4YFYA

X-ray structure of the viof n-formyltransferase from providencia alcalifaciens o30 in complex with thf and tdp-qui4n
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
241
structure length
241
Chain Sequence
MKKILVISDNYQLVSYIKNLYLSNEEWSKELFIDYSYSSINRNPQSLIELGMTEIDIKNKNLNELNDYHLIISAHCKQIFPAHIVNNKLCINIHPGLNPYNRGWFPQVFSILNKKPIGATIHKMDSEVDHGEIYCQEEVSILSHETSIDIYNKVIELEKKLIKNNLLKIINNELQPKLPSQEGNYNSIQDFNKLCKLNLEDNGSLREHIDLLRALTHGDFKNAYFYDENNTKVFVKIELSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VioF
publication title Molecular structure of an N-formyltransferase from Providencia alcalifaciens O30.
pubmed doi rcsb
source organism Providencia alcalifaciens
molecule tags Transferase
total genus 80
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18216 N_formyltrans_C N-formyltransferase dimerization C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4yfyA01
1NJSA 1YRWA 4R8VA 4S1NA 3NRBA 2YWRA 1RBZA 1C2TA 3N0VA 4ZZ2A 1GARA 5J9FA 3W7BA 3KCQA 1RBYA 3TQRA 4IQFA 1MENA 3OBIA 4ZZ3A 4QPDA 4TTSA 2BLNA 1ZGHA 1GRCA 4NV1A 4QPCA 3DCJA 4EW1A 1RBQA 3AV3A 4PZUA 4DS3A 2CFIA 4TS4A 4EW3A 3AUFA 3P9XA 1MEOA 4ZYTA 3O1LA 4ZYYA 4ZYVA 4ZZ0A 5J63A 3DA8A 2FMTA 4TT8A 1C3EA 4YFYA 4ZYZA 2GARA 1ZLXA 3R8XA 3GARA 2BW0A 4ZYWA 3Q0IA 1RBMA 3LOUA 1FMTA 1CDDA 3TQQA 5CJJA 1MEJA 1S3IA 4YFVA 4Q12A 1CDEA 1RC0A 1RC1A 4ZZ1A 4ZYUA 4EW2A 1JKXA 4ZYXA 1ZLYA
chains in the Genus database with same CATH superfamily
3Q3EA 3EAQA 3KSRA 4HN4B 5BN5A 2V7GA 4CKBA 3WQRA 3LU1A 4IH1A 1KYWA 4CMEA 1PDWA 1EWVA 1QG6A 1WV1A 3R09A 4H1UA 4F8EA 4B3RB 1ULAA 1XL0A 4MITA 1A9RA 3TEMA 2NUBA 4BNJA 4BQQA 3VSEA 3S99A 1EGVB 5CD1A 1JJAA 3EXIA 4H1VA 4GI7A 4IHAA 5K01A 5KC9A 4BX3A 1D2AA 3RFVA 1D3AA 5H82A 1PK8A 1IRIA 1TJ5A 3B6IA 1ZO8A 4L2IA 4RPKA 5SZHB 2WP0A 3LPCA 4LBZA 3KKNA 4O4HA 4PAWA 2C2HA 4CEIB 2VT3A 3PA8A 4JV5B 3D3QA 5F78A 1DIHA 1BEEA 5EJGA 1QVAA 2CXSA 2DE0X 3ZE9A 1JFTA 1C1XB 3UZUA 5BSVA 1IB0A 5FWNA 1IDOA 2B7BA 4HLUC 1PQYA 5TC4A 4ZV9A 1WCXA 2A3RA 1OLXB 4B17A 1CP3A 2PLFA 2NN3C 1W85A 3L77A 1Y7PA 3OZXA 3OPVA 2VJYA 3DD1A 4PVCA 3KPYA 5HKBA 2KLBA 1X7XA 1Y5RA 2CXQA 4LY9A 5KYGA 2R25B 2QTCA 2FMFA 3V8PA 4BLSA 2I4RA 2Y27A 3E2PA 3KJHA 3PEEA 3V55A 4D9KA 4RHTA 4N41A 3K0KA 1IAVA 1U8YA 1DEOA 3VYTB 4MW4A 1N3YA 4KBYA 5J2UF 1FDUA 1CQJA 4QFMA 5AW1A 5KQSA 1BZYA 1J24A 3KAJA 3KEMA 1M34E 4CEHB 3P94A 2WJJA 2WZDA 2OWEA 4LE0A 5LJLA 3RRMA 3N2GA 1LDBA 2XTZA 4B3JA 4PSVA 1XUOA 5EJ7A 1E64A 2WV9A 4Q37A 2POQX 2WIFA 4RY2A 1SURA 4OGLA 3EIEA 3CVVA 1JKJA 1K2WA 1Z6AA 1X1TA 1KETA 2O07A 4ZO8A 2PX4A 1U5BA 3V4ZA 1WAMA 2XRZA 5B5SA 1VL1A 3OJOA 1E98A 4JJ4A 1I7SB 1I2CA 4GMGA 3REFA 3FCUB 4HATA 4MYHA 4Z1OA 2ZSIA 1M5UA 2EL9A 4MPRA 4DIEA 2PR7A 1AV6A 1Q74A 3E7WA 3KYDB 4O4IB 3RVKA 3HPQA 1TX4B 3QFRA 5EJ4A 5C8ZA 1V7PC 4D9NA 4LJSA 4Y2XA 3F6SA 5LQUA 2LW7A 2BZ1A 3CRRA 2VSYA 4HUJA 1RQ2A 5EPOA 1YZNA 1ZIPA 4F45A 1HDRA 3GPCA 1RZ3A 1G8GA 1YR3A 1Z25A 2CFTA 4KEAA 3WSTA 4DY6A 4I2NA 4EX6A 2JBAB 1PNTA 4FC7A 3ST7A 2JVIA 1U8AA 1JLKA 1DVRA 4YRBA 2D1RA 2PYZA 1FMJA 1O7JA 1BYUA 3AF1A 1PAUA 1EVEA 5KTMA 4QEZA 3PGXA 4D9EA 3HCCA 4OXYA 4PPFA 2GZ1A 5L3RA 2ZANA 3AESB 4QZVA 3L6BA 4I50A 3NDJA 1ACMA 1OJ7A 2CNOA 6Q21A 5LZ5A 2R6AA 3ITNA 1ECBA 3H5LA 1QPGA 4DBVO 4HT3B 3MAAC 2WQ7A 4ENTA 1QVRA 4BLTA 2FEAA 2BKXA 2BFFA 1LJUA 4M1YA 3F5MA 1X70A 5K8LA 4DW8A 1EI9A 1AZWA 1P73A 1S8FA 2ILTA 2AFHB 3GEEA 4MW2A 1EGMB 3UK0A 3HK2A 2GD0A 1ZA2A 1J8FA 2V9ZA 1OXVA 4LBVA 1E9BA 5I6DA 1C2TA 4IIJF 1YJXA 4CIDA 1X3LA 4WBXC 3SKYA 4R84A 3FXAA 1RAFA 4ZANA 1LLFA 3FPJA 3GGSA 4MWCA 3VJRA 3V48A 3O4FA 5E3JA 1WJGA 3QNMA 5KSYA 4V2IA 3CRQA 4WFIA 3FLAA 4ZT5A 3DAFA 3TRDA 3EPPA 3WSVA 2ID8A 4AJJA 1TUBA 2AEMA 2CLKB 2J6BA 2P2GA 3IKJA 4GS5A 2ZSAA 1OQAA 2WSBA 2Q5QA 2ZREA 2WSMA 4M36A 1OA1A 4CT5A 2PFKA 4F9GA 4GYYA 3TJRA 3V4LA 4I9NA 1FJXA 2QL5A 2YJ3A 4R7ZA 3JZAA 5LQMA 4RD2A 3CB4A 1W0KA 3CWZA 3HCNA 3VKFA 1ANKA 1PFQA 1XVUA 2NU9A 3RUDA 4KKXB 4IDOA 2YBEA 4B4UA 1Z13A 3AYZB 4RFVA 3SMQA 4ZAVA 3OX4A 4IJ5A 4OHPA 4RJ2A 3K6SB 1PKXA 1UC4B 1GLNA 2KW5A 2E82A 2FOXA 3EIXA 4GZ3A 1SCDA 2ACEA 1SU6A 1T25A 2DFDA 1Q19A 3ESBA 1NZDA 2ZRIA 3KDAA 5AVZA 4I9UA 1KMMA 4CM4A 3JTEA 3X1ZA 3F67A 5KC8A 1Y5IA 3KX2A 1GN8A 3ZGVA 5BR4A 1R16A 2X8BA 3A4VA 4U5QA 5A0FA 4Q6WA 2VJPA 4A0RA 2WF8A 2IXDA 4AKSA 1DEXA 1OLUA 2ZYWX 4YAKA 2QRLA 4IDEA 1QMPA 2IBSA 5H0IA 1H23A 3PCTA 2BP7A 5EWMA 5CB4A 3LTNC 4LZZA 2PO7A 3TPFA 1G8KA 3DKRA 4Q7JB 3UH1A 2Q6TA 2HF7A 4HAOA 1RAAA 3V2UA 1KHHA 1KI8A 221PA 2O3TA 1P3DA 4P54A 5IYZF 4F2GA 4GMDA 4CTJA 4L16A 3ND6A 1OBOA 1LW6E 5B1DA 4CG0A 4AICA 1G3RA 3LFTA 3G49A 1M0SA 1Z7YA 4RSGA 4KQWA 1U1FA 1AH2A 1PG2A 2B98A 3KU4A 2I4LA 4UUBA 4W99A 1NFQA 1AD2A 5CG1A 4GICA 4G56A 4BLUA 3ISJA 4UTXA 4XRRA 3FCYA 4LRQA 2FN9A 2CV0A 4Z4EA 4HNHA 3ICVA 1SPXA 3S40A 2QTNA 5JAIA 3TLXA 5A0TA 1T8PA 4YMIA 1STOA 4MIKA 4NG5A 5AKXA 5CA0F 4A15A 1BS2A 1PEYA 1QFZA 1VYVA 2CVFA 2V7UA 5GM2A 3IL2A 2EBHX 3FFAA 4GKKB 3B6KA 3D2LA 1TMGE 2XE7A 3VPCA 1BN6A 1QRDA 4Q3EA 2ISCA 5EE5B 1KDZA 1GCGA 3E03A 4AD8A 3TRKA 1G5FA 4JOBA 4XB1A 2R5NA 2PH3A 1SHKA 3H8WA 4MUAA 3MJ4A 5CB0A 5L45A 1PBNA 2ZSDA 4WK4B 5DNVA 4CM6A 5FTNA 4FN5A 4D74A 4DJTA 4JYZA 