4YFLI

Crystal structure of vh1-46 germline-derived cd4-binding site-directed antibody 1b2530 in complex with hiv-1 clade a/e 93th057 gp120
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
208
structure length
200
Chain Sequence
TQPPSASGAPGQRVTISCSGGPSNVGGNYVYWYRQFPGTAPTLLILRDDQRPSGVPDRFSASKSGNSASLAISGLRPDDEGFYFCATYDSDGSIRLFGGGTALTPSVTLFPPSSEELQANKATLVCLISDFYPGAVTVAWKADSSPVKAGVETTTPSKQSNNKYAASSYLSLTPEQWKSHKSYSCQVTHEGSTVEKTVAP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Repertoire of HIV-1-Neutralizing Antibodies Targeting the CD4 Supersite in 14 Donors.
pubmed doi rcsb
source organism Human immunodeficiency virus 1
molecule tags Immune system
molecule keywords Envelope glycoprotein gp160,Envelope glycoprotein gp160,Enve
total genus 17
structure length 200
sequence length 208
chains with identical sequence L
ec nomenclature
pdb deposition date 2015-02-25
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yflI02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yflI01
2Z31A 3BW9A 2J7LA 3CXHJ 4DZBB 1NFDF 3MUZ1 1NEZG 4NQSB 5E08L 1NCUA 5TPWH 3H0TB 4NWTH 1BFOA 4L8SA 4NHUA 2DB8A 3MODH 3Q6FA 3B9KD 3I75A 1RIVH 3PQYA 4LCUB 1A9EB 1CXLA 1H3PL 4P99A 1CL7H 5IJVB 3VD4A 4OF8A 5D1XC 1NL0L 4WEBL 3RWHB 4F7MB 3JWOC 3TLRA 1VDGA 3ULUH 2D2OA 3MRHA 4KTDL 5D1ZC 4R0LB 1TPXC 1JHTB 4WO4A 5DC9B 5DT1L 3T09A 3CFBB 1TQCC 4QOKD 5HHOB 1CLOL 1GC1C 5D1XB 2W0FB 4UV4L 4LLYA 3S34L 4HJGA 3HC4L 4LNRA 4F37F 1D5BB 3QEGL 4OZGE 1S7TB 3WFBL 5GXBB 4M4RA 1EO8H 2FL5A 1KACB 2A6JB 1QRNE 1ZLUH 3U46A 4Y89A 4PRNB 3BQUD 3P9MB 5C0RH 1UWEL 3ORJA 3BPLB 4HXBH 1PYWA 2PO6B 4X4XA 3QO0B 2VDQL 5IHUL 2J8OA 5EZIL 2CLZA 1FORL 3PWPE 5D2LB 1JTTA 1JIBA 3C09C 3QDJB 4NHCH 5A2FA 4RWHA 2ED8A 3RZCC 1CFSB 3SDYH 1NLDL 2VNCA 1J5OL 1G7PA 2J4WH 3SE8H 1OL0A 3P0YH 4L29B 2EIDA 5I8KL 1IGMH 1S5IH 4DN4H 2A6KB 1GGYA 5EU3A 3CPLB 3RA7H 5SX5H 4FQ2H 1NDGB 3A67H 3O41A 2P8PB 3GSRA 3TFKC 5TE6H 1QBLL 3VU2A 1TFHA 5B4MD 5JPMB 5KBNC 5E5MA 1N0LA 1EGJL 3QG6A 1X5LA 4PLOB 5D9SA 3WBDA 4ZUUA 2FO4B 5HYQA 1IC7H 3CXDL 4KJYA 1ACZA 1WBXA 3GB7B 3U30B 1AH1A 1TJHL 4EI5A 1HCFX 3REWB 2DQHH 1N5AA 4HWBA 5I76A 3M17B 4XT1C 3TV3L 3QXVA 1KULA 5DYOA 4ONOA 5HDLA 4YQXL 4PJGE 4M9PA 3PWVA 5H37G 2HFGL 1U92B 4ZFGL 2MCPL 3MV01 4I4WA 2W65A 2Y36H 4OJFH 4LHUD 5AYUL 1EHAA 1NANI 1LEKA 3VXRA 4LFHD 1OGTB 1WZ1H 3RRQA 4WTZA 5DEFA 2DM2A 2P5WA 4PV9A 2LV4A 3NAAH 1R5IA 4LPWA 4LSUH 3V6ZA 3VRIA 2ARJQ 3SKOB 2NY1B 4U1GB 1FL3A 5IUSA 3ULVL 1WICA 4S1SH 3B43A 3CVHB 5ID0B 3CLFL 3J7HA 4HWNA 4J2XA 3WKNA 3IKCA 2G5RA 4MQ7A 1RFDH 3FQRB 3T0ED 1LDPL 5I74B 1H9VA 5ID1B 4S1SL 4HUWB 5T3XD 3N0PB 5E99H 2A9NL 1I1AC 2OX5A 3GDBA 5AWNL 1YEGH 4YAQA 4CADB 1OAXL 1EGJA 4QGYA 4F7TB 1I3UA 1WZ1L 5BS0B 1WLHA 3FOLB 5AYUH 4F7CB 2MCPH 3D5OF 1BQLL 2ARWA 3WKMH 3DYPA 3N1GC 5I8OH 2GCYA 2DLIA 5DZNA 4K2UH 3VGHA 5JHDA 1CF8H 1OARL 1UB6B 1Y6MR 2EE3A 3L7FA 4LLWB 4TPRH 4JQVA 2W59A 3O2WL 4G7VL 1NAMH 4PP2B 3QRFM 3MPCA 1INDL 4BSWB 4Y4FD 4QO1A 5IVZB 5BOZG 5C0EA 4U3HA 5C8JA 2NQCA 4G9FB 4DVRL 4EXPX 1YQ2A 4RZCA 1RJYA 4XXDB 1T7XA 3OR6B 4YDKL 3QXAA 5EC1A 3UDWC 1INQA 4LRNH 2BNRD 2GITA 3H9HB 2D7QA 2F54A 2FECI 3PHOA 4KUCF 5MERA 1FN4A 1RVFH 1B0GB 4RSVA 4YEFA 2AEPH 1YEKL 1DUZB 3RA7L 2VH5H 1FSKC 3WEXB 4N0UB 2DQTH 2FJFA 4NT6A 4DN4L 1FPTH 2H3NB 4OLWL 1MCFA 1IZJA 3VXRB 4XMKH 1MRCL 1J5OH 1SMOA 1LDSA 3BGAA 1NLDH 1JV5A 4OFYA 3U7WL 1P4LA 4NHCL 4CBPA 2D31B 2C3VB 4E41E 3ZDYF 1KJVA 1S7RA 3W82A 4MQSB 2FJGB 2R23A 2COQA 4R9HA 3ARBB 5T1MA 1ZV5A 2X70A 3ZE1F 4YC2B 5BW7C 1AFVH 3WFDL 3GHEL 1WITA 2DLHA 1XGRB 1XZ0B 4U6YA 3ARFA 3ULUF 4XP1H 1R6VA 5CKGA 3WIFB 3QXUA 5ILTL 1MREL 2CK0L 1HZHL 1I8MB 1LGVA 3L3GA 1P53A 2FX9H 3Q48A 1NBVH 3Q2CA 3ARWA 4XTRC 3LKSB 2VE6B 3QEGH 1NANH 1MIEL 5ANME 4TUOA 1MI5D 2XKUA 3MRKB 2D7MA 3WN5C 5EOCL 1MJUH 4NO3A 2B1AH 3V0WH 4EI5D 1CLOH 4NQEA 3D3VB 1MHPL 3QRGL 5DT1H 5EU3B 2DQJL 5EFIB 2B2XL 4KTDH 2F5BH 3C8DA 2XKNA 1BEYL 3B9AA 5IHZB 1F4YL 5EBWB 4PLJC 5D2LA 1GGCH 2PYEE 3SBWC 2BSTB 3SGEH 4HS3A 2CDGA 2YUWA 4APQD 3WIHA 1ROWA 5FYKL 5KANG 4UTAH 3QXAB 1BD2B 3HCVA 2Q1EA 1OM3H 5F7DA 3R8BB 3X11A 2WBWB 3BGFC 1VEMA 5DJ0A 2A1WL 4L4VE 4QRPD 4X0KA 5FECA 3P0VL 2X4PA 4P2OC 3N85H 4FQPA 4LBEB 3QUMB 1DBBL 1N0XL 4WWKC 3UAJC 5B22A 1HYRC 4ZAKB 3DUHA 1T89A 3R8QA 4Z78B 5L88L 3FN3A 4X98B 4M1CC 5C0BB 4HWBL 5DD0H 3PWPA 4I9WD 3C9NA 3D9AH 1WIUA 43C9B 3CFCL 3KGRA 3OAYK 5GS1B 4Z7UA 3BFOA 4F37K 3PG2A 4QY8A 3BD5A 3V4VH 1PG7X 5IEKA 4U2YA 3TNMA 3ARBD 1QLRB 1CGSL 1YEFL 5GIRA 3WNPA 4F15B 5DUMH 3BSZL 4WDIB 4YBHA 1ZS8B 2IPTL 2EYTA 2GQHA 4OCWH 3IU4H 3K4AA 3VFRA 4P2RB 1A4JA 7FABL 1KFAL 4OSUL 4OZFB 3HZYB 3VFMA 4OCYH 4UU9B 4Z8FL 1TVBB 2BNRA 1UZ6E 1K5NA 1WBYA 3OGOE 2N1KA 4DGYH 1B2WH 4NQEB 3QZWG 3WS3B 5EZOH 2Y1VA 4KK9C 5EUKB 1TCRA 2Q76B 4MX7B 4HUMB 3TYFB 3DVNA 3VG9B 1T5WB 5MHSD 4ZODA 1OLZA 2WINB 2XG4A 1IMHC 4EBQH 4FXGA 4WWID 4JFQB 1L7TH 3LN5B 2R8SH 2PF6A 3OTTA 4GRWE 2VC2L 3NN8A 5C08B 2ADJB 1BQHG 1MNUH 1QFOA 4XP6H 4OM1H 3QI9B 2IPUG 2FX8H 3VGAC 4JG1H 5KVDL 3GI8H 4JVWA 1NBZB 5FOBB 2VZTA 3G5VB 3O3BA 4NQCD 4U1MB 1MPAH 5ENWB 2FLBT 3PABB 5EO0B 4M62H 2DD8L 2XY1A 5ESVB 3F7YB 1ZHNB 3TEUA 3BZFA 2NW3B 3C09B 4BELD 4N0UA 