4YFPA

Crystal structure of the r111k:y134f:t54v:r132q:p39y:r59y mutant of human cellular retinoic acid binding protein ii with retinal after 20 minutes incubation at 1.95 angstrom resolution-kinetic product
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
137
structure length
137
Chain Sequence
PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A Photoisomerizing Rhodopsin Mimic Observed at Atomic Resolution.
pubmed doi rcsb
molecule keywords Cellular retinoic acid-binding protein 2
molecule tags Transport protein
source organism Homo sapiens
total genus 36
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4yfpA00
2NNQA 1KQXA 1DZMA 1T8VA 1TOWA 2A0AA 3FA7A 3P6CA 4R0BA 4ALOA 1RLBE 4UU2A 1GT5A 4GKCA 1ADLA 4A1YA 5C0NA 1JJXA 1T68X 3TGBA 3ZQ3A 1KT7A 4OMXA 2FS7A 3VG2A 2R56A 4QAEA 1BLRA 3G7XA 1SY1A 3BSZE 2LBVA 1LFOA 3CWKA 4WBKA 2KTDA 4OS3A 2AT3X 4K19A 2OZQA 2W2AA 1BSOA 3U9PC 4BOEA 2L67A 2EU7X 5EPQA 4GRJA 1QY1A 2JU8A 1O8VA 2FR2A 1FTPA 5L8NA 5EDCA 3L4RA 1ERBA 1SY0A 4AW8A 2OVEA 1OBUA 2G79A 3QKGA 3S26A 3RZYA 4XMHA 4HPBA 2NNEA 3MBTA 1ML7A 3CMPA 1KXOA 2AT8X 3WVMA 3K3LA 2AH7X 4A8ZA 3CQRA 3B2LA 1LKEA 5HCCC 1T0VA 2FLJA 3NADA 3Q6LA 1UZ2X 1TOUA 3NQ9A 4HPCA 2CZTA 3O19A 3ZUOA 3WJGA 4I9SA 1JBHA 1ZRYA 4QGVA 2FT9A 3P6DA 1SY2A 4XMCA 3D96A 4ZH6A 2PY1A 3KQ0A 4ZH9A 2AT0X 1QFVA 4BVMA 2X46A 1QWDA 4TKHA 4ORXA 2RCTA 2ALLX 1GX8A 2CBSA 4NLJA 4Y0QA 2XKLA 3WJEA 3UEXA 1EW3A 1MX7A 1G85A 5EEDA 1FELA 3I17A 3FA8A 5DPQA 1KOIA 2L68A 4AZOA 4YGZA 1X71A 1CBIA 1H91A 3BX7A 2QO6A 3KFHA 2LBAA 2Q9SA 1B0OA 4UU3A 3FIQA 1DZKA 4ZHGA 4MVLA 1A3YA 4YFQA 1PEEA 1G7NA 5L8IA 1BBPA 4ES7A 4ZHDA 3OJYC 1BSQA 1YWBA 5CE4A 3PH6A 4RUNA 5EEEA 4YKMA 3KZAA 1B4MA 4TJZA 2QO4A 5BVTA 4NNTA 4ORWA 1A57A 3WJFA 3KFFA 1GKAA 3RSWA 1HMRA 4AZPA 1IIUA 2CBRA 5EDBA 1GT1A 5K06A 4IMOA 2E4JA 2FR3A 1S2PA 4NLIA 1XCAA 1CRBA 1QFTA 1GGLA 2HZRA 4IB9A 4YKOA 4N7CA 3PPTA 1GXAA 2A13A 3IA8A 4GH7A 1TXLA 4EXZA 1LF7A 2Q39A 1YWDA 2QOSC 3JS1A 3VG3A 1S44A 5DG4A 2G7BA 1OPAA 1GT4A 3APUA 3B2HA 1HN2A 4ZJ0A 3FW5A 5HCEC 2FTBA 1IKJA 3PH5A 3B2IA 3VG6A 2K62A 2RA6A 3SAOA 5LJGA 1DFVA 1I06A 1X8NA 1E00A 1U17A 1I05A 3T1DA 5HZ9A 4AYHA 1ZNLA 1FDQA 1JV4A 1BJ7A 4IB7A 3KFGA 4OS8A 1CBSA 2ACOA 2HYSA 3AKMA 3NQ3A 1IFBA 2ASNX 1ALBA 3HWDA 1SA8A 2GC9A 3PP6A 4HFOA 4I3CA 4YH0A 2NNDA 1CBQA 1LIBA 1FE3A 1JJJA 1KT5A 4CK4A 4ORRA 3UEVA 1LIEA 4XMFA 4A60A 1D3SA 4GE1A 4IAWA 3FLLA 3FENA 3CQNA 3UEUA 3KFIA 4GETA 4GNWA 2QO5A 2O62A 5HTDA 3FEKA 3F8AA 3JSQA 4D6AA 3DTQA 1EPAA 1SXUA 4Y0RA 2NP1A 1BRQA 1LPJA 3TZSA 1NP4A 4BQUA 1QG5A 3HWEA 1AB0A 3STNA 2R73A 5H9LA 2OFRX 1PM1X 1BSYA 3EBKA 4PSQA 3STKA 1KQWA 1QY2A 2WR6A 2AL0X 2OFMX 1BRPA 4YCHA 3VG5A 1D2UA 3BDRA 2WWPA 1A2DA 1L6MA 4MVIA 5L8OA 1AELA 2AT6X 1ZNKA 1IW2A 4IB6A 3FEPA 3HK1A 2MO5A 1OEKA 3VG4A 5HBSA 1HBPA 1KZWA 4NYQA 2P8GA 2W2FA 5IO7A 3STMX 5IO6A 2JU7A 4Y0PA 2WQAE 4OMWA 1SXXA 5HZ6A 1P6PA 3GAQA 2N93A 4YGGA 3BLGA 1LICA 3MVFA 1B8EA 4A1HA 2QM9A 5LJDA 5BVQA 5AQ6A 1LIFA 1EIIA 2Q2MA 1SXYA 3NX2A 1XKIA 3TGAA 1S7DA 5HCDC 1DC9A 2Q4NA 5LJEA 1YWCA 4HPAA 4AZMA 1Z24A 4RUUA 1KT3A 3I0AA 1R0UA 1O1VA 1AVGI 5LKEA 5EZ2A 1DV9A 1E5PA 1EUOA 3EBWA 2WEXA 2A3FX 5LJKA 1PMPA 5JR8A 1EIOA 3NP1A 5H9NA 1YIVA 4YDAA 3P6FA 1GM6A 3APWA 1I4UA 1YP6A 5F1EA 1OEJA 3HWFA 4IB8A 4MVKA 1VPRA 1A18A 5LJHA 1OEEA 3VG7A 3U03A 2X45A 4NYRA 5FFHA 1OPBA 4O9SA 5D47A 3EYCA 1QQSA 3BU1A 4I9RA 1ZNGA 3C76X 1ZNHA 1NGLA 1IFCA 4QZTA 2LKKA 2YG2A 2JU3A 5HA0A 4DQ3A 3FELA 4IAXA 3FR4A 2RD7C 1HBQA 3PEDA 4QZUA 2HZQA 5H9KA 4KIIA 3WBGA 1FENA 3ZUIA 4ZCBA 2RCQA 1E06A 1EXSA 1EQDA 3FA9A 2HNXA 1OBQA 4NP1A 1DZJA 5H9AA 2MJIA 3ELXA 1ICMA 3CBSA 2F73A 1G74A 4WFVA 5HA1A 2R74A 1ICNA 1VYFA 1LNMA 3EM0A 2GJ5A 3D95A 2LB6A 3FR2A 1N0SA 1G5WA 3BS2A 4LZUA 5D4AA 2AT5X 1X8PA 2BLGA 1I04A 3AKNA 4QYNA 5FENA 4TQ2A 4HPDA 5D8JA 1CBRA 5FAZA 3APXA 1DZPA 1HQPA 3NR3A 4I3BA 1ACDA 4QYPA 5B27A 4YMYA 1KT4A 2HMBA 3CR6A 2GTFX 3TGCA 1QY0A 2ANSA 1ZNDA 1BEBA 4AZRA 4EFGA 1QABE 4AZNA 2G78A 2DM5A 4ORUA 2AKQA 5BVSA 2FRSA 1E02A 1ERXA 2WSJA 1B56A 3APVA 2CZUA 1MVGA 4IBAA 1ZNEA 4ZR2A 1TVQA 4Y0SA 3FW4A 1HMTA 1LIDA 2JOZA 3FA6A 1SXWA 3O22A 4YBUA 4ARHA 5HZQA 1EALA 1NP1A 4GNYA 2Q2PA 4XMGA 2POAA 3TF6A 1MUPA 4EDEA 3CBCA 3IFBA 3ELZA 5HWZA 1OBPA 2AMMX 1HMSA 4NNSA 3WJBA 5LKFA 1PBOA 2L9CA 4ZHCA 1U0XA 4YFRA 1UREA 5F6BA 1SY3A 4M6SA 2A2GA 2CM9A 5HZ8A 3B2JA 2XSTA 1JYDA 4TKBA 1KZXA 1TW4A 2W2BA 3FMZA 4N7DA 3WXQA 3HWGA 5H8TA 5LJBA 4YGHA 4DQ4A 2A2UA 2OVAA 1YUPA 4ZFXA 1EPBA 1KT6A 1X8UA 3BY0A 4ORYA 2K23A 2MM3A 3DSZA 1RBPA 2JN3A 3BU9A 1GX9A 1YWAA 1MDCA 4IMNA 4TLJA 4QGWA 4TKJA 5F58A 2HLVA 2WQ9A 4QGXA 2RQ0A 5HTEA 2FWVA 3FR5A 1VYGA 4XMDA 3WJCA 5KHPA 5D48A 1AQBA 2IFBA 5KICA 2LFOA 3PECA 3NPOA 4YCEA 4OS0A 4LKPA 4I3DA 3C77X 3NX1A 5HZ5A 5F6ZA 1CJ5A 1MX8A 1U18A 3O2YA 2CM4A 5D45A 1YP7A 4ODDA 1X8OA 3C78X 4AZQA 1KGLA 3U0DA 3P6EA 4D6BA 4WFUA 4M7MA 4XMEA 4TNNA 3BRNA 1X8QA 2WEWA 2OVDA 1GT3A 4YDBA 5F7GA 5IO5A 1O1UA 1BM5A 5HAEA 4YFPA 5LJCA 4ZGUA 2L5PA 3D97A 4ZHHA 1JYJA 3BX8A 1DF3A 1IKEA 1JZUA 1X89A 4YBPA 1GKAB 4EEJA 4LZVA 1BWYA 3B2KA 3F9DA 2KT4B 3P6GA 3UEWA 4ALBA 3EMMA 5KIDA 3P6HA 4ZHFA 5B29A 1FEMA 4ORSA 2WUTA 4LKTA 3WJDA 2FS6A 2ACPX
chains in the Genus database with same CATH superfamily
