4YFLI

Crystal structure of vh1-46 germline-derived cd4-binding site-directed antibody 1b2530 in complex with hiv-1 clade a/e 93th057 gp120
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
208
structure length
200
Chain Sequence
b'TQPPSASGAPGQRVTISCSGGPSNVGGNYVYWYRQFPGTAPTLLILRDDQRPSGVPDRFSASKSGNSASLAISGLRPDDEGFYFCATYDSDGSIRLFGGGTALTPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160,Enve
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
total genus 17
structure length 200
sequence length 208
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yflI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yflI01
2BVQB 5A2JH 1SJVA 1RUML 2A73B 2H2PD 2P5WA 3C6LD 1C8PA 1DJSA 2IANA 1BZ7B 2DKSA 5DQ9B 4U6YB 2JJSC 2Y6SD 4YEEA 4D9RE 3UDWC 1TTGA 2WBJC 4ZUSB 3CK0L 4LK4A 5FGBA 3MMEB 3FFDB 1CE6B 3IETA 2R0KH 3MRHA 4QWWC 4MZ2A 5I1EL 4HGKC 4HCRH 1L7IL 4NKIL 2APTA 1MHHA 3QQ9C 2PW1A 2R4SL 3DV6A 3QRGH 3BPNC 1B88A 5I75B 4QRRD 1W0VA 4Q97A 1Q9LB 5T5FH 2ADGB 2R15A 4HS6B 5E95B 3DX9A 1CDIA 1S7TA 1AIFB 1U8JB 2X9YA 3KPRA 3GSNH 4YWGL 2QSQA 1DEDA 4TNVF 4XT1C 2CDEB 4OCNC 2OQJB 4Y4KB 1P6FA 1E4XI 3ARBD 4PTTA 2DAVA 1A21A 3KXFA 1HIMH 4IIQC 5GS0L 1NDGA 1R5WB 1UT9A 1I7TB 4ZAKD 4XVTL 1VEPA 3BP7B 1CE1L 2JCCB 3UBXB 5B8CC 4ODUA 1GZQA 3HPJB 3CMOH 1CVSC 1WZ1H 1ZS8B 4FXKB 3FHAA 4FQ2L 4WCYH 2P4AB 3GIZH 2A6IB 2ED7A 3AXLA 3NTCH 3CSPA 5C7XH 1YEIH 2F54B 1TZHB 1Z5LA 4IEFB 4NNXB 2OTUB 1OTSC 4P5TD 3JWNC 1WBZB 1CLOL 3P2TA 4YDLC 4XC1H 4PP1C 1AP2B 1OSZB 3ZT6A 4IDLA 5JIIA 3UTTE 1E27B 3ES6A 4HH8A 4OZHE 4JO1H 4KROC 3HZKB 3JXAA 4I8DA 4PFEA 2OM5A 3EDJA 3L3KB 1SJXA 4LASL 3RWFB 4JFOB 4NQDD 3GB7B 5C8JA 2ATPA 4OZGA 3RP1A 5B4MD 2D2OA 2YMXL 3MRBB 5F7WC 1BIIB 4KJPC 4HK3J 4XPFL 3T8XB 2BY1A 4M6OL 4NRZB 5C0CB 1MH5A 2QHRL 4XTRC 5E9DD 2Q6WA 1Z3GL 4YXKH 3DVIA 3U0TB 3OV6A 5FOBA 2ZUVA 1RFDH 1MRCL 3MA9L 2JIXA 4Y5YC 3P4OB 3VDAA 4LPCA 4NZTL 1RIHH 3L95A 4QXGH 3G6JA 5BVPL 2D7QA 4P4RA 3O9WB 3TO4A 1TETL 5DD3H 4PJHB 5DMIH 5SWZD 4HDIA 4HIXH 2DOCA 3BIBX 4LHJB 1MI5B 2IGFH 1OCWH 4BA8A 3OKKB 3GK8H 4NSKA 2FEEI 1Q9WB 1WIPA 3KJ6H 4CN4A 4MVBD 4YDVB 5TFSH 1R5VB 4GQ9H 3AREB 3MRLB 1HHGA 1QYGL 3WUWG 1ND0B 3QPQC 3S88L 5GGSB 2AI0H 4R7DA 1AH1A 4MQXC 4GBXD 4PD4J 4X7CC 4O2EA 3QH3B 4OD2A 5IWLA 5F96L 4JFZH 5HXMA 2N4IA 1GC1L 5ESQB 4P46B 4K7PX 4NO2B 1JGUH 1U3ZA 1QKZL 1SQ2N 5FYLD 4JFPB 5GJSH 5JHDB 3EYFB 3T2NL 1VDGA 4LHUB 4U6XA 3HZMB 2ZCHH 3FFCA 3WJLC 1KT2A 4HEPG 2IAND 4C58B 5CAYB 2A9NL 4MB5A 4LCIL 4S1RH 4KRPC 5KN5A 3QHTC 1TJIH 2BNRD 3LIZH 2OBGA 3X14B 5GS2D 4C83A 5TE4L 4GS7B 1S7VB 2EICA 3V4PL 1GPOH 2EDXA 3ISWA 2BK8A 5DJ2A 5ADOH 3QUMA 3I9GL 5MENA 4KKLD 4JHWL 4BZ2L 2FX7L 4JQIH 3TVMC 1XGPB 1B0GB 3U7WH 4XNUH 5AZEL 1WEJL 1FFOB 2JCCE 1FRGL 3R06B 4FFZH 3HE6D 3HNTL 5DGQA 5EBGA 3WDIA 4WGVB 2VLRA 2P48B 3ZKXB 4PJ7B 1TZIA 3BD4A 4Z6AT 3QCUH 1XR9A 4A2LA 5HHVH 5HDBF 4D3CL 1RJZB 2IH3B 1T7VA 4YHZL 4ZUUB 4MSWA 1CQKA 4B0MM 2MHAB 3MV8B 4MXVE 5F7KC 1RULL 3HC4L 5SWSD 1KV3A 4GAJH 3TBVB 4Y4HD 3U6RA 3Q5OA 4TVPL 1S7XB 4HIHA 4IOFD 1JHKL 5E8OA 4WU5B 3RKDC 2DLFL 4Y19D 2WINA 4BM7A 4OLUH 2XZQL 5C2UB 4NQCE 2X7LB 2XFXA 4UQ3A 2ZNXA 1PZ5B 1I85A 2W07A 2OR8A 4J12A 3FO0L 5LQBH 1YMMA 1LK3L 2J1KA 4BKLA 5I1KH 2DTMH 1FCGA 1U3HD 4BH7B 3GI8H 2UVFA 5C0CE 1YQ2A 2E8ZA 2Y07L 1NC4B 1ACYH 1QFHA 4UUJA 1NSNL 2CK2A 5IK3B 1R5IA 3ALWA 1EJOH 3IXTA 1MQ8A 5B3JF 3FB5A 4OTXH 4KQ4H 5HHXL 5ENWA 4JKMA 5FUOH 5EU5B 1M7DA 1CLZL 1BBJB 5T3XH 12E8H 1NFIB 3KPQA 1AI1H 5IR1B 1ACZA 1ZGLB 5KSAB 1CG9B 4PJHE 5D7SL 1CK0L 3O2WH 5DJXA 3VFTA 1NCCH 5HHQB 1MI5E 2R9HC 4TSCL 3PWUA 4KV5F 2AQ2A 2AJXH 5J6GB 2EYSB 3B5GA 5SWZB 1XGRA 1RMFH 3K4AA 3OGCA 4ZSOA 3T1FA 3WIFB 5DJCB 3PV6B 4M5YH 1IZJA 15C8L 1UZ8B 1JYVA 2OZ4H 1ZHLB 4OBRA 1UYWL 3T08A 2XRAH 4PJGF 5BW7C 2O5YL 3HAEG 4KUCF 4D8PA 2C3VB 4J6RL 2GT9B 3W9DA 3T4YB 1LEIB 4WUUD 4ZQKA 5IQ7L 1FVCB 3MBED 2RCSH 4FNLL 3LV3B 1DL7H 2OL3B 1X5YA 4JRYA 5K9OB 2G2RA 4GRWB 1ZSDB 1W0WB 5JHDE 1YPZB 2J88H 5IV2A 1DVFA 1I1AC 5DMKB 2DQIH 4MXWL 5D7KD 3C5SB 1NFDA 1YEHH 2D0HA 3A6OA 3MCLL 4LSTL 3RAJH 1JWMA 4XPAH 4CADB 3WUWB 4RDQG 5ID0A 5IG7B 1I8IA 5D2NA 1T7XA 4OGYL 3ULUF 4X7DC 4ELMA 4L4VB 3KPNA 3O6FD 1N6QH 5BO1H 3MC0A 1FAIL 1T5XA 4X6DB 5I1IL 3UROR 3FOMB 4BUGA 3L3GB 1AY1L 3BKYL 1PYWA 4BQBA 2BY0A 4NUJB 3WN5A 3F7RA 3O4LD 1IC7L 3W39B 3O6MH 4PRPB 3GHBL 4QHNB 3HMWL 2MCPL 3MLSH 5GZNC 4MCYA 1Q0XH 5FECB 4LCWB 1HKFA 3BZEA 5DXWA 4PBVC 1U93A 3NZHH 5DJ8B 3CVHB 2XXCB 5IKCA 4R8WH 3O3AA 4P3CL 4X7FC 3OR6B 4NHCL 2CLZB 3LKPA 4WWKB 3OSKA 1MLCA 1CD1B 1CGXA 4RX4D 2D7TL 3HR6A 4K7PL 3BPCA 3WS3A 1EGJH 4WI5A 5C0EA 1Q9OA 4IRSD 1ZLWK 4PJ7E 1OAKL 2VLJD 3INUH 4NDMB 1DQDL 2COQA 1I7ZA 1TNMA 3S96B 5F9OH 3KPPB 4I3RL 1W72L 3UYPA 3V6OA 2FB4L 4HXAH 4U1IB 4OLYH 3B3IB 4GH7B 3REVA 4F15C 4R0LC 2AJUH 4OFYA 1M71B 3SDXE 3VJ6B 3ULSA 3KLHD 4AEIL 5DZOA 4YC2B 3A6BH 1PD6A 5C07D 1ZGLP 3TT3H 5DK0A 1S7QA 1RV6X 1WTGT 4YEFA 4JM2F 2B1AL 4N0UA 5FM8A 1U2CA 1IEAA 1TJGL 4C56A 4XX1G 4Z7VA 2NX5D 1IGTB 2ESVA 4PPTA 1BQUA 2X6MA 4MJIA 2I60L 2WIIB 3QHFL 4DKEH 1IGMH 2LE9A 4MA8L 4H1LG 1E4WH 4F8TA 4JVWA 5EFIA 1M6OB 3MGTB 1QLRA 5A16B 3FZUC 3CSYB 3VH8G 4H0IA 2LVCA 