4YFYA

X-ray structure of the viof n-formyltransferase from providencia alcalifaciens o30 in complex with thf and tdp-qui4n
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
241
structure length
241
Chain Sequence
b'MKKILVISDNYQLVSYIKNLYLSNEEWSKELFIDYSYSSINRNPQSLIELGMTEIDIKNKNLNELNDYHLIISAHCKQIFPAHIVNNKLCINIHPGLNPYNRGWFPQVFSILNKKPIGATIHKMDSEVDHGEIYCQEEVSILSHETSIDIYNKVIELEKKLIKNNLLKIINNELQPKLPSQEGNYNSIQDFNKLCKLNLEDNGSLREHIDLLRALTHGDFKNAYFYDENNTKVFVKIELSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords VioF
molecule tags Transferase
source organism Providencia alcalifaciens
publication title Molecular structure of an N-formyltransferase from Providencia alcalifaciens O30.
pubmed doi rcsb
total genus 80
structure length 241
sequence length 241
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18216 N_formyltrans_C N-formyltransferase dimerization C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.170 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Formyl transferase, N-terminal domain 4yfyA01
3LOUA 4TS4A 3O1LA 1ZGHA 3DCJA 2BW0A 3R8XA 4ZZ2A 4ZZ3A 1MENA 1CDEA 1RBZA 1RBMA 1GRCA 4ZZ0A 4TT8A 3OBIA 4S1NA 1CDDA 1NJSA 4YFVA 3GARA 4DS3A 1MEOA 4ZYTA 4ZYXA 4ZYWA 3Q0IA 1YRWA 4QPDA 4IQFA 4QPCA 1FMTA 5J63A 1ZLXA 3AUFA 1RBYA 2GARA 3NRBA 4NV1A 4EW3A 1GARA 1ZLYA 1MEJA 1C2TA 2FMTA 3KCQA 3DA8A 4PZUA 4R8VA 3TQRA 4ZYVA 1C3EA 1RC1A 4ZYUA 1JKXA 5CJJA 1RBQA 2BLNA 4EW2A 4ZYZA 2CFIA 3AV3A 4ZYYA 2YWRA 4ZZ1A 3TQQA 3N0VA 3P9XA 3W7BA 4YFYA 4Q12A 1RC0A 4TTSA 5J9FA 4EW1A 1S3IA
chains in the Genus database with same CATH superfamily
5CA0B 2JLRA 4FDMA 2C1EA 4B74A 3NVMB 4G36A 5DASA 4D3XA 3CR7A 3EVZA 4AM8A 1W73A 1K7CA 4BC1A 3HN7A 1HQDA 4IDHA 3NEJA 5EIBC 2P68A 1VJRA 3DB1A 3F3YA 1GG2A 1E5TA 5IKXA 1Y3AA 4YT2A 1GXSA 1DEHA 2HU7A 1LU9A 4MITA 2HU5A 4JODA 2FPIA 1P8JA 1YZ3A 3M5CA 3MYRA 2WMNB 2IOFA 2QPLA 1XROA 2IPOA 1R8YA 4XGRA 1QTQA 2BP7A 1E9CA 3ZIUA 2Y2VA 3EE6A 3RFXA 1U2RA 5E6UB 4TV9A 1UBTS 4YP6A 1QFZA 1SU4A 3U4AA 5CA1F 1X8JA 1X1BA 2JFVA 4TYPA 2IYWA 4H1VA 4TKVA 4HZGA 1H42A 1NNI1 1L4MA 2GVZC 5BPHA 1UDWA 2Q3MA 2ZQZA 2CBGA 3E9MA 4DQDA 2CHGA 2AFIB 5GVRA 1DBWA 3OCXA 4LOKA 2ZREA 2RGCA 2J31A 2G5GX 1Z25A 4COKA 4YAOA 1ZAYA 2VJDA 2I2DA 1N6PA 1UKVY 2AOVA 2Y67A 6ABPA 1ZD3A 3IBFA 5DM4A 1U3FA 2CMGA 3KZOA 1ORVA 5CNMA 1I7LA 1DINA 9GPBA 3AM4A 1UWLA 2Z09A 3DFUA 2PFKA 5DI9A 1BWRA 1OC4A 2X0DA 1ZM4A 3WBBA 2F8SA 4GT1A 5HF8A 1MD9A 3VNRA 3VMMA 4ZT6A 4AJ1A 1HGXA 2P2DA 2WM9B 2NNLD 4QPJC 4OIMA 5DF1A 5AKLA 2QS9A 3V3TA 1J21A 2C2XA 4IIUA 1Z39A 1XLWA 2DFPA 3INRA 4AJHA 2RDMA 3KCNA 5IDXA 4GI5A 3U1VA 2AGVA 4IYRA 2RIRA 3GLTA 1J1UA 1FMTA 4M21A 3EYWA 4DJFC 1FP7A 2VJLA 3P52A 1C29B 1T5DX 3EXIA 4HPXB 1K3TA 1IJEA 1L4EA 4OQPA 1P3DA 2Z2ZA 3DWFA 3GLIE 3G82C 2YIVX 3OOYA 4UEOA 2HJVA 4UFPA 3UGTA 2AF4C 2CE2X 3GQVA 1E2EA 1G7RA 2HPAA 4ZRMA 3L92A 1N36B 1V9CA 4I6JA 5FA5A 4IGKA 1NDUA 1H9AA 1YKSA 1PW5A 2OXCA 3DNMA 3VYRB 2C8JA 4CODB 3QXXA 1T25A 4OHPA 2BHTA 1QC5A 5T5QA 1QOZA 1ZITA 1NBAA 2V98A 2VSXA 1V2HE 4L5JA 5TVGA 2AG1A 2VDKB 4JELA 3EDCA 4HRAA 4RPCA 3KAPA 4CLXA 4U2FA 5HQJA 1CBUA 1J0CA 2DLDA 1OXTA 1E7SA 1LWOA 1AT1A 2JIMA 3EDYA 3IE2A 3JVUA 4WTOA 4B8ZA 3ZYCA 3D1LA 3EAQA 3H2SA 3LBAA 2QKYA 1XCBA 2RB4A 1X13A 3NRBA 3N86A 2NU8B 4K3VA 4JDUA 2OYSA 3IP3A 3K16A 1R74A 4KI7A 2ZRKA 1M1UA 2QRZA 1JPJA 3PHGA 4MP3A 4LJ4A 3T3HA 1X9HA 2J41A 3BXHA 3HABA 3P94A 3TB4A 1HUQA 1SHLA 3IYLW 3WHPA 1WQ4A 1J20A 1ZSNA 3QW4B 1Q17A 5DLDA 3DKVA 1O6FA 2VQ6A 3RYIB 4MW1A 5FP0A 1R4AA 1O9HA 1O6GA 3UAVA 1L5VA 4BZQA 2H4ZA 2QXTA 5JMWA 3ZJTA 1DI0A 5C0OE 1W0KA 5JHHB 3NV9A 4R01A 1KYTA 4S1NA 2VFAA 4AYWA 1Q44A 3S99A 2XCLA 2W8ZA 2QTMA 4TM8A 1QV6A 1DIBA 3GGSA 1P1IA 4EA7A 4P08A 3GEDA 1ISJA 3ENKA 3QVXA 1E3SA 4BWYA 5C35A 5CVDA 2GCGA 3VSEA 1EQUA 1JHPA 2PMFA 4W5TA 5FUYA 5C8YF 3GVHA 2FOLA 1Z9BA 5HYVA 1GUZA 1VIAA 3AQ4A 3EA4A 1UKCA 1KWGA 4LYEA 4UDNA 3TBHA 3BWCA 1P1CA 2DQZA 2B0JA 1A50B 2WTUA 3HJFA 2UKDA 1V6SA 1H9BA 2Z2KA 3UMMA 2G7ZA 1M2GA 4GI2A 4E21A 5A3VA 3P32A 1Z75A 4LF9B 2M1ZA 1R4NA 3AILA 3JWPA 1P0QA 3GLIA 1L7MA 5L8VA 4J07A 1OB2A 3NTUA 3DL0A 3AUKA 1UBEA 2P27A 1PLKA 1HXHA 3EEBA 1BDJA 3NWOA 3EZ2A 3DYIA 1ORIA 1I94B 3N8KA 3A4YA 1CQZA 2UZ1A 2ZJ7A 2WLSA 2I3GA 2VA8A 1OH5A 4M0KA 3IQGX 1PDVA 1NLYA 3AQIA 1EHIA 4EO4A 3FD8A 3HYTA 3MBKA 1GGHA 1ZSYA 3RU9A 4JJEA 2PKYX 4B3XA 3GFOA 5KSYA 4HLNA 4EG6A 1E8NA 2JZNA 4UUPA 4EM6A 1P0CA 4KSBA 4DIUA 4NCNA 4G0PA 4L4YA 1N5MA 3DOOA 2OCGA 5JD4A 3MIZA 2W0SA 2XE8A 1M8FA 3GVCA 4HXEB 2ORYA 3R6DA 5JROA 3ZY5A 4RVGA 4CQNA 3QPCA 5BWLA 3C3XA 2AFHA 3BPSA 5FPKA 3B2QA 2YQZA 3GRAA 3ASYA 1URPA 4F21A 2DSNA 1WY7A 3MTIA 3JALA 2YASA 2V7PA 3L5OA 1ZW6A 3O2SB 1XMPA 5KNDD 1JKJB 2PRYA 3GYBA 2VAXA 3WNZA 5BVHB 1RPJA 3G0DA 3A32A 3CNEA 2EFDB 1P4AA 3O4VA 4ALJA 4XPIA 4LBYA 1ZGZA 2IYUA 3LGAA 3LP8A 4AF8A 4B3RB 4EHNA 2QQ0A 4UCWA 2DECA 1OAOC 3CZCA 3H8SA 3JTMA 4EO9A 4G8CA 4O8CA 4YK7A 1EDOA 2A6PA 4OU4A 2O54A 1VECA 2SHKA 3Q9SA 3EDMA 1D2HA 3ZCPA 4G6ZA 1U8EA 3AYXB 2JCSA 3QBJA 3C6KA 5FPHA 4DCNA 1DADA 1XEWX 2A78A 1Q1ZA 2YRWA 3HO8A 5AH0A 3I3SR 4QTYA 4B34A 3VOAA 1RBYA 2ZYVX 3MMZA 4S0XA 5KQLA 1Q0LA 1C9DB 4XYBA 1BD3A 4FMDF 3QOYA 4MQFB 1OU0A 