1YFKA 2ZJ7A 1LU9A 4HLCA 5ER6A 2JW5A 4M9SA 2X41A 4F46A 3IBYA 5IZ4A 3U1BA 3AVUA 4PC2A 5JEEA 5KI6A 1RC8A 1OV6A 3NEPX 1HT3A 1QFYA 1XZKA 2WILA 2CBGA 3A6HA 4KXMA 4J16C 3U9LA 4HYTA 3K15A 4KK3A 1I4DD 5A06A 1JFRA 4C2TA 4KLNA 1QK3A 4IUYA 1LPAB 4JUFA 4B7XA 1IG0A 1RZVA 5JY6A 3CNBA 3JARA 2QU7A 4UMEA 5TQ0A 2NM0A 5CTJA 1XLTC 1DIRA 1K4KA 1M34B 3HDGA 3II6X 4HDSA 4W7HA 2EL7A 3UJCA 1FJGB 4C7JA 1PHPA 2XCRB 1Q1EA 4WH0A 1T8RA 1FU8A 3ASVA 4QUBA 4MDFA 5GONB 1MTOA 4GOLD 2CYCA 2HT1A 2QN3A 1BE8A 3F6BX 2CWWA 2FZKA 2QVXX 3ICCA 3KD2A 4B4KA 1OH5A 4L72A 4C4PA 3LDHA 2VHCA 2C4MA 3AKEA 4ZCRA 3E9ZA 5DGIA 3RUCA 1X7YA 3CZAA 2H3EA 2P3QA 4RJJA 1A7KA 2QU8A 3G0DA 3YASA 1Y8CA 2PX3A 3QFSA 1YRBA 4FE7A 3HBMA 3VR0A 1YKFA 4NJMB 5M04A 1COWD 5L40A 1GVHA 3EC7A 3MTBA 1OX4B 3ROQA 4BYGA 5EE0A 4MDEA 3A8TA 1NQ5A 2C1EA 2LZ0A 4RETA 3TNFA 1AKUA 4JODA 4XYLA 1FZQA 2BGGA 2Z6VA 5AHKA 4HN2A 3L92A 2I7VA 5BWNA 1GLGA 2I1WA 3TOSA 3E53A 2UYHA 4P58A 1WKCA 3ONNA 3PD7A 3ZDXB 3NEAA 2QLLA 4G4SP 3UV3A 1GCIA 2VN8A 1QE5A 2ZR7A 3PA6A 3N05A 3QW4B 4BV2A 3DV2A 2NSYA 1ETHA 3SFZA 2HBQA 5FULA 5JDIA 2ZKIA 3N6RA 1VBMA 5AK0A 5IUJC 4JJ7A 2YWHA 3QXHA 1PVVA 4FBLA 1MU0A 3BL8A 1I3NA 1TM5E 3MWFA 4R9UC 1HDXA 2H4JA 4WY2A 4CMIA 2CKMA 3SS7X 4NAUA 5A3SA 3VKUA 3WGGA 4J0DA 4A92A 2JFXA 1D5WA 1IC6A 1CP2A 4YRZA 1GTRA 2ZE7A 3OEHD 4WJLA 1D0VA 2AHOA 3OZIA 3QKSA 4J49A 1LJLA 4J3FA 1L7AA 5CNJA 3KR2A 4TLMB 2PU5A 2ZRLA 1EFKA 2FJUA 3CUTA 3MD0A 4ESVA 1T9KA 4YCNA 2FSHA 2IP1A 4HV4A 5L95A 2CFRA 4FSDA 3LX4A 4RTLA 2IPLA 4NBUA 3MLAA 3QYFA 3IMEA 4K3VA 4OGWA 4QODA 3V46A 2G71A 2VDPB 3NVMB 4IIHA 1E3JA 3ZJYA 1CUXA 4FP9A 1GZ4A 1DX6A 3B6ZA 1G6OA 2IYWA 1VJ0A 5FA6A 2J9GA 1YJQA 3QX8A 5FOVA 4G5YA 1OFIA 1U90A 2VWGA 3AHHA 4DBLE 2A9RA 1VJRA 4MWDA 1UC8A 1HZJA 1Q3HA 3T6KA 2PKRA 2ZDHA 3EFBA 3LHKA 4K1LA 4Y67A 3MB8A 3W3AA 7REQB 4OK5A 2ZVQX 1K9SA 1A7JA 1OPXA 1U8EA 2PEYA 3H11B 5F2NA 3KLNA 1QK5A 2HRBA 3AGQA 3QVVA 4ND8B 5HK9A 3CRVA 3IRUA 1I7DA 2MOKA 1XJ0A 4YLYA 4RZIA 3ZU4A 3NFYA 4EJSA 4PLGA 4ZHQB 3ENKA 4I9HA 1DS6A 5MFZA 4CMAA 2R7NA 4DDHA 3BJZA 3T1YB 4A36A 2RHGB 5FWAA 2ASVA 4G8DA 1UBCA 2XMRA 4DG5A 2PL1A 2VDOB 2CMDA 2G4VA 3TQCA 3TOXA 4E1AA 1AM4D 5DTMA 5EE1A 2CHGA 4KHPB 1F8UA 1T1GA 3BEOA 2ZXUA 5HM8A 1VSQA 2GFQA 1NJGA 2QBYB 5K3BA 2X0DA 4QU8A 3Q5GA 1QFMA 1DG9A 4OGFA 4DHEA 1MVLA 4J7UA 5L3SB 3DQPA 5BSEA 1OXTA 4KIFA 4PBSA 2JIBA 3PF9A 4QASA 2AW5A 1U04A 1V16A 1CQIB 1WXDA 5E4TA 4RF4A 2BEUB 1JGTA 1OBFO 1Y0BA 1S0UA 1YMVA 2ZWOA 4MMZB 4YYZA 4EJ2A 4IH4A 3SJZA 3FOCA 3T7JA 4PSAA 4IDDA 2ONJA 3E6AA 1L5GB 4AO7A 1V11B 3D1JA 3ZH9B 2DBVO 2ZETA 1SUDA 3DE6X 2JHGA 3AHDA 3NZEA 5F5XA 3OOYA 1P61B 1ZNXA 4V39A 1XWIA 2PSSA 5HGJA 1NMEA 3ZKWB 4AMVA 7AT1A 2PU7A 5DYWA 2A5GA 1ZQ9A 1VIDA 2FE4A 1M76A 2F62A 3HU3A 2VQ3A 2DUJA 3U4GA 1JDUA 1MW8X 3I9V6 3SR3A 1UKCA 3MMXA 5CFOA 2HQ1A 1C7FA 4D96A 4L4SA 4WLUA 1HNZB 2YNMA 1EDEA 3ZGNA 3DCJA 2MSCB 4KJZA 5JCXA 3GRCA 2CNLA 2XUKA 1MJHA 3O95A 4Q7QA 1U1EA 4PZLA 4NL4H 4F8YA 4PIMA 4Z54A 2VHXA 2BTQB 4PLTA 2W2VA 3N74A 2Q6IA 3TD9A 5ECWA 4YRPA 4B0PA 4C6RA 4F9FA 5C1DA 4N0QA 4YJ3B 2WAYA 4OIMA 4I5IA 5THKA 3HSKA 1XEWX 3BB4A 1P39A 1I3MA 1X8KA 1MAVA 4TMKA 1K8YB 4EG4A 4F93B 4O4HF 1L4YA 2XWJI 2BFPA 3ZWXA 3KZVA 1KZYC 4XYEA 4PZEA 2V7XA 4PF1A 3VAZA 4QT4A 3RYFB 2Q99A 3FWHA 4WOJA 1N5IA 2OHVA 3B70A 3MYYA 3KS9A 2F1KA 3ZLUA 3PLAE 2L17A 4YR7A 1DU4A 3UYLA 2ZFUA 4ZQEA 4A27A 4RVUA 1SVWA 2G1AA 3K32A 3WWPA 1F2TB 1SUFA 4XWAA 1SCKA 1OGIA 2RH5A 4V0OA 4F97A 2QRGA 3H19A 1NBEA 3BWVA 3OLQA 2Q62A 5JCJA 3AP1A 3P97A 3PGVA 3RT9A 5ICSA 3UHFA 1K5GA 5D7BA 1RYFA 1JIJA 1MNAA 1VRCA 4DNFA 3GWZA 3GGPA 3P9PA 3M1YA 3M2TA 3WZ2A 1GZDA 4HD8A 4J0JA 4OQEA 4YWJA 1OCEA 3JD3A 4HN9A 3DKPA 4NH4A 2J9ZB 4AMZA 1GDTA 2XLBA 1V5GA 4FZ3A 2JGMA 4MLZA 4BP1A 5A9SB 3ER9A 4B6SA 1WG8A 1CFZA 1Q1NA 1PD1A 2OORA 3C3KA 2CXHA 4NOJA 1EEXB 4KXVA 1JECA 3ROGA 5KZMB 2AXQA 5HRUA 3WA6A 2HJWA 4E12A 3QUAA 5FBVB 1L1FA 4UVEA 3T7SA 3TL3A 3WRXC 3ZWNA 1Z5OA 3QW2A 4YX9A 1Q1AA 2IJGX 5TMPA 5J2TB 3EPLA 1JL3A 5CYPA 1QHEA 1KQOA 2OGUA 2B6NA 2DU8A 1WW8A 3NB0A 3BMQB 4Q3NA 1Z5NA 2NU6A 2ZRCA 1BIFA 3U3ZA 4NSNA 2Q7DA 2ZYAA 1IY0A 1WSWA 2OG1A 5D3MA 1O97C 4DLTA 4WRRA 3PPXA 4NH0A 5AHXA 4A2QA 2D6FA 4CLXA 3INRA 1S1MA 3HU2A 1VMEA 4JITA 1HG0A 1Q44A 1HMPA 2A88A 4OI2A 3O9MA 1N2SA 4BNNA 2P6OA 4DB2A 4R7GA 2Q1SA 4D4LA 1WDWB 3IPCA 4FOLA 1GCUA 3A1FA 5CLIA 4B4VA 2EW1A 3AZOA 1JNYA 4UEQA 5EINA 1Z0DA 5EUQB 1RWKA 2YJ6A 4CM8B 5DLEA 2PKXA 3LIIA 2D5IA 5CR9A 5JWHA 5TB5A 1CY6A 1WKBA 4BFSA 3F1KA 5SZJA 2V4UA 3MCUA 5K2MA 4F3TA 4O8ZA 2F7SA 1E7YA 2C9DA 4PQGA 3VKVA 3SQWA 2QUIA 1OUMA 2BUAA 1FYDA 4KMOA 2C0CA 4FFSA 4AU1A 4I50F 2ODPA 4J0QA 1GHTA 5TRTA 3K1ZA 1Z39A 4MULA 2YV2A 2A9OA 1G63A 5GVSA 1F2DA 4NOLA 2GO7A 3HJAA 2DKOA 3ZXXA 1GUBA 1Y34E 4H16A 2XDAA 5FI3A 1HTTA 4OQFA 1AUPA 1DAIA 2X77A 4IDBA 2RB5A 5KTRA 1NXTA 4FYVA 2AS0A 1QJCA 1FLDA 1LS1A 1Y4SA 4WLNA 4XDHA 2D0DA 5AKYA 5HF6A 4W8HA 1S3FA 4HB0A 1CT9A 2GR9A 1G2QA 2BJWA 2DLDA 4DPLA 5CXUA 1KTIA 1SUCA 4MKZA 3Q6MA 5HJ5A 2ZIFA 4JYMA 4UBOA 4ZCPA 3PKIA 3TTYA 1QH1B 1ZIDA 4L6IA 4N6OA 4L95C 3D81A 4J1TC 2JLVA 5AO9A 2W00A 5KWSA 4DS3A 4CQNA 3BREA 5MHTA 4KO4S 2EQ5A 3FR7A 4HGOA 1UJ4A 4JSYA 3UWOA 3VTZA 2Z4RA 3I3SR 4C1BA 