4YFYA

X-ray structure of the viof n-formyltransferase from providencia alcalifaciens o30 in complex with thf and tdp-qui4n
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
241
structure length
241
Chain Sequence
MKKILVISDNYQLVSYIKNLYLSNEEWSKELFIDYSYSSINRNPQSLIELGMTEIDIKNKNLNELNDYHLIISAHCKQIFPAHIVNNKLCINIHPGLNPYNRGWFPQVFSILNKKPIGATIHKMDSEVDHGEIYCQEEVSILSHETSIDIYNKVIELEKKLIKNNLLKIINNELQPKLPSQEGNYNSIQDFNKLCKLNLEDNGSLREHIDLLRALTHGDFKNAYFYDENNTKVFVKIELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular structure of an N-formyltransferase from Providencia alcalifaciens O30.
pubmed doi rcsb
source organism Providencia alcalifaciens
molecule tags Transferase
molecule keywords VioF
total genus 80
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18216 N_formyltrans_C N-formyltransferase dimerization C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4yfyA01
2GARA 4EW3A 4ZZ3A 3AV3A 1GRCA 4QPDA 4IQFA 1RC0A 1CDDA 4R8VA 2BLNA 2BW0A 1RBQA 3AUFA 3DCJA 4ZZ2A 4YFVA 3DA8A 4S1NA 1RBYA 3P9XA 4TT8A 4ZYXA 1CDEA 1ZGHA 1RBZA 1YRWA 1C3EA 1FMTA 3OBIA 2YWRA 5J9FA 4ZYZA 4ZYWA 4ZZ0A 4ZYTA 1C2TA 1RBMA 2FMTA 4TTSA 3TQQA 3NRBA 1MEOA 1NJSA 5CJJA 5J63A 3R8XA 4ZYYA 4QPCA 1GARA 3TQRA 3Q0IA 4NV1A 4TS4A 4EW1A 1RC1A 1MENA 1MEJA 3W7BA 4DS3A 3N0VA 4YFYA 4ZYVA 1ZLYA 4ZYUA 3KCQA 1ZLXA 3LOUA 4Q12A 4EW2A 4ZZ1A 1JKXA 3O1LA 2CFIA 1S3IA 4PZUA 3GARA
chains in the Genus database with same CATH superfamily
2W4MA 4I4TA 4MDHA 3RK0A 3VAZA 3ZXSA 4EZEA 3U19A 1RPJA 3VPAA 4MR8A 2BP7A 3EOBI 3H1EA 4GD3Q 5AKEA 1IPFA 3JAKB 2BR3A 1QC5B 2HLNA 2Y71A 4EMTA 5IASA 3SVLA 2VDKB 4BXOB 2C3OA 4IDAA 1FBNA 4Y6SA 1CHDA 2Z8XA 3V4PB 4B4VA 5KHAA 1ZUHA 4CEIB 4RYLA 3AGQA 1W5SA 3NWEA 3MJTA 1E9FA 3U80A 1Q3HA 1WZCA 5FTKA 3UPTA 2V3CC 2A7QA 4A23A 3A6FA 5HZKA 1UJ4A 3AI3A 1VCHA 2R44A 1GD1O 1YR2A 2QR5A 1IULA 3HB9A 3L05A 4O4JB 4QL3A 3ND6A 3VU9A 1DKLA 2Q3DA 3QKRA 2XPCA 3FHOA 2EIHA 4F84A 3UJNA 2ZP1A 2GZ1A 4MWDA 2OZEA 2CNDA 3A31A 4F4DA 5GWXA 4EDFA 3PRHA 5SYAA 3W3ZB 2JCYA 4BVAA 3KHSA 1IH8A 3KYDA 3LWNA 4MYDA 4Q1EA 5CLIA 3TO5A 5SZJA 3A2MA 1B14A 2HFJA 1IVSA 4YV7A 1NBOA 3OZDA 5DLEA 5BN1A 3WLHA 2FFAA 2ZEJA 3U7RA 2QJTA 3USZA 3LDGA 4NESA 1E77A 2BGUA 2P35A 4RVFA 1MRSA 1YQUA 3BK2A 4R8LA 5FBKA 3RUDA 4ZCMA 3HHPA 4IX9A 4DMKA 4NG5A 4FINA 4EHHA 5A04A 3LSYA 3RNOA 4UHFA 4EKIA 3IP6A 3D8NA 4XI9A 1YHYA 3AHHA 5EJMA 3K32A 3M1YA 1MAVA 3RRZA 2M32A 3D1JA 4ZVNA 3SQOA 3SFTA 3LOQA 3THYA 1JYEA 2Y0BA 4Z9AA 4EHBA 1WM1A 5EHGA 4KGDA 1QNFA 2OV3A 3B1FA 3P9KA 1GR0A 1WU7A 5IAAA 1QZZA 3CZCA 3DAFA 3HYTA 3LLSA 3RH0A 5HCUA 4RTRA 3H13A 1KQNA 2YWBA 2QTMA 3GCXA 4TKUB 2VP9A 1Y82A 3NBXX 4C2AA 5JBIA 1PG2A 2BKLA 2L69A 1XVIA 4HRVA 4Y1FA 4Y98A 3VR5D 5I7RA 1RKUA 4W5HA 1SGWA 2O1XA 2RGBA 1E9AA 3BN3A 1CYDA 2UKDA 1POWA 1HE5A 1IM5A 2JFUA 2NUPB 4MVYA 3STWA 3VR4H 1B42A 1J2EA 1FDRA 2FCAA 4NQZA 5JZOA 4RD1A 5I8PA 5JEDA 5CIQA 1OA0A 4DCMA 2MSCB 2P2ZA 3C0KA 4YXWD 2Y1GA 2W2KA 3DP7A 4RF2A 4B35A 3A6KA 5JSUA 1J90A 2F1IA 2FPGA 2G5PA 3M6MD 2GZMA 3M83A 3PPYA 2SCUB 1TUBA 4PAOA 4DMRA 1KARA 1JQKA 3Q87B 2VWQA 3GUZA 4NRDA 2PD4A 1G16A 1J24A 2V65A 3OECA 4KQKA 5LDHA 4G4JA 1VJ1A 2WUEA 1E2QA 3FFWA 4MUHA 5FLYA 5FWYA 3CV3A 2DMRA 4HHEA 4PYKA 5TQ2B 1L7VC 2FOIA 1YK1A 1YI0A 1GPJA 1ORVA 4DY6A 2JFNA 4GMDA 4RABA 1RXWA 2CUKA 1WSWA 1UANA 5K3SA 2CLHB 3M49A 3DF7A 3QJGA 1YZ3A 4PRKA 5FTJA 5JZVA 3JVVA 3LYAA 4Y7CA 2JIOA 4X3OA 3O26A 3S40A 5CPBA 4AO8A 5AUPB 4UDOA 4RLQA 4AMUA 4KMMA 2ISCA 4PFSA 2RK4A 2W0SA 2WJAA 4KSYA 4D9KA 4DDTA 4M46A 2G9ZA 4MS3A 4FEEA 3LT1A 3L7DA 2PIAA 4R1MA 4MUGA 3C3DA 3LGAA 1Q1ZA 3W5IA 4M1TA 4QLBA 2XE4A 3WLRA 2ZFUA 2BFFB 3DYVA 1A2OA 1O94D 1QDUA 1WEHA 9LDTA 4FWTA 2GSDA 2BWJA 1FFYA 2NZ8A 3AWIA 3UA3A 4NE7A 4MJLA 4LFAB 2FEPA 3D3KA 1F17A 4HDAA 4YUVA 5J5CA 4KG7A 3LBNA 3GOQA 4Q9HA 1DXHA 3A1NA 5LVAA 2FRDA 1M5UA 1CJUC 2OBFA 2Q3HA 3KB8A 4RK6A 2Z5VA 3FAZA 4ZFNA 2JI9A 1UDBA 1C4OA 3W90A 1M7BA 1XEFA 3H9BA 1PR1A 1W30A 2BM8A 4Y2JA 5JWOA 4IXWA 2QLFA 3FPGA 3HN6A 4F6LA 3GNSA 1LFDB 3UYLA 4C5CA 1F2UA 1Z22A 2GPBA 1ZBQA 4JJEA 4YLEA 4B09A 1E3MA 2OM2A 1RDFA 3IQHX 3Q3CA 4MR7A 3MCAA 4PYIA 4QEDA 4A7PA 5JCZA 2X6TA 3CRVA 2QA5A 2VRNA 5D51S 1H8HA 1XAJA 3ZLTA 2PH5A 1O9HA 3X1WA 4CF6A 2CXXA 1LA2A 2BHTA 1G6KA 1O94A 4IIJA 3LQ4A 3QU5A 4GLFA 3EH2A 4YMIA 3TCNA 4E15A 3BJZA 1HL3A 2P2NA 1A9XB 4BVLA 3HP1A 2QG6A 1J0CA 1YL5A 3QUBA 1M2EA 5SY9A 3I0ZA 1OSNA 4CZ2A 3OX3A 5F1OA 4Z8YA 4D4IA 4RESA 4FX2A 4KPFC 4DV7B 3Q7IA 4MR9A 2IYNA 3OOHA 1CSEE 3EXEB 5E9QA 4E51A 1BKYA 3KAKA 3GFBA 1EX6A 4L8LA 4V03A 3LY5A 5KSZA 2I34A 2A0KA 2V7XA 5B1SA 5HKAA 3MRVA 6PFKA 5HK9A 1YO6A 3BXFA 1XA3A 4CKBA 2OTCA 1Z17A 4X95A 3OFJA 2RG7A 4FDTA 5LU8A 4E5VA 4L74A 5AIBA 1I1HA 3HKCA 2V1XA 2VWHA 4FHZA 4K0KB 3DCNA 3QU4A 4YI3A 4EDHA 1XYGA 3LTNC 1PNQA 2BMFA 3O0TA 4NC9A 4A6DA 1FPMA 3QIVA 5CJPA 4XASA 2CL7X 1SD1A 1XVTA 1XWFA 2ZQZA 1R8QA 4R6WA 1G6OA 3TPCA 3RBXA 5LZ9A 5HFJA 1D1TA 4NYMQ 5IBRA 4OFWA 1TD1A 2HLDA 5CK4A 4YXWA 1F2DA 3QBTA 3LBIA 4WEOA 5E0OA 1VI5A 2QRMA 4D8UA 4P3NA 1XDSA 1M0WA 3T7CA 4YP9A 1TJYA 3CNQS 2BGGA 4BWFB 4EGFA 1P4HA 2CF5A 2FF5A 1P62B 3JARA 4EBBA 4A36A 1GV0A 1KEZA 1Z0KA 1UH5A 4QPJC 4IFIA 4A0FA 5A9RA 