0EC 4EXKA 2I07A 1LE9B 5DXWA 5EO1B 2LAAA 4WI6A 1AO7B 3GK8H 1RZGB 3RTQD 4KHTH 5IK3B 5A16B 3TA3D 1A6WH 3B3IA 3FN0H 4WU5B 1EGJH 4FQQB 1PG7H 4NO5B 2XTLA 3D2UA 3TT1L 1X5YA 4LHQB 2PO6D 4AG4L 2XN9B 3FRUA 4OD1L 4XAWH 1ZA6A 4ONFH 2HTLD 3QWRD 3DHJA 4OV6F 3PQYE 3SDXE 1HXMA 2WBJC 2EXYC 4G6KH 4J8RA 3T3ME 3GEWB 2VITB 2A9MH 4GQ9L 4LHUD 5HYJB 1ORQB 4WO4C 4Y4FB 1IFHH 2R9HD 2Z35A 4LOUD 5C09A 5C0DB 3MV9B 4ZUTB 4OFYD 5C0FB 4D3CL 2Y23A 4UBDD 5ENWA 1OSPH 2DYPB 3ARFD 4BKLB 5CGMA 1VGKA 5E70A 2WK2A 4OJFL 5DJ6B 1A3RH 4NN5C 1Q0YL 5JORB 1Q94B 4FABL 2AJVH 3RGVA 3V8OA 3D0LA 4Q6IA 4JO1H 1F58H 2Q8BH 2MWCA 1PW3A 2HWZH 3HPLA 4JRXA 32C2B 4X80L 4LDEB 3WKNA 3OAUL 2EH7L 4IRSB 3U6RB 1BGXL 1RZJL 4FFVC 4JFEE 3MV9E 4YXHH 2PW2A 4BJLA 4HS6A 3NOIA 4RAHA 2VQUA 4LLDB 1SM3L 3RNKA 2W9EL 1D5ZB 1M71A 3I75A 4M4PA 1QSFD 4G42A 3TNMB 3T1FB 4OF7A 4NQVB 2GK0A 1UM4L 2R2BB 3L5HA 3V52H 4NO3B 4AM0B 3RTQA 5TF1H 3TA3A 1MLBB 4TN9A 1RUAL 1X5FA 3GI9L 3WKML 4Z7WB 4RAUA 2DWEB 3QQ9C 3L3OB 2RIKA 3OXRA 3QWRA 4HBCH 4ZUWA 1T3FB 3WIIH 1N5AB 2VLJD 1AE6H 4UOW0 3CXDL 4HBQA 4OD2B 3EYOB 1BMGA 5HVGB 5HYJD 4LFHG 4Y4FD 3B2UC 1J0JA 3KPNA 5JIKA 3BT2L 2GJZA 4FXKA 4LF3A 5DVMA 1GGCL 4QF1B 3QCUH 5EO9B 1T1XB 1CXFA 4YPGB 5GS1C 1OAKL 43CAA 2XQYG 4B5EA 4ZUUB 1JWMB 4A6YA 4OFYA 4TSAH 1YZZA 3MBXL 2RAMA 3PWPB 5DR5L 2B20A 3AY4C 3RGHA 3QXDB 3MFFA 3MRIB 3ARFA 4L8SA 3WE6B 5HHVH 2BSSB 3I9GL 1EVTC 1NMCC 3GDBA 4M02A 1K3IA 4QO1A 3VFGH 4DK3A 4DN4L 3WLBA 4TPRL 3VFNA 2IH1A 4R4BA 1I7UB 2EDKA 4KTEL 3GSNL 3RX7A 4M6MH 5I75C 3ULUF 1NSNH 1F8TH 3UROR 1KCUL 3BXNB 5ID0B 5J6HB 5F9JB 4X9GA 1WVZA 1QKZH 5EZJA 1OAXL 2HVKB 3V6OC 3HNSL 4U1KB 3REVB 3MRBB 2YPVL 5L88L 1S9VB 1R5WA 4WW2B 5FUCC 4N1EA 4E41D 4FQIL 