4PY7B 3VG9B 1LO2H 5E08L 3MRDA 3MOQA 1FSKB 3IFLL 4MWFB 1EMTH 3RDTA 4X4XA 3TO2A 5E9DE 5HTSA 3KDMA 4JFYA 4QHLB 4PV9A 4KKCD 2F53B 4Z5RB 2V7NA 3WLWD 1U8QB 5IOPA 1T4KA 4CDGC 1A6TA 4M48H 2VISA 3MV01 4M1CC 2A74A 3V4UL 2HMIC 3BOVA 2UWEF 1JHLH 4IRZH 4ODSL 1FNGA 2C1OA 1R3IL 4HULB 1MFAH 4CNIA 4S1DC 5I1AB 5MERA 2VXVH 3JWOL 4ONFL 3KPMB 5SWZE 3CFCL 3BO8A 3QQ9D 5D8JH 1WICA 5CUSL 1D6EB 4LHQB 4ODXA 1Y6KR 3MLZH 4LPVA 3Q1SL 4M7ZC 4ODVH 4UB0H 4LLWA 4XHJC 4MNQB 1UM5H 5A3ID 4BSWB 2DMCA 1JUFB 4NO0A 1FDLH 5L2KD 2R56H 4JPIB 3VD4A 1JGVH 5I73B 5D93B 1MJ8H 2NXZC 4GRWE 3UO1L 1HQ4B 2ZPKL 4JANA 5DRZA 3T3PE 4EBQL 2IBZX 5CMAA 3TBWA 2M1KA 1PEWA 1WAAA 1SEBB 4KUZH 3U83A 1P7QA 1YNTA 3BKCL 4JRYD 4G8GD 4QHUB 4Q9RL 5CJXC 3BGMA 3D2UA 4K9EL 4FFWD 3HAEB 4KZDL 2CDFB 1HEZA 4RBPK 3O3DB 3MODL 3W5MA 4JY6B 1X44A 5L9DH 4L4VE 4JKWA 5DT1L 2AV7B 5H35B 2DI9A 3RUGA 2OXGA 1MFBL 5LXGH 4PJDA 2DLIA 4X6DE 4BSVA 2OTWB 2JJVA 4FP8H 2DWEA 3CDCA 1A7OH 3D39D 1V3KA 4IS6B 4MAYD 3AY4A 1UA6H 2CGRH 3GJFK 5GGRB 1DLHA 5J06A 1IFHL 2CH8A 1VEOA 3WXVL 3K2UH 1DQLL 2ZOKA 3V0VB 1UQSA 3RNQA 1J8HB 1RURH 1L0QA 4LARH 4LCWE 3S36L 4I48B 1U0QA 3O2DH 1PY9A 4M7KH 1BF8A 4NFCA 5DFWH 2SEBA 4L9LA 3VXUB 1FGNH 2BVOA 3RTQC 5F7EH 2V5YA 5JR1H 3KNBB 3P30L 4PJ8C 4PRNA 4L9DA 4OFPA 3KLSA 4J8RB 1V7ML 3GMNA 32C2B 4Z7QF 2NY6C 1MOEA 1AXIB 5EC1A 4FABH 4GRMB 4XBPA 4G5ZL 5HYIA 1JPSH 2YA2A 4P2YA 4YIQB 4XNZB 3SE3C 4H88L 2PYEA 4EI5C 3ROLA 5TE7L 1D5IL 5EZIH 5EIQA 1QO3A 5H37H 4KTDL 1C5BH 4QOKB 4JPVH 3L6FB 4U3XA 1MJJA 4O9HH 2ZZUT 3WMSA 4Z78B 3DHMA 3X13A 3JV5A 3TA3C 3QIBD 1TJHL 3WE6B 5FA3A 1UACH 4JN1L 4PGEA 1AD9B 5EOTB 4MJ5A 5CKAA 2ATKB 3WS6A 4ZFGH 3BEVB 2WUCH 3ARGB 1DUYB 3QT2A 3VGDA 4G6KH 3P0YL 1QSZA 2HWZL 1IGFH 4XNYL 3W0WD 4BZ1L 2DBLL 5CP3A 1CZ8H 3CH8A 4GW5B 2E6JA 3STZA 2I26N 3CH1A 2JLLA 2K7PA 5JZ7C 5EUOB 3EYQD 1BGXH 3GMRA 4IMLB 2AXGB 2HA1A 3REWB 3MOBL 4QHKI 5DD0L 1OOAA 3FMGH 1ITCA 1JFQH 1WCBA 4Z7UA 3RFZC 2XZZA 2LU4A 1MRDL 2ZCLH 4LCCC 3R1GL 4POYA 2OL3L 5SX5H 4ZNEE 2DWDB 2CLRB 3LN4A 2B5IB 3I3DA 2R0ZH 3HN3A 4K8RH 3MRPA 3DLQR 1I1YB 3KLDA 4NO5B 3MRJB 4PRIB 3KYMA 3FB6B 1KIRA 4OJFL 5FYLL 1RPQA 5E56A 4H1LB 4DTGH 5HD8D 5J9PB 1JGDB 3ZT7A 4JAMA 1A7NL 1RZFH 5HGBA 3VH8B 2WBJB 3BXNA 4OIAA 1BAFL 4PYGA 4KRPD 2VLMD 1Y6MR 3RX8A 1EAPA 3DUSB 4BQCA 1M4KA 1J10A 4Q74A 4IHOB 3GEWB 1Z2KA 2AABH 4U1HA 3BPNB 5ICYA 3EYSL 4QTHB 1B2WH 5JORB 3DWTA 2JB6B 3GJFA 2NYYC 5EZLA 3C08H 3FT3B 3NCJL 1DR9A 2W65A 5L2KB 1CBVH 6FABL 4PB0L 4RFOH 1JNLL 2G5RA 3D3VB 4F57L 1EVUA 5IBTH 2ZP0T 3QEQD 4EJ1C 3QG7H 1SJHB 4IIQB 4UIKH 3TYFB 1AGCA 5J0BA 5D7KE 3HNSL 1HWHB 2DLEA 3TNMA 4M6NH 5B8CB 3WLBB 4PJAB 1HSBA 4HUKB 3LQAL 4F9LC 2DQGL 3RBGA 5BJTB 4NJAH 5C1MB 4RMRA 3DRQA 1YEKH 5L2JB 2WV3A 3MLYH 1LQSR 1OD7A 1KJ3H 3SE9H 1EUTA 1FL5B 1BF2A 2WBWB 1MVFA 2YPKB 2ZCKH 4HWBL 4UI2A 1J8HE 4YDLB 3P73A 2BVQA 3D39B 4HFUL 5ICZB 5IMOB 4CMHC 3O4LE 4EEEA 2A73A 1XIWC 2HYMA 4YNYB 1GXEA 1BZ7A 1HNGA 5DQ9A 3VXUE 3BH9B 4U6YA 3PWLA 3S3SA 1K2DB 4JG0H 4MQSB 4ZUSA 1NBZB 3MMEA 3FFDA 2BX5A 1CE6A 4GMTH 2YBRB 3WFHA 5BV7L 4TPRL 3HI1B 5DC9B 4YHLH 1KLUB 3MJ8B 4XMLL 3V79C 4MQ7A 4ZS7H 1JK8B 1GVIA 1K9TA 3MRFB 5CFHA 1VPOL 5HYSG 1Q9LA 2GJ6D 1IKFH 2XQYK 5A40E 2J6EL 3HRPA 2ADGA 4HS6A 1IQDA 4EDWL 2A9ML 3U0WH 5IVXA 2VAAB 4Y5YB 3WV0A 2CDEA 5CCKL 3DIFB 1MRFH 3WJJC 2OQJA 4Y4KA 1GGCH 2OTPA 1CCZA 4Z7NE 2YPLB 5C92A 5FGRA 3QAZC 4DQOL 2LFGA 3OJMB 1R5WA 4MDJB 1I7TA 2DI8A 3TYGL 4GSDH 3BP7A 4AT6A 4YH6A 2DIAA 2JCCA 3UBXA 2CSPA 4KK9C 4KMTL 3HPJA 3DX7B 3PXHA 4Y1AD 5J11C 3LRSA 4FXKA 4CVZB 2F5AL 2WLYA 5KVFL 4JPKH 4NQVB 4EOWL 2K9UA 2A6IA 5ADPH 3ULVH 2F54A 1TZHA 1CL7H 4H25B 4NNXA 2GEEA 2OTUA 5D7IF 4MS8C 3C2AH 1ERNA 1QA9B 1WBZA 1H3WM 1Z9LA 2IQAB 1AP2A 1OSZA 4XX1E 2A6DB 4LLQB 4OD1L 1E27A 5JOFB 2JK5A 5DJZB 5F7NC 3SDYH 3HZKA 3HUJB 3L3KA 4JHAH 1IM9B 1QACA 1SJEB 4JFOA 3C9NB 1NMBL 3MGOA 4S1SL 5B3NA 5C0GB 3GB7A 4XCCL 4GKZB 3VG0H 4LEXL 4X6CA 4FXLA 5C0NC 5J1TC 3MRBA 1H15B 3GMQB 4Z7WF 5IB4A 3DSNA 2UY6A 5M7QA 3FAXA 4I77H 3T8XA 2QBWA 2APVA 1JMXA 5C09A 1XF5A 1JN6B 2AP2A 1QUNA 4KRPB 2H26B 3A67L 5EO9B 4R2GD 1EEYB 3S8WA 2ADFH 2XA8L 1WZLA 4PJ5B 3U0TA 2HRPH 3H42L 1F58H 1QBBA 5I8KH 2R1XB 4Q6IC 3D5OF 3IXAB 3P4OA 2ZKHH 3PDDA 3RIFF 3LQMA 3PV7A 2A0LC 3TGXA 1PKOA 5L2KE 4LNRB 2PW2B 3CVIL 3K81A 4N0CC 3BDYH 4CN1A 3ARFC 4N5UA 4L5FH 2P8PB 2D7NA 2ADIB 3R0NA 1MI5A 3TVMB 5GRZA 3OKKA 3EW3B 1TIUA 3ETBF 3GO1L 3OAZK 4WO4D 1RJYB 4PJAE 3KYKH 4ZOCA 4P2CG 4YDVA 1R5VA 2Z92B 3GRWH 3HPLA 3AREA 3MRLA 4OT1H 1MIEH 1VGKB 1ND0A 4XMKH 3I50H 3ABZA 5GGSA 3B2UD 5GJTH 3QH3A 3EHBC 5IW1B 2VDPL 3GBLA 1MQKH 4M9PA 1K8DA 4NN6C 3B4NA 3NH7L 4WHCA 5I9QC 4JLRB 3OHXA 3D39E 5LBSL 4P46A 3CU1A 3MA7B 3Q5TA 4NO2A 2XQBL 1INQB 3KPTA 5JHDA 3EYFA 4LSQL 2DQCH 4LHUA 3HZMA 1U6AL 3L9RB 4XP1L 3EOBB 4PJXF 4PUBH 2PNDA 5IM7B 1IBGL 1ROWA 3FTGB 4KVNL 5FDWA 5EOCH 5JIPA 3F62A 5D4QA 1WWCA 2EH8L 4XNQB 3X14A 3HI6L 1CL7I 1IGCL 3IVKB 2RBLA 1H3VA 5SV4A 2IBGA 5EULV 2E7LA 3UYRL 3BP4B 3X17A 4K7PY 1R3HA 1OAXL 4EIZC 4RAVB 2HFFA 2Y25A 1NQBA 2NTFB 4N1HB 4Z76B 1LP9F 4NFBA 1OAQL 1DDHB 5IJKC 2YPLE 4JFDD 1ZVHA 3UAJD 1B0GA 3QDHA 3MLRH 3EYOA 3E1F1 4YO0A 3RBSA 1FFOA 4YZFF 