5KPJA 1NBME 2JGKA 3UY4A 4OQ4A 1A5SB 1TGVA 4GX2A 3IUQA 4AMVA 2F90A 1J9ZA 2J1LA 4J76A 4F71A 1RAFA 2FY8A 3G13A 4EO7A 1U0JA 2BI8A 4CNQA 1NWCA 2ZJ0A 4UZSA 2ZTUA 2HIAA 4PC1A 1PUXA 2H4XA 5JH7F 5EMJA 1TAGA 2WNSA 3GNTA 5DM1A 1DEHA 3ZCRA 4M1SA 5EKDA 1VG8A 3NEAA 4N5LA 3CHYA 4JDUA 4UNRA 1D4AA 1MXFA 2RARA 1PQ4A 2ZRGA 3S29A 2GR9A 5HYVA 5IVDA 3A1WA 1QH0A 4IBOA 3L1HA 3WYBA 4OBBA 3ZVRA 3PGXA 4JT9A 3PNPA 2I2FA 5D1HA 4YX9A 5DPMA 2XCUA 1TE2A 1A2KC 3NWOA 3QOYA 3I5UA 4EL5A 4K87A 2W2XA 2LPMA 2GO7A 1R5OA 3D0OA 3DTTA 4I1RA 4PIVA 1C8KA 5EIBC 3AUAA 3REFA 3NU1A 3E7PA 1I7QB 1W88A 4P9NA 1MA0A 1Y7LA 4PGHA 4AURA 4DKXA 2UYCA 3E35A 3GGGA 5HQTA 2ZIAA 3IUSA 3INTA 4ZCIA 3ZLBA 2QU7A 4EELA 2EC5A 3S68A 1AQNA 1S9DA 2FXIA 3C8ZA 2GHRA 3IQXA 2X5JO 1LF0A 1GM5A 4J2OA 1T2NA 1KAHA 5KTYA 4FNAA 3T1OA 5LIPA 1J5XA 4A2QA 3G2HA 3EQ2A 4ANFA 3FOZA 1U4NA 1A9SA 2C9ZA 3EG9A 4AL4A 4AI6A 1C0PA 3M82A 1SIOA 1E9RA 2D5LA 4RHCA 1JAXA 3JPYA 3HKCB 4NAVA 5WRFA 3JY6A 2O06A 4OJKA 3G79A 3OJOA 5SYNA 2P41A 2ZRQA 5IM5A 4Z3OA 1R0WA 4A6EA 5IWCA 2QLLA 5DBOA 5FPHA 3UMYA 4H08A 1A82A 5DH9A 1IVYA 4CMHA 1Q74A 3H2BA 1YCGA 2QKYA 1T13A 2HJHA 5J2UB 1E3DA 2MINA 3NVMB 3TBFA 2VC2B 2G71A 4I2VA 2DGDA 1GOTA 1KVQA 2YOHA 3VPGA 4K2HA 4R8MA 3UAGA 2DPMA 2FETA 1CT9A 4CNBA 5C2JB 5EHZA 1VPVA 1UJCA 3GX1A 5CFZA 4U1RA 1R4AA 1U2PA 2WKSA 2ZI6A 3GD7A 5ARDA 1L4NA 2QMOA 3AZPA 1E2KA 2GHTA 1BXGB 4YQZA 4P3YA 4B32A 4KC0A 3WKBA 3I6YA 1L1QA 1L3IA 2O0JA 3SVZA 5FUMA 2O8CB 3H1PA 4AU1A 3NOXA 1FFWA 4YDQA 2X8JB 3K7EA 1FFEA 3NOVA 4IIBA 4K6CA 4MP8A 5FO1A 1M1YE 4BTLA 2XA2A 1SCJA 3FAKA 3IUMA 2GK7A 2QM0A 5LP6B 5HM6A 2RKOA 1EIZA 3EC1A 2YZ2A 2VRBA 3LI2A 2BZ1A 4JHLA 3IA2A 5JXHA 2IBSA 1SUDA 6REQA 5CD1A 3S2GA 1IJKA 1ZN8A 1E5QA 1K27A 3GJRA 3ZD6A 1BKDR 1LPNA 2J3IA 4X3PA 1IN1A 2AUTA 3UPDA 1VP3A 3HP7A 4LOJA 1G21A 1GA1A 2NOAA 3DDHA 3U3JA 3NB0A 4JUIA 4R51A 1JAZA 3PPWA 1UDAA 3I09A 1M8FA 5G4KA 3V4SA 3KELA 1V41E 5GAJA 1T9ZA 5ICGA 2HK8A 2PXAA 1FS4A 5JYCA 2I03A 2GAJA 3EQ8A 1QKIA 4D74A 3NKVA 2A9PA 1LI7A 4ALIA 2FPXA 4IMIB 4N0PA 1E1DA 2G9QA 1NP7A 1ZQ9A 1FS5A 3IT3A 3HFGA 1ZSNA 2ZQYA 2FX5A 4FU0A 5K2MA 3CQ9A 3RHTA 5AVZA 3F78A 4ZDWA 1EG7A 2EU8A 3HC7A 4KXYA 1YBMA 1TAQA 1I14A 3HWWA 4HFNA 4F4UA 1D3AA 2M2IA 1TF5A 1OTHA 3BRCA 4HI0E 1N5RA 2PUDA 4HQRA 4KUHA 1W7AA 2CLMB 4FEGA 4R2XA 1I80A 4IRUB 5DIZA 3ZBPA 2BJHA 4D45A 2OUKA 3CUSA 1JE1A 4M0LA 5FI1B 1A72A 3IULA 1AV7A 1YDEA 1KXJA 5KAMA 2FX3A 4BN5A 4EJFA 5EJ4A 3IIIA 4ZARA 5D3KA 1KDRA 4JB8A 2XWQA 2VUHB 2EP8A 3ZZUA 3R7WA 1P7VA 3C87A 1QONA 4CMCA 4AO6A 1T2VA 3N2LA 4OCZA 1L3BA 3FYTA 4ITVA 2YIVX 5DISB 4DZZA 2IIBA 1KK2A 2YXEA 4FI3C 5E8RA 1ISGA 1C0LA 4D2IA 1HDRA 4ZVQA 4ZJUA 1M5RA 5AVKA 1NW5A 4G0VA 1CCWA 2PH7A 3KEFA 3OA2A 4YQYA 5HIIA 1NE7A 3E23A 1OI2A 4I99A 3I52A 2R4UA 5CT9A 2X0KA 2CGEA 2I99A 4GPD1 2PZFA 3AZOA 2HSWA 5JWRA 1PV1A 3BWDD 1XQXA 1EM8B 1P44A 3WYGA 3RR2A 4XKJA 5J59A 3CKKA 5FOVA 5DCYA 4BJ6A 3FNEA 1B8OA 1ZJYA 1YULA 2H4FA 3K73O 4G5QA 4GKBA 1SUEA 1Q16A 1U28A 4JI0B 4OM7A 3IB3A 4X93A 1ONPA 5LB2A 5IVPA 5BXQC 1TLLA 3Q5EA 4YASA 3F3KA 4M0UA 2LR0A 4KWIA 4M0KA 2BHSA 3DAHA 3F67A 2H17A 2J31A 4DIFA 1TNDA 3OIYA 4B6EA 3GDHA 5IP5A 3U44B 2O8BB 4GZ3A 4OXKA 2PGOA 1FF9A 1ZZGA 2DKNA 4M89A 3GLIE 3IUNA 4K46A 1FSZA 3DP9A 3R76A 2YY5A 2ZBRA 3LP6A 1E66A 1ZBDA 4OMUA 3D5TA 4QPZA 2CEAA 1NAIA 4JLBA 5JBQA 5EFZA 1A9PA 4FKZA 4EKYA 5JMWA 1C1YA 1RXCA 5G0VA 3WC4A 3VPXA 3H17A 4QNRA 3R5TA 3HEMA 2ACKA 3TNYA 2FHSA 4OEHA 2CXTA 1VI2A 3KXIA 5DM4A 1E94E 3DOCA 4LXUA 5AM0A 5AWFC 1W49A 3D6AA 4BNWA 5C5IA 5KU1A 3ZDCA 4PHFA 2PWBA 4N0QA 3DXFA 3G7SA 1VA4A 2BP7B 2QN3A 3HKBB 4RZUA 5EUQB 1RLTA 4O29A 1BDJA 1WXIA 1U2GC 1JKJA 4HNHA 4OXXA 3L0PA 3D7KA 1ZITA 1V0JA 4B8WA 4DZTA 2OUIA 2LXNA 1P45A 1UZMA 3VKFA 4LYDA 1Z56C 3EQ9A 1YZYA 2D7CA 3HXQA 2FW7A 3LQKA 3GLQA 4GZ6A 4PYMA 3WMFA 4D97A 5JDIA 1DRWA 3EW7A 2BEWB 3E9ZA 2C9BA 2ZB2A 1HRDA 2AKYA 3A11A 5ALXA 4PPNA 5EJ5A 2C3UA 1K8XB 3QXJA 1CJTC 4CV3A 1NU8A 1XZCA 3PKIA 4ZDKA 2OG2A 3OA0A 4IUYA 5DCLA 4B6OA 1X1AA 3QPUA 4FMCF 2YHAA 5K3CA 3L0YA 4RQAA 4UTNA 3DDZX 2ZRCA 2JEYA 3C2QA 4J0GA 5CT4A 1GCAA 5DVZA 4HTFB 4AC9A 3N2YA 3BCHA 4CCWA 5IN5A 3ZG6A 2H85A 1DRKA 4MVWA 4A91A 2CWWA 1H1DA 2JLRA 2XDAA 3FLEA 3K53A 5JROA 5KB3A 1R2QA 5B1HA 5I5GA 3RREA 4YQFA 1ST3A 4D0NA 2XCLA 4Y6LA 3RQIA 1PNVA 4R83A 1X1TA 1PD0A 5AP9A 1AN9A 4WN9A 4O4HB 1FVXA 3LUJA 1Q0RA 1VFPA 1SRQA 1OCEA 1ORTA 1YD7A 3C6BA 4MV0A 4AF8A 1JAHA 2W58A 1C8LA 3A4YA 3PQ6A 3TTYA 4BY9E 4GZMA 1YR3A 1X7ZA 4DM4A 1MT0A 3PFHA 1O6BA 2HMVA 2QTZA 4UDYX 4NIMA 3U6KA 4LRQA 2W42A 4CF3A 1ABBA 3T7KA 4KVFA 4TGLA 4GWKA 5GV8A 2Y1XA 2ZVPX 3HL0A 3DDOA 2ZAMA 3O90A 2Z3WA 1IN8A 1AKRA 4KIWA 4OQFA 1MTOA 1OPRA 2JI8A 1G7RA 3GNQA 4E6PA 4ZQFA 1JJ7A 3FCAA 3HO6A 5FT9A 2FZGA 3CU5A 5KOIA 1CBUA 2BCGY 2RMKA 3INGA 3QXCA 4BRSA 4JXZA 3M5CA 2IEYA 1IAQA 5GOTA 3NIWA 2CYAA 2JEOA 3N59A 3PCTA 4KDEA 1TTQB 4P38A 3W6ZA 4F2HA 1RJ9B 1XNGA 1XQYA 3AONB 4RHYA 3S5JA 4WNYA 3U7IA 4PRLA 1RM0A 2XLCA 3JRXA 4HAIA 2ZPAA 4YJFA 4I0WB 4XH9B 5JD4A 4MO2A 4RTSA 1U81A 1TU0A 3KKQA 3DAYA 4D44A 2OOKA 1IOLA 2QLNA 1CUCA 1NUQA 4QUIA 5I9TA 4NHEA 1XCPA 5AVQA 2JIZA 3HZZA 4TKUA 1ES9A 2DUNA 2HU2A 2O8DA 2ODEA 3FKSA 1KQPA 4QYMA 5ELLA 2N1MA 3WNQA 