2O8CA 3W06A 1QQTA 3AVXA 1R0CA 1U8TA 1XMSA 3E15A 5ERYA 3UWOA 2YS6A 1KQGA 1KI9A 4HUQB 1E69A 3HY6A 3JYHA 1VE5A 4WOCA 2GF0A 3A6EA 3KXLA 5BYBA 4IDFA 1K6XA 1LI5A 1ZMTA 4YCMA 5C18A 4PZAA 3UTDA 5KCZA 2AC2A 4IRMA 2VATA 1M73E 4MGIR 1O87A 2I0FA 4IWXA 4FHEA 1UIMA 3WL3A 3FDXA 5EFZA 2BEWA 2PLAA 1ISIA 1ADFA 3FMPB 5IM4F 4ZAWA 4FIDA 3RUFA 1AUPA 5BYKA 4XVUA 1VMEA 3DZCA 4HSEA 1DJLA 3TEMA 4C4TA 1OXUA 2R8OA 3LWDA 2HMAA 3MSCA 2GBCA 1ULSA 1UMBB 3CN7A 1IWOA 4OV6B 3PXCX 4XIGS 3ZG6A 3L1VA 4HLUC 4FFRA 4N03A 4BRWA 3L7MA 3JWJA 2B61A 3VZSA 4E31A 3ANTA 3KOXA 4D5EA 1XHLA 2PBFA 5H3CA 4Q24A 4Q34A 5PNTA 4KCGA 4NCJA 3UT5B 1M2FA 3HR7A 3KDAA 3AHJA 1YK1A 4HDSA 2DH6A 4ZN6A 1JDUA 1T6ZA 2DU8A 1JG2A 2NZ2A 3CA8A 3LPAA 5IZCA 1MG5A 5ALKA 3PZRA 1G3UA 1X1SA 4ZIRB 3FSJX 3UK7A 3HCDA 5KNBA 1BC5A 1P73A 3K1TA 5EOVA 3I0ZA 1ZHFA 2I34A 3EMVA 3K2EA 4R41A 3S3TA 1IQRA 3LX6A 3ZLVA 1TAQA 5A9SB 3MA0A 4IILA 4A3SA 1DQSA 4O1HA 1MAHA 3EZLA 3KQQA 4LQ4A 3OT1B 4M38A 3OA2A 5T8KC 2ZE6A 4WXYB 4O4LA 4OMUA 2JBAA 1TZBA 3AIKA 5IVIA 4U7HA 4L4RA 4V0KA 5I9BA 4P4GA 3WHLA 3RUEA 5JMTA 4ZOLA 1ENPA 1TOAA 5BT8A 4U8GA 2J85A 2A94A 3PEYA 3CX8A 2BCGY 2LP4Y 2PKWA 3H5AA 1R6XA 2ZJ4A 1U4NA 3RJ5A 1LK7A 2ETXA 4X1KA 3DE4X 1V43A 3NCTA 3TRHA 3FBTA 3NONA 1EDZA 1ZBQA 1VGRA 1IZYA 2A14A 2J87A 3PI6A 2OCBA 4UPDA 4EY6A 1I3MA 2CNDA 1U0FA 4ZCLA 4B6RA 2P9JA 1IK6A 3OP4A 1O6CA 2EJWA 1CUIA 3EGDA 3QMPA 3H9CA 4ZAXA 1FLNA 3EIHA 5F1KA 1WR8A 4FB5A 5HNKA 1EK5A 4HQRA 1WZUA 4OBBA 2QXUA 3FTPA 2A57A 4ZCPA 3ZLJA 5LQCA 1KIMA 5ARDA 3PQ3A 4KVZA 1PD1A 1UK7A 1YDHA 3R44A 2HT6A 3NGXA 3A37A 2Q45A 3N5CA 5DGTA 4B2YA 4REQA 3P9QA 3UATA 4J75A 4LEIA 1E9EA 4C7MA 1PT5A 1XCJA 2H4WA 3GELA 2FPXA 3FPJA 3DBRB 3BSSA 1E79D 2X6TA 3PWTA 4U7JA 2QTZA 3D4OA 1WMBA 4IJVA 4PCAA 2XQVA 1T6NA 1OVGA 4JGGA 5LXTB 1KU6A 3PEFA 1L1RA 1JEYA 1GTRA 4B6EA 3OTHA 3W2GA 5DNYB 2Z0MA 4LXYA 4XUCA 5B7GA 3HG7A 5DOVA 5KB3A 2R44A 1ISHA 4ZEWA 3DFMA 1FP2A 2EAUA 1FFDA 5A5DA 3HCRA 4KQ1A 1KDPA 3KPJA 4XPIB 3II6X 5C34B 1AQJA 4EG0A 2HXYA 3PE3A 5ARBA 3ZDAA 4PYIA 2OCPA 3PXGA 2IPNA 4ZDWA 821PA 4UEJA 3T52A 5EMHA 1GZDA 2OBBA 2C1ZA 2QYSA 4AJNA 4ALNA 1JLHA 1SIUA 1Q16A 3AWIA 1WP4A 3R7WA 3QF4B 4KK3A 5AJXA 1STOA 2G07A 2JANA 2XNDA 2XX3A 3VHRA 4IP0A 5CB4A 1TM4E 4PS0A 3IQXA 1XF1A 3QBEA 4PFSA 1LDYA 3LC0A 1EUCB 3CCBA 1V5FA 4M55A 2JFOA 4L78A 5EAIA 5JCZA 1HYGA 2W2KA 2AN1A 3PS9A 2GS9A 4L57A 4FR5A 4LY0A 4TV8F 3LQ2A 5IH3A 1PR3A 3RVNA 1VLLA 1Z12A 2D74A 3BE8A 4G25A 1O57A 3QEAZ 2FFJA 2O9JA 2Z2JA 2CMDA 4HN9A 2HT1A 3W6PA 3D6HA 3T3NA 2J0VA 3KQHA 3UWMA 3G2HA 2CMKA 2NACA 3QPBA 2YMQA 5J1SB 4ESEA 1HFEL 3PWKA 5CAEB 2BJWA 1BYIA 2XMGA 3JWEA 4B81A 4GICA 1SK9A 1G55A 2FSIA 1YZVA 4LXTA 5JQGF 3CBQA 3AR6A 3DVSX 1CUVA 2YINC 2K2WA 4DSZA 3KOYA 4JDPA 4GU5A 5AW0A 3F49S 2QBYB 3OTWA 3R74A 2GJAA 1RWMA 1Z74A 1QDEA 2PKEA 4XARA 1FRZA 2V7TA 3QVGA 2D1TA 2VDJA 1X77A 1P1FA 1YUNA 1D2CA 6CHYA 2HMYB 2V3CC 5EMKA 1OTXA 3KHTA 3T7KA 3S1AA 1K75A 2XZLA 2V59A 2YTZA 2JGRA 3CJTA 5HSGA 1XU7A 2OK8A 1RRFA 1HDCA 3T5BA 1Y1TA 3E3OA 4EL5A 1UPCA 1EE9A 2COKA 5FOQA 1GNRA 3SX0A 4DR7B 3ER8A 3LYHA 4PHHA 4YNBA 2NUAA 3B3QA 1QAOA 2D5BA 2I3ZA 1EM6A 1QC5B 1ZVKA 2G3YA 3E7DA 5DW3A 4BMSA 4F11A 4YJ3A 1Y3DE 1Z7EA 1KAGA 1RWXA 1RAGA 2HI0A 1NNSA 1ZJ5A 2Y68A 2OFFA 3H1FA 3L8YA 3WG9A 3CF2A 2WFLB 5ICMA 2PUWA 1ILEA 4DR5B 4CNQA 2HRDA 3RYHA 2IQIA 4FC7A 2RE8A 3WKBA 4WLEA 3OOHA 3ZDFA 3ILHA 3CE6A 3AJ8A 3K5WA 2JGEA 3CZ9A 4L8LA 2H3EA 1Y1LA 4Z3DA 1Z4JA 3F7NA 4FNGA 4QAJA 3V4OA 3PV0A 3OE1A 4UUBA 2PKRA 2HD4A 3RJ9A 2GNPA 3UMCA 2FFQA 4QWMA 3HB1A 4R05A 1A7KA 3UQYS 4YRNA 4UNNA 3TCNA 2TECE 1FDIA 4BQFA 2V54A 2Z1MA 3PSHA 1EHYA 3CLUC 4FFVA 4B80A 1P39A 2E49A 2PD4A 4UC0A 4NOMA 3VJMA 4D0NA 4WBSA 4DSOA 4MA4A 4A1OA 3TJZA 3ZDZB 5CVVA 1XCOA 3DAPA 1M1NB 3G0OA 4CW7A 2AMYA 1ZLYA 2NV2B 3PK0A 5JCJA 4EMTA 2Q8NA 3QSYA 3GLHA 2VJCA 1K92A 5FNVB 1EWTA 2VZ8A 1OX4A 1NN5A 2QXYA 3EC2A 2WR8A 4AMZA 2EBWA 1RD4A 5ETJA 1UM9A 4C0LA 4Z7QB 1US8B 3L49A 5THQA 2ZS9A 1KO7A 4KLCA 1CIVA 1YIOA 4HQNA 1SC4A 4GE3A 4PRYA 1CJCA 1PFYA 5CXSA 1BCSB 4ESHA 1E0JA 3MM4A 5IC6A 1A5ZA 3V4VB 3ORHA 2UZ4A 5BNIA 3LHIA 1YU6A 5E6UA 1PGJA 5EE0A 2F3PA 1YGYA 3BL8A 3I5XA 1PJCA 3FZGA 5H59A 3EJ6A 1ACJA 2VN8A 2D1QA 1VL6A 4ZCTA 1KMMA 4YMWA 5IDYA 5GGXA 4Z9FA 3BXXA 5BN3B 5L7YA 1TMYA 3FVTA 1R9MA 3RG2A 1AUQA 3KQVA 4JS0A 5J5VA 1OZFA 2Y0EA 4UQPA 4D81A 1KSHA 4QOSA 5LUAA 4UTPA 3P2KA 1KAEA 3ZDBA 1E9FA 4MHOA 4WY8A 3WGYA 1N2XA 1PHPA 2JFXA 1CV2A 5JSKA 1ZJJA 4MW0A 3ENQA 1JAZA 4NZ9A 1TKAA 3RTDA 4TWIA 2C20A 1RAHA 5JNLA 4Q03A 1U0SY 2FQYA 3D3WA 3DT8A 3PUVA 5JU6A 3GCGA 2P91A 1XRJA 5DNUA 2J8ZA 2DR2A 1DIAA 1Q0QA 4V3CA 1KK1A 3NTQA 4QJ5A 4R54A 2D1YA 2D7CA 3OHSX 1RXYA 5GZ1A 5IANA 2R1ZA 1QHIA 5AKJA 3ZWNA 1IFXA 5H68A 1PR4A 3LWNA 1NASA 1U8UA 3JARA 4RZHA 1HG0A 1DTWB 4M3NA 4R40A 5JBNA 3RUCA 4ZPJA 1CY1A 3PRJA 3SX2A 4PZCA 2RGRA 3FTNA 3JSAA 4ND7A 4Y7CA 3ZTWA 4LHVA 3VHLB 5JBIA 2NU6A 1PSDA 5JPDA 1PQYA 2IP2A 1XYGA 5KX5F 3PJRA 1U1CA 2IODA 3HWX1 4JYPA 2X41A 4OXIA 4ZRNA 3CH7A 4H4DA 4CQLB 5IVHA 1IB6A 2PNFA 1J2TA 2FEPA 3GOHA 1FUUA 1USWA 3CKYA 5K2OA 3QX7A 4GI7A 2YIJA 4GD3Q 4BNXA 2LIPA 5JWRA 1KARA 2XMBA 2E3JA 4M0EA 3SK0A 2WPDD 3MT7A 3HR4A 3AF5A 3PGMA 4LOAA 1QIFA 4A8TA 2A0XA 1AZLA 2FWPA 