4X62B 3N7TA 4YHHB 2WYIA 1Q2XA 1CVIA 1R9NA 2VC2B 3OA0A 1OI7A 1RADA 2WINI 3Q1LA 4YP6A 1PYGA 1YIAA 3I12A 1N8TA 3I2HA 4TTAA 2PZMA 1IM5A 3MXTA 4KVAA 3C4QA 4CBVA 1BWSA 5JNUA 2YXPX 3CO5A 1WPRA 3K0CC 1AVTA 1UK7A 5T3YA 3JRWA 4QSMA 2IH4A 1YZKA 1PLJA 1QGOA 2JLAA 3VC2A 1BRTA 4O4JB 1AS3A 2DETA 5FRDA 3U3KA 1R74A 3O2SB 4AYWA 2VDNB 5CD9A 1GSIA 1Y81A 4LHEA 2VQDA 2WG0A 4C29A 1E32A 3KTOA 5TNXA 1IPHA 1EZ1A 4YXWA 1JIXA 5KHLB 4D02A 1X7HA 1A9XB 4YRQA 3NHAA 3DVAA 2VHEA 2NUPA 4HDNB 4NZ9A 2ONKA 2ZRHA 4GM0A 1XDSA 3EXHC 5DMHA 1G60A 1OX6A 4BRWA 1RYDA 1Q22A 3R3ZA 2NU7A 1GYRA 2E4XA 4I3FA 1IEXA 3GBSA 1VTKA 3AOGA 1ECGA 3O8RA 4U3JB 1HDYA 4RVDA 2J6HA 1RC0A 5EZ5A 1NSTA 2AKYA 2WKWA 4HGQA 1FOEB 1NY6A 4ASUD 3BIOA 3CLHA 4AP6A 2FEXA 3GN1A 5IJ9B 2OUIA 3FSGA 1P1CA 2EX1A 3IT0A 2IDMA 2TMGA 2Q21A 1LX6A 2V6MA 2WI8A 1Y6QA 3AVOA 3OEYA 4R51A 3BHMA 5FV7A 2YXEA 4DCGA 3D6TB 4RTJA 1EE1A 3KZKA 2C5LA 2W6PA 3FW1A 3V7UA 3TTVA 4CR8A 5KYWB 4AY2A 2NP6A 2C92A 1U3CA 2AZMA 2UVPB 1AS0A 3LQRA 4ZOBA 2HTFA 4B74A 3ADKA 3RV4A 4D4MA 5C9ZA 1T6XA 4MVJF 3WGYA 2NO4A 5JW6A 2REBA 3SE0A 3K5IA 4C20A 3QTBA 4RHUA 2ZJ0A 4Q1CA 4XH9B 5BN1A 1HNNA 1R6UA 2F8TA 4JHLA 1G3MA 2Y1DA 1AN9A 1YQ9A 2ZBQA 3I01A 4V0MA 3C3CA 4OJNA 3GF4A 2J3QA 2C7RA 1GGJA 2I2AA 3U48A 3ZBUA 2CV1A 4A23A 4R8SA 1U80A 1KMIY 3L7JA 3TQIA 2J0UB 1O4VA 1M8FA 5ECGC 2FU5C 1MO6A 2HC9A 2ZAGA 1NN3A 2WDZA 3E3MA 2ZJ1A 5HIJA 4FJ0A 1PJQA 3AP2A 3AI3A 1GG9A 3R75A 3SN6A 5ILOA 1Z6YA 4FDUA 1ESEA 1O87A 1PQUA 2OHXA 3L18A 3CVWA 1JSCA 2ZB3A 2Y1FA 3R5XA 4M8LA 4UAUA 1EVJA 2XUHA 4BIIA 3HBFA 1Y3HA 2V1UA 4RH1A 1V1MA 1NYLA 2IQ5A 3NORA 3BWXA 4S0XA 4EGCB 3SQXA 2RHDA 3UGQA 1MENA 3ODPA 4X1IB 1QFJA 5GPBA 1FA9A 1N9ZA 4GSLA 4OXNA 1ORWA 3B1XA 4PYMA 4CMCA 1YQXA 5BNZA 3B60A 1D2GA 2NSDA 1K66A 2BLNA 1YD7A 1UJ2A 4QJBA 2EATA 1ENYA 3I9KA 1GLVA 2K6GA 2R68A 2QTLA 3B3AA 1ILEA 5CJ2A 1PFUA 3KLOA 3AHGA 4X61A 4FFLA 1RBQA 3GP8A 2Q0HA 4PZYA 4QBKA 3CE9A 2Z8ZA 4C05A 3RTCA 2A0FA 4YJHA 1C7EA 4YUVA 2XUZA 4EI2A 3GP3A 3MA0A 1AXRA 3KVNA 2OLEA 3MTDA 1FNMA 3QA3E 1X2BA 3QX7A 4KHZA 4RFSB 1TLLA 2JJQA 5EMMA 1AHPA 4ZVTA 4AG6A 2R1VA 2AOWA 1XYYA 3AUFA 3B1FA 3FNQA 4PZ0A 5ALLA 3ZGXA 4INAA 2YWXA 3LWBA 5DJ5A 3ZJUA 3ZI7A 4XYGA 4HAYA 2JCXA 1YZYA 3LXRA 5I5GA 4QOIA 4KMRA 3N2LA 3ZCUA 3DBIA 3FWZA 4KU4A 1Q95A 2HQOA 4Q7LA 4PYKA 4B6QA 1GPLA 1S1CA 2O7NA 1WZCA 1NKTA 3OH8A 5HUJA 3ZG6A 3UXHA 4HEA1 4LWPA 5KVQA 4WUTA 2EV9A 3B9PA 2ZTHA 2IE0A 1A8SA 3MAGA 4PTLA 1BGWA 1Z5PA 5ENDA 5CT5A 3ZLTA 2GEFA 1VHJA 2EFJA 1K9VF 3AEUB 4GPD1 2DHEA 4ONEA 5TY0A 4D44A 2WLTA 1G4HA 2CF6A 4G5GA 4XGQA 4G8JA 4D43A 1SXQA 3OM8A 5AW8A 4ARZB 4Z4GA 2C3UA 3OZWA 5B3KA 1GG8A 1ESCA 4YDSA 2EYUA 4KGDA 2BFEA 1GUFA 3L8FA 4Z9YA 2HRDA 3AVXA 4KFSA 3DM5A 1F2UB 4YGXB 5K3SA 4DQ0A 2V1XA 4G0UA 1YNSA 2WSIA 1OWMA 5EJ9A 4KWHA 5JZ9A 3R5JA 1TXGA 3P32A 3JS5A 2OECA 4MS3B 3KRTA 4BO1A 1ZR2A 5KX5A 2A9JA 1D04A 1DWUA 1YMUA 3B20A 4IOLA 2P9FA 1NPYA 3ZLBA 4J3NA 2WZBA 3QBVA 2QD2A 3FETA 5DTEA 3UUGA 3LYUA 4P3KA 3SF0A 3O03A 5JH7A 1A50B 3KWLA 1NJSA 4BECA 2HJRA 2UZ4A 5I9TA 2QMZA 1N9KA 3N2KB 4NEQA 4G0WA 1GO2A 3ZZ1A 4MPDA 2C61A 4ETIA 3T54A 4ZJPA 4IVRA 4M0FA 1OI2A 1OOEA 3TIXB 4FT4A 2I6QA 5CM8B 4D25A 3PKJA 5DSTA 1XNRB 5E38A 1WB5A 4LYGA 3E1SA 3VNBA 2WIAA 2XT0A 4NU5A 3KE8A 2CK3A 1AUOA 4TSRA 2A1TR 2BISA 3HABA 1N0IA 1BX3A 2GERA 3CJQA 5BSTA 2X7JA 3K3PA 2ATIA 3TTTA 2VIIA 4R16A 4BFWA 2E4YA 4BWGA 1XSEA 2H18A 4AN0A 3VR3A 5KDLA 4Z9XA 3TW8B 3GLIA 4B3GA 3UAZA 2YRWA 2CL6X 3UWKA 4TYMA 5AWFC 5CT6A 2B35A 2B6HA 4YT4A 5AIBA 5K6RA 5JBQA 1ZJZA 2XDQA 1W4CA 1JYSA 1ID1A 4IGAA 3QEBZ 4I4TA 2WYVA 5LOVA 1NVAA 4WXMA 5KOIA 3ZY4A 2L18A 1M2NA 1HMYA 1P2UA 2VRWA 2XE8A 3ONDA 3W1EA 5CW2A 1VHTA 3IERA 4A0SA 4F4HA 5EZYA 2JCBA 2NO5A 2RAVA 4G0NA 4QTUB 5BT9A 4CMKA 4C6TA 4EG0A 1VXRA 4NNJA 2ZIWB 2YUTA 4OYLA 1G21A 1LNSA 2QTVA 4RF3A 3C0KA 3MGBA 3GYGA 3HBLA 4PSCA 5ALVA 1MP0A 1Z88A 2HIHA 2ZBDA 5IEJA 5KQLA 3BWYA 2HMAA 2G80A 2PQMA 4GXNA 4L15A 4A82A 4Z7JA 3R7DA 5G3YA 1EUDB 1NT2A 3WMGA 5GM1A 1USVA 2CDRA 4FYMA 1V96A 2UZAA 5CEFA 3IT3A 2RGXA 2Z08A 1MB2A 4P3OA 1G8YA 1QHHA 4MUEA 3L0YA 4PFJA 1HURA 5I5EA 2WWGA 3ABSB 3RWMB 1U0BB 2HU2A 4Q5IA 4EHLA 2VPXA 5ILQA 1ISIA 4JL6A 1H6AA 3CUYA 3LF1A 1IM8A 1TD9A 2W2KA 1OFUX 1B8PA 1NQOA 2B37A 4JKOA 5TMBA 1XZMA 2EKBA 1M10A 4BWFB 3R8FA 5IKPA 1R6AA 1F1BA 3OJEA 1NRWA 2XHEA 4R68A 5FBZA 2FW7A 1UEJA 3QMPA 3TKAA 2ZJYA 4ZXFA 3CRZA 1NPDA 2I7DA 4C21A 1QIFA 5AESA 1I30A 2BW0A 1Z08A 3NGLA 4HH1A 1K1EA 5CK5A 5CX1B 3ETNA 4YI3A 5H9VA 1ZXBA 1JHXA 4RCZA 3U7GA 1O03A 3SI7A 3LE8A 1X80A 3EVZA 4FKZA 1V1RB 1M1YA 2VLIA 3R5TA 2P11A 2V6BA 1Z16A 2J5BA 3P1JA 1C3VA 2HWKA 1SOUA 4KO2S 1Q17A 3JYOA 1NXWA 4OHKA 4QLOA 4Z99A 3FFWA 2OGZA 3EIWA 3IESA 1PX0A 1TUEA 4KRFA 2FR8C 4V0KA 1M6YA 3BB3A 3BXOA 4LZNA 1BGXT 4HWRA 1BS9A 2GT1A 4ZAFA 1L8OA 1PEAA 3VSBA 1NKVA 3IAS1 2VSXA 1Q50A 4N6GA 3K73O 3VJKA 2PUEA 5GZ6A 1FP4A 1NUHA 2GYVA 2EF1A 3NTLA 3SK0A 4Q4HA 3MTAA 4WI1A 3KXLA 5AKJA 5JSYA 3QY0A 5CLFA 4GGMX 1USWA 4O5AA 4FFBA 2PJZA 3TL6A 5ALFA 1RR6A 3OFJA 1JJVA 1GQ2A 1LFAA 4P80A 2P3OA 3U0VA 2GS9A 1U2ZA 5LQKA 3NM5A 3PVCA 3R23A 3KQQA 1E6WA 1EVKA 2GTPA 2GSWA 1X3SA 1QOQB 1G8MA 2C42A 1B4DA 2BEKA 2GDJA 2X13A 2BH9A 3ASZA 1KNQA 5AK5A 