4EATA 3OQMA 3IJEB 4B81A 4DV6B 2H1HA 1Y42X 4HD8A 1XPUA 2P8SA 1RKVA 3M6UA 2QB5A 2CNBA 3EEFA 5CVEA 4CMEA 4Q4LA 4XD2A 5F3RA 2RGWA 1E99A 3K0KA 2HW8A 3EGWA 1WCXA 2P9YA 3PC3A 1H0HA 4V0ME 2ONKA 3IKJA 2H3HA 3OQ1A 4ZVUA 2GJ8A 3IJPA 5ADUS 1PEAA 4DR2B 2P78A 1EK5A 3DC7A 2ZTMA 3TVDA 3ICVA 1PT9A 4IFEA 4L3WA 2DECA 3BZUA 1YE8A 2J4CA 4UUQA 1MH9A 3NNDA 1DFGA 1B2LA 2P90A 3FPSA 5C5CA 2ZSFA 3CLHA 1E2EA 1YCDA 1MX3A 4FN5A 4IJVA 1EE9A 5EZQA 2BSXA 2Y1OA 4HUTA 4WASA 1WP9A 3GN1A 3IPYA 1DQNA 4LN1A 4JH0A 5ECYA 3GA7A 4MVCA 4XGQA 1FTWA 5F51A 1T9DA 1IWOA 1J00A 4M3NA 3RUCA 2DLNA 3ODPA 4L16A 3QKRB 2PUEA 4X1KB 1EFKA 1UOPA 3I62A 3UT0A 5ALHA 5C1BA 1QV6A 4X8LA 3WGZA 1CUUA 1T6BY 1WBJB 3HZRA 4ITRC 5H02A 3W2FA 5I7FA 2BBTA 4E4RA 3KZNA 3V1NA 4EHAA 1TTTA 4LG1A 4KR3A 2WYVA 2BFPA 2IX3A 1P77A 4MK4A 4RXMA 4TLAA 3SIRA 2HJRA 1OWMA 2WF8A 2BE7A 1Z5OA 1NMXA 4DJJA 5I4CA 1B26A 3D4IA 3IP1A 3BHJA 1TYCA 1O0CA 1TW3A 1AHHA 5GMOA 1JLRA 3LAWA 2R9VA 4MVJE 2VBIA 1EG2A 2XTMA 3H9QA 4FGKA 1JZSA 1U2GA 3FYHA 3OJEA 3OM0A 5T3YA 2AOVA 1RZUA 2ID4A 1U0EA 3GAFA 1SRRA 1MOPA 3E84A 3DT6A 4DCCA 2PRZA 1JEDA 2IUEA 2QUJA 4LHYA 3ZHXA 4HH4A 1JTFA 4DA7A 2H4HA 1WMFA 3B89A 1XALA 3A9RA 4NBUA 5AM4A 1W4AA 3PTZA 3VH4A 2Q07A 3IAFA 1IN4A 5A5FA 2IEIA 1EWTA 2P0YA 2QN7A 3WX0A 3PL5A 2PZBA 1ZRHA 5KX5B 1HDIA 3RSOA 1WUHS 5BT8A 1LSJA 3FMGA 2PEYA 3HNRA 1ZOOA 2IVFA 4GDMA 1IAVA 3W6PA 1VMKA 1R4MA 3EK2A 5CLJA 2JK1A 3U60B 1ZUNA 1PS8A 5ALGA 2J3LA 3GFTA 4DSNA 3AB3A 1NZDA 1PCXA 1H8HD 1SH7A 5G0WA 1U0SY 3ICWA 3I9MA 2DH5A 5AI0A 5CFPA 3ZE6A 1UBTS 1ITZA 1XRLA 1BXRA 4PLTA 3VBEA 4F9TA 1JSRA 2OMKA 4Q7EA 3TCKA 4GC5A 1GT91 5BSVA 1P72A 4E13A 5KNLA 1PF7E 2B3DA 3RV3A 4MLDA 4RD0A 3TTXA 2C8KA 3K2IA 3ROKA 3M6IA 3PEWA 2QY6A 3KP1A 2XODA 1DS6A 1DCMA 1P2VA 1V16A 4YUZA 4YJ2A 4G63A 2JARA 1F14A 3KOWA 4BDSA 1F4VA 2CJWA 1B15A 4Q4JA 5ESDA 4IVQA 3NH9A 2XGOA 4D4LA 1GGHA 2HX1A 3B7GA 4NY1A 2F6RA 3TKYA 4XQ9A 4HWTA 4PYRA 5BQOA 4A8PA 5K9ZA 3UGTA 3JQ7B 4O1IA 2AK2A 2QDKA 2P9TA 4N1AA 5F5XA 5BYJA 5I4KA 1QAQA 4UPVA 5SY6A 4GBMA 5DFAA 4JC8A 3ZKWB 1SBCA 3TBKA 2XE6A 2J6IA 5DYIA 2B83A 1LI4A 1XRPA 2VJYA 3RU3A 1PVVA 2PZMA 3KKPA 4IV5A 5TQ0A 4QGSA 2C8LA 5M34A 3WQHA 2ZI7A 3FDIA 3P45A 1P1FA 2R86A 3BEDA 3EFOA 3FR7A 1DXYA 1HG0A 1L5ZA 3OPVA 4JYAB 5HF5A 1L8OA 4RWZA 2I4IA 3CMCO 1JB1A 4HDKA 4RZQA 5IKPA 3TR5A 4NECA 5EJ6A 1XUOA 1DWQA 2C97A 1DBPA 3H8SA 4JL6A 5DSTA 3THSA 3NV9A 1YDGA 3O31A 5KNDD 4F21A 2WUGA 5JDCA 1J6UA 3NYRA 1OH6A 1YZHA 4UNPA 1VGRA 3LHKA 3K5IA 2PHZA 3CN7A 4IIYA 1U11A 2JRCA 2X40A 1DCKA 1HDOA 3GRAA 1KVRA 2EW2A 3JALA 4LGCA 4P98A 3JV7A 5AKHA 5EN4A 5PGMA 3MWEA 1DCTA 3CXRA 3WK4A 2JGDA 3P4YA 2EZUA 3CKYA 1VM6A 5JALA 3COZA 2W6ID 2EFJA 1KZ9A 1YRWA 3I4CA 2V7QA 4OXIA 1G8AA 1O96A 3SIXA 4RL6A 1ZJWA 2VUUA 4PQRA 1N1DA 1N8NA 5BOSA 4OQLA 1MORA 2ZSUA 3WNVA 3RS4A 1J1ZA 1TGYA 2RGEA 2BY4A 2WNHA 4F86A 3WLKX 3DFUA 2YXNA 1PYGA 4MLZA 2J8ZA 4GX5A 4ZOAA 3KCQA 1M5TA 3T4XA 1GGJA 2Q5OA 4FFMA 3G2OA 1P80A 5A0FA 3VR5A 4YMHA 2FG6C 4KWTA 1CY8A 2E0IA 3NBYC 4FONA 3NASA 4OO3A 3WMWA 1AKVA 3OMXA 2VCYA 1I6WA 3G8AA 5KHOC 1GT6A 3L4BC 4BN0A 3IEMA 1KO1A 4H18A 1NC3A 4BLTA 1P0MA 1TO1E 3IODA 1ECCA 4GKKB 3VR2A 2WILA 2KSQA 4DJDC 1PZGA 4L95C 4F1WA 1OGIA 4ZT3A 3GJ3A 3TM4A 4DIKA 4XVCA 1ILEA 4CM5A 1CJKC 2YXBA 2OYCA 4HLDA 2QU8A 2B6NA 1CFJA 2Q5CA 2VWGA 3NW9A 4YAIA 4RX1A 3LX4A 2A35A 2R0QC 4UMDA 2PFGA 4D0SA 1Z36A 1K6MA 2H7YA 4RDXA 3IPLA 1FP6A 3IR5A 4QU9A 3WYCA 1QG2A 5KYUB 1YCHA 1DB3A 1PU2A 2ZVJA 2PYIA 4M38A 3STYA 2ZCVA 1KBQA 1IZZA 5H4HA 5LZ5A 2ZSEA 2XKJE 3WNDA 1WKCA 4EJSA 5EIWA 1L5RA 5TVKA 2J5XA 3LPLA 4YAJA 1L5GB 3C7DB 3IOBA 1KDVA 4MAAA 4B76A 1J5PA 4Z86A 3RHFA 2Z6UA 4BWGA 4HSGA 3TKAA 4S24A 3QVUA 2WYUA 4MWCA 1NVVQ 4PG8A 1T3TA 5K1ZA 1F48A 3OQHA 4LNUB 2H7CA 4ZZIA 1MW8X 2ZZMA 4CE6A 2D74A 1UBMS 4G0YA 4Y2VA 5TQVA 3VDMA 5ILGA 3T3HA 3DFMA 3AF1A 1ZK4A 4X54A 4LJRA 4P7KA 4I3HA 4XLZA 3VDRA 4X1OA 3EDOA 1GPDG 2JHGA 3TZLA 4R1OA 2WYIA 1ZD5A 1FXWA 4OOFA 4BFTA 2PKWA 4B83A 4CN9A 4ZHQB 1Y48E 3NC1C 2JJ1D 2QM7A 4LMAA 1H2EA 1OJLA 3I92A 3NWBA 2PUVA 5FP0A 2YZMA 2EG5A 2RGDA 2X13A 3KJQA 4P0PB 4GXQA 4ZO9A 1E5XA 1U1DA 1WXQA 2FPGB 2AWNA 1X1QA 3G2LA 5DYYA 5JEEA 5EQFA 5HWSA 2BGJA 4C06A 4FBMA 3AHIA 3I2IA 2EHDA 1TYAE 4GYKA 3K3PA 4CFSA 3ZE0B 5M04A 4L6IA 3SVTA 4KX3A 2ODAA 3E9CA 4UQLA 1YI1A 2VP0A 1R66A 1K4KA 2PNFA 3F6CA 5CUQA 1I7DA 3QPVA 3TZKA 3THWA 1J4AA 2OORC 3FLAA 2Y6VA 3H8WA 3U31A 1JVBA 4NEGA 2PWYA 1TRHA 1Z12A 3IBFA 4M37A 4QUAA 4BKPA 3TQIA 4IJ5A 3M5DA 3E1GA 3KEOA 3ILXA 1CD5A 3MMSA 2LRHA 4JJ4A 3HDYA 1N4AA 1SMKA 2WVAA 1K3FA 1NRIA 2O2CA 2EBHX 1M2HA 4FFPA 3L07A 4D56A 4KDFA 1P3JA 2IHKA 3LUPA 1SOMA 3KTDA 2JCXA 2V7TA 3W78A 5IZCA 3RT7A 1X14A 5FH9A 1GZ7A 4P0TA 2PMDA 4JEMA 3CNEA 1JWBB 3A6GA 2Q3EA 4NU6A 4EX6A 3JASA 4EHIA 8MHTA 4FDUA 3I1JA 4XJXA 1DOHA 5KNDH 4EKGA 1P6QA 1JHZA 1XRRA 4UBKA 3ROZA 1XG5A 3BC1A 4TLBA 3V2IA 5KYUA 3ZHUA 2ZI3A 1QHGA 2HWWA 3VR0A 1N0VC 1R88A 4OMDA 1NVEA 5FNVB 1ZPDA 1GPYA 2O5EA 3U7GA 1FJXA 1PQUA 4BLRA 5DP1A 2C7GA 2X0EA 1P29A 4U2GA 2F4VB 3DKKA 4XDZA 4GEGA 2GVDC 5DI3B 4QYXA 2C2HA 5TF0A 1NM5A 3TTVA 1MKYA 1J06A 4F60A 2IYEA 1AXEA 3EVCA 2ZKIA 4ZO4A 3WYEA 4CDRA 1CY7A 4EJ0A 5B36A 4K9SA 4UEWA 3C6ZA 1O96B 2BMDA 