2F9BT 4G8IB 3R06A 5HYSB 5C6PB 1QRKA 1D5MB 3N1GC 1OTUC 4OLWH 2Y1VA 4XWOC 3W0WE 3MRCB 2XKNA 2GK2A 3ALPA 4GG6B 1ULVA 3RVXC 5HI5D 1LEKA 1P69B 4C4KO 2NY0D 4N8VG 3H9HB 1II4E 2MHAA 3MV8A 4HT1L 4U33A 3TBVA 2FD6H 5E6IA 1RUQH 3HCVB 1AC6A 4JO2L 2AEQH 3EJYD 1S7XA 4RGMC 4BQ8A 4WU5A 5KZCB 2FGWH 4MGXA 1KCRL 2WM0A 3O6LL 3QCVH 3Q5YA 2GTZB 3UZEA 1I1AB 1QHOA 4RMWA 1OB1A 1AQKL 1PZ5A 1OPGL 2W9EL 2EC9U 5HGAB 3C5ZC 4YHNB 4BH7A 4PJFF 4GKSB 4QHKJ 2RHEA 3EOAB 1NC4A 3VI3E 3QQNA 1G7LA 3E6FB 4LIQE 4PJ5E 2NNAA 2FX9H 1UCBL 2DD8L 1NLDH 3BESR 1I3GH 3KPLA 1IJ9A 3QDMB 2AJYL 5C09D 1LHZA 3LS5H 3OXRB 4RMQA 3E2HC 3QA3B 5GRVL 4RWYH 1BBJA 5LGJA 1ZV5A 3EFFA 4UTBH 4YDKL 2B20A 2X4OB 5HGDB 4LVHC 5DFVC 1F11B 5F88A 4PJ9A 1QBAA 2JELH 1ZGLA 1PG7W 5KSAA 1CG9A 3PGFH 5F93C 5HHQA 1PX4A 3V2AR 4HXBH 3OKOA 5J6GA 3V0WH 3ZE1E 4DCQB 3O81A 4UT7L 3WIFA 1FP5A 3PV6A 1KJ2A 4DAGL 1UZ8A 3FQNB 4YUEH 4GG8A 1ZHLA 4GMSH 4P4KC 5CIPB 5C0RL 3ZKSD 1TITA 2C3VA 1I9IL 3T4YA 2EDNA 1K6QL 3BKJL 1FVCA 1F45A 3OB0K 3T2QA 4F15B 2VH5H 4R0LB 1DQTA 3LV3A 3MV9D 3SJVD 1HILB 2BVPB 2OL3A 3V6FB 5K9OA 3W11C 2JKXA 1ZSDA 1VACB 1W0WA 2LAAA 1NAML 1YPZA 1PQZB 5DMKA 1L6ZA 3MX0A 2I9LB 3IAPA 2DTSA 2DRUA 3C5SA 2VC2H 1T1XB 4YPJA 4U6TA 3G08B 2ENYA 4QGTA 4CADA 4Q7DA 3DUHA 4NNPL 5IG7A 5E7FA 4MA7H 1MHEB 2Y06H 3MACH 1JZ6A 4RGNC 3ROOA 4H0GA 1KEMH 3KS0H 2ZUUA 1AR1C 4OCXH 4X6DA 4BZYA 3NCFB 3BIKB 3FOMA 3B2VL 3L3GA 5CBEB 4NUJA 3U0PB 2A77H 1C12A 2GJ6E 3P0VH 3U9UB 3W39A 3QYCA 4PRPA 3WHXB 2AJVH 5HI4D 5FECA 4LCWA 5IGXH 5IMLA 5DJ8A 1FZJB 3CVHA 2OS7A 4TRPL 1INDL 1VADA 4GXVL 3OR6A 4NP4H 3RWGB 5KANI 2AXHA 5KAQG 4XBGB 4G7VH 4WWKA 1CD1A 5LWYH 4OIIH 1H8NA 5JW5B 1WZMA 4HMEA 4LVOC 1BD2D 3KVQA 3RPIB 4Q58C 3WFEH 4WNQB 4NDMA 3C60C 5DJ0A 3S96A 1U91B 3KPPA 4LIQL 4Y1AE 4M7ZB 2X1XR 1EXUB 3B3IA 4KKBD 4GG6E 4GRLC 1ODAA 4PY8I 2FATH 1UADC 1M71A 5DHYB 3IGAB 4DFIA 3VJ6A 1G0XA 2HKFH 2NXZB 4PS4H 2CKBL 4ERSL 4OZGF 4DGIH 4YXHL 2WUBL 2DI7A 1VFBB 5E6ID 1SVZA 2DKUA 1IGTA 2D7PA 5C9JA 1P9MC 2WIIA 4F7PA 2CDGB 5IMMA 4N8VB 3RY6A 4O02H 4KHTH 5A16A 5JA9A 1QFWH 3CSYA 4KGJA 4PY7A 1HWGB 4HWEH 1MREL 3LKQA 3NZ8A 1A1NB 4MWFA 5IROC 2H3NB 5LAXB 2H1PL 5GHWH 4Z0XB 4XPHL 1KPUB 1I3UA 3G6JF 4QHLA 2F53A 1U8QA 3CFBA 1FO0H 2AKRB 3U1SH 2XTJD 4K23H 1B3JA 2E7MA 1Z9SA 3VFUB 1YECH 5D5MB 1RZ8A 5TPWL 4AH2B 4PRDA 3BD3A 5KG9B 5I1AA 1BMGA 1CGSL 3RTQB 1J86A 3KPMA 4AL8L 5E0QA 5H94B 1YNKH 4MD5B 5EA0H 4PJ8B 1RY7B 4N0YH 5GRYA 1D6EA 3IRPX 2E7BA 3DROA 4U4BA 3DECA 4HJGB 5MHSE 5GRJH 2NY6B 1S9XB 3FN0L 4MNQA 4TUJB 5DLMH 1DANU 1JUFA 1SEQH 4X80H 4XWGH 4JPIA 4WFGE 3WUZA 4I0PD 1OP3K 4EI5B 4FQIL 4F7MB 1HQ4A 3V5HB 3QWOB 3Q0HA 2E27L 1CICC 1SEBA 3WEXA 3H3PL 3TA3B 4RGOH 4U49A 3JBG7 2B2XL 1F6AB 1A5FH 1NANH 3O8XC 3HAEA 4J3WA 2CDFA 3STLA 2F19L 1GAFH 1GGBH 3O3DA 5I1HL 4JY6A 1LEGB 2AV7A 5D1QA 5C0FA 1RI8A 5HDLA 2OTWA 3T04D 1ZOXA 4MMZC 4ZOEA 4KTYA 4KI5C 4X7TA 5GGRA 2P1YA 5TF0A 2LU7A 2C1PB 4LCCB 3UPAA 3V0VA 1C5CH 3GJEB 1J8HA 5FYKD 4Z95L 3V52H 4I48A 4I2XA 3B83A 4NQEB 3VXMB 3ULVC 4TQEL 3VXUA 1JNNH 4WFED 4OGAC 1KC5H 2ZUSA 3DGGB 4IDJL 1RZJL 1X5KA 2BZDA 3NAAH 3KNBA 2J12B 4MYWB 1N64L 4XPGH 5GRUH 1RVFH 3LEVH 1DBJH 3C8HA 5D71L 1T21B 4GRMA 3GMPB 4LFHG 3EFDH 2NY1D 4YBHA 4YIQA 1RQ5A 2KDGA 3MQIA 3MXVH 1N8ZA 4KAQL 4KK8D 2FBJH 4QOKA 3OPZL 2PUQT 3L6FA 2B1HL 1SBSH 5DJDA 4N0CD 4N9OB 3W82A 4Z78A 5I18L 4N90D 1N5YH 3QIUC 3BSZH 3WE6A 1MWAL 3NA9L 4XVSL 3U4AA 1AD9A 1NCBH 2AEPH 3NPZB 4FTVD 5JW4Q 3OBAA 3MREA 2ATKA 1IC1A 5C70A 3BEVA 1RZGB 1RUMH 5IB1B 1DUYA 4JFFD 3DETD 2FNBA 5I30L 3TN0D 3CGTA 4WTXA 1FNSL 4GW5A 4DOHB 1A9BB 3IS1X 3CK0H 3TC9A 3RU8L 1NCAL 2WK2A 3QDJB 1NPUA 4MD4B 5EUOA 3Q3GB 3REWA 4IMLA 2AXGA 5I1EH 1S8DA 1L7IH 4NKIH 5E99L 2P7TB 1JZ7A 2R4SH 1GOGA 3LMJL 3EO9L 2UUDK 2R2EB 2DWDA 2CLRA 4NKDB 1Y18B 5FYJD 1I1YA 4KJWC 4L1HA 3VCLB 4PRIA 3L3HB 4CMHB 3OMZA 3FB6A 5JPNB 1XIWB 5DRNB 4YWGH 1A14H 4H1LA 4P2OD 3BN9D 4KPHL 5DVNA 2JJSA 5AG9A 3HC0B 1GOFA 3VH8A 3FONB 3UDWA 2WBJA 2BNQB 1KG0B 5B22A 2GW5A 3DUSA 3MRRB 3EYUL 4FQXC 4IHOA 3RZCD 4XVTH 1CE1H 1FVDB 4JFHD 1V7NL 5IFJB 4FQLL 4ZXBD 4YHOL 3ZE0E 2QSVA 2KZWA 1CGYA 4QTHA 4EZMA 3VFWB 5JORA 2XOTA 1I8LC 4FQ2H 2JJWA 3SPVB 2JB6A 2NZIA 3WHE0 4Y4FC 4KK6D 3FT3A 4X6FB 4KKAD 3U48A 3SHSA 4L4TB 2C26A 4I0PB 3D6GA 1CLOH 2WSKA 3SJVE 3B9VA 2XACC 3D3VA 1FAKT 5D1XC 4TN9A 1T0PB 5EOCJ 1LMKA 1LGVA 3QAZB 4IIQA 4R4FL 4UDTB 4UV7L 3TYFA 2VYRE 2GJZB 3JUZA 3VWJC 4LASH 3U2SB 4ELMF 1J05B 2GHWB 5FK9B 2YMXH 3T09A 1JV5B 5J11B 2EKSA 1J0JA 4CDHA 4NHUB 4XPFH 3S5LG 3WFCL 5MP6L 1OT2A 1CFNA 4AIXA 4HLJA 1KIQB 2ED9A 25C8L 4HK3N 5CJBA 2QHRH 5D1QD 4NC1C 2YPKA 1Z3GH 4ONGL 2PXYC 2FEEL 5ICZA 1DEEB 1BWWA 5IMOA 2HJKB 3TP4A 4NT6B 4YNYA 1MRCH 1NGQL 3MA9H 5D1ZC 3FO2B 3LPFA 5EORL 4NZTH 2ITDA 4Y0GA 3ARDC 5I66B 1P53A 1K2DA 3U46B 2HTKC 4QTIL 4WTWA 5BVPH 1NBZA 2NY2D 3GUTB 1TENA 1ZHNA 2YBRA 1TETH 4XP6L 3HI1A 3MJ8A 2AK4D 3WDJA 2YSSB 1EZVX 1JK8A 1PY4A 4OLXH 1ZKAA 2DIJA 4WY7L 2W60A 3DJ9A 3MYJB 1Q9KB 5A2IH 3BHBA 1N4XL 4OZIF 3OKNB 1BWMA 3UC0H 4JRXB 5EU3B 1QYGH 5IEKA 4PJIA 3S88H 4Y5YA 4Q6IB 3RVTD 2VJXA 5FHBL 2I24N 3EDEA 4Z7VF 1MY7A 5HI3D 2XWBB 3LPGA 5D2LB 1GC1H 3QULB 3ARFB 4M7LL 2C3GA 