4YG3A

Structural basis of glycan recognition in neonate-specific rotaviruses
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
163
structure length
163
Chain Sequence
b'GSLDGPYAPDSSNLPSNCWYLVNPSNDGVVFSVTDNSTFWMFTYLVLPNTAQTNVTVNVMNETVNISIDNSGSTYRFVDYIKTSSTQAYGSRNYLNTAHRLQAYRRDGDGNISNYWGADTQGDLRVGTYSNPVPNAVINLNADFYVIPDSQQETCTEYIRGGL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Outer capsid protein VP4
publication title Structural basis of glycan specificity in neonate-specific bovine-human reassortant rotavirus.
pubmed doi rcsb
source organism Rotavirus a
molecule tags Viral protein
total genus 31
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00426 VP4_haemagglut Outer Capsid protein VP4 (Hemagglutinin) Concanavalin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yg3A00
2UWBA 4H55A 4Y1VA 4YZ2A 1W6NB 4DS0A 5JOYA 3OJBA 1W6NA 3AXDA 4LBLA 4Z8BA 2EXJA 1MS1A 3WZ1A 1AXKA 2A3YA 2P3KA 3O12A 2OW4A 1FX5A 1N47A 2UWCA 3OYWB 4FPFA 1SLIA 1GANA 5BYNA 3OYWA 1IS5A 2D6MA 1KJRA 1MVQA 4JCKA 1HLCA 1LHNA 1KJLA 3IN9A 4Y24A 1CQ9A 3VKMA 1LODA 4XE9A 2EALA 1RINA 3V65A 3WDXA 2DTYA 1Z0HA 2PHUA 4UW5A 3VUOA 5DUXA 3QLQA 1N3QA 2A71A 2WQZC 4FQ4A 1G9BA 1OKQA 1GV9A 4WVVA 4Y1ZA 5GZFA 2ZBJA 1A78A 3WG3A 3WLUA 4FPEA 1VLNA 1CPMA 1BQPA 1PZ7A 2ZHNA 2VW2A 1Q8QA 2WSVA 2NZ9A 1F5FA 3DUIA 5CB7A 4WV8A 4PQ9A 4KBBA 4YM3A 5JDBA 2NMNA 3N7MA 3T1LA 5IK8A 3SH4A 4LBJA 2ZGRA 3D4KA 4XHBA 2NM1A 1G9CA 1WW4A 1W0PA 4YG3A 4XOGA 2JJ6A 2D3RA 2VY0A 1W0OA 2ZABA 1FATA 2LALA 5GLVA 2VUAA 2P34A 3T2TA 3WG1A 1AX2A 4YZ1A 2A6WA 4AGVA 1UN1A 2C9AA 1R1ZA 4YLZA 1G9AA 2E53A 3PVEA 4M01A 3R4UA 2UURA 1AJOA 4PBPA 1WW5A 5F5QA 3A0KA 1DHKB 2AUYA 3AP6A 3M3EA 4R9CA 2NMOA 2VH9A 1FAYA 3O0WA 1LOBA 1AX0A 3AP9A 5DG1A 3WG2A 2A75A 4XJAA 4P9WA 4DFSA 1N3PA 3O0XA 5AVAA 4LBNA 1S0BA 4FPLA 1LHUA 2JE9A 3UL2A 1Q8VA 2JDZA 1FNYA 1AX1A 2FHRA 2VW1A 2VW0A 3B9CA 3V0AB 3B3QE 3GNEA 4WZFA 4NOTA 3ZYRA 1V00A 5GM0A 3SITA 3IMNA 5DG2A 2ZGQA 3N36A 1GZWB 2A6VA 2GDFA 1F9KA 4FP2A 1GZWA 2OUHA 1QMJA 1V6JA 1SLLA 3PVOA 3NV3A 1JBCA 4AGGA 2ERFA 3KM5A 2EAKA 4Q27A 2SBAA 3AXEA 1JXNA 1LEMA 4JRAA 2ARBA 3N35A 1DQ1A 3O0VA 3ZSKA 4GWMA 1Q8OA 4U36A 4AGRA 3ATGA 1OFSA 1TEIA 3AX4A 5IK7A 2A7AA 1V6OA 5DXDA 4AVTA 3AYEA 5IK4A 2CWSA 3SISA 1G8WA 2DUQA 4XXPA 4ITCA 4FQZA 2C5DA 3INAA 1UMZA 1UZYA 2D6KA 4YGBA 1N1SA 1A8DA 2W68A 5T52A 1YI7A 1N1VA 3WCRA 1IOAA 2PHWA 4XJUA 4AYUA 4JC1A 1S0FA 4XJWA 3BTAA 3ILNA 4XJ8A 1NXD1 4PCRA 3OBTA 4ZXKA 3POYA 2YROA 4TZDA 1S0EA 1S0DA 3GALA 1DLLA 1YYNA 1WBLA 4Y1YA 1DIWA 2PHXA 1ULGA 5HCFA 5H9SA 4M3CE 4Y26A 1MS3A 2AREA 2ZGTA 3L2YA 3M3OA 1BZWA 2P37A 4Q8LA 1ULFA 4R9DA 2EF6A 1FV3A 3ZXLA 1NLSA 1Q8SA 3PVNA 4YZ5A 4Q8KA 5JMCA 4XILA 1UKGA 1H9PA 1CIWA 4LBKA 1AZDA 1JN2P 1S0JA 1AXYA 2A6YA 1KITA 5LK5A 4R9BA 5DUUA 1N3OA 1Z78A 1HQWA 4Y1UA 3RMYA 1AXZA 3FLTA 5IT6A 1G9DA 3JUUA 1MR5A 5E88A 4FVVA 2I2SA 3MEPA 1FYUA 2AGSA 3RMXA 1IS3A 1DYPA 3WNXA 2GNDA 4Q26A 1QKQA 2GNMA 2P3IA 4K1ZA 4YG6A 4BLIA 2AENA 2A5ZA 2ZGPA 1AF9A 2TEPA 3UK9A 1CESA 3N7LA 1GZCA 2A70A 4BMEA 1JW6A 1ZM1A 1IKPA 3UJOA 5GLZA 3MPPG 5GLWA 3CNAA 2YV8A 2DWRA 4DQAA 4YFZA 5FRAA 5DZEA 3NV1A 1C57A 1RITA 4Q2FA 1IKQA 4ATEA 2JKBA 1DBNA 1LHWA 1DYKA 1LJ7A 4M00A 1YXWA 4DPNA 1LU1A 4YW2A 3AK0A 4PBOA 3BIWE 3OPZA 3WHUA 4MYEA 3AJZA 3WDUA 1GBGA 1SACA 3ZXEA 3ZSMA 4YGCA 5DZGA 2WNEA 4YM0A 2PHTA 2WT2A 1YRZA 3Q9OA 3SH5A 3RSJA 3AFKA 1WW6A 3IPVB 4ASMB 3IPVA 3N7KA 3RG0A 3VV1A 1GSLA 2D7FA 2R49A 2A3XA 5EXOA 4AVVA 4BPZA 2DUOA 3POWA 2GALA 3AZZA 2ZGKA 4AVSA 3ZSJA 2YZ4A 3B00A 2DVDA 1SBFA 4XBQA 