2IZEB 1SWSA 2NNQA 1KQXA 2FKJA 1DZMA 1SWEA 1T8VA 3OBLA 4AW8A 1TOWA 1SWRA 2OY1O 3ZZVA 2A0AA 2FHLA 3FA7A 1Y52X 1RAVA 3P6CA 4R0BA 3Q34A 1RLBE 4UU2A 4ALOA 1GT5A 2X34A 1ADLA 1NBXA 4GKCA 4A1YA 5C0NA 1JJXA 1T68X 2RTGB 3TGBA 5IRAA 3ZW2A 4Z2VA 1SWBA 1KT7A 2JMBA 3ZQ3A 3P24A 2AF5A 4OMXA 2FS7A 3VG2A 2R56A 4QAEA 1BLRA 3G7XA 1RXKA 1SWFA 1SY1A 3BSZE 2LBVA 1LFOA 3CWKA 3RDOA 4WBKA 3RY1A 2KTDA 4OS3A 4BX6A 2AT3X 4GJSA 4K19A 2OZQA 2W2AA 1BSOA 3U9PC 4BOEA 2L67A 4C5PA 2EU7X 3WYQA 5EPQA 4GRJA 1QY1A 2JU8A 1O8VA 1SMPI 2FR2A 1FTPA 4GUZA 5L8NA 5EDCA 3L4RA 1ERBA 1SY0A 1VWGB 2OVEA 1OBUA 4KT5A 2G79A 2FGSA 2A5CA 3QKGA 1MEPA 3S26A 3RZYA 4XMHA 3SZJA 2I5ZO 4CPHA 1SRIA 4HPBA 2NNEA 1Y55X 3MBTA 2C4IA 1ML7A 3F6ZB 3CMPA 3EW2A 1KXOA 2AT8X 3WVMA 3K3LA 2AH7X 4A8ZA 3CQRA 3B2LA 1LKEA 5HCCC 1T0VA 2FLJA 3LHNA 3PDFA 3AUMO 3NADA 3ZW0A 5K67A 3Q6LA 1UZ2X 1TOUA 3NQ9A 4Z2PA 4HPCA 1RSTB 2CZTA 3O19A 3ZUOA 3WJGA 4I9SA 1JBHA 1ZRYA 4KC7A 4QGVA 1SWUA 2FT9A 3P6DA 1SY2A 4XMCA 3D96A 1VWAB 4ZH6A 2PY1A 3KQ0A 4ZH9A 2AT0X 1QFVA 4BVMA 2X46A 1QWDA 2UZ2A 4TKHA 4ORXA 2RCTA 2ALLX 1GX8A 1SRGA 4HWMA 2CBSA 4ZGFA 1SRHA 2RTPB 4NLJA 4Y0QA 2IZDB 2XKLA 3WJEA 3GE2A 3UEXA 1EW3A 1MX7A 1G85A 5EEDA 3SOTA 1SWOA 1FELA 3I17A 3FA8A 5DPQA 1KOIA 2L68A 4AZOA 4YGZA 1X71A 4CPHB 4EQAC 1CBIA 1H91A 2GTLM 2QO6A 3BX7A 3KFHA 2LBAA 4FBOA 2Q9SA 1B0OA 4UU3A 3VPJE 3FIQA 1DZKA 4ZHGA 2RN4A 1A3YA 1SWDA 4MVLA 1G7NA 4O3WA 4YFQA 5L8IA 1PEEA 1BBPA 4I3CA 2AVIA 3T6LA 3UAQA 4CSBA 4EKVA 4ES7A 3OJYC 1BSQA 4I6SA 4Z6JA 3ZW0B 4ZHDA 1YWBA 3WOVA 1W6FA 4KCAA 5CE4A 3PH6A 4RUNA 3MM0A 4YKMA 5EEEA 3KZAA 1B4MA 4TJZA 2QO4A 5BVTA 5JD2A 2RTCB 4NNTA 4ORWA 1A57A 3WJFA 3KFFA 5FQ6E 3ZW1A 1GKAA 3RSWA 2OFAA 2M4LA 1HMRA 1N9MA 4AZPA 1IIUA 1AVEA 2CBRA 5EDBA 1Y53X 1GT1A 5K06A 3TGCA 4IMOA 2Z4HA 2E4JA 2FR3A 1S2PA 4NLIA 1XCAA 1CRBA 1QFTA 1GGLA 1SWJA 2HZRA 4GU8A 4IB9A 3PPTA 4N7CA 1GXAA 2A13A 3IA8A 4GH7A 1TXLA 1K3BA 2G5LA 5IRUA 4EXZA 3WZPA 1LF7A 2Q39A 2X8FA 1RXHA 1YWDA 1SWTA 2QOSC 1SRJA 3JS1A 2A8GA 1S44A 2QOMA 4MIRA 5DG4A 3VG3A 1OPAA 1GT4A 2G7BA 2RTAA 3APUA 3B2HA 1HN2A 4ZJ0A 3FW5A 5HCEC 2OL6O 1VWJB 1E2TA 1IKJA 2FTBA 3PH5A 3B2IA 3RKGA 3VG6A 2K62A 2RA6A 3SAOA 4JHQA 5LJGA 1DFVA 1I06A 1X8NA 1E00A 1U17A 4FBVA 4JNJA 3WZQA 1I05A 3T1DA 3NBXX 4Z2OA 5HZ9A 4AYHA 1ZNLA 3WZOA 1FDQA 1JV4A 1BJ7A 4IB7A 4PJ2A 1VWHB 3KFGA 2GTLO 5F2BA 4OS8A 1CBSA 1HQQA 2ACOA 2HYSA 2MF6A 1IFBA 2ASNX 1ALBA 3AKMA 1SA8A 2GC9A 2RTDB 3HWDA 3PQUA 4FGIB 2NNDA 1CBQA 1LIBA 1FE3A 3LTWA 2RTEB 3OD9A 4OELA 3SLJA 1KT5A 1JJJA 2IZAA 4CK4A 4ORRA 3UEVA 1LIEA 4XMFA 4A60A 1D3SA 4GE1A 4IAWA 3FLLA 1SLEB 3FENA 1I9HA 3CQNA 5AEOA 3UEUA 3KFIA 4GGRA 1PBYA 4GETA 2QO5A 4GNWA 2O62A 5HTDA 3FEKA 3F8AA 3JSQA 3X00A 4D6AA 3DTQA 3RDMA 3VGWA 4INNA 1EPAA 1SXUA 3JQOA 4Y0RA 3WZNA 2NP1A 1NC9A 2DJFA 2Y3FA 1BRQA 1LPJA 3S5VA 3TZSA 1NP4A 5B10O 4BQUA 1QG5A 3HWEA 1AB0A 3STNA 1VWBB 2R73A 5H9LA 2OFRX 4ML7B 1PM1X 4DNEA 1BSYA 3EBKA 4PSQA 3STKA 1VWEB 3ZI8A 1KQWA 1QY2A 2WR6A 2AL0X 4IABA 2OFMX 3RBYA 1BRPA 3KVNA 1VYOA 3T2WA 1MOYA 4YCHA 3VG5A 1D2UA 1SLFB 3BDRA 1LCVA 5B3MO 2WWPA 1A2DA 1L6MA 1UYNX 4CDFA 4MVIA 5L8OA 1AELA 2OF8A 2AT6X 1ZNKA 1KL5A 3VU1A 1IW2A 1SWQA 4JO6A 4IB6A 3FEPA 3HK1A 4NV7A 5FQ8E 2MO5A 1OEKA 2ZSCA 5HBSA 1HBPA 3VG4A 4NYQA 2P8GA 2IZFB 2W2FA 1NDJA 3STMX 5IO7A 5IO6A 1KZWA 2JU7A 4Y0PA 2WQAE 4OMWA 1SXXA 5HZ6A 5CHKA 1P6PA 3NQKA 3GAQA 3P02A 2N93A 2UYWA 4U46A 1VWCB 3BLGA 1SWHA 4O49A 1LICA 4YGGA 2YMSA 3OE3A 3MVFA 4L3RA 1B8EA 4A1HA 5CSEA 2QM9A 5LJDA 5BVQA 5AQ6A 5B2AO 1STRB 1LIFA 1N43A 1EIIA 2Q2MA 2C1QA 3FYFA 4GD9A 1JIWI 1SXYA 3NX2A 5CYBA 3T2XA 1XKIA 3PK2A 2ZAIA 4CDEA 4U8UN 1VWNB 2KW1A 3TGAA 1WUBA 5FQ7E 1LDOA 1S7DA 5HCDC 1DC9A 3EC5A 2Q4NA 2BC3A 4FBRA 5LJEA 1YWCA 2BS5A 2RTIB 4HPAA 5L3YA 4AZMA 4OKAA 1Z24A 3AEHA 4RUUA 1KT3A 4YH0A 3I0AA 1R0UA 1O1VA 1AVGI 5LKEA 1PTSA 4FQBB 4Z28A 5EZ2A 1W4TA 1DV9A 4GDAA 1E5PA 1EUOA 3CKGA 3EBWA 2WEXA 2A3FX 2C1SA 5LJKA 1PMPA 1VWLB 1N4JA 4O3ZA 1K24A 5JR8A 1STPA 1EIOA 4JGLA 4KH8A 3NP1A 2RTOB 5H9NA 1YIVA 4YDAA 3P6FA 1I78A 1GM6A 3APWA 1I4UA 4L1NA 1YP6A 5F1EA 1OEJA 3VHIA 2RTLA 4Y59A 2OY8A 3HWFA 2RTKA 4IB8A 4MVKA 4B55A 2QMIA 2BT9A 4GDZA 1VPRA 1A18A 1GX3A 5AJBA 3S5XA 2DJGA 1SLGB 5LJHA 2X4MA 1LCZA 1OEEA 3VG7A 3U03A 2X45A 4NYRA 4I60A 5FFHA 1OPBA 2OF9A 4O9SA 2Y3EA 5D47A 3EYCA 1QQSA 3BU1A 4I9RA 5IRWA 1ZNGA 3C76X 3FIDA 4MEEA 4QQ1A 4GGZA 1JJUA 1VWOB 1ZNHA 2OL8O 1NGLA 1IFCA 4QZTA 2JGSA 2LKKA 2YG2A 2JU3A 5HA0A 4DCBA 4DQ3A 3FELA 4IAXA 3FR4A 4CDDA 2RD7C 2IZLB 1HBQA 3LV4A 3PEDA 2HZQA 4QZUA 5H9KA 3S60A 4BJ8A 4KIIA 3WBGA 1FENA 4WHIA 3ZUIA 4CPEA 4ZCBA 1E06A 1EXSA 2RCQA 1EQDA 3FA9A 2HNXA 1OBQA 2G8CO 4NP1A 4QRLA 1VWMB 1FJ1E 1VWQB 3VHHA 4BGFA 3N91A 1DZJA 1W5RA 5H9AA 2MJIA 4O4UA 3ELXA 1ICMA 4NV8A 3CBSA 2F73A 1G74A 4WFVA 5HA1A 1HXZA 1ICNA 2R74A 1SRFA 1VYFA 1LNMA 2IZKA 3EM0A 2GJ5A 3D95A 2LB6A 4BX7B 3FR2A 1N0SA 2RTHB 1G5WA 2RTFB 3BS2A 2F09A 1LUQA 4LZUA 5D4AA 1JQPA 1X8PA 2AT5X 2BLGA 1I04A 3SZHA 3AKNA 4QYNA 2VFBA 1SWCA 2OY7A 5FENA 2RTJA 4MVEA 4TQ2A 3MX7A 4HPDA 5D8JA 1CBRA 2OVSA 4O3XB 3FDCA 2Z4IA 1SWNA 1DZPA 1HQPA 3APXA 5FAZA 2Y32A 3NR3A 1UYOX 4I3BA 1ACDA 4HFOA 4QYPA 5B27A 4YMYA 3MG5A 1KT4A 2HMBA 2BSZA 4GGTA 4I95A 4Y5DA 3CR6A 2GH7A 2GTFX 4ON1A 1QY0A 1ZNDA 2ANSA 1BEBA 4QNIA 4AZRA 4EFGA 1QABE 4AZNA 2G78A 2X8TA 5B11O 3NQ3A 4YVBA 1VWKB 2DM5A 4ORUA 2AKQA 5BVSA 1NQMA 2FRSA 2F01A 1E02A 1ERXA 2IZGB 2KTSA 1B56A 2WSJA 3APVA 3HOEA 2CZUA 1MVGA 2IZJA 4IBAA 3E3CA 2PI3O 1VWPB 1ZNEA 4ZR2A 3RE5A 1SWAA 1TVQA 4Y0SA 3QQ2A 3RDSA 3CKFA 2X55A 3FW4A 1HMTA 1LIDA 2JOZA 3FA6A 1SXWA 3O22A 4GK9A 4YBUA 5HZQA 4ARHA 2VDFA 1EALA 1VWDB 1NQNA 2IZCB 1NP1A 4ID2A 4GNYA 2Q2PA 3RDXA 1STSB 1SLDB 4MISA 4O4SA 4XMGA 3RWXA 2POAA 4BX5A 3TF6A 2RTMA 1MUPA 4EDEA 2RTQB 3CBCA 3IFBA 3ELZA 2RTNB 5HWZA 2QCBA 2GTLN 1IJ8A 5K68A 1OBPA 4O4OA 2IZHB 2AMMX 2I5VO 4CV7A 1HMSA 1VWRB 4NNSA 3WJBA 2X8SA 5LKFA 1PBOA 