1KPIA 2E1PA 3Q8WA 5KQMA 4OA5A 1FVFA 1T29A 4HS9A 5CVDA 3T7RA 3WRXC 3CEMA 4Y1EA 3VR5H 2ZUWA 4UHEA 4REMA 1FFXA 1RKQA 4B6GA 3GYGA 1Z7GA 4BP1A 5HZMA 3L7JA 1VZ3A 4IHQA 1NQWA 2ENWA 2WM3A 3I2JA 4NYJQ 4MGHA 3PR1A 2A3NA 3NBKA 2ZYVX 4FGLA 4FP9A 3V8RA 4DLLA 2GCNA 5JHGB 4EP1A 3MERA 4S05A 2ZKLA 3E1KA 3FG9A 5JAHA 5E4YA 3AR7A 2O0LA 1AK2A 4D8TA 4CMEC 1HPLA 5JUWA 2W6JA 2YS6A 2GKSA 4DMMA 1VJGA 4W7HA 2GTHA 4ECAA 1PTJC 3FOWA 1NNLA 1P6UA 4KQGA 4TVSA 3UIEA 4AN0A 2D4HA 3QOXA 1VYUA 1HDYA 1YFLA 1QWOA 4TMTA 4EX7A 4MX8A 3SR4A 1P2DA 3DZDA 4LRYA 4KPEC 3NHYA 3SSAA 1PK7A 2SNIE 3L0BA 3ONEA 1SKMA 1DBSA 3CZ9A 2O2HA 4ZEOA 2QRGA 1JKIA 1M2KA 1QAMA 3BG5A 2R5WA 4G4IA 4M88A 4NXNB 3ADPA 1YE3A 4JUAA 2CHUA 3D3EA 3V97A 1WY7A 2C5FA 1E60A 3PE4A 5LMCA 1QX4A 3RADC 1DEOA 3SCZA 3FRHA 4HBGA 4B3TB 1KFKB 4AJ2A 2WDPA 3N8HA 1M8PA 3V2UA 3VU0A 3O83A 2O48X 4EA6A 4DDWA 2C42A 4HKTA 4N3BA 3VFDA 2IXBA 3I53A 3BRWA 3N2NA 4U6NA 1PI3A 2VN8A 4K9MA 1P60A 1PX0A 2I8LA 2O3JA 4H27A 3O8NA 3ZJYA 3AETA 3CX8A 3NAZA 1B73A 4LAFA 2XXJA 3RS8A 5A06A 4Z7QB 4NJMB 3B1WA 4LHSA 2YJZA 4AWBA 3ZVMA 4Y30A 4LC9A 4OM8A 1M2FA 3D7MA 1ZSVA 3OZVA 2JHCA 2NU9A 1EEXB 1IRIA 2PVPA 1CJBA 3GAMA 2DXIA 1VL0A 1TUEA 3O7WA 2ZE6A 3U1BA 1OB5A 4MIEA 3OFVA 1N6PA 2P91A 4P83A 4PIPA 4G26A 4UU7A 2QN2A 1D1PA 1A8SA 1NJ2A 4EYQA 1TJNA 4F5YA 1IEVA 1S3FA 1W29A 4HUQA 4U8HA 5JQWA 3AU9A 5D6OA 1M33A 4DQXA 4MRAA 1M1UA 2ALJA 5THXA 3NIDB 2X22A 3UHPA 4AJKA 3R6TA 5D3MB 3VO9A 3VR2D 2W6NA 3B5IA 4KDRA 1QTRA 4XQ0A 3VUEA 1VMAA 3X1YA 1G6HA 1PSWA 1ZCZA 2R6GA 4MQLA 4G1EB 3JD1A 4P31A 5G4KB 4J6FA 3WGTA 4HSEA 1H22A 4OSEA 4R8VA 4R1UA 1LPMA 4LXTA 4EI2A 1SVKA 4H4CA 1EHIA 4WT7A 2JANA 5KSOA 2AL7A 4G5YA 2FUG6 4M6WA 4YS6A 4O4LB 1REQB 2QG4A 3QM1A 2HMAA 3OOWA 1H1TA 1MB2A 4BMDA 13PKA 1RQXA 2B1JA 2ZJAA 3RVPA 4MZXA 1XCLA 4H77A 1ZGJA 1N7IA 2FWAA 3PZBA 4FDLA 2WKQA 3B7PA 3MLEA 4GI7A 4HOYA 3RQSA 1WPRA 1K06A 4FCTA 2I55A 3F5QA 5HQ3B 2ZB8A 4HF7A 3A1SA 4LE2A 1JSZA 2XTZA 3R3JA 5E2BA 2G5TA 3LXXA 1P9OA 4E2YA 3KBBA 1CF4A 4LQDA 2OP0A 3KUKA 4OI4A 1NUUA 1M34A 521PA 1FTGA 6LDHA 2YJ5A 4WOBA 4P5EA 3QVWA 1J42A 5B6JA 2R7MA 3SKXA 2P11A 2EQBA 1FSPA 3DE1X 4N65A 4OKSA 4RM3A 4URVR 1H3EA 5LU9A 2O50A 9GPBA 2F1JA 3EGVA 5AHXA 5DWVA 5L3QA 1D5CA 1DXQA 1TZBA 3AUUA 2QW1A 1BXZA 4RZIA 3CTMA 4RWEA 3EWNA 4KRGA 3RRYA 3TEMA 4D9EA 3R09A 2C2MA 5CG2A 1XZNA 4OGGA 5A9SA 3LPNA 3PWTA 1YT5A 1V1RA 3OZCA 1U3TA 2V54A 4YFYA 5D6NA 2ZZKA 4HV4A 3M4XA 4UOEA 3V4RA 4TYYA 4LXXA 4EG1A 1NW6A 3AFHA 3F9CA 3RG2A 3IILA 1M10A 4EWLA 1LBIA 3ASZA 2BMWA 2DU8A 3A6EA 3JQAA 1E20A 3MJVA 4OAPA 4KLRA 3QMVA 1ND5A 4FLFA 2ZIVB 4H4EA 1Z26A 2M6RA 4YLYA 1CQZA 3O1HB 4COOA 4LA4A 1NVVR 1SKQA 2ZIXB 4YDRA 4AULA 4BJ3A 1N2BA 4FDVA 4Z4FA 5FI3A 2HT1A 1XD2B 1G42A 4V38A 3GUVA 4LV8B 3WKDA 2OSBA 1G4AE 4I55F 4RDIA 3OOSA 2JAXA 2FMXA 5C8DA 1X42A 3G1WA 4G6ZA 4FUTA 4JLVA 4W82A 1P9LA 2QV7A 4PQFA 2BGLA 1S3GA 3HEBA 4NFLA 1JXOA 5EERA 1NYQA 2BRUA 4DDVA 1NQOA 3GAZA 3DLCA 2GFHA 3KTFA 2LTAA 1ZJ5A 3QE4A 4RZ2A 5ECDA 1SXQA 1QBGA 2F43B 2VJKA 3H18A 2EJTA 2JBWA 2WABA 3OPYB 3HPQA 5LUAA 5K0JA 1H9BA 3OUZA 5E95A 4EA7A 3KFLA 4ARVA 2VQ6A 3BIOA 1VB3A 4IEEA 1XTIA 3HVHA 4DDKA 1H5NA 1TO2E 5KMGA 3PT9A 4JVSB 3E27A 3II6X 2JVIA 1HBJA 3FFAA 2HM7A 1DAFA 5CB8A 1DPFA 2X0JA 3U1TA 4PR0A 2IFTA 4WN3A 4EKEA 5B37A 3SXJA 5IAEA 8ADHA 5C37A 5ICMA 4WXEA 5D1NA 1JIKA 3GLUA 3HS3A 1EWKA 4HVTA 1PGNA 3RIEA 1V7QA 4MPTA 1RWNA 1Z29A 1JZQA 1TLTA 2H57A 3GQBA 5ALQA 1VBMA 3ROEA 4C03A 1TZMA 3NBMA 4M1QA 2W2NA 2XGGA 3NRCA 5E6SA 2BE9A 2REBA 3CBGA 1NVTA 5IAOA 3KG2A 1O5OA 1NQ5A 4TV9F 2GA9A 3W1VA 1VLVA 5L6MB 5ITZB 2BTEA 3NV7A 1AGNA 2DQZA 3G3EA 3KLNA 1OAOA 3QE3A 3HCRA 4WXYB 2VZ0A 2ZRAA 1KZ1A 4YP0A 5E0KB 3ZE9A 3WB2A 3HFJA 2P68A 1GLVA 4Q4HA 2W37A 3KJIA 1DT5A 2C9DA 4LOIA 3S0JA 5BN5B 3DMTA 3A9TA 1GYQA 1CRWG 5DBEX 3C3PA 4KMSA 1PJRA 2XRMA 5EMHA 5FF9A 4FMPA 2EFGA 2I62A 5ES3A 3K0SA 1IJEA 1CDOA 3CUUA 3RKRA 3DMDA 3DGFC 4L4XA 5LM3A 4Z1MA 4EW6A 4DCGA 2OV6A 1KQOA 3RS0A 3K6SB 4LDPA 3MG9A 1N7HA 2HBZA 3PC2A 2RG1A 4PGFA 1HYEA 3KNZA 3TSWA 5DF1A 4D8WA 2KE5A 3AU8A 3P97A 3ORQA 1ZC4A 2FKAA 1NSTA 2DTXA 2POQX 1JVSA 1KYVA 2X15A 3LLMA 5I4IA 2E4ZA 1NZJA 3OAAA 3L5OA 4JBGA 1BVYF 4KAFA 3TI7A 4B84A 4BB0A 1JFFA 2W9XA 4DMLA 1KMQA 3DT9A 4UOQA 2A5GA 2QVZX 2IV3A 5KYNA 2H6EA 1BGWA 2DPXA 1H8EA 3WL7A 3P71T 3DM5A 2ZSBA 2HXSA 3AMVA 1KBZA 5T4EA 3EBLA 4DARA 1GNVA 1B23P 2DJIA 2PKXA 2PSFA 2CNOA 1Q15A 4IIGA 4LYHA 5FAKA 1UOEA 1B1AA 3DLHA 2V3VA 3JQ9C 4KVAA 4IIJB 5CFNA 2H9AA 2E37A 2OLKA 1UJ2A 4Q0MA 1WZIA 4RANA 1SVSA 2G7ZA 1DOZA 2PMFA 4XUEA 1MN6A 4F92B 1AKMA 1NONA 3SJZA 5KUTA 1KZGB 1THZA 1KHTA 3LCRA 3OX2A 4BB5A 3KJNA 5JS6A 4ND6A 3PNLA 3TQTA 4UFOA 3RJ9A 2F64A 2PLWA 3LUGA 4JU8A 1IPHA 4YA6A 4ZVLA 1U2TA 4DLKA 4DV0B 1JHAA 2KX7A 3NVAA 2ABWA 1NUSA 2OO5C 4UBNA 1I2ZA 3VX3A 1L4LA 4JI4B 3T3DA 3RAFC 4GEKA 2R4QA 3FW1A 1IHUA 4DSOA 4NXMB 3QFHA 4N7JA 1L2TA 3FGNA 2FW8A 1U8XX 5ETJA 4AG6A 5IBPA 4G0ZA 4OH7A 4N0MA 2IQ5A 2VP6A 5DEOA 3QEOA 1CQIB 1KQ3A 1BMQA 1TCUA 5JMTA 2O8BA 1QZ3A 1VRCA 4U2KA 3N74A 3E2PA 3V80A 2E4XA 4UCXA 4L4RA 1VCNA 3L7LA 4GE0A 4HPWA 4MCHA 3ESDA 3JATB 1PR0A 2DWUA 2G0TA 2JGJA 3BBPA 4J94A 1QGAA 4JQYA 2ORIA 4LXHA 3VUFA 4FX5A 1BEEA 1J99A 