1UZZA 2ZAAA 4DRRA 5F9TA 2A3WA 2CWMA 4YW1A 2V5YA 4DRVA 2ZMNA 4HANA 1CPNA 2W39A 1FNZA 3AP4A 2PHFA 4I30A 4C1WA 5HCAA 5IK5A 2DYCA 1LGCA 1WUVA 4XBLA 1D0HA 3SNMA 3NV4A 2R1DA 3WDVA 1WLDA 4UW3A 3AYDA 1DQ0A 3ZYPA 2BQPA 3W58A 1C1FA 1I3HA 3RS6A 2NN8A 5GZDA 3V0AA 3ZPYA 1JOJA 1WBFA 3WUDA 1S0CA 2A6XA 2CNAA 4XDQA 1KRIA 1HDKA 1IS4A 1CONA 4K1YA 3ENRA 4U2AA 2D6NA 5GLUA 1MS9A 1SLBA 2Q5TA 4FPOB 1A3KA 3OY8B 3OY8A 4K21A 1JUIA 1SBDA 1CJPA 4FPJA 1GNZA 2GN3A 3KQRA 5H9PA 4ZKTB 4UW4A 3SH3A 1LGBA 3POSA 3HMYA 4BMBA 1ULCA 1WD4A 4XMAA 4GKYA 1G86A 2E6VA 4XBNA 4YM1A 3DGTA 1MZ5A 2CTVA 1WD3A 1DZQA 2ZHKA 1H30A 1LHVA 2OUJA 1N1YA 2P2KA 3RQ0A 3HN1A 1PZ8A 4XZPA 5DUVA 1YIFA 1W6MB 2CL2A 5GZEA 4XIKA 4F83A 1ZA4A 5JOZA 1W6MA 2ZACA 2FMDA 5E8AA 1WLWA 2EIGA 2RHPA 3C2UA 1KDMA 4GWNA 2D44A 2DTWA 1RIRA 2YXSA 2GN7A 3WHTA 3O5SA 1DFQA 3M1HA 1LEDA 1Y7BA 4FOWA 4D69A 3ZVXA 1APNA 3ZXKA 5DZFA 2PHRA 1GICA 1QGLA 2DUPA 3N7JA 2WSUA 1MS4A 4Y20B 1O4YA 3ILRA 4XYXA 1QF3A 5CA6A 2D6OX 2W08A 1WCSA 2HYKA 1QDOA 4M3CB 4YW4A 4FPKA 1UL9A 4RA0A 4UW6A 2GMMA 4M3CA 3WG4A 2ZA9A 2E7TA 5T54A 2GMEA 1LESA 1ENQA 3QCWA 3V0BB 5EYYA 3V0BA 1LENA 1CN1A 4XHXA 5CAZA 1I1EA 4CZSA 4XXAA 1HKDA 2CY6A 4FOYA 4YZ4A 2YMZA 1GKBA 3VKNA 3WDTA 3M3CA 4HL0A 3VKLA 1LCLA 2ZGUA 3AYAA 3SLIA 3WCSA 3OGGA 1LOAA 2ZMKA 4BOWA 1LU2A 1U0AA 5KXDA 1X50A 2H0BA 4YGEA 4YFWA 5T5JA 4BLJA 3PMEA 4Q1PA 4NO4A 1V6MA 2JE7A 5H9QA 4OZXA 2WJSA 3B69A 3RRDA 2R0FA 1V6KA 2ZZJA 3WDYA 4YGDA 4YW3A 1DQ2A 1S0GA 5GZGA 5CBLA 2WLQA 5EYXA 1GZ9A 3W59A 3WUCA 1AJKA 2CYFA 2ZKNA 4ISRA 1MS5A 3I4IA 3FUQA 5CNAA 5KXCA 3BOPA 2GNTA 5GZCA 1W6PB 2ZGOA 1VIWB 4FPGA 3FFZA 2ENRA 4XJ9A 1B09A 4AWDA 1W6PA 2ZGSA 2R0HA 1V6NA 1MS8A 1LHOA 1W6OB 2B7YA 4PF5A 1QOSA 4XIOA 2D3SA 1W6OA 3LSEA 1JYCA 1PZ9A 2JD4A 1VAVA 3ASIA 1H9WA 2PELA 4LBOA 2W52A 4ISQA 4BM8A 3WDWA 2YY1A 5T5OA 1UAIA 4Q1RA 1XQNA 1JYIA 1S0IA 5T50A 1MS0A 4CRQA 2AR6A 3M3QA 5T55A 1LOGA 1CR7A 4ATFA 4CTEA 5IUQA 2EXIA 3OBRA 4GXLA 5SV8A 1W6QB 2SLIA 4P14A 3U4XA 1ULDA 1W6QA 2AYHA 1N1TA 5JLVA 1SLCA 5T5PA 1BXHA 3IM0A 1SLTA 3PJQA 1D2SA 2UU8A 3AZWA 5JOXA 3MW3A 2D6LX 2UWAA 2ZGNA 1MVEA 1SCRA 5EWSA 1DQ5A 1ONAA 1C1LA 4FPCA 3A0NA 1LOEA 2AH2A 2ARXA 2Z42A 2OVUA 3UJQA 4YZ3A 1LTEA 1G9FA 1LULA 4XMIA 2ZGLA 3ZSLA 1MZ6A 2ZHLA 2E51A 4TYSA 5HCBA 3N3HA 4P9YA 2WKKA 4FPYA 4YG0A 2DVFA 1QNWA 4SLIA 1Q8PA 1GYKA 3A4UA 2ES3A 3R05A 3M2MA 5JOWA 1DGLA 1LOFA 3BODA 2DVAA 1YO8A 2G4IA 4GKXA 3H0OA 1WW7A 3FLRA 4FPHA 2KM2A 1MACA 1Q56A 5E89A 4FOVA 5GALA 2ZMLA 3IKWA 2EXKA 1GNHA 4M3CF 2ZHMA 3AZVA 2DURA 3D6EA 3ZXFA 1ULEA 1WLCA 1BYHA 3AP5A 3I8TA 1UPSA 1SBEA 5KXEA 3WVJA 3FBYA 3TAYA 1ENRA 1LOFC 2DU0A 4BQ1A 4P9XA 5T5LA 4C1XA 5FREA 4FP3A 2DV9A 3USUB 1VAMA 1DQ4A 1SFYA 1EPWA 2DVGA 2EXHA 3NWKA 3USUA 1IS6A 4R9AA 2WT0A 3AP7A 5KXBA 3AYCA 1OQ1A 2D6PA 3NV2A 2R1BA 3AJYA 3B01A 1J1TA 2GMPA 4K20A 4LBMA 1CVNA 1QOTA 2XB6C 1QOOA 3APBA 1BJQA 1LGNA 1QNYA 2LTNA 1HQLA 2E7QA 1UX6A 1V6IA 2DU1A 4XTPA 4YM2A 3JU9A 2DVBA 3LCPA 3AZYA 4GA9A 5H9RA 2NP0A 3WV6A 3ILFA 3HR9A 1S1AA 4XJZA 4Y20A 4LBQD 4W65A 4FOQA 1KQRA 1C4RA 5DUWA 2JECA 4RL7A 1BKZA 3MW4A 1SLAA 2WT1A 2D43A 4GALA 1ENSA 4LBQB 2R16A 4LBQA 3TB0A 3V64A 3T1MA 3LSDA 3AZXA 4L8QA 1G7YA 3MW2A 4XTMA 3VKFC 5GJ6A 5GLTA 1AVBA 2VU9A 3FUOA 3R4SA 1GLHA 3ZXJA 4Y22B 1LOCA 4WVWA 4YW5A 2GNBA 4Y22A 1DQ6A 1SCSA 2P3JA 1O4ZA 4Y1XA 1F31A 3WOGA 2ZGMA 1URXA 3FLPA 2V73A 4IQPA 2A6ZA 1KDKA 1VALA 2D3PA 2XG3A 5JVVA 1JHNA 3VKOA 2VXRA 5L73A 1QDCA 2NYYA 1FV2A 1V6LA 1LECA 3D5OA 1QU0A
chains in the Genus database with same CATH superfamily