2L9CA 1N9YA 4ZHCA 1U0XA 2MWHA 4YFRA 2ZAGA 3HOLA 4CPIA 1JMXA 1UREA 5F6BA 1KL3A 1SY3A 2RTBB 4M6SA 2A2GA 5B5GA 1AVDA 2CM9A 4U9CA 4BX6B 5HZ8A 3B2JA 2XSTA 1JYDA 4TKBA 1KZXA 4CDCA 1TW4A 2W2BA 3FMZA 3D9WA 4N7DA 3HWGA 3RDQA 3WXQA 5H8TA 5LJBA 2LA7A 4YGHA 4DQ4A 2A2UA 2OVAA 1YUPA 4ZFXA 1EPBA 1RXJA 2X56A 1KT6A 2VFCA 3H3IA 1X8UA 1Y0GA 2X32A 3BY0A 4YKOA 2OYBO 4ORYA 2WPUA 2K23A 2MM3A 3DSZA 2FHNX 1RBPA 3EW1A 4LQZA 5AJCA 2JN3A 3BU9A 1GX9A 1YWAA 3RY2A 1MDCA 1SREA 2OL7A 2HKDA 4BX5B 4IMNA 5B5FA 4TLJA 4U8UM 4QGWA 4TKJA 1LELA 2JW1A 5F58A 2HLVA 2WQ9A 4QGXA 2RQ0A 1VWIB 3VE1A 1LCWA 1VWFB 5HTEA 2FWVA 3FR5A 1VYGA 3SLOA 3HTYA 2KD2A 2BHVA 4XMDA 3WJCA 5KHPA 5D48A 1AQBA 2IFBA 5KICA 2LFOA 4BX7A 3PECA 1RSUB 3NPOA 1MK5A 4YCEA 4OS0A 4LKPA 4U3QA 2A5BA 4O4XA 3VHMA 1Y9LA 1SWLA 3C77X 3D4RA 3NX1A 4I3DA 5F6ZA 5HZ5A 1CJ5A 1KFFA 1MX8A 1U18A 1EI5A 3O2YA 2CM4A 2OFBA 3PQSA 5IXGA 5D45A 2OY5O 1YP7A 2CAMA 4ODDA 3SLTA 1JMZA 1X8OA 3C78X 1OSPO 4KC8A 4NW4A 3VE2A 4AZQA 3U0DA 3P6EA 4D6BA 1KGLA 4WFUA 4M7MA 4XMEA 5BYPA 2MHDA 3V8UA 1MM9A 3T6FA 4TNNA 3BRNA 1X8QA 2WEWA 3PP6A 2OVDA 1GT3A 4YDBA 3HPEA 4CPFA 2RTRB 2BS6A 5F7GA 5IO5A 3RDUA 1O1UA 4O3YA 4BCSA 4BBOA 1BM5A 5HAEA 4YFPA 4COTA 1LDQA 3SZIA 5LJCA 4ZGUA 2L5PA 3D97A 3RE6A 4ZHHA 1SWKA 1JYJA 3BX8A 1Y9TA 1IKEA 1DF3A 1JZUA 1DF8A 1X89A 4YBPA 1GKAB 1SWGA 4EEJA 4IRWA 4LZVA 2IZIA 1BWYA 3B2KA 3F9DA 2KT4B 1HY2A 3P6GA 3UEWA 4ALBA 1N7YA 3EMMA 4Z27A 1SWPA 3P6HA 4GZVA 4ZHFA 3ZWEA 5B29A 5KIDA 1FEMA 4ORSA 3WYPA 2WUTA 4U8UO 3ZW1B 1HXLA 4LKTA 2FKGA 3WJDA 1KL4A 2FS6A 4OEMA 4GJVA 2ACPX 1WBIA 2IZBA
chains in the Genus database with same CATH topology
2NNQA 1KQXA 1DZMA 1T8VA 3OBLA 1TOWA 3ZZVA 2A0AA 3FA7A 3P6CA 4R0BA 4ALOA 1RLBE 4UU2A 1GT5A 4GKCA 1ADLA 4A1YA 5C0NA 1JJXA 1T68X 3TGBA 3ZW2A 3ZQ3A 1KT7A 2JMBA 3P24A 4OMXA 2FS7A 3VG2A 2R56A 4QAEA 1BLRA 3G7XA 1SY1A 3BSZE 2LBVA 1LFOA 3CWKA 4WBKA 2KTDA 4OS3A 2AT3X 4K19A 2OZQA 2W2AA 1BSOA 3U9PC 4BOEA 2L67A 2EU7X 5EPQA 4GRJA 1QY1A 2JU8A 1O8VA 1SMPI 2FR2A 1FTPA 5L8NA 5EDCA 3L4RA 1ERBA 1SY0A 4AW8A 2OVEA 1OBUA 4KT5A 2G79A 3QKGA 3S26A 3RZYA 4XMHA 4HPBA 2NNEA 3MBTA 1ML7A 3F6ZB 3CMPA 1KXOA 2AT8X 3WVMA 3K3LA 2AH7X 4A8ZA 3CQRA 3B2LA 1LKEA 5HCCC 1T0VA 2FLJA 3LHNA 3ZW0A 3NADA 3Q6LA 1UZ2X 1TOUA 3NQ9A 4HPCA 2CZTA 3O19A 3ZUOA 3WJGA 4I9SA 1JBHA 1ZRYA 4KC7A 4QGVA 2FT9A 3P6DA 1SY2A 4XMCA 3D96A 4ZH6A 2PY1A 3KQ0A 4ZH9A 2AT0X 1QFVA 4BVMA 2X46A 1QWDA 4TKHA 4ORXA 2RCTA 2ALLX 1GX8A 2CBSA 4ZGFA 4NLJA 4Y0QA 2XKLA 3WJEA 3GE2A 3UEXA 1EW3A 1MX7A 1G85A 5EEDA 3SOTA 1FELA 3I17A 3FA8A 5DPQA 1KOIA 2L68A 4AZOA 4YGZA 1X71A 4EQAC 1CBIA 1H91A 2GTLM 2QO6A 3BX7A 3KFHA 2LBAA 4FBOA 2Q9SA 1B0OA 4UU3A 3VPJE 3FIQA 1DZKA 4ZHGA 2RN4A 1A3YA 4MVLA 4YFQA 1G7NA 4O3WA 5L8IA 1PEEA 1BBPA 4I3CA 4ES7A 3UAQA 4CSBA 4ZHDA 3OJYC 1BSQA 4I6SA 3ZW0B 1YWBA 3WOVA 4KCAA 5CE4A 3PH6A 4RUNA 5EEEA 4YKMA 3KZAA 1B4MA 4TJZA 2QO4A 5BVTA 4NNTA 4ORWA 1A57A 3WJFA 3KFFA 5FQ6E 3ZW1A 1GKAA 3RSWA 2M4LA 1HMRA 4AZPA 1IIUA 2CBRA 5EDBA 1GT1A 5K06A 4IMOA 2Z4HA 2E4JA 2FR3A 1S2PA 4NLIA 1XCAA 1CRBA 1QFTA 1GGLA 2HZRA 4GU8A 4IB9A 4N7CA 3PPTA 4QQ1A 1GXAA 2A13A 3IA8A 4GH7A 1TXLA 4EXZA 1LF7A 2Q39A 2X8FA 1YWDA 2QOSC 3JS1A 3VG3A 1S44A 4MIRA 5DG4A 2G7BA 1OPAA 1GT4A 3APUA 3B2HA 1HN2A 4ZJ0A 3FW5A 5HCEC 2FTBA 1IKJA 3PH5A 3B2IA 3RKGA 3VG6A 2K62A 2RA6A 3SAOA 5LJGA 1DFVA 1I06A 1X8NA 1E00A 1U17A 4FBVA 1I05A 3T1DA 3NBXX 5HZ9A 4AYHA 1ZNLA 1FDQA 1JV4A 1BJ7A 4IB7A 4PJ2A 3KFGA 2GTLO 4OS8A 1CBSA 2ACOA 2HYSA 3AKMA 3NQ3A 1IFBA 2ASNX 1ALBA 3HWDA 1SA8A 2GC9A 3PP6A 4HFOA 3PQUA 4HWMA 2NNDA 1CBQA 1LIBA 1FE3A 4YH0A 1JJJA 3OD9A 1KT5A 4CK4A 4ORRA 3UEVA 1LIEA 4XMFA 4A60A 1D3SA 4GE1A 4IAWA 3FLLA 3FENA 3CQNA 5AEOA 3UEUA 3KFIA 4GETA 4GNWA 2QO5A 2O62A 5HTDA 3FEKA 3F8AA 3JSQA 4D6AA 3DTQA 4INNA 1EPAA 1SXUA 3JQOA 4Y0RA 2NP1A 1BRQA 1LPJA 3S5VA 3TZSA 1NP4A 4BQUA 1QG5A 3HWEA 1AB0A 3STNA 2R73A 5H9LA 2OFRX 4ML7B 1PM1X 1BSYA 3EBKA 4PSQA 3STKA 3ZI8A 1KQWA 1QY2A 2WR6A 2AL0X 4IABA 2OFMX 3RBYA 1BRPA 4YCHA 3VG5A 1D2UA 3BDRA 2WWPA 1A2DA 1L6MA 4MVIA 5L8OA 1AELA 2AT6X 1ZNKA 3VU1A 1IW2A 4IB6A 3FEPA 3HK1A 5FQ8E 2MO5A 1OEKA 3VG4A 5HBSA 1HBPA 1KZWA 4NYQA 2P8GA 2W2FA 5IO7A 3STMX 5IO6A 2JU7A 4Y0PA 2WQAE 4OMWA 1SXXA 5HZ6A 1P6PA 3NQKA 3GAQA 3P02A 2N93A 4YGGA 3BLGA 4O49A 1LICA 2YMSA 3OE3A 3MVFA 4L3RA 1B8EA 4A1HA 2QM9A 5LJDA 5BVQA 5AQ6A 1LIFA 1EIIA 2Q2MA 3FYFA 5CYBA 1JIWI 1SXYA 3NX2A 1XKIA 2ZAIA 4U8UN 2KW1A 3TGAA 5FQ7E 1S7DA 5HCDC 1DC9A 2Q4NA 4FBRA 5LJEA 1YWCA 2BS5A 4HPAA 4AZMA 1Z24A 4RUUA 1KT3A 3I0AA 1R0UA 1O1VA 1AVGI 5LKEA 4FQBB 5EZ2A 1DV9A 1E5PA 1EUOA 3EBWA 2WEXA 2A3FX 5LJKA 1PMPA 4O3ZA 5JR8A 1EIOA 4JGLA 4KH8A 3NP1A 5H9NA 1YIVA 4YDAA 3P6FA 1GM6A 3APWA 1I4UA 4L1NA 1YP6A 5F1EA 1OEJA 3HWFA 4IB8A 4MVKA 2QMIA 2BT9A 4GDZA 1VPRA 1A18A 5AJBA 3S5XA 5LJHA 1OEEA 3VG7A 3U03A 2X45A 4NYRA 5FFHA 1OPBA 4O9SA 5D47A 3EYCA 1QQSA 3BU1A 4I9RA 1ZNGA 3C76X 1ZNHA 1NGLA 1IFCA 4QZTA 2LKKA 2YG2A 2JU3A 5HA0A 4DQ3A 3FELA 4IAXA 3FR4A 2RD7C 1HBQA 3LV4A 3PEDA 2HZQA 4QZUA 5H9KA 3S60A 4KIIA 3WBGA 1FENA 4WHIA 3ZUIA 4ZCBA 1E06A 1EXSA 2RCQA 1EQDA 3FA9A 2HNXA 1OBQA 4QRLA 4NP1A 3N91A 1DZJA 5H9AA 2MJIA 4O4UA 3ELXA 1ICMA 3CBSA 2F73A 1G74A 4WFVA 5HA1A 2R74A 1ICNA 1VYFA 1LNMA 3EM0A 2GJ5A 3D95A 2LB6A 3FR2A 1N0SA 1G5WA 3BS2A 2F09A 4LZUA 5D4AA 2AT5X 1X8PA 2BLGA 1I04A 3AKNA 4QYNA 5FENA 4MVEA 4TQ2A 3MX7A 4HPDA 5D8JA 1CBRA 2OVSA 4O3XB 5FAZA 2Z4IA 3APXA 1DZPA 1HQPA 3NR3A 4I3BA 1ACDA 4QYPA 5B27A 4YMYA 1KT4A 2HMBA 4I95A 3CR6A 2GTFX 4ON1A 4QNIA 1QY0A 2ANSA 1ZNDA 1BEBA 4AZRA 3TGCA 4EFGA 1QABE 4AZNA 2G78A 2X8TA 2DM5A 