4MD5B 1TJGL 2R2EB 1BHGA 3QWOB 4XNYH 4ZYKB 4EVNB 1WBYB 2OI9C 4LMQE 3O6FA 4TYUA 5F6IC 3KJ4B 1I3GL 2J6EL 2JB6B 5EU4A 3GSOA 4YH6A 3I3EA 1OWRM 4LLQA 3D39A 1IE5A 4WO4D 2MKWA 3KYMB 2F54B 1ND0B 2EKSA 3F12B 3I85A 4K71B 4CVWA 2NY6C 5EA0L 4WFFE 3QIBB 4X4ME 1JGLL 1Q9WA 1KIPB 1R3HB 2DJUA 2Z0BA 2BSSB 4XHJC 4LOUC 5HJ3A 1NMBH 4OCXL 5MEPB 3BP7B 5DD3L 4OD1L 4X4XB 1IGIL 4ZDHB 3M8OH 1M4KA 5DQ9A 1N5YH 4OI8A 3O9WA 2EDQA 4X6DF 3KPPB 3LHPH 4R26L 4NKQB 3N9GL 4LAQL 3TBSB 2DLFH 1HXYB 3IXTB 4HHAA 2W91A 3GMRA 1QSEA 3DX9B 3RPKA 3CH1A 5GSVB 1OD7A 1Q9OB 4XNZB 1WAAE 1EJOL 3FO9A 1BREA 2GKIA 1Z9LA 4PLNC 4ODUA 2PW2B 5BVPL 1KB5B 2EE2A 3SKMB 2OP4L 1VADA 1NCDL 3HE6C 3PL6B 1IC5H 1YDPA 3UTPE 4O4YH 3W9EB 5ACZA 4QF1B 1J1OL 5FKPB 5FO7A 1I75A 1CVRA 4ERSL 3RI5K 1C5BH 2JB5L 3SDAC 1BFVL 4R7NA 2WP3O 1ZA6A 1MCOH 5KSBA 3C8KB 3RHWF 1NH6A 3FZUC 4NO2B 1G0XA 2OCFD 4YHNA 4UUJB 1URLA 1CTNA 1Q0YL 4WW2B 2PYEB 1CXEA 3S98A 1EFXD 1BFSA 2X4TB 3I6LD 4K3DL 4G8GE 4FFVD 4DKEH 4QXGL 4HUUB 4X6BA 5J12B 1SMAA 3MLWH 1CYGA 5IVXF 5C07D 4U2ZA 3SPVB 5EBLA 4Q6IC 1DDHB 4KJQC 2AXFB 3TGXA 3CDGA 1YN6A 2VLRB 4FS0A 4L3AA 4EI5B 4MXQC 3VRLF 5DJDB 4G8GA 1GGUA 3OGCA 5I76B 4RBPK 3VJ6A 1JZ8A 1I8MA 4J4PA 2PO6D 4GO6B 1CIUA 3K80A 1W8OA 1MJ8H 5KS9F 4QXTA 5JPMA 4DKDC 4GAGL 1KTLA 2AV1B 3AREC 5IIEA 2IJ0C 4Y5YC 4EEEA 1QHOA 2CKBA 3HUJB 3CFDB 5DJ2B 1NJ9A 2FEEL 4JRYA 4I77H 3BKCH 4NC0B 2J88L 4OLVL 1BVZA 1KEMH 1AGDA 4OCSL 1FV1B 4P5TA 1A3RL 1C1EL 4G42A 4LGPB 1FCGA 4AH2B 4AEHL 5DD6A 1TZHA 3G6DH 5I1IH 3WUWG 2PXYD 1R3KB 4Z7VA 3L3KA 5FYKE 1HHGB 3GBML 4F7PB 5EC2A 5IBTL 3TNMB 3PGCB 4JRYE 4Q0XH 4P5TC 2Z4QA 3CZFA 5GIRB 1AKJA 4QWWC 2XT1B 2F53E 4GMTL 4IMKC 1MH5B 3B2UC 1A21A 1S5HB 4NM8L 4U6VH 3T65A 1CFVH 2NY6D 5CD5C 1T3FA 4HPYL 2KQMA 1SBSL 4WNQA 4N0CC 4P2OB 3OR6A 3E8UL 3O3DB 5E94A 3VXRD 1QSFE 2AJUH 5IMOA 1ZHBB 1NC2A 1PKOA 1XF3B 2APBA 1U58A 1UB6A 4G8FB 4Y4FB 3ZTJH 1X44A 4GMSL 1F4HA 1Z6JT 2R2CA 1RZGA 3MRDB 5CD3B 1HOCA 1P1ZA 1MIMH 4YDVB 2VZUA 4RMVA 3L95B 3LD8B 1C12A 1MF2L 5SWSE 1L4IA 4PY8J 3O6LH 2Y23A 3FONB 3H3PL 4XPBH 3LEVH 4YBLC 5FB8A 2G75B 3TBVB 1KT2A 4JLRA 1A1MA 4LPYA 1F11A 3N1MC 3OKEA 1IQWL 4YHYB 4O9HH 3CVHL 1G1YA 4U1JB 3MA7B 2BOCA 1G7QA 1CZ8L 5J8OA 3SGDI 1P7HL 2D03L 5JIHA 5H94A 5JO5B 3UCRA 4GKSB 3AMKA 2GTWA 1HIMH 5CIPB 3E3QE 3ARDA 3RJQB 3U0TA 1H5BC 2MPAH 5CZKA 2NY1D 3MLSH 4JRXB 4M6AA 5GGRA 3IVKB 3TBTA 4G43B 3SE3A 3BUYB 4D3CH 5J1SC 4IRSC 3WLBB 2HLFC 5TQ2H 3GFUA 1D9KC 3T77A 3ARFB 2EH7L 4Q74A 3RY6C 3GNML 5ALCL 5EB9A 4AMKL 4OM0H 1UM5H 4N8VA 3SDDD 2GSIB 3C2AL 4FQLL 1FRGL 4YFDB 1D5MA 5FDWA 3P77B 2R4RL 1YMHA 1PQZB 5JPNB 4HKBA 2C3VA 3MRPB 3DI2B 4KDVA 1JPGB 1TIUA 1XCTA 3JUZA 1QR1B 2ICEA 3QUZC 1AO7B 3NIGF 3AY4C 3HB3C 3U7YH 1FAIH 2XZCL 3SDCA 3LEXA 2XRAH 3D3VE 5D71H 2DM3A 3AS3A 1RZJL 3SHSA 1CGTA 4LVOC 1G9NH 2I5YH 1AQDB 5E4EB 1K5NB 2DDQL 3QB7C 4KJQD 4ONGL 2DQFA 1JCKA 1JHLL 1WSST 4GW4A 1F2QA 5IGXL 1H8SA 3MUY1 4KRPD 3A6BH 3LV3A 1MJJB 1JHTA 1FNGA 2X1OA 3WS6C 2XTJB 4WGWB 2B7DT 2NW2B 3TVMB 5JIKA 1EHLL 4Z7NE 3VFGH 5KW9H 1S7VA 2HWZL 4JFZL 1HYSC 4UT7L 4JANB 1KB5L 4MNGB 5J1AB 1LO5B 1EVUA 2BRQA 2BVUA 2Q20A 5F89B 3VWJB 1ZEAL 4TVSa 2FIKA 3UJTH 3OKKB 4WEUD 3VG0L 3X13B 3BQUB 4X98A 4MS8C 4RISL 3T4YB 1QP1A 3UJIH 1MI5E 1MAML 1UEYA 1YN7B 2Z8VC 2RHEA 4ODHH 1U58B 2O5ZH 4EUPH 2PTUA 1U8KB 2EDFA 2CR6A 4XPGL 5JMRA 3VI4F 1QPXA 4NC1C 2VLJB 4PJEE 2DQGH 3HZMB 5FECB 3HI6H 4PJ9C 4UQ2B 1CLZH 3VMOA 4PRDA 3I50H 1RIUL 2VABB 3J8F7 2VDOL 3DSNA 2NXZD 1T1XB 4JG0L 5JW4Q 3RWIA 2X4UA 2ZSVB 1WUNT 3IS0X 1RUQH 4JREC 2DQDH 1U95A 2X1WL 2BNQE 3IJHA 4OZFG 3U9PH 4NKOB 2DYPB 4HBQA 5I1HL 2Q8AH 5D2NB 3RWGA 2MHAB 1JHKL 3EBAA 1R3KA 4Z7VB 4OLYH 2X7LB 3BT2L 5L9DH 4YXKH 4B7LA 4TSAL 5BS0D 2XWJA 5D7LD 3U9UB 1MVUB 2NNAB 5JPNA 1JMZA 1R24B 2DJ4A 4L8BA 2R39A 2F74A 1RZ7L 1DVFA 2BRRL 3GB7A 4YXHH 1BQHB 3ARGC 3NCJH 4LIQH 5ITFA 2HN7A 1S7QA 5DXWA 5HHNA 3ABZA 5EUOB 2Q3AA 3H7BB 5FV1L 3FO0H 2UY7A 1LO2H 4WUKL 2CLRB 5GGRB 3RU8L 3QG7L 4ONHA 5I16B 2WIIA 3B4NA 4G9FD 3X3FL 3EDEA 2OL3B 4OI9A 5FUZH 1DLFL 4MAYD 3E6FA 3GMOA 1FNFA 2QADD 3MRNA 4PJDA 5I1GL 4PTTB 2V9RA 1CBVH 1TITA 1GCFA 4XXCC 2R2BA 2E8YA 2RJMA 4PLKD 3T3ME 2Y07L 4L3CB 5B38A 1WF5A 2XICA 3ARUA 4U6TA 4UU9A 4ZAKD 3FOMA 5DJXB 4JHAH 4IRJD 3VXMA 2X7LA 3GO1L 2QKIB 3V5HA 1D9KD 4Q9CA 4JM4H 4KMTH 5B4MC 1C16B 1OP3K 1FFNA 3TN0C 4MZ2A 1Z2KA 1PKQA 2IGFL 3QPXH 2AJSH 1CG9B 2CDEA 2PR4L 1GHFH 1OSZB 3IGAA 1KYOJ 1KN2L 1XGTB 2WSKA 4U6HA 4ALAH 3I02A 2APXA 5KN5A 4F58H 3WN5A 1T5WA 5FUOH 4JZNB 5DHXB 5ESAB 2EDDA 2V5YA 1NC4A 2CDFB 4A6YH 1LO2L 1MRFL 1S78C 3OQ3B 4GAYA 4IOFD 4FQIH 1KPUB 1IC4L 3U0TB 5B8CB 2R0ZH 1ZWIB 5I19L 4Y19D 2Q86A 5AYQA 3MNVB 3EW3B 2XPGB 3NCJL 4M6NH 4NQDD 1QFUH 4Q9RH 3SE4A 4HXAH 3S35L 4U4BA 3CH1B 5JA8B 3AMLA 4JZJB 3AXLB 5CGMA 1CICB 4LHQB 4MHHG 2MOVA 1LP9B 2FWOA 1O7VA 4L3EE 4HPOH 3NCYP 4XP5L 3WXWL 1UKQA 1JYXA 4ZTOH 4Y2DB 1JGEB 5I6XB 4CW1A 5E70A 5C0CB 4PRAB 4ETQA 2VSCA 4JANA 2R9HC 3VFNB 4YX2L 1JZ5A 2NZ9D 2EEBA 5F7LB 4MHHI 3C5SA 1EFXA 2MKLC 3DO7A 4PJFA 3FZUD 3FQTB 1F97A 3K1DA 3T08A 4MD4A 2YSSA 5F96H 1Q9WB 5FM8A 3FQRA 1D5XB 1RIUH 3UTZA 4K55A 35C8H 4EN3D 1ZWIA 2AAVA 3PXJA 4MCYB 4X99B 3GMLB 4DK6A 2V2TA 4RQQA 5GS0L 1RUKH 4DVBB 4XPGH 3S37H 