5FQ0B 5FO7B 3VBHC 5CG9A 4YVSB 1W6NB 2VXJA 3KT1A 4DS0A 5I91A 2WZPP 1TMF2 2P3KA 1YFUA 2Y6LA 3KV9A 1BMV1 4FPFA 4AW7A 3N9QA 2JXAA 3B5LB 1Z7S2 2OPKA 4XF1A 4JCKA 2NQYA 3IN9A 4UBGA 3VKMA 2ZTNA 2EALA 1VP6A 1J83A 1VRH3 2Y34A 4RQPB 5FJKA 4AE2A 3WDXA 2DTYA 2PHUA 3G7DA 5FLJA 3VUOA 2CAUA 2IFRA 1AR61 3K48A 3OSDA 4WM7B 1N3QA 2A71A 2WQZC 4FQ4A 1VMHA 1OKQA 2XDVA 4HPKA 4D6RA 2JB4A 5K9YA 2Y6FA 2Y8KA 5D2AA 1TE1B 4Q4W3 2LUWA 3VDDB 2HWD2 5F37A 1YUDA 3EJKA 3B7MA 1V9U2 1XB9A 1ZRIA 2BNOA 4PI0A 3QBQA 3I3QA 1WZXA 4KBBA 3T2PA 4YM3A 1ST8A 1ZYBA 3T1LA 4I0WB 4XHBA 1TG7A 3VZNA 3GZTB 3RYPA 1G9CA 1DGWX 4DINB 3JD72 4PIZA 1ZBE3 5BNNA 1NX9A 4EJRA 1W0OA 3N9MA 5IYYA 2LALA 4CSWA 3PIJA 5FOJB 2VUAA 4CP9B 3AL6A 3H7YA 1UYZA 3GF6A 4KI5M 3WG1A 4AQ2A 5JSRA 4MGKE 2A6WA 3IDEA 1W2NA 3QOPA 3SQOA 4AGVA 1QJU2 3MICA 1CWPA 2BERA 1R1ZA 2W1SA 1PVC3 2XHNA 2VTXA 1BCXA 2BWCA 1ZBA1 2UURA 5FP3A 5FXVA 4PBPA 2YC0A 3BOWA 3ZIWA 5BNNC 3A0KA 5FZLA 4R9CA 2NMOA 1JHJA 3SKVA 2WS91 4LHKA 2QNKA 2W46A 4IEYA 4CCKA 1DGRN 4BJ0A 4XFHA 1C8M2 1IPJA 2UY9A 4XJAA 1VBA3 1ZZ6A 4P9WA 4Z07A 3C3VA 4DFSA 4UOJA 1LHUA 4HETA 4E4DX 4CVUA 4QQ2A 5ANQA 1Q8VA 4RFT0 2VW0A 4URTA 1VBB2 2R7EB 4QX3A 3V0AB 2YU2A 3U4SA 1RVF3 4WZFA 5F6LB 2QQMA 2WN3A 2B8MA 4NOTA 3UT0A 1Q5OA 1V00A 1TME1 5KC6A 1HV1A 2Y6GA 2ZGQA 5J36A 4BQYA 2YFZA 5IVJA 3JQWA 1GZWA 1PMJX 3H3ZA 2RS32 4CCEA 4CDUA 1SLLA 4LIUA 5IFTA 2K46A 2ERFA 1YFWA 4K9SA 3VZLA 5FZIA 3SKJE 1LEMA 4IEZA 4JRAA 4CEYA 3N35A 5K8SA 2XJQA 1BK0A 3RZHA 1AR82 1BBT3 3PL0A 3WNPA 4CDWB 2YU1A 3SCGA 2RE9A 4CDUC 5JXJA 1A8MA 2HKXA 2A7AA 1V6OA 3CHXA 5DXDA 2XVKA 2PAEA 3AYEA 3NJYA 2FZ2A 2BTVC 3KT7A 2W92A 1TNRA 3ZFFA 2ZEZA 1JU3A 1PO11 4PDWA 3PJYA 4CEYC 2XVGA 1N1SA 5J96B 1H6XA 1NY72 3DN7A 3KV5A 1YI7A 2X5IB 1N1VA 2VO5A 1OLME 2YB7A 4FXKB 5FZKA 1R1A2 2YG0A 2PAKA 2R073 3ZXGA 4AHYA 4C91A 1QJX3 4JC1A 2G19A 3JCIA 5DABA 3POYA 3ZFFC 1DLLA 4PDWC 2TBVA 3LD8A 1YYNA 4WVMB 2IXCA 4AFCA 4QQPA 1AYN3 1NQDA 2KA3A 3MIHA 2FCVA 5J98B 4M3CE 4Z1VA 3OEAA 3ZR5A 2ZGTA 1BVVA 4R9DA 2P37A 4Q8LA 5F3GA 1ULFA 1UX7A 3PVNA 1UZ0A 3MBWA 3ZLIA 5CKQA 2VMIA 1DLCA 1L7LA 1PNFA 4YZ5A 5JMCA 4BH9A 5CG8A 4LBKA 1AZDA 3VBRB 4O9GA 4CYDA 3MYXA 4OI0A 4Y1UA 4ZU5A 1O59A 2RMU2 1US3A 2DF7A 1G9DA 2E7AA 4QHOA 4NUBA 1OPMA 2KXLA 4FFFA 4QPGB 4QX2A 3MEPA 5E88A 4AFBA 4B4PA 1IS3A 1LKNA 1TVGA 2Z5WA 4TWTA 1IQDC 1GP5A 1RJ8A 4BLIA 1B35B 4AVCA 5F1RA 2P6HA 2A5ZA 2ZGPA 4LOTA 2GSYA 1CESA 3NRUA 1VBC2 1EP0A 1JS9A 1Q3EA 2IUWA 3CDZB 5JI7A 4IUGA 3SCHA 1RUF2 3UJOA 2XONA 3J8F1 4DEVA 5KBFA 4XDOA 3H8OA 1H1IA 2ZXQA 1C57A 3O1MA 4ATEA 4N43B 4M00A 4LT5A 4C0HA 4DPNA 1LU1A 2PXJA 3AK0A 3HIFA 3P1IA 2WYFA 4LXLA 3WHUA 1YFYA 4HXCA 2ZS6B 4KG0A 1YWKA 1S2EA 3ZXEA 1X8MA 2KD7A 2OPWA 1ND2B 4LNVA 4A7YA 2WNEA 4YM0A 4MOAA 3NJXA 4IEVA 3Q9OA 4UF0B 4Z82A 1WW6A 1AR91 4NN0A 4ASMB 2QTWB 1ZA7A 4WM8B 3IPVA 3WY6A 3L2HA 2R49A 4BPZA 2K0GA 3VZJA 1K3IA 4CU7A 3DEMA 5K0UA 1HB3A 1UWWA 1O5LA 3ZSJA 2HBUA 4AVSA 3KHCA 3IT8A 1QEXA 2DVDA 1SBFA 4FTEA 4JDOA 4AEKA 2RS13 1UZZA 2RJLA 3E97A 2IVIB 3KWVA 4JGZA 2ORZA 5DAVA 4A3XA 2VVFA 2BJSA 2ZMNA 1K5MA 4I30A 5I8TA 3SMHA 5C7GA 1QQP3 1C28A 1RUD3 1RUH2 4ARXA 5K0UC 2DYCA 2ZX2A 2ZX0A 1WUVA 5FZ8A 1SDDB 3CEWA 3WF3A 3RWNA 2CSGA 3H3LA 2Z4FA 3AYDA 2OX0A 1KGYA 2OIIA 4JGZC 4AQTA 4FI9A 3HPNA 2Q8DA 3ZO0B 1W06A 1K5MC 2VCBA 5IVEA 5A33A 1JOJA 1GZTA 1RUG1 1AUYA 1T6GC 1TME2 4XFCA 4AVAA 1XE8A 3E6DA 3I2HA 5LEJA 1KRIA 1CONA 5GLUA 5JI9A 1ND3B 2D6NA 4FPOB 2HWC3 3ZYJB 5LY2A 2LM3A 5DAXA 5A1LA 2IWGB 5FZ3A 5C3QA 3MIEA 5LA2A 4QMAA 4AEDB 4AI9A 3PHMA 5EIYB 1SQ4A 3ST7A 3POSA 3HBZA 4Z92B 4COYA 3HMYA 1ULCA 5J1XA 4GKYA 1EUTA 