4ORUA 2AKQA 5BVSA 2FRSA 2KTSA 4FGIB 1E02A 1ERXA 3HOEA 2WSJA 1B56A 3APVA 2CZUA 1MVGA 4IBAA 3E3CA 1ZNEA 4ZR2A 1TVQA 4Y0SA 3V8UA 3FW4A 1HMTA 1LIDA 2JOZA 3FA6A 1SXWA 3O22A 4GK9A 4YBUA 5HZQA 4ARHA 1EALA 1NP1A 4ID2A 4GNYA 2Q2PA 4MISA 4O4SA 4XMGA 3RWXA 2POAA 3TF6A 1MUPA 4EDEA 3CBCA 3IFBA 3ELZA 5HWZA 2GTLN 1OBPA 4O4OA 2AMMX 4CV7A 1HMSA 4NNSA 3WJBA 2X8SA 5LKFA 1PBOA 2L9CA 4ZHCA 1U0XA 2MWHA 4YFRA 2ZAGA 3HOLA 1UREA 5F6BA 1SY3A 4M6SA 2A2GA 2CM9A 4U9CA 5HZ8A 3B2JA 2XSTA 1JYDA 4TKBA 1KZXA 1TW4A 2W2BA 3FMZA 4N7DA 3WXQA 3HWGA 5H8TA 5LJBA 2LA7A 4YGHA 4DQ4A 2A2UA 2OVAA 1YUPA 4ZFXA 1EPBA 1KT6A 3H3IA 1X8UA 3BY0A 4YKOA 4ORYA 2K23A 2MM3A 3DSZA 1RBPA 4LQZA 5AJCA 2JN3A 3BU9A 1GX9A 1YWAA 1MDCA 4IMNA 4TLJA 4U8UM 4QGWA 4TKJA 2JW1A 5F58A 2HLVA 2WQ9A 4QGXA 2RQ0A 3VE1A 5HTEA 2FWVA 3FR5A 1VYGA 3HTYA 2KD2A 2BHVA 4XMDA 3WJCA 5KHPA 5D48A 1AQBA 2IFBA 5KICA 2LFOA 3PECA 3NPOA 4YCEA 4OS0A 4LKPA 4U3QA 4O4XA 1Y9LA 3D4RA 3C77X 3NX1A 4I3DA 5HZ5A 5F6ZA 1CJ5A 1MX8A 1U18A 1EI5A 3O2YA 2CM4A 3PQSA 5D45A 1YP7A 4ODDA 3VE2A 1X8OA 3C78X 4KC8A 4NW4A 4AZQA 3U0DA 1KGLA 3P6EA 4D6BA 4WFUA 4M7MA 4XMEA 5BYPA 2MHDA 4TNNA 3BRNA 1X8QA 2WEWA 2OVDA 1GT3A 4YDBA 2BS6A 5F7GA 5IO5A 1O1UA 4O3YA 1BM5A 5HAEA 4YFPA 4COTA 5LJCA 4ZGUA 2L5PA 3D97A 4ZHHA 1JYJA 3BX8A 1Y9TA 1IKEA 1DF3A 1JZUA 1X89A 4YBPA 1GKAB 4EEJA 4LZVA 1BWYA 3B2KA 3F9DA 2KT4B 3P6GA 3UEWA 4ALBA 3EMMA 5KIDA 4GZVA 3P6HA 4ZHFA 5B29A 3ZWEA 1FEMA 4ORSA 2WUTA 4U8UO 3ZW1B 4LKTA 3WJDA 2FS6A 2ACPX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NNQ A;  1KQX A;  1DZM A;  1T8V A;  1TOW A;  2A0A A;  3FA7 A;  3P6C A;  4R0B A;  4ALO A;  1RLB E;  4UU2 A;  1GT5 A;  4GKC A;  1ADL A;  4A1Y A;  5C0N A;  1JJX A;  1T68 X;  3TGB A;  3ZQ3 A;  1KT7 A;  4OMX A;  2FS7 A;  3VG2 A;  2R56 A;  4QAE A;  1BLR A;  3G7X A;  1SY1 A;  3BSZ E;  2LBV A;  1LFO A;  3CWK A;  4WBK A;  2KTD A;  4OS3 A;  2AT3 X;  4K19 A;  2OZQ A;  2W2A A;  1BSO A;  3U9P C;  4BOE A;  2L67 A;  2EU7 X;  5EPQ A;  4GRJ A;  1QY1 A;  2JU8 A;  1O8V A;  2FR2 A;  1FTP A;  5L8N A;  5EDC A;  3L4R A;  1ERB A;  1SY0 A;  4AW8 A;  2OVE A;  1OBU A;  2G79 A;  3QKG A;  3S26 A;  3RZY A;  4XMH A;  4HPB A;  2NNE A;  3MBT A;  1ML7 A;  3CMP A;  1KXO A;  2AT8 X;  3WVM A;  3K3L A;  2AH7 X;  4A8Z A;  3CQR A;  3B2L A;  1LKE A;  5HCC C;  1T0V A;  2FLJ A;  3NAD A;  3Q6L A;  1UZ2 X;  1TOU A;  3NQ9 A;  4HPC A;  2CZT A;  3O19 A;  3ZUO A;  3WJG A;  4I9S A;  1JBH A;  1ZRY A;  4QGV A;  2FT9 A;  3P6D A;  1SY2 A;  4XMC A;  3D96 A;  4ZH6 A;  2PY1 A;  3KQ0 A;  4ZH9 A;  2AT0 X;  1QFV A;  4BVM A;  2X46 A;  1QWD A;  4TKH A;  4ORX A;  2RCT A;  2ALL X;  1GX8 A;  2CBS A;  4NLJ A;  4Y0Q A;  2XKL A;  3WJE A;  3UEX A;  1EW3 A;  1MX7 A;  1G85 A;  5EED A;  1FEL A;  3I17 A;  3FA8 A;  5DPQ A;  1KOI A;  2L68 A;  4AZO A;  4YGZ A;  1X71 A;  1CBI A;  1H91 A;  3BX7 A;  2QO6 A;  3KFH A;  2LBA A;  2Q9S A;  1B0O A;  4UU3 A;  3FIQ A;  1DZK A;  4ZHG A;  4MVL A;  1A3Y A;  4YFQ A;  1PEE A;  1G7N A;  5L8I A;  1BBP A;  4ES7 A;  4ZHD A;  3OJY C;  1BSQ A;  1YWB A;  5CE4 A;  3PH6 A;  4RUN A;  5EEE A;  4YKM A;  3KZA A;  1B4M A;  4TJZ A;  2QO4 A;  5BVT A;  4NNT A;  4ORW A;  1A57 A;  3WJF A;  3KFF A;  1GKA A;  3RSW A;  1HMR A;  4AZP A;  1IIU A;  2CBR A;  5EDB A;  1GT1 A;  5K06 A;  4IMO A;  2E4J A;  2FR3 A;  1S2P A;  4NLI A;  1XCA A;  1CRB A;  1QFT A;  1GGL A;  2HZR A;  4IB9 A;  4YKO A;  4N7C A;  3PPT A;  1GXA A;  2A13 A;  3IA8 A;  4GH7 A;  1TXL A;  4EXZ A;  1LF7 A;  2Q39 A;  1YWD A;  2QOS C;  3JS1 A;  3VG3 A;  1S44 A;  5DG4 A;  2G7B A;  1OPA A;  1GT4 A;  3APU A;  3B2H A;  1HN2 A;  4ZJ0 A;  3FW5 A;  5HCE C;  2FTB A;  1IKJ A;  3PH5 A;  3B2I A;  3VG6 A;  2K62 A;  2RA6 A;  3SAO A;  5LJG A;  1DFV A;  1I06 A;  1X8N A;  1E00 A;  1U17 A;  1I05 A;  3T1D A;  5HZ9 A;  4AYH A;  1ZNL A;  1FDQ A;  1JV4 A;  1BJ7 A;  4IB7 A;  3KFG A;  4OS8 A;  1CBS A;  2ACO A;  2HYS A;  3AKM A;  3NQ3 A;  1IFB A;  2ASN X;  1ALB A;  3HWD A;  1SA8 A;  2GC9 A;  3PP6 A;  4HFO A;  4I3C A;  4YH0 A;  2NND A;  1CBQ A;  1LIB A;  1FE3 A;  1JJJ A;  1KT5 A;  4CK4 A;  4ORR A;  3UEV A;  1LIE A;  4XMF A;  4A60 A;  1D3S A;  4GE1 A;  4IAW A;  3FLL A;  3FEN A;  3CQN A;  3UEU A;  3KFI A;  4GET A;  4GNW A;  2QO5 A;  2O62 A;  5HTD A;  3FEK A;  3F8A A;  3JSQ A;  4D6A A;  3DTQ A;  1EPA A;  1SXU A;  4Y0R A;  2NP1 A;  1BRQ A;  1LPJ A;  3TZS A;  1NP4 A;  4BQU A;  1QG5 A;  3HWE A;  1AB0 A;  3STN A;  2R73 A;  5H9L A;  2OFR X;  1PM1 X;  1BSY A;  3EBK A;  4PSQ A;  3STK A;  1KQW A;  1QY2 A;  2WR6 A;  2AL0 X;  2OFM X;  1BRP A;  4YCH A;  3VG5 A;  1D2U A;  3BDR A;  2WWP A;  1A2D A;  1L6M A;  4MVI A;  5L8O A;  1AEL A;  2AT6 X;  1ZNK A;  1IW2 A;  4IB6 A;  3FEP A;  3HK1 A;  2MO5 A;  1OEK A;  3VG4 A;  5HBS A;  1HBP A;  1KZW A;  4NYQ A;  2P8G A;  2W2F A;  5IO7 A;  3STM X;  5IO6 A;  2JU7 A;  4Y0P A;  2WQA E;  4OMW A;  1SXX A;  5HZ6 A;  1P6P A;  3GAQ A;  2N93 A;  4YGG A;  3BLG A;  1LIC A;  3MVF A;  1B8E A;  4A1H A;  2QM9 A;  5LJD A;  5BVQ A;  5AQ6 A;  1LIF A;  1EII A;  2Q2M A;  1SXY A;  3NX2 A;  1XKI A;  3TGA A;  1S7D A;  5HCD C;  1DC9 A;  2Q4N A;  5LJE A;  1YWC A;  4HPA A;  4AZM A;  1Z24 A;  4RUU A;  1KT3 A;  3I0A A;  1R0U A;  1O1V A;  1AVG I;  5LKE A;  5EZ2 A;  1DV9 A;  1E5P A;  1EUO A;  3EBW A;  2WEX A;  2A3F X;  5LJK A;  1PMP A;  5JR8 A;  1EIO A;  3NP1 A;  5H9N A;  1YIV A;  4YDA A;  3P6F A;  1GM6 A;  3APW A;  1I4U A;  1YP6 A;  5F1E A;  1OEJ A;  3HWF A;  4IB8 A;  4MVK A;  1VPR A;  1A18 A;  5LJH A;  1OEE A;  3VG7 A;  3U03 A;  2X45 