3T99A 4D8XA 4ABTA 4QGFA 1L5HB 4B4OA 2V5UA 4RABA 1DFHA 5D3KA 1Z73A 4BLWA 1N3BA 2FKAA 4EELA 2RDMA 421PA 5BQ3A 5KMGA 2CHFA 4HQOA 5K3AA 2CMFA 2DWQA 2GCPA 4KR7A 1JJBA 3V7NA 4K6CA 2W71A 4WGFA 4X6YA 5AK4A 4B3CA 4B75A 2HLHA 3KNZA 1XRSB 3AW9A 3HYTA 1IATA 4XLLA 1YVEI 3WLJA 3DTVD 1A1VA 3LUJA 2QR2A 1OVMA 2IPXA 2IXTA 2G7ZA 3T3GA 4MWBA 1YQUA 4C76A 2WA2A 3JVEA 2NSHA 1VKJA 1JUDA 5AOCA 5T8KC 3I2IA 1R3UA 1V9SA 1UR5A 2ID4A 3FWYA 3IVCA 2C96A 2WU1A 1ZD3A 1QO0D 2Z5LA 3ABIA 4Q18A 4MGKR 2PZEA 1T1RA 4HEJA 3QWAA 4X44A 3TQRA 1XF9A 1XZBA 1XJ5A 3P5BA 4BCDA 2JLYA 4A8JC 4Y6GB 3FYSA 3EBLA 4ND2A 4PLHA 1JP7A 2BM0A 4OYYA 1QVVA 3KUKA 5C7YA 2GUGA 3QVXA 3PUZA 4RHEA 2LD4A 5A3RA 2DX7A 3OG9A 4JIMA 4EEKA 1L7EA 3OPYA 1OWOA 3KDSE 1P7VA 1KFCB 2M6RA 2Q2QA 3DOFA 3JVIA 1G291 1PS0A 1IBRA 3VNSA 3KQOA 5DWQA 2H5EA 5E0KB 1IQ0A 4RIHA 3U09A 1M8KA 1QYWA 2ZKLA 4Y2GA 1ENPA 2XB9A 1FSPA 1XKQA 1Y1LA 3EEFA 3RHSA 3EXAA 2XV1A 4D5EA 1X7ZA 1C2YA 2YW9A 2JJMA 3FWNA 5HUQA 3FTPA 3DDHA 2ODQA 1H0SA 3MWEB 1A5BB 4LEIA 3Q3VA 1HKHA 1XLVA 1B3RA 3EWSA 3DCIA 5C52B 4EHNA 1QRTA 1QYRA 1WCYA 4RK4A 4FYYA 5HA5A 5DIZA 2BHTA 2QRHA 4I0WB 4ILEA 2WIBA 3KVVA 2R1ZA 2YC2C 3PD0A 5ES3A 4DA4A 1MABB 3NWOA 4MA0A 1OYYA 3GFQA 1Q0HA 4MV0A 1DFIA 5A02A 3FHTA 1K2VN 3EHEA 3IHLA 3WGJA 5BV1A 3ETDA 3R9XB 3QQ5A 1EM6A 2C4UA 3D4NA 1XMPA 1PJ2A 1C29B 3FMGA 4LHZA 5F5LA 2ZWIA 2YFYA 3JQGB 4YDRA 1XROA 1CDDA 2QT0A 4IF6A 1A9OA 4C5AA 4DWWA 1JILA 4QPZA 1FFXA 2F9MA 3C6YA 1U0NA 5JMPA 1EK6A 5JHGB 1B2LA 2OE2A 2I3GA 4X3PA 2QN7A 3SE7A 4DYHA 2ZUBA 3B2QA 3L4EA 2QSUA 3AGPA 3QMVA 1VPVA 5K4AA 3HE3A 4MV4A 1K5HA 4DEYA 1XKXA 4FR2A 4DC9A 1W6RA 1ZCAA 2QP9X 1XZFA 2DLNA 1KH2A 1SKYE 2QGNA 1S9DA 1YIDA 1TYZA 4A6DA 3WADA 1BDIA 3OECA 5TSDA 4OK3A 1NNLA 4K5QA 2HSZA 4BAUA 4JI4B 5K0EA 1J56A 2Y1OA 3FYTA 3NHLA 2HLDA 2PPVA 2HDNB 1Z3CA 2I76A 3HA2A 1ACLA 4TUYB 4TVOA 5E9JA 3UPDA 5B2EA 2DQZA 2KI5A 3W3AH 2QLJA 1O0SA 4ZT3A 3CURA 3TSOA 1P45A 2R6GA 4LQDA 3QA9A 4RIFA 3QEMB 3JQ7A 5JVDF 4QAJA 4ID3A 3IIEA 2CWDA 4U5XA 5LDHA 1Z75A 2CE2X 1FTQA 2G09A 4XWKA 4TOIA 4DIFA 2WHPB 4IDCA 1LPBB 1ZC4A 4N3BA 3HJTA 1CS0B 4P4LA 3CWCA 4EGJA 3WC4A 1HX7A 3FY4A 3A1EA 4A6EA 2H2AA 3OUUA 2PQ2A 2XSZA 1UMDA 4FWTA 4V38A 2C5FA 1KK3A 1AKYA 3HACA 4FD3A 1Z0KA 1TU4A 2HH9A 4LY3A 5DNUA 2YX1A 1CEEA 3TQSA 2CNWA 4EY7A 1ZI8A 5DCYA 2BH2A 4CZ2A 1DCFA 3T5MA 3X3HA 4AL4A 5K4GA 5K7SA 3AL2A 1K4YA 1E20A 4Q16A 5JARA 5C8VA 5FPKA 5AVVA 2AZDA 4RYDA 2Z0MA 1VP3A 1E2QA 4KWEA 1Q14A 2B20A 3CF4G 1OB2A 4LXYA 3DEZA 3WL5A 1BKSB 4OD0A 4TKLA 1W36C 2E18A 3EEOA 2H51A 3TLGB 1T3GA 4BNDA 2EWMA 1CIVA 1OTHA 5AVOA 4IJUA 3M5DA 4DM7A 2J08A 1E79D 1Z0AA 3G0OA 4FCCA 3L41A 7GPBA 4BKRA 4XVUA 5FLYA 2EZ8A 2R4QA 4QNMA 5ABPA 5JEDA 3ICPA 2ID9A 4QOFA 3P9RA 3UMSA 4KQ9A 3LUHA 3OAAD 3DLPX 4JROA 3GH1A 1NFRA 1LUAA 2JAHA 4O4LB 4BVHA 1T91A 5JRDS 3QKRB 3H16A 3A32A 3D8UA 3DBLA 4L0QA 1VHLA 3R7WB 3WKBA 3QF4B 1E1MA 2EZUA 2GOYA 4EYQA 3S4YA 2YZNA 3RVQA 3SYMA 5CMLA 3W4JA 2J5KA 1VPLA 2C94A 2DFLA 2JZNA 4KQXA 1SEPA 1SXPA 3RYIA 1IWPB 1ECLA 3T7DA 3R7LA 3HBNA 1EXDA 4ZMRA 4C0JA 4FLFA 3MWJA 4RHYA 5LP6F 1RPAA 4WXYB 3LX5A 3V8QA 1POWA 2Q29A 3DWGA 3U4CA 1N5RA 1PFWA 3W3ZB 3LT2A 1TYDE 4M49A 2E4ZA 1P1JA 3ESQA 5F3DA 4I46A 1JXOA 1FDIA 2C9ZA 2JHFA 3EGDA 3O5AA 4QT0A 3QEKA 1Q21A 1YC5A 3AHCA 4FHZA 3N0XA 4XGNA 3NYRA 3G82C 1C9DB 4O2AB 1J9EA 2O7VA 4JJAA 2I67A 3LBIA 4HRAA 4U2BA 4DCOA 4DMRA 4EF5A 5L3QB 3L4BA 3GLGA 3ZJVA 2NXNA 3KOWA 1AB6A 1E5DA 1KRXA 5FO1A 3SQLA 3DUWA 2JARA 5F1OA 3PLRA 2IXBA 4NOKA 3MJDA 3BK1A 2Q45A 3IDQA 3VSDA 5TPWB 3VMFA 1PFYA 2NXJA 3WV5A 4B7UA 4DMGA 5K3CA 4QLAA 1PK9A 3IVRA 2HMYB 1K6EA 3GDOA 2B2NA 2QJFA 3KKOA 1SA0B 5ULLA 2AXNA 3KKKA 3TPCA 3WLEA 4F96A 5BV0A 2HWWA 3ETLA 4UE6A 4Y2TA 4I3HA 4RSRA 2O8DB 1MW9X 1KMHA 5CDSA 4RZHA 3SG0A 4KR3A 1N6PA 1NTRA 1VDMA 2DHCA 2PWAA 3QOXA 4IMRA 4F7WA 5KTSA 3EFHA 5C51B 2I71A 3DHEA 1ABEA 1YJ5A 3JRXA 1UQTA 4MI3A 2D3WA 1QHXA 2OZLA 1CUWA 1QTNA 3R4CA 5DYIA 1RQ7A 5DI3B 3LO5A 5C80A 3PCXA 2B69A 4J0FA 4UE2A 5KX5F 2C2KA 4W5WA 4GQAA 4I66A 4J0KA 1FXWA 3SDBA 1OLSA 1WSBA 2I2FA 5BV2P 1Y8ZA 4IFTA 1KGDA 1ZUHA 2J87A 3LYHA 1ZWLA 2A33A 1QH9A 2W6JA 4XQGA 5EUCA 4C4ZA 2CT8A 1IN6A 2GD6A 5B37A 1CWUA 2FSVA 1REQA 4EYGA 5JH7F 4NS1A 3FLMA 4QUIA 3VXKA 2WNSA 3MFQA 1GFZA 4DUYB 2JIRA 1X8XA 2BGIA 4L76A 3FPEA 5LL6P 1Y7LA 4KOEC 1BSVA 5COQA 3GUUA 3UWPA 4RTSA 3U62A 3GN2A 2DM6A 4OXRA 1DADA 2Q1XA 3QELA 1JI3A 5TQ2A 1LNZA 4Y1FA 4EVQA 3HCEA 2XKKA 2BM9A 4YO8A 1CC1S 2C07A 1NF9A 3PNMA 3LBHA 3MGCA 3GGDA 3P9SA 4XOUA 2YQ4A 2YFHA 5SZKB 3NUZA 3DWFA 4C3OB 2A1UB 4JR2A 4P38A 1APBA 1EK5A 2FG5A 3VX3A 2AJLI 1TIPA 3FDXA 3JALB 3KJGA 4HPJB 4JGBA 1PR4A 3TUZC 4CL0A 4V03A 3T9AA 2JNWA 5SV2A 3NRJA 4Q01A 1YZFA 3UOWA 4TWBA 5J3JA 4BLOA 3H2GA 4P3PA 1P7ZA 2ZB4A 1NY5A 4WNCA 4BE4A 1KO8A 1YBHA 3UYKA 4YIHA 4X24A 2WPDA 5LXTA 4O2BA 1FYEA 1UKAA 3OIFA 4GUAA 3FYUB 1I5OA 3BB1A 3LRPA 3TLBA 3F6YA 1UPBA 5LOVF 2XAAA 3OX2A 4KB5A 4PCLA 4R81A 1Y3DE 2NU8B 2BM8A 3FI0A 3EMKA 4O8CA 1PDOA 1ZXLA 2HRQA 1N0WA 4N3GA 3BXGA 2ZSHA 1KC1A 3C6XA 3G1TA 3RJZA 1PNRA 3BHIA 3L05A 3TD6A 4B3XA 4BMXA 5B4UA 2Q3HA 4O2LA 5KYTA 1VXOA 3QPAA 1JR6A 3A36A 1DP4A 3CT4A 4RL6A 3B3FA 2CLCX 3K53A 1CLUA 1EAMA 2FSSA 1ODCA 1I1QB 1N2JA 