2HY7A 4EDFA 1MC4A 4LWPA 1X7ZB 4C14A 4CEJB 4QHTA 1H8HA 1Z34A 2YJ6A 1JNYA 2J3MA 3C48A 2BVNA 3JV7A 2G71A 3ZVNA 1TL7C 4HAWA 2OV8A 5ESRA 5TF0A 3PC4A 2QRMA 3RQIA 5P8WA 4D0RA 1OV4A 5JO0A 3RBXA 2GD1O 1Z4QA 2BUAA 2NTNA 2FMIA 2XNKA 3FWPA 4OOFA 2CLLB 3RTEA 3DLBA 4QBGB 2FB9A 1JFSA 5HMLA 2VT2A 3GRZA 5ADVA 4YAWA 3RS4A 2I6FA 1UK6A 1FX0A 1XMQB 2PPLA 3F1KA 2L82A 4BFSA 2VT7A 3QLVA 4ZJPA 1U2DA 3E7WA 3BJIC 3OPYB 3CRRA 1R5JA 3JW8A 4B4OA 3D8TA 1V4BA 4QG7A 1E1CB 1QOPB 4TV8A 5AOBA 4R6XA 1MG0A 4O2BA 3BFPA 5IKPA 1HEIA 2LDBA 4LMPA 1IXYA 2WP8J 5ILQA 3EG9A 3FB4A 2YX1A 3UTCA 2SCUB 1FDSA 1PX2A 4GWGA 4UXHA 3CY6A 1LQ2A 3U7QB 5I4KA 1YCFA 3ORFA 2JIQA 1O95D 1NN1A 4WFKA 3TL3A 3WJ7A 4EBBA 3SMQA 4IIDA 3VTAA 1C1HA 4BP3A 2C82A 4DA6A 4RTSA 1HTTA 1G3IA 1T5LA 1Z4OA 1QKIA 2ADFA 2EP7A 4K9NA 4N40A 4PZPA 4Y9SA 4P98A 1G5TA 5E6SB 1RM3A 4BQRA 2IIVA 5JQGA 3PXXA 4G0VA 1UPFA 2M98A 3C7CB 2BUCA 4QM7A 3W8DA 2UUCB 2H2WA 1M6WA 1XZQA 1YI0A 1TFRA 4PAQA 1SBQA 2O2IA 3AJDA 5LXTF 3BX1A 3S81A 2D2XA 2ZPTX 3OFND 4P4SB 5JLAA 4MCHA 1XX6A 2DJ5A 4J0CA 3PNMA 2IKQA 1QXSA 3ESYA 4IGAA 4CF4A 2WT9A 1P6UA 3BTUA 2UVQA 3VAZA 1K7FB 1NLUA 1ZP6A 1NV8A 1AK1A 1AQIA 3EGVA 1C8LA 4OVKA 3KOMA 2R86A 4PGAA 2A0KA 4NARA 1C4KA 3U3DA 3QE3A 1E1LA 4NG4A 1PL7A 3LLUA 4KB5A 3HP7A 1PNQA 1KEVA 1TVMA 3IT0A 4FOOA 4HDRB 5DKFA 4GXRA 1OI7A 1Y9JA 2CVZA 1WULS 3M34A 4HJXA 2L69A 2VF7A 4LNHA 5IXJA 3SZOA 4LE0A 5DX1A 3TQOA 2F3RA 7GPBA 3DLAA 2I55A 5JXGA 3U5ZB 3E8MA 5E3HA 3ZVKA 2GJSA 1WW8A 1C9JA 1KMNA 2AEMA 5AI8A 2AC4A 4RAOA 5ULLA 4DGSA 4F2GA 4IJWA 4O0MA 4G4GA 2VQ3A 1L5SA 4YP0A 3U1BA 3TGPA 1ABFA 5FNVF 1JA1A 1EK0A 4F6LA 4C7OB 4O6VA 4AQYB 2GZ2A 4FXPA 1A5BB 3JR3A 4I8IA 5CFQA 4Y98A 2Y9MB 5D7NA 4B87A 4CMGA 4MCJA 2IVZA 4GEKA 1T3HA 3DCNA 4PC7A 3WICA 1TZ2A 3B1WA 1KR2A 5EHNA 5I9TA 2C8VA 2VUUA 3DNPA 2O0MA 3I39X 3PFGA 4F96A 4DDVA 5JZBA 4KQXA 1CPYA 1Y9EA 3ROQA 4UTNA 1H22A 2DKNA 1OLSB 3QG1A 3T9DA 2WQ6A 2AHRA 3PTZA 1G9XA 3VV3A 5KYGA 3KUKA 2WTMA 1JSCA 2YOHA 2X1MA 3GUZA 4LG1A 1DAEA 1F6DA 1LEHA 2VDMB 2C8KA 2W2VA 4C3VA 5CAEA 3LHDA 2BGMA 3LBYA 5BW8A 3TO5A 2IELA 1YQWA 5CX1A 4ROSA 3QWBA 2YYYA 5EZSA 4B0PA 3ZDCA 1RZ3A 2H1SA 4IOKA 4B4DA 1P2TA 5KO2A 2F00A 4EKEA 4YY3B 3L7KA 1XQ6A 1Z17A 4AL4A 3SC3A 3E1KA 3HC7A 3TMKA 3UHPA 5EKXA 2YNMA 4WUVA 4GMDA 5FPSA 2WB2A 2YHIA 4YYEA 3P9SA 3QUAA 3PX7A 1RYBA 2P6NA 4CHGA 2MSCB 2XZTA 1V1JA 2A30A 3DVRX 3NLLA 3P97A 3PC3A 4QARA 1LS1A 2MR5A 3WOVA 5IK2D 2IXGA 2QAIA 3ROKA 1A7AA 1J5XA 3EC7A 4LZLA 4Q3EA 1X9IA 1JT2A 3CUYA 4Q93A 4J43A 1EVQA 2F55A 4YRCA 1PFQA 4EOGA 1P19A 1K08A 2O8FA 1ZIPA 1NC3A 1YB4A 5TQ2A 3UWKA 4OXQA 1SVLA 1U28A 3AVVA 2QTVB 3Q72A 1OH6A 5FBKA 1P0FA 3KC2A 4QZVA 3QUCA 1EIZA 1GA1A 2OL4A 1KH3A 4P3YA 1NUTA 2QN1A 3ABQB 4UZFA 1KJJA 2CF5A 3MGGA 1RXSA 2ZU6A 3SC2A 2PVPA 3V4RA 3FE2A 2IJGX 4ICIA 4D41A 3FKJA 1EWQA 2BGRA 4KVGA 5EJ4A 3WZLA 5CDGA 2J0UB 3V33A 1R0LA 1LZKA 1YJQA 4JQYA 4Q16A 2QRNA 5IH7A 1DCTA 3WGNA 1MJHA 5DIFA 3C6BA 1G4UR 2IEBA 1XQXA 3PC8C 3HEBA 4RLQA 5IAGA 2A7QA 1ONBA 4N7JA 1HEUA 2H4XA 5GM2A 2NM0A 2NAFA 3U31A 5JC8A 5CRIA 4DZTA 3NOVA 5GM1A 1CDOA 1I3KA 6GPBA 3HBJA 4IV5A 5E3IA 2BSAA 1AQNA 1W4ZA 4O3FA 2UYCA 5AMXA 4BX0A 3KKKA 3S5UA 4MWCA 4QRHA 5KTPA 4F45A 1G42A 4L22A 4AWXA 4A0RA 5K0BA 4HFJA 1JDBB 1NF2A 4Q18A 4C76A 4A4DA 1GQRA 4KHPB 3LDUA 3IT3A 1UBRS 1NMEA 1AC5A 3VYSB 3KG2A 4A8JC 1C1XA 3WGIA 1U0EA 2WAYA 3PQ4A 1I3OA 2H06A 2L0XA 3OKPA 3IA2A 1EFCA 2OMEA 1EGAA 2NO0A 1JQJC 4BN4A 4CM8A 4YH1A 2W2TA 1I2MA 4I1SA 1JG7A 4C0JA 1XTIA 1K8QA 3SHVA 3W8FA 4R8VA 1ACLA 3MCZA 3BK7A 1NM5A 2E21A 3CB2A 4BKMA 2XXAA 1QP8A 2WT8A 4X8LA 1G63A 1QE3A 1HKUA 2ABWA 2XCQA 2YYAA 3CEMA 3LSTA 1TVKB 3GJYA 3NHLA 4GBMA 1OBVA 1SR8A 1W5SA 4H31A 4J1TA 3EQ6A 2WU3A 4UVEA 3AWDA 3TRIA 4HZUA 4BGUA 1OTHA 3VJRA 1O95A 3JYQA 3W77A 2NO5A 1D2RA 2OCYC 4RZUA 5FA8A 4A15A 4BU1A 3PCRB 3RWOA 4U39A 5K20A 3SLRA 4F8EA 1WQ3A 4LGMA 1YFJA 4ZQIA 3E27A 3HVJA 3JQDA 5EGNA 3ZW7A 2ZWOA 3M9WA 1RLJA 3FPHA 2Z3VA 1U2GA 3LDFA 2AW3A 3JSXA 4O2LA 1EX1A 1SXJE 5CD1A 4XWYA 2FYTA 3STXA 1JL3A 5DTIA 4BNNA 4WKCA 3ICCA 1GP2A 3MFQA 3GXOA 4LA4A 5G4KB 2ZAGA 3FYUC 3VSBA 3H4TA 2JKVA 3ENWA 1X19A 4DB4A 2RD2A 2M2IA 2XIJA 3OFNA 5EZYA 3A6KA 4I1PA 1YMVA 4BDSA 1SOUA 1QKJA 5A4JA 3AHGA 2VCHA 4HNVA 2A9VA 2O3JA 3RABA 3QU2A 3G6WA 1WJGA 2ZRGA 5FL7A 1E8MA 1WUHS 3SBOA 5EHIA 4B2IA 1OLUB 4Q4HB 3L3BA 3LRTA 1GSAA 1E2FA 4QU5A 3KJEA 1USIA 1NBEA 3UAXA 2WE8A 4KR2A 3AOGA 3CF6R 1H1DA 1N5DA 2WU4A 1PZMA 2BM1A 4AS2A 5J2TB 4AS1A 1V48A 3V1LA 2Z5VA 3R3SA 4LV6A 1EJ6A 2E5FA 3SU8A 2IYPA 4AC9A 4DJEC 2J9FB 4ND2A 2GERA 3GC6A 1C2YA 3FYSA 2QLMA 4HK4A 3HZOA 4GX1A 5HK8A 1X2EA 3WY9A 1ZN8A 2JI4A 3D0QA 2LKDA 1UFOA 2W93A 3TLBA 2F1HA 1VGQA 3A1VA 4I6EA 1QRTA 5CIWA 3PXAA 4L3OA 2R5WA 1Z0ZA 4G86A 4N5IX 2BKLA 1GTSA 2W6ID 1SQFA 2FUEA 2QN6A 5JDCA 4L8FA 2N0SA 4C4PA 4R68A 4Y7DA 3I64A 2H2HA 3BZWA 5EIXA 1O58A 1SKYE 4GMHA 4JI4B 3BORA 4Z4FA 2Q9UA 5H9WA 4INJA 4Y0VA 1AU9A 1DC8A 4G85A 2GYWA 3ZJ5A 4LCEA 4OJQA 3GJ3A 5ESDA 1X7XB 2OCAA 3O6VA 1LKZA 2VRCA 2XWQA 3A26A 4P3NA 1O03A 2V7UA 3UPUA 1RWBA 1JLLA 2D2EA 1KPHA 2EBUA 1P29A 3QPDA 2QVZX 2LCIA 4KXFB 1NJ6A 5EPEA 4YAIA 1EQ2A 2H59A 2HQ1A 4WK4B 3VR6A 1KMHA 10MHA 4AN1A 1IULA 2ZG6A 4QGAA 3WBFA 4BNHA 3L4KA 1UXIA 