1G86A 3QACA 2BGPA 3JXSA 3P3NA 2BBAA 4XF0A 1WD3A 3CMGA 2ZHKA 2OUJA 3OG2A 2P2KA 2JENA 1W2AX 4XZPA 1POV0 3VD5A 4AI3A 4E8DA 5DUVA 3WF1A 2CL2A 1OBNA 1W90A 2W94A 2VJXA 5FK8A 2Q1ZB 1HB1A 4AFAA 1RGSA 3D0JA 4GB33 5FMDA 5EP9A 5C4WB 3C2UA 1KDMA 1UCXA 1OHFA 1NOVA 2JDKA 1DG6A 2GN7A 3AC0A 1SDWA 1LEDA 1Y7BA 1W9TA 2AACA 2RVAA 2HWF3 1APNA 1GMMA 1CX4A 1CIYA 3I59A 4FOWA 5DZFA 3ZXKA 5AC91 1GICA 1QGLA 2DUPA 2Q1MA 4CCJA 4CUGA 3OGJA 4Y20B 4XYXA 5JZGB 5JXHA 1QF3A 1CX1A 1YEWA 2GP3A 4IW3A 5JXGA 3IDBB 1QDOA 4M3CB 1XBFA 4NHYA 3MFAA 5FP9A 1UL9A 4Y4RA 2E7TA 5T54A 5BNOA 5FY4A 2XGXA 3C7HA 5FZ6A 2AC1A 3N9NA 5FZ7A 5FZEA 4BDVB 1CN1A 1US2A 2WLPA 4XHXA 2GH8A 2CAVA 2EIDA 1RYYA 2R071 3UGGA 3PIGA 5LK7B 3GZAA 3K4DA 5M0TA 3CL1A 3WCSA 2JKXA 3I3EA 4AVBA 1LOAA 4AG4A 1U0AA 3AMMA 4FFGA 4HSJA 3VLBB 4YGEA 3WW3A 2VBBA 2RM23 1OMIA 4P9LA 2PAMA 2WIIB 3BYWA 4BLJA 3GBWA 2ZX3A 1V6MA 5H9QA 4OZXA 2WJSA 5C9AA 3B69A 5EV7A 1OT5A 2ZZJA 4Q0SA 5E1RA 3ZX7A 1ZZCA 1GFF2 3KZ4C 1KD7A 4LPLA 1H8VA 2ET1A 5GZGA 2DCTA 2WLQA 1HRI3 1WGPA 4D7TA 1QJFA 1EAH3 5BY5A 2DFCA 4O7XA 1H1AA 2W2IA 3WUCA 3W5MA 1WCDJ 3FUQA 1V9U3 3AKPA 2GNTA 5GZCA 1YHFA 1W6PB 1VIWB 5C9AC 1JMUB 2ENRA 1RUI3 2VZ1A 1MS8A 1W6OB 2XWJB 4Q4Y3 4OYUA 4ZS2A 1LB2A 1AR92 1VAVA 3KGLA 2XKOA 5CYYA 1VRH2 3ZDSA 4ISQA 4DUVA 2BDRA 3CKHA 3DXUA 4Q1RA 5CIRA 5FCCA 4NVPA 4LUKA 2J7MA 4N8MA 1HW5A 1JODA 1W8NA 2P6CA 1UU6A 4K3UA 4FO9A 4H7LA 2XLAA 2VZSA 3M3QA 4KG8A 1CR7A 1LOGA 3RGBA 4ATFA 2XBO1 1OUSA 2VQAA 4MXWB 1ASJ1 3WNMA 4GXLA 5IJRA 3N4MA 2LROA 3CBNA 4QU2A 5FV3A 4IEQA 5GKAC 2Q8EA 1GQPA 2AYHA 2YBSA 5ABJB 1SLCA 5T5PA 1PVXA 3T2QA 5FO8B 1SLTA 2QQOA 2WR9A 3PJQA 3SEPA 4QKDA 4UFHA 1RTVA 1ZBE2 3ZFEA 3EB7A 2JDMA 4R4ZA 1H4HA 3MW3A 4CEWB 4IERA 5EWSA 4QXCA 1UYXA 3H8XA 1W8UA 2ARXA 1OOPA 5HBAA 2NLRA 4BB3A 1VBB3 4XMIA 1RHI1 4TYSA 3BKZA 3LIHA 1Y9QA 1W9SA 3FE5A 4CUCA 1ULPA 4FPYA 3F95A 1PK6B 3K4ZA 2Y60A 1GNYA 3N9PA 4W6XA 4EZHA 2BYVE 1HXS1 5JXIA 3ORJA 3ZFEC 2EVXA 4KGQA 4XQWA 3R05A 3B02A 2RS33 4O61A 3BODA 3A23A 1NE6A 1VRBA 1OOPC 5FP4A 4D94A 4I3PA 3ACIA 1O8PA 5A70A 3FLRA 5C8WA 1MACA 4DY5A 5E89A 1QIQA 3IKWA 3RI9A 1GNHA 5JCTA 1XNCA 4QDQA 3D6EA 5E16A 1CAXB 1WLCA 1BYHA 4NHKA 2WWJA 1SBEA 5KXEA 3WVJA 2EIBA 2QVSB 5D8AA 3ZN5A 4ARYA 4HKLA 4IGPA 2ZEXA 2YC4A 5T5LA 4YNIA 4LR4A 2VULA 4N53B 3PTRB 1ZZ9A 1EPWA 2EXHA 4FSJA 1O91A 1REDA 2W1QA 4Q0QA 4R9AA 2Q8OA 1WA4A 3H42B 4PLMA 1OQ1A 2D6PA 3B01A 3ZM8A 3DYPA 1J1TA 2AZ5A 2GMPA 2EIEA 1QOTA 5D8AC 1UMIA 1X33A 1BJQA 2H0VA 1UPIA 2BFUS 2BV4A 1HQLA 1UX6A 1V6IA 4YM2A 3TN93 3AZYA 4GA9A 5AC92 4NIAA 3KVAA 1RUJ3 3M3IA 1Y9MA 1S1AA 3PUQA 2XVLA 4MG2A 2A1XA 4IEUA 4EZ4A 5I0SA 1MQTB 4FOQA 5DUWA 2XLGA 4RL7A 3KSCA 4H14A 4TN7A 2DCJA 4DUWA 1UU4A 2WO2A 5LA1A 2WT1A 5JR2A 3NO8A 3LOBA 1AL21 4LBQB 2R16A 3V64A 4CP0A 4L8QA 5FZOB 1G7YA 1UOFA 3DPRA 3ETPA 4XTMA 2R072 5GJ6A 3R4SA 1GLHA 3DXTA 2WN2A 3KHBA 4Y4YA 4OFGA 1EUUA 2BEOA 4XUPA 1O4ZA 3IDAA 3WOGA 3DPRC 1NLQA 4L92A 4XETA 5BNOB 5JVVA 2OKXA 4A42A 4CDXB 4DXSA 1QDCA 2QQVA 2JG9B 1D4M3 1FV2A 1YQ8A 3TRSB 1AR63 3NKGA 3D5OA 3I3MA 2UWBA 2VCCA 4G3YC 4H55A 2F17A 4YZ2A 4LK6A 1Q43A 5FQ0A 5FYVA 4AL9A 1EYBA 1W6NA 4Z8BA 1MS1A 3HQXA 4F8AA 2OW4A 2UWCA 1X7NA 2XJPA 3OYWB 4COWA 3K46A 4QQOA 3VD4A 1DYOA 1AHSA 2RM21 4RD7A 4Y24A 2BUKA 4RHV1 1UZWA 1LODA 3NSTA 1CZVA 1QJEA 2I07B 2Q1FA 1JZ3A 3GBFA 1D2QA 1Z0HA 1YIPA 2Q4SA 4RQPA 4UW5A 4MLOA 2YBPA 4K40A 1OH4A 5APAA 4A3ZA 2QDNA 4TTGA 4TSVA 1G9BA 4WM7A 1OA3A 2IVJA 1HRI1 4FPEA 4XUTA 1EAH1 2VNRA 3KF3A 4OMCA 1PZ7A 2ZHNA 4GZ9A 4UBHA 1ASJ2 2TUNA 2VW2A 5KWRA 3DL3A 3VDDA 4HLTA 4IE7A 1UYYA 4IESA 