3HU2A 5EWLB 1SQGA 4ZCRA 3I76A 5IX8A 3WQQA 1UP7A 7MHTA 4B79A 3BSSA 4YR9A 5JRDS 3BFPA 5F5LA 6YASA 1H9AA 2NG1A 3R9WA 1L5WA 4BEBA 2OO7A 1NTRA 5KQGA 5B2ZA 5CK5A 3KT3A 1QQ6A 1C29B 4FWIB 4HFJA 4ESEA 2VBFA 1FBTA 1NTOA 1R0KA 4G1CA 3EZ9A 4IJMA 4IZOA 4KGVA 4C4AA 3IDSA 3UYKA 4DSAA 2K7FA 4R01A 3TUIC 3IVAA 1DBIA 2O1EA 2XQIA 3W04A 1W34A 4GM0A 4ZVPA 4BN4A 4AG5A 2ZT8A 4WXRA 3HDQA 1D5WA 2G83A 3EB9A 4W6ZA 3GJ7A 3KK0A 3QUTA 3QVKA 4C1BA 2XUIA 3IBSA 3HVKA 3QI2A 3ROFA 4YH1A 5LOVF 1U8CB 4AKTA 1GPWB 1Z5PA 3M1LA 4KPUB 1XEWY 4CMJA 4DUYB 4J4BA 3TGLA 1QV9A 4N49A 4FFNA 1CETA 1WR8A 3M6VA 1R9NA 1LV8A 5LOVB 2PUBA 1KETA 2PAFA 4H1TA 4P4GA 4PG6A 2A1TR 5EXDA 5LC1A 2P6RA 5TT1A 1L4MA 1USWA 1XT6A 3KB6A 1Z6XA 3QPCA 2CLEB 4G81A 4MGIR 3WJ7A 1KIAA 1RKXA 1S2MA 4DSUA 3C6QA 3N2IA 4J0IA 1RBMA 3HVUA 4YUWA 3G8YA 2JFQA 1TAHA 2ACVA 1XHLA 3M4NA 2FSVC 4HYEA 5LQDA 3TIVA 4LDZA 3U7FB 4CG1A 1Q7TA 4E5PA 2ZE7A 2FI1A 3V3TA 2NX2A 2C1XA 4HCJA 3IRUA 5CYPA 4RY0A 3A2KA 2O3TA 4F2DA 1BROA 3PFWO 4CM8B 2CBGA 1IBSA 2A5FA 2Y2UA 4BECA 3OCWA 2CFTA 2LCFA 2WTBA 2C7VA 3IXMA 3N6RA 4GYYA 2DSNA 3AH8A 3PFBA 4S2UA 4C7MA 4EJ6A 3ZW9A 5KMGB 1TD9A 2ZS9A 4J0QA 2B3TA 3PBKA 4BKRA 1R5BA 3VKVA 1GSIA 4AKHA 1XVAA 3G8DA 2ATCA 4E46A 5JJKA 4IS3A 4U9HS 1RHRA 2O4CA 4EFNA 3MD0A 3GPBA 3AZQA 1PR5A 1B43A 1XC7A 3C1AA 4MVJH 1A9QA 1TMGE 4CEJA 2C1EA 5JYBA 2C78A 4FM9A 3UJ8A 3KT6A 3ENZA 2OK7A 3N8NA 1YJCA 5JCPA 3PZRA 1XE3A 1FLNA 2G77B 1QGUA 5G2OA 2FWBA 1NNI1 4F6RA 3OH8A 3QV2A 1OLSB 4C20A 4GRDA 5F76A 3QELA 5EWMA 3ZXIA 2JVKA 4CEHA 1SOUA 1IHPA 2VHTA 3FROA 3HY3A 4XA8A 3RROA 1KR2A 3RVDA 3ZCXA 4CIYA 2GAIA 5KEIA 4L3OA 1RC0A 1W36C 4EB6B 3F49S 5KCMA 5LXTF 2WMOB 3RJ5A 1Q0ZA 1EQAA 2ZT6A 1KJZA 4OJTA 4DCSA 3ORFA 3LNTA 4X3CA 3QPBA 1C8BA 2PX0A 3P9PA 4WW0A 3C15C 4BZXA 1V5FA 1NW3A 3R8XA 3V5NA 4MR8B 1S0UA 4EY5A 1EP1B 1M2WA 1V26A 3PXBA 5K0GA 2VOJA 2IPAB 4H7EA 2Z98A 4DC0A 1NQVA 1IZYA 4LY0A 1RABA 4N3AA 3ZPXA 4D26A 1MA3A 1Z0DA 3HCBA 3NBAA 3CW2A 2ZAIA 2BMJA 2C5SA 2CSUA 3A2NA 2LIPA 1JSXA 2P9GA 1WB6A 1E0SA 2W6JD 3BTSA 3CEAA 1X19A 3QFSA 1BHJA 3MTAA 2B94A 1FSFA 3LYHA 3QITA 2OORA 4ZALA 4MP3A 4B87A 1V1MB 3F73A 1I0ZA 1SXHA 2XGJA 3T4UA 3A9VA 3AUTA 4I50F 5HG0A 4NJEA 4ZOEA 4OATA 3LDFA 2OFFA 2EKZA 3U37A 1N32B 2DWPA 2ZJ8A 2Z1NA 2EFDB 3MS2A 4JUCA 1DWPA 1NMEA 3M7IA 2AFIA 2HDWA 2YUIA 1JEJA 4I50A 2OO5A 3QUSA 3WAKA 1EM6A 3HY4A 1JI0A 4BNVA 2DERA 3WK9A 5A4IS 2A1TS 2JLZA 3D7LA 2UUBB 1A9TA 1GNLA 3AOEA 1YFZA 3EZ2A 4L5AA 4OBXA 2PS3A 3P0EA 5E6UB 3BB4A 5TGZA 2HFKA 5AW3A 2P4UA 3JD2A 2AOTA 4CLRA 3LFHA 1SVLA 3JQ9A 4W9RA 1ZD2P 4KAAA 4UE2A 4PC6A 4P2BA 5DEIA 2RHWA 2NNWB 3OCUA 4GOJA 2JLUA 4BYGA 2PXXA 5HOEA 1XZHA 5BO5A 2NPIA 4BLWA 5DGHA 4B82A 3OE7D 4GX1A 3UT5B 5EHXA 1JWAB 1ZH8A 5E4FA 4QM7A 5AO9A 2GCEA 3GO4A 4WESA 3GBSA 1GZ6A 1UXHA 1W47A 3Q3VA 5CH5A 1NNUA 1Y3AA 4P36A 4NZOA 4JGBA 2X9NA 3C70A 4NZZA 2HQRA 4AFNA 2I6TA 3RB8A 5DNYB 4GMGA 2IXDA 5KREA 5LOVA 3CYFA 1G7SA 3SJCA 3TD6A 4CHTA 4EYGA 1J7JA 1KI7A 5KSPA 4FHDA 5KVCA 3OFND 5DNUA 4JBXA 5J9FA 3DPIA 2EJBA 4INJA 1U1CA 2PT6A 1UKYA 3CJTA 2Q3JA 2FLVA 4LRWA 4O3FA 5ALPA 1S7CA 3OPNA 4CMAA 2C8VA 2V7PA 1NXOA 3FPCA 2C57A 5A7GA 5HIAA 3DYBA 2FGKA 2FJUA 2PLAA 4IIVA 3AKCA 4RQTA 4FOOA 1XHEA 1U2RA 2C2GA 1U28C 2PA3A 4ZMRA 1ZGBA 2JIDA 1HFJA 1SOVA 3HI4A 2XNSA 4GVXA 3TSCA 1A9RA 2PZAA 4UHBA 3KVNA 1OZFA 1TF2A 2ZLBA 3E15A 3IBGA 4FDAA 1KJYA 1U2ZA 3RUEA 4CLEA 3PF8A 5A2GA 7ADHA 5FTMA 3UK6A 3PDHA 1ZNYA 4LBWA 2GCOB 3BD8A 3NG1A 1MZPA 4M21A 4MKHA 4C4PA 5LKRA 2I3BA 3NHZA 4GOKA 4MW2A 2J0UA 4GLBA 2NU8A 1RSZA 4R7ZA 3W5CA 3UOGA 3TLYA 3R5SA 1A9YA 2K2WA 3B12A 4H1WA 2YXPX 3ILSA 4WSOA 1OFUX 5GIPE 1VPWA 2JLCA 1CJMA 2RC5A 1N25A 2XUJA 3KQWA 1KSHA 3LBFA 4KI7A 4ZQHA 1E1CA 4CI9A 2PV0A 2R1VB 2O2IA 3ZIAD 5ITVA 5AW8A 3AJ8A 5HFNA 1PG5A 1NW8A 1LBTA 2AMFA 3MGAA 3QY0A 3IEXA 4MSUA 4W7SA 2N46A 1NG9A 1E2GA 4O63O 2A9FA 1BIFA 2ADMA 2GBLC 2LWIA 5T4BA 2IYXA 5TPZA 3U3XA 5F7XA 5C35A 1H5UA 2BELA 2XTAA 4OQMA 2IS2A 2WRZA 2VHXA 2WTNA 4QNMA 2GBIA 2HJWA 2JI6A 2Q9UA 4P3XA 1J70A 4LDJA 3K70B 4AKEA 5AUQA 1J22A 3EAQA 1WXXA 3FGPA 4CT5A 2EEZA 3A1DA 4FYWA 4ZMBA 5GVSA 5BWOA 1JBQA 3LVFO 2FPKA 3DR3A 3K0FA 4ZI7B 4RTMA 1CRQA 1FJ2A 1LUAA 5HCNA 1PN3A 4HDQB 1GPKA 3UC5A 4OU5A 4AMZA 1NXSA 3KB1A 4KMOA 3F2IA 4RC9A 2AZTA 2V7GA 4V2IA 4I1VA 3PUVA 1Z39A 4EGJA 3UH0A 1GTMA 2JA2A 5FHQA 1QH8A 4G5XA 2WAMA 3ZDAA 1EWRA 4U6QA 2IYYA 2C58A 3NHBA 2BBSA 4PQYA 4AXBA 1GQQA 1UFKA 2I8AA 2VHVA 2ZWMA 2YWDA 1PG0A 2H2WA 4OXQA 1B7GO 3EF0A 1NQTA 1OU0A 3KKKA 2IGBA 1L5KA 4N6NA 2HAEA 3SE7A 3OLZA 3CX4A 4QJ3A 1NPDA 1LSSA 1OFVA 2H2AA 2VDMB 4Z0NA 5CR9A 1QIDA 1MH1A 3IAM6 1JUDA 3K4HA 4G07A 3OE4A 4C0XA 4E5DA 1F0NA 2HTEA 3BULA 4IILA 4UNSA 4H1HA 2QMYA 3ZCQA 4CKZA 3TIFA 4H17A 1OGJA 5A0VA 4J7CA 4LOLA 1L4KA 3ID6C 2UVPB 5JO9A 1NN1A 2MYUA 3E53A 3GCZA 1HQCA 2XBUA 1CG6A 3AUXA 1ID8A 3GLFE 4GP7A 3G5AA 4I46A 2QNBA 1JNXX 4MKRA 2B5VA 1U31A 4TS1A 3MTQA 4DCPA 3I9V1 5K3FB 4LSZA 3WTCA 4BZZA 2Q6VA 2PRYA 3KDSE 4B3SB 3L7OA 1M83A 2CVPA 4Y2QA 3TNLA 3QLEA 4JSYA 2E7ZA 2WSSA 4I4LA 2NVUB 2IU3A 2VNIA 3EIOA 4Q4AA 5FKJA 4Z2AA 3I5YA 1OYOA 2G09A 1COWD 1N0HA 1II8A 5TE9A 5AJYA 5DP2A 3TD9A 3C8MA 2O5RA 3QYJA 4IUDS 1ZLYA 3W5DA 3KQLA 2FLKA 4O1HA 