2EYTA 1A0QL 2B39A 3T2NH 1QSED 4HUNB 2A2QT 3O2VL 3FQRB 4DOHE 4CVZA 3TZVC 4NQVA 3ARRA 5EBLB 3BZ4B 4I3SH 4PY8J 5T1DL 2A9NH 5H37G 2O5ZL 4G7YH 4LCIH 1DN2A 4YE4L 2RB8A 3UYOD 1QA9A 4O5LL 1EFXA 5D7LB 2IQAA 3WKML 4QEGA 1TMCB 5TE4H 1TZGL 1NCUA 3V4PH 4NN6B 2A6DA 4LLQA 5I9QB 5JOFA 5DJZA 1Q8MA 3HUJA 2DIBA 5KVMC 1QSFD 3QUKB 1I7RB 1SJEA 2XTJE 3I9GH 5C0GA 4UNUA 4Y5VB 4QRTB 3FB7B 4M1GL 2X4NB 2MMXA 4JHWH 4BZ2H 1H15A 2BNQE 1FVEB 4D0BA 1QVOB 4LKXB 5ERWB 3TF7C 2JTDA 4Z7OF 1YN6B 2FEDD 3WJLA 5HBBA 3GSRB 4LLVA 2IG2L 3FN3A 3ZDYF 1WEJH 1FRGH 5DUBB 2PYFB 4RBPH 5EO9A 1EEYA 4HGWB 4ZPVA 1YC7A 3HNTH 4PJ5A 3HNVL 5F9JB 3QXDB 1FNFA 3D85D 1CFSB 2E6QA 2R1XA 2X40A 4OF7A 3IXAA 3MLTB 2FBOJ 4G6FB 4X5WB 1C5DB 4YHZH 4LNRA 4CUCA 4AEHL 1B0RA 5HY9B 5C0BA 5IJVB 5B39G 1RULH 3HC4H 4HC1L 1VA9A 2P8PA 4UV4H 2ADIA 4UOW1 3U36B 4TVPH 1P5VA 4ODTL 5SV3A 3V7MA 2DN7A 1JHKH 2DLFH 3HC3L 4R90L 3C8DA 3C60D 2XZQH 4RRPA 5JO5B 5KOVC 3RUGF 4PJDF 4N8CL 2HFEB 2Z92A 3FO0H 1VGKA 1LK3H 4APQC 1AJ7L 1ZLSL 4P23C 5IW1A 1WITA 2Y07H 3F7YB 1NSNH 4JLRA 5EZJB 3QISA 3ZZ1A 4WI9A 7CGTA 1DSFL 4FQ1L 4NO3A 4Z18A 3VFNB 3MA7A 2OSLB 2E3VA 4YHML 5HHXH 1HKLL 1INQA 4RGMB 5FYKE 3CC5B 4OCWL 1CLZH 3TBSB 1GIGL 3QDGD 3EOBA 4ENEC 3IDMB 3S5LB 1CK0H 2HRLA 3FTGA 1X7QB 3ALXA 5GPRA 3VU2A 4TSCH 3UCRA 3UJJL 3C5ZB 1Z9OA 2VXQH 3PUCA 2VL4A 4YHIA 3LN9A 1CFTB 5JPMB 3RWIB 3I02B 4LVNC 15C8H 4XCNA 5FV1L 3BP4A 1RK1B 1ZXQA 1UYWH 4RAVA 2O5YH 2NTFA 3E2HB 4NOFA 4J6RH 4Z76A 1A6VL 1VFAB 1DDHA 4MZ3A 5IQ7H 4YBLC 5J56B 1U92B 1SM3L 3OG4B 3QSKB 2G5BB 4LVHB 5D2LE 4N90E 1Z0MA 4M4PA 5D9SA 2DQEL 2W92A 4B7LA 4FTVE 3VRLE 2ICEB 4P9MH 1RIUL 5HYSA 3S34L 1D5MA 4MXWH 1F8TH 1W8NA 3MCLH 1KTDB 4LSTH 1A3QA 3MRCA 4YGAB 4LP4A 4Z7UF 5F71A 3IJSB 2QSCL 4AQOA 4ZFOA 4P4KB 5BW7A 4OGYH 3MJ9A 5FGCB 3H9HA 2YD8A 1YEJL 3DMMC 3MJ7B 3CFJB 1FAIH 2Z31A 5I1IH 3HCVA 4LRIC 1YY8A 3BKYH 1GSMA 3KHQA 5A43C 4EUPA 2Y4SA 1EFXD 1IC7H 4X98A 3BIAX 4D9QD 2GTZA 3GHBH 1I1AA 5JQ6L 2MCPH 2IC2A 1DZBA 3H8NA 1J1XL 1KTLB 4IOIA 1IL1B 4YHNA 4P3CH 4NQTA 5K59E 4NHCH 5DDHB 1P2CB 3SGJC 4GKSA 3EOAA 3SGDI 3SCMD 2D7TH 3TFKC 1KLFA 4ZO7A 4YJZL 8FABB 4K7PH 4RGNB 4LDOB 5HGGS 3NABL 4KI5D 4L8SA 1UXWB 1OAKH 4JFHE 3R8QA 1DQDH 3QDMA 5E2TL 1ZA3B 3OXRA 4I3RH 3QA3A 2FB4H 4ODWB 3CMGA 5D7JC 3HKFA 2BRRL 2VXUL 5HGDA 2CIIA 5FYKL 3W81A 1F11A 1MPAL 1MCPL 2V2TB 4I0KA 3MUY1 1AO7B 4S10A 4U7KA 5EBWB 3WYRA 3L5IA 4OBSA 2PR4L 5C08D 3WFBL 4AEIH 4ZFZB 3MZTA 2BVTA 4KRNA 1KBGL 3OKDA 4XH2B 2W0FA 2B1AH 4DCQA 1TJGH 4LMQI 3BJ91 4LVOB 4LSUH 3FQNA 2I60H 4V1DB 3QHFH 3C60B 5CIPA 1TNNA 5I2IB 5EU6D 4DN4H 3QIWD 3CD4A 5DVOA 4RMVA 5FDYA 4GRLB 1J1OL 3RWHA 2PF6A 5B39B 4R0LA 5E08H 1HILA 2BVPA 3IFLH 3LOWA 3V6FA 4HUVB 2P24B 1WT5C 2Y23A 1VACA 5HYQB 4FS0A 4GKOA 1JYXA 2M8XA 1PQZA 1FC2D 4QXTB 2LTQC 2I9LA 4W70A 43C9A 4XB8A 4WDIB 5CJOL 4YAQA 4DZ8B 4ZTOL 1T1XA 3V4UH 1HZHL 1YDPB 4X4ME 1A4KB 1R3IH 3VI4E 2X4QA 1MHEA 5F1NB 4ONFH 3CFCH 1RJLA 2AK4E 3CIQA 5GZOC 4H8WH 5CUSH 3Q1SH 1X4ZA 5IVXF 3U0PA 3U9UA 3F12B 5CJ5A 4L1DA 3WHXA 1T0NA 5K9KB 1FZJA 1AC0A 2IPUK 2A1WL 2XWJB 3RWGA 3UO1H 2JCCF 4MHHI 2ZPKH 4XBGA 4OM0L 3RL2B 4EBQH 3GFUA 3RVWD 3BQUA 2NTSP 1SY6A 2UY7A 4JM2C 4RWHA 5DURB 4KZEL 3HE7C 1QLFB 1REIA 3P4MB 1NMAL 5JW5A 2X4RB 2W0KA 4YHYC 3V5DB 3BKCH 2NMSA 3N9GL 4WNQA 4Q9RH 4JQXA 1QSEE 1WISA 4K9EH 4KZDH 1KCSL 1EXUA 3MODH 3QP3A 5IBLD 4ZUWB 1LD9B 1BFOA 3CU7A 4ODHL 2N1KA 1UCTA 5DHYA 2ICWA 3IGAA 1MFBH 1U42A 4C59B 5GS0C 1B6UA 4HCRA 2DL2A 1IFHH 3WXVH 3BW9B 1DQLH 4X6CF 5D1XD 2ZSWB 5AG8A 4G8FB 1CICB 3SDCC 4E41A 1VFBA 2X4UB 4RNRA 3N1PC 1QSFE 3S36H 1T22A 2FIRT 1X5JA 2Z8SA 4JM4H 4XVUD 3QEUB 1G7MB 5DD6B 2K1MA 4R4NC 5CJXA 3RGVD 4JFEB 3GSNA 3O8XB 1QLEL 4Q0XL 3P30H 4H5SB 3SDAD 4J3XA 3OAZH 1BREA 1V7MH 2KQNA 1A1NA 5LAXA 3EJZC 4F33B 4Z0XA 1KPUA 4G5ZH 1FORL 3RWDB 3BT2L 4H88H 2AKRA 4IBLT 2VXTL 3ECBB 4P2QB 5TE7H 1D5IH 4YK4B 3JSSA 1MHCB 4X7TB 2HT3C 3VFUA 5KANG 1AO7E 3F7VB 5D5MA 2E9BA 4AH2A 2HTLD 5KG9A 1NAKL 1KACB 5ESAA 3ZMRA 1IT9L 3PGCB 3RTQA 2FLRT 1TJHH 5H94A 4JN1H 5C08B 5F89B 4MD5A 4PJ8A 2YPVH 3PWJA 2Y36L 3WIHL 3FO9B 1U8LA 1WCQA 3P0YH 4PB9L 2HWZH 3MFFB 1RU9L 1S9XA 4XNYH 4BZ1H 1KEGL 2DBLH 4EN3C 1U8HA 1V3LA 4FQCL 3SE3A 4EI5A 2ZUTA 2NXYD 3MOBH 1FFRA 5DD0H 4N0FB 3V5HA 1MRDH 3U7YL 3R1GH 2NW3B 2OL3H 1EEQA 4XP4H 4GRWH 3TA3A 1GYAA 3QIUB 3DXAD 5E4EC 1N2RA 1X4YA 1RUKL 1F6AA 2V6HA 4OJFH 1FG2A 3VXSD 3PP4L 1A7NH 1LEGA 2QJDA 5B21A 4LKCA 5EU7C 5JW4R 1BAFH 4TTGA 3UTSB 1GC1C 1LO4L 1MJUL 4O51B 4NJ9L 4DGVL 3D0LB 1M1SA 3T0XA 4RIRB 4RISL 5FOJA 3KWWB 5T5NG 1KTKE 5HVWA 3BZFA 4LCCA 4TTDC 5IVZB 1Y0LA 1MCOL 3GJEA 2ID5A 2VR4A 3EYSH 5JXEA 1UWXK 3SO5A 4NQEA 3VXMA 4FG6C 1CDHA 5SWQB 3FT2A 3NCJH 1F3RB 3DGGA 3SY0B 3OTTA 2OK0L 6FABH 4PB0H 4HHAA 4QT5B 1QQDB 4JREC 1JNLH 4F57H 5AZ2L 4PR5B 3D87B 4RMSA 4HMDA 3NIFE 4F37F 4FQXB 3BQUD 3GMPA 2DYPD 5CGYD 4LSDA 4S11A 1HQRB 1UM4L 1F02I 4QXUL 2DQGH 1RZKL 2DQHL 4LGRB 1RK0B 2HLAB 4Y4FB 3ZTJH 4PRAB 3NBNA 4HWBH 1FZOB 3IRZA 1E4KC 2WWMD 3Q48A 4L8BB 1RZGA 5IB1A 5D1XB 1EJ6A 3PL6A 5JMOC 4OLEA 3AROA 5CSGA 3HG1B 3VWJB 2P8MB 4ZUVB 3MV7B 1A9BA 4E41D 3CNKA 5DMGD 3QCTH 5IW3A 3QDJA 3IDGB 3Q3GA 3MLXL 2E7CA 5BV7H 