A;  4NYR A;  5FFH A;  1OPB A;  4O9S A;  5D47 A;  3EYC A;  1QQS A;  3BU1 A;  4I9R A;  1ZNG A;  3C76 X;  1ZNH A;  1NGL A;  1IFC A;  4QZT A;  2LKK A;  2YG2 A;  2JU3 A;  5HA0 A;  4DQ3 A;  3FEL A;  4IAX A;  3FR4 A;  2RD7 C;  1HBQ A;  3PED A;  4QZU A;  2HZQ A;  5H9K A;  4KII A;  3WBG A;  1FEN A;  3ZUI A;  4ZCB A;  2RCQ A;  1E06 A;  1EXS A;  1EQD A;  3FA9 A;  2HNX A;  1OBQ A;  4NP1 A;  1DZJ A;  5H9A A;  2MJI A;  3ELX A;  1ICM A;  3CBS A;  2F73 A;  1G74 A;  4WFV A;  5HA1 A;  2R74 A;  1ICN A;  1VYF A;  1LNM A;  3EM0 A;  2GJ5 A;  3D95 A;  2LB6 A;  3FR2 A;  1N0S A;  1G5W A;  3BS2 A;  4LZU A;  5D4A A;  2AT5 X;  1X8P A;  2BLG A;  1I04 A;  3AKN A;  4QYN A;  5FEN A;  4TQ2 A;  4HPD A;  5D8J A;  1CBR A;  5FAZ A;  3APX A;  1DZP A;  1HQP A;  3NR3 A;  4I3B A;  1ACD A;  4QYP A;  5B27 A;  4YMY A;  1KT4 A;  2HMB A;  3CR6 A;  2GTF X;  3TGC A;  1QY0 A;  2ANS A;  1ZND A;  1BEB A;  4AZR A;  4EFG A;  1QAB E;  4AZN A;  2G78 A;  2DM5 A;  4ORU A;  2AKQ A;  5BVS A;  2FRS A;  1E02 A;  1ERX A;  2WSJ A;  1B56 A;  3APV A;  2CZU A;  1MVG A;  4IBA A;  1ZNE A;  4ZR2 A;  1TVQ A;  4Y0S A;  3FW4 A;  1HMT A;  1LID A;  2JOZ A;  3FA6 A;  1SXW A;  3O22 A;  4YBU A;  4ARH A;  5HZQ A;  1EAL A;  1NP1 A;  4GNY A;  2Q2P A;  4XMG A;  2POA A;  3TF6 A;  1MUP A;  4EDE A;  3CBC A;  3IFB A;  3ELZ A;  5HWZ A;  1OBP A;  2AMM X;  1HMS A;  4NNS A;  3WJB A;  5LKF A;  1PBO A;  2L9C A;  4ZHC A;  1U0X A;  4YFR A;  1URE A;  5F6B A;  1SY3 A;  4M6S A;  2A2G A;  2CM9 A;  5HZ8 A;  3B2J A;  2XST A;  1JYD A;  4TKB A;  1KZX A;  1TW4 A;  2W2B A;  3FMZ A;  4N7D A;  3WXQ A;  3HWG A;  5H8T A;  5LJB A;  4YGH A;  4DQ4 A;  2A2U A;  2OVA A;  1YUP A;  4ZFX A;  1EPB A;  1KT6 A;  1X8U A;  3BY0 A;  4ORY A;  2K23 A;  2MM3 A;  3DSZ A;  1RBP A;  2JN3 A;  3BU9 A;  1GX9 A;  1YWA A;  1MDC A;  4IMN A;  4TLJ A;  4QGW A;  4TKJ A;  5F58 A;  2HLV A;  2WQ9 A;  4QGX A;  2RQ0 A;  5HTE A;  2FWV A;  3FR5 A;  1VYG A;  4XMD A;  3WJC A;  5KHP A;  5D48 A;  1AQB A;  2IFB A;  5KIC A;  2LFO A;  3PEC A;  3NPO A;  4YCE A;  4OS0 A;  4LKP A;  4I3D A;  3C77 X;  3NX1 A;  5HZ5 A;  5F6Z A;  1CJ5 A;  1MX8 A;  1U18 A;  3O2Y A;  2CM4 A;  5D45 A;  1YP7 A;  4ODD A;  1X8O A;  3C78 X;  4AZQ A;  1KGL A;  3U0D A;  3P6E A;  4D6B A;  4WFU A;  4M7M A;  4XME A;  4TNN A;  3BRN A;  1X8Q A;  2WEW A;  2OVD A;  1GT3 A;  4YDB A;  5F7G A;  5IO5 A;  1O1U A;  1BM5 A;  5HAE A;  4YFP A;  5LJC A;  4ZGU A;  2L5P A;  3D97 A;  4ZHH A;  1JYJ A;  3BX8 A;  1DF3 A;  1IKE A;  1JZU A;  1X89 A;  4YBP A;  1GKA B;  4EEJ A;  4LZV A;  1BWY A;  3B2K A;  3F9D A;  2KT4 B;  3P6G A;  3UEW A;  4ALB A;  3EMM A;  5KID A;  3P6H A;  4ZHF A;  5B29 A;  1FEM A;  4ORS A;  2WUT A;  4LKT A;  3WJD A;  2FS6 A;  2ACP X; 
#chains in the Genus database with same CATH topology
 2IZE B;  1SWS A;  2NNQ A;  1KQX A;  2FKJ A;  1DZM A;  1SWE A;  1T8V A;  3OBL A;  4AW8 A;  1TOW A;  1SWR A;  2OY1 O;  3ZZV A;  2A0A A;  2FHL A;  3FA7 A;  1Y52 X;  1RAV A;  3P6C A;  4R0B A;  3Q34 A;  1RLB E;  4UU2 A;  4ALO A;  1GT5 A;  2X34 A;  1ADL A;  1NBX A;  4GKC A;  4A1Y A;  5C0N A;  1JJX A;  1T68 X;  2RTG B;  3TGB A;  5IRA A;  3ZW2 A;  4Z2V A;  1SWB A;  1KT7 A;  2JMB A;  3ZQ3 A;  3P24 A;  2AF5 A;  4OMX A;  2FS7 A;  3VG2 A;  2R56 A;  4QAE A;  1BLR A;  3G7X A;  1RXK A;  1SWF A;  1SY1 A;  3BSZ E;  2LBV A;  1LFO A;  3CWK A;  3RDO A;  4WBK A;  3RY1 A;  2KTD A;  4OS3 A;  4BX6 A;  2AT3 X;  4GJS A;  4K19 A;  2OZQ A;  2W2A A;  1BSO A;  3U9P C;  4BOE A;  2L67 A;  4C5P A;  2EU7 X;  3WYQ A;  5EPQ A;  4GRJ A;  1QY1 A;  2JU8 A;  1O8V A;  1SMP I;  2FR2 A;  1FTP A;  4GUZ A;  5L8N A;  5EDC A;  3L4R A;  1ERB A;  1SY0 A;  1VWG B;  2OVE A;  1OBU A;  4KT5 A;  2G79 A;  2FGS A;  2A5C A;  3QKG A;  1MEP A;  3S26 A;  3RZY A;  4XMH A;  3SZJ A;  2I5Z O;  4CPH A;  1SRI A;  4HPB A;  2NNE A;  1Y55 X;  3MBT A;  2C4I A;  1ML7 A;  3F6Z B;  3CMP A;  3EW2 A;  1KXO A;  2AT8 X;  3WVM A;  3K3L A;  2AH7 X;  4A8Z A;  3CQR A;  3B2L A;  1LKE A;  5HCC C;  1T0V A;  2FLJ A;  3LHN A;  3PDF A;  3AUM O;  3NAD A;  3ZW0 A;  5K67 A;  3Q6L A;  1UZ2 X;  1TOU A;  3NQ9 A;  4Z2P A;  4HPC A;  1RST B;  2CZT A;  3O19 A;  3ZUO A;  3WJG A;  4I9S A;  1JBH A;  1ZRY A;  4KC7 A;  4QGV A;  1SWU A;  2FT9 A;  3P6D A;  1SY2 A;  4XMC A;  3D96 A;  1VWA B;  4ZH6 A;  2PY1 A;  3KQ0 A;  4ZH9 A;  2AT0 X;  1QFV A;  4BVM A;  2X46 A;  1QWD A;  2UZ2 A;  4TKH A;  4ORX A;  2RCT A;  2ALL X;  1GX8 A;  1SRG A;  4HWM A;  2CBS A;  4ZGF A;  1SRH A;  2RTP B;  4NLJ A;  4Y0Q A;  2IZD B;  2XKL A;  3WJE A;  3GE2 A;  3UEX A;  1EW3 A;  1MX7 A;  1G85 A;  5EED A;  3SOT A;  1SWO A;  1FEL A;  3I17 A;  3FA8 A;  5DPQ A;  1KOI A;  2L68 A;  4AZO A;  4YGZ A;  1X71 A;  4CPH B;  4EQA C;  1CBI A;  1H91 A;  2GTL M;  2QO6 A;  3BX7 A;  3KFH A;  2LBA A;  4FBO A;  2Q9S A;  1B0O A;  4UU3 A;  3VPJ E;  3FIQ A;  1DZK A;  4ZHG A;  2RN4 A;  1A3Y A;  1SWD A;  4MVL A;  1G7N A;  4O3W A;  4YFQ A;  5L8I A;  1PEE A;  1BBP A;  4I3C A;  2AVI A;  3T6L A;  3UAQ A;  4CSB A;  4EKV A;  4ES7 A;  3OJY C;  1BSQ A;  4I6S A;  4Z6J A;  3ZW0 B;  4ZHD A;  1YWB A;  3WOV A;  1W6F A;  4KCA A;  5CE4 A;  3PH6 A;  4RUN A;  3MM0 A;  4YKM A;  5EEE A;  3KZA A;  1B4M A;  4TJZ A;  2QO4 A;  5BVT A;  5JD2 A;  2RTC B;  4NNT A;  4ORW A;  1A57 A;  3WJF A;  3KFF A;  5FQ6 E;  3ZW1 A;  1GKA A;  3RSW A;  2OFA A;  2M4L A;  1HMR A;  1N9M A;  4AZP A;  1IIU A;  1AVE A;  2CBR A;  5EDB A;  1Y53 X;  1GT1 A;  5K06 A;  3TGC A;  4IMO A;  2Z4H A;  2E4J A;  2FR3 A;  1S2P A;  4NLI A;  1XCA A;  