3F7RA 5GGQH 2E27L 2O5ZL 5KJRL 5HGAB 3BISA 4DKFH 3ULVF 1KPVA 1OAUH 1MAMH 2ITDA 4OGYH 4ZUTA 4MWFA 5FGCB 2GW5A 4N0FA 1MFCH 2GEEA 2DWEB 2BFVL 4DOHB 3WIFA 4LAJH 4UT7H 4PD4J 5I2IA 3QEHA 4NN7B 1JK8A 5ADPL 2HTKC 4X4YB 4JKMA 4PY8I 4NCDA 1H15A 3QCTL 1XGQA 1SEBB 2LFGA 3GK8H 1UKSA 3DBXB 1DUYA 4NFCA 1NCNA 4LASL 3FAXA 5I1JL 2JE8A 3QIWB 5B38G 1A6TA 4PJIB 2X4TA 1G9NL 2A0LD 3BD3A 3H7BA 3MRFB 1I9IL 4Y4HC 2IADA 4LCWD 3BE1H 3P73A 3KWWB 5IHBA 1OP3H 5HPMA 2VQUA 4EQ3A 5M94B 5D71L 1EZVY 4D9QD 5HGGS 5DD5H 5HI4D 4RFNB 3B8YA 1C5DB 1DR9A 5FHBL 1UACL 5HVHB 5BRZB 2AEQL 2I07B 1DEDA 1G6RH 2X4NB 5DMKA 1WT5C 3EGSA 1TENA 1DDHA 3E6HB 4JRXE 5ESQB 2F5AH 1TZGL 2P48B 3MCKB 4UDTB 1CD1B 2P46B 1LP9E 1MHEA 2MJWA 5GJSL 2D7TH 1A14L 1JWSA 1W0VA 4XNUL 1W72A 5EN2A 2YRPA 5HXMA 5D7JB 5I75C 1I7TB 4JFYA 3MLZH 4QT5A 2BY2A 1VGEH 2MNUA 2A9ML 3OKDB 4AMKH 2Z31D 4DOHE 5TQ2L 4Z78A 5JOFA 3VRLE 3IYLW 1GRWA 1OCWH 1U8LB 1HQ4A 4HKZB 4CVUA 3MRGA 5C6TL 3B9KA 3EHBD 3TM6A 5B8CA 3HI5H 3PDGA 3KPRA 5GRVL 4HG4J 3DYOA 1PSKL 4YK4C 4NBXB 1RU9H 3U6RB 2D9QB 1DBMH 1U6AH 3FFCD 3PQYD 4JKPH 1CZ8H 4IJ3B 3WFHB 1AKJB 4O9HL 2C3XA 5FM5O 3RQ3A 5IB1B 3SGKA 3MCKA 2HLAB 4BUHA 4NPYB 4NC1E 4I0PC 3QI9D 2LE9A 4I3RH 3I6GB 2FD6H 3WIIL 1JRHL 3ZDYE 1MOEA 4L4TE 2VAJA 1WFTA 4OIIH 5F1NA 2XZAL 1IL1B 3HFMH 1U8PA 4YHML 2UYLB 3PWUB 1G6VK 4PJHE 4K94H 5IWLC 5CP7B 4ZPTA 1KNOA 3GJFB 2VDKH 4K9EL 5FCUL 2BVOA 4PBXA 5C0NC 1KCLA 3OAYH 4K8RH 2J8UE 1MIML 1CD9B 3MR9B 5ETUA 3S5LA 3MRJA 3TIEA 3REWA 1YZZA 2I9TB 5GJTL 4GMSH 1NBYB 3JVGC 5I8CB 4S1RL 1X9QA 4AEEA 5ANMA 4UT6L 5JIPA 5TDNA 4P23A 3E8UH 3O2VH 5GPRA 4G6MH 5BCAA 3ARBC 1CFQA 4KKNA 1G7LB 4ORZC 4ZUSB 4PJEB 1Z0MA 1QFWL 3O41B 2DI8A 1UM4L 3HC0A 3QQ3A 4ZPVB 2ESVB 1HE7A 5HHXH 1HHIA 4AENB 5CAYB 1NCCL 2Q8BL 3JTSA 1D6VL 2F53A 3SY0A 1JPFA 3F62A 4XI5C 3LEYL 3EYVA 3OHXB 1OQOA 4WHYG 4OCSH 2EDJA 5E9DE 3QUYD 3LSOA 1IGYB 2MTPA 5SWSB 4XCCL 4RWYL 3RDTC 4YNYB 4BSVB 1EEUA 5KOMC 3LIZL 2QSTA 5GRVK 1BIHA 1MHHB 2X89D 3L7EB 3G6AA 1HCVA 4HC1H 1F3DH 1FP5A 3HS0B 3LKRB 4MCZA 4PRDB 5CUSL 1NLBL 4H5SA 1QUNA 3GMLA 5TGBB 2V2TB 4GW5A 4O2EB 2WIMA 5FF6A 1HHHB 1RI8A 3ZTNH 3B9KB 3ZL4H 4Y19B 1Z5LA 4PTUB 2FH8A 3L7FB 3VDBA 3QULB 4C56A 1QSEB 3DX9A 1U93B 3UC0H 5JHLH 2R56H 4DQOL 4UAOB 4P3DA 5C0FB 1DEEA 4NZRH 3U4AA 1DE4A 1X4YA 4MAUL 4MXWL 3RDTD 4PREB 1ETZB 3P4NB 4OIBA 5IMLB 2GAZB 2CLZB 4Y4HD 1RZIB 4YWGH 3S36X 3WV0A 2APFA 3O4LE 3QR2A 4MNGE 4QXGH 3VGEA 4N0YL 25C8H 5FA3B 1MAKA 2H2PC 5FYLL 3OR7B 4MQXD 3F65A 3RVTC 1MI5B 4W81A 3T0AA 4U1NB 4PJIE 4JDZA 3TH2T 3MRBA 1TQBC 5D93B 3I2CH 4LSPH 3VD9A 5ESQA 3WIHH 1C5BL 1W72H 3IDIA 3TJEH 4NHUB 4DEPB 3KYMA 3TA3B 3EOBA 4N90D 5CJ5A 4IEFB 5KN5B 3S8WA 3H6JA 2R2HA 3BIBX 3MRFA 3O45B 5BV7B 3I9GL 3UPRB 1C5CH 2CGRH 2YPLA 5J06A 4XVUC 2FH6A 1CTOA 4POZD 1KPUA 1QYGL 4XH2A 3RVVC 1MCJA 3OKDA 4PP1C 2OJZL 4TSCL 2X44D 1BD2A 1G6RA 5AD0B 1OAZL 3RWHA 4Y5VA 3KLDA 1OT1A 4NGHH 1U2HA 3KXFD 3EYFB 3S35X 3QYCA 1NQBA 3WUZA 1C5CL 4MVBD 3FQUB 4GW1A 5F7NC 1ZA3B 4JN2A 4D9LL 1F6FB 3QFDB 1WCQA 2CRIA 5DYOB 1ACYH 5E8PA 4UILL 1RULH 3QXWA 2AJXH 4JY5H 2BC4B 1BD2E 1T20B 1J0KA 2FO4A 1NMBL 4OCXH 5BMFL 5HYQB 1JPFB 2DQUL 1X5GA 4TTGA 4OTXH 1MFBL 2FEEI 4PRPB 2AS5M 5CJQL 3VFSA 2X9WA 1MHCA 2APWA 4LQFH 5E8EB 5EA0H 3OKLA 1PJ9A 4XPFL 25C8L 3O4LB 5SV4A 2EE6A 2FLRT 3BGMB 5EWIH 4LLMA 4LVNC 3QWRD 4NFDA 1MWAB 3VFOB 2VAAA 4HGWA 4KQ4L 2XXCB 4FFVC 3QQ9C 1JWUB 4WI3A 1WAAA 4KHTL 4L8CA 2M26A 5C0ND 3K7UA 3MFGB 5I1LB 1MWAH 3OBAA 1PG7L 5DVKA 5I66A 4YHNB 4O2CA 3NABL 1I3VA 3W0WD 4L29A 3BP4A 3CVIH 3FFDA 5KAQG 5CJ8A 1AI1H 2DD8H 1CDCA 1MPAL 3CVIL 4JFED 1QFPA 1YPZA 1PG7H 3OR7A 3SDCC 2ZG3A 4G9FA 2ITCA 1RJZB 5JOEA 5IQ7H 1MI5A 3RHWK 1CXHA 5F9WB 1XGPA 4IDLA 1OWWA 1YUHB 3BIKA 3C5SB 3HPLA 2NXYD 4R96B 4RGNE 5GZNC 5EWIL 1G7JA 5HY9B 2GAZA 3LIZH 4LF3A 5K33A 2OTWA 3VE0A 4YDVA 1C7SA 4XCCH 3DO3A 4ZNEE 3O9WC 4I5BB 3NH7L 1YYML 3QUXD 5BMFH 4ZO8A 4DFIA 3FB7A 4KAQH 5DJ6B 4KK8D 4Z76A 3PWLB 4MJ2A 3D87B 4HJGB 2PW1A 1RV6X 4PJGA 5C0GB 4LEXL 2FGZA 1U93A 5KZCD 5EC1B 5EZOL 4I1NB 1ACYL 4GRWF 3RIFK 5CBAA 5EIQA 1NCCH 1ZHKB 3DUSA 3L3HB 2XZQH 4DJMA 4XP9H 1FVEB 4HEME 1AXSA 3ROLA 4RA3A 3IU4L 3NCYS 3VRJA 1P84K 1XCQB 2GHWB 3BEVB 1OSZA 4J3OC 4G6ML 1IGTB 2EDEA 3ILPA 5EO1A 5FEBA 3L5JA 4U6HB 1EUUA 1T7ZA 2Z8RA 3I9GH 4K94C 3HMWL 1VFAA 3MXWL 2ZNXA 2ZSWB 4J4PD 3SKOA 3RKPA 2PETA 4YLQT 3QWQB 4KK9D 4Y19A 1IGYA 5JXAH 5CSZA 1HWHB 4OZHE 5DD0L 3TJEL 3MRCB 4TNVF 5L88H 2Q86B 5L2KE 3HMXL 3N50A 2HMIC 3BYTA 2X2YA 5HHOD 1VPOH 5E2UH 4OIIL 1A1NA 4W4OA 4HDIB 4FQCH 3CC5A 1GGTA 5FK9B 5LBSH 4MA1B 4D9RD 5KVFH 5E8EA 1W8NA 3KWWA 1RQ5A 3NN8B 5C08A 5I71B 5J1TC 1RJCA 7CGTA 5KZCB 4MXWH 1QR1A 2VZVA 1U0QA 4OKDA 4PGBB 4X6CA 5F1IA 1IAIH 1G7HA 4QTHA 1U6AL 1ONQB 4N8VG 5DK3A 3KDMB 2M8XA 3PNWB 2CKNA 3CGTA 1S7SB 3TF7C 3WL9B 1WZKA 5K9JH 5DQDH 3GSXB 1M7DA 1J8HA 1GGCL 3TCLA 4BFIA 4WI2A 2LU4A 1RHFA 3GHBH 3HZYA 5AG9A 1EAPB 1YY9D 5FYKD 5HYJA 2A6DB 2E3VA 4HC1L 2F5BL 4EDXB 3DGGA 1NC2D 3WS3A 1HNFA 2IBBA 3WMSA 5HI5C 1OTTD 1CFSA 4YHIB 4RWYH 5D1QB 4HF5H 3VFMB 4DK3A 3DVFA 1N7ML 5HDQH 4F7EB 1A3LH 4WFHD 4J1UB 3W0WB 1A14H 3VXSB 2FX9L 3LEYH 3EYQD 4ZQKA 4XXCA 4I3SH 4NKMA 4OQ1A 4YHOL 4ODBD 4OZIA 3SPVA 3KNBA 4GG6F 1QO3A 2CRMA 