5DAQA 4EN7B 1YQCA 1ZBA3 1NA1B 3NJZA 2ADDA 3PMSA 4R4XA 4RQPC 4EWDA 5IK8A 2WS93 2J22A 2ZGRA 4N90A 1PHMA 1WLTA 2NM1A 3AB0A 4Q4Y1 4WM7C 3BTXA 1W0PA 4YG3A 2WDBA 1ACCA 2JJ6A 2WQ4A 2D3RA 2ZABA 1JZ5A 4HVRA 5GLVA 4CCCA 3VDDC 5IHRA 1ZRCA 2P34A 3BGAA 5K7PA 4QX7A 3T2TA 1ZRDA 1P8JA 3H8UA 1RHI2 2RV9A 4XUQA 4AI2A 4CP9A 4YVWB 1UN1A 3ZOIA 2RS12 4YLZA 3GCWA 4P02B 4XAAA 3MIGA 1HXS2 4M01A 4Q4V1 5FMOS 3BIEA 1AJOA 5F5QA 4QB6A 1HJGA 2RDRA 3S57A 1HJFA 3I97A 4XFFA 3O0WA 5EZWA 1F4HA 1XNKA 1QQP2 1AX0A 1RUD2 2EAAA 3AP9A 4OI4A 5DG1A 1HB2A 3WG2A 5F3CA 2ETEA 5FPUA 5CZKA 2JDZA 2FHRA 1AX1A 2VW1A 3JBG1 1W9WA 2HYXA 4BXSV 3UKVA 1VE0A 2CV6A 2J1TA 1VJ2A 3ZN6B 1KS5A 2VM9A 1X8EA 3IWZA 3IMNA 3W21A 3KS7A 1IG3A 1F9KA 3DCQA 3NQHA 2HWC2 1PO13 3HJRA 3LGRA 3PNAA 4AI0A 1J3PA 1PGSA 1NE4A 2CDPA 2EAKA 4Q27A 4CUAA 2SBAA 1OPOA 3KV4A 4IV3A 5FZ9A 2ARBA 3ZSKA 4GWMA 1FMD3 3AVSA 2FDJA 4JDMA 4U36A 5FYYA 2J1VA 3GXUA 2D40A 3JB8A 4DIQA 1TEIA 5IK7A 4A41A 2BVVA 4AVTA 3GM8A 2XJUA 1CAWB 5LA9A 5FY5A 2J1UA 2QQNA 5IK4A 2JE8A 1GU3A 2CWSA 2W91A 3PUIA 4IE6A 4IV3C 3VBOB 4A2UA 5LCWL 4FQZA 5LBFA 1UMZA 2W68A 1XSQA 3U0ZA 4NHLA 2IXLA 4LLFA 3WCRA 3ZKYA 1IOAA 5F5IA 2FDKA 2X5IA 4PT6A 4NPMA 3LE0A 2CGOA 4D8MA 2JDAA 3RYKA 2KR2A 3TN91 3WEZA 1F2NA 2HWF2 1JH5A 3TEZA 4A6SA 2QDRA 1RXFA 2VZUA 2IC1A 1WBLA 3LAGA 1DIWA 1PM4A 5FLHA 2VMHA 2OA2A 4Y26A 1MS3A 2AREA 2B46X 2X5IC 2XR4A 3M3OA 4P9GA 4AI1A 1FV3A 2VUCA 1NLSA 1Q8SA 3ZYGA 1EV11 3J8F3 4X8PA 3VDBA 1UKGA 1H0BA 2XUEA 5FYTA 4DXZA 1GR3A 2A6YA 1JN2P 3HOBA 4HFSA 4R9BA 4PIYA 3VBRA 4CXXA 4A7KA 3A7QA 3E5QA 1XPWA 2Q0AA 2HBTA 4FVVA 4AQ6A 2I2SA 3GJBA 4HK9A 4QX0A 3M70A 2PHLA 4QPGA 4NPRA 1DYPA 1KXGA 1UD1A 4QWNA 2C0ZA 1K42A 1W99A 2UY8A 4LLOA 4K1ZA 1ZZ7A 4MGQA 4A44A 2RM22 4RHV2 2YHJA 2TEPA 3N7LA 1GZCA 1OSGA 1AR93 3VBRC 1ZM1A 1IKPA 1H2MA 3MLJA 5GLZA 3MPPG 4YFZA 3TWIA 4QB2A 5FRAA 1D4M1 1PGW1 5A7WB 4QPGC 4IV1B 3TNPB 1UYPA 1DBNA 5FP7A 1DYKA 1HRI2 3OB8A 1EAH2 4N43A 3POFA 3O7OA 4YW2A 2JX9A 3LDKA 3NKTA 1OUXA 4KNCA 2VL4A 4MYEA 3I2FA 3POGA 4LA2A 1GBGA 1COV1 2W95A 1ZVFA 5FZ0A 4YGCA 1RUI2 2VZPA 4Q4Y2 4PHZA 1WCUA 2YGLA 4S2GA 5DMYA 3NMBA 3SH5A 2D5HA 3RSJA 4MV2A 4UF0A 5DN2A 4N43C 3UYJA 3Q8AA 4WM8A 4PIXA 2A3XA 1E57A 2YFUA 2K2SA 4N7IA 4XZUG 2CHHA 3GHNA 1YLLA 1MEC1 1RUG3 4CCOA 4NROA 4W6WA 1UY0A 4NHMA 2V09A 3Q8EA 4Q4V2 3KCYA 2V4AA 4ZONA 3NAPB 2V5YA 4WM8C 1CPNA 3BVCA 3OGSA 4QX8A 2ILMA 1W3VA 2W1WA 4C1WA 2VR4A 4LO8A 5HCAA 4D6QA 5I0DA 4JV4A 3SNMA 4QT6A 1T2XA 3WDVA 5J37A 1EPZA 1WA6X 2RS53 1E5RA 2VOKA 3ZYPA 2QBXA 5FBJA 5FWEA 3M4FA 1I3HA 4LOSA 3W58A 5LA0A 1XRUA 5EPAA 1PX3A 2NN8A 5GZDA 2AEYA 3WW4A 1L3JA 1WBFA 4MUVA 4RSUA 3UGFA 3WUDA 2CNAA 1NXMA 3ENRA 3GDBA 4U2AA 4DEQA 1MS9A 3OY8B 4IL7A 4ET7A 2QQKA 5C5UA 2B5HA 3MZHA 3AMQA 1GNZA 2ARAA 4AEDA 2GN3A 1W39A 3SXWA 3IAQA 2BGOA 4NPLA 1WWYA 2E6VA 4MGIE 4XCBA 4YM1A 3ZN4A 2B42B 5AC93 2WC2A 3DGTA 4CDQA 3ZFGA 2CTVA 1Y4WA 4NIDA 1SPPB 1NG0A 4JVAA 3POEA 3RQ0A 1OQEA 4AEDC 3ABZA 3KF5A 3ZR6A 2VZRA 1W6MB 4RFRB 2ZKLA 5JOZA 3WF2A 2VBPA 4QPIA 5E8AA 2FMDA 4XPVA 3POJA 3VZKA 2RHPA 3K3OA 1D7PM 4CDQC 1QHDA 4MHRA 3ZFGC 5C4WA 1RIRA 5FJHA 5L36A 3TN92 1QH7A 1FMD1 1U5ZA 4NWVA 5IVBA 2B39A 3CQOA 4Z2AA 2J42A 4FFHA 1RUJ2 4QPIC 4XUOA 1JI6A 3I49A 1OI6A 3PUAA 5JZGA 1I9RA 2PMWB 2W08A 4HT1T 1DGRA 4OCTA 2ET7A 4YW4A 5C4WC 3H3UA 4RA0A 4M3CA 3VBSA 4QM9A 2LS6A 5EHDA 4LE4A 3WNNA 1LESA 1ENQA 4UFLA 4LQRA 4IETA 1ODMA 3FMGA 1CAUB 1XE7A 1LENA 3P6BA 2X05A 3WR0A 4CZSA 3OUIA 2WFF3 2YMZA 4ONUA 3NW4A 5JZGC 1GKBA 3VKNA 3M3CA 4HL0A 3O14A 1LCLA 2ZGUA 5F6KA 3AM2A 3VBSC 4GH4B 4BQWA 1BMV2 