3ZWMA 5A7HA 3BG5A 4TQ9A 1W5TA 2H0RA 3HL0A 3P2YA 1CQIA 2J4FA 3BE4A 3CVJA 1WVGA 1ID1A 3NQ41 4LRYA 3TG8A 4N4AA 1L6RA 3R24A 3G88A 5K7SA 3M2TA 2VK8A 2YFQA 3DYVA 4F3YA 4UE2A 2IU6A 3A2LA 4KAXA 2YQ5A 4C0XA 4ZQHA 2UYHA 1FLDA 4EQZA 3ZQJA 5COQA 2GWRA 1EIWA 4DTIA 1QHGA 2BKAA 1TM2A 2CNWA 2DLNA 3NBQA 3PVZA 5ER6A 4DQXA 2XBMA 4LRUA 4ZZ1A 2IXBA 3OZCA 3OOSA 2OOSA 2VP6A 3D5QA 1I4EB 3PR2B 1XN4A 1OAAA 1AA9A 3QMVA 3QVJA 2F1IA 1UJ4A 3OOEA 2GN0A 4FILA 4KMSA 3H3XA 5CB6A 5IT4A 2H5IA 3NWBA 4AXXA 1P4JA 2P7HA 2WKQA 3IEUA 4TTTS 5DHTA 2ZYDA 2PJDA 3TFOA 3RYCA 2D4HA 4BL5A 2V6BA 4J3JA 1L7RA 1JTEA 2AK2A 2EJTA 1KZ6A 1S8OA 3KJXA 4MWTA 5DTRA 5GV8A 2OGSA 4C6HA 1KC3A 1KZ4A 1CZHA 2R47A 1Z6PA 1WEKA 4TLMB 4X93A 3I92A 3SPXA 1KA9H 4TQAA 3SGLA 1CUZA 4DJJA 1SXJB 4FCTA 2ZRQA 3ZDRA 3PHIA 1GTMA 2P1RA 2F43B 3K96A 4DNOA 4XDHA 1SBIA 2IYRA 2V6MA 4QULA 2ZUVA 2H17A 1VCNA 3ZOKA 1QJCA 3UV6A 1TEXA 2JK0A 4KAFA 1AS3A 4Q1VA 1YWGO 4D0SA 5AD1A 4RWEA 5SV2A 4G4SO 1RRVA 2I22A 3C41J 4JH0A 5CM9C 1W9MA 5EWMB 1XD9A 5FWYB 3RKSA 3K0FA 2REXB 1QFMA 2XGMA 5CCBA 2CJYA 3KQNA 1IEXA 1EJ2A 1HE3A 1U9CA 1U8CB 2DKOA 3H8VA 3I1JA 3SEFA 2AOTB 2YVUA 4W5QA 4UCQA 1GT6A 3DL4A 4Y67A 3U1TA 4NBUA 2XI4A 3GGGA 3L7DA 1E99A 3QJ5A 3HJNA 3IV9A 3D6NB 2ZCJA 5BN4B 2H4YA 3KTAB 3I6IA 1H05A 2CVPA 1MF7A 5FBZA 3V8VA 3DKIA 4QG3A 2V03A 2IE0A 4C3OB 5KYWA 3MF4A 2YWBA 2PBZA 3B3JA 2FX3A 4LZWA 2W6OA 4E15A 5C8YB 5HVNA 3RG8A 4YIHA 4DCPA 3I5AA 2LGJA 2WM8A 2RG1A 4P7FA 3BDAA 4ALIA 3G0CA 4ENUA 2XVAA 2B8NA 3WQBA 3WFJA 3SDZA 3I3OA 3HSKA 3T5TA 1Y3BE 5J4VA 4QAQA 5MGNA 5J2TA 1FF9A 2MSDB 4OK3A 4WWHA 3P9PA 1M7HA 5H80A 3W1EA 1V8ZA 5AQEA 3ZD7A 3AL3A 3WV5A 1L5NA 1MO3A 1SMKA 4FTWA 3WWYA 1NXXA 5ALNA 4PG5A 3ABSB 4EY8A 3KB6A 4FMBB 1DHRA 4P4SA 1F38A 5D5PA 1XL1A 3G9ZA 5JS2A 3UEOA 2J5BA 1C7ZA 5DFAA 3SN6A 5JARA 2A9PA 3A9WA 3LKDA 4I1UA 4ZIRA 1H8ED 3B53X 3Q5GA 1TJYA 3PE4A 4OFWA 4WNAA 1T3GA 4M8NE 1CNEA 1P5RA 3HN2A 3GT4A 3OJWA 3PPYA 2BFBB 3O8DA 4HXYA 2FPWA 4M7WA 4NBTA 3VNQA 3Q3GE 2DWPA 4FNOA 1CDDA 1E3JA 1V25A 4EFDA 3O8RA 1JZTA 5T4EA 4LXIA 1E3LA 3LX8A 4AKEA 1NURA 2C5EA 4IR7A 2C4TA 2GVDC 1G1AA 1DL5A 1UBNA 3BJRA 3FUUA 5EE1A 1OPRA 4PG8A 1BA3A 5MN5A 4G0UA 4O2BF 5AK0A 4Z54A 1NVMB 1F3LA 2OHHA 3AF3A 1MVOA 2CHVA 1PSZA 4B09A 3CLTC 1TYDE 1OFVA 1SB8A 4K7JA 2AMFA 3AJAA 2RIPA 1W75A 5F1OA 1XDUA 3CSUA 2PRSA 3JWHA 2QVYX 4ALMA 2DP4E 1SBTA 2A5YB 1D1TA 2WTNA 1MCZA 4QBFA 2BMWA 1WXGA 4G81A 1FX0B 1D1PA 1T4CB 2V7VA 5DU2A 2I6QA 2RGUA 4G5HA 4Y9RA 3UCXA 5M2QA 2FLKA 2NZVG 4AJ9A 4TS3A 3A1NA 3NFRA 2OOKA 4F56A 5I9LA 1UDBA 4EKYA 2R2GA 4E46A 2IF2A 5MFZA 2F8TA 3M2PA 1TCVA 1EFVB 1H1LA 1R50A 5JS8A 1GNVA 4QYWA 4BTLA 2OZEA 3AL2A 4TMFA 1TF2A 1GCIA 3WV4A 2EEPA 2IYFA 3FFBA 8ATCA 4CMIA 4UNQA 3LUCA 4HATA 5ES4B 3DF7A 3RJMA 2B3DA 4OQDA 5AM5A 4HYQA 4IG4A 2OBLA 1GGEA 5HDBB 3Q1LA 3P2JA 4FONA 1AKEA 2W00A 1FSZA 5BN5A 3F9IA 3GJXC 2JBHA 2QRLA 1VHWA 1ZS9A 2H16A 3MEQA 3OLQA 3SAJA 5IUJC 1FSSA 2ZUCA 3AY3A 1W36B 2A0UA 1WVIA 4I8DA 2PA3A 1PWYE 2C3UA 3LP6A 2V3WA 5K8LA 2AKAB 2DUJA 3IULA 1NVGA 3ZJVA 1JIIA 1MB4A 2ERYA 1J99A 1H66A 1IQ0A 1DC5A 1ZA2A 1V96A 4GM0A 1ZUIA 4RVOA 1B6RA 2NU6B 1P7CA 4OMCA 1XMJA 3L6DA 1J8DA 1J2RA 1E5VA 4P7BA 4K5QA 4XUDA 4IHAA 4JKYA 3RBZA 4JLUA 4ND5A 1TTHA 4PLZA 1SUBA 4UBKA 1ZEMA 3TM4A 4RTKA 1MQ8B 2HF8A 4NBVA 3ZS8A 1IAQA 3KJGA 2C5HA 1WSAA 4LVCA 2VPQA 4WZAB 1OJ7A 2VXCA 4MP6A 4UMDA 5CT9A 5BWCA 4Q37A 1QORA 1NIPA 2DQSA 3R9WA 5TQ2B 3RVQA 5A5FA 1SJ9A 3ZVLA 4BNTA 1YS2X 2JD0A 1WSDA 2OHFA 3REQA 4BB5A 2BSXA 4E30A 1NLZA 3KLPX 3QW2A 5D3QA 3I09A 4BMDA 5EUQB 1LK5A 1K06A 2BJVA 2PU5A 1BE6A 1VB5A 2AQ8A 4IJKA 2WAMA 5KU1A 4GDMA 1ORTA 1U3DA 4FZ3A 2CUZA 4PZLA 1YJ8A 4N49A 3V7NA 4RPJA 3VOTA 2PY6A 1OYYA 1G5RA 1PUJA 1QGUB 2KLHA 2WJ3A 3FWYA 2B98A 2FOIA 3OHMA 5AM3A 2YXNA 1KEEB 2RH4A 4IVQA 2HSEA 5ICCA 1C50A 3F6RA 2XCSB 4HCJA 2AB0A 3CONA 3PUIA 1U2DC 3IUSA 4G89A 1OLXA 2NUPB 2ZSJA 4MPTA 2EKBA 3U4QA 1YBVA 4P84A 3RS9A 1DPGA 5CX1B 2AHOA 3P0FA 4ZQCB 1DX4A 3K1AA 1OSNA 1T4MA 2XAUA 2ZIEA 3GGCA 3NJ4A 2GA8A 3TKAA 3WWEA 3ZZMA 4KYUA 3AUTA 4V39A 3BM5A 4DC9A 4PRLA 4FK8A 1EUDA 3O0DA 4HRXA 3T3DA 3UYKA 4B43A 2AR0A 4S04A 3IIMA 3T9CA 4IDQA 4CT4B 4V1CI 1O4VA 2IHYA 3QEJA 1ORHA 3RC8A 1TJPB 1RKBA 4D57A 2GBGA 4IIHA 3CFYA 4FHZA 3R7LA 3ZZTA 3S40A 3NEAA 1JJAA 1LRLA 1OW3B 3NBAA 3QEBZ 4W6ZA 2R8YA 3EISA 4J7XA 3S1SA 3AR2A 3LLMA 3HEAA 3ZWQA 2MMCA 3U40A 1OXBB 2VPZA 2XDQB 4O33A 1BKYA 1PL6A 1GKKA 1Y48E 5HF9A 3K9FC 3EG9B 1QAMA 1Z7BA 1YR8A 3FRJA 4RZXA 4MS3A 3V1TC 2XMDA 2VHZA 1T8PA 3PFBA 3R4CA 3NI2A 1H0HA 5FOVA 3RSCA 3WLHA 5C5CA 2XDAA 1NW3A 3GFSA 3ICPA 5CJ2A 3TTTA 5CVTA 5J23A 4UHHA 3HY3A 4WNAB 5CA1A 3HDGA 1NJ1A 1A2QA 2XA9A 2YIMA 1CU1A 3H9QA 3R4VA 4RNCA 4HGRA 3MGCA 3E6AA 4MVJD 3FGZA 3CE9A 3QKUA 1DEOA 2W2XA 2ZZMA 1JMYA 2J08A 1V9LA 3F4KA 2ZJ0A 3EIOA 2Y0DA 2R1VA 3A25A 2W37A 1DBIA 3ROZA 4YJ3B 4KZKA 3C45A 3JASB 2I4NA 4UU0A 6REQB 3SEZA 1TA0A 2XVXA 2TYSB 5DN6D 3LVRE 1VLVA 1M2VA 1J8FA 1FFWA 3SY8A 2CXUA 3M81A 4IIYA 2X1LA 1T4GA 1U3VA 1X7WA 2EQ5A 3D7KA 2WVHA 1G64A 3HCEA 3NJRA 3PLNA 5EE3A 5KBYA 1PDWA 3RAFC 3SM9A 4WCVA 1IN1A 3FYUB 3KYDB 2WMOB 3OCCA 3QUSA 5BYJA 2Z6AA 1XK7A 4I3FA 3ULKA 3V34A 4OHBA 1OY1A 1YOVA 3LI2A 2CLIB 4ISBA 4JUIA 3QEMB 4V0NA 1DAFA 