2JVJA 2B21A 3H2JA 3LVRE 1OXVA 4ILEA 1R27A 1UMCB 2YWGA 4ZQGA 4Q9IA 2G9UA 1GKUB 2NU7B 4E70A 3ACCA 3A1VA 4GBED 4WZZA 1ZK1A 2HLDD 4TVBA 1OJ7A 3I4LA 3ESBA 3SYLA 3WQBA 4Q21A 1YQEA 5BNFA 1EDDA 3LZ6A 2ZREA 3OVMA 1QFJA 1QLJA 5DGIA 5B58C 3LUFA 4XJSA 3A9WA 3F74A 3HXPA 5E4JA 5CFRA 1FMCA 3F3YA 1XTTA 2ZYUX 4YJDA 1P73A 1G8YA 3MPOA 2H59A 1QYVA 1CZOA 2XZDA 3EPPA 1TCVA 2GN2A 3HUEA 3M9XA 3QA9A 5MN4A 4ZQBA 3THYB 4NENB 5BQPA 3M4JA 4HNRA 1GPLA 1FMLA 4YRDA 1D4OA 4KWHA 2DR0A 4XFKA 5T6BA 5K8TA 1WS6A 3HG7A 5EZYB 1PJAA 4BMPB 2F3UA 1D2EA 4DNXA 1YRAA 4TN5A 3TS1A 4B31A 4G0XA 1YQQA 4MXDA 4YR7A 4X1YA 4KH1A 1Q6YA 2CMFA 4I4IA 4ZOLB 1SCIA 4ZRMA 3PXGA 2FN9A 3HXLA 4G5SA 3V7FA 4E1VA 1I3MA 4PZZA 2H7VA 2QQ5A 2V7VA 3QY9A 3FPAA 4IMRA 5EZ5A 2JGRA 1ZAYA 1JLMA 2ZUCA 2V5UA 4YRTA 3R9XB 4L78A 4POAA 4ZCQA 2Y1FA 1ZH0A 3AR2A 3MUFA 1RWVA 3U39A 4FKBA 4INAA 2XCRB 2VJPA 1YS7A 2RCYA 4LECA 5E1MA 1MIHA 1HE3A 5TR9A 1LXCA 1EFRA 1TIBA 2VYQA 2YC4C 3LP5A 1YZFA 4ZXFA 4GW3A 4YT5A 3FXAA 3PITA 3QXSA 3X1DA 4MJXA 4B45A 1BA3A 2QXTA 3V8MA 1LSOA 1COZA 5AKXA 5AHWA 2V6GA 1CQIA 2O7NA 3DQQA 2W2PA 3MCVA 4C2BA 2V1UA 5HGXA 1NOIA 4Z0TA 1T36A 4PFJA 5AR1A 2I6SA 3IPCA 3EQ7A 4FFDA 3WZMA 4WLEA 1PTJA 4YT4A 3L49A 3PGVA 2FG5A 1UL1X 4H3SA 3FPBA 5EZYF 4HAVA 1KEEA 5FUQA 1M2VB 3L8GA 1GTL1 1U2DA 2D1QA 3K2BA 4JR0A 3RU2A 3T9EA 2AZXA 2Z1DA 1EFHA 1SC6A 1NFQA 2LNDA 4U0JA 4YAWA 3HM2A 5A6SB 1S5PA 5FUBA 2C59A 1PQPA 3WSTA 3AY7A 2FPSA 1FDVA 2ECFA 4K9QA 4XQCA 2Q4RA 1OZAA 4LK3A 1ZK3A 1Z0AA 3OTIA 4IDDA 3JALB 4NE2A 1BDBA 1XZFA 2B4KA 2JLBA 2QTNA 4U3JA 4L73A 3TZHA 1CRLA 1S8FA 4YJ3A 2WIGA 1PZNA 2HHJA 3HKEB 3RE1A 3N6VA 3WV5A 1GDHA 4S3MA 5EJIA 5JC8A 4F3TA 2WFLB 3CE6A 4OL9A 4ZIRA 5EJ9A 3EXAA 4AKSA 1EFCA 4NARA 1DC4A 1VG9B 3ZJ4A 3H97A 4Z51A 2XMCA 2KBFA 2Y92A 1LDNA 4JVOA 1B1CA 3GRYA 2YV3A 3LBHA 3AI2A 4H6XA 4CCAA 1TMOA 5AVTA 3QVMA 3GJ4A 2ZE8A 5IVKA 3C4VA 4ON9A 4P22A 5K4HA 3CEHA 3L0CA 4PTZA 4QICA 5KS2A 1SJ9A 1QYWA 1KSFX 3NI2A 3OJFA 1Q0LA 2WQZA 1NUHA 2C94A 3GROA 1O4WA 1XRNA 4HAZA 1KQFA 4IQFA 4QD3A 2ATXA 3BKXA 1QBKC 1VFNA 4ZI5A 1V39A 1CQWA 2OXEA 5FL7D 3RAEC 1UDCA 4OHOA 3Q2OA 4X24A 3H1TA 3I1FA 4TPKA 4NCKA 5TPWA 1YJ5A 1G18A 2NVWA 4TQAA 1EUDA 1U0LA 5I7UA 4LPSA 1CJVC 4DUZB 4ITUA 5NLLA 3ABIA 1TF7A 1X7YB 5C7LO 4X65B 1G7CA 5GJBA 1SC4A 3WLIA 3BKWA 4X20B 1T8YA 2XHEA 2XW6A 1FYFA 2JFVA 2WSIA 2ZI4A 4WCFA 1F6DA 2DBYA 4N54A 4GR5A 1RLIA 3LKZA 3BIJA 4NULA 5HIMA 4PYNA 1ZU5A 3F7NA 2CLCX 1E69A 2H65A 4FFBA 2X8BA 4NFHA 4EG5A 1YJ8A 5MFPA 1FEZA 3VZBA 4JQCA 4QSHA 3EPJA 1NVAA 3AVWA 4N76A 3OJXA 2JB9A 4KPGA 4ID9A 3PDUA 1ULAA 1Q1AA 1J25A 3IESA 3UHJA 4ZDJA 3DMFA 3MAAC 5LLSA 3KOYA 3GJQA 4JJZA 3NHUA 3HCDA 2P3SA 2WOJA 2IOYA 3N87A 4X92A 2YXLA 3AVOA 4EJ2A 1H2HA 3KXDA 4WADA 4AW9A 4ZJZA 4UNIA 1Y6RA 3TSAA 3RM3A 2B2XA 1M9NA 2XWJI 3R5XA 2R79A 4UW9A 3ZC3A 1V9CA 2J09A 1CZUA 3D0RA 1FDOA 3LHDA 4GPEA 4MB2A 3TNJA 5K09A 3ZD8A 3O8LA 2G1UA 3PA6A 4B4KA 2AJDA 4TWRA 4TL7A 1CEXA 4GL2A 4YIKA 1XLTA 5REQB 4QBTA 1G5PA 2XA9A 4JP5A 2WZQA 4JOSA 1WNFA 2X2PA 2XCTB 5IAGA 4YAFA 4D6PA 2BFAA 3X2SA 2BFDA 4AAYA 4IDEA 3NHRA 2DF8A 2BF4A 4J16C 4CETA 1U3WA 1W36D 3L6BA 3LKBA 1X9GA 1XP5A 1XIVA 2HOQA 3LMKA 4W8OA 2HLPA 4A2PA 4EFKA 2CL0X 4CF7A 2AEJA 3VHLB 4P35A 4N9WA 5A4JA 3KM0A 5CIYA 1JR2A 4HZIA 5L8VA 2UXDB 3CRMA 2XQGA 2X5XA 2W93A 1TL7C 3IHWA 4D6YA 2X7XA 2C2OA 3BILA 3IRVA 4LQ4A 2F43A 3FVTA 1WHSA 2MSKA 1I9GA 4BV3A 3CUYA 3EDMA 3TJZA 4IX1A 1QK5A 3IQDB 1NXQA 1NOKA 3PQDA 2DLCX 3VKGA 1T3LA 4QBHA 1SBZA 4MUAA 1G63A 2WU0A 2YHUA 3UFBA 1SXJB 2I8CA 3TXAA 2BMEA 3VJKA 3WBFA 4L85A 3COYA 1JGTA 3RFUA 1DXOA 3BH7A 3FR8A 4NCAA 2NO0A 4XX0B 2ZUDA 1FUKA 1FU4A 2HRRA 1AVTA 1QYRA 2JCBA 2CD9A 3F8SA 4WDQA 3ZV4A 4B6JA 1KO8A 3RVLA 4BO0A 1EDBA 3L6UA 3LCCA 5I01A 1JMVA 4FC6A 2JHPA 1PT5A 3JYQA 2OILA 3C8DA 2P79A 4YMVA 1BMDA 3MD9A 3GMDA 2C92A 2QUAA 3ND9A 2DBQA 3QUCA 1LDYA 4QXAA 5FWXA 3U4GA 2CDBA 1JI3A 2PWZA 2PEZA 3WFZA 4N0DA 1T91A 1JJAA 3LRTA 4WKNA 4BNUA 3DXYA 4TN1A 4D81A 1XJQA 3GZJA 2CV2A 1Q1QA 1UJNA 3K9NA 3LS2A 1E4YA 4XPIB 4GKAA 2R7KA 3ONFA 4PSKA 4UEQA 1H5QA 1CLUA 3TXYA 4EHFA 1NVBA 3ABOB 3WJAA 4EZBA 4GC9A 2W90A 3ED5A 1VL8A 4BO6A 2W5UA 5KTOA 2IXEA 2JFWA 1ZKDA 3EYWA 5JR3A 3CZPA 1EKXA 3U4CA 1TVMA 3ZDZB 3TLCA 3ESYA 1KPGA 3LOPA 5LQKA 2Z2YA 2VF5X 5D84A 3N0TA 3U3MA 3ZV7A 3NBFA 2FSFA 2VQSA 3WL3A 3MCWA 2LP4Y 5GONF 3RT9A 5E9AA 5F1YA 2ZBVA 2IUTA 1GG2A 3HABA 2EQAA 3EVNA 4YNBA 3FCYA 2AKEA 2O3SA 3THXA 3RVOA 3QG1A 4PX9A 3U3ZA 1Q12A 1J2TA 2EZ8A 3A14A 4JLPA 2V4ZA 3CONA 3CUWA 2OHVA 5CDGA 1DLIA 1FNSA 1MEOA 4J91A 1Z8FA 3RAGA 3WDKA 4E88A 4F06A 5A7FA 4B9EA 1DRVA 3AUSA 2EJVA 2BKVA 2QZ4A 3UK0A 1WCIB 1KKMA 4M1YA 5C1IA 4OQDA 3PC8A 2Q9CA 4OQEA 4NONA 3EASA 1T5LA 3VR4D 2HF8A 8GPBA 5E1OA 3O4HA 4HPJB 5ED4A 4CLXA 5FAXA 4TMWA 5AW6A 2C4TA 5JYEA 4M99A 3F1KA 4JC4A 2DUUA 4C88A 2JIBA 4X91A 4G3XA 4Y6RA 5FUWA 5JS7A 2B92A 4LOAA 4MRMA 3TI9A 2N75A 5CBPA 2W6PA 4IFTA 3UGKA 3DUFA 3VHQA 2PS9A 3EGEA 4K2AA 3JD4A 2VZ9A 3S2FA 4TKVA 4HUQB 4JYBA 3RVKA 1APBA 3HB0A 3GRRA 5B64A 4MQBA 2OBMA 2VSXA 1QIMA 3OCJA 5ENDA 1JQDA 2EARA 5KOJA 4LGMA 1JHMA 3HA7A 2D1SA 3G9UA 1I3CA 1EPUA 2DFNA 1AZLA 2PGLA 3MWDB 4LVNA 2R65A 3AWDA 1A69A 1U5BB 5BN3A 1MF7A 4RQBA 3REQA 