2GTZA 3N06B 1K4DA 4M7KL 1AD9B 1G6RL 1I9EA 4GH7B 4P2CG 3VWKD 1NDMA 5HHXL 3WFDH 4GQPH 2RAMA 2NXYC 1HQ4B 4HKZA 3O6FD 4MJ6B 4LEOB 1DZBA 3WFCL 3QNXA 4FABH 5C0AD 5JW4R 1S8DA 3V0VA 3GMRB 4WGVB 1MFAH 2R69L 1AJ7H 1H3VA 2V17L 1MRCH 4H1LA 3UTQB 3ESUF 4MJIA 4NN5C 5JA9A 1PYWB 4IRZH 1KTDB 2O26U 3HRPA 3CCHA 5C09D 3BD4A 5DGRA 4AQ1B 2CR3A 1QQDB 3GSNA 3K2MC 4GKNA 5CHNB 5DRNA 2F58H 2F9BT 4K9EH 4OGAD 1ED3B 1I1RA 1OTSD 1DQQA 2DQFB 4DGVH 1HN1A 5ID0A 3HFML 3MCLL 1E28B 4U1IB 1DL7L 1KENH 4YDKH 1CCZA 5T1KA 2A6IA 1UA6H 3LQAL 2DLEA 3BPOB 4JFEE 5C2BH 2Z4QB 3Q5TA 2CMRL 1BZ9A 1NPUA 4ODXA 3ULVC 1C08A 3MGAA 5HHMB 3KPPA 4OGYL 4F33B 4R6UA 4DKFL 3BZFB 2H2SC 4X4ZA 1P9MA 5AUMB 1CF8L 1OARH 4JKPL 3TP4A 1UVQA 5E9DB 3S4SB 1LEIB 4ZSOE 5GS0H 5I8OL 3HC3H 2X6MA 1IAKB 5KS9E 4QXTB 5JXED 1T2JA 3C5JB 3INUL 3KDMA 1MCWW 1IQDA 1N5AB 2B4CH 3S4SG 1SEQL 2AK4D 1IEBB 3RY6A 1ZT4A 2B1HL 3GRWA 3LN5A 4EUPG 3RTQB 2H45A 4ZD3H 4ZSOA 4PG2A 1U91A 3MJ6A 3AROA 5D96B 1GSMA 4F9PA 4HUVA 4PY7B 3MLZL 1T83C 2F19L 2R15A 1CLCA 3BP6A 4C4KO 5F7YC 4IOIA 4XNUH 3VD3A 1N8ZB 2R0LH 5ICXB 3KXFE 3PV6B 3RVXD 4HPOL 5I9QC 3QISA 4GRMB 4JM2A 1I4FA 3NPSC 1TETH 4M61A 1U8HA 3QUMH 4S0TD 2AEQH 2VUYA 1U8PB 2AXHA 1G7HB 1T1YA 5C70A 4CMHB 2UVEA 1A6PA 2NY2C 3H7LA 2Y36L 4OJFL 5DD5L 1YNTB 1QFUL 4LPVA 4GLRI 32C2B 2CD0A 2R1YB 3CDGB 4NQVA 3CAFA 4XZUA 3MR9A 1MVUA 4Y5VB 1I9IH 1QQDA 1V3JA 3NGBC 4OZHB 4PJBA 4R7DB 3IAQA 1A7RH 4P57B 2CJUL 4PJAF 4JVPA 4ENED 2AI0H 5I1AB 4F58L 1N3NB 3TJHD 5I1JH 2XWBA 3MMEA 1TJIL 4RMRA 4AT6A 3M1BB 1P7QB 2AJSL 3HPJB 3GK8L 3P3YA 2GCYB 3ARQA 4JM2F 3QUMA 4KXZI 1A3QA 3JTTB 1AE6L 5E5UB 2DN7A 3UEZA 1QBLH 3L5XL 1G0YR 1T5XB 2C1PB 1FL6A 2YD6A 4MJ5A 4WHCA 3VDAA 4NQTA 2KDGA 4HIXH 3LDBB 4M7LL 2UV3A 4U1HB 5TJWK 2HYMA 1HWGB 2X5PA 5F21B 1AR1D 1IRAY 4L4TA 4QRRD 2W60A 3HCVB 1DN0A 4PJ8B 4N5ED 4G8IA 1MCHA 3QO0A 3T0XA 1OAUL 3CNKA 1OAQL 3B5HA 5IB2B 4X6EA 3EO1A 1HI6B 1IBGH 3QIUD 3V0VB 4XC1L 3IFNL 3CUPB 4XVUD 2A77H 2CDEB 3CX5J 1HHGA 3L95A 3O3UN 2WBJB 4LKXA 4HXBL 5I1KL 5T5NG 2DBLL 2ICWJ 1HEZA 3WSQL 3BIKB 3MSPA 3DUUA 1QD0A 3UJJL 5D5MB 5F96L 1VFUA 3PABA 4TSAH 5DI8A 4A2LA 4X9IA 4QHMA 5JTWA 4JJHA 1T21A 1O7SA 2O5YL 5DURD 5F88A 2JCCA 4WNQB 2NX5E 4KJPD 2R0KH 1FFPA 4ODWB 5EOTA 4C54A 4YX2H 4PGJA 3HC4H 43CAA 4PJXB 5KSBF 4MNHA 3KYOA 4RRPG 4ZTOL 3GMPB 1YC8A 3N1FC 2O5YH 4L4JA 3L3GB 4HKJA 4NRXB 3ZTJG 1BAFL 2DM7A 4FQQA 4I18C 1N8ZA 1A02N 3M17A 1OAYL 2VDOH 1UH2A 1VB9A 1T7YA 2HA1A 3TCLB 4BFIB 2BNQD 4RGMB 3JV4B 4TUJB 3QFJA 1RD6A 3GKZA 3DGCR 3MODL 1YQVH 4HV8B 5I15L 3MRRB 5H35A 3TBWB 4XPHL 1OAQH 5F44A 3CX2A 3QAZB 3UZVB 1MLBA 1UZ8B 3UJIL 5IFHL 2PR4H 1ZEAH 3HNSH 4ZFZA 3UJTL 4TTDC 2BK8A 3NOIA 5HGBA 2GTWB 2H1PL 5KSBB 4KC3B 1CU4L 3VFRB 2ZG1A 3MACH 5F3HA 1UG9A 3GO1H 2AP2A 4X5XA 1E4WH 4I2XA 3TH4T 4JZOB 5T3ZD 3GGWA 3RVTD 3LN4A 3LRSB 1F11B 1I3RA 1P6FA 2R0WH 4YGAB 2D31A 2YUVA 5DJAB 5HYSB 5ACLA 5I1GH 4X7EC 4YHLL 5DUPH 1BZ7A 2W9EL 3BP5A 2W0LA 5FUZL 5IOPB 2YD5A 1AC6A 4LSQL 3UTQA 4WUKH 2GT9A 3GI9H 3BQUA 5CEYA 3QWRA 2XQYG 2ZSWA 3C5ZC 4MA8H 1ZGLM 5ALBL 5DFWH 4F2MA 5IB2A 3L3DA 1F8TH 2FHBA 1RZJH 2NY2D 5HY9A 5IMMB 5DRWB 5I1AA 3IFLL 1WWCA 2AEWA 5DFVD 5IROA 3PWNB 3REVA 4OZGA 4RZCB 2PYFB 4YHPB 3KJ6L 1T66D 4PB9H 5J56B 3G5YB 4JFEA 1IEAA 4JHZA 4OGXL 4LHUB 3GSUB 1I1YA 1YECL 2AQ3A 3D18B 4Q97A 2YR3A 3STZA 2YPVL 2C4XA 3CFKA 4R4FL 2LVCA 1AXTH 4I48B 3DX7B 1T6VN 4JM2B 2VLMD 4TVPH 1FGNL 4OLUL 5EPMA 2DWDB 1PW3A 5HI3D 4UIMB 1BFOB 4L8SB 3TIDB 2M2DA 4JG0H 2YD8A 1G7JB 4LCCB 1F4WH 2AJ3B 2B1HH 1SEQH 1X5ZA 3EYSL 1UENA 2B4CL 4BKLA 3TVMA 4N1HB 5IV2A 3TZVD 2JIXA 3G6JB 1U3HA 3EHBC 4M8QB 1CD8A 1D6EA 3L5WB 2L7UA 4L8DB 3HC3L 5HHPB 2P7TB 1T0NB 3WO4C 4ELMA 2FBJH 4PJCA 3DIFB 4BM7A 1A8JH 3JUYA 2VR5A 2EC8A 5L8LB 2UY6A 2P49B 4ODHL 3RVWD 4F57L 3RTQD 1QSVA 3SDAD 4H26B 2R4SL 4N8VB 2R2BB 3T1WA 2BVYA 5JW4M 1CT8B 2AK4B 4OD3L 4JRYB 2HT3C 4LK4A 5CINL 3E6FB 1DFBL 4NQCE 4CN4A 3GM8A 3MRKA 5I8EB 2XKSA 2HWZH 4JFZH 3T2NH 5GZND 4QXWA 1PD6A 4DGVL 3D2UA 4QYOB 5EORL 4ZUVB 3O81A 1CGVA 1MF2H 3ZE0F 2KBGA 1WWAX 3C87A 4HWZA 3QZWA 3E1F1 4IDJH 1X7QB 2P8MA 2AK1H 1JHLH 4MA3A 4O02H 1CICD 1A4JB 3HAEG 4MSWB 5D2NA 3RWGB 5A40E 1KIRB 3VWKA 4L8BB 3CUPA 4NO2A 1T0NA 1AJ7L 3IDGB 3VXSE 2ILLA 4NM4L 1ERNA 2G5BA 3QHFH 4WI8A 2YUXA 1BOGA 4Y0GA 1T7WA 2BNQB 3VXOB 3U7YL 2QSCH 3P4MA 1T21B 2ATKA 4JO4H 3GBMH 1LO3H 3QNYA 4U1IA 3WD5L 2NY4B 1R5VB 1YEDA 1XR8A 3MBEB 3MQIA 2A6IB 4PB0L 3HN3A 5DDHA 4PRHE 4LLYB 1ORQA 1UJ3C 1MCCA 4FQLH 1KEML 4RGNC 3T4AA 3EKCA 3GSUA 3TESA 3UZEA 5GRXG 1MVFA 4I77L 5DRNB 3DHJA 2DRUA 2EH7H 3DMMB 4PRAA 4ETQB 1L6ZA 4BZYA 5DRWA 5I0ZA 1OP9A 5D1QA 3MLSL 3V8OA 4GRLB 4PRBB 1MJ8L 4OCLC 1T66C 2DICA 4HIJA 4QRTA 4WHDA 4ZOCA 4F2MB 3MFFB 5HGDB 4KRNA 1LP9A 2FWOB 1HIML 2P8LB 3LS4L 4AH2A 5ECJE 1FZJB 5DLML 1WFOA 4CMMA 3P4MB 2UZIH 3V4PL 4MJID 1IQWH 4X9BA 1HHHA 3C5ZD 4UTBH 5E1AA 1QRNB 5HBBA 3T65B 3ARDC 2HVKA 4CGTA 4NNPL 3OWEA 5LBSL 4X8XA 4I2XB 4FFWD 2OJEA 3MBXL 4MQXC 4OUUB 1FZMA 4JJ5A 1E4XI 3FQXA 5D1ZD 1IKFL 1N2RA 2B5IB 3HMXH 2W1NA 1J12A 3CDFA 3CSYA 1JPGA 3UTTB 2A73B 4PRID 4J3SA 4Y1AA 4HG4K 4H20H 4NSKB 2GUOB 3ILQD 1JL8A 2JIXD 3WFZA 3V6FB 4UV7H 3FOMB 5DJXA 5HVGB 3HMWH 1NCDH 1X7QA 4U1MA 1CFTA 5BVPH 4TNWK 