4BQ6A 1LE9A 4PR5B 3F6LA 5EO1A 2E3VA 4UUJB 1QSFA 4XCFL 1IZJA 1RZGA 4OCXH 3RVVC 4OAWA 5E1HB 4WU5A 4NO5A 4ISVA 5DMGD 2E8ZA 4F15C 5C0BB 5K59E 3BPCA 2VDQL 4IMKC 5D1ZC 4LNVA 3W9DA 4XP1L 2J4WL 1OT1A 1ULVA 3VA6A 4J2XA 1NBVL 4XC3L 4O2CA 1T20A 2YD9A 4U05A 1PAMA 3LN9A 2HLFC 3H0TA 2B4CH 3UTTE 1H5BB 5LJYH 5EG6C 3EJZC 2E5EA 2N4IA 3NPSC 3KXFE 4KH2A 1ITCA 4JQXC 2A38A 2EDXA 4G8IA 4KK9D 2MHAA 2P7TA 3W2DL 5HYJA 3JTTA 1OGAB 1ORQA 4Y4FA 1BQHG 4G6ML 2IPUK 4H0GA 2DOCA 1YN7B 2CPCA 4K8RD 4R0LB 4ZUTA 4MD4A 4NIKB 3K4ZA 4YHZL 3AB0C 4OGAD 3N0PB 4PJCF 4X6BB 1ZGLB 2BVQA 3OKYA 4M7ZC 2VDPL 5DFWH 1AGBA 4BKLA 4OLVH 3BE1H 1DLHA 4IJ3C 2D31A 2HKHH 4OQTA 4KTDL 3L3GA 3O3UN 4NN7C 4UTBL 1IAIH 5I1JL 5KBNC 2M1KA 4KAQH 3MOQA 3G6JF 4KMTL 5HGAA 1TLKA 4OZ4B 4HGMA 3GMRB 1Q8MA 1WBYB 1B6DA 4CRPA 3GMOA 32C2A 5DUMH 5MEPA 3MLYH 4U1LB 1HHIB 4J3VA 3VXOB 2C1PB 3CX2A 3DNKA 4NM8L 4NKOB 3MTRA 4LLDA 2ICCA 2XZZA 12E8H 4QY8B 5EU4A 4HJGA 3MROB 4E41A 3T1FA 3EO9L 1OLLA 2CIKB 1SEQL 5EB9A 2R2BA 3ZL4L 3TGXA 1CD0A 4NO3A 2JB5H 3RVTC 2LTQC 3FQTB 1JNLL 1JWSB 2W0KA 1HCVA 4LPUA 5KAQF 2BNRB 4XNQB 2DWEA 2Q87A 3GO1L 4P9MH 2AXGA 1QEWB 4PJIE 1ADQH 3OR7B 3RPIB 2I9LB 2YC1B 3CFJB 3JBG7 2WWKT 1TDQA 1L6XA 1FG9C 2FLBT 3CFBA 4OD2A 1DVFD 3HI1B 3IFNH 3DGGA 4PGBB 1G7QB 2IWGA 3F7QA 1OGAD 5IB1A 3QJHB 1BFSA 4WWKB 4ZDHA 4YXKH 1A3QA 2V2WB 4UAOB 4R8WL 4WTXA 1PJ9A 1T1XA 3VD3A 3GSRA 1F4YL 1CFVH 1E4JA 5HD8D 4C83B 5GJSH 2GHWB 3VMOA 4S1RL 1FORL 3VXQB 1LE5B 1KIPB 3P4MB 5JR1L 4HGWB 1T2JA 3QXDA 3WE6A 3INUL 3BD5A 1TENA 1IVLA 1T1WA 1K6QH 2J1KA 1U3HC 5FFLA 1Q1JL 3PP3K 1FN4B 5HHOD 4BZ1H 1IARB 4MJ4A 1I7UA 1NLBL 2NQCA 3QIWC 2WUBH 4KMQA 2LU3A 2XICA 1NKRA 1ZLVK 3RWIA 1C5DA 3BXNA 4FG6C 5J6HA 4HLZG 4JO2L 