3RRJA 1VE5A 3NDRA 4IZHA 5EE3A 4Y6OA 2P6PA 3W9BA 1Z62A 2V0NA 3OM8A 3H5LA 3MRSA 3QNMA 3U62A 1YV9A 4RELA 3RODA 3QFFA 5HKLA 3WOVA 1LY1A 2HMTA 1BJRE 4MAMA 2WFLA 2UU9B 2H51A 3I12A 3RC3A 1X86B 1ZCAA 4IQ8A 4RF3A 2ECPA 2QQGA 3DE7X 4HQOA 1E6KA 3LX5A 5J4LA 3L04A 1UR5A 3QPDA 3OFSA 3TR0A 4Y2GA 5K8VA 5LXTB 1WXGA 1V8PA 2YWHA 3HKDB 4JA0A 3PXCX 1XKXA 4JQZA 4LXIA 3VO8A 5TLSA 4NDNE 4YCJA 3HM9A 4F46A 2C98A 1KRWA 1WOYA 1SVNA 1OXBB 2J5QA 3E7DA 3OPYI 4URUR 1L7PA 1EJ6A 2OHJA 3EEOA 3EIXA 1U0HC 1QHIA 1DX9A 3WGYA 3SC2A 3W6NA 3D5QA 3CF0A 3IP3A 3OM9A 3HU3A 2WEKA 3IR7A 3O4FA 3U48A 3NO4A 1F5NA 2PZGA 4PLZA 4RFLA 3FSGD 3ZTTA 2W8BB 1HR0B 5JXGA 2BHNA 2J59A 2FPMA 5LBIA 2YWJA 4E2WA 4ZTZB 2Y68A 1Q57A 3QPAA 4GZ5A 4WA8A 5BSKA 2NSLA 1ZRSA 4I9GA 1RJWA 4N4AA 1FFXB 3DHEA 2EP7A 1SCBA 4FR5A 4R9UC 1I7LA 4DV2B 3AF4A 1X7WA 5KNDA 2LV8A 1WZUA 3B2EA 1K63A 3U49A 1N9GA 3ZGNA 4YCAA 1GA6A 1W44A 4GBJA 1GGKA 4PV7A 3FF4A 4PS0A 5DK6A 1NBMD 4DR4B 4INPA 5JPCA 1KI6B 1G60A 3FHJA 2VUSA 3FCEA 3RASA 1DJLA 1GZ4A 2R62A 1L4GA 4IHJA 1QQ5A 2BEJA 3ANNA 1RYBA 4OBWA 2BEUB 2WHPB 3X0DA 5EE9A 4JUDX 4AKGA 4PR3A 5I9MA 1N57A 5ENVA 3EY9A 4BNGA 2ZRNA 5E7QA 4D98A 1MO5A 5JTUA 1K8QA 3SLKA 1BN7A 4GPBA 3X3HA 2IYFA 5A02A 4JKIA 5BXYA 4K86A 3JQCA 3SBDA 1N8SA 3AC0A 1FQOA 4KN9S 5IEBA 1RT9A 2Q8PA 3WLTA 1SU4A 3H5IA 4Y6GB 2HNKA 4R98A 3H75A 3OP4A 1T5SA 1Q1NA 1GV1A 2JH9A 3CBQA 5JE8A 5EVJA 1XMQB 2VHZA 3L6OO 1XU4A 3N58A 4ZVOA 1IK6A 1G0OA 4PZEA 1HXHA 4H3HB 5A9TA 1R8XA 5LQNA 1B00A 3ONDA 3K70D 2ES4A 5IHPA 2A2ZA 3C7KA 5EKTA 4S1PA 5FB3A 3PGMA 5D5QA 8OHMA 1UQUA 5CHEA 1TEXA 4WACA 4XB2A 4HDOB 2MWMA 1E6UA 1WEKA 3HK2A 3VHRA 1T10A 4V0MA 3BWYA 3E9QA 1OWOA 1QHFA 5ESWA 5JNLA 4DRYA 1N6LA 4BIMA 1YC2A 2E4AA 2D6FA 4FHGA 5IAKA 3DZ8A 4Y9TA 3HO1A 2DVMA 2IXFA 1N78A 3SYRA 3AM5A 5TSDA 4LI0A 3DE5X 3KOMA 4JK3A 4N8EA 2WIBA 3PRYA 3O3MB 4Q19A 3LT4A 5EL0A 3L9XA 2AFVA 1A7UA 2Y4OA 5DYWA 5HK8A 1A98A 3RU7A 4DNOA 3O4IA 4A6PA 1BH6A 1BU8A 4HRAA 4JYPA 3L4SO 2HA7A 3TNDA 3UUGA 3LJKA 3DSRA 3QYAA 4UMEA 1EVIA 5CM2Z 2Q1YA 3PXAA 4JGGA 4IIEA 1W0JD 2H0RA 3DTVD 1H23A 4L57A 4EYSA 3BJRA 4HDCA 4X6YA 2AOUB 1I2MA 3GGDA 4Q3LA 2FA9A 4ZZ1A 1M72A 3AUKA 5JO0A 5CXUA 4IDNA 1EVQA 3K92A 3O47A 4IIDA 5EIBD 1G1AA 3PQ5A 4ZI3A 2WE8A 4QYIB 4TMKA 4XJTA 2BD0A 1ODSA 3FBWA 3H8JA 4BFYA 3WKAA 5D2CA 3O4VA 4C7KA 4B73A 2XCOA 3ZIDA 5LDDC 3U0VA 3O5AA 4PEVA 1XYYA 4WFJA 3B1XA 1C1DA 5EMNA 2B37A 4V0NA 3UCEA 3N3AC 4R8SA 2DHQA 3MOIA 1G9TA 3EXHB 1GU0A 1UPBA 1N2CA 3JWHA 4B3JA 3AR9A 1IWPB 1ECGA 1KNXA 1DAKA 2FXVA 3Q41A 3ZQKA 4DLUA 4OHFA 1DUIA 1VJ5A 3ORYA 2OQIA 2N1BA 3NETA 1S2NA 4P58A 3F97A 1AC5A 5DYTA 4BKOA 2VPIA 4CM6A 3B70A 1FFGA 2G82A 3P0RA 4FZRA 4MYSA 5LYJF 2UUCB 1G98A 3Q0TA 3AIKA 2IK8A 1ULSA 4JT4A 4XB1A 2ZGVA 3RW9A 1GTZA 1MR3F 2MMCA 3EHEA 5HA5A 3TAUA 2BDUA 1OE0A 5DTMA 3MLBA 2GOYA 3IUEA 3KSMA 4C3ZA 4UREA 3D0QA 5KTKA 1F2TA 4JSTA 5CJJA 4IS2A 1YACA 5BRAA 1Z6AA 3M2TA 1QRRA 2GTPA 2JGEA 3DTYA 3PUYA 1DG3A 2NP6A 1OC4A 2CNWA 3RVSA 3VI3B 1U0BB 2QI9C 2CVZA 4RMIA 4UUNA 3UHFA 4HGPA 4XDYA 1YBVA 4DUGA 4CKEB 1GWNA 1ZY2A 3UVEA 2KWIA 4ABYA 4DKJA 5JBNA 3M9LA 4KQ2A 1FU8A 5ALIA 3FZGA 4IVPA 4CQLA 3OT1A 4IXMA 1KZ6A 2JKVA 4MITA 3WA7A 4LCJA 3NXSA 4EK9A 1XQVA 1VL1A 2CMHA 1GHTA 4A2WA 5DMHA 2HIHA 1GAEO 1G3UA 4KE6A 1P5HA 2Z09A 2YIMA 1R0SA 4RV9A 3CWCA 2FMKA 3S6JA 4I2NA 4W9NC 4ZO8A 1X1RA 3DE2X 4DWJA 1EP3B 3D2LA 2BT4A 3F6PA 1C5KA 2QORA 2OFXA 3R74A 1NRXA 3DVQX 3UWSA 5M5BA 3ZE8A 1X7WB 4M9XA 2FZ4A 1Y3CE 4JITA 2YVAA 3BZWA 2Z4TA 4GNRA 4D9IA 4P80A 4JX9A 1MPTA 1P81A 4P32A 2WHEA 3N28A 2B8WA 5DYGA 1HNXB 4RDHA 2QT0A 5K0ZA 2ZSAA 4YCBA 2C2YA 2XF2A 1SXGA 3A4NA 5JZSA 1ESCA 4KO4S 5A3VA 2JGDB 4E14A 1JZTA 5HMLA 1BJTA 3PGJA 4JLKA 1M7HA 4ZVVA 2C4KA 2JDID 5K0CA 2ZUFA 5BP7A 1DHRA 1T5HX 3PC6A 5FOUA 1XZJA 3GDWA 1NC1A 3KKLA 4ZHSA 4BLSA 3U13A 2HF2A 4RMHA 2XB2A 1MVLA 1II9A 3TGWA 1Y7IA 1YR9A 5JSZB 3FPLA 3IV9A 4ZV4A 4LTMA 4NE9A 1OX6A 5KKNB 3A1TA 3VU8A 3RV4A 4TL6A 3F5DA 3MZ0A 4MTCA 4ERXA 1A9OA 2OR3A 3V3KA 3VO2A 3DTVA 4LJ5A 3T1TA 3ITKA 3Q6MA 2HWXA 2X86A 4QLOA 1M54A 2ORYA 4XOIA 3TW8A 3ITNA 1NXTA 4ZMSA 2RE8A 2G76A 5BV2P 4OHMA 2HTFA 3IQWA 1SCKA 2AMLA 3L7MA 2XYVA 1DZIA 4QECA 4XEUA 3W5HA 5I7VA 3T5PA 1HX7A 4LXGA 2KM1A 2IV7A 4RACA 3PV0A 1D1SA 1TFRA 2R751 3IVRA 2JLYA 3CT4A 3JQ7A 4M22A 3KOXA 4KLCA 2QAGB 1UFRA 3WGOA 4F4JA 1UC8A 5ALZA 2QOEA 1IIRA 5EWJB 5BUCA 4HXGA 1MTZA 3DMYA 3KYBA 2WJ4A 4PBSA 4Z7NB 2AT1A 5KKAA 4RJJA 4CL8A 3AFMA 1W9MA 1W8DA 1DX6A 2WHYA 2YC2C 2NSYA 5C7IO 3CVVA 5JADA 2FPOA 2IC5A 4HGYA 4QULA 4WNAB 4Y67A 1R0CA 5F2EA 3PNKA 1TQHA 1Z07A 2ZYGA 4I55B 5AESA 5AVRA 3MUNA 4MI9A 4WK2B 3T7SA 4FN4A 4U2DA 4BX2A 4KE7A 5A71A 3RIGA 4HEHA 2A67A 2QN1A 3GZTB 2GLTA 5IEJA 2FB9A 3VR6H 2QN8A 3DVAA 5K3AA 2LDBA 1C7JA 4TS3A 2HYIC 1J1UA 4ER5A 3VVLA 1SU8A 1YQWA 2V74B 2GAAA 4FBLA 2VR1A 3OD5A 3Q9UA 5MF6A 1GQYA 3PUZA 2Y99A 4TS4A 4K28A 3OKCA 1CW2B 4DPLA 4Y9SA 4YGYA 3H8VA 1ZHHA 2I5PO 1XNQB 4N7RA 1GZ3A 2VH2A 1BXRB 1UBKS 1GQRA 3B3FA 3EF3A 3IKMB 4J4HA 4Y9DA 4BJ1A 1E7WA 3NDJA 4A0QA 1GRNA 4MUMA 4BX0A 1MJHA 1NBMA 1BOOA 1MG0A 1UMBA 1JIJA 4EGCB 4GKJB 2FZLA 821PA 5E8JA 4MI6A 1ZUNB 2I3GA 2PUAA 1OQAA 4X5OA 1E32A 2QMHA 1EGVB 3I64A 5EKUA 5KQSA 2E85A 3QMPA 