1DJSA 5GGTH 1EJOH 1ZTXH 2HT2D 4GSDH 3L6FB 3S5LG 3GMMA 2MCG1 2YRZA 3QEHB 4NM8H 3NIDE 4NKOA 5BS0E 3TZVB 1LD9A 1FFOA 3BN9D 5TDOA 3CDCA 2QJDA 1P4IH 2PKDA 1FHGA 2IQAB 5KG9B 4B53A 1CT8A 2AK4A 3FO2A 2QQKH 2X4UB 3K8KA 3MV8A 4HWUA 4LDLB 3RWDB 1NGQL 5IBTH 1SY6H 4KROB 3C2SA 4O2FB 5ICYA 4YDLB 2JCCB 4HEPG 4G43A 4ZS7H 1TLKA 1HKFA 4JFHD 1IGIH 3NCFB 2Y72A 4QRPA 2IMMA 5KVEL 5ABDE 2YS4A 4XVJL 3NH7H 5I1EH 3HB3D 4ZNCD 1U36A 2FX7L 4ZUWA 3S36L 1JGLH 1UFUA 2P4AB 4OGAC 1CFBA 1JNNL 1N59B 3GSQA 2VKWA 3SN6N 4KRPB 1HH6A 3L9RB 3CFJA 1QA9B 1KCUH 5IESL 1FAKT 3F58H 3TBSA 3MLTB 1I3GH 2BVPB 1LO5A 1NAMA 1LEGA 4X8JB 4NO0D 5GGVY 2IAMB 3B8SA 2J8UB 1EFXB 3OB0K 5JOPD 3NA9L 4QCIB 4CDGC 3GUTB 1KCVH 3QIUA 4FQXC 4G8IB 4JM2D 1A5FL 1IT9L 1I1FB 1VA9A 5J7CC 2N56A 4PYGA 4XNMA 3WFHA 5JLZA 2YN5A 4IBLT 3A6CL 3GSVB 1AQKL 2OZ4L 5C0JA 1QBMH 1FNGB 1MCRA 2VZSA 4UQ3A 3NABH 3QIUC 4FZEH 1YDPB 1WIOA 3SEPA 5IKCA 4HFWA 1HKLH 2CKBL 5FKAB 4JG1L 5C0EB 5K59E 5KVDH 3VFNA 2DQIH 1QRND 4KHTH 3ALWA 2FX8L 4U1HA 1JF5A 2BOBA 4XP6L 1YNLH 5CD5D 3IFPB 2H9GA 2EYRB 5CZXC 4HWEL 3DETD 2VC2H 5E2VH 3V6OC 1T2QL 3T4YA 2DLGA 4YNYA 3WJJC 5C3TA 1Q8MA 4FQXB 1FDLH 3ARRA 1J1PH 1QNZL 4XCEA 1YEEH 1P7QA 1D7FA 2DAVA 4LP5A 1EERB 3RWFB 4MXQD 5E8NA 1CD1A 1Y0LA 4G5ZL 5FCSH 4LSDA 1N6QL 1WWWX 1W0VB 5T1DL 5TGBA 1A6WL 4KRPC 4JB9H 4Z8FH 4PJ9D 1N64H 4HLZG 4OSUH 2BNUA 3Q6GH 2LTQB 1IM9B 5A2IH 3LOWA 4Y5VC 5IF0B 2LAAA 1REIA 3LS5L 1JJUA 3F5WA 4JO3H 2VDPH 2YMXH 5DUML 1PKQB 4WJ5B 2I9LB 5K9OA 3ZHLA 3N9GH 2HVJB 1XGRA 5HSFA 1M7IB 1MCSA 2L0DA 5T3XH 3KYOB 4ZUVA 5I9QB 4X7SH 5EBMB 2FEDC 4MNQA 4W6YB 3LKSA 5E6IA 4YIQA 3QDAA 5DMIH 2XZZA 1EA9C 3JTSB 1I8IB 1U3YA 2NNAA 1GGIH 5FGSA 3WLWC 4PJBE 4PJDB 1A22B 1FO0A 4BH7B 3RWEB 4XP4H 5TDNB 5K9KA 5E2WL 3EDKA 4Y2OA 4MXVE 1T4KA 4OFDA 5FYJE 1HEZB 3JV4A 5DURB 3TWCL 5B39A 2ICWA 5L0QB 3IDXL 4Y4KC 1AXIB 4NBZB 4Q9QH 4WDIA 4YWGL 1BZQK 2QADB 1MJ7L 1U95B 5GGSY 4BKLB 1FH5L 3L3IA 1GGBH 4M4PA 1BOYA 5CP7A 5F7UA 3GMNB 1Z9MA 3NIFE 1MFDL 3D39E 2DQCL 3GMPA 5D7LA 3UROR 3V52H 5AD0A 3BUYA 5IB4A 2BDNH 1ZGLA 2VN7A 4ZS6D 1BJMA 2A74A 1A6VL 1ES0B 5J3HC 5DQJA 5BJTA 5T1LD 3GMQB 5GS2D 4PRIE 3RL1B 2IH3A 3GI8L 5CUSH 1DQLL 4I48A 2JJSA 2EDBA 4E5XB 3CZJA 2B2XH 5D1XA 4M02A 2C3WA 5GZOC 3QEQB 1AGBB 3VXSD 2Z9TA 4Q58C 4N0UE 4N8CH 1M1SA 4P2QE 3WJLA 1BJ1H 2B1AL 2VJXA 1KLFA 3GSNB 4H1LG 2BY0A 4APQB 1MJUL 4FQXD 4YGVB 2CDFA 4R90H 4B0MM 3QIUB 1EH9A 3R06B 2XG5A 4XNMB 4Y5XB 1M6OB 3D0LA 1D5IH 2X89A 4FMFA 2CK0H 4ZXBC 3ARVA 5FGCE 2BX5A 1D6VH 5C0FA 2VL5A 2IAMA 2YC1B 3V7MA 5F3BA 3OAUL 4UBDD 1E6JH 4WV1C 3HE7B 4DZ8B 4LSSL 3VCLA 3ARED 3V5KB 4I0PA 4U7KA 5HDOA 5HYSA 4XMPH 1IGCL 4Q9BA 5HPMB 4KKLD 4LLQB 4UINL 3VH8B 3GMQA 1Z5LB 2B8OT 4NZDA 2BVQB 4FNLL 5IFJB 4J3VA 5D7JA 5C1MB 4H5SB 2ZUSA 4HSQA 3LKOA 4YO0A 3HPLB 1CN4A 1JZ6A 1LK3L 1J0IA 4X5WB 4Z0BL 4J3XA 1FBIL 1KC5H 1MAJA 3Q3GB 4JFXB 2VH5L 4K8RL 1YEKH 2I25N 2OZ4A 1XGQB 2GK0B 5BVJB 5L7XH 3AS2A 1B3JA 1NUDA 5AZEH 1VCAA 5CKAA 1PEZA 2FECL 3C6SB 3ECBA 3DROB 1WBXB 3EYVB 3OHXA 5E5RB 2C4FT 4N0CD 4K07A 1KN4H 2LU7A 3ULVD 4I3RL 3PV6A 3QDGB 5FOBA 4ZO6A 4HGWB 2ZCHL 4P3CL 4NFBA 4TPRL 4NKDB 2ESVA 1VEOA 2CO7B 3MNWA 5T1LB 4CDHA 2GY7B 5ISZE 1E27A 2H2SD 4UTAL 4KY1L 5ICZB 1RU9L 5KS9B 1EHXA 1UWGL 2GJ6E 3BKML 4XNXH 3ZLQC 4KI5C 4CAGA 2MFNA 1G9ML 4GKZA 4CKVX 1Q38A 1OVZA 1NGXA 5DJ8B 1ZVHA 5LGJB 2HTKD 2AJZA 2EH8H 5C6TH 4M1GH 1YEGL 2P7TA 4ELMB 1S7UB 4QHNA 1OCWL 4YHKL 1F4AA 2QQLL 5KSVB 1QTYT 2A6KA 1O0VA 4N8PA 3FQNB 5FM5M 2IBGA 1KNOB 1A7BA 3LKNA 5HGAA 3DROA 4PUBL 1INEL 1RHHB 1FJ1A 1U8NA 3GEWB 3OX8B 4MAYC 3MOAH 5C0IB 2GUOA 2FZ3A 4HKXB 2BSED 1UT9A 1HZHH 3HHRB 3S3PA 1IAOA 3NACH 4LBEA 1V5JA 1CE1L 4OB5H 4N9GB 1AXSB 1UACH 4RNRB 1I85A 1XCQA 1DN0B 4QOKE 1MSPA 3PWPB 1U8OB 3TA3A 2C4FU 1KJ2B 1BVLA 5FHAH 3BE1L 3FMGL 1ADQL 4PJ7A 4X6FB 4WU7A 4LNVA 3U7WH 5A2JH 1ORQB 1KB5A 1MCQA 4KRMB 1OB1A 4PGEB 3WDIA 3T4AB 5GGUA 1K8DA 2VLRE 3GSNL 1RPQA 1VHPA 1YYLH 1KGCD 1U8MB 3PWLA 4JO2H 2N7BA 4MDJA 4HH9A 1W2KT 3GSOB 1GH7A 1D5ZA 1JFQH 4FFYH 5JOFB 4JQVC 2A74B 3KLAA 3QJFB 5J3HD 1R3IL 5IQ9A 5DHYA 1ZOXA 1FL3B 3BESR 2VXSL 3HNTH 1RVFL 1EX0A 2GFBA 5DQJB 1U8NB 4LF3B 1VFMA 5KTEL 3GJFK 4JFOB 4LCWE 2IQ9H 2Y5TA 2NLJB 4FFWC 1HH6B 1NUNB 3L9RA 2A83A 3TNNB 1GXEA 3E6HA 2CDGB 5MEPA 1OW0A 5ID1A 1AD9A 2LAGB 3SDDC 1FO0H 5MI0B 5I8KH 5C0DA 2VTFA 1U42A 1CDJA 2WQ8A 5IJKA 4HW6A 4XB7A 3T04D 5GGQL 4AQOA 4MMXC 3FO2B 3SKNB 1BBDH 3MGTA 3EFDH 3U4BH 3SDCD 1U8QB 5C6WH 1FORH 3IETA 4P23B 5D1QD 9CGTA 1AP2B 1Z3GH 5IJKC 5A16B 2WV3A 8CGTA 4WI6A 2GJ6B 35C8L 2Z93A 3PWJB 4UIKL 1Q1JH 1KLUA 1A6TB 2VXVL 4PJIA 1PAMA 2X4SA 2NY7L 4OAWB 4Y16D 1U3HC 4QXUH 3HZVB 1GZPA 4WI5A 5CEXB 5ETUB 4NRZB 3S5LB 1CD0A 5HYEA 2NTFB 3F6LA 2VXUL 3MV9B 1H3XA 3RNKA 3QUKA 3WFBH 2W0KA 1X5AA 1V7NH 2VSDA 1VACB 3C60D 1Q0XL 4XRCB 3W39B 3UTPD 4PS4H 5CLTA 5SWQA 4UUJA 3M07A 4BQ6A 4XP5H 1CFQB 1TXKA 2H6PB 3GBNH 5TF0A 2CXGA 5D8JH 1NMCC 4TSBL 2QSQA 3ROLB 2HJKA 5C07A 2EH8L 1KPVB 1DSFH 4DW2H 1XF2A 4P5MA 2XQYK 4Q9RL 4N1EA 4WW1A 3CH8A 2V5TA 1BLNB 3U0PB 5IW6B 1IC4H 1VSCA 4WJ5A 5LXGL 5KSAD 4KY1H 4ODVL 4DGIL 5I17B 1BWWA 4Y4FA 5DRZA 4E0RA 1B0WA 5CZVH 1LILA 3KPMB 3ZKNC 2FB4H 3OSKA 1TJHH 2OYPA 1G7PB 2AGJL 1IC7L 3CXDH 3EOTL 4DEPC 