2LFGA 2HVKA 4NN6C 1C12A 2FHFA 3REVA 3FT4B 1AXIB 2IBZY 3KDMB 2DLEA 2G2RB 1L4IA 5IROC 3MUZ1 1H3PL 2ENYA 4N90D 4Z6AT 3UYRH 4WEBL 4JKLA 2Z93B 2ADJA 4NSKA 4IIQC 5C0BA 4MXQD 2EO9A 4LRIC 3GGWB 3V6FA 3Q1SL 3LD8C 4Y4HC 2ESVD 3EYSH 4AEIL 5A43C 3BPNB 2H6PB 3K2UH 4EEEA 1KLGB 4KY1L 5FOJA 4GG6E 2XG5A 1TQCB 3IDIB 3ULUD 1T4KB 2PUQT 3U4BL 3RL2B 5BO1H 5JPMB 3G6JB 1XGRA 5HY9A 1N5YL 1UQSB 3TN0C 1AGCA 4QHKJ 1KIQB 1I1AB 1DVFA 4P46C 1AIFA 5FGCB 1CBVH 1OGAA 4FQHB 3KPSB 1CR9L 4GAGL 1YN7A 4XBEH 4R0LA 1GOGA 3RFZC 4LNRA 3EKCA 3FB5B 1MCKA 2EEAA 3BESR 5DJZB 2R69L 3MJ6A 3QT2A 2PW1B 3X14B 4EUPG 2R0KL 1S7QB 2HT4D 3QG7L 1HEZB 1GZPB 5DEZA 4M48L 3MRKA 3D48R 2IFGA 3MLZL 4NBZB 4YFEA 3QCVL 4XCEA 5C0JA 1KTRL 2AEQH 4MXVE 5IFAH 5ALBL 1RAMA 4NZUH 1F00I 2FGZA 3QDGB 1RUPL 3VXOA 2C1PA 5E5UB 3ULVE 3O11A 4D9LL 1C8PA 5CS7A 4KPHH 1CD8A 3BP4A 3F7VB 4MNHB 2ADIB 2RFXB 3KGRA 3ES6B 5TGBB 4YHLL 2VLKE 3DX6B 3A6CL 1FNFA 3H42L 4PTUA 1WITA 2CIKA 5I2IB 2Y07L 4QHKI 2EIEA 2NX5E 3EZ8A 3FQTA 1JWSA 2YD4A 1G9ML 4OCNC 1DN0B 4ERSL 5L8LB 1FNGB 2BNRA 5F1KC 1Z0MA 1Z2KA 1QEWA 2ESVA 2XWTB 1DQDL 4R7NA 4Q2ZA 3QDGE 1MVUA 4I3SL 4TULL 2P43B 3OB8A 4OLXL 5F9WB 3AXLB 1MUJB 4IBLT 3MXVL 5DLMH 5HYEA 4N0RA 3HI1A 4G7VL 2HT3C 4C54A 3QJHA 5D2LE 3KPSD 1YQVH 1S9YB 4FFZH 5A2LH 4MNGE 5IW1B 2X89A 3LMJL 4ODVH 3QEQE 4C83A 3TIEB 1RURL 3GMLA 4AEHH 3U30B 3VXQA 2K9UA 4WCYL 1QFUL 1KIPA 3IB4A 3P4MA 4M5ZL 2CMRL 2OR8A 4HGWA 43C9B 2Y6SC 4Z78B 1NDGA 1WWWX 3ZHLA 4AIZB 1KXQE 2OQJA 2OL3L 2VIRB 3O4LE 4PJEB 4HK3J 3BUYA 4D0BB 1VFMA 4Y4KB 4MCYB 3DBXB 2P24B 1WTGT 3EDEA 3KPOB 4V2CB 5HTSA 3VG9C 4H88H 3BP6B 5DUBB 5E4EB 3PJSB 3T0XA 2F5BL 4Y2DB 5A2IH 3G5XB 3TO4B 1XGUB 3CNKA 5GS0C 3RA7L 2X7LB 3MRCB 5HGDB 