1CRB A;  1QFT A;  1GGL A;  1SWJ A;  2HZR A;  4GU8 A;  4IB9 A;  3PPT A;  4N7C A;  1GXA A;  2A13 A;  3IA8 A;  4GH7 A;  1TXL A;  1K3B A;  2G5L A;  5IRU A;  4EXZ A;  3WZP A;  1LF7 A;  2Q39 A;  2X8F A;  1RXH A;  1YWD A;  1SWT A;  2QOS C;  1SRJ A;  3JS1 A;  2A8G A;  1S44 A;  2QOM A;  4MIR A;  5DG4 A;  3VG3 A;  1OPA A;  1GT4 A;  2G7B A;  2RTA A;  3APU A;  3B2H A;  1HN2 A;  4ZJ0 A;  3FW5 A;  5HCE C;  2OL6 O;  1VWJ B;  1E2T A;  1IKJ A;  2FTB A;  3PH5 A;  3B2I A;  3RKG A;  3VG6 A;  2K62 A;  2RA6 A;  3SAO A;  4JHQ A;  5LJG A;  1DFV A;  1I06 A;  1X8N A;  1E00 A;  1U17 A;  4FBV A;  4JNJ A;  3WZQ A;  1I05 A;  3T1D A;  3NBX X;  4Z2O A;  5HZ9 A;  4AYH A;  1ZNL A;  3WZO A;  1FDQ A;  1JV4 A;  1BJ7 A;  4IB7 A;  4PJ2 A;  1VWH B;  3KFG A;  2GTL O;  5F2B A;  4OS8 A;  1CBS A;  1HQQ A;  2ACO A;  2HYS A;  2MF6 A;  1IFB A;  2ASN X;  1ALB A;  3AKM A;  1SA8 A;  2GC9 A;  2RTD B;  3HWD A;  3PQU A;  4FGI B;  2NND A;  1CBQ A;  1LIB A;  1FE3 A;  3LTW A;  2RTE B;  3OD9 A;  4OEL A;  3SLJ A;  1KT5 A;  1JJJ A;  2IZA A;  4CK4 A;  4ORR A;  3UEV A;  1LIE A;  4XMF A;  4A60 A;  1D3S A;  4GE1 A;  4IAW A;  3FLL A;  1SLE B;  3FEN A;  1I9H A;  3CQN A;  5AEO A;  3UEU A;  3KFI A;  4GGR A;  1PBY A;  4GET A;  2QO5 A;  4GNW A;  2O62 A;  5HTD A;  3FEK A;  3F8A A;  3JSQ A;  3X00 A;  4D6A A;  3DTQ A;  3RDM A;  3VGW A;  4INN A;  1EPA A;  1SXU A;  3JQO A;  4Y0R A;  3WZN A;  2NP1 A;  1NC9 A;  2DJF A;  2Y3F A;  1BRQ A;  1LPJ A;  3S5V A;  3TZS A;  1NP4 A;  5B10 O;  4BQU A;  1QG5 A;  3HWE A;  1AB0 A;  3STN A;  1VWB B;  2R73 A;  5H9L A;  2OFR X;  4ML7 B;  1PM1 X;  4DNE A;  1BSY A;  3EBK A;  4PSQ A;  3STK A;  1VWE B;  3ZI8 A;  1KQW A;  1QY2 A;  2WR6 A;  2AL0 X;  4IAB A;  2OFM X;  3RBY A;  1BRP A;  3KVN A;  1VYO A;  3T2W A;  1MOY A;  4YCH A;  3VG5 A;  1D2U A;  1SLF B;  3BDR A;  1LCV A;  5B3M O;  2WWP A;  1A2D A;  1L6M A;  1UYN X;  4CDF A;  4MVI A;  5L8O A;  1AEL A;  2OF8 A;  2AT6 X;  1ZNK A;  1KL5 A;  3VU1 A;  1IW2 A;  1SWQ A;  4JO6 A;  4IB6 A;  3FEP A;  3HK1 A;  4NV7 A;  5FQ8 E;  2MO5 A;  1OEK A;  2ZSC A;  5HBS A;  1HBP A;  3VG4 A;  4NYQ A;  2P8G A;  2IZF B;  2W2F A;  1NDJ A;  3STM X;  5IO7 A;  5IO6 A;  1KZW A;  2JU7 A;  4Y0P A;  2WQA E;  4OMW A;  1SXX A;  5HZ6 A;  5CHK A;  1P6P A;  3NQK A;  3GAQ A;  3P02 A;  2N93 A;  2UYW A;  4U46 A;  1VWC B;  3BLG A;  1SWH A;  4O49 A;  1LIC A;  4YGG A;  2YMS A;  3OE3 A;  3MVF A;  4L3R A;  1B8E A;  4A1H A;  5CSE A;  2QM9 A;  5LJD A;  5BVQ A;  5AQ6 A;  5B2A O;  1STR B;  1LIF A;  1N43 A;  1EII A;  2Q2M A;  2C1Q A;  3FYF A;  4GD9 A;  1JIW I;  1SXY A;  3NX2 A;  5CYB A;  3T2X A;  1XKI A;  3PK2 A;  2ZAI A;  4CDE A;  4U8U N;  1VWN B;  2KW1 A;  3TGA A;  1WUB A;  5FQ7 E;  1LDO A;  1S7D A;  5HCD C;  1DC9 A;  3EC5 A;  2Q4N A;  2BC3 A;  4FBR A;  5LJE A;  1YWC A;  2BS5 A;  2RTI B;  4HPA A;  5L3Y A;  4AZM A;  4OKA A;  1Z24 A;  3AEH A;  4RUU A;  1KT3 A;  4YH0 A;  3I0A A;  1R0U A;  1O1V A;  1AVG I;  5LKE A;  1PTS A;  4FQB B;  4Z28 A;  5EZ2 A;  1W4T A;  1DV9 A;  4GDA A;  1E5P A;  1EUO A;  3CKG A;  3EBW A;  2WEX A;  2A3F X;  2C1S A;  5LJK A;  1PMP A;  1VWL B;  1N4J A;  4O3Z A;  1K24 A;  5JR8 A;  1STP A;  1EIO A;  4JGL A;  4KH8 A;  3NP1 A;  2RTO B;  5H9N A;  1YIV A;  4YDA A;  3P6F A;  1I78 A;  1GM6 A;  3APW A;  1I4U A;  4L1N A;  1YP6 A;  5F1E A;  1OEJ A;  3VHI A;  2RTL A;  4Y59 A;  2OY8 A;  3HWF A;  2RTK A;  4IB8 A;  4MVK A;  4B55 A;  2QMI A;  2BT9 A;  4GDZ A;  1VPR A;  1A18 A;  1GX3 A;  5AJB A;  3S5X A;  2DJG A;  1SLG B;  5LJH A;  2X4M A;  1LCZ A;  1OEE A;  3VG7 A;  3U03 A;  2X45 A;  4NYR A;  4I60 A;  5FFH A;  1OPB A;  2OF9 A;  4O9S A;  2Y3E A;  5D47 A;  3EYC A;  1QQS A;  3BU1 A;  4I9R A;  5IRW A;  1ZNG A;  3C76 X;  3FID A;  4MEE A;  4QQ1 A;  4GGZ A;  1JJU A;  1VWO B;  1ZNH A;  2OL8 O;  1NGL A;  1IFC A;  4QZT A;  2JGS A;  2LKK A;  2YG2 A;  2JU3 A;  5HA0 A;  4DCB A;  4DQ3 A;  3FEL A;  4IAX A;  3FR4 A;  4CDD A;  2RD7 C;  2IZL B;  1HBQ A;  3LV4 A;  3PED A;  2HZQ A;  4QZU A;  5H9K A;  3S60 A;  4BJ8 A;  4KII A;  3WBG A;  1FEN A;  4WHI A;  3ZUI A;  4CPE A;  4ZCB A;  1E06 A;  1EXS A;  2RCQ A;  1EQD A;  3FA9 A;  2HNX A;  1OBQ A;  2G8C O;  4NP1 A;  4QRL A;  1VWM B;  1FJ1 E;  1VWQ B;  3VHH A;  4BGF A;  3N91 A;  1DZJ A;  1W5R A;  5H9A A;  2MJI A;  4O4U A;  3ELX A;  1ICM A;  4NV8 A;  3CBS A;  2F73 A;  1G74 A;  4WFV A;  5HA1 A;  1HXZ A;  1ICN A;  2R74 A;  1SRF A;  1VYF A;  1LNM A;  2IZK A;  3EM0 A;  2GJ5 A;  3D95 A;  2LB6 A;  4BX7 B;  3FR2 A;  1N0S A;  2RTH B;  1G5W A;  2RTF B;  3BS2 A;  2F09 A;  1LUQ A;  4LZU A;  5D4A A;  1JQP A;  1X8P A;  2AT5 X;  2BLG A;  1I04 A;  3SZH A;  3AKN A;  4QYN A;  2VFB A;  1SWC A;  2OY7 A;  5FEN A;  2RTJ A;  4MVE A;  4TQ2 A;  3MX7 A;  4HPD A;  5D8J A;  1CBR A;  2OVS A;  4O3X B;  3FDC A;  2Z4I A;  1SWN A;  1DZP A;  1HQP A;  3APX A;  5FAZ A;  2Y32 A;  3NR3 A;  1UYO X;  4I3B A;  1ACD A;  4HFO A;  4QYP A;  5B27 A;  4YMY A;  3MG5 A;  1KT4 A;  2HMB A;  2BSZ A;  4GGT A;  4I95 A;  4Y5D A;  3CR6 A;  2GH7 A;  2GTF X;  4ON1 A;  1QY0 A;  1ZND A;  2ANS A;  1BEB A;  4QNI A;  4AZR A;  4EFG A;  1QAB E;  4AZN A;  2G78 A;  2X8T A;  5B11 O;  3NQ3 A;  4YVB A;  1VWK B;  2DM5 A;  4ORU A;  2AKQ A;  5BVS A;  1NQM A;  2FRS A;  2F01 A;  1E02 A;  1ERX A;  2IZG B;  2KTS A;  1B56 A;  2WSJ A;  3APV A;  3HOE A;  2CZU A;  1MVG A;  2IZJ A;  4IBA A;  3E3C A;  2PI3 O;  1VWP B;  1ZNE A;  4ZR2 A;  3RE5 A;  1SWA A;  1TVQ A;  4Y0S A;  3QQ2 A;  3RDS A;  3CKF A;  2X55 A;  3FW4 A;  1HMT A;  1LID A;  