2VZ3A 3WHXA 5CJXC 4OF6A 4WI4A 2EIBA 2FGWL 2BY3A 3O11B 2HT4D 4MDJB 1EGJH 1WTGT 2RFXB 4KMTL 3CMGA 1X5JA 5AZEL 4U33A 4D0BB 5C0BA 1N6UA 3DUSB 4EKXA 1P2CB 2Y07H 2WUCH 1K8IA 2WAHA 1KJ3H 2E6PA 1NGYA 1OGAB 1QSFB 1KC5L 3HG1D 1IGML 5J11C 4Z0BH 1LK2A 2WBKA 4D0CB 4JPVH 2W0FA 4KVNH 4I3GA 2JCCE 4PJ9A 3QG7H 5A2KH 1AD0A 1XGUB 1NDMB 4LSVL 3VXPB 4PJ7B 4KZDH 5EULV 5D72L 3V6OE 5C0CD 2HJFA 3X17A 5EZIH 4LIQL 2OTWB 3EDDA 3VE0B 4F8TA 3ARGD 4QNPF 3NCMA 3BEWA 4MJ4A 4O51A 3QEQD 4RNRA 4G80B 3I75B 4LCUA 3PWVB 5TF1H 2OS7A 5C09B 5JHDD 1XF4A 1FNAA 3BOVA 3NFSL 2WP3T 4L9LC 4EI6B 2FO1A 4M1DL 2Z35B 4YXKL 2G9HA 3BT2H 4JPWL 1R5IB 4X4YA 3V2AR 4R2GB 1KOAA 1GOFA 4IOSD 5DVLA 3OG6B 1UB5A 1EAPA 4WENB 3IJYA 1LNUA 4Y4KB 2Y06L 4ZUUB 2F53B 4RFEA 3SY0B 2C3HA 3SCMB 4PJDF 3QT2A 3VXMD 2F54D 2ICEB 3KVQA 4NJ9H 4EIGB 5DJ2A 3NFNA 4ORGA 3O4LA 3ULUL 5HDBE 5ENWA 3VFOA 3RUGA 1LHZA 4WEBH 1JP5A 1U8QA 1I7RB 1H3PH 1A6AB 5DJZA 1FYTB 2DQGL 1NC4D 4ISVB 2XFXB 1GZQB 3RWIB 3SJVA 3V6BR 3W5NA 4G80A 1ZLVH 5IG7A 1INQB 3FB5B 3K46A 5C0DB 3DX6A 2BNUB 3KYNB 1I9JH 3C5JA 3MRQA 1SYSB 5CJOH 5T5NF 4ZOAA 1U3HB 4KGJA 1IQDB 3EYFA 4LLDA 5BO1L 3DURB 2YPLE 3O2DL 5F71A 4GW1B 5KVGL 4ZUTB 4PP2A 4JPIA 5E8OA 1OTSC 4P4KA 1BGXH 1KB5H 1QFWI 1Q9OA 3CD4A 3EFFB 4J3WA 2FJFB 2QBWA 4NT6B 1AGEA 4AIZA 2VERN 3JV6A 3BN3B 3KR3H 2KUTA 4LVHC 4HS6A 5GRJH 4FTVE 5E95B 4DUVA 3IDYC 3KPNB 2W9DH 2ZNWA 1M7IA 1VGKB 5IGXH 1NEZB 1BECA 5JNYB 1S7TA 1FN4B 4NZUH 4CNIA 4U1SA 4X7CC 1BVKB 2X4PB 5FIEA 1JVKA 2HKFH 1A7OH 1QSFA 1YY8B 3O8XC 4GAFB 3HZMA 5HYSG 1QLEH 4I0PD 5J11B 1E0OB 4L3EA 3T2QA 3OJDA 2AEIT 4P9HL 3WYRA 1J7VR 3TVMD 5H8DA 2PW2A 4XGZA 1AGBA 1ZT1B 4NOFA 4AEIL 4JO3L 1RZ8A 5F8RC 5I1CL 4FQJH 2XRAL 2BMKA 4BUGA 3S3JA 4F7MA 4WFED 3Q6GL 4KK6C 4APQA 1FAIL 3ZE2F 4UB0H 4OCRL 3IXTA 4EN3C 3MROA 3PHQA 3U82B 1N3NA 3D0LB 3CDYA 4AT6B 4BH8B 3HE6A 3LKNB 2R4RH 5C7XH 5AZ2H 3V79C 2E7HA 1FRGH 4WHTA 3NZ8B 2NY0D 5I18H 1I3RB 1YEIL 4GRWB 1RJZA 5D1XD 5DJAA 3D69A 2BSTA 4QHKJ 4G9FE 2WWMD 5E2VL 4FA8A 2NY4C 3IKCB 2OMBA 4OLXH 3H0TA 4U05A 3HR6A 1T1YB 1L9MA 1UCTA 4D3CL 1KGCE 4V1DB 5T33H 4D94A 1UADC 4BFBD 1ZLSL 5BW7A 2MPAL 3QUXA 5C71A 3QPQD 4FXGB 5EUOA 2EC9U 1CXKA 4OKVA 1P6AB 1AQKH 4P9ML 3SE3C 1I9RH 5HGHB 5DRXA 5KSAB 1TVDA 1F42A 5CEXA 5DWUL 4G42B 1RIHL 1RK0B 2CRZA 1RMFH 1UZ8A 4S10A 2B39A 2ATPB 5CILH 2ZJSL 1DBAL 4EJ1C 1UXSA 4GKOA 4JFFA 2HRPH 3SCMA 1KCUL 2YA0A 4NQVB 5IESH 2V5SA 4AG4L 1A9BA 3WUWA 1SYSA 2HMID 3OB0H 2Y7QB 4PG9A 5E2JA 1FNEB 1SJEA 4UDUA 5EU7C 4GQ9H 5T3ZL 3MLYL 2ZKHL 1IFHL 4M6OH 3AY4A 5JORA 3IJSA 1LWRA 1MEXH 2DL9A 4IM8A 3UTTE 4KQ3L 3QDMD 5D9SB 1MCPH 4MNHB 1AC0A 4RAVB 4X5WA 4QHKI 4ZS7L 1A0QL 1T22A 1KCSL 2JLLA 2EDXA 4JFDB 1C08B 4GRLD 5F88B 3SKJL 3OPZH 4F33A 1C12B 4OKVB 3KPSA 2YXFA 3BAEL 2HT2C 4ONFH 1BWMA 1E28A 3PIQB 4HH9B 3BMVA 5T5FL 1TMCB 1CFVL 5TDPA 4G6AD 3V6FA 3X14B 2DQEL 4BH8A 4ONFL 4FRWA 1RZKC 5DHYB 1PY9A 5DTFA 5ADOH 3TPUB 3G08B 2ZPKL 4QRUA 1JGUH 3DLQR 3ZSTA 4X6FA 3EO1B 1FG2A 3SKJH 2NLJA 1GOGA 1JGEA 4MA7H 4WIQA 4MJIB 2VMFA 1R3JA 3U46B 4GRLC 2V5RA 3IDUA 4X80L 3CSGA 3PQYB 4ZAKA 4KQ3H 4P49A 5DEZA 3ELAT 4PJ8A 5I6XC 2RQ8A 3SOBH 1IKFH 3OG4B 4GAJL 5L2JA 1G9MC 4WV1B 3RPIB 4UOW1 1DQJB 5MENB 5C6PB 4ELKB 1YNKH 4JFDD 3FQNA 2H32A 1E4XH 2D7OA 1QO3B 4K7PX 1WC7B 3MMEB 2P45B 4JQXC 3GGWB 3MV8E 1BOGB 3M1BA 1RMFL 4JE4B 4NCC1 4Z7OE 5DD1H 4P57A 2XOTA 1WCBB 3SDXB 5EO0A 1XT5A 1RK1B 1XEDA 2YZ8A 1JWSB 4O58H 4K9EC 2K1MA 3QIBA 3MBED 2WUBH 2GJZA 4Y16A 2QV2A 3W39A 3MLWL 1AO7E 3KPRE 2N7AA 2W92A 1KXVC 2R1YA 4XCYB 4DKEL 1DQML 4PJ5A 1BJ8A 5DK2B 5C3LD 2NTFA 1IZKA 3SOBL 4JY4B 5D2LE 3JVGA 4PIRF 5EO9A 2AERT 3QUZA 4X80H 5AZ2L 4P5MB 5C7XL 2VYRE 1CIDA 3WD5H 4P5TD 4RAVA 3QUYC 3PWJA 4YHIA 3ZYOA 3TO4B 2F8OA 3MV7A 3LMJL 4OCMC 2QEJA 2ERJB 4K7PL 3SGDH 3CFEB 5FGRA 1NCAH 1AIFB 4YZFE 5I30L 3WXVH 3RTQA 4QF1A 3O3EA 2ADJA 5ERWA 4LCWB 1JTPA 2AJVL 3QHFL 4RGMC 4L8DA 2BXYA 5HHPA 2RIKA 3CFIC 3DIFA 4BYHA 5C09A 3PWUA 1L7IH 2UYLA 3DXAD 1JTOA 1CXFA 5HD8C 5FA4B 5KSAC 2ITDB 4MD0A 4ZPTB 2VR9A 3RIAF 5GQBA 2PYEA 5JXEA 4WHTB 4DTGH 1T1ZA 4KJWC 4Z7WF 4ZFFA 4HCRA 5DD3H 2ADFL 3WEXA 3ZMRA 4JPKL 4Z7UE 4M6ML 4PLKC 3AGVA 2DWDA 2NY3C 3QXDB 4LPUA 3H9SB 1CICA 2LTQC 4RX4D 4M6OL 5IBUB 3OF6A 4DUWA 3QFJE 2I26N 2VLLB 4EN3B 1A47A 1T1XA 5IT2L 3H9HA 5CINH 3SQOH 5I0DA 3WDHA 2XN9A 3OJDB 3QO1B 5KVGH 4OD3H 3FRPG 3LQMA 4GKNB 3MFFA 5GSRB 4ODUB 2CXKA 4RAUA 2JJUA 3L5WA 3CK0H 3NCEB 1DBAH 5D93C 5C2UB 1I9JL 5GS1A 3KS0J 3TT1H 1SY6A 4XNYL 5GSVA 4BSWA 3CJJA 1GYAA 4XCNA 3H9YA 2HTLC 3TIDA 3O11A 1XIWD 2NMSA 3VWJA 3MLVL 1I9RL 5SWZA 1EMTL 3AVEA 5EU4B 3IU3B 5BZWA 3U2SB 5CEZL 5K59F 2GSGA 5CBEA 2X40A 1ZLSH 4F7CA 3EOAA 5IB4B 3QQ9D 3IFOB 4OM1L 3IDYB 2AW2A 2ITCB 2DI9A 3DARA 4EQ2A 2QR0A 2VITB 3EDFA 1XGPB 3GRWH 1JUFB 3QHZH 4OZIB 4TVPL 4XAKE 4R3SB 4BQCA 2VDLH 3HS0A 4HUWA 4PJHB 3SGEI 1NC4B 5EUOE 2EIZB 5EBWA 4JFDA 3FHQA 2OL3A 3BJ91 1G9EA 3QHTC 4GAYB 5JNYA 4WFEE 1FE8L 2K7QA 2NZ9C 2KPNA 1FYTA 2WWKO 1UQSB 3RY4A 4PB9L 4AK1A 4MYWB 3MREA 3KJ6H 4MZ3A 4DGYL 4NN6C 4E42B 5F9JA 4OCRH 3W9DB 3VMNA 4UBDC 3RAJH 3VXMB 2J6EA 2JF1A 4G8GB 5J6HA 4P2OD 3MZTA 1IGFH 4FQJL 4L4TD 5FO9B 3Q1SL 2IPTH 3GSXA 1HK6A 4C59B 1CGSH 2VR4A 3ARGA 3UP1A 1BJ1J 3V4VL 5J6GA 5HHMD 