3WRYC 1CUHA 4BBJA 5BNFA 3VYRB 5ALIA 1PEDA 3MTIA 5E9WA 2GF2A 1S8NA 3E22A 2W2XA 1OZFA 2AE2A 3GAFA 2QHXA 4RZQA 5IVPA 1LI7A 2C2WA 1CDEA 1VLVA 2O23A 2XTJA 3ADBA 2AFIE 4EMBA 2GFHA 3WLAA 4UVDA 4L22A 4RZXA 4HB3A 4S3MA 3QE9Y 4QUEA 5AHOA 3OQVA 2O8CA 1SQ0A 3K8ZA 1XP8A 3ZI4A 2IIQA 2G1UA 1C1XA 1ZJ4A 1Q84A 4AMUA 2P9QA 1BMFD 3IP6A 5DCUA 4NBVA 1SM4A 4R1SA 4M0DA 4MZDA 2MHCA 2W22A 2PWYA 3VJLA 1CX9B 4HBGA 3AB7A 4KXQA 5E1MA 5JNVA 1NW7A 1SC6A 1QORA 5AK3A 3C16C 4HGYA 4WTOA 3K2BA 5K8UA 4P0PB 1T3TA 2P35A 2H1VA 2PT6A 1WSDA 4IWNA 2VRCA 2JFYA 3A1NA 3H9QA 4FPXA 1Z8NA 1RYNA 1C3OA 2FK8A 4KDRA 5K3FB 4TWRA 4TQ9A 1B8OA 1H1LB 2YMLA 1SVMA 3G9ZA 3SWWA 5INTA 1VG8A 1Q6ZA 5GP1A 1WXHA 4UM8B 4CEHA 1N2HA 3P2MA 1M2VA 1JHMA 3P7MA 3QLEA 2TMKA 4JUIA 5DN6A 3RG2A 4E21A 4YMSA 1LPSA 1BA2A 3A28A 3N7AA 3HXQA 4B84A 1X94A 4JJGA 2FPGA 1TZBA 3MCWA 3QVWA 3SYKA 5J9FA 3W7BA 3SDZA 3CLTD 1TB4A 3W04A 3QF7A 3TYXA 3O7MA 4TV9A 4MVJP 3PQEA 3HEBA 1AGPA 1AQIA 3IUQA 4U0JA 5EIHA 4E5PA 3QX9A 4KDFA 3J81k 2QUKA 3F9CA 4QOGA 2W11A 4QJ4A 4HFMA 4Y9SA 1KQNA 1Y6FA 2X5XA 3E9CA 2H1HA 5A4KA 2PS3A 2IDJA 3BF8A 3KYDA 1F17A 2Y0DA 5DNDA 2X2PA 3W05A 1JHZA 2FPSA 4A8PA 3AONB 2A9QA 1II9A 1Y1SA 3BL5A 4NCKA 2YRFA 1UKVY 1ITZA 4IDHA 4JWKA 4JWTA 4LOIA 5K0CA 4HWTA 1IQRA 3G5LA 3C48A 3LW7A 2UXCB 2DQSA 4LHXA 4QPJC 4XUCA 1QIIA 1GG2A 3RUHA 3WHKA 4COOA 2I7XA 4GQIA 5B64A 4D3FA 3U81A 2DTDA 3NXSA 1GNPA 4OOEA 4HVCA 1NP3A 3AM4A 4DKJA 3FTFA 2Q41A 1CD5A 3MRVA 3WJ1A 4A7PA 4ZVSA 2X19A 3G8BA 4EI7A 3I0MA 1ORRA 4H18A 4AF8A 1H65A 4AY6A 5K03A 3OMWA 3ROEA 1H2ZA 1VL8A 3CNQS 2ZRQA 1GSAA 3PNPA 3LHDA 3KQPA 1HT0A 1E66A 2FG7C 3EK2A 3LUAA 4P35A 5D00A 3UJHA 4E5NA 1T2CA 2J07A 3PGA1 1D9ZA 2C7VA 1W0KD 1L5ZA 1BVRA 5THXA 2VJBA 4JVMA 5BN4A 2QDXA 3Q15C 1TVKA 2J1LA 1A8HA 2F1HA 4GYWA 3OOWA 5HHTA 2D4HA 4AECA 2QDKA 1BD3A 1KOLA 1Q15A 1BQEA 1WZNA 2OFWA 2HN9A 3NIFB 4TS1A 3SBXA 1AA9A 4A2CA 3WICA 1ULUA 2FHSA 4BZPA 2LDBA 5DCLA 3GNSA 4P86A 2QB5A 3FTNA 3OOHA 5IJZA 4FGLA 3L7OA 1BH6A 1FRFS 2FPRA 3VO1A 1KVUA 4PZAA 4BQOA 1GZ3A 2J9RA 3IQHX 3PIDA 5ALRA 4POAA 3HN6A 5DLPA 1IHPA 3OT4A 1T29A 4JXJA 5FUBA 2GJAA 1W0JA 4JQYA 5TXGA 2QENA 3UJ6A 1W6UA 5HQ3A 3FKSA 4JP3A 2WIGA 4IS3A 2V7QA 1X14A 4WASA 2DWPA 4YAWA 2H5LA 2X0RA 5LU9A 1JKXA 2OAEA 3W2FA 3B78A 2ZAMA 3LCRA 4GKJB 3HYCA 1L5WA 3V97A 1FXSA 3TGLA 4EI9A 4CEJA 2BHSA 3DHWC 2CEAA 3KQHA 4OQXA 1RYBA 1GZ6A 1TJYA 1AKQA 4M6WA 4Q34A 3G8CA 2ZIXA 4LQ4A 1NGSA 4BLRA 2XIQA 3IAM1 1IBCA 1AHNA 3FWPA 3IOEA 5CNIA 3RVJA 3WLTA 1NI4B 3G79A 2EOAA 4IUCS 4LK2A 2OM2A 5DFAA 1K6JA 1U2PA 2P9TA 1U3UA 2P69A 3GCWA 3V2IA 1Y8RB 2VYCA 2GM5A 3F74A 3S2UA 1SKAA 5LN1A 1IHUA 4TVKA 2W2OA 2ZJ6A 3FOEC 3SX4A 2BSQA 1TCCA 1EFHA 3TIFA 2ZEJA 4V1CB 2N46A 4HX2A 4K05A 1L5YA 2B1IA 3GPIA 2DXIA 2AXPA 3OP4A 1IK6A 1EB9A 1U7XA 3LA6A 4LOHA 3TZCA 4R0VA 1EG7A 2X76A 1SQGA 3WFIA 1X1EA 7MDHA 1NKSA 1Y6GA 1QMGA 4JDUA 1F7VA 3A25A 3OIVA 1K3UB 1Q12A 1UUFA 2WSSA 3UB4A 2X2OA 3BL6A 5FHQA 4C7MA 5LJIA 3ADCA 3PI7A 3T12A 2EJVA 2X42A 4LJ9A 4H08A 4IDFA 2YOGA 3ZH2A 5IKXA 2J09A 3FRIA 1J25A 1D0IA 4ZKDA 1KDOA 2IY7A 3ZE8A 1T5DX 2KQUA 5HBRA 3ED5A 4BWVA 1S3GA 2WWRA 2XCTB 4CUKA 4HQFA 3S5UA 2ZROA 1R15A 4C0WA 5KJ1A 3GJ4A 1C7IA 1OC2A 721PA 1C0EA 1VMDA 5L3VA 1ZUNB 4C07A 5I3ZA 2AFIB 5EKSA 4KBFA 2I6SA 5KYNA 2GF0A 1ESNA 3NBYC 3P4UA 3LCUA 4KUEA 4TKUB 3CUVA 2QZSA 1K7FB 1RHUA 3O1LA 4R3WA 3FHOA 5EQDA 1IE3A 5K0NA 2XYPA 2DOKA 3TEFA 1U2TA 5JLJA 2OCDA 2WFAA 4UW9A 1CEYA 1FJ2A 3L43A 5FOWA 3FFBA 1LDNA 3BJRA 4RFLA 1MC4A 3MJSA 1SY7A 1SZDA 2Q0XA 1R0ZA 3KLBA 5DASA 4GPTA 2FMTA 1NUTA 1Y6ZA 2M1ZA 3G0GA 4JH0A 2GN1A 2Q2WA 2GK6A 4KV9A 4MRAA 2G5CA 4DMFA 3D0RA 1O54A 2DR3A 5E9QA 1RP7A 3H1EA 4MI1A 5CA1B 1JAXA 3O8CA 1HDGO 3AFNA 5G0VA 3FCXA 3THOA 4DYDA 1KOGA 1W4AA 4GP9A 3U3MA 4XM1A 2F48A 3PXCX 1TGYA 3C41J 2XITA 2EG5A 5DLYA 2QLTA 4UMFA 3M5CA 4TTQA 4XM2A 5HQJA 3WK6A 1RXCA 4ZCTA 2F3RA 1XRLA 1UM9A 1Y6JA 3ES9A 3NC4A 4HVTA 5JZSA 1CE8A 3P9CA 4PYQA 3SSMA 1XTRA 4UXJA 5FLKA 2LV8A 3GROA 5DX0A 3AY6A 3EVDA 4JASB 4JJKA 1AO0A 1TJNA 2HJGA 5GQSA 4OHFA 2BR5A 3FJYA 2HWXA 2A2ZA 4O08A 1W2HA 2RIRA 5EMJA 1SBYA 3MJTA 3OM0A 1S2LA 1YR2A 3OU7A 2FPIA 2A0YA 1VYTA 3E58A 5CCBA 1JTFA 1N0VC 1A88A 4UDNA 1CFJA 2C9MA 2QSZA 2ZUCA 2R751 1I3LA 3OCCA 2ODWA 1VGRA 3A2NA 5NLLA 2YVQA 3ZHUA 3ZJTA 3U44B 1UFRA 1GKIA 3EG9B 3JD2A 2XVXA 4H6PA 1N7JA 3NX4A 5F2EA 3JYQA 3AB3A 2Z43A 1FY2A 3D2CA 4PSDA 3ZCVA 4BX0A 1T4CB 1CK4A 2JFWA 1I14A 5AHWA 4C0BA 4E2ZA 2GNAA 4MR7A 4B32A 3PEWA 2WF9A 2QNRA 4NMXB 1J2YA 4B81A 5DX1A 2BZGA 3BVPA 3W5SA 4CKEB 3T7TA 1B6SA 3W3AD 1U94A 3K0BA 4X1KB 2IS6A 3D7KA 5ALXA 1GQYA 4BMSA 4NYIQ 5FLXA 1FYFA 2FP4B 3C1TA 2B61A 3R7AA 4DWOA 4LA4A 5C1OA 1WPGA 1LD3A 4GX2A 2IZ7A 4QVIA 4AJIA 1WETA 4PR3A 4ZC8A 1JEQB 2GN2A 2Z8YM 2BFWA 2VJCA 2FZCA 2PV0A 3B9BA 3ENWA 1VPEA 3IOMA 3KELA 4FQ7A 4HGNA 3SEAA 1L6RA 2IYAA 4L73A 4URZR 4WZ6A 4BVEA 5AOAA 4YCSA 4HNGA 3VYVA 2ZJOA 2NNLD 1EEHA 1SCAA 2NLOA 3OE4A 3OTQA 1PU2A 3PR1A 3QMWA 3FIJA 4PHHA 5HRCA 3IA7A 3J80A 1C4XA 1UJCA 1DG3A 4QPDA 5IEBA 4ZICA 4IEIA 4M76B 1VKZA 2VP6A 4LVCA 4KX3A 4YMLA 3MNFA 3K96A 2QJRA 3FPFA 2BAGA 4PYLA 3G02A 4AY3A 1NBOA 2UYOA 2XE6A 3UO8B 4DPMA 2OKCA 3V6LA 3ZYZA 3L7AA 2PVPA 2OPBA 4E7OA 5TEVA 