2JOZ A;  3FA6 A;  1SXW A;  3O22 A;  4GK9 A;  4YBU A;  5HZQ A;  4ARH A;  2VDF A;  1EAL A;  1VWD B;  1NQN A;  2IZC B;  1NP1 A;  4ID2 A;  4GNY A;  2Q2P A;  3RDX A;  1STS B;  1SLD B;  4MIS A;  4O4S A;  4XMG A;  3RWX A;  2POA A;  4BX5 A;  3TF6 A;  2RTM A;  1MUP A;  4EDE A;  2RTQ B;  3CBC A;  3IFB A;  3ELZ A;  2RTN B;  5HWZ A;  2QCB A;  2GTL N;  1IJ8 A;  5K68 A;  1OBP A;  4O4O A;  2IZH B;  2AMM X;  2I5V O;  4CV7 A;  1HMS A;  1VWR B;  4NNS A;  3WJB A;  2X8S A;  5LKF A;  1PBO A;  2L9C A;  1N9Y A;  4ZHC A;  1U0X A;  2MWH A;  4YFR A;  2ZAG A;  3HOL A;  4CPI A;  1JMX A;  1URE A;  5F6B A;  1KL3 A;  1SY3 A;  2RTB B;  4M6S A;  2A2G A;  5B5G A;  1AVD A;  2CM9 A;  4U9C A;  4BX6 B;  5HZ8 A;  3B2J A;  2XST A;  1JYD A;  4TKB A;  1KZX A;  4CDC A;  1TW4 A;  2W2B A;  3FMZ A;  3D9W A;  4N7D A;  3HWG A;  3RDQ A;  3WXQ A;  5H8T A;  5LJB A;  2LA7 A;  4YGH A;  4DQ4 A;  2A2U A;  2OVA A;  1YUP A;  4ZFX A;  1EPB A;  1RXJ A;  2X56 A;  1KT6 A;  2VFC A;  3H3I A;  1X8U A;  1Y0G A;  2X32 A;  3BY0 A;  4YKO A;  2OYB O;  4ORY A;  2WPU A;  2K23 A;  2MM3 A;  3DSZ A;  2FHN X;  1RBP A;  3EW1 A;  4LQZ A;  5AJC A;  2JN3 A;  3BU9 A;  1GX9 A;  1YWA A;  3RY2 A;  1MDC A;  1SRE A;  2OL7 A;  2HKD A;  4BX5 B;  4IMN A;  5B5F A;  4TLJ A;  4U8U M;  4QGW A;  4TKJ A;  1LEL A;  2JW1 A;  5F58 A;  2HLV A;  2WQ9 A;  4QGX A;  2RQ0 A;  1VWI B;  3VE1 A;  1LCW A;  1VWF B;  5HTE A;  2FWV A;  3FR5 A;  1VYG A;  3SLO A;  3HTY A;  2KD2 A;  2BHV A;  4XMD A;  3WJC A;  5KHP A;  5D48 A;  1AQB A;  2IFB A;  5KIC A;  2LFO A;  4BX7 A;  3PEC A;  1RSU B;  3NPO A;  1MK5 A;  4YCE A;  4OS0 A;  4LKP A;  4U3Q A;  2A5B A;  4O4X A;  3VHM A;  1Y9L A;  1SWL A;  3C77 X;  3D4R A;  3NX1 A;  4I3D A;  5F6Z A;  5HZ5 A;  1CJ5 A;  1KFF A;  1MX8 A;  1U18 A;  1EI5 A;  3O2Y A;  2CM4 A;  2OFB A;  3PQS A;  5IXG A;  5D45 A;  2OY5 O;  1YP7 A;  2CAM A;  4ODD A;  3SLT A;  1JMZ A;  1X8O A;  3C78 X;  1OSP O;  4KC8 A;  4NW4 A;  3VE2 A;  4AZQ A;  3U0D A;  3P6E A;  4D6B A;  1KGL A;  4WFU A;  4M7M A;  4XME A;  5BYP A;  2MHD A;  3V8U A;  1MM9 A;  3T6F A;  4TNN A;  3BRN A;  1X8Q A;  2WEW A;  3PP6 A;  2OVD A;  1GT3 A;  4YDB A;  3HPE A;  4CPF A;  2RTR B;  2BS6 A;  5F7G A;  5IO5 A;  3RDU A;  1O1U A;  4O3Y A;  4BCS A;  4BBO A;  1BM5 A;  5HAE A;  4YFP A;  4COT A;  1LDQ A;  3SZI A;  5LJC A;  4ZGU A;  2L5P A;  3D97 A;  3RE6 A;  4ZHH A;  1SWK A;  1JYJ A;  3BX8 A;  1Y9T A;  1IKE A;  1DF3 A;  1JZU A;  1DF8 A;  1X89 A;  4YBP A;  1GKA B;  1SWG A;  4EEJ A;  4IRW A;  4LZV A;  2IZI A;  1BWY A;  3B2K A;  3F9D A;  2KT4 B;  1HY2 A;  3P6G A;  3UEW A;  4ALB A;  1N7Y A;  3EMM A;  4Z27 A;  1SWP A;  3P6H A;  4GZV A;  4ZHF A;  3ZWE A;  5B29 A;  5KID A;  1FEM A;  4ORS A;  3WYP A;  2WUT A;  4U8U O;  3ZW1 B;  1HXL A;  4LKT A;  2FKG A;  3WJD A;  1KL4 A;  2FS6 A;  4OEM A;  4GJV A;  2ACP X;  1WBI A;  2IZB A; 
#chains in the Genus database with same CATH homology
 2NNQ A;  1KQX A;  1DZM A;  1T8V A;  3OBL A;  1TOW A;  3ZZV A;  2A0A A;  3FA7 A;  3P6C A;  4R0B A;  4ALO A;  1RLB E;  4UU2 A;  1GT5 A;  4GKC A;  1ADL A;  4A1Y A;  5C0N A;  1JJX A;  1T68 X;  3TGB A;  3ZW2 A;  3ZQ3 A;  1KT7 A;  2JMB A;  3P24 A;  4OMX A;  2FS7 A;  3VG2 A;  2R56 A;  4QAE A;  1BLR A;  3G7X A;  1SY1 A;  3BSZ E;  2LBV A;  1LFO A;  3CWK A;  4WBK A;  2KTD A;  4OS3 A;  2AT3 X;  4K19 A;  2OZQ A;  2W2A A;  1BSO A;  3U9P C;  4BOE A;  2L67 A;  2EU7 X;  5EPQ A;  4GRJ A;  1QY1 A;  2JU8 A;  1O8V A;  1SMP I;  2FR2 A;  1FTP A;  5L8N A;  5EDC A;  3L4R A;  1ERB A;  1SY0 A;  4AW8 A;  2OVE A;  1OBU A;  4KT5 A;  2G79 A;  3QKG A;  3S26 A;  3RZY A;  4XMH A;  4HPB A;  2NNE A;  3MBT A;  1ML7 A;  3F6Z B;  3CMP A;  1KXO A;  2AT8 X;  3WVM A;  3K3L A;  2AH7 X;  4A8Z A;  3CQR A;  3B2L A;  1LKE A;  5HCC C;  1T0V A;  2FLJ A;  3LHN A;  3ZW0 A;  3NAD A;  3Q6L A;  1UZ2 X;  1TOU A;  3NQ9 A;  4HPC A;  2CZT A;  3O19 A;  3ZUO A;  3WJG A;  4I9S A;  1JBH A;  1ZRY A;  4KC7 A;  4QGV A;  2FT9 A;  3P6D A;  1SY2 A;  4XMC A;  3D96 A;  4ZH6 A;  2PY1 A;  3KQ0 A;  4ZH9 A;  2AT0 X;  1QFV A;  4BVM A;  2X46 A;  1QWD A;  4TKH A;  4ORX A;  2RCT A;  2ALL X;  1GX8 A;  2CBS A;  4ZGF A;  4NLJ A;  4Y0Q A;  2XKL A;  3WJE A;  3GE2 A;  3UEX A;  1EW3 A;  1MX7 A;  1G85 A;  5EED A;  3SOT A;  1FEL A;  3I17 A;  3FA8 A;  5DPQ A;  1KOI A;  2L68 A;  4AZO A;  4YGZ A;  1X71 A;  4EQA C;  1CBI A;  1H91 A;  2GTL M;  2QO6 A;  3BX7 A;  3KFH A;  2LBA A;  4FBO A;  2Q9S A;  1B0O A;  4UU3 A;  3VPJ E;  3FIQ A;  1DZK A;  4ZHG A;  2RN4 A;  1A3Y A;  4MVL A;  4YFQ A;  1G7N A;  4O3W A;  5L8I A;  1PEE A;  1BBP A;  4I3C A;  4ES7 A;  3UAQ A;  4CSB A;  4ZHD A;  3OJY C;  1BSQ A;  4I6S A;  3ZW0 B;  1YWB A;  3WOV A;  4KCA A;  5CE4 A;  3PH6 A;  4RUN A;  5EEE A;  4YKM A;  3KZA A;  1B4M A;  4TJZ A;  2QO4 A;  5BVT A;  4NNT A;  4ORW A;  1A57 A;  3WJF A;  3KFF A;  5FQ6 E;  3ZW1 A;  1GKA A;  3RSW A;  2M4L A;  1HMR A;  4AZP A;  1IIU A;  2CBR A;  5EDB A;  1GT1 A;  5K06 A;  4IMO A;  2Z4H A;  2E4J A;  2FR3 A;  1S2P A;  4NLI A;  1XCA A;  1CRB A;  1QFT A;  1GGL A;  2HZR A;  4GU8 A;  4IB9 A;  4N7C A;  3PPT A;  4QQ1 A;  1GXA A;  2A13 A;  3IA8 A;  4GH7 A;  1TXL A;  4EXZ A;  1LF7 A;  2Q39 A;  2X8F A;  1YWD A;  2QOS C;  3JS1 A;  3VG3 A;  1S44 A;  4MIR A;  5DG4 A;  2G7B A;  1OPA A;  1GT4 A;  3APU A;  3B2H A;  1HN2 A;  4ZJ0 A;  3FW5 A;  5HCE C;  2FTB A;  1IKJ A;  3PH5 A;  3B2I A;  3RKG A;  3VG6 A;  2K62 A;  2RA6 A;  3SAO A;  5LJG A;  1DFV A;  1I06 A;  1X8N A;  1E00 A;  1U17 A;  4FBV A;  1I05 A;  3T1D A;  3NBX