1A7OL 3K74B 2CLVB 4L1HA 1A1OB 4KZEL 4OD2B 1V05A 4WW2F 2XNAA 1FC1A 5CSGA 1B0GA 2W9DL 1JPST 2OTPA 4Z7UB 5B39G 3PUCA 4O51B 5D96C 3ARFC 2W38A 3VFPB 3KR3L 3H9SE 3ARSA 1KUMA 3SGJA 4XH2B 4PJXA 2H3NA 1RZJC 3MUGA 5I73C 2FGWH 1RUAH 3EYUL 5F9JB 4NWUH 1OTUC 3PXHA 4B50A 3IXAA 2AGJH 5IV2B 5DK2A 2YEZA 5CJOL 3IJYB 4Y4KA 3FAWA 4OZFA 3OL2A 2CUHA 5C0BE 3C6SA 4L3ED 4FMKA 1YQVL 4NSKA 5LXGH 1GC1H 2JJSC 1YEJH 3AFLA 5FKAA 4NNXA 3GIVB 4QGTA 3ES6B 1JUFA 1NCWL 1KJMA 1I8LA 1DANU 4WO4C 4OLZL 1W0WB 2G60H 2NY4D 1F4YH 1RZ8B 2EIZA 1RZIA 3QFJD 2EYSA 5D7KE 1NMAH 5FA3A 5GGUB 4LIQE 4V1DE 3D18A 1MCBA 4FXLA 1TNNA 1BAFH 4X7TA 3A0OA 4NJ9L 4UQ2A 2CUIA 4NBYB 3WFEH 5CJBA 3MJ7A 2FJHB 4BZ2L 1OTUD 1R0AL 5GSRA 1SVCP 5D2NE 4P9HC 2Y06H 1JYVA 3QDHA 4XVSH 3VFWA 1Q0XH 1SYVA 5EOCH 2D0GA 3AS0A 1NGZA 2R0KL 4C57C 2IAND 3LDBC 1PZUB 3IDMA 1MFEL 4O00A 1N59A 5IB5A 5GS2H 1BF8A 4CJ1A 3NFSH 5HHOA 3A6OA 5F9OL 1FNSH 3UYOD 1HHJB 2BNQA 3VXOA 1YC7A 5TF1L 1OGAD 4NKMB 2DBLH 4ZG1A 2VXVH 3MLRH 3IKKA 3IRPX 2G5BB 2E7BA 3UZQA 1KBGL 2YRLA 4UZGA 1YUHA 1LP9F 1VGKA 3MTRA 1KJMB 4JKKA 4XWGL 4KZDL 3RVUD 4XTRD 3G08A 4XBEH 4N5EC 3QNXB 5IB3A 1HHKA 4XMKL 1KIRA 5TFSL 3ZO0A 4JPVL 1YEDB 1HSAA 3QQ4B 4YDJB 4OF0A 4ZUWB 4NRZA 5C08E 2P5EB 2VXQL 5DC4B 4KROC 2VUOA 4HIXL 5IW1B 1HHIB 5DHVA 4AENA 2CKBB 1MQKL 3PQYE 3O0RL 15C8L 4E41D 1IAII 5GHWH 3QDMA 3DBXA 5DFVC 1A4KB 2W07A 4KDWA 4NQDE 3F7YA 2WLZA 4Y19E 4URTB 4YBQD 5SWQB 5F7EL 3QEUA 1JFQL 1A7QL 1E4KC 1YJDL 3GIZH 1F3JA 2OQJB 1AO7D 1CE6A 3G5VA 3O3BB 3RL2B 3RVWC 5LJYH 5AG8A 5CZVL 1YN6B 2VLRA 1UYWL 2CJUH 5FDWB 5DMJB 4DGIH 4JFQA 1A9BB 2VDMH 3WUWB 1ADQH 4DN3H 4EI5C 1DVFD 4J12A 2EO1A 4GG8A 4MNQD 4TN9A 4D2NA 1UVQB 5E9DA 3S4SA 5MI0C 4OUUA 2F54E 3ARFD 2AJ3A 3D2UB 3K8MA 2GY5A 2MHAA 2B5IC 5M7QA 3WLBA 1EJ6A 1J18A 4CJ0A 4KKAC 5J6HB 3NACL 1TCRB 2A73A 1TETL 2FATL 4HCRH 1F6AA 3NPZB 3TC9A 4B5EA 2VQ1B 5E99L 5I1DB 5IB5B 3MRLA 4MAYA 4XC3H 2E7CA 3FQXB 4G9DB 5BOPA 3SDDB 3PJSB 1CGUA 3C60C 1HINL 5JQHC 1V7NL 5E03A 3ULVH 4P4KC 2VXUH 1IEAB 1ZHKA 3LRGA 4B41A 1M05A 1DTUA 5CBAB 2FATH 1A6UH 3BZ4A 3IF1A 4K3GA 4Y5XA 4QXUL 2DMCA 4CW1B 5JHDB 1IL1A 2QLVB 4X6DA 3LY6A 4LLWA 4HHAB 1MH5A 4D0CA 2P8LA 1ZVSA 3P4OB 4RCAA 3C6LA 4KKAD 2IALA 1C7TA 4W68A 5A1AA 4NNXB 3DSFH 3V5DB 1UWGH 4MNGA 3MJ7B 2VL4A 2VDML 4OFKA 1NC2B 5EU5A 3CIQA 3MJ8A 2C5DC 2IC2A 3HAEH 1FO0L 1WIPA 5CCKH 3VD5A 3LN4B 2X4NA 5C2BL 4KI1A 3MBEC 4OBRA 3VXSA 4AL8L 3TH3T 1ZANL 3EZ8A 5KSUA 1A6ZB 2NZIA 4GW4B 3BUTA 1QPPA 1KTLB 3BO8A 1OPGH 5C0AE 4QOKA 4KDTA 6CGTA 5ESAA 1OHQA 3DECA 3HNTL 4QCIA 3GUTA 1AGFA 1B0RA 1QR4A 1R3IH 2VXQH 3MV8B 4R4ND 3RWDA 1FLTX 1CDUA 4OGZA 5EUOF 5DMGC 4PJ8D 1S5IL 4JO2L 4IRZL 1FV1A 3P0YL 1YYLL 1QSZA 3ARBA 5KOVC 2H32H 4L4VA 1TZHB 4BQ9A 1OW0C 5IVOA 3L6FA 3FO1A 4RGND 4XBEL 5FA4A 3SDYL 4PTTA 3PNWA 5HI3C 2E9WA 4UINH 5E6IB 3ZKXB 3OMZA 2VE6A 3BZEB 4IIQA 3O3EB 4I9WE 4M7JH 5ERWB 4O2FA 4H25A 3BP4B 2IH1A 4M7KH 3B6SB 1EEYB 5HGBB 1EHNA 1FNSL 4MVBC 3VDCA 1S7QB 4ELME 3IDJB 2VDRH 3SDXA 3W0WE 2BXZA 4POYA 1B9ZA 3BMWA 5T1MB 2BHYA 4ZS6C 5LGHH 3MOAL 5HDQL 1X5YA 4R90L 1SJXA 3EO0B 4MLSA 4R4BB 4MA1C 4LMQI 2XACC 3TJHC 1XF1A 4RX4A 2XWJB 1VFBA 3IRZA 2Q87A 5FOJA 1CGWA 5JUEH 1R24A 1T1WA 3H2WA 3BXNA 3T0EA 3ZT5A 5D70H 3MUJA 4S2SA 3SKUD 3BHBA 3V5KA 3S7GA 3NMEA 5GZOD 4M1GL 1AY1H 1YY9C 1DQLH 3L3JA 4OLZH 3JWDH 2ESVD 1NL0H 1F4XL 3RIFF 4KGLA 1CL7L 3BH9A 1G9MH 1RIVL 3CSYB 5DJYB 4JDZB 2NR6C 1YEJL 5GGSB 3HE7C 1A6VH 2VZ1A 3LQZA 1ZVSB 4OV5A 3T0EE 2ZOLA 5FYKU 1FCCA 2DQCH 1FIEA 1J88A 5KSUB 2OMNA 4ZMAT 5C0CA 2JJTA 4G6KL 4R3SA 3V9FA 4NZTL 2ZCHH 2H8PB 4DVBA 3HR5B 3KPRB 2HH0H 3ZHKA 3DOSA 3QJFA 5EOCJ 5JR1H 2FL5B 3PL6D 5KVFL 2XN9B 4XVTH 2WBJC 4I13B 3IDMB 3MRMA 4TQEH 3IDXH 4JRWA 4RMUA 1VPOL 5EZJA 4FTVB 3IT8D 1DQQB 1JGVL 5JDSB 4PBVC 5CJXA 3RUGE 2X1XR 1Y6NR 3C60B 4WI7A 3DX8A 2O5XH 1WJ3A 2EDRA 3FQTA 3ZE2E 5J1AA 1CDGA 2B20A 3MRHB 1KJ2A 5HYIA 4R0LA 2FZ3B 2PN5A 4WO4B 3ZE1E 2VN4A 4JZOA 4LGSB 3CXHK 3OKNB 4BZ1H 2HJKB 1FBIH 5JXAL 1AGEB 4OQTH 1QRKA 4HIHA 3RZCA 2XIDA 3L7EA 3QXTA 4R7DA 2VXTH 3G04A 5HVFB 2M1KA 2DTMH 4JFPA 1K4DB 2KQNA 2RGSA 3KLSA 4LVHB 4GG8B 1XGTA 4QKXB 5J9PA 3O4LD 3STLB 2V9QA 1B6DA 3MLUL 3UX9B 4XMPL 1UWXH 2AV7A 2YUZA 1P7KB 2IH3B 1OLLA 3HUJE 4OLEA 1Q9KA 5FGBA 3P73B 2VIRA 3K2UL 4JGMA 3VXME 5CZXD 3G6JE 2FCBA 4JB9L 3B3IB 3OAUH 5BQ7A 2YA1A 4YHZL 5T1DH 1S9YB 5E4EC 5SWZD 2AQ1A 3QA3B 1A4KA 1RZFH 5CSBA 5D7LB 4OAWA 1S7SA 4LEXH 3MUGB 3MRNB 5CIPH 4QYOA 4RMTA 3HC0B 4JAMB 3W5MA 5LGJA 3HAEA 8FABA 1QNZH 3BP6B 2PXYC 4OD2A 2LABA 4LVNB 2OL3H 4K3HA 3S9DB 4KKCC 3P11L 1ZGLP 1T04A 4YE4L 2UWEE 2YD3A 4KPHH 4NQCB 1YNLL 4MSWA 2F74B 5B39B 5JQ6H 4LARH 2DQIL 2PXYB 1HKLL 4H0HB 5EU7E 5LQBH 2DBJA 5EZLA 3D0VB 1GZPB 3QPQC 1QBML 3H8NA 4MNQB 1IEHA 1AI1L 4X7FC 3RWFA 3MRCA 3V52L 1NAKL 1A7NL 3FJTA 4XAKD 3QJHA 4CVXB 3P9MA 5I16A 1AP2A 5BQ7B 2EICA 2V2WA 5IBLD 1GGBL 3MJ9L 3CK0L 3W9DA 3QA3A 4ZTPL 3C60A 1JZ3A 4YPGA 1MJ7H 3HG1B 3Q3GA 4JFXA 3U36A 4M3JA 3SKNA 1RZKH 4KQ4H 5IB1A 3S6CA 5JOPE 1I1AA 1JNNH 4IS6B 1EEQA 5C8JB 3PGFH 3U0WL 1FQ9C 5E2WH 5IVXB 5IKCB 2MQ0A 3D6GA 1MFBH 4JFPB 4XVJH 2DQUH 3RJDA 3H42L 1G7MB 1GGIL 4ZFOB 4FHBD 4GXUN 3RVUC 1PLGH 2AJXL 4JY5L 2MQ3A 1MCNA 4POUB 4UILH 2FEDD 4NQED 