1A1VA 4E30A 4L8VA 1JR6A 1ZCBA 3KWFA 4GGPA 1V5WA 4C0WA 1RAAA 2JW5A 1FDTA 3BPSA 3DE6X 4HEJA 1UOOA 4TVKA 1ZOPA 1MJFA 3KJGA 3SLGA 2R4TA 3T1QA 1JEYB 4BZWA 3LC0A 2SHKA 3E7FA 3RS5A 4V0RA 1LLCA 4HWGA 2GBPA 2WG2A 3E58A 1BD4A 2OAEA 4MPDA 4OKNA 3O75A 3SPXA 2O2ZA 2RHTA 2HPHA 3HN7A 3ULKA 1BWPA 3EGOA 3W2IA 3ZY5A 1T1GA 1W2WB 3PKJA 4BIIA 1L5MA 2E5WA 3DGEC 4KQJA 3WRYC 4QDJA 1ACMA 5CLHA 1UBGA 3IPRA 3WAGA 1AN0A 2J7KA 4DNPA 5KWIA 7REQB 4I6JA 3ZWWA 1ZXXA 2WDZA 3EFHA 1HDGO 2X4GA 3LA6A 5FRDA 4CT0A 1EWVA 2BEVB 2YQZA 4TRMA 4ER6A 2VDWB 3DBHA 1SQFA 1G8MA 1DRUA 1G64A 1LQ2A 2FF7A 3SKVA 4JXJA 3PLAE 3S27A 3QH4A 1NE2A 3AHDA 2ZULA 1KH3A 2Q9BA 4DJAA 1EGMB 1Q84A 4FR2A 1Q44A 1BYIA 2QE7D 4YBRA 1C50A 1FNBA 1WD7A 3A7DA 3O03A 3RF6A 3F6RA 3TLJA 1NA5A 2B9VA 5I9IA 2R11A 1Y8AA 2AK3A 1QIIA 5DTRA 3K20A 2B1RA 2QTVB 1GZVA 2FTKE 1K98A 3ZCPA 4CLOA 1SKYB 4XGNA 1WHSB 2MDTA 2ZR7A 3A06A 4B3MB 2H7XA 3WMRA 3EHDA 2C61A 2KB0A 2H2HA 3G02A 4ZU1X 3UKOA 1OC2A 2FPIB 2L82A 2R8PA 4JL8A 2R6FA 3QPWA 3JAMA 2JZOA 3P4UA 3BTOA 2J41A 3H86A 1GL3A 1BHSA 2A9KA 2VZLA 3KXPA 3MQ2A 5JCJA 4YRRA 1PO7A 4JI1B 1JEAA 3S8MA 4DMUB 1JLSA 1F06A 2VK2A 5I7WA 1ZJ6A 2RH4A 4KNWA 3OUUA 5CT6A 2XDWA 5LMNB 2XMGA 5KNCH 2Q3CA 2YZNA 4KSCA 4JI8B 4YJHB 1LRJA 1CB7A 3EIHA 3I2KA 4IGEA 1OREA 4MTLA 1J9GA 1K8YB 2HPAA 1MD9A 3N07A 1Y3BE 4P7FA 5FWYB 3A37A 4RF5A 3ILHA 4QFCA 3WIOA 3I9LA 2PX5A 1ENOA 3T3OA 1JQ3A 1VTKA 3UV6A 1KJJA 3MTEA 1PAUA 3ETLA 2WM8A 4UE6A 5EIOA 2XVYA 2VJMB 1P31A 2FH5B 2ZBEA 4FGSA 5JXJA 2DKOA 2BGTA 4NK4A 3HBLA 4Q3AA 3KKZA 4G0NA 2QT1A 1YQXA 4O4LF 4WLFA 4HDMA 1Z7BA 1HLGA 4RH0A 3JYPA 1HY3A 2ODWA 1IVNA 2Q4OA 3UFXA 4AD8A 5BUQA 1AQ6A 1FVHA 1SUCA 1C3OA 2BFMA 5JRZA 3PJRA 2DBRA 5F4BA 1AKNA 4L5BA 2F8SA 4LQLA 3TLGA 3CX6A 2PK3A 3DMPA 3NDPA 2O8VA 3KYCB 4TVOA 1YS6A 3HCPA 4ETWA 1RMYA 1DV2A 2B1QA 1WAMA 3K0BA 4QBFA 1EINA 2PRSA 3FIUA 1SXJE 3Q8KA 3JQQA 4DCOA 4U5QA 2N47A 1N33B 1RJGA 1FDWA 2I2BA 3D3NA 3WLJA 4UM9B 3DW3X 3INYA 1A7JA 4EO4A 2QVGA 3V1UA 1XEXA 1E4EA 2ECKA 4Q3NA 4AY5A 1PYDA 5TPWB 4LZZA 2D2EA 2BGKA 4NABA 5HFAA 2X6RA 4CR8A 2Q5LA 3HYCA 5TMBA 2Q0QA 2XV1A 3MNFA 4RCYA 2W2LA 3KRTA 2HWKA 4MVXA 4OYHA 4RKQA 3C39A 1P3Y1 1YVEI 3KYDB 3NTUA 3SMVA 1S96A 3TZQA 1CZNA 2NUTB 3IBCA 1Z0IA 4NZPA 1NVMB 3WKCA 1QQBA 1U7WA 4YXFA 4WGGA 4BFUA 3T0FA 2Z9DA 4IVRA 4XZ3A 3C5HA 2BZSA 3V4OA 2H8KA 5F4ZA 1ISIA 3UAWA 3BH0A 5CFLA 1UPTA 2IYOA 1I0LA 4YAOA 3KZ1E 3RVQA 2IYAA 4ZHQF 5CGZA 4HYYA 1EH5A 1I1NA 2FEKA 2H4ZA 4GNKA 2X8LA 1Q0PA 1P4AA 4KBYA 9MHTA 4PO1A 2NW6A 3CSUA 2UXCB 1DUSA 1ZM9A 3HDJA 3GMIA 1QKKA 2FWJA 3NJRA 1AKWA 1PD1A 5J1SB 2X4IA 2QQFA 3IBTA 4C6TA 2WVGA 3UOWA 4CCSA 4PICA 2WSLA 5FBWB 4KRFA 1ZD3A 1XZEA 2WIFA 3GNLA 3ZWXA 5KYYB 2J3KA 2VQ3A 3CVOA 3M6AA 1C0KA 2H11A 3HJUA 4K1XA 3TRJA 2BFNA 3KV1A 1TT5B 3OEEA 3SICE 3DL0A 5CB4F 3CIOA 1T9AA 3HLKA 5C8ZA 3D8BA 1U3VA 3CN9A 5KVSA 3K5WA 5JCJD 1EEHA 1FQJA 4KODA 3MOGA 4O08A 2WUVA 3BF8A 4EEZA 4GUAA 2Y0CA 3O84A 4RHXA 1V35A 5KKCA 3OLQA 4C0QC 3Q5DA 3ZN2A 1VLMA 4BV9A 3ADCA 3W8DA 1N3IA 1II0A 1QTIA 3VNAA 2OFPA 2FEXA 4GQAA 2PJRA 1OH7A 3UJ9A 3W4JA 3S55A 3LQYA 1P2UA 2IDJA 4M9RA 3SMQA 3UTCA 4EFLA 3RSHA 3LC1O 2XUKA 4MA5A 2H08A 4R8KA 2JJ2A 4JBYA 4R6XA 1RMQA 1O89A 5H59A 5LYYA 4PNPA 5TS3A 3EOAI 1YZQA 2YVLA 2WIDA 1CNEA 2GPWA 5G0UA 5F35A 1KP2A 4FXOA 1FFBA 1X7DA 5CVTA 3Q3GE 3ZXYA 4YCNA 3MJCA 1K0FA 4BNXA 5CDYA 3W3AA 4G5FA 1EBBA 1DV1A 3MC1A 5JG7A 1SEPA 1HYBA 4YRIA 2B8JA 2Z2ZA 4RGBA 3QLTA 5BN5A 4V1CB 1AQLA 1JF8A 5JNTA 4C7JA 2Q4EA 4AIRA 1L7XA 1T3HA 1W4CA 2AUMA 3BXEA 4KH0A 4JL5A 4ZC8A 3OIWA 3EGDA 4KGXA 3AG6A 3HY6A 3PFKA 1LX7A 3ZU2A 4BE9A 1DJQA 4PIMA 5I3ZA 1Z5ZA 1PWEA 2PG3A 3OOYA 3QFRA 4OK5A 4LVOA 2FWIA 4QJ5A 3OTHA 4U2BA 1YSCA 2ZAGA 1SVMA 4WCDA 1VYVA 5ITZA 5KNBA 3M0EA 3UBMA 2OCLA 5M2QA 2VH1A 3PRKE 1GTG1 4BUCA 5ALOA 4MUNA 3MTJA 4HEQA 4YC7A 1X3SA 3OQIB 1ACLA 4E7PA 3IOEA 3NRBA 1DIGA 4HB2A 5A4MS 3ZNPA 2ODPA 3OX1A 4K03A 1CUGA 3O8QB 1PEYA 5HJEA 3P8ZA 5HGJA 3F6BX 4M1MA 4B44A 2EKPA 3JWIA 5JW6A 5KIAA 2IZ7A 2PJUA 2YCBA 4JI3B 4HNVA 1G5TA 2QT9A 4I4CA 4QOGA 1UZLA 1JG7A 2X0FA 3SZGA 5IYZB 2JGIA 1YOBA 4MHOA 4BFZA 3IEVA 1B16A 4NPHA 1Z2EA 4CJXA 5H80A 2QRVB 2YHBA 4GL4A 2YW2A 2P9HA 3AOGA 3PX2A 1CDDA 1YKSA 3IXLA 1D9ZA 1XZQA 2ON6A 2DPGA 3GY0A 1T0HB 4YJHA 3B1JA 4IQGA 4OPMA 4QODA 4D3SA 2Q49A 3T7IA 4C7OA 2JLWA 1G5HA 5BUZA 4Z7OB 3EVZA 3TLBA 1MZVA 3RBZA 2XT9A 3TEJA 4RV4A 5B3AA 1FXSA 2PSJA 3K70C 2WV7A 2Z58A 3K1ZA 5FEUA 3L8YA 1C8VB 3UM9A 4KFCA 1RIIA 3ETHA 1C41A 3OTQA 2DR3A 1Q7BA 2PU5A 2C8JA 1MO6A 2GEUA 1XKLA 1CP2A 2J0VA 3T5TA 4E5SA 5DNWA 4KE8A 3DLPX 3ENVA 2W7TA 1HE2A 2AOWA 4WZBA 1SIUA 2WPDD 2VDVE 4FZ3A 4XTRA 2R6DA 5TGTA 4J1QA 1BO6A 4UMVA 3TMYA 1QVAA 1SKBA 2J9ZB 5IFKA 1FJHA 2Q9AA 3H6KA 4TWZA 3ZWVA 3ZHVA 2V7QD 1S02A 2R3SA 5IS2A 4DW8A 4RHFA 2VFAA 4E12A 1AF7A 2B4TO 3CXUA 3F4KA 3QEJA 4BRUA 1OROA 3HZHA 5ITWA 1I2BA 3A4MA 3K15A 1FTSA 1SCUA 5SICE 1N2OA 5AJUA 1IHDA 4EGSA 4O2BA 1C7QA 4K5QA 4RNDB 1TM1E 2O7VA 1SELA 3W9YA 5JC1A 1LBQA 1V9LA 1P2SA 2HREA 2V6IA 4YO8A 3U9LA 3O8OB 4RCZA 4KZKA 1G1MA 4G1VA 2PQ6A 3EGXB 4JP8A 4XX1A 4EW2A 5J43A 2HK7A 2YHSA 3TE6A 1SUPA 5FOQA 2OGSA 3OC0A 3FX2A 1DC7A 1HC7A 5DTQA 1M6EX 2JZNA 1T0IA 3EOZA 1GDTA 3AVXA 4NH4A