5KHOC 3IV6A 3U49A 4I08A 3BAZA 3I5UA 2AKEA 2O8NA 1TLFA 1SB9A 1Z56C 5DYNA 3LPNA 1W1UA 4ND8A 3M4JA 4V24A 2E48A 3ILSA 4JLJA 4WXHA 1ZH2A 1TA0A 2IEDA 2X7XA 3CTPA 4K9QA 2GCOA 3C5VA 5E7JA 3D0OA 1AC5A 3CX6A 4Q3LA 4UHKA 3HB0A 4U2DA 3E7PA 4X00A 1P0CA 1ZM9A 4KGVA 2WFMA 4YMVA 4MXDA 4MQ4A 1YVDA 1M2GA 2B1RA 1Z34A 4ZVVA 4U9UA 5A2GA 1CTQA 3WMFA 1VZ2A 4E07A 3OC6A 3PGKA 4JELA 2PIAA 2PCJA 1SFRA 3ABZA 3HB5X 4IZOA 2BEWB 2GXQA 2EIHA 3RC3A 2PRYA 4BNKA 1X13A 4ZQIA 1U2GA 1T36A 1ZOIA 2GLUA 4PZCA 4YRRA 3ZXUB 2DPLA 5JWRA 3KBBA 3R5KA 2P4QA 1N3IA 3QIVA 4KGZA 2WD8A 3OZDA 3CLKA 4R41A 4RSMA 3AYXB 2QE7D 4C87A 4X9XA 3O4HA 4K2AA 4CG1A 4EKNB 4JX8A 2IW1A 3A0UA 3DF9A 4KXNA 1Z62A 3T3MB 2SKEA 4OJTA 5GGYA 4P84A 4XRGA 4ZDIA 4C08A 1XZIA 4B82A 1KR2A 4K1XA 4DMCA 2RHLA 3PDCA 4IVPA 1TKAA 5JCPA 4UKDA 1NDQA 3A9VA 1FSZA 2QMQA 2WHYA 3QBEA 4KO8A 4YCMA 3RVNA 4PZDA 3E5MA 3E9DA 4XWOA 4UM5A 1Q0ZA 4C0XA 3ZGLA 5JBNA 2ZM6B 1V5WA 2C7GA 4GI1A 1J8QA 4MR8A 1DBRA 2HMSA 4QXOA 1SVIA 1YUBA 2PT9A 3AXTA 4J94A 2X8JB 4HXGA 2OQVA 3GZJA 2BV3A 4B3DA 3IC5A 5JCJD 4V3BA 4XPIA 2ACWA 1PT9A 2BFDB 1P18A 2XLCA 3HS3A 3KYIB 4E5YA 2YV4A 3UENA 4M9UA 1PW5A 3EHDA 4EDHA 2GKSA 3HRHA 2PX8A 3U5ZB 2JAPA 3T35A 3WWZA 1EQUA 1ODIA 2GD2A 4MR9B 5DNAA 4DARA 1FW6A 4DKXA 1LC0A 1UOPA 1QG0A 1M2KA 2PR2A 3CISA 2PIDA 4G37A 4IJMA 1I32A 4QG7A 3FSJX 3G9UA 4E09A 4YP7A 1ZX1A 2X40A 1ZR4A 2AI1A 1BDJA 3ABQB 3SFTA 1NR1A 4EEXA 3SEFA 5IAOA 3K1AA 2PFSA 1QK4A 3OPYI 2H1FA 4RZ2A 4D9IA 3BHNA 3DLHA 3W9UA 3DFKA 2O54A 5K8CA 2F3UA 3RUAA 2WUWE 1W2GA 2VDUE 5LM3A 3L1UA 1PQPA 1U4NA 3L8CA 4GW3A 4DLVA 1NVKA 3TDMA 1IPFA 1F2TA 1QQ7A 2D2EA 5DISB 3TX6A 4XVCA 2PJDA 1SUSA 2ZIVB 3DBHA 4L8LA 1W52X 3DDCA 1TEHA 2Q1YA 3EF0A 4M87A 2WMDA 4MP8A 4WSOA 1U4OA 3RS9A 1H42A 4IGFA 4F21A 2F3SA 4FBMA 2O5VA 4OY3A 3L0DA 3TKLA 1SOVA 3FGNA 3TSWA 5AVQA 4L8FA 2A94A 2Q0QA 3O3MB 4WESA 2GHIA 3CU5A 4DMLA 4HF7A 1VCHA 1RWQA 1V8ZA 2WVJA 5K0FA 4I1RA 1VI6A 4AG3A 3MJHA 3FGZA 2O8BB 3E15A 4G84A 1HFWA 2X8WA 3JZFA 3OETA 5TVGA 2B25A 1L7VC 3HRKA 1KTVA 2HXGA 1FJHA 4MP6A 1QBKC 1RXSA 3LP5A 5J2TA 3E8SA 1UJ6A 3GJ5A 4J0HA 3BMQA 3MERA 1JYFA 4R9VA 3HR8A 3NDIA 2EGUA 3GW8A 5FNVA 4W5HA 3WJ7A 4O4IF 2WM8A 4BBPA 1WLSA 1XRMA 2NV6A 3H3JA 5DDIP 1C1DB 1KARA 4FDAA 4L0CA 4RPCA 1XC7A 1XN4A 1V26A 1ZZGA 2XOKA 1O5IA 1NR7A 4FWIB 4M53A 3TW4A 1C4KA 2H2DA 1R4AA 2HXYA 1YDFA 3O8QB 4TVSA 1QYVA 3ESXA 3OFKA 1P0MA 1VGQA 1KVTA 2G77B 1OZAA 2IYXA 3PSHA 1SUBA 4N5MA 5LZ8A 4LGVA 4HVLA 2OD2A 1QHYA 1XN1A 4KH1A 4N01A 2FZLA 4OUDB 1T10A 2RKWA 5TDHA 5K8TA 2B1GA 1AUXA 4MUFA 4MTCA 1IK4A 2OTCA 4L02A 3L7IA 1X19A 4QL3A 6PFKA 2IYFA 1DKNA 3GVCA 2GZDA 4GEKA 5LWQA 1U0HC 5CAEB 4WBSA 1LI5A 3PWZA 1T2FA 4QJIA 3SKVA 3VU9B 4RTQA 5KSWB 3VHQA 4BYMA 2E5FA 4BEBA 2YDXA 4GMKA 5IM4A 4ZEVA 5A71A 3LD9A 3E61A 5ALMA 1Z17A 2NOAA 1HUQA 3KM0A 1E6EA 4IVNA 1BVHA 3F3SA 4KV7A 4WJKB 1OT3A 2O48X 2WYWA 2Q2VA 1ABFA 4LDPA 4RBNA 4HFRA 4QRDA 3RAPR 4E0BA 1QLWA 4TRRA 5ERGB 2GN9A 4KLZA 4MMYB 1TUGA 2FETA 2XMQA 1FE8A 2XGJA 4ZJZA 1L4NA 2DH5A 4TZTA 4PN7A 2D74A 4YXWD 3AFOA 1QH1A 1UBOS 4OATA 2I0FA 2OVFA 2DWUA 3FBTA 2VF8A 2YXNA 1E3IA 3KOOA 1JR3A 3TM4A 3ZHQA 2HMWA 2O8VA 4URYR 4R54A 2HSWA 4QULA 1T3LA 1Q16A 5FBWB 5IWAB 2QRVB 2B30A 2XYQA 5JQGA 2C8VA 4YRKA 1UBUS 3OZAA 3H2SA 3SXUA 2IS2A 3KEGA 2YYZA 1NQWA 4PC7A 4IXDA 5IVKA 1KFBB 3F5QA 4WVLA 3N70A 2W43A 3DGEC 3BTSA 3H4VA 4GE3A 5ALYA 5HYVA 4R0NA 4CXMA 3Q5DA 2V59A 2JRLA 3GOHA 4OB7A 4OHUA 1WQ4A 3L0PA 3HPRA 4F71A 5JFGA 1QWOA 4WCDA 2VDLB 1AGYA 1U1IA 2C8JA 1CYDA 2XA1A 3ORFA 1H0KA 1XAGA 4YEDA 4I6EA 4LXTA 3C4JA 3LDUA 3UTDA 1DQZA 2AC2A 5FFFA 1N6RA 2O2SA 2Q6VA 1DZIA 1B8NA 4AUMA 3IAAA 5I9LA 3QXGA 4MKXA 1PGNA 4HDNA 1UK9A 3RRNA 1F0KA 2BGNA 2I6GA 5JD4A 3IVMA 3R0XA 2G1PA 4RKWA 3O1JC 2CJWB 2ZDQA 4RLSA 2O8FB 3DYVA 2O0MA 1RXUA 1WMFA 2BKLA 3O73A 2E5LB 1NE7A 3NTRA 2WJZB 2I4MA 2D7JA 4H7HA 6ADHA 1K63A 1VI2A 3AI1A 1DEKA 5HGXA 1NX9A 4ZI7A 4OX9Y 4L08A 1YO6A 1PJRA 2DSNA 2EAUA 4TN5A 9LDTA 2WJPA 1GGVA 3A4LA 4ITVA 4RVCA 2BJHA 2XXBA 5FF9A 2HWUA 5BQPA 5SYMA 4E22A 1XWWA 1WXIA 2I6UA 4LC0A 3WOHA 4HPWA 4BEVA 1QNFA 1R5OA 2OESA 4LSMA 4ON9A 1QZTA 2A35A 1DC5A 3OQIB 4UARA 3W9SA 3OPXA 4QQRA 1QE0A 1D9XA 1R1DA 4YACA 5AJZA 4ZTBA 1RSZA 4CI9A 5AJYA 4HXYA 1DAPA 3WYFA 3ZLJA 4D3DA 2KHZA 3NVDA 4L9SA 4EPVA 4S1PA 2IF0A 3LUCA 3B1JA 2ZBFA 3SC2B 1TKCA 3GT3A 3DTVB 2A1TS 2JKZA 3N5CA 2GILA 2L69A 1T2UA 2GAAA 3EJWA 1N7GA 1OBCA 4QREA 2J4DA 1I2ZA 3I04A 2GZMA 1O95A 3CW9A 5E1BA 3NAGA 4GVXA 1GPYA 3ZU5A 5DNCA 1ZOSA 2YXLA 1WNTA 1CR0A 3NHPA 5D3QA 5JOQA 1FTNA 1E2HA 2JFHA 1YRWA 2HT6A 2PGIA 3DCYA 5EKUA 2P2SA 5BUCA 4ZCIA 4IJWA 2OENG 2P3SA 3BXPA 2PK3A 2J59A 2W7TA 1NW9B 3FUWA 3LUFA 4JBXA 4IUDS 1LEHA 2HI0A 1J21A 2JGFA 1GNVA 4MV8A 2CJYA 1KZ7B 3EGWA 4LVOA 3JQ9C 3TX2A 4G41A 4I2VA 3QE2A 1OAOA 3DSRA 3GCDA 4FZVA 2AQHA 1SUEA 2RB4A 2O8EB 1BHQ1 1KOFA 2B2XA 3TFQA 5LFAA 1YBAA 3DQQA 4HNAB 2YHBA 1W9MA 5HJ2A 3ZW9A 3HN2A 5IABA 1NXSA 3OPNA 1L4KA 2ACVA 2QY9A 3OWXA 5H3HA 3SY8A 3RC8A 4NHOA 2IZ5A 3U3JA 1NPTO 5C4IA 1ZVKA 1OH7A 1FMFA 2VF4X 5FHRA 1T9BA 4BJ5A 1KK2A 5CK4A 4ZQBA 4JA0A 4F3NA 3DZHA 4IMJB 1DRVA 5G0UA 4BPRA 1W30A 2AI2A 2M32A 3VDRA 3OCWA 4D5GA 4YCLA 2QN8A 4X45A 1PZGA 3OQ1A 2DR2A 1DOZA 