3CFKA 4MA1B 4MWFB 5GGTL 3DURA 2DQTH 3PWNB 4BFIB 1MCNA 3UDWC 3FT4A 3VXUE 5BZWB 3OKLB 1EERB 5AG8A 1IGMH 2WWKO 1NBYA 1DSFL 4N0FA 1FNSL 2GFBA 3L7FB 7FABH 3IDGB 1YY9D 3L1OL 4PB9H 3K0WA 3LKPA 5TDNB 4N9GB 3EGSB 2NR6D 1FO0B 4PJCA 3RTQC 5KSAC 4PJDE 2D7TL 1YC8A 3TA3C 3RWCB 4JG1H 3GGWA 2APXA 1R3HB 1CVRA 4MJ5A 2QADC 2X40A 5EBMA 2H6PA 4JAMA 4HUXB 5IHLB 3IAGC 1KLGA 4G9DA 1JPTL 4FQ1H 4G80B 3GSNB 1P9MA 4TNVK 4ESKA 3G6JA 3MX0A 3U83A 2A0LD 3V5HB 1MCOH 1YYML 1FZMB 1I1AA 1P53A 4WDIA 3F7YB 1JPST 3KPSA 5IEKA 2Y5TB 4M00A 3QHFL 4FZ8H 5TFSL 4PV9B 1KJ2A 3FB5A 1J1OH 4XBGA 4DGYL 2IC2A 3FRPA 4U7SA 2H1PH 2ITDB 1AI1L 3NFPB 1GGBL 2PW1A 2ADFH 3ARFC 3EDKA 2VLRE 3VGBA 1ED3A 3P4LA 2G75B 1D6EB 1S7QA 5CLTA 1JTOA 5E8NB 3QR2A 1DANU 4D9RE 1A7QL 4L3CB 5IQ7L 5D7IB 1CCZA 5C0RL 1U8PA 3LDBB 1YYLH 4LBEA 4F37F 1J8HE 2AP2A 2YR3A 4JJHA 1VA9A 2DI7A 3TPUB 4JREB 3WUZA 1PSKL 3VD4A 3REWA 1A9BA 2LV4A 3GMPA 4PJBF 3EFDL 5CSGA 1JGEA 2RFXA 1KTDB 4N0CD 4KKAC 3DX6A 3HC3L 2ICES 4Z7QE 1MREL 1YEIL 3DUUB 4MXWL 5B8CB 2IALA 1AGEA 1Z3GL 1T04B 4FFWD 3RWJB 4R4FH 5AG9A 1E0OB 3GMMB 1DN0A 1YEEH 4XVUD 4JG0H 1DFBH 3CSYB 2GSGA 2XRAL 3VMPA 3B9KD 4JE4B 1SJVA 4X4YB 4JZJB 1BVLA 1H8NA 3HHRB 3TESA 4TVPE 4I3RH 3FMGH 5D6CA 1MUJA 2WIIA 2FO4B 5CSZB 5AYUH 3MJ9L 3WHXA 4KRLB 2BP3A 2Y06H 4Y4FC 3T0WA 1PKQE 4M43L 5FHBL 1S9YA 3ZTNH 4P5TB 4DN3H 4O4YL 5GSRB 1VB9A 5HHQB 1A6UL 1KELL 4YGAB 4OZFB 2VTFA 43C9A 1NBZB 4QYOB 3MLRH 1KTKE 3RWFB 5A3IC 4JDTL 2VIRA 1HINH 2AABH 1FC2D 4XBPA 4D0BA 3C5ZB 4JO4H 2YD6A 3SKOB 1QLFB 4XP9H 1MVFA 5TDOB 1OAQH 1X5KA 1U42A 4XP4L 2J3SA 5DUBA 4Y16B 1EHLH 4QRPD 5T33H 4LCWB 1T7YA 4OZIB 4ONOA 1M7IB 1WZMA 4X7EC 2X7LA 4IRSC 1IE5A 2AJSH 2BCKB 2X5PA 5BZWA 3OKLA 4AJ0A 