2ZMKA 1LU2A 1ZZBA 4L9BA 4EE2A 4R8HA 5A6YA 3UNPA 4YFWA 5T5JA 4Y5TA 4QXBA 1A34A 3PMEA 4LKEA 5EJ1B 4GMP0 4NO4A 4FTBA 1O6UA 4DMIA 4LKSA 4CU8A 3WQ1A 1HB4A 2C1FA 1D4M2 4TLGA 4YW3A 1SG3A 1AR62 3U10A 1S0GA 3GZEA 4Q0PA 4XQ4A 5CBLA 1F35A 2QZ3A 4D69A 2TNFA 5EYXA 4EROA 3QH6A 2CYFA 5FZCA 2XBO3 4FAGA 5KXCA 1ASJ3 5CNAA 4OHWA 3BOPA 4BE3A 5I8YA 4AWDA 1LR5A 1COV2 5A7NA 1W6PA 3HNYM 1IPSA 2R0HA 3FHQA 1SEFA 5A7SA 4QD2A 2B7YA 5DAWA 5A1FA 4PF5A 5BPXA 3RJ2X 1W6OA 3DF0A 5G04L 5A3OA 4CXYA 3P5BA 1R081 3J7NA 5C3PA 5T5OA 4HPKB 3LEKA 3LF7A 1XXNA 3NJVA 5T50A 1RHI3 1MEC2 2AR6A 3QH7A 5F39A 3NNMA 5FBZA 1RUOA 4LULA 4CTEA 3DKWA 2RDNA 5I0UA 3T0AA 1HXS3 2XL9A 4MXWA 5SV8A 1ZBA2 2SLIA 2G9FA 1O7FA 4ORFA 4JGYA 2DBNA 4YSFA 3EXUA 5JLVA 1BXHA 3IM0A 5ABJA 2WS92 1AYM1 2E9QA 4QB1A 1A6CA 1D2SA 4AOCA 1JUHA 3THPA 3POBA 3W5NA 4P9JA 4IE5A 3LEIA 2D6LX 2XH6A 1MVEA 1W2UA 4UI9L 4AFMA 1ONAA 4CEWA 1F8VA 1C1LA 4S2DA 4CCMA 4IE4A 4YZ3A 1UKRA 3OBZA 2ZGLA 2ARCA 2VMCA 4JGYC 1PIV3 1FXZA 2E51A 5FLIA 5HCBA 4LMFA 3RZMA 2PA7A 5A32B 5ABJC 2WKKA 1TZOA 1YJKA 1X82A 4XFBA 2DVFA 5ACA1 1PK6A 4Q4X1 4SLIA 4P9IA 3OUHA 2WFPA 2RG4A 2D5FA 5JOWA 3D82A 1DGLA 1LOFA 4CEWC 2WWSA 3ON7A 4X8NA 2XLFA 2CDOA 2FQPA 4GKXA 3RPQA 1WW7A 2KM2A 2HEYF 2BNMA 3A22A 1CAVA 2RS51 3U37A 3KD4A 2ZHMA 1PK6C 1BVP1 1ULEA 1UXZA 3CJXA 2Y0IA 4COZA 1CAXA 4S2HA 4JAAA 5F2SA 1JTZX 1LOFC 4P9XA 3ZYIB 3CJIA 4DXTA 4FP3A 1GOFA 2DV9A 3USUB 3ZKUA 5FY8A 1JZ6A 1OD3A 2HWE1 1PO12 2DVGA 3ACHA 1AL23 3EMRA 1IS6A 4MVTA 4N53A 4OHZA 5A3MA 1C5HA 5A1AA 3HT2A 3AYCA 4K8RB 4NHXA 4NRPA 4DZGA 2CU5A 3FC0A 4TLFA 2Z69A 4LBMA 1CVNA 1QOOA 3APBA 2XKPA 3S7EA 3CJIC 3MGUA 1C5IA 1FMD2 4XTPA 1RUC1 5FZMA 2DVBA 3LCPA 3LFIA 5A7PA 1U5XA 3WW2A 4AFDA 3ACFA 4N53C 5AFBA 3B9IA 4M0HA 3HR9A 1LRHA 5HV0A 2XXZA 4XABA 4NIHA 2I45A 5DDJ1 1C4RA 2VZQA 2VNVA 1OH3A 4OULA 5LATA 4QPYA 1ENSA 5CVRA 4E27A 2GAUA 4IE0A 4LBQA 3TB0A 3MLLA 2B45X 1OA2A 4A6OA 5FZOA 4L11A 1AVBA 3FUOA 2ZPXA 4YPJA 5KHGA 4XF3A 5F3EA 2DDUA 3A21A 4QX1A 4QXHA 4YARA 4Y22B 1LOCA 3IZOA 2PQQA 3MUZ1 1CZTA 1JZ4A 2GC3A 4XFAA 3MIBA 1QXRA 3WX5A 1UQXA 4UFMA 4EQVA 1ALYA 4Y1XA 3TOJA 5JAXA 2BVBA 2ZGMA 5L7OB 2VCAA 4RHV3 1U5YA 2X10A 3PUSA 1OURA 2V73A 2PLV1 4OI1A 4B3NA 2VMDA 2A6ZA 2LRPA 3VKOA 3MV11 3J8F2 3VZOA 4CDXA 4Q5OA 1CJDA 1W8OA 2JG9A 3C7FA 3I2OA 3WNLA 3ZIXA 4BA6A 3T08A 2WFF1 5JOYA 4OVEA 3FFQA 3OF1A 5FZAA 3WZ1A 2A3YA 3LQCA 3PVBB 1FX5A 3AMHA 3LA3A 1GANA 5BYNA 3OYWA 2VTFA 5IVCA 1PO21 1IS5A 4BK4A 4CDXC 3OGRA 1PMIA 2JG9C 1MVQA 2O8OA 1LHNA 1POQA 4MX3A 4ZZ5A 3O1TA 1CQ9A 2IXJA 3K2OA 1RMU1 3HBKA 2J1RA 2XQXA 3PDQA 3V65A 4EYUA 2D97A 5LB6A 5C70A 2ZX1A 5A3NA 1DGWA 3VDCA 5DUXA 4LA3A 4XC9A 2VAUA 4NR1A 1GV9A 3WLUA 1W9YA 2RJ2A 4LJHA 1A78A 3WG3A 1VLNA 2CGPA 1YFXA 1CPMA 3VGIA 2P3YA 2XHKA 1UOGA 1W03A 5JR7B 4E2SA 1Q8QA 3DUIA 4W6YA 5CB7A 4Q4V3 3LEGA 2VZVA 3WT3A 3AL5A 3AKQA 1NA1A 2Y0OA 2V72A 3AKTA 4QM8A 3AMNA 5KHKA 4NIGA 4XFIA 2C26A 4RGGA 2OQ7A 3IMMA 4LKFA 4LE3A 4XOGA 3ZYBA 2VY0A 4COUA 2GP5A 1FATA 3JBG3 4ZU4A 4CXWA 1H2NA 2V4VA 5FXZA 5FY9A 1SMVA 4YZ1A 1NA1C 1E5HA 2C9AA 2HH9A 1RUG2 2FDHA 4KBZA 2E53A 5ACA2 3PVEA 2RJKA 4Q4X2 5A3UA 4BHPA 3LEMA 1WKYA 2G1MA 3S6PA 1WW5A 3ETQA 2OYZA 2W9XA 2XMLA 3AP6A 5LWBA 4NRMA 1Y43B 1LOBA 2YGMA 1JZ2A 2YPDA 1XYOA 1OF4A 2A75A 2VOWA 4NAMA 5A7OA 3UV9A 2VZTA 2RS52 3O0XA 4LBNA 1S0BA 5A3LA 3LPGA 5I0TA 3W9AA 1FNYA 3H7JA 1NCQB 2Y33A 3B9CA 3VZMA 5C8CA 1LAJA 3B3QE 1JYTA 3I2KA 5HI0A 1PIV1 1SZBA 1H6YA 2YBKA 3ZYRA 4MO3M 3ZN6A 1OQDA 1M4WA 3LDBA 2A6VA 2XUMA 3N36A 4CP1A 4JKLA 3JQXA 1V6JA 5A3PA 2F4LA 3PVOA 4IEOA 2V5DA 2MNGA 3NV3A 