1KPIA 3KYCB 4ARZA 3CV3A 1ADGA 3IFSA 3HVJA 4GUDA 1MJGA 3PUXA 1PV2A 1X7DA 1HL7A 3PFKA 3QEJA 4PZUA 2WU4A 3BIJA 3FDIA 4YONB 1KEVA 3FLEA 5REQB 4TS4A 4EAQA 2DQKA 4F1WA 5L6MB 5AW4A 4PHCA 3LCMA 5F73A 2C5HA 3QBDA 3EPRA 1GPUA 1XQYA 1K0FA 4QX6A 1GR0A 3R1IA 1PK7A 1MO4A 3FVQA 4HGRA 4LY6A 2RHRA 1E2EA 5BVGB 2RK6A 3LBYA 3VR3D 3WNDA 4HQ0A 4PAOA 3OHPA 1BAPA 4QWMA 4PO8A 4BGVA 2YHIB 3HO6A 1LV7A 1A5ZA 1RT9A 1V39A 2IEGA 3KKZA 3NV9A 3KQKA 1NIJA 3QKUA 3ESCA 2OZPA 3AXSA 5AKKA 3D2BA 3LK7A 5E7IA 2Y0PA 3UJ8A 5FYQA 1KVQA 3GA7A 3R3XA 4IP0A 3CKKA 4OFXA 5C0OE 4AYXA 4IKEA 1JH9A 1EFCA 1ZRMA 1DO8A 1SH7A 3GLTA 2XUAA 3M4ZA 1EYZA 3GUCA 3N2KA 4JR1A 4S24A 2YZ2A 3GGCA 1IHOA 2P8JA 3CS3A 1I36A 4BMYA 2VT2A 2O5EA 9MHTA 1ZH0A 3NT2A 3GFFA 4EK9A 4KXLA 3RADC 2VYFA 2OBYA 1L4LA 2Q9AA 3C2QA 4G23A 2CLDX 4GZLA 4XB6B 1M0WA 3KB6A 3PYXA 4IHKA 4KFRA 3VPBA 4ARSA 1SZCA 3CW2A 3ZD9A 4C4SA 4D3YA 2BR3A 4JA2A 1YULA 1ZP6A 5JYEA 1UT6A 4PGHA 2BE9A 2RC5A 2X2EA 3ECCA 4HEA6 3T94A 1O9GA 4TL7A 4XVRA 2XNDA 4NV0A 4U02A 3ZWMA 4ENPA 3RYHA 5K5EA 3HA3A 3EXG2 2TMYA 2EKDA 2XNCA 4NU6A 5G02A 4ZHQF 5KOHB 1K68A 5KNCA 3M34A 3AF0A 4MQFA 3HU5A 2B1QA 3A05A 3V80A 2Q5HA 1QH8B 3IP7A 5FT9A 2IW3A 1XD2B 4IX9A 4TZKA 4ITRC 8LDHA 5H4HA 5B4VA 3EW7A 1E1RA 121PA 2Q5LA 4YASA 3NWPA 1VSUA 2ZWPA 3D5TA 4LW8A 5JYDA 2GAJA 4TMFA 3L79A 3VM6A 1ULSA 4QNNA 2BLLA 4CM9A 3GNQA 4OSOA 1Y33E 1I2AA 4D98A 2GDZA 1HOXA 5IX8A 3LQ2A 1G5IA 1I3OA 2BC9A 2D8MA 2PQ6A 1YQGA 4C0AC 3EZ9A 4QDKA 4DLSA 5J4YA 2IUTA 1EUDA 1XAIA 4U1RA 2JK1A 5E4FA 3FOAA 2P41A 1BCRB 1F9AA 1GNLA 2VTVA 3LQKA 4BUJA 3L0OA 1TECE 3L6OO 3QMMA 2HIMA 3EOBI 2WD7A 4N5NA 2DQYA 3RLFA 1GU7A 1A9PA 3LKBA 3H4IA 3FKQA 3EF3A 3UC9A 4XSHA 1KQPA 4MK4A 1DV1A 2CW5A 3ABOB 3MXOA 4D9MA 3IUNA 4MVJM 3WB0A 3IUEA 1WCV1 1Z5UA 1PHRA 1J22A 1RHQA 1T1IA 3RS4A 3S3TA 2ZR9A 4DLRA 3KQVA 5CX1A 1W88B 1W49A 4MUJA 1ORIA 2VJDA 5EIBC 2IVFA 1Z8HA 1E89A 2G9UA 1Q1QA 3P2JA 4MHSA 1V1RA 5K0LA 3P9NA 2I54A 1YHNA 2AMYA 2GXAA 5E8RA 5FTLA 2UZ0A 2PPLA 2YVUA 4BN4A 5FUMA 4UNPA 4KNWA 4QUGA 3G1UA 4YJ3F 2QE6A 3T1QA 5U9CA 1YR1A 3P27A 1RI2A 1T6ZA 3MJCA 1JR4A 1MO5A 1N1DA 2NPOA 2WW8A 4CUZA 2W42A 3EQ6A 2QXUA 4J2TA 1L7DA 5F9MA 3UK6A 3V6MA 2G0NA 2HQRA 1KZ4A 4UASA 1DO2A 4ND3A 1KJ8A 3ZVRA 4CDMA 2H4HA 1TU0A 3REOA 1WUJS 3D4IA 1K6IA 3HDTA 3HDQA 2XEDA 4B8ZA 2YMMA 1Y1PA 3DTYA 1UXKA 5HEKA 2FHPA 1OW3B 2X0JA 3L40A 4GI2A 4G3XA 4P93A 4YP1A 1ZQ1A 3QPWA 4DCTA 2J3LA 4LDQA 1L5HA 4JBGA 2I34A 1TO2E 2JAWA 3LLSA 3OCYA 3IOCA 1KK1A 3QV2A 5ADWA 5I9NA 1ZG3A 3HCFA 1CDZA 1N3LA 4RULA 1JH8A 1KDPA 4BNZA 5JSUA 2F00A 4KDCA 2QJTA 2D5LA 3SF8A 4IINA 4E6PA 4ARIA 2GBLC 4ZO4A 1TT7A 5FBKA 4JP2A 1CVRA 1J97A 1UBLS 4JB8A 4HLUA 1WBDA 1BOFA 4FEYA 1QP7A 4ERNA 3BE6A 4G1CA 5DXAA 5ARCA 3D5EA 1AE1A 4DADA 3LXMA 5J2TF 2DFVA 3C6KA 4G1VA 4J6EA 4QQ8A 3H6HA 5J47A 3W5CA 4BV3A 3PF8A 2QLMA 3I6IA 2CLLB 4LCEA 2VA9A 4G0MA 1FTGA 4OTZA 3VZSA 2OQRA 5GV7A 2FUG1 3V8RA 3W6UA 4CKXA 2GWHA 4CQMD 4FYPA 4MX8A 2F9FA 3G8YA 3LSYA 3I1YA 1UK6A 1NDHA 4MAMA 2ILVA 1RPZA 1Y80A 2OXFA 5F23A 1FLVA 2ZWAA 3FTDA 3V8BA 3IAS6 2R5WA 3EZNA 1PWZA 4P31A 5I4CA 4KG7A 3GJTA 1J1ZA 1EPUA 1L7BA 1R7RA 3B52X 3FTQA 3NWBA 5SYNA 3X1WA 4TL6A 3O92A 4JBIA 3NMUF 4NU0A 3OU2A 4KQMA 5BW6B 4UFNA 1KZHA 4ZOEA 5BN5B 5IASA 4CKBB 3DHVA 3CVYA 2ZUFA 4R2KA 2CLMB 1KMCA 1QIGA 1KYIA 3OIUA 4LVUA 2IYNA 3RANA 3WDKA 1OIVA 1N1GA 4EZIA 5JXIA 1P5HA 3PRJA 3VPSA 2C82A 3MBIA 1B42A 3RBXA 5K0ZA 3MWEA 1DTSA 2YWDA 1QTRA 4I4CA 4MA4A 1IULA 2JDID 5FP0A 3A3KA 3KHSA 2A59A 2KLHA 2PYDA 1SIWA 1UDBA 3SBEA 2B1JA 4RZUA 3WLFA 3SU8A 5F7XA 2G28A 4L2IB 1H6BA 3UMMA 2VQFB 3A9SA 2R1UA 4BKMA 4Z4FA 1ZK3A 4CFZA 2CLEB 1T0HB 4M83A 1QB8A 2O2HA 1KJIA 3PWTA 1EHYA 2IUYA 3A2LA 4O5OA 4F3CA 2PL5A 3MBKA 2HLDD 3A9TA 3K72B 4LCBA 3C4VA 4KVFA 4NFHA 1J1UA 4WGGA 1P4RA 3GG9A 3UOGA 3OJCA 1LY1A 1KP2A 1TK3A 4M38A 4M0UA 1S8AA 1YJBA 5DZSA 4G9BA 4PINA 3WDLA 5A4IS 1W85B 1V3VA 4WZZA 4HH3C 4BVAA 3GH3A 3UFXB 1YDEA 1UQRA 4MB6A 4CTMA 2I03A 1X7XB 4LSGA 2J33A 4JL8A 2A58A 2PLAA 1GY8A 4ZT7A 3T3NA 4BNLA 3IO5A 4B46A 1UPUA 1UZUA 1ZSVA 1HLFA 4WLEA 4US1R 1Z45A 3PFHA 1E4YA 3C7DB 1CSEE 4HFJA 4XEHA 2UDPA 3BXZA 4OVKA 1QHSA 2Z6QA 1Z2NX 2XRYA 4LRUA 1JJIA 4P7KA 2IOFK 2PY6A 2CNWD 5IAEA 2XB2A 2JI7A 2C4HA 5JC8A 1B7GO 1JDBB 1W19A 3PNOA 4O4JF 1JKJB 3NV7A 4UM7A 1KJWA 3EIQA 5IT9A 3ZUPA 3PC2A 3ZCTA 1OYOA 5IHXA 2R86A 3AR2A 3I05A 3ACCA 1O1YA 4JI1B 3RREA 2ATCA 3BGOS 1YJAA 4Z8XA 4HDRB 1JN0A 2N42A 3URMA 3X43A 2CMKA 3NKVA 1H85A 3X1JA 3PU6A 4E2FA 2XZPA 2FF5A 3Q8LA 5DHQA 5A62A 1QGYA 2V6FA 3WXBA 5DHTA 3FNEA 1AS2A 2DQ4A 1T8UA 3AP3A 2JAXA 3OBBA 1P19A 1A77A 2QGZA 3P2OA 4BNVA 2CB9A 4LCJA 4CV0A 1BO6A 4GPEA 4GECA 2BELA 5DTIA 2Y9MB 3DZJA 4H15A 5GJBA 2HDHA 4EJ0A 2R8RA 4FGJA 5FDFA 3KJEA 1EWYA 1JIUA 2BMDA 2YN2A 3HKEA 3V4OA 5IPFA 3ZN2A 5CLJA 4GXTA 2QK4A 2PVSA 1JMVA 2QX6A 4C7XA 1EXMA 5BW4A 2YV5A 3ZVMA 1ZXXA 1LLQA 1YIOA 2MSKA 3LUBA 2VDQB 2QN9A 3M4NA 2ZP1A 3RT1A 2X0EA 4P22A 3N8NA 5HF8A 2HBZA 3WTCA 4K0RA 4HOYA 4WCFC 1EVYA 2GZ2A 1ZLYA 4DJFC 2NSLA 3LBAA 3E48A 4RO0A 1CF2O 3I28A 4IIGA 3HWX1 3T0IA 1QO7A 2XBLA 2V7PA 4UEWA 2PUDA 4UPEA 1UBFA 5F1YA 3GWGA 5AM2A 3DM9B 3FX2A 2WABA 4MWZA 4NRDA 3WZMA 4XPZA 4A6PA 1G64A 2GNOA 1OR8A 2FUEA 