4F9LA 4TPRH 2P7TA 1AXSB 4XMLH 3FHQA 3AU1B 3NIGE 4KI5E 4UILL 2R2EA 4KMLB 1YA5A 1VPOH 5DO2C 4NKDA 3MUGB 4HZLB 3NPSC 4P2QE 2J6EH 5HHOA 2DQTH 2PXYB 5DMJB 3VCLA 1XF2B 5JPNA 1XIWA 2OP4H 1BVLB 1FV1B 2YOCA 5D1ZB 4G8EA 2YR3A 3EO0B 5CCKH 3HC0A 3FONA 5ANME 1VSCA 3ARDB 5C08E 4TUOB 2BNQA 2OLDA 1A1MB 1WBXB 4PLKD 4DQOH 2J8HA 3K4DA 4Y5XC 3MRRA 3TYGH 4PJBE 4UBDD 2WLZA 5KS9E 3F7PC 3VGBA 1FVDA 4KH2A 4X6BB 5JW4M 4KMTH 3TIEB 2XG4A 1NEUA 3BJLA 3VFWA 2F5AH 4P3DB 5KVFH 4EOWH 1L0YA 4RFNC 2M2DA 3RJDA 4X6FA 2HT4C 1QNZH 1YPZF 2XNAB 4L4TA 4U1LA 3LS4L 1I4FA 4NRYB 3TCLB 3U4EB 3ZKMC 2EDKA 4HJ0D 4P2RB 5IT2L 4PRHA 2V2XB 1BVKB 4UDTA 5EPMB 2WWKO 3DURB 3HB3D 2GJZA 4J7RA 3U2SA 4NKMB 1NMBH 4S1SH 1QFPA 5FKPA 1J05A 4LEXH 5FK9A 2GAZB 4XVJL 1JV5A 4X6DF 2IPTL 4NHUA 3WSQL 3TZVB 3VXSB 4K94L 5GQBA 3G6AA 4FFVD 2J8UB 1KIQA 5J1AB 1I3RB 4X5XB 1KGCD 3A67H 4W6WB 1YJDL 2XA8H 3O0RH 1A47A 2YD5A 2Z35A 3D69B 1DEEA 3H42H 2HJKA 2PO6D 3S37X 4NT6A 2G60L 1CXHA 3QNYB 3FO2A 2DQFA 1A6ZA 2NPLX 3QUZC 5FA4B 2EYRB 3CVIH 1NCNA 3BYYA 3GUTA 1VKXA 3RL1B 4M8QB 3H3KA 2VMFA 2XKSA 1YYLL 3MV11 4R26H 1IAMA 1V5JA 4DWHA 3GO1H 3P9WB 3I2CL 1QRND 1NDMB 3MYJA 3ZHKA 5BVJA 2R4RL 3AM8C 4KUCD 3G5XB 3OKNA 3GIVA 4JRXA 2H9GB 5I1DB 2GJJA 3MNVB 4Q6IA 3HZYB 1UKSA 4HPOL 2Z8VC 1JCKA 2VDPH 2IAMC 2FCBA 1F6LL 2P42B 3WNOA 3CFKB 1DE4B 4Y16C 5I6XC 2XWBA 2DICA 3C8KB 5LBSH 5BS0B 4N5ED 3QULA 3ARFA 2B0SL 4LAQL 3S35X 5E5RB 2XQBH 3PGDA 2D31A 4LSQH 1T0MB 2P5EA 5EB9A 1FNHA 1U6AH 3FQRA 3HG1E 4XP1H 2CPCA 3X3GL 1IBGH 1G9NH 1RZIB 3ULUD 4JDVB 3VRIA 3PL6D 5BQ7B 4O58L 4APQB 5CHNB 4AM0B 5D7LA 4P23B 2EH8H 3UTQB 2BJML 3HI6H 4KU1A 1S7WB 1IGCH 3BD5A 3PXJA 2WW8A 4NC1E 1EGJA 2L7JA 3UYRH 5T1KB 1MCRA 5L6YL 1I7RA 4GUPB 4QRTA 1OAQH 3RRQA 1KFAL 4KQ3L 4H1LH 4OCRH 1QVOA 4LKXA 5ERWA 1BM3L 1WBYB 1K4DA 3RVVD 1YN6A 1JRHI 1W0YT 3GSRA 3PABA 3PE9A 4F2MB 3M1BB 5DUBA 1J5OL 4HGWA 4YPGA 1H3XA 2P46B 5F9JA 4CJ0A 1EUUA 3QXDA 4LGSB 1CFSA 3C6LC 4LVNB 3MLTA 3QQ3A 4GXUN 4L3ED 3C6SA 3QNXB 2Y6SC 3EDDA 5GGTL 2BVEA 3JWOC 5DEGA 4W4NA 3CLFL 2R23A 5IJVA 4WW1A 1D9KD 4HT1H 2XY2A 5TH2A 1HHHA 4YBLB 5IJKA 4XI5D 3U36A 4M02A 1U8IB 1VEMA 2AXFA 2FZ3B 4JM2D 1CDBA 3FCTB 2EE9A 3DXAE 1KCRH 3O6LH 2VLLB 2CJUL 3QI9D 3PHOA 1FO0B 1AQKH 2HFEA 3IF1A 3VGAC 4NQSB 3VXSE 3I85A 5IESL 2Y5EA 3EYVA 2J8UE 3MRQB 2W38A 1IE5A 1XCTB 5T3XD 4WHTA 1D5XB 3F7YA 4POZD 3QJHA 4Y2DD 5EZJA 3ARBC 1UCBH 2DD8H 1BFVL 3DMMB 1X3DA 1PLGL 3OGOE 4RDQF 5CJQL 5CD5C 2OSLA 2AJYH 4ZAKC 4PREB 2Q7YA 4HS8L 4M62L 2EC8A 3CC5A 1IGIL 2HFTA 1NC2D 4YDKH 2IPKA 5L7XL 1N5AB 3IDMA 4YFEA 2IALA 5CWSB 4X4MA 5SX5K 1QHPA 1S7UB 3O45B 3S5LA 4WHDA 1X7QA 4HUUB 3LKOB 3C5ZA 4P5TC 3J8F7 3WIHA 1CFTA 5ACLA 2FLBT 4LSVL 4UT7H 1OWRM 3EJZD 3MR9B 3VMOA 3RWIA 4J1UB 3I02A 5CILL 5F72S 1G7IB 1U8MB 1CXEA 1RK1A 4UIMB 1PG7X 5C0RH 3O11B 1GJIA 1I9IH 4WGWB 1K6QH 4PG2C 3CJJA 5D7JB 1U92A 3B9KA 4JGJA 3BDXA 2G5BA 3B8YA 5C0AD 3L5WB 5ALCL 3CPLB 4PLJD 2NLJB 4X7EC 1NAMH 1YEGL 2X1QA 3BUTA 2BXZA 2XT1B 1FYTB 3S37L 3GSUB 3SKMB 2ZOLB 1GGYA 1NGXB 5EUOF 1UM6L 1KTDA 2R0WL 4U1GC 3O2DA 2GCYB 3IJSA 4NNPH 4P4KA 5JOEA 5TQ0L 2AS5M 3N1QC 2IMMA 3MJ7A 3CFJA 3CLEL 2VQTA 3B2VH 4ZUTB 1T5WB 2G75B 1QFWM 5E6YA 3NFSL 3MLWL 2CIKA 1YC8A 4WI3A 3V7AG 2DL9A 2LTQB 2QQKL 3RI5K 3IDNB 4MVBC 2QQLL 3GMLB 1KTLA 5IW6A 4TRPH 2IMNA 5FKAB 1INDH 1IL1A 4GXVH 4U6VL 3LZFH 4WEUD 5E7BA 3BPOC 5DDHA 5T1LD 1L0XA 4GBXC 3IDYC 5IHUL 5CEZD 4DW2H 8FABA 5HHPB 4Q6YA 3S35L 2NR6D 5CZXC 3CFDA 3MRIB 1UXWA 3VD5A 3I3BA 3VXRB 2O5XL 5ISZB 4LIQH 1ZA3A 2R39A 4OUUA 4ODWA 3GBNH 5HDBE 5I1GL 3P9MA 4J4PA 5IEHB 2ZG1A 2GKIA 1S9WA 4DVBB 2V2TA 4UT6L 1AO7A 3DX6B 5EBWA 4TOYL 2XN9B 4HGMA 4G80B 1MF2L 3W2DH 2CKBH 4ERSH 4XH2A 2BHZA 1GGIL 2GUOB 2Y72A 2WUBH 1QPXA 3F5WB 3LAFA 3RWEB 4JM2B 5HHMB 2ZNWA 3HE7B 5IFAL 3H9SB 4KXZH 3UJTL 5CLTA 1YMHA 4YHYB 1DBKL 1CR9H 3OF6D 1FFPB 4V1DA 2XZAL 5I2IA 2HP4A 3LQZB 3BP6B 4DKDC 4ZYKA 4KKLC 4GRLA 5B39A 1R24A 3TPUB 3I6LD 2EXWD 1MREH 1KXVC 3G04B 4HUVA 3NCBB 2P24A 1N6UA 4LF3B 1MEXL 3G6DL 5HYQA 3KPOB 2H1PH 1HHJB 1MFDL 4XPHH 4R3SB 2DMBA 4DKFL 4QXTA 2VQ1B 3X11A 3HE6C 4WDIA 3N50A 5CS7A 4DZ8A 3JV4A 3LQAC 4XZUB 5JQHC 3SDCB 3I75A 3QBTB 2YUWA 3MRMB 4PGBB 5TPWH 2UWEB 1EDQA 3O3EB 3SKOA 1YY9D 4IJ3C 5F1NA 2FYYB 3FKUS 4BFBD 1CGSH 4AL8H 1IKNC 1VESA 4KV5E 1XF1A 5IHZB 4WHYH 1C7SA 4Y4HC 5EC2A 1QFUH 1IGJA 4PJIF 5DO2D 4IOFC 5IROA 2LVEA 1QRNE 1KPRA 1LO5B 2YD3A 3F12A 3OAYK 3FN0H 3WXWL 2YD2A 4PJGE 3VFMB 3ILPB 3PWPA 1B4RA 4NC0B 1ZAGA 4Z9KB 4HG4J 5BV7C 4LOUD 5FO7B 2V17L 3R8BB 2XWJA 4OUOA 1U3HC 3GNML 3RL2A 1OGAD 4FOMA 4NNYA 2FJFB 2E27H 3H3PH 3P4MA 3SE4A 3B9KD 4Z77B 3O3UN 4QRPB 3QFJB 3V5DA 1BLNB 2B2XH 1WC7B 3U30C 1Z9MA 5DS8A 2F19H 4BK4A 4ZUWA 2WQ8A 7FABL 3ULUE 4EN3B 1MCQA 4OGXL 5DVLA 3HUJF 4JO1L 3TNNB 4C54A 4U1SB 5GGUB 5IF0B 4KFZC 2O26U 4I4WA 4NPYB 4A6YL 4CU7A 3BW9A 3B6SA 3FQUB 1CICA 2IF7A 4ZTPL 2JB5L 2X4UA 4YDJB 4Z95H 5E8NB 1PG7L 1JYWA 4MDIA 5E4EB 4MAUL 4TQEH 1TTUA 5DD6A 2BOCB 3CZJA 3QJFB 4JFEA 4IDJH 3O8XA 1RZJH 4WU7B 1A6UL 1ZEAL 3PHSA 2E8YA 4H5SA 2DQJL 1OAZL 3MBEC 2EO9A 4PGCB 1UC6A 2PTUA 3VXRE 4F33A 2BCKB 1J87A 3QDAA 3OJVC 3GMOB 3RWDA 3GSQB 1CF8H 3LHPL 5INCB 4KAQH 1MHCA 