2E31A 2MEV1 2RDQA 3EHKA 3J7HA 4J25A 3T4VA 4AGGA 5C8CC 1UY1A 4P08A 1IGOA 5CKMA 1JXNA 4N9IA 4PQQA 4CCNA 4ZU7A 1DQ1A 3H1YA 1ULOA 2Y38A 1RUC2 1XSRA 1Q8OA 2GH2A 4AGRA 4WZCA 4KL1A 4WVZA 1YNAA 5C71A 3ATGA 2YC2A 3EYPA 3LA2A 1OFSA 3RVHA 3WNKA 3O1OA 5DDJ2 2WAAA 4JZRA 2E26A 3RDIA 2E32A 4CP2A 4YWAA 3SISA 4E4HA 2AEZA 1G8WA 2DUQA 4XXPA 4ITCA 4B7EA 5FKBA 3INAA 3VBOA 1UZYA 1Y3TA 2D6KA 3GGLA 1EV13 3UETA 1A8DA 4LITA 4FT8A 3ZPOA 2PHWA 4JHZA 1POV3 4XJUA 4BXFA 1J59A 3DYOA 5J09A 4MGYE 2HEVF 1VBE3 2XJRA 4UXAA 4XF9A 4AYUA 1S0FA 4N7UA 4XJWA 4XJ8A 3I3BA 2Y6JA 1NXD1 5EFUA 1H1MA 3HEIA 4ZXKA 4D6SA 3MFCA 5IFPA 3S0MA 5IVVA 3VBOC 2QJVA 4ZPIA 1W2TA 3ZYHA 4Y1YA 3Q8FA 2WNUB 1GWLA 4I2OA 1ULGA 3ROUA 5H9SA 1NCRB 5KR7A 1NUKA 3L2YA 2VOXA 4LORA 5F3IA 4IDZA 5AVAA 5H9RA 1OLQA 3R6SA 3WSOA 2EF6A 3ZXLA 3THCA 3GBGA 4ES9A 4Q8KA 4AF9A 1J58A 4XILA 4AXOA 1C8NA 3HAGA 2BWAA 5FPAA 2OQ6A 4JKKA 1AXYA 1KITA 5FPZA 5BUVA 5JUVA 1Z78A 1HQWA 2WFF2 3RMYA 1AXZA 3FLTA 4AEJA 5IT6A 3O1RA 3JUUA 5L19A 4YVSA 5JPMB 2WA3A 3E6BA 3RMXA 3RNSA 2G9GA 2XJSA 3FWEA 3RZLA 1XNDA 3THTA 4HVOA 1COV3 2GNDA 1QKQA 4B4RA 4YG6A 4LHNA 5A6XA 2YPJA 5ANNA 1AF9A 2E33A 4QKNA 1VB4A 2A70A 1XYNA 1RMU2 1ZNPA 5B4XA 1H8TB 1O8SA 2DCKA 3CNAA 2YV8A 4YVSC 5DZEA 3NV1A 1IQAA 1RITA 4BU2A 1O5UA 3KCCA 3RZGA 2VTXJ 3KGZA 4Q2FA 1IKQA 4XACA 4CCLA 2JIGA 1LHWA 4IV1A 3FX3A 1LJ7A 1YXWA 1MEC3 4G9SB 4AEMA 4RR3B 1S4CA 1H2LA 3CIHA 1XU1A 2XBO2 4PBOA 1TMF1 2JIJA 3KB5A 4QQLA 4M0NA 3AJZA 5I8SA 5FZGA 1SACA 2BPA2 1UW8A 4OHXA 3ZSMA 4D7SA 5DZGA 1CZSA 1Z7S1 1F15A 2WT2A 5FYHA 5FYZA 5CKNA 1YRZA 2VUDA 3N9OA 3VD9A 5A6ZA 4IV1C 3M7AA 2ZAHA 1RUE1 3N7KA 4LTAA 5HV4A 3RZJA 3VV1A 2X53S 2D7FA 3WQ7A 5EXOA 2DUOA 2J1AA 2GALA 2WZ8A 3AZZA 4PJYA 5A6QA 3LDRA 3MUY1 4GMP1 3IDCB 5EQUA 2J1EA 1PNGA 4W50A 5FKCA 2HWD1 3WQ0A 4DRRA 2A73B 5F9TA 4CUBA 1O3RA 4LKDA 2A3WA 5FZFA 3FJSA 4O65A 1PGL1 4IGQA 4YW1A 4KWKA 3FBMA 4XUNA 1ENXA 2O0OA 3U1XA 1CD3G 4BZ4A 2QKDA 2QQPA 3U78A 1JYNA 3NV4A 2R1DA 4B7KA 3LB9A 1WLDA 4UW3A 1DQ0A 3EQEA 4JHTA 1QXJA 1PIV2 3V0AA 1QJU1 1BEV3 3MPBA 2A6XA 2JWPA 1BLZA 2QFEA 2Q5TA 1SLBA 4PF1A 1A3KA 3KVBA 1DCSA 3ELNA 2WNVB 3MIDA 1S55A 3OY8A 4QGMA 1OF3A 1SBDA 2MEV2 1CJPA 2VPVA 4IXLA 2QQUA 4RGKA 5FMCA 3KQRA 2ADEA 5H9PA 4MXVA 2JDPA 4UW4A 5FY0A 1FOD1 1BHGA 3SH3A 4QU1A 4BMBA 1IPKA 4XMAA 3SCFA 4XBNA 5LY1A 2VOVA 5EJZB 4AZZA 4RS5B 1YI9A 4QKBA 2WAOA 4X6QB 3QD6A 4CDWA 1H30A 4FCAA 3ZMOA 3VHRA 4KU8A 1AL22 2P1BA 4F83A 1W8HA 2R32A 1ZA4A 3VBFB 1W6MA 5FY1A 4QHZA 2BOJA 1WLWA 2BP6A 2EIGA 2WUHA 3LZZA 5L9VA 4AHWA 4D3WA 3T0DA 2OS2A 2DTWA 1UIKA 4XF4A 3TYJA 4CDWC 3WHTA 3O5SA 5CFCB 3M1HA 5KC5A 1UXXX 3JZVA 3S30A 1ZX5A 1U5IA 5IAXA 1KEXA 3N7JA 4E8CA 2D6OX 4WVMA 3VBUB 1O3QA 4NJ4A 5FY7A 4XEZA 3ZXAC 1DZRA 3D0SA 2B4KA 3MDPA 3OTFA 4GWJA 5L9RA 4R52A 1XOYA 4UW6A 2GMMA 4TXWA 2ZA9A 4JX0A 5FWJA 3CO2A 2GMEA 3QCWA 3DPRB 2MPFA 3B94A 3G6JB 3ZSEA 1RJ7A 1YCIA 5EYYA 5I0RA 3OBAA 2K9ZA 3V0BB 1POV1 1CAUA 2PHDA 4HN0A 1OXCA 4XXAA 1I1EA 1HKDA 5C5TA 1VBE1 4YZ4A 1QJZA 4FFIA 1S2KA 2O14A 4QQHA 3WXPA 4P5YA 3WP3A 3PLQA 3K77A 1UNBA 3VKLA 4URAA 3RZZA 3SLIA 1W28A 1LNSA 1GOGA 2R061 4AR2A 4BOWA 4GH4A 5KXDA 5FPLA 1X50A 2VC9A 5C3RA 3PURA 2IFWA 2IXKA 2QQJA 3CF6E 5FZ1A 4XAEA 3T09A 1O3SA 1B35A 1IHMA 2VMFA 4BISA 4B4QA 4WBBA 4F3JA 3RFRA 1F5JA 1R083 1WMXA 2VNGA 5JIAA 3ACGA 2R0FA 3RRDA 1V6KA 4ES8A 3WDYA 3ALQA 5LZ6A 3NNLA 2WO3A 1U12A 4JQTA 5CADA 5DPNA 4GH4C 4AHZA 2RMU1 5IVFA 1GZ9A 3W59A 5AFEA 4Y3OA 5FYIA 2UYAA 4OZOA 1AJKA 2ZKNA 1B35C 4YYOA 3SC7X 3VHOA 5FUIA 1HRV1 4C90A 1IZ3A 2ZGOA 1NZCA 3FFZA 3U07A 1HN0A 1B09A 1SFPA 