3ZW9A 1LBTA 3MSXA 4RFSB 3QLVC 1O0CA 2XMPA 3ROPA 5KAMA 4ZODA 5TPZD 2EHJA 1JWAB 3ZWDA 2HNKA 2I1QA 3TZKA 4JBYA 1O0BA 1HYHA 1Y6FA 4YAFA 4ID9A 4C89A 2ZAOA 4B3HA 3DC2A 2JLQA 3R5KA 4EYGA 3O0TA 3O95A 1TCUA 4KFUA 1PYOA 1LJLA 4QQRA 2VP9A 3GUVA 2C4MA 5F1YA 3B2EA 1T0PA 2J45A 1OT5A 1WD7A 3BS4A 2AXNA 3D43A 4O25A 1GTJ1 4J4TA 4OG2A 1KOJA 4DWWA 5HOQA 3VR1A 2PRJA 3K0SA 2ATXA 4OU5A 5DEIA 1XTPA 3EVNA 1NT2A 1UC8A 4R8MA 1I2AA 2VJQA 4HX9A 2HF2A 4PX9A 3VPSA 4BFTA 3KTDA 3BXEA 5COAA 3FOFC 2XUOA 1IN4A 2IBTA 1IHUA 1U4OA 2ZS8A 3G2LA 3PL5A 5A6SA 1IBLB 3CF0A 1AQUA 2X3UA 1FXWF 3RSFA 3QMWA 1NWCA 2XMCA 3WR5A 1T3SA 2ID8A 1QANA 1EAMA 1QCCA 2C29D 2G1UA 2Q6KA 4DMKA 3P9ZA 3M9XA 3ZGVA 3UUGA 3BFJA 3RC2A 2AD1A 1ESDA 2DT5A 3BMOB 1S2OA 3EOBI 2FR8A 4EAQA 4ZJUA 2Y93A 3EH1A 3HBNA 2AMJA 5EJ8A 2I8CA 4GKKB 1QK4A 3BWXA 3ELBA 2B5WA 4OHKA 3VYTB 3X1JA 4HV4A 4BNIA 1CY0A 1T9DA 3RAGA 1XVVA 4QQFA 1P6QA 3V4SA 4OI4A 4KNWA 3DUFB 3W7AA 5T57A 1OCEA 1XZFA 1JH8A 2RSLA 3UICA 1Q7CA 4II7A 2XDWA 1ODFA 1EGQA 5LZ2A 1F7UA 5I48A 4MJ3A 1L8AA 3WYAA 1NONA 1KERA 1S3GA 5J4YA 2AFHE 2GO1A 2C0QA 2CHQA 2XOKD 4RD3A 1G3RA 1EP1B 3GAMA 4ZA2A 4YI3A 4D9IA 2LDXA 2ZIFA 1EVIA 2C2KA 4EH1A 4DXAA 5FL3A 5KHLB 4KL8S 1HR0B 2AFVA 4QM6A 4PLFA 2XV1A 4LYHA 1ODCA 3AIIA 4BEWA 4M9RA 1Q15A 1VJ5A 4HWOA 1G1MA 4V2UA 2DTDA 3L1KA 4OHVA 4ZOLB 2BV3A 3MJ4A 3BYZA 4QQKA 4QNMA 2BEVB 4NICA 3A3YA 5GONA 4RCYA 5AT1A 1UL1X 2QTRA 4K81B 2JDID 3FFWA 2IZ0A 3NWEA 3UOGA 1QYXA 4F38A 1XXHB 2C2MA 2D4AA 2HK9A 3W6NA 3WADA 5ICEA 1UJ2A 1J0DA 4HWKA 3Q1KA 5U1PA 2HBRA 3LO8A 4C01A 1PVVA 5CIYA 1P1RA 1T8UA 2ZCVA 4X64B 3ADDA 1CUJA 2PKQP 1CIJA 4ZYYA 3RE1A 1P7YA 4GLOA 1V45E 1WKCA 2FN9A 5L3RA 4EPYA 5KVAA 1J0AA 1OWLA 2YW9A 3FLMA 4QFDA 4Z8XA 4CUKA 3L02A 4OFXA 3R8XA 3OIFA 5BRAA 2IW3A 3EULA 4YRDA 1KJWA 2ZYTX 1EP3B 4BJHB 2ECKA 4KBGA 2XZOA 1QIKA 1HFWA 2PUHA 4DNXA 1YS9A 1P45A 1PV4A 2IX9A 2PL9A 3K0EA 1OILA 4Y1EA 2GSDA 3BGIA 4BO4A 5K0SA 1YE5A 3ZXUB 3NVAA 3ZU2A 3LUJA 5F12A 4N9QA 4A2WA 4C21A 2VQEB 3FHCB 2XE7A 3P5BA 1JEQB 2O2JA 4J1QA 4A5SA 3AUJB 1AKQA 4DA4A 4LFBB 4LOHA 3HU1A 4Z5XA 2O0LA 3S8YA 3CF4G 3I32A 4LV5B 3HQ4O 3TF5A 1CP3A 1VBKA 2NXEA 2V0NA 1FRNA 4JBNA 1YAHA 3WIBA 4GX0A 1YRBA 3BIWA 1TD9A 4P1ZA 2WAOA 5I7AA 1RYNA 4MRVA 5LQJA 1Q0UA 2PYIA 2W6NA 3ESBA 1E9DA 1A9QA 1RWNA 2CL6X 1JXQA 1T1RA 1OC2A 1TM3E 4RC9A 4EO7A 3COVA 1O97D 4RQAA 3HP4A 4EFLA 3FOBA 4HEHA 3RLFA 1FVFA 4G1VA 2Y9PB 4LHZA 5JAHA 1VP9A 2G6BA 3OF3A 2WWWA 4U6NA 1GTZA 1GPDG 3BMQA 3TQIA 4L1KA 1IOZA 5DISB 4BVJA 3B2NA 4OQLA 5ALUA 2UYYA 2Q41A 3GZ4A 3ZU3A 2XJ4A 2G06A 5LLTA 3GJ8A 4Z9XA 2R0QC 5CFNA 3FMFA 4S2UA 3VDRA 1F2UB 1XQWA 3WQQA 1WDKA 4CYMA 4L0QA 5A9RA 3CSDA 5AI0A 3OZTA 2ODQA 3MAJA 3OLCX 5HEKA 3TSWA 2W4IA 4PSCA 5G53C 1DOZA 4ADSG 4L7VA 1KETA 3I28A 4AN0A 5F9HA 4F4DA 3CZPA 3WTBA 1PKXA 2FXIA 3LUFA 3RHFA 1Y98A 1J9GA 1UBKS 2IPXA 4P58A 3L0IB 1KDZA 2A92A 2VJYA 1CXZA 2XAAA 1RJ9A 3C7TA 4ZGWA 1QIHA 1VL8A 1JG1A 2QSUA 2PCLA 4M1QA 2EV9A 1EFUA 3G7NA 1WMSA 2V65A 4FCCA 2G0NA 1BVUA 1SU7A 1VMAA 2CE7A 4JEMA 4M9QA 2PO7A 2GAAA 5H83A 3PRHA 4B48A 3L9XA 2GCPA 4EF5A 4YP9A 5JLJA 3CG0A 4CMEA 1BDIA 1GEGA 1KSGA 3S1AB 2JFHA 2VSYA 3W9UA 4HFRA 1H6DA 2PUJA 2OZLB 2GN9A 1WPGA 4EHJA 1GRCA 3NORA 3DBVO 4PONA 4GNRA 3LXXA 3H3FA 1CWUA 2P9CA 2VS1A 2YMLA 2DPYA 1E0DA 3HUEA 4GLBA 4L08A 3P20A 2ZI3A 4E5PA 4DWVA 2QBYA 1OIWA 2H7YA 4RFVA 3LE8A 4P6VF 1KAQA 4WESB 4NV1A 2BGIA 2PUGA 1DEAA 1GHTA 1PWZA 4XVQA 5E4JA 4MV5A 5HUQA 2W2LD 2I8AA 2ENWA 1R10A 3EXAA 4HB4A 1MO6A 1XZDA 3DAHA 4HS9A 5HUJA 2Y1FA 1GT91 1Z5VA 1AKYA 3KX2A 3HCFA 3N70A 4FBMA 2VZ9A 4B2PA 3ANMA 5K6RA 2Q27A 5E9JA 4B6OA 1E62A 2AQKA 2MOKA 1BROA 1VLQA 3MUEA 4KV9A 4NFSA 3RRYA 4YT5A 1KXJA 1B1CA 1R4NB 3LLCA 3FYHA 4RH1A 3DS8A 4MQMA 1G7TA 3TZ6A 2VPYA 2JHGA 3GPIA 3M6WA 4WV3A 1X39A 1VBMA 3R5JA 2CT8A 2DG2A 1W5FA 1O4WA 3IHWA 5FD8A 3LOPA 3G2QA 3NTVA 4YRMA 2HLPA 1DTSA 1HNWB 3O82A 3HM9A 3WE7A 4MI1A 4KJZA 2GEUA 4XOIA 2VHVA 4L9WA 1H2AS 1TD1A 1G2OA 4YPFA 1S02A 1L5YA 3U7JA 2HV9A 4MIKA 2O3UA 3WRYC 3VI4B 2OO5C 3DOEA 5B4UA 2JGKA 3UXYA 4HSGA 3LQKA 1N7HA 2GXSA 4C6RA 3I9KA 1AB5A 2JEOA 3W5SA 3H9GA 3RROA 3NVDA 3N6VA 5SZJA 5C7OO 1C7RA 1NF9A 2HMWA 3ELWA 3EZ6A 2FEWB 2OECA 2DUUA 2GPTA 4FEEA 2X5JO 2VZLA 3JWGA 4Q1EA 3PF8A 5TMPA 3TZQA 2JCVA 4A0HA 3K70D 2ZU0C 1GZ7A 3OJ0A 1R3DA 4I36A 1LLCA 1WOMA 2EL9A 2E37A 4KGXA 3KVVA 3OCWA 4WCDA 3P26A 4X60A 1KTIA 3B82A 3BDIA 2P3OA 4WADA 3B1VA 5EXPA 1ZRMA 2E4YA 4B7XA 1GG9A 4EGSA 2G4VA 1VSUA 4ZYZA 3L1HA 4ZI7A 3VV2A 2A9QA 3KKPA 4YV0A 2CUNA 3ONNA 2WSBA 2ADMA 3MJDA 2J5RA 1KEUA 2W9XA 2WUVA 3LZDA 3B6JA 4AYXA 3V2IA 4N3AA 4CN9A 2HADA 3FPKA 3S27A 5I6DA 1G6OA 1OZGA 4UPVA 4NZMA 1I4DD 2UU9B 1FA9A 1LX7A 5BORA 3O8QA 1M6VA 5KZMB 1J33A 1U3GA 2NQ8A 3RT7A 5KSOA 1I24A 4BPBA 1E1DA 1FY2A 3LQ1A 3KPYA 4J3FA 1ICEA 2AA3A 2P9FA 1U2QA 3SZRA 1DEKA 5CVUA 1Y5NA 5LIPA 3WMEA 4I14A 4MHTA 2B8TA 2Q3BA 4QU0A 1P3Y1 1LW7A 5A02A 4CEHB 4HLDA 5IBQA 1JMVA 3K8YA 1DX9A 2QM3A 4TS9A 4C5BA 1XZMA 1T9CA 4A92A 4HNHA 3A1TA 3PUYA 1QCYA 3A7DA 3GEIA 3HXTA 3NP9A 1K8XB 1NJ8A 4I50F 1HZZA 4WN9B 4CM9D 1KFJB 2YS7A 3H1GA 3L7JA 3U61B 5F2KA 1OLUA 1L4NA 5JPIA 3CLUD 3UMJA 4R1SA 1K7XB 3KELA 3GWGA 1JIKA 4BZZA 4N1AA 1EFRA 3SFTA 3WQHA 3BBLA 1XAIA 1U94A 