1CN4A 3OPZH 4MHHG 1RZ7L 4PLOB 1YEFL 5TE6L 5I18H 1S5IL 3L3OB 3MXWL 1MWAH 3NA9H 4XVSH 3HR5B 3BE1H 3BGAA 1WWBX 3O6FC 5F89A 2Q86B 5T1MB 3MGAA 4JREB 3H9SE 5GGVL 5BXFB 3MBXH 2EDOA 4GQ9L 3QUXD 3FO9A 5ACZA 3WNPA 3BGFC 1LE9A 5I30H 4JKPL 1FNSH 3ZYOA 1FPTH 3T0WA 3IFPB 5KTEH 5DTFB 3SDDD 4JPWL 2NQCA 4K8RD 3RU8H 3RWCB 5E99H 3GHEL 5IHBA 3K0WA 3LMJH 4WTZG 3EO9H 1FL3B 2BOBA 2NW3A 1PEZA 1BQHA 4NYLB 2X89D 4LLMA 5CBAB 3RHWK 4P5KB 1AKJB 4IRSC 1HINL 3OKLB 1MCCA 3FT4A 2MQ3A 1IAIM 2D03L 1X5IA 5JW4N 2UWEE 4PRBB 1VFMA 3D1MC 4KPHH 3LIZL 4YHPB 4O2FB 1JNJA 4QCIB 2OXHA 3GKWL 1HHIB 5KSVA 2XPGB 5HVHC 1BECA 3UTSA 3ULUL 3BDBA 3EYUH 3D0LA 2W59A 1XEDA 4HKJB 1HDMB 3KYNA 3KWWA 1V7NH 4FQLH 5I19L 4YHOH 3JV0A 2Q1EA 2FSEB 3MUZ1 2F8XC 3NPSB 4JQIL 5J13C 4CKVX 3CCHB 3IKKA 3GRWA 5SWQA 4UINH 2VL5B 1WJ3A 4LCYB 3Q6GL 5BOPA 3SY0A 1KLGB 3PWPD 1SYVB 4QT5A 4XMPL 3VGHA 1BVZA 1QQDA 5C0AE 1OARH 5J3HD 4QRPE 3QFJE 4WEBL 1OGAB 4OLVL 2V5SA 3RY4A 4PR5A 4X99B 4Y5XB 4UV7H 2BSSB 5CP7A 1EA9C 5T3ZD 4FQXA 1JHTB 4WFFD 4N1CA 5TDOB 2VN4A 4KKCC 3WLWC 3MNWB 5H2BB 1Q94B 1HQRA 2QADD 3LKRB 1I8LA 5CJ8A 1NUGA 1A7QL 5MP6H 3WFCH 5DSCB 3ZYJA 1RK0A 4RFNB 4Y4FA 3WIIL 1IQWL 1S3KL 25C8H 2FIKB 3IU4L 4OLUL 2WP3O 4XAWL 3PNWB 4NWTL 5IB3A 1S9KC 2CLVB 3TBYB 1FZOA 4L8BA 2CRIA 5LQBL 2VLKD 4X6EB 1L7TL 1IC5L 1NGQH 2VITB 5I1CL 1F4XH 4NCC1 5A3IC 3F8UB 3HG1A 3VWJA 2P8MA 2OMBA 3MV7A 4HAGA 4QTIH 1KCLA 3IDGA 4NRXA 4XP6H 4RA0C 5EU7E 4PYHA 4C4KT 1AXSA 5CEZE 5DYOB 2APXA 2OJZH 1MCHA 5IB5B 4Z7QE 5BRZD 4JN2A 2DMKA 2N7AA 3V7AE 2X42A 5CD5D 1U8KA 4WY7H 1RHHB 3QEHB 1ZVSB 2PXYA 4BJLA 5C0JB 3S98A 1N4XH 1XF2A 3HHRB 4MB4A 4UT9L 4XNXL 2VKXA 4FFWC 2AEWA 3EO0A 5FHBH 4CW1B 4E5XB 5AUMB 3QUZB 3ARDA 4GT7A 4TUOA 2EIEA 1A1MA 3P40A 3VMNA 2H2SD 1ES0B 4WJ5B 3UTZB 1QEWB 2W1NA 3QUYD 1QZ1A 2OZ4L 1XZ0B 3NGBC 4MAYC 4M7LH 1A0QH 5L8JB 3TIEA 3BVNB 3O2VH 4M1DL 1SYSB 3OX8B 1JJUA 3CXDL 3DYOA 5DZLA 5EH1A 5T1DH 2O5ZH 2AERT 4YE4H 2XNAA 3SDDB 4EI6B 1P7KA 4NQCB 5D7IB 4O5LH 1N3NB 3WKMH 3FQXB 3TCLA 3U4EA 1TZGH 2IAMB 4P2RA 3L5XL 4Y16B 4K3EL 2GITB 5I6XB 5EPMA 3DURA 2YD6A 5HVGB 2YRLA 4NKMA 1W72B 3GKZA 5F7FA 3IDXL 1VFOA 1JTTA 3QO0B 4M1GH 2GAZA 4MNGE 5EO0B 3QB7C 3L7FB 4KY1L 3MNZA 4Z7WB 4YDIL 3TZVA 2AW2A 5DJAB 3V6OC 1BZQK 1MCIA 4QNPF 2J8UA 4TVPE 3AS1A 2IG2H 5J1AA 4X5XA 3SBWA 3EOTL 3QIBC 1P6AB 4ZMAT 1FE8L 1Q0XL 3D69A 3HNVH 4JZJA 2H6PB 3VXNB 3QNYA 2Z4QB 4IRJD 4XCEB 3HZVB 2ZSVA 3DO3A 3UPRB 3L3JB 4G9FD 1F5WA 4NKOA 3RL1A 3EYQC 4TSAH 1OGAE 3P11L 4ODTH 2RJMA 4WUKL 5CZXD 3HC3H 4R90H 4HUMB 5CEZL 3C87A 1NDMA 2GIYA 4LLUA 5GS1C 1DUZB 4N8CH 2ORBL 3G5XA 3RDTC 4RCAA 5FV2A 2H9GA 4M93C 5I1DA 1AJ7H 1KB5B 2ARJB 3C6LB 5CZVL 5IIEB 3MNVA 1H9VA 3TT3L 5IFHH 3T0DA 3HZYA 4IMKC 1KN2L 2P5WD 5HD8C 1J0HA 5JDSB 4LMQE 1TCMA 5F9DC 1DE4A 4X83A 1KJVB 4U1NB 3C8KA 3ZKND 5BS0A 3WD5L 1DSFH 4FQ1H 1X6LA 4YHMH 1HKLH 4HZAA 1FHGA 5GSVA 4OCWH 1GIGH 3FB8B 4QRRB 2APWA 4PJXB 2F74A 3E3QE 4GAYB 1RZIA 5FF6B 3IKCA 1DBAL 1EMTL 2EEBA 4HX1B 3VGAB 4KI1A 5BQ7A 2RFXB 4X8JB 4APQA 5EIVA 1EO7A 5CHNA 3GSOB 4AM0A 3H9YA 3UZQA 4K07A 3UTQA 1ED3B 2CMRH 4HD9A 3ZTJG 5HYEA 1M7IB 3KPRD 1S7WA 4M7JL 5DRXB 2NY5L 3AB0C 5DHXB 3ARBB 5D5MF 3GSWB 3I6KB 2EIZB 4HS3B 5T1KA 5JHLL 4ZAKB 3KXFD 5ECJE 3KPSA 1XF3B 5D8JL 1R3KB 2I07B 1HSAB 1SM3H 3BH8B 5DI8B 1FLRH 1WBYA 3VXTB 1HCVA 4I5BB 3P4NB 1IARB 1S7SA 2DQEH 4F2MA 1G6RL 1JPTL 3M1BA 3SDXB 2FRGP 1RIUH 4OGZA 3QUYB 3S34H 3JWDL 4P5TB 1IAOB 2R69L 4X4ZA 4HLZH 1HXYB 4OSUL 1S9VB 3OKEB 3TBTA 3EDKA 1GZPB 2C4FT 2QSCH 5HDQL 1RAMA 3QNXA 2VWEE 5F8RC 3MCG1 4NN7C 4XCYB 5D7IE 2FL5B 2APBA 2VABB 1OP5K 5F7DB 4NQDB 4KUZL 5HYJA 1YEJH 2I5YL 4JR9L 3JVGC 3B5HA 1UWXH 1U8IA 1H3TA 5ABDE 3FCTA 4PG9B 4M3JA 1EHNA 3DTXA 4UU9B 1T03H 2GTWB 5E5UB 2VLLA 4R7NB 1A4JB 5JQ6H 5L9DL 3HI5L 5MEPB 3K8LA 5E9DB 1FO0A 3BMVA 5LXGL 4NQSA 1J1XH 4Z7WE 2ICCA 4NN5C 4KJYB 3QG6B 4U1GB 1U3JA 1MIML 3E0GA 4BFIB 2EDHA 3FL7A 4PJFB 2VERN 1XCTA 3K2UL 3T0VA 1D5XA 4RFEB 2JIXD 1D5ZB 1FBIL 3NABH 3OJDB 1VGEL 4PJEA 4M7KL 1I9RL 4LRIA 5E2TH 4PREA 2EZ0D 2VDKH 3TO4D 3PHQB 2VE6B 4NZJA 3VGEA 1WFOA 4L4JA 4D94A 2BRRH 2VXUH 3EJJX 1N5AA 2DBJA 5FYKH 5EN2B 3S36X 1MPAH 4I18C 5CWSA 2H45A 4DUVA 3O45A 4ONOA 2WZPD 2PR4H 3CUPB 4HUUA 3WFBH 5DVKA 3MLVL 1M05B 1KBGH 4FABL 3BPOB 4G9FB 3EGSB 3LD8C 3SGJA 1U8PB 3BKMH 4GBXB 4ZPTA 3IDYB 1NUNB 3RJQB 4PTUB 5T3ZE 4J1UA 4WFFE 4DVRL 1C5BL 1G7IA 1IGYB 1P4LB 2NY3C 1JPFB 2J8OA 4UIMA 3U82B 3O11A 1RZJC 4HF5L 4ZO8A 5D7JA 3HMXL 2O61B 4ZFGL 4JGMA 2WUCL 2I25N 4X9IA 4PGZA 3L5WA 5L88L 4LL9A 2IANB 3CPLA 3FFCD 2RR3A 2UVEA 2NLJA 2RIKA 3O3BB 1CZ8L 1K8IB 5DK2B 1FYTA 2BNRB 3GSUA 4R2GC 3SKMA 2ZOLA 5E00A 5CJOH 4QRRE 4ZTOH 1P7HL 1CLYL 1RHFA 4PJXE 3TESA 1BGXL 3CFEB 1HZHH 1NLBL 2GCYA 1MHHB 2QV2A 1AQDA 1JFQL 2PW1B 5HVFB 1OAYL 3DV6B 3K8MA 4U0RC 1R3LB 5J7CC 3TH3T 4UNTA 5ILTL 1W0VB 2R0ZL 5IVOA 2OJEA 2H8PB 9CGTA 5MEND 4ZUTA 5KVDL 3DX9B 1T5WA 1AHWC 2I9TB 1WT5A 2ZJSL 4CBPA 5T33L 3T4AA 1IM3A 3F6IA 4WO4C 2PETA 2DM3A 1YUHA 3HE6B 5CGTA 3WNLA 4MXQD 3AS3A 5FKAA 2A1WH 1XGYL 3B2UC 2VLRD 4OM0H 2XV6B 3EDFA 3KPSD 4X9BA 4IJ3B 4YZFE 5HHPA 4KZEH 3TWCL 1NMAH 4X5LA 1ZGLM 3N9GH 5M94B 1ITBB 5SWSB 1P5UA 5ISZA 4OQ1A 