2JCGA 4MWEA 4CYMA 4F3KA 3CH7A 1P33A 3DL4A 1NOJA 2H1SA 2BFFB 1JG2A 1N7HA 2FXIA 3F5SA 2GESA 3G2PA 3OF5A 5DTJA 2ZYDA 1A98A 3TLGA 5DM4A 3WIDA 3U4MA 4AZVA 3O4IA 4L4RA 2D5CA 2C59A 1YSCA 2AUTA 3GPDG 2PS1A 1E1KA 5FJJA 1JKMA 3KB8A 3S2SA 2R60A 1QWSA 3NO4A 4GFDA 1I4WA 1T9ZA 3DBVO 5L7WA 2ZQZA 2HJVA 2XYHA 3BAFA 1PW7A 2JK0A 3H4MA 4MNTA 3DKIA 5A4FS 1E69A 2IIVA 1TAHA 4BO4A 2QROA 2ES4A 5DM2A 1TCUA 2G9VA 3IP9A 3P4YA 3U9TA 3WYAA 4BE7B 3DKKA 5FOQA 3PP8A 1TUBB 2CCJA 2X58A 4IIUA 2IPOA 4WK0B 2JFZA 3R7WA 2DH6A 1XZJA 1CZOA 4IOKA 4MOWA 2FZ5A 1E99A 5DBFA 5IJ0A 4MCJA 2OB2A 2O2DA 4KLAA 3DBRB 2C84A 1T8YA 2H8GA 1U7HA 2W6ID 4B1FA 1FS5A 5JS7A 1WPXA 5CXSA 1ILWA 3G2JA 3QH4A 3WSWA 4TV8A 5IUNC 1EFAA 4H3VA 2XNKA 4GLFA 2E4AA 3N8HA 3GLUA 1JHUA 4LE1A 4Q0MA 3VHXB 4EW1A 4EYOA 4RTPA 2XOXA 1RLJA 5K0GA 1QSGA 5EYPA 3O31A 4I1VA 4ZREA 3QP9A 3K4PA 3KV1A 3T7EA 2X3FA 3NHSA 4PSUA 2VTKA 4CTOA 1XV5A 3EQ7A 5FH9A 1I6LA 1S89A 4UAJA 1O0BA 5IC5A 4EAAA 3CY6A 3O9VA 2JCYA 1M6NA 1QONA 1D4OA 4MUKA 2JA1A 4HGPA 3G2HA 3OJWA 4NS4A 1WOMA 1LDMA 2ARKA 2WJIA 4LYAA 4ZYYA 4GMHA 2VWQA 1K75A 4GGOA 4UHBA 4O2AA 3ACDA 3JQFC 4YBRA 4LVNA 5EJ5A 5EWMB 1XI2A 4HDMA 1LTHR 4DRXB 5CB4B 2QOEA 1K5DA 2C1XA 4RQBA 3OPQA 2UYGA 5CDTA 1TQ6A 4YT5A 4U8GA 3CF6R 2X3UA 3BWEA 4FR0A 1ESZA 5TPWA 4C0HA 3PB3A 2C78A 5JROA 3KHKA 2XZDA 1GG5A 4V0RA 3BE4A 3PXDA 1MX5A 4OM7A 3ZS9A 3CLSC 4ZYWA 2GQ0A 4EL0A 1ESDA 3CT6A 4Q3CA 3BFPA 4LYYA 5I51A 1HQKA 2FR1A 3ICEA 4GWKA 1QCYA 3U2QA 1HZZC 4PZZA 4CTKA 3O9ZA 3LLMA 2EDAA 4PYRA 1YE8A 5JZOA 4DTCA 1J07A 2E55A 1DBSA 1Y3CE 1TTPB 5IVDA 3VR6A 5BR7A 1GZHB 1LF5A 4JX9A 1ZH4A 1PF7E 2XUPA 4GOXA 4Q12A 1JPUA 3ESDA 2Y66A 5DI3A 3SBDA 4BFZA 5HOQA 1MAWA 1V8BA 4MW7A 4Q9DA 5H70A 3DMGA 3ZDCA 3QHAA 3C3XA 4EFLA 4MWSA 4AO8A 4I1PA 1YQQA 2WPDD 2ZTSA 3QENA 2EIXA 2ORWA 4NC9A 5B2FA 5IZCC 3FE2A 4YB8A 3VTFA 4M1KA 3O4JA 3K70D 2X23A 2O2XA 5IN4A 4H6VA 8GPBA 2AG0A 2V7VA 3ODGA 4RPGA 4OX9B 1Y1QA 4S04A 2NYRA 1E77A 4R5MA 3DXZA 2F4NA 1GZ7A 3QI7A 1G7CA 3RO7A 3RTAA 3UJDA 3NKFA 1NNUA 2X8LA 4AX8A 2I7CA 1LI4A 3RVBA 5AVWA 2X5KO 1YWGO 2XPCA 4YJ2B 1FVHA 3A1VA 1HY3A 1KYQA 3QVKA 2QYSA 5I7AA 3VTKA 4DYVA 1G8SA 4YP0A 2AKAB 2H31A 3JALA 2ZTVA 3JARB 2ZCUA 4K8RB 5TQ0B 3B5JA 5CM9C 1TCBA 4EBFA 4HTFA 3ZDRA 3ZI0A 4PX9A 2PRZA 2IH5A 4AS1A 3SS8A 3VR4H 2G72A 1V2HE 3UUEA 1N6OA 3G1WA 4MPJA 1H8HD 4KQFA 1Y6RA 1Y8QA 5G2OA 3FYUA 5DLQC 2HSGA 2ZE6A 3IP3A 2HMVA 4J1SA 4Q7KA 3ZCSA 3G2OA 5K99A 1I7LA 2NU8A 1IN5A 1X7YB 3ZCQA 2RI1A 4AT1A 1NLFA 3GRYA 2OOKA 5ALTA 3CF2A 4MYSA 1E2IA 2KBFA 2MSWA 3PFIA 1YZHA 4LI0A 5ESWA 5EXPA 3GJXC 4HDAA 1ADBA 1XZHA 1P7YA 2DVMA 3CKLA 5ICFA 5T5QA 2ET6A 2GKOA 3N5KA 1YI8A 4IKOA 1JSLA 1ESMA 3O47A 2OGSA 2VRCD 4GDMA 4U4AA 2GAFA 2UUOA 3NANA 1EK0A 3A6GA 3ZWWA 3M5WA 3GJ8A 3Q7QA 5B55A 1U31A 4K9OA 1F3OA 1XXLA 4MV3A 1V25A 1XFDA 2GYUA 1RXEA 2W4MA 5CEEA 3TCNA 4LBWA 3PUHA 2O19A 1S4QA 3BTOA 2I9KA 1CLEA 4NABA 1NNI1 5DN6D 4TUYF 3V1NA 2C5BA 4FMBB 1RAHA 2RHWA 5KBYA 3EASA 1GT6A 1WO8A 3AU9A 3PXXA 4CMIB 3MHPA 4Q39A 1G8JA 3DE5X 1XA4A 2JLRA 1NJ2A 4YJDA 3AILA 5EKTA 2EGGA 1CS4C 1OYVA 4DDWA 1WM1A 2X9LA 1I2DA 3LPAA 1W4BA 1DTWA 4RVNA 3MW8A 1I94B 3QKSB 1S2NA 2AI3A 1X0XA 1Z36A 3CLRD 4NAVA 1QHNA 3G23A 4Z5XA 4A2PA 2D2VA 2LXNA 2JFGA 4Z4CA 1RZRD 2DF8A 1DT5A 1G66A 3OE1A 3CF4A 4UD2A 5AI9A 2I99A 3BMXA 4UCWA 1BROA 4AN1A 4KWIA 3FDFA 2IUFA 3JU3A 4ZCQA 3ZW8A 2VQEB 1SNYA 3OWOA 5A7HA 3ZCRA 5K3FA 2R66A 1H9BA 2O7QA 4D8UA 1BFUA 2YXBA 1Y8AA 3CINA 3WLMA 3OX1A 1U9ZA 2J3EA 2HV9A 2GYYA 3H2YA 2CNDA 3AEZA 3FMIA 2PYIA 3MRXA 4M9XA 3GEIA 3CH4B 4CKWB 3C5EA 4F5DA 5FB3A 3I5YA 4G1UC 1ML3A 1U2RA 3SC3A 1MHTA 1PWYE 4B2PA 1E0AA 1F0PA 4M0PA 2E9SA 2ZYRA 3CX4A 2QUHA 4FC6A 5EHNA 2WZQA 3A04A 3EAFA 3UKDA 2EW8A 5JSZA 1HYBA 2C2BA 2P3LA 3E27A 3PC8A 2Z95A 1GZUA 4YUAA 1OXXK 1GUAA 1ZJ6A 2VLBA 5PNTA 4EJSB 1E2BA 3OPMA 1MRNA 3KLMX 3R3WA 2PLWA 2YN4A 1A9YA 4PQRA 4ZDJA 4NK4A 1P0FA 5JAQA 3UFBA 5F7JA 3BGWA 3K6KA 3Q11A 2QV0A 5ALDA 3V8MA 5L8VA 5EESA 5JAOA 2PGOA 3SX2A 2YWRA 4HX9A 2HIAA 1A5AB 2VF7A 1E9RA 4XCQA 2Y4NA 5KU1A 3IUYA 4K6HA 4YAFA 1WU7A 4GQBA 4RV9A 4F2HA 3ZXYA 5DI9A 3SNHA 1ZIOA 3UMBA 3WB9A 1K4MA 3NU1A 4RJKA 1V16B 1SHZA 2YICA 2PTHA 3TF5A 2NVBA 1DV2A 3HKBA 2I6TA 3MGKA 1UIMA 3KKMA 3MJFA 1LVGA 1BDBA 1UPXA 4DHWA 4Z3KA 2YL2A 8OHMA 1SEVA 4HX5A 4C6SA 2GNPA 3DMYA 5LB4A 3WKDA 2Q8NA 1FNNA 1MD9A 1HDIA 2YR0A 3G7SA 3CLUD 1VPWA 2P2CA 2WD9A 3VO2A 5TARA 2J41A 1EGAA 1LBIA 3F8WA 3M9LA 4NENB 1HDOA 4DCUA 5H5JA 3LVBA 5H59A 4YMUA 2JH9A 5JE8A 1GWNA 3D4LA 1L7QA 3N0TA 3P5SA 1C4OA 2NZXA 3R3YA 1KY5A 2NVOA 3G13A 3QIAA 4G5QA 1NW3A 4KGXA 1QV9A 2D3TA 5EXTA 4BEWA 1BGVA 4OAQA 4RM2A 3A6FA 4MYTA 1G17A 2QAJA 1KH1A 3WO1A 2Z4SA 5LZ7A 1IBKB 1DO0A 3DTTA 3C98A 1A9TA 5JZVA 2D2IA 3H3FA 4EQZA 1PIWA 2PMEA 3AHJA 4EW6A 3N1UA 5ED0A 5CLQA 1PSZA 3PQ4A 4EUNA 1YU6A 1CNMA 4OKIA 2GK4A 1KZ1A 5B3JC 1VBFA 3RC1A 1QHIA 1R0LA 5DOVA 3AUKA 2K2WA 3P9YA 1XTUA 2VZEA 5JYCA 1DEHA 3RVPA 2WJYA 4JVNA 2ISSD 1T0IA 1YR6A 2C77A 1JB1A 1C3JA 1JRLA 2B8JA 2FRVA 2HA6A 3FYCA 4PLVA 2J45A 4TRNA 3WL6A 3KHTA 1ETUA 1P1RA 1XCJA 2H4ZA 3B3GA 3BZWA 1WKVA 1X8LA 2O0JA 1PX2A 2G8LA 1XMJA 4II7A 2JLUA 1PQWA 1SXJC 1Y8RA 1VLJA 1L3BA 1QKKA 3OESA 5TPZD 1MEJA 4UMVA 5E3IA<