4A8JB 1JE1A 1WCWA 2JH3A 5GWXA 1TPZA 4ETIA 4UM5A 2V6JA 4JOQA 1G5IA 1PO7A 1E18A 4NBNA 5JD3A 5LL6P 1NNEA 3HDQA 3M89A 2A5GA 1O2DA 3NH6A 3TI9A 3HACA 3FIUA 4MJ7A 3BWMA 4FGZA 3MMSA 1N2EA 3TCKA 4BKRA 1OREA 2VSFA 1IHPA 1YRLA 1XGKA 2ZRDA 3H2IA 3X1DA 4C3UA 2CFIA 1ZD5A 4ZXPA 4V1CA 4QGSA 1F0YA 1LPAB 3B51X 4I55F 4YUVA 1Y9DA 5GTDA 3YASA 5AW4A 4PZDA 5JNUA 2B2CA 3DCJA 2H4FA 3GRYA 4BGEA 1ADGA 5LB2A 1DBVO 1ZN7A 3EGOA 1CUFA 1UBOS 2AUMA 3O1HB 3P0HA 4C5CA 1ZWLA 2PZGA 3KEFA 1JHRA 3OBIA 2H9IA 4KIFA 3C1AA 3L8GA 3GZTB 4TT8A 5K3AA 4D45A 3BILA 2PZKA 4NRDA 4U6SA 5DE3A 3HA5A 4JHLA 2Z2IA 4MWBA 4FYVA 4CLRB 3LRXA 3ROGA 3FSGA 3GW8A 2DM6A 4RULA 4NYJQ 2FRVA 2VNKA 1JJ7A 3L40A 4ER0A 4QICA 4C4ZA 1Q84A 1JDNA 1HK7A 2G88A 1VCOA 1C1DB 1PTKA 1ESEA 1PV1A 2IHKA 2Y99A 4R1MA 5EIOA 1RFGE 2PXHA 3SG0A 2H2FA 3OU2A 2Z4TA 1XWFA 4BNVA 4OP1A 5FYDA 5SZHB 3TYXA 1EVLA 4LE1A 2QMUA 2QT1A 2AFIA 3H04A 4AU1A 1M0EA 5G0TA 3SS9X 2JA2A 2UYGA 1XLVA 3BREA 1EWKA 1FNSA 1I14A 2BFWA 2P6UA 1K5DA 3PBKA 4DARA 5LJIA 3GBVA 7MDHA 4V0QA 1RJWA 3OX2A 5EESA 1NUAA 1X0XA 4KU4A 3ENNA 5DMHA 1CP2A 1PK8A 1DOAA 2VTBA 3MB8A 2R7MA 2VF4X 1YR3A 1RJDA 3LU1A 4RVUA 2W2OA 3OZRA 4L4UA 2A5FA 2NUBA 3KO8A 5BSWA 4JV5B 1JGTA 2YRFA 1HORA 3WGMA 3Q7EA 4Y6LA 2C5BA 2EIXA 5EUBA 4Q3BA 2GD6A 1XZHA 1SG0A 5MN6A 3P0JA 2ZI7A 1SA0B 3HP1A 3QNUA 2O6LA 2NVUB 2H1FA 2JFYA 1D7AA 3TOVA 4Y2PA 5J58A 2QW0X 1ZUHA 3GDFA 4FHFA 4J0KA 1Z15A 3RIEA 2ECQA 1DPFA 5DGIA 3ZY4A 1VSBA 2HWXA 4KTTE 1JBEA 2YYZA 1G8AA 4Q3AA 4US1R 2GKOA 3V8QA 1NW9B 3RF6A 3OG9A 1MV8A 4HVTA 5KOJA 2FRDC 3H2HA 1XQ1A 3LCJA 4Y8VA 4D56A 1GG8A 2WNIA 5CTJA 1UH5A 1UOOA 2IA5A 3NXSA 4UHEA 1LVHA 1ZPDA 1GJRA 1NMYA 1SXHA 3UJ8A 5IVDA 1C0EA 3ZEIA 4IJUA 4BJ5A 1G5FA 4HAIA 3C98A 1YA8A 4MVJE 4MRNA 2NZJA 1CDEA 4AMBA 3C3MA 3NOQA 3AUAA 3GUCA 2B94A 3QMMA 3ZVRA 4AZ0A 1CS4C 4QDZA 5BOSB 3EWSA 4JI3B 3NHPA 1PJLA 2JLXA 3G23A 2VWQA 4TKZA 5A0TA 1CZKA 3BTSA 5BSGA 1TK2A 4YIKA 4HB3A 4FX5A 2ODTX 4ABTA 3IP5A 1V5GA 1E3QA 2F4NA 4LTDA 4N7MA 5DT9A 4EGFA 1NVXQ 5BV1A 5BRNA 2XUZA 3N2NA 4D6PA 2XITA 2QE6A 4LRSB 3R5SA 4BQQA 2ZXUA 1O95C 2ZSDA 1H23A 3DEAA 3AHHA 4EI7A 5COBA 5B4VA 5L7WA 1OZAA 1Y80A 2HPHA 2VXOA 2LWIA 4BB6A 2F1JA 3B89A 3K35A 3HMQA 3EX7C 4OH1A 3NIGB 2OCLA 5E8RA 5L4LA 5T3UA 2ZPAA 3LW8A 1EFTA 1RHMA 4G1EB 4C2TA 1I9CA 4OJTA 4PSAA 2HOQA 3BD6A 3UHFA 4RA9A 5EKUA 5JQWA 1JALA 5LNK6 3UT0A 2JCXA 4C6TA 4BP9A 3KR0A 1H2ZA 2JW5A 4NV0A 4H7IA 1SXJD 2A58A 3AR5A 3THYA 2ZETA 3HI6A 3R76A 1YBFA 2J7PD 2WHPA 3RREA 3D6VA 4BQNA 4ZCQA 4FFBA 3GEGA 4HN4B 4NDAA 4XFDA 3HRHA 5E1BA 2AOUA 3T3OA 2PX8A 2TMGA 3LT5A 3MRXA 3MCVA 3IT2A 3ZHTA 4BV8A 4OTZA 4U1RA 3SYKA 3V3KA 5B55A 4Q3OA 4X97A 3CUUA 2WFLA 2D2VA 1OFHA 2ZT5A 1ISGA 3Q3EA 2B3TA 1C7QA 3COWA 1RTTA 1WXFA 5HIMA 1RQNA 1FTSA 1DXOA 1IQPA 1WMEA 1L4UA 3NPAA 4FMCB 2AL7A 4GYKA 2P67A 1N6HA 4OB7A 3IBTA 5HX7A 2DWUA 4CEHA 4Z86A 1UXOA 1Z47A 4HF7A 2F3TA 1EBUA 1ZAKA 3A2MA 2AH5A 3RIHA 1ZGCA 2D0OB 3ETGA 4DRXA 3KUDA 1C7EA 2H1CA 2H07A 4ND8B 5DBHX 1CCWA 4CCWA 4YS6A 4W5OA 1MU0A 1ODIA 1P62B 4F04A 3O8CA 3UJNA 4KH1A 1KK0A 1Z7WA 3KAQA 3VKVA 3WAGA 2WKWA 4J9VA 2JK1A 3S68A 2X0RA 3H42B 2HSJA 1O0SA 3H6KA 2CXNA 3HKCA 3MCWA 3GIWA 3OT4A 4ALKA 2Q0SA 3C6YA 1O5TA 2XB9A 2YCLA 4I4LA 1GA4A 4NCXA 4PC6A 1KYQA 5A5GA 2XQKA 1QH9A 4E2XA 1FRQA 3U48A 3KKEA 4LJAA 4H9GA 2XWBF 2RMKA 4QVKA 5E7MA 5BVGB 2QR5A 4E32A 3NHSA 3D9QX 2PKXA 1F1JA 2OAGA 3OWXA 3QHQA 2VDUE 2GA9A 2OGZA 2Q49A 4X6UA 1G6KA 2NXNA 2ZP1A 3FDFA 5FNZA 4CM4B 2FSVA 5KQMA 3PNKA 2EYUA 2XNHA 2JLBA 1UDXA 3IT1A 4LF4B 1VDZA 1SZCA 3HCNA 1SXJA 1V8OA 4PHTA 4WZBB 1A7UA 2NUAB 4DQUA 2XVMA 3OU7A 4EG1A 4EYSA 1MZPA 4U7TB 4CTKA 5SYNA 3HVKA 3REFA 3JYOA 3BFVA 2JLVA 4S1WA 1CT9A 1RWVA 4G8DA 2ZT6A 3WIVA 5KREA 3QVTA 4X1IA 4B3IA 2X2EA 3BB1A 3CCCA 2P69A 4HTFB 1HO3A 4N5NA 2VYND 2YH2A 3AESA 3SFZA 1AM4D 1ND6A 4DCMA 1J1IA 5HIAA 4C87A 1XNRB 1Y37A 3HY4A 4RGYA 4CIVA 1O94C 1JLRA 1RYYA 3SJCA 3B78A 1IE3A 3HL4A 1D07A 1GZ4A 3ZX5A 2FFBA 4BLVA 2NG1A 2V7QD 4EPWA 1N9GB 4WNIA 3SQLA 4ZOEA 1RQXA 2A2ZA 1RHUA 4JVOA 1L3BA 3FZEA 3AEQA 2ZJ8A 4DV0B 1PEDA 3TZCA 2J9GA 1HOTA 4I5IA 4IFEA 4BUCA 5JTUA 5DGCA 5J5AA 4EA6A 2N47A 4RY2A 4U3JA 4K6GA 3UC9A 4MV7A 4BLQA 2A5JA 3EQ7A 1E3IA 4R7ZA 3FKSD 3PEEA 1YQQA 2W8BA 1MJGM 4ZYWA 1ITZA 4P83A 4HH0A 4ZVOA 3ESZA 1XTJA 3MWDB 4I3HA 2O5RA 4YRGA 5DYIA 3PHBE 4JGBA 1SOAA 3AEUB 2XUIA 5LQDA 5LXTA 4IIGA 2HNBA 4EF4A 1H5UA 1YVPA 1POWA 4EW2A 1CKEA 4YLGA 1MRNA 5AOVA 2GRAA 2JFUA 3AHEA 2BTQB 2FFAA 1UBFA 2ZI9A 4BVAA 3FSEA 4RCVA 2YWXA 3JD1A 4HNAA 5G4LA 4Z8YA 2EX0A 4K28A 2PZFA 4R71A 2VLIA 4Q1AA 3ZCXA 3MWJA 2Y0CA 3ZTTA 4HWGA 4RANA 1U2SA 3IEMA 1HE4A 4A8JA 1DFGA 3RV4A 5KYXA 4FLMA 3C7DB 4UOZA 2D6FA 5ICFA 3LQFA 4EB3A 1ZWKA 4Q01A 4RKWA 3VAAA 3BL5A 1NAIA 1BDMA 3PUXA 3PCTA 1G8MA 2DBVO 4EI9A 2YN2A 4IBOA 4O4LB 3GPDG 3KV1A 3QY9A 4JLVA 1WB4A 1P7VA 4FFSA 4A5OA 4U5XA 1REQB 2EZTA 3M5WA 4MJXA 5ICSA 2H5EA 1KIAA 3SIXA 4TMVA 3WB1A 1NZJA 4B4WA 4LC9A 1QRRA 1P18A 2AG5A 4Z9AA 4XDYA 4LX0A 4NESA 5FLEX 3CO5A 2HLDD 1N5IA 3CLSC 1KL7A 2W11A 2WPNA 3A1EA 3D54D 4P4LA 1CUYA 1GV0A 3ONVA 4R9RA 4EB8A 1E6LA 5LQAA 4RJLA 5B4TA 1I30A 3KZVA 2WIFA 4BFWA 1FYEA 1UFKA 3K71B 4QSHA 5F73A 1RJFA 2G4LA 3D6UA 3HJRA 5FH9A 2WE7A 4UMVA 2YXDA 1XDZA 