4YZFF 1SY6L 4WFGD 4D9LH 4E9LA 5T3XL 3W11D 1OGAA 5DFTA 5DJYA 4ELKA 1FVDB 4HMCA 4NGHL 3BPCB 4ZXBA 4G6FD 1OAZH 1XFPA 2IAMC 3SE9L 5IROC 2F15A 1Q94B 2AJVH 3LD8C 4GSDL 5EU6A 4LVEA 3WXVL 4FTVA 4JHWL 1NFDB 2ARJA 2ICES 3RY5A 4K7PH 1N64L 4KFZC 4LRIC 5MP6L 5TQ0H 1P2CA 1A7PH 1BBJA 5IWLA 3RWCA 1V8HA 2YHGA 1C5DA 1FYHB 4ZFOL 2NPLX 5SX5K 1N6QH 4TULH 2XWBB 4Z7VE 2ZP0T 4G5ZH 5TDPB 4MQ7B 5I74C 5BV7L 4H20L 5HVWA 2SEBA 3SDDA 1CG9A 3VXQB 1ZLWK 3GIVA 3JTTA 1J1PL 2H6PA 2P5WB 4PV9B 1FLRH 1T2QH 5SX4I 3MBXH 3OJ2C 2FNBA 3B9EA 1I7TA 2P5ED 2A6DA 5IFAL 2OR9L 1MCDA 2NTSP 4NNPH 2L4OA 3LVEA 4MDIB 5KSVA 4PGCA 4UTBL 1FGVH 1ZAGA 1H3TA 2LU3A 5GRYA 3KHOA 1MHCB 4WTWA 1NEUA 1JI1A 1B4JL 2ZUXA 4MMZC 4NQDB 1ZLUK 2OZ4H 5CGYD 5JHLL 3WL9A 1MELA 2GJJA 1MWAA 1EAJA 3ARYA 3F8UB 3SDXE 1NGXB 5DJ8A 5SWSD 3IDJA 2V5MA 4G6JH 5E9DD 3QNZB 2WIIB 2XFXA 3SJVB 4F9PC 5MEQA 4EOWL 2DS4A 5I66B 4WTZG 3U30C 3VXUD 4NUGH 4OCNC 1J05A 3D85D 2IANE 4XRCA 5DA0B 3MYZA 4Z5RA 1BM3H 3HG1E 1J86A 1NFDE 2LQRA 5DUBB 1RJLB 3QDGA 3OJMB 4HD9A 1U8IA 4QHMB 1EEZA 3TIEB 2FX7H 3S36H 1H5BB 1A2YA 5MEOB 5L8KB 2Q6WB 1EDQA 1HSAB 2DIAA 5KVEH 4Y88A 4V1DA 3MC0A 4PB0H 1J10A 1YPZF 1LE5B 5A16A 2EDHA 2DL2A 1NGQH 4Y1AB 1BIIA 3IDIB 2ENSA 4JRXD 2QQKL 2Q8BH 2ZPKH 1QEWA 1LO4L 1QG3A 4ZO7A 2ICCA 3Q5OA 2AXGB 1HH9A 4PRHD 3OZ9L 2BMKB 4X6DB 2PCPA 5C0AB 1T0PB 4NM4H 5GGTL 4K3JH 2FDBP 1ADQA 4L3EB 4NQUA 1KEGL 3U6RA 3I6LE 1ETZA 1BVLB 3LPGA 3P4NA 4UT6H 3L3HA 3ZDZF 3LKQA 4A6YB 3FRPA 5F9AC 3R0MA 5DEGA 1ZSDB 3HE6B 3OPZL 3E0GA 4UV7L 2EYRA 3AM8A 5DMGD 1KCSH 2GFBB 3STZB 1NGWA 2YSSB 1MCPL 5L2KB 1DBJL 1D5ZB 5BZDA 5K9QI 2VDKL 3MV7E 1MEXL 1JPTL 1K6QL 2CUMA 5EORH 4K94L 4PJ5D 4KU1A 3O6ML 3UBXA 4QWWD 1V7MH 2DYPD 2YOCA 1IFHH 3T2NL 3K4DA 5D1ZA 3LKRA 3KYAA 2HLFD 4P4KB 1JRHH 4JZNA 2IBZX 3PHSA 1KELH 4OZHA 4F7TA 2QQQA 4A2MA 5E6ZA 4K7FA 4R8WL 2R4SH 2MQCA 1KIUA 3RI5F 1GVIA 3BH9B 4RA0C 3MLXL 2UZIL 3V4PH 4F57H 3PJSA 2EKJA 4ODSH 3BX7C 3I6KA 5DMKB 3OX8A 3QIBC 4KUZH 1F45A 4P9MH 4GRMA 3LKQB 1VFOA 5GISH 1P9MC 4A6YA 4WUUA 4JHBA 1MUJA 5HYJD 5F9WC 5C07B 3L3OB 3QCUH 4L5FH 4Y4HB 3EFFA 1J8HD 3QCVH 2GYSA 1F4WL 1U92A 1FVCA 1ONQA 3G9VA 1QBAA 2OTUA 3T8XB 2J12B 1OGTA 1TTGA 1SHMA 4Z7QE 4PRPA 1P5UA 4KHXL 3CSBA 2YK1H 3R1GL 2XNAB 3AUVA 1SEBA 2XTJD 3LZFH 3RUGB 1HXMB 1ZT4B 4M43L 2YPVH 4EDXA 1KB9K 3QFDA 3VGGA 1S9XA 3KPOA 1NBYA 1YMMD 2Q6WA 4JO4L 4NN7C 2OSLB 3CU1A 4O2CB 2ZWLT 3BPNC 4HK3J 2MMXA 2BP3A 1UXSB 2IFFL 4QHUA 1JV5B 4P59H 1G6RB 1WV7T 4PJBF 3HZVA 5E8DL 1RSFA 2WBJD 3IFLH 1OD9A 5BRZE 5I1CH 4AEIH 2ZCKH 5AUMA 1N6VA 2BJMH 1QVOA 3ESVF 4K23L 3TT3H 1MUJB 2VLJD 3MREB 5HGHA 5DRXB 4S1QH 2JELH 1XR9A 1UZ6F 5D6CA 2PUQT 3HE7D 3I3DA 1FZMB 5D7IA 4C58B 3ILPB 4JGUA 4HLZH 5DSCB 2AK1L 1ZS8A 4YHLH 5I2IB 3PL6A 2EIEA 3UTSE 3Q0HA 1VEPA 3MOBH 2ZCLL 4PRIB 3D69B 4HULB 2K7PA 3REVB 2R29H 3P2TA 4U1LB 3PL6C 3BEWB 5T1KD 3JWOL 4LU5L 3UXFA 2I60H 2ADIB 4OUOA 5F1NB 2W0PA 4U6XA 1U8KA 3MRIB 2H1PH 3DXAE 1V3LA 4H0GA 5D7SH 2BFVH 1K85A 1JNHB 3NA4A 3VXNA 5IQ9B 1MCLA 5C09E 4NKIH 5DTFB 5IFHH 2X4QB 3KPMA 1FL6B 1I7UB 3FQWA 3EJYD 4PTUA 5HJ3B 2NX5B 2FHFA 4FP8L 5FKPA 5FO7B 5INDB 5E7FA 4JVUA 1RUKL 4ZDHA 5JW4N 2BVEA 2UZXB 1YEHH 3EIFA 3NFPA 1JBJA 3U1SL 3EYSH 4CRPA 5MENE 5B8CC 3VWJC 2AKRA 2AXGA 1HH9B 3S3SA 3C5ZB 4WVRA 5GGVH 2NY5L 2ATKB 3E3QC 4HS6B 4CU6A 3HPJA 1Q72L 1JF1B 1LEKB 4G3YH 3TPUA 4LPTA 5DRZB 4M03A 5IVXE 2CPCA 2D3VA 5DJCA 3V4UH 1MLBB 4R4FH 2AVGA 3JBG7 1Q9LB 4HIEA 1YECH 3DURA 2XKNB 3WLWD 1JGDA 3MV9A 4OF7A 1N26A 3CMOL 3RVVD 4KWUA 5FO8A 1J8HB 2UVFA 3QQ3B 4WCYL 4DCQA 4QTHB 4LCYB 4ONHB 4MB4A 4LCWA 1GZQA 4U7SA 4HXAL 3ET9F 3S35H 4M6NL 2AV1A 1T22B 4EI6A 4ZUSA 2EDYA 5I19H 3HG1A 2Z92A 4HKJB 1FFOB 3QAZC 4G8EB 5F72S 3IFNH 3S88H 4FQQB 5ALBH 4FQIL 4P4RB 5TDOB 3VJ6B 1WZLA 3GI9L 4Z7NF 1J8KA 1DQDH 3LRHA 3LCYA 4LSQH 4ZNEA 2FJGA 3QUZB 3EDJA 2ADGA 1ULVA 2IF7A 2QKIA 3FT3B 3RWJB 1S78D 3NIDF 3T1FA 4TOYH 2P47B 2IGFH 3QUZD 5BRZD 4LSRL 5IBLC 1KJ3L 4R2GC 2OSLA 5IMKA 4M7LH 5DI8B 2BCKB 5CSZB 4PJ5B 2R2HB 4IRSD 1E4WL 2VIRB 1KG0A 1YPZE 1CU4H 1F02I 2APVA 1UC6A 4MNQE 4JDTL 4HJJL 3DV4A 4M1CD 4U1NA 2QTEA 1I7ZA 1TJIH 3C8KA 1DLFH 2FB4L 1JPSH 4JFFE 2AI0L 1DQDL 4ZXBD 1A7RL 3BRFA 4RFOL 2AKRB 1CFNA 2FYYB 4XPHH 3RWCB 1I8LC 4ODVH 2F8XC 5EPMB 2DKSA 4UNVA 3T0DA 4L4TB 3FB8B 5HHVH 2R1WA 4FTVD 1TVBA 4OV6F 1JMXA 4L1DA 4YXHL 5L2KA 4ZAKC 2BRRH 4PJ9B 1DSFL 4KKLC 3ROOA 1FIGH 3QDME 3O8XB 1I1YB 2GSGB 4TVPE 4N9OB 4FZ8H 4YBLB 3GBNL 3PP3K 3DO7B 3PV7A 3WHE0 4PS4L 5F97E 2OR8A 1WQVT 2ADIA 5F7KC 4WY7H 3FN9A 1K2DB 2F19H 3HI1A 3BP7A 2C3GA 4G3YL 1ZK9A 3X12A 1QSEE 4UAOC 2KH2B 4YR6B 3U9PL 4NP4L 2DQDL 1RUQL 4JN1L 2XN9D 3TVMC 1CK0H 2PNDA 2HT4C 4PJDE 4IS6A 2EDTA 3FL7A 5JHDE 3K1KC 3VWJD 4CNIB 3WSQH 4X4MA 2NY3B 3U1SH 3I50L 1Q1JL 3IB4A 4UIKH 5LGKA 3PIQA 5I73B 1QKZL 1ZLWH 3B9DA 4XCFH 2UUDH 3QNYB 5D7JC 5I1LA 1Z3GL 2A77L 1J11A 1YEHL 4H88L 4YDLC 3EFDL 4XC1H 5FV2A 2JB6A 1PKQE 4RRPA 5T3XE 2FR4B 4PPTA 4PFEA 2QQNL 3D85A 4PJBB 3EJYC 3HZKB 4TTDD 4Y1AE 4HAFA 4YJZL 4HS3B 3QFJB 4X6CE 3IDGA 2GK2A 5GS0D 2JJVA 2EC9T 3LQAH 1UA6L 3DXAB 2DIJA 3W81A 3KPOB 4AY0A 2BY1A 4ZOBA 5IG7B 3W2DH 1LE5A 3MCLH 3FN0L 2IQ9L 3KYNA 3L5XH 1EHLH 2E7MA 3BWUC 5KANI 2BCKA 1AE6H 3FQUA 3QUYB 4G7YL 3IAGC