4Y4HB 1KCSH 4WWID 5GGVY 3ZDZF 3DBXB 4Y19B 4ODHH 5IEHA 4NQDE 4ZS6D 3DUUB 5DRWB 2YUXA 4DVBA 3DX6A 2XN9A 5BV7B 1CD9B 3OKMB 4G80A 1L4IA 4QY8B 1BHGA 4UIKL 1SMAA 3PQYA 4L8CA 2ICES 1U3HB 5C2BL 4YXLL 1YMMD 5HSFA 3F5WA 2ATPB 3RWEA 2DLHA 5E03A 3HE7A 3H9SA 3T0EA 1BBDL 5T3ZL 3U30B 1AGDB 2DQUL 3LQZA 3BP6A 4B50A 1JWSA 4PJFE 1MH5B 1QLEH 1FGVH 1KB5L 4Q0XH 3D0VB 3TPUA 3G04A 4JDZB 3UAJC 4LF3A 4F58L 3NIDF 1AXTL 2JIXB 3KPOA 4MB3A 1HHJA 4R3SA 5AAWA 1DTUA 2VQ1A 1FORH 4HIJB 3BT2H 3IFNL 3KLAA 1MCSA 2VXTH 4A2MA 4XZUA 3SDCA 5DVMA 1MCNA 4PGBA 4OZ4B 2UWEA 4ZS7L 5CD3B 3O3EA 2EKJA 4HEME 4QHMA 4R97C 5AYQA 1NAKH 4NSKB 5HI5C 1IT9H 4G9FE 2B7DT 5DR5L 1UEMA 2NY0C 1A7BA 5LVEA 4KDWA 2FR4A 3CDFA 4WUUB 1QPPA 3SGKC 1X5AA 1XF4B 3MBEB 1HH9A 2Y36H 3WIHH 2EC9T 3EJYC 1A64A 1HHGB 4WW2C 4PB9H 2YK1L 4PP2B 1LO5A 3L5JA 1RU9H 1KEGH 5FYLE 3VFMA 3ILPA 1A22B 4FQCH 4U1KA 2VZSA 1DVFD 5FO7A 2X05A 3K7UA 2OR9L 3RWJB 4AZ8A 2IANE 1E0OB 5TGBB 3U7YH 3PWVA 5BCAA 3LEYL 2FJFA 2YWYA 1F2QA 3LEXB 4OFVA 4LNVA 2H32H 2BNRE 4YHKL 4W4OA 5ITBL 3O6FB 3QFJA 4U1JA 4JPKL 5EU4B 1RUKH 4TNWF 1WC7A 1YEEL 3ARVA 5KN5B 2WIMA 3BGFB 3O4LB 3PP4H 1F42A 1G1CA 4LSSL 1LO4H 4U6HA 4DGVH 4NJ9H 3TNNA 4U1SA 5GGUA 3SDYL 5IF0A 3I6GB 1AD0A 4NPYA 4UZGA 4OCLC 1MCOH 3UTPD 4YDJA 5E8NA 1KCUL 2IFGA 3KXFE 1HH6A 5K59F 3IS0X 4IRSB 3F65A 2VLJB 2BOCA 2B4CC 3QJFA 2CO7B 4WU7A 3MRNA 4HIEB 2OK0H 2ADFL 1AGFA 1EAJA 3NCYP 1NCWL 3O6KL 1ADQL 3ORJA 5AZ2H 1TZIB 4CJ1A 5HVHB 5SWSE 5SX4I 1LE5B 2BCKA 4OFYD 4ORGB 3GMOA 4XXDA 5C07B 4JFXB 2MSPA 1ONQB 2D0FA 3GSQA 4Y19E 4NZRL 5B38G 2Z0BA 1WF5A 2X1OA 4G43B 1UJ3C 4QXUH 3W5NA 1XGQB 3EO1B 1N26A 2NX5B 5J13B 2YWZA 4C56D 1MNUL 4KMQA 3H0TB 3FOLB 4JVUA 3VFVB 2ESVD 3RA7L 1GHFL 3L3OA 4MJID 4HFWB 2Q86A 4AEFA 4OZGE 3P9LB 3KYKL 5T1MA 4LLYB 2XFXB 4LPUA 5F1IA 4NQXB 1CXIA 2O93L 3PQYD 4RQQB 1F3DH 5DUPH 3HLAB 1FH5L 3UTTA 2Z91B 4HUXA 3RDTD 4OZHA 3IFPA 5DTFA 3FQWB 3T0ED 5HI4C 3RWCA 3MLXH 3P3YA 3THML 5ENWB 2BFVL 3SKJH 3NCCB 1FL3A 3MCKB 4E42A 4UILH 4NYLA 4ZNCD 5CBAA 3G6JE 5DJYB 1AKJA 4RAUB 1PX3A 4URTB 4DUXA 4BSJA 1A6AB 1QBLL 1JPST 5F21B 4PRBA 2J2ZA 4KKBC 1N0XL 4Q9BA 3VWKA 1U3YA 4OF8A 4O2FA 1X9QA 1MCLA 2X2YA 4QCIA 2LV4A 3OGCB 4WUUE 4HMCA 5ITFA 1FZKB 4NO0D 1U8OB 4HKJA 1ZTXL 1RSFA 1T89C 4ZFFB 2EXYD 4FQQB 1PSKH 2FSEA 5E6IC 5AWNL 5E8PA 3J7HA 1GH7A 5AAMA 4D9LL 5MEOA 4JRYB 4G8GB 2VL5A 4LCYA 1BFSA 2K7QA 5HGHB 1MUJA 1P7QD 4HKZB 2D9CA 1SYVA 3LS4H 8CGTA 5IV2B 3D2UD 3DGCR 5IT2H 1NBVL 4WHYG 2XIDA 1JWMB 4Y5XA 2BSSA 2OX5A 1JHTA 4ODBD 5TDOA 3NGBB 1AFVL 5I0DA 3DNKA 1HYSD 1BP3B 4MAYB 4XPBL 3MNWA 5H2BA 5BOZG 4XVJH 2F5BL 2XTJC 1I8MB 3T2OA 2IPTH 3BP5B 3WSQH 4K94H 5DSCA 2VDOH 2FGWL 4LCUB 3W9EB 5E2UL 1TVHB 1M7XA 5EUKB 1DANT 1YJDH 2CLVA 3TBYA 4OF3A 4XP9L 4MCYB 2AJ3B 5JNYB 1GOHA 1KXTB 4YBQC 4D9RD 4K71C 3BZEB 1U93B 4X6EA 2G60H 2VITA 2XICA 1HXMB 2VLJE 4Z8FL 5E6ZA 1T1YB 3E8UL 1OD9A 5I1LB 1AIFA 1U8JA 3BPCB 4LEOB 5C0EB 4I0PC 2AQ3A 2VLRE 3DYPA 2PYED 4M6ML 1I7ZB 3IAGC 1G7QB 2R29L 4B53A 5IB5A 5F3HB 4X8XA 1YYLH 5C07E 4RWYL 1NAMB 1QFOA 2QQQA 3V0AC 3I2CH 5F9AC 1RHHA 3QIBB 3QEHA 4GFTB 2R4RH 2FJHB 1FYHB 4OZIB 2NX5E 3KAAA 1ZS8A 4HXBL 3TJEL 4CW1A 4E5XA 4HPOH 5AUMA 3W0WB 3QUZA 3CAFA 1KTRL 3PP3K 1ES0A 3UTZA 1A6WL 1QEWA 4LAQH 2B0SH 1YMME 1XZ0A 3TIDB 4ALAH 4K3JL 5CEYB 3BVNA 3MO1B 1SYSA 5B38B 3OX8A 4RA3A 2NY3D 1PFCA 3TV3L 3AC0A 4DUWA 3V5KB 3X3GH 3MRDB 1D6VL 3RWFA 5GS1B 1XGUB 3L1OL 1I7UB 2YD1A 3RDTB 4M93B 3WNKA 1JRHL 4O58H 4NQCA 4EI6A 3DARA 5D7IA 1BIIA 2EDLA 1MCDA 4PV9B 3OAYH 1IEBB 1UB6B 3FQXA 1T4KB 4N1EA 2IAMA 1N59B 4NRZA 3S97C 1KCVL 4Y16A 5C0CA 2GITA 1OTTC 3ZT5A 1G7JB 1CFBA 2C1OB 5L6YH 1W72A 1KENL 4AQ1B 5DQDL 2NY1C 4XC3L 4RSVA 2R8SL 3QO0A 5EO0A 4D0CB 4R96B 1KFAH 4KQ3H 4PGJA 1BM3H 4ODXB 4KK8C 5DJAA 4MMXC 4OZFH 5MEQB 3F58L 3VWKD 1Y6NR 3P0VL 1NFKA 3O9WA 2ZUQC 2X4PB 4JY4B 5I8CB 1J5OH 4PJHA 2CKBB 4I1NB 2AJVL 4PBXA 2FDBP 3QUML 2UZYB 3NFNB 3VXNA 3AB0B 3AGVA 4JRYE 1JF1B 2Z4QA 3DETC 4G8GE 3QEQB 1JIBA 4M03A 4NGHL 1Q9WA 4JANB 5DRZB 4XCEA 3TN0C 3HZVA 3RI5F 5FCUL 1WFUA 1OGTB 3UZVB 3ZKQD 3ZL4L 5KSBF 2C3HA 4OB5H 3CLFH 4R9HA 3UPRA 3L3JA 5ICXB 4MLSA 2Q3ZA 3BGMB 3D2UB 1BQSA 4KHXL 4JZNB 1BPVA 5FYKU 2CJUH 5ESQA 1OM3L 1KYOJ 1DUZA 2MQ0A 4HWUA 4JFPA 2FX8L 4HAFA 4Y5VC 1KB5A 1CD8A 2ARJA 3C6LA 5IIEA 4J2XA 5IESH 4P2OC 3BN9C 4OV6F 2BNUB 4NN7B 2C3XA 5JDSA 2ZOKB 3U79A 1UQSB 3Q2CA 1KJVA 4U1NA 5F9WC 1BFVH 1PLGH 2VXSL 5CJQH 3LDBC 1QR1B 3RZCC 4L9LB 4HS8H 3S7GA 3UTPE 3T2PA 3N0PB 1S7VA 2BVOB 1UZ6F 1CU4H 5JMRA 1IGIH 4ZXBC 3ZE2F 3FB8A 4QRRA 5L7XH 3MLPA 3SE8L 4GAGL 5K9QI 5E24E 4GAYA 2GJ6B 1HOCB 3HFML 5FF6A 3GI9H 4HX1A 1CS6A 4NN5B 2RFXA 4KK6C 4X8JA 5EC1B 4KKAC 3V6OE 5I16B 2VR5A 4HJJL 2Q8AH 1ED3A 1UWGH 1XGPA 2NZ9D 1M7IA 2PYEB 4EVNB 3K2MC 5DRXA 4LSVH 3ROLB 3ARBA 1EO8L 4Y4KD 5CILH 3ULVF 1S78D 4OZIE 4HS3A 5DC4B 4ZAKA 2FO1A 3DYMA 1FIEA 4PJ7A 4BQ9A 3OR7B 1XF3A 4XNMB 2EECA 4N0UE 1R3KA 4W6XB 1HSAA 1ZHKB 4MJ5B 4Y1AB 1RJZA 1UJTA 5DI8A 2IH3A 4ZUUA 4I18B 2ESVE 3VXTA 4I5BA 1KPVB 5ALCH 1OY3B 1IEHA 1KF9B 1YEGH 3SDXA 1CFQB 3S37H 1IAOA 3LD8B 5D1QC 2F54D 5AYUL 3STZB 1CIUA 3CH1B 2A83B 1UM6H 1HXYA 2UYLB 1S9VA 2R0WH 3OKEA 3GMRB 1GZPA 1UKQA 