4C0SA 3THXA 5FQNA 1QU2A 5IYZA 2F3UA 4BNKA 1G21B 3V1NA 2QTAA 2HA4A 3CS3A 4TYQA 2R5NA 3HXLA 4ZCSA 4ZMBA 4I66A 1ZI6A 4PY2A 4DE5A 1Q7BA 2VYVD 2UZ0A 3EXG2 3LOUA 3ZWAA 2ZTSA 3TPCA 2IW1A 1BHJA 1XNJA 4UUQA 3IQFA 2FGKA 4O2AF 1NOIA 2FPGA 4RV9A 5IPFA 2YHUA 3KVRA 2HUPA 2X5KO 4DMFA 3KXPA 1PJ8A 2Q4OA 3M83A 3LPLA 2P4UA 1QO9A 1N1DA 2IGTA 4WXPA 1Z0JA 5E9WA 4Z0NA 3DZKA 3QQPA 4ZK6A 1TUGA 2XT6A 3CZRA 1JDJA 3ZBTA 4ARAA 1Z16A 3BHIA 3IBCA 2HHHB 3AGQA 1NBHA 3ADKA 4IFTA 3TVDA 1RWPA 1UP6A 3TIXB 4ZOQI 1W25A 3F6YA 2BFPA 2CLSA 1FVXA 3C1OA 4KH0A 1KO5A 1SC3A 2OWEA 3A7EA 1GNPA 1K3UB 3IUQA 3IEIA 4EEZA 2J3QA 1XU9A 2ROQA 2XQJA 3KJHA 4UKDA 3LTNC 3LP5A 1DDIA 5B37A 1NL3A 1VG8A 4MIOA 1QO7A 2PGXA 4GI1A 4ZV7A 1K27A 2ASEA 4M0MA 3M6LA 3M6XA 3IVRA 2C2YA 4UM9B 1RRMA 1LX6A 1S0UA 1N6LA 3B36A 4ZI2A 1K4MA 1H9CA 1SIBE 4E2WA 3AI3A 3O7WA 4UBNA 1V0JA 3TPZA 2PIAA 3OT5A 4KQEA 2BELA 2ZGVA 2C04A 1Z8DA 2EBHX 2YV2A 1BKDR 3MTEA 1N6IA 4AZ0B 1U1FA 3M4ZA 1B0ZA 5K8VA 1H5NA 2Q2QA 2JC3A 1DB3A 1JEAA 1RE0A 1VA4A 4R1UA 3SHTA 3OIUA 5DI3B 3FWZA 3PC8A 3ZDYB 3IO3A 4URFA 2GEFA 4QC2A 4BV9A 3LUAA 1U02A 1AQLA 1XQVA 1NW7A 4R9UC 2HK8A 1YJ5A 3UXHA 3VH3A 4EI2A 7ABPA 3K9GA 1JNXX 3AXTA 2QW1A 3KJQA 5H02A 2FCRA 5DNVA 1P5JA 4OJYA 1J4AA 2AFHB 3ROTA 2XUHA 4GMFA 4WZAA 3DC7A 3CUWA 3OZVA 5EJEA 4OA8A 1DMSA 1RQ2A 3N8NA 4Z1OA 4B3CA 2O2SA 1UC5B 4FZJA 4TTPA 1Y6ZA 1EVKA 4KO2S 3MRVA 2X0FA 3WWOA 4FKZA 2GAIA 3GFBA 4ZCIA 4KGVA 1E7YA 4YJKA 4CMJA 1PR9A 2ODEA 5KYYA 1T5IA 4PRZA 2GBLA 2AG8A 5KINB 1Z38A 1I51A 3PGXA 5DCYA 5AM1A 4CUJA 4F85A 2O8EA 5IKMA 5DGDA 3RIXA 4DC1A 2X5XA 1YZGA 2ZK7A 4ZEOA 4EHFA 1QF7A 5ADWA 3JAWB 2C00A 1SRQA 2NXCA 1UUFA 3ELYA 3K9NA 3MCAA 4CTMA 1POXA 5GZ6A 3DUFA 4HX2A 4Z3OA 4NLLA 3FY4A 1IN8A 3SDBA 3IQDB 4OQNA 3JQ8B 3OUTA 2AS0A 4E88A 5LKAA 1N1GA 4GYYA 4DSTA 3VC1A 4IV0A 4S12A 3WGOA 3HADA 2YHSA 4AO8A 3S2FA 4N3NA 4FYMA 4DLVA 5LOVA 4F4IA 1S1CA 3L7LA 3TUJC 5M04A 5T4BA 1E94E 2QD5A 2ZUWA 3CXUA 4MWDA 3NBYC 4I50B 4LW8A 2XTJA 3IJRA 3VZQA 2ZSKA 1KHHA 3VKGA 1AV6A 2C3MA 2UAGA 4ARZB 1MOQA 2V7QA 4MMXB 3H2BA 4NI5A 4HXFB 1OTYA 1EG7A 2VK2A 3X2SA 2HA2A 1A9PA 1CQJB 5LU9A 1TVCA 2K5UA 2C5FA 4A6DA 3UFBA 4H15A 3PXDA 1SVNA 4R5MA 4D4GA 4FGUA 3E9YA 4S3MA 3RS3A 4CLRA 1NVAA 2J30A 1D4OA 4IL5A 1WKVA 2ZJYA 1IDN1 3QLJA 4D99A 2P9BA 5DPMA 1SWVA 1DKOA 2P30A 4H77A 1Z6XA 4LF7B 5HKLA 5CLQA 3KT3A 3RRBA 3U0BA 2VF8A 4Y2GA 2UV8A 1JPUA 2CEAA 1N1EA 3GCDA 4NV3A 4W9NA 4H1WA 2DPGA 4PN7A 5CGZA 1W0CA 4KKVA 1JQBA 2GO7A 2O6HA 3E5MA 1NP3A 3ZK7A 1E5XA 3K0CC 4MQBA 1JEYB 2GZRA 1H1TA 1L5QA 4UUMA 1YL6A 2K4MA 1HH4A 1ZUNA 2R8XA 3DDUA 4EVQA 2GN2A 4OIFA 4Q4LA 4RQBA 3CV3A 3DVLA 3QU4A 5DP2A 4V1CB 4QFMA 3TVYA 4U0JA 1BMFA 4MAAA 1JR3D 4MRMB 2A5LA 2RHOA 1HF3A 4PYOA 4YJDA 2JG3A 3N9IA 3GRCA 1PFWA 2BI4A 1T4BA 1KP2A 2HA5A 3DFIA 1DAOA 2UZAA 3IHKA 3KU4A 2PD6A 3FGNA 3SQOA 1X7GA 5EP3A 2GH1A 2A1UB 4YCLA 1EBBA 1XXHE 1WPQA 3I2FA 2J0EA 2OZPA 5ENVA 5FLXA 4EG5A 2HEIA 3OQIA 4YAGA 3CINA 3C3AA 3KYIB 4I1RA 4PO8A 4DBLC 1XPOA 2OLJA 1SY7A 2SNIE 4QDTA 4TSFD 5IARA 2OY0A 2FE4A 3L6OO 3MUOA 2QY6A 4TMTA 1L1EA 1V6AA 3RASA 3A70A 3IB3A 1TW3A 2Q5EA 3OAAD 4KR6A 2W2MA 1HETA 1XTTA 1DKUA 1N3IA 5CMLA 3X1MA 1DWOA 3DE5X 4DCCA 4MX8A 3PPVA 4CIAA 1UDRA 4BTEA 3NBFA 1QQ6A 2FRXA 3KKNA 3PQ2A 4KO1S 3G0IA 1XPRA 4ZZ2A 4F4CA 5D85A 3TMAA 2DC1A 1CD5A 2WABA 5IG2A 4JJ6A 4K6MA 4CDRA 3VTZA 1U0OC 1I0ZA 2C84A 3UUEA 2WOOA 2GTPA 4YX9A 1UFVA 5AK3A 1AKNA 1EESA 1DT5A 3GAFA 3BMNA 3SIPA 3N0RA 4KEAA 4L6CA 5KHOC 521PA 3E0QA 1X7YA 1PZFA 4JOSA 4LPKA 5DV9A 3U56A 2ZBUA 4BZPA 4BV2A 4EG8A 2P3SA 2CNLA 2DVMA 4LFCB 1XJWA 1Z5NA 1E5DA 5JYBA 4KFSA 3ZOZA 2BPOA 1TKBA 2AVDA 4Q12A 4RV5A 4BIMA 2CHFA 1T35A 2YRXA 1YB5A 3X3HA 2H11A 5GQSA 5DNEA 4KP7A 1E64A 1ZNYA 2W4MA 4EG4A 3BMCA 4LAFA 3U39A 1RJEA 4RIEA 5CPBA 1GA6A 5HWSA 2DFNA 1VXOA 3O9MA 1ECFA 2Y4NA 4O4IB 1D2AA 3TK1A 2BYTA 3OPYI 4DY6A 5IXYA 3ZQUA 1U0JA 1ZLXA 1ABBA 3IE1A 3IAEA 4YJFA 3ZEAA 4DANA 4ZYLA 3ZI4A 2FZCA 2YWGA 4AIRA 2Y1DA 3N5KA 4X61A 4Y6RA 3NDIA 1RRKA 3B3GA 4OF4A 3TZLA 4ENQA 2HMTA 3U44A 4RSMA 1CC1S 1W5BA 2Q29A 3KAKA 5L3ZA 3C5WP 1TQHA 3I23A 1ZN2A 3E5HA 3IUNA 1CUWA 2ZE7A 4L3VA 1BXRA 4ZAVA 3ECSA 1XYVA 2O06A 3DMRA 4MWZA 4XI9A 3MWEA 3WGUA 1IIRA 4W5RA 2ZEJA 3NT2A 1VYTA 1O8BA 1YZLA 3H4IA 3R23A 2QRKA 4JR2A 3AR4A 4MDYA 2PLRA 3K9LA 5WRFA 4WK0B 1OWPA 2ECFA 2VNAA 4MQEB 2ANBA 1F3OA 4D6YA 2YUTA 5MGBA 2PRIA 4LC1A 5BRJA 2XSZD 4AG3A 1OYVA 1RBQA 2QNBA 3ZUGA 3GBSA 3IMGA 4B44A 2BHLA 2ZIWB 1VXRA 3BUSA 5CFPA 3V4LA 5ALPA 4S1OA 1EUQA 4U5QA 1L7PA 3LUKA 1SU6A 3EQ9A 1M7BA 1TGYA 1AH2A 3F1LA 3NDRA 3UJ6A 1EFPB 4KR7A 5AJVB 3J7AC 4N5HX 4R2XA 2B8JA 4R3UC 5E7JA 3L6EA 2X9NA 4FS3A 1E4EB 4CM4A 4P5EA 2E0IA 2G9VA 1YZNA 2ISCA 2Y1WA 3VR4H 2O8BA 4GMXA 1J0XO 2H2GA 3K2IA 3QBDA 4RPLA 2QLFA 3RS5A 1XPUA 1DBPA 1PSWA 1YDMA 2IXEA 2YFHA 3G2OA 3NOOA 3V5NA 4MYHA 2HCFA 2FWAA 3RRFA 4Q9KA 1YS6A 3KEOA 4ZDIA 4R69A 5SYAA 4RZQA 4DAOA 2C8LA 1LJUA 4DPLA 4OJKA 2AN3A 5CITA 3Q85A 5BSMA 1MFPA 3O74A 3Q6NA 4KXWA 3EEOA 3S2SA 3ZZUA 5MFPA 3RW9A 3K3PA 3N6XA 2YWCA 1N6OA 3R3YA 1UPAA 4MR7A 4D96A 5TRTA 2NU8A 2C5LA 3A4VA 2OLKA 2RC6A 4WRRA 2OGUA 4LN1A 4BKPA 5KPJA 3DNFA 3I9V1 4GX5A 4Q5IA 3OWOA 1GNSA 4GVXA 5HTOA 4XIYA 1E32A 2VRWA 3RUHA 2MYUA 4CR7A 