X;  5HZ9 A;  4AYH A;  1ZNL A;  1FDQ A;  1JV4 A;  1BJ7 A;  4IB7 A;  4PJ2 A;  3KFG A;  2GTL O;  4OS8 A;  1CBS A;  2ACO A;  2HYS A;  3AKM A;  3NQ3 A;  1IFB A;  2ASN X;  1ALB A;  3HWD A;  1SA8 A;  2GC9 A;  3PP6 A;  4HFO A;  3PQU A;  4HWM A;  2NND A;  1CBQ A;  1LIB A;  1FE3 A;  4YH0 A;  1JJJ A;  3OD9 A;  1KT5 A;  4CK4 A;  4ORR A;  3UEV A;  1LIE A;  4XMF A;  4A60 A;  1D3S A;  4GE1 A;  4IAW A;  3FLL A;  3FEN A;  3CQN A;  5AEO A;  3UEU A;  3KFI A;  4GET A;  4GNW A;  2QO5 A;  2O62 A;  5HTD A;  3FEK A;  3F8A A;  3JSQ A;  4D6A A;  3DTQ A;  4INN A;  1EPA A;  1SXU A;  3JQO A;  4Y0R A;  2NP1 A;  1BRQ A;  1LPJ A;  3S5V A;  3TZS A;  1NP4 A;  4BQU A;  1QG5 A;  3HWE A;  1AB0 A;  3STN A;  2R73 A;  5H9L A;  2OFR X;  4ML7 B;  1PM1 X;  1BSY A;  3EBK A;  4PSQ A;  3STK A;  3ZI8 A;  1KQW A;  1QY2 A;  2WR6 A;  2AL0 X;  4IAB A;  2OFM X;  3RBY A;  1BRP A;  4YCH A;  3VG5 A;  1D2U A;  3BDR A;  2WWP A;  1A2D A;  1L6M A;  4MVI A;  5L8O A;  1AEL A;  2AT6 X;  1ZNK A;  3VU1 A;  1IW2 A;  4IB6 A;  3FEP A;  3HK1 A;  5FQ8 E;  2MO5 A;  1OEK A;  3VG4 A;  5HBS A;  1HBP A;  1KZW A;  4NYQ A;  2P8G A;  2W2F A;  5IO7 A;  3STM X;  5IO6 A;  2JU7 A;  4Y0P A;  2WQA E;  4OMW A;  1SXX A;  5HZ6 A;  1P6P A;  3NQK A;  3GAQ A;  3P02 A;  2N93 A;  4YGG A;  3BLG A;  4O49 A;  1LIC A;  2YMS A;  3OE3 A;  3MVF A;  4L3R A;  1B8E A;  4A1H A;  2QM9 A;  5LJD A;  5BVQ A;  5AQ6 A;  1LIF A;  1EII A;  2Q2M A;  3FYF A;  5CYB A;  1JIW I;  1SXY A;  3NX2 A;  1XKI A;  2ZAI A;  4U8U N;  2KW1 A;  3TGA A;  5FQ7 E;  1S7D A;  5HCD C;  1DC9 A;  2Q4N A;  4FBR A;  5LJE A;  1YWC A;  2BS5 A;  4HPA A;  4AZM A;  1Z24 A;  4RUU A;  1KT3 A;  3I0A A;  1R0U A;  1O1V A;  1AVG I;  5LKE A;  4FQB B;  5EZ2 A;  1DV9 A;  1E5P A;  1EUO A;  3EBW A;  2WEX A;  2A3F X;  5LJK A;  1PMP A;  4O3Z A;  5JR8 A;  1EIO A;  4JGL A;  4KH8 A;  3NP1 A;  5H9N A;  1YIV A;  4YDA A;  3P6F A;  1GM6 A;  3APW A;  1I4U A;  4L1N A;  1YP6 A;  5F1E A;  1OEJ A;  3HWF A;  4IB8 A;  4MVK A;  2QMI A;  2BT9 A;  4GDZ A;  1VPR A;  1A18 A;  5AJB A;  3S5X A;  5LJH A;  1OEE A;  3VG7 A;  3U03 A;  2X45 A;  4NYR A;  5FFH A;  1OPB A;  4O9S A;  5D47 A;  3EYC A;  1QQS A;  3BU1 A;  4I9R A;  1ZNG A;  3C76 X;  1ZNH A;  1NGL A;  1IFC A;  4QZT A;  2LKK A;  2YG2 A;  2JU3 A;  5HA0 A;  4DQ3 A;  3FEL A;  4IAX A;  3FR4 A;  2RD7 C;  1HBQ A;  3LV4 A;  3PED A;  2HZQ A;  4QZU A;  5H9K A;  3S60 A;  4KII A;  3WBG A;  1FEN A;  4WHI A;  3ZUI A;  4ZCB A;  1E06 A;  1EXS A;  2RCQ A;  1EQD A;  3FA9 A;  2HNX A;  1OBQ A;  4QRL A;  4NP1 A;  3N91 A;  1DZJ A;  5H9A A;  2MJI A;  4O4U A;  3ELX A;  1ICM A;  3CBS A;  2F73 A;  1G74 A;  4WFV A;  5HA1 A;  2R74 A;  1ICN A;  1VYF A;  1LNM A;  3EM0 A;  2GJ5 A;  3D95 A;  2LB6 A;  3FR2 A;  1N0S A;  1G5W A;  3BS2 A;  2F09 A;  4LZU A;  5D4A A;  2AT5 X;  1X8P A;  2BLG A;  1I04 A;  3AKN A;  4QYN A;  5FEN A;  4MVE A;  4TQ2 A;  3MX7 A;  4HPD A;  5D8J A;  1CBR A;  2OVS A;  4O3X B;  5FAZ A;  2Z4I A;  3APX A;  1DZP A;  1HQP A;  3NR3 A;  4I3B A;  1ACD A;  4QYP A;  5B27 A;  4YMY A;  1KT4 A;  2HMB A;  4I95 A;  3CR6 A;  2GTF X;  4ON1 A;  4QNI A;  1QY0 A;  2ANS A;  1ZND A;  1BEB A;  4AZR A;  3TGC A;  4EFG A;  1QAB E;  4AZN A;  2G78 A;  2X8T A;  2DM5 A;  4ORU A;  2AKQ A;  5BVS A;  2FRS A;  2KTS A;  4FGI B;  1E02 A;  1ERX A;  3HOE A;  2WSJ A;  1B56 A;  3APV A;  2CZU A;  1MVG A;  4IBA A;  3E3C A;  1ZNE A;  4ZR2 A;  1TVQ A;  4Y0S A;  3V8U A;  3FW4 A;  1HMT A;  1LID A;  2JOZ A;  3FA6 A;  1SXW A;  3O22 A;  4GK9 A;  4YBU A;  5HZQ A;  4ARH A;  1EAL A;  1NP1 A;  4ID2 A;  4GNY A;  2Q2P A;  4MIS A;  4O4S A;  4XMG A;  3RWX A;  2POA A;  3TF6 A;  1MUP A;  4EDE A;  3CBC A;  3IFB A;  3ELZ A;  5HWZ A;  2GTL N;  1OBP A;  4O4O A;  2AMM X;  4CV7 A;  1HMS A;  4NNS A;  3WJB A;  2X8S A;  5LKF A;  1PBO A;  2L9C A;  4ZHC A;  1U0X A;  2MWH A;  4YFR A;  2ZAG A;  3HOL A;  1URE A;  5F6B A;  1SY3 A;  4M6S A;  2A2G A;  2CM9 A;  4U9C A;  5HZ8 A;  3B2J A;  2XST A;  1JYD A;  4TKB A;  1KZX A;  1TW4 A;  2W2B A;  3FMZ A;  4N7D A;  3WXQ A;  3HWG A;  5H8T A;  5LJB A;  2LA7 A;  4YGH A;  4DQ4 A;  2A2U A;  2OVA A;  1YUP A;  4ZFX A;  1EPB A;  1KT6 A;  3H3I A;  1X8U A;  3BY0 A;  4YKO A;  4ORY A;  2K23 A;  2MM3 A;  3DSZ A;  1RBP A;  4LQZ A;  5AJC A;  2JN3 A;  3BU9 A;  1GX9 A;  1YWA A;  1MDC A;  4IMN A;  4TLJ A;  4U8U M;  4QGW A;  4TKJ A;  2JW1 A;  5F58 A;  2HLV A;  2WQ9 A;  4QGX A;  2RQ0 A;  3VE1 A;  5HTE A;  2FWV A;  3FR5 A;  1VYG A;  3HTY A;  2KD2 A;  2BHV A;  4XMD A;  3WJC A;  5KHP A;  5D48 A;  1AQB A;  2IFB A;  5KIC A;  2LFO A;  3PEC A;  3NPO A;  4YCE A;  4OS0 A;  4LKP A;  4U3Q A;  4O4X A;  1Y9L A;  3D4R A;  3C77 X;  3NX1 A;  4I3D A;  5HZ5 A;  5F6Z A;  1CJ5 A;  1MX8 A;  1U18 A;  1EI5 A;  3O2Y A;  2CM4 A;  3PQS A;  5D45 A;  1YP7 A;  4ODD A;  3VE2 A;  1X8O A;  3C78 X;  4KC8 A;  4NW4 A;  4AZQ A;  3U0D A;  1KGL A;  3P6E A;  4D6B A;  4WFU A;  4M7M A;  4XME A;  5BYP A;  2MHD A;  4TNN A;  3BRN A;  1X8Q A;  2WEW A;  2OVD A;  1GT3 A;  4YDB A;  2BS6 A;  5F7G A;  5IO5 A;  1O1U A;  4O3Y A;  1BM5 A;  5HAE A;  4YFP A;  4COT A;  5LJC A;  4ZGU A;  2L5P A;  3D97 A;  4ZHH A;  1JYJ A;  3BX8 A;  1Y9T A;  1IKE A;  1DF3 A;  1JZU A;  1X89 A;  4YBP A;  1GKA B;  4EEJ A;  4LZV A;  1BWY A;  3B2K A;  3F9D A;  2KT4 B;  3P6G A;  3UEW A;  4ALB A;  3EMM A;  5KID A;  4GZV A;  3P6H A;  4ZHF A;  5B29 A;  3ZWE A;  1FEM A;  4ORS A;  2WUT A;  4U8U O;  3ZW1 B;  4LKT A;  3WJD A;  2FS6 A;  2ACP X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...