5IUSA 3QXUA 5EOQL 1WCBB 2R1YB 2X09A 4Z7UB 2NY3B 1A3LL 3UTOA 2X7LA 4OCYL 4XCYA 4X9HA 4YLQT 4FA8A 2FL5A 5TQ0H 2VABA 5F7DA 4L8DB 4NQDA 4OI7A 2NY2C 2Q8BL 4PG2A 1JNHB 5GIRB 3CLEH 4YQXL 2X44D 2E6PA 4KK5D 2VLME 1X5HA 3PWNB 1AE6L 4PG9A 5IK3A 4UU9A 3NFSH 4HKXB 1D5BB 2GTWA 3MLWH 1MJ7L 4HWNA 4FQJL 4R7NA 2BC4B 5MEPA 2OMNA 5E9DA 2QQKH 4R2GB 3RX7A 1J1PL 1YNLL 2QQLH 5EU5A 2FWOB 2J4WL 4U6VH 1NFIA 3BFOA 4FXGB 4Z7OE 3K1DA 3RVTC 4BFIA 5I17B 3M17B 1ADQA 2C9AA 5IHUH 5IR1A 4HG4K 3ZDYE 4U0RB 1D5ZA 1C5CL 3LCYA 1MWAB 3S35H 5GGQL 5HI3C 2CXKA 3OJDA 2XI9A 3DV4B 3GJFB 2O5XH 2EYSA 5SWZA 4CVXB 3C2SA 3QEQE 1AHWB 2VE6A 4NIKB 2R2HB 1QR4A 5DJCA 4JDTL 5I1GH 1MI5D 5EN2A 5F7UA 4WO4B 4F7TB 4UT6H 4TOYH 3CUPA 2GT9A 1LEIA 1MF2H 1M05A 4H26B 4OQTL 4OD3L 1D3CA 3EGSA 3EFDL 3ARED 1U8PA 2X9XA 4Z0BL 1GGIH 4GBXA 4PTUA 1UVQB 1Q1JL 3UJTH 1LDPH 3RUGE 1IGYA 1P4LA 1DBKH 3DRQB 1A8JH 1JPFA 2XZAH 1EERB 4XGZB 1CDGA 1L6XA 5TQ2L 2IH1B 4P46D 3MJ6A 2HKHL 2Z8RA 1NCBL 4U2ZA 2AEPL 3WUWA 5C9KA 5JHDD 5J57B 3P73B 2O61A 4JJHA 4LHUD 1G9MC 1KELL 1MEXH 2FEDC 4L4VA 3G6DH 1HE7A 1MFDH 3DRTB 3O3BA 1FQ9C 4JKLA 3PWLB 1LO3L 4DKFH 1U8NB 1K8IA 5DK2A 1MCBA 2BNRA 4JJ5B 1OP9A 3CFEA 3WFHB 1RZKC 3VW3L 5E2WL 2FHFA 4QHNA 4F9PC 4MQ7B 1OL0A 5E1AB 5FM4A 1R3LA 5DF0A 2PYEE 4LPTA 2H8PA 1GGUA 2CLZA 4G6ML 2VDML 3CZFB 1IQDB 1I9JL 4JFDB 4O2CB 3JTTB 3TLRA 2I9TA 3RHWF 1A14L 1EEUA 5IVXB 4P5MB 1BQLL 3WXWH 1B9ZA 2MOVA 3HE6A 4JG1L 4U1IA 2V17H 2Y5TB 1F3DJ 4NM8L 3GNMH 4J23A 4AT6B 3RZWA 2VZVA 4R97B 4NOBA 1T2QL 1WFNA 2NY0B 3LRSB 1IKNA 4HWBA 2JJTA 1R0AL 5SWSA 5FO8B 3JV6B 4Y4HA 3MV8D 4X4YB 4Z7UE 3QO1B 4WW2B 3DBXA 3VFPB 1T20B 2VDQL 4Y19A 1XAUA 7FABH 3DUUA 5DRWA 4HUWB 4OGXH 4JFQB 1OHQA 3OKMA 2JK5B 4G6JL 1M6OA 3MGTA 4QY8A 3AS2A 4M61B 1Q0YL 1U3HA 4A6YH 3MGOB 1N0LA 2ZWLT 5JXAL 4X6CB 4ZTPH 2JB5H 5IB4B 2PKDA 1PG7H 2J6EA 1HN1A 1NC4D 3T65B 4ZNEA 4MAUH 4HLZG 4Z5RA 2J8UF 1IC4L 1AGDA 5C09B 1XF5B 1A6UH 1G84A 1ZEAH 1IAIL 2DQJH 2OR7A 1OAZH 3D0VA 4OFDA 4M43L 4JDZA 1B4JH 2VNCA 4ZD3L 4PJ9D 4YBQD 5KSAD 4FMKA 1KB9K 4HIJA 1P4BH 1RUAL 4W6YB 3LHPH 3ARZA 2WWKT 4K94C 4BSWA 1RZ7H 1I1RA 2ICWI 4OZ4A 1YEFH 5T5NF 5CD3A 4G42B 5D70H 1ZT1B 5TE6H 1NL0L 3LKSB 1OWWA 1S5IH 1LWRA 4OLXL 3MXWH 4R6UA 5MI0C 1YJDC 4WUUA 1F00I 1CGVA 1ORSB 2V5TA 2NY4C 1SBBA 1XF4A 5GGVH 3MBEA 3HPLB 1WLHA 3UC0L 3MV9B 3SJVB 5ID1B 4PP2A 4HBCL 2DJUA 1JTOA 3MSPA 4JKPH 4QHUA 5E4IA 1K8DB 1QBML 2J5LC 4JPWH 2RAMA 1FCCA 3OHXB 4XP5L 1UJ3B 3RWJA 2WAHA 2AJSL 3GHEH 4P9HC 5TGBA 4F7CB 5H35A 3VFGL 4BFGA 3LEXA 2X9WA 4UMGA 3SCMC 3UX9B 2YUZA 5I1JL 4Q9QL 2AK1L 3O6FA 4IS6A 1HINH 3KG5A 5EU4A 3MUJA 4L4VD 4I3SL 2D03H 4G7YL 1TVBB 1ZVYA 4N0RA 4YK4C 4MJ2A 5FDWB 3SOBL 3VA6A 2ED8A 3O4LA 5C0IB 1T7YA 4M3KB 4CVWA 1EHLH 4NUGL 1C16B 3GKWH 3S6CA 3QWRA 4PRPD 3ULUH 5FCSH 4JFDE 2KL6A 5DHVH 3I6GA 4LCWD 4J8RA 1R3HB 3AUVA 4QO1A 5C86A 5IVXE 5KJRL 1HYRC 2HFFB 5I19H 5TDNB 1OTTD 1EBAA 32C2A 4HPYL 4RX4A 1OP5H 4WWKD 4Y88A 3VD9A 1OW0A 4XRCB 4IRSA 1BD2B 3NCEB 2VLJA 3OAUL 3Q6GH 4MJ6B 5IBUG 4YO0B 3EYOB 3MJGX 3VDCA 4JY5L 5JOPD 4X7SH 3OJ2C 3KHOA 4HIEA 3QIWC 4RZCB 4XMPH 5GRVK 5A2LH 4WEBH 3KYAA 1BEYL 4OLVH 3ILQD 2XKNB 1LE5A 4ORGA 5EOTA 2F54E 1JP5A 4UDUB 5C07A 4JFXA 1LEKB 1ONQA 3WBDA 4GLRH 3ARGA 5IHLB 2CUIA 2HT2D 4G43A 1CWVA 2J7LA 1BX2B 5E6IB 1XGQA 3EO1A 4UV4L 2NX5A 2C5DC 1A7QH 2G9HB 5F3BB 1WK0A 4OCSL 3H0TA 1P4IL 3FOLA 3WIIH 5A2FA 3VFVA 2ARWA 4DEPC 1IQWH 1S3KH 5JIHA 1ZT4B 5F1SA 4HFWA 1U2HA 3IU4H 4TULL 4XAWH 4NWTH 3P9LA 4X6CE 4LLYA 1OB1B 5FUZL 2PTVA 4NQXA 2FO4B 4YR6B 1L7TH 1T66D 1IC5H 4RQQA 5I1CH 1VHPA 2VAJA 5C09E 3HLAA 2YRZA 4NO5A 5FHAL 2Z91A 3MRJA 1G7LB 3FQWA 4K3DL 3OB8A 3B43A 5FUCE 2X41A 2NNAB 4PJEF 2XTJB 3ARSA 2F53D 1EBPA 3KPLB 5J9PA 1JGDA 1MFEL 1EFQA 3MCKA 3RVWC 3EBAA 5LGJB 1UEYA 3EFFB 5GS0H 5DJYA 4PD4K 4F8QA 3ZHDA 4RAUA 3GZKA 3WCYA 4JO4L 1A6AA 5F88B 4PJ9B 4K71B 4UT9H 4XNXH 3SKNB 1J0KA 1YEDB 3OKOB 2VXQL 5IBLC 5IB2B 4WV1C 3MTRA 1T6VN 4MNQD 1JYNA 4YX2L 5L2KA 2KH2B 1KJ2B 1FZKA 4O4YL 1U8OA 3MV9E 4AG4L 2E9IA 4GG8B 4ISVB 1HK6A 1NFDF 5DWUL 5J6HB 4ZFFA 4M1DH 1ZK9A 4FQQA 1SJHA 2Z31C 3CXDH 3LB6D 3T3MF 3S3PA 2AXJA 1JWUB 1BJ8A 4XVUC 4G8GA 5B8CA 5HGHA 3WLBA 1VCAA 2W91A 4PJAA 3RGVC 4HKZA 3QEGL 5BJTA 4P9ML 3SDAC 2BXYA 1Z6JT 5L2JA 1F8TL 4M6OH 2X4SB 3L5XH 4K3EH 1FL5A 2WNGA 1V3MA 3U4BL 1DQML 3D39A 4MAYA 3GSXB 3D18B 3IDXH 4NZUL 1ZT7B 4S1QL 3ROOB 2VB5A 3CX5J 4L8SC 1I8MA 4KY1H 3BH9A 3BP5A 4YDIH 5AD0B 4GLRI 1WIUA 4KJQD 1J8HD 1YZZA 2HTLC 4ONHB 2CK0L 4LCUA 3CXHJ 1C12B 1NCDL 3W9EA 5E1HB 3EOTH 4CL7A 5GXBB 1Q72L 4U0QB 1TVHA 1FJ1B 5EUKA 3VXUD 1KLUA 3QWRD 1FE8H 2AJ3A 4NBXB 5JNYA 5IMLB 2OI9C 3MRFA 1VADB 1F90L 1BD2E 1HXMA 2YD9A 5JLZB 5DEZA 1T1YA 2OCFD 4U2YA 5I1LA 2NY1B 4LEOA 4OQTA 1EIBA 2HN7B 2XKUA 2VAAA 3STBA 1F4WL 2P45B 3P11H 2NXYC 5F6HI 3DIFA 1G7QA 5DJ0B 5F3HA 4WUKH 2YPLA 5F96H 4QOKD 1NAMA 5CEZH 2ZUQB 4MDJA 3QIBA 3A6CL 3FO1B 1QKZH 3MV8E 4FTVB 2FJHA 2ORBH 2W0LA 3WO3B 5CSZB 4OZIA 3DX7A 3MRGB 4MA3B 5CZVH 5IBUB 3P0GB 4JFFB 3TCXA 3ARGD 4RAHA 1KN2H 3W0WA 3TN0B 5DD1L 2BVYA 3G9VA 5DEFB 4H25A 2PN5A 2B4CL 4H20L 4G6AD 3WD5H 4X9FA 4LSUL 5C9JB 3TIDA 4TSBL 4QF1B 1RJCA 1H8OA 5CEYA 4F7PB 5IMMB 2NY7L