2D3TA 1O6ZA 1RYMA 1Q3HA 3FUTA 4F3CA 1KKUA 4BNMA 1ODJA 1T0BA 1XZJA 3KXKA 4E0BA 3PYXA 5CYFA 1M6EX 8GPBA 2JIPA 1ECBA 4WJLA 1AHPA 2W6JD 4N01A 3W5CA 1XHEA 2AN9A 3SX4A 2RC5A 1I2DA 1YB2A 1GKUB 3V55A 1P1BA 3T0FA 2IC5A 1ULBA 4OKNA 4S35A 1XKXA 2FPGB 2X19A 4L0DA 4H17A 1N2ZA 1VIVA 3W2FA 5AK4A 1RCTE 1DC6A 1QP4A 1R66A 2QUHA 1EH5A 1KRXA 4X62B 5GP1A 5A4AA 2MWMA 2CNOA 3MTDA 3C8UA 2H0AA 2I3AA 3DZHA 3G5LA 3PNQA 1SQ5A 1JJIA 3AX6A 1E9RA 1GARA 4ZZIA 2C42A 3GYGA 1C2TA 4WUTA 5ELXA 3AHDA 1OFUX 4DM4A 1YCGA 1JBKA 4Q9IA 1X8LA 1G19A 4OATA 1E2BA 2E5WA 1RYFA 4PQRA 4MYRA 1CUSA 3ESRA 3GT3A 3D8BA 3UJAA 4F06A 3U0VA 2ZE5A 1DQYA 4BVKA 1N8TA 4KIWA 4XWTA 3WX0A 4QYIB 1W44A 4RD0A 3F98A 4ARVA 3G3EA 1PFUA 4U6QA 1EQAA 4NS4A 4R84A 3WGTA 4BQEA 3QWFA 1S9DA 5H4GA 1IM8A 1TM7E 2R66A 4ZOCA 3DQQA 5EJIA 1P9NA 1LLQA 4HZUB 4HBZA 1K98A 4IGIA 3OQ6A 4H7EA 4KQIA 3I8XA 3IUYA 4FKMA 5EHGA 3RUAA 3WBJA 1FP4B 4IXDA 1JFLA 2ATIA 4E3ZA 3U16A 1WPXA 3WLMA 4UFNA 1KZYC 3TW8B 2B0CA 3QKTA 4NENB 4RYLA 5CXXA 3JPYA 1R0YA 4GYJA 1T8TA 3DLPX 4CM8B 1BYUA 4PRKA 5DYYA 1L5MA 1YUBA 3IJEB 4TYNA 2VPPA 4TM7A 4LDZA 3G2MA 4QEDA 1WTAA 3AR3A 4BNFA 1UINA 1KYZA 2JCGA 4X85A 2OPHA 4RVDA 2AZMA 3SFVA 5DGHA 2VTDA 3F5DA 2NNWB 2VI5A 3OECA 4JB8A 4LSWA 1NQ5A 3BBPA 5B1EA 2QX8A 5EUMA 2IDKA 2BLLA 1NW8A 1YQTA 1M5TA 1IUPA 3A4TA 2JJMA 3A0UA 3FNFA 4QEZA 1JB9A 1VJDA 2GZ1A 3RO7A 3VPDA 4Z4CA 1T5TA 2R1TB 3LL7A 2HDNB 5HS6A 3VKWA 2INGX 1XVUA 3AEUA 4BOYA 3EA0A 3ZJ4A 5BSHA 1TM5E 1GUAA 4J1TC 1VI5A 2EDAA 1IEQA 2BGUA 3JZAA 2FLVA 4G01B 2Q3CA 5TVKA 4EYQA 3ONDA 3THYB 4NAUA 3QM1A 4TTSA 1NYRA 3IC5A 1A3CA 3UMRA 2P2NA 4XWOA 2P9GA 3BE6A 2I1LA 2P4EA 1A4UA 1E1QA 1JZSA 2AC7A 2C7BA 2OG2A 1KFCB 1EGVB 1LK0A 5EJ5A 3UK2A 1Q7TA 1N2CA 2O3SA 5E95A 1SBZA 1K4YA 1LPOA 2OQRA 2VDRB 3W7VA 1NI4A 5E6SA 3T94A 1TA9A 2QYOA 1R37A 2DFVA 1FXSA 2HC9A 2PBLA 3RPEA 4KSYA 2EVWX 3CPHA 1KKMA 3SSOA 1G0NA 1WUIS 1ZQ9A 1CF4A 3LBFA 4QYMA 2CLOB 1DXYA 1GRVA 2HV8A 2DRIA 2VBGA 4NBKA 1Z29A 1RYZA 3BXPA 3Q12A 4S2EA 5I9MA 4C20A 2BKXA 4WFJA 2GXAA 4TKMA 4NK4A 2BDTA 2V0GA 1KP9A 5A4FS 2R4UA 3H5RA 5AUOB 3TD2A 2VTKA 3E53A 2PLWA 2R7AA 5FL7D 3JYNA 4CETA 3EGIA 1AMOA 3RADC 2P2SA 3WWDA 3ZZ0A 5FULA 1L7VC 1R16A 2EKPA 3ESAA 3PJEA 3T61A 2QZSA 4IUCS 4INPA 1WUJS 1EZZA 1W4AA 1XOIA 3K9HA 4PG4A 4ZWNA 2IWRA 4CFZA 3HCAA 1CULC 3CXRA 4TRMA 3K6SA 2ONCA 4TMWA 2R751 3PIDA 5AOAA 1N2JA 2WIAA 3OQ1A 5ERGB 2WJAA 4QUGA 4LFAB 3QKSA 4JC4A 3EGXA 3OIWA 2AI3A 3X43A 2GF2A 4K9DA 2ZWIA 5AVSA 3CRZA 4K6CA 3R3JA 2C7GA 1EAYA 2HA0A 5BVGA 1E59A 1Y34E 1D6MA 4LNUA 4UMFA 1Z3IX 3DPIA 2QMOA 3X1KA 4AZVA 1TJ4A 2IEGA 2VP0A 3IJPA 7REQB 3K6SB 4JASB 3QOWA 4PXAA 4RENA 3TFQA 4P31A 3WWZA 4WINA 3KV3O 4OHWA 3RRXA 1DZIA 4P0PB 4GUDA 3FFAA 4M0UA 4YONB 3CRMA 1JFVA 4ZVNA 5AJHA 2XCTB 1GPJA 1P31A 2V9CA 1EWVA 3O83A 4RXTA 4MV6A 3FRIA 5D7BA 3UM9A 2G5PA 3EUEA 2CXXA 4D4MA 3AI7A 1VPLA 1KJ8A 5HUHA 2QW8A 2IU4A 3J7TA 1UBGA 4LHSA 4E12A 1X0VA 3MUNA 1E6CA 2GK4A 1ZOOA 3JQ7A 4WOKA 1IBCA 1N57A 2AJCA 2QGZA 5INTA 3A2KA 3PUZA 4LXGA 1M7GA 3HRKA 2PAFA 2WVAA 3P9YA 3OZBA 4JQCA 5SYMA 5BWBA 3ACBA 2GEVA 3BOSA 4W9RA 1AXRA 4M1ZA 4A6EA 3KKZA 4FYXA 3UAOA 1QYWA 2YVKA 4ER6A 4OM8A 5F9FA 3GJ0A 3IDSA 3UMSA 4GR5A 1RPNA 1P4SA 4N5DA 5FWAA 4QHYA 5LZ5A 2RG7A 3U6KA 1ZHOA 1ENZA 4EDHA 1PNVA 3LXMA 4GPTA 1NQVA 3O90A 1SD1A 1G9TA 1XTQA 2HHAA 2O2HA 3PQ5A 4GOMD 4IPTA 2MSNA 3ZNQA 5K9ZA 2Q0XA 4Y2JA 2SBTA 1JLMA 1V8PA 4Q02A 1GDTA 5AJWA 5K0GA 3H19A 3EF1A 4YRQA 4Z51A 1Z0KA 1RZVA 2D1SA 2Q6LA 4G5RA 1P5ZB 2Q7OE 2M9MA 2YZMA 1BE8A 2Z8YM 1UZMA 1Y8CA 4GXQA 3PRYA 4MW7A 2QF7A 3STYA 1CYEA 3I6YA 1B8UA 1F14A 1WCV1 1U2TA 1GM5A 2W7TA 5FWXA 2BIFA 5D84A 2QRGA 2X8BA 2I54A 3KFXA 3OFJA 1U7UA 4FXOA 1W4BA 2X77A 4O08A 1JUDA 1EXDA 4OL9A 2GCNA 3DW3X 3OO1A 3DDHA 2COUA 4J0FA 5TV2A 2Z08A 5CG1A 1C4XA 1E7QA 1G3MA 4PGMA 5HZKA 3B7PA 2F8MA 1WXDA 2EZUA 3AR7A 3QY0A 1LDGA 4XUGB 4OFBA 1MT3A 1YDWA 4GZLA 1H4TA 1FLVA 2FG7C 1CF2O 1L0BA 2RGDA 3JRWA 2XWPA 4Q05A 4QYIA 4QHSA 3RU7A 1L5GB 5TE9A 4TT3D 1YI1A 4EHHA 3VYVA 4RGBA 5G0SA 3WK4A 4ZICA 3TEJA 2GPAA 2C9BA 2PG3A 1EX7A 3ZCSA 1Q11A 2PVCA 5JFTA 2Q5LA 3ANXA 5B2ZA 4EHLA 1SVKA 5HZGA 1EK2A 1X6VA 3MJFA 1CR6A 4JBLA 1AMUA 2VYNA 4YUYA 5LP6B 1JR4A 4K03A 5CB4F 3WGJA 5K3OA 3CUTA 1WZ2A 2PR2A 2J48A 3UBTA 2P6RA 1FZTA 2BEUA 4OQZA 5C7LO 1CQPA 1DBRA 2XPCA 2DBZA 3S4YA 2ZI5A 4C2UA 3OZUA 1RLOA 3EVBA 2O19A 1B3RA 2QNRA 4GOOD 1B00A 1XO1A 5JIBA 4EQ6B 5LBIA 2FEMA 2BI7A 5DEOA 1ZVVA 1SNYA 4JUBA 3L01A 5AVQA 3IFSA 1WWKA 4O4JA 1NVUQ 3WIDA 2UUBB 3SEAA 2ZLBA 3HHPA 4TTVA 3W2IA 4XVCA 4CV3A 1B8OA 4QOHA 2RKBA 2QRVB 1SA0A 3O03A 1E7RA 3MJTA 3L41A 3HBMA 3UKOA 4M6WB 3EC1A 1MKYA 2PS1A 3MELA 2WKSA 1KY5A 2GPBA 3KR2A 1JHUA 3HXKA 3O2JA 4BO0A 5JC1A 3DCYA 2EYQA 5LN1A 2FSGA 1XB2A 4MR7B 3EK2A 4FMDB 4QDXA 2OC4A 5BOSA 2P5YA 2IH5A 5HK9A 1VRWA 2KLBA 2XT0A 3DEJA 3GWZA 1ZCAA 3WNDA 4GR4A 4JNKA 5KQRA 1GYRA 5F7JA 4WH0A 5CXQA 4AJJA 1PR6A 3WDKA 1OHHD 4CDGA 2QDXA 2VT3A 4WY5A 3Q2KA 2IYAA 3F6CA 5JALA 6NULA 4AZ3B 5CURA 3PX2A 3AMVA 1Z83A 4LJ8A 3AJRA 3R9XA 3M33A 5L3SA 4AMUA 4JLJA 5AUNB 4K9RA 5JEEA 4X8HA 1SIWA 2V1UA 4GHWA 5A0VA 1JAIA 1KDVA 4YJHA 3F7OA 2GAFA 4YROA 2ORIA 4RF4A 4XQ0A 2OQVA 5A1JA 1QTNA 2OD9A 4XUEA 2EKDA 1OJLA 3SS8A 4IEIA 2WNHA 4H