2A73A 3L3HB 1ND0B 5F93C 5MEOB 5FDYA 1T5XB 3EGSA 2ZWLT 5ETUB 1AKJB 1FO0A 1W0VB 3UTSB 5KSUA 1WEJH 4HX1A 3QHZH 3UO1L 3RWCA 3RVXC 1JNNH 4LGPB 1R3HA 4YEFA 4NQXA 1I75A 3GSVB 4Z76A 1B3JA 3DIFB 4LK4A 4ZODA 1QLEH 3O6LL 1IAIM 1A1MB 3MA9H 3QJFB 3IT8D 4JPVH 5INDB 3P11H 4ZFFB 3O4OB 2G60L 2D7NA 3C2AL 1FZMA 1RQ5A 2AJ3B 4UT6H 1A6ZB 1V3JA 3FQNB 3HMWH 4YK4B 1T2QH 2Y5TA 4JVPA 4WUKH 4J12A 4M61A 4G9FD 1UADC 4UU9A 4KK6D 4K8RC 1OAYH 2OMNA 4WGVB 4OGXL 4OIIL 4G6AD 2ITDA 2ZKHL 3NFPA 3BISA 1P6FA 4XHJD 3LEYH 4XPFL 5D4QA 2G75A 1D6EA 2JJWA 3CFEA 5SX4H 2CH8A 3GJFB 4FXGB 4UNUA 1JTPA 3MUGA 2A83A 4KKLD 3T3PE 1KENH 4CMMB 3WFEH 4DW2H 1BIIA 3TT3L 4X6CF 2Q8AL 3DVGB 4R2GD 4QRPA 3RY5A 5ITBL 2CLZA 3LEVH 4BQ8A 3HUJF 3MGOB 3TPUA 1BVKB 1FZKA 2A6JA 4CDGC 5FYLD 1ZHBA 4K7PX 4LKXB 4QHMB 4NQDB 4WW2C 5AZ2H 2CKBB 2X9WA 5LVEA 4NGHL 3X17A 1JTTA 5C07B 2JB6B 4ONHB 1DEEB 4KZDH 3H9SE 1T04A 5SX5H 3EW3B 3ULVH 3HC0B 1PX4A 5IEHA 3SKMB 3B83A 5DTFB 3RVWD 2N7AA 3TBSA 2ARWA 3K46A 1T89A 4W4OC 1PQZA 1JGVL 3TBWB 2VLLA 4L8DB 3VJ6A 1H5BC 1S9WB 1XF4B 4L3AA 4JZJA 5L6YL 1MCIA 4IHOB 4AG4H 4OD1H 3ARRA 3BPLB 3OR6B 4K3DL 3ROOB 3J7HA 1XMWA 4U6VL 5FA3A 2VISB 1P7KB 3E6FB 2Q86B 4UZGA 5GSRA 1UM6L 4R0LC 5K9KA 4J4PA 1BD2D 2I60L 4Y1AB 4G9FA 2CLRB 4GQ9H 2BC4A 5H2BB 1MELA 4LVNB 1KYOJ 1OSZA 3N1QC 5T3ZL 2UYLA 4Q58C 2MKLC 4BSWA 3OG4B 1NBZA 4QYOA 4QCIA 3RWFA 4NC1E 5CBAA 4D3CH 2XZQL 5ESQA 1TZIB 2J5LB 5FF6A 1HHHB 4MCZB 1QLFA 4PJ5E 1MF2L 1MI5E 1C7TA 2KBGA 3DV4A 5TDOA 1EUUA 4OJFH 4DQOL 3DJ9A 1Q0YH 5DRZA 4M8VA 4NHCL 4FABH 3BWUC 1M7IA 1IBGH 3QZWA 2FDBP 4U1NB 5SWZB 2H9GA 3W0WD 4KMLB 4HJJL 3QISA 4X80H 5C07D 5MEOA 2EH7H 2BNQB 3PDOA 1BGXH 1RZJH 5HI5D 4NP4L 5EA0L 3RL1A 3B4NA 1T5XA 4XMLL