2ZGSA 1O4TA 4FXGB 5HCHA 1V6NA 1LHOA 1ND2A 1QOSA 3I3DA 1AYM3 2WABA 2D98A 4JDNA 5CEHA 1JYCA 2Y6HA 1PZ9A 1VBC1 1RUE2 2JG8B 1H9WA 2JDNA 1RUF1 3P3PA 2W52A 2VG9A 4KWUA 2YY1A 3EBRA 1UAIA 5F7UA 1JYIA 2VVDA 1W8ZA 5C33A 2JDUA 4PI2A 5CFDB 1JZ8A 1K45A 3S5AA 2QZ2A 4CRQA 5T55A 5A3WA 1ND2C 3KMHA 1YJLA 4M4PA 5ACA3 4HG6B 4LHLA 4Q4X3 1PGL2 2O8QA 3N9LA 1W6QB 4P14A 3U75A 3U4XA 1ULDA 2EA7A 3IIIA 4YRDA 4AAPA 3U11A 2UU8A 2X29A 1W2OA 1R093 1GP4A 2W47A 2UWAA 1SCRA 1DQ5A 4Q0UA 4FPCA 3A0NA 2Z42A 2AH2A 3JBG2 3OOXA 3UJQA 1OA4A 1G9FA 2WO7A 3ZSLA 1MZ6A 2ZHLA 4XCAA 5JIUA 5ISLA 4P9YA 3I2DA 5A32A 5AVPA 5JMOA 5FUPA 1Q8PA 4LK7A 4LO5B 2ES3A 2HWE3 1ZREA 1ND3A 4JQRA 2DVAA 4V2VA 1J1LA 1WMFA 1RUH1 2G4IA 1HN1A 3TBDA 4OI2A 5F5AA 1WMEA 1FOD2 1Q56A 4CCDA 4SBVA 1AL0G 2PFWA 2BRTA 3KQ4B 2EXKA 4M3CF 1F4AA 3WP6A 2DURA 1RUC3 2ATFA 4BYYA 3AP5A 4Y5SA 3I8TA 1NKGA 1UPSA 3OEBA 1ND3C 3TAYA 1REFA 1E5SA 2X09A 5FXXA 4CPBD 1W8WA 4UFKA 1BEV1 1YQ2A 1QXPA 5LW9A 5DDJ3 3LIGA 1STMA 4C1XA 5FREA 1G6NA 5I93A 1VAMA 2VE1A 3OPTA 1YQ6A 5KXBA 3USUA 3NWKA 4I02A 1L7RA 2HWB1 2WT0A 2VQ0A 3AP7A 4KGGA 3PU8A 3W20A 3WINE 4B1MA 5FO9B 3NV2A 4OHYA 4V2WA 4RGAA 5BNPB 1W05A 4IV3B 2VNOA 4K20A 3I7DA 2XB6C 3BB6A 5A7QA 4KWLA 1LGNA 1OLMA 4I0AA 2LTNA 2E7QA 2GU9A 2DU1A 4AHXA 1W04A 2NP0A 4EWAA 2QQLA 5TSWA 3ILFA 3X29B 4QAWA 4CU6A 4XJZA 5KHJA 4INDA 5CU1A 4Y20A 3WP4A 2L9LA 2P17A 4QXKA 2JECA 3MV01 4A7ZA 2BW8A 3ZXDA 1REEA 1SLAA 2PLV3 2IXHA 2D43A 2VQUA 3KLSA 4GALA 3T2OA 5CISA 1EV12 5JWPA 3T1MA 2VECA 1XU2A 3OUJA 4NAOA 4F7ZA 2VGDA 2BU9A 4KMQA 3VKFC 1VBE2 4D0QA 3U14A 4B29A 1QY4A 4XW3A 2E63A 2OZ6A 2WL1A 4Q29A 4WVWA 2GNBA 3J4UH 4Y22A 3VBHB 1SCSA 2R062 2P3JA 2WA4A 1NAEA 4GQ7A 3AKSA 3BU0A 3O1PA 1UIJA 1PO23 4MADA 1VBD1 4BIFA 3OD0A 1QJY3 3LFMA 1K12A 2OZJA 1L7QA 3D8CA 1UU5A 3JB4C 3HWJA 4IQPA 3L9JT 5L7OA 1RMU3 3LPFA 1KDKA 1VALA 5F5CA 2B9UA 2VXRA 5L73A 2NYYA 1ODNA 1I5ZA 2WZR1 1PGW2 1V6LA 3WQBA 1LECA 5IVYA 3ZXJA 2QCSB 3UESA 3RZKA 4Y1VA 5FPVA 3OJBA 3AXDA 4LBLA 3OPWA 4LO7A 3ZYFA 2EXJA 4PLOA 2XQRA 4J1XA 1AXKA 3R0RA 4S2FA 3O12A 1VR3A 2W87A 1HRV2 1N47A 1W3XA 2WNOA 1GUIA 1SLIA 2VD7A 2XOMA 3H50A 2BNNA 3UKTA 2DCYA 2D6MA 1ZZ8A 4A45A 4AK3A 1KJRA 1W9FA 1HLCA 1MZEA 1KJLA 4E4SA 2UYBA 3HN3A 3POIA 4XE9A 3T3YA 1RINA 3RJRA 3WW1A 4MGSA 1UOBA 4K8FA 2FCTA 3ZMNA 3CU7A 3QLQA 1ZRFA 3K51A 1XE0A 2RR13 3H1WA 4WVVA 4Y1ZA 2ZBJA 5FXWA 5D1IA 5GZFA 2XL7A 3C7OA 4M4RA 4A4AA 5BNQA 1BQPA 3LWCA 2R6QA 2WSVA 2NZ9A 1F5FA 2XWBB 3HQRA 3WP5A 4FAHA 4WV8A 4PQ9A 3BCWA 1VPHA 5JDBA 2NMNA 3N7MA 3VHNA 2P4EA 3SH4A 4LBJA 2FMYA 1JOBA 1SFNA 3D4KA 4KQ7A 5BNNB 1FT9A 1WW4A 2FDGA 1VRH1 3AVRA 3E5UA 2IZWA 4CA9A 1X9TA 2VMGA 4N9HA 1AX2A 4HONA 2FDIA 5J3UA 2OT7A 4Q4W1 1MPXA 5IATA 4EN6B 1G9AA 1XNAA 4GJZA 2R043 1GWKA 2Y64A 3R4UA 4UYBA 4W4ZA 4HBNA 4YW7A 3E6CC 1HIXA 1DHKB 2AUYA 3M3EA 3ME2A 4GD4A 4IEPA 4OQ9A 2VH9A 1FAYA 1W8FA 4LHSA 5FAXA 2GC0A 1FPN3 2MEV3 4Q0VA 1ZBE1 4HKWA 1WCQA 3TEYA 1MZFA 1R091 4ASKA 1N3PA 2ZX4A 4DXRA 3K3NA 4FPLA 2JE9A 3UL2A 3H8RA 3D3AA 2QUOA 5L7OC 4OHVA 3GNEA 1NCQA 4LIVA 1TNFA 3IIAA 1BEV2 4E4ZA 2FCUA 2C6SA 3SITA 4QGNA 5GM0A 2JDYA 5DG2A 1PVC1 1RXGA 1GZWB 3LA7A 5FDBA 2GDFA 4KH9A 3GYDA 4FP2A 2OUHA 4CDUB 5JPNB 1QMJA 2HWB2 2QQIA 2F6BA 1JBCA 3ES1A 3KM5A 4NWWA 5JSPA 1NCQC 2ORXA 2ZCWA 2JD9A 3R4DB 4CEYB 1QWRA 1DDLA 1VBA1 3AXEA 4HVQA 4XURA 2VBDA 3O0VA 4E2GA 4CDQB 3ZFGB 3C8XA 4FTSA 1AR73 4UFJA 5FZ4A 1RVF1 3WF0A 3GZUC 3AX4A 1UMHA 2HJIA 5B2GB 4IGOA 3NNJA 3M8LA 4E9KA 3ZFFB 4BCUA 4PDWB 1MQTA 4UAPA 3LKJA 4YGDA 4IEXA 4QPIB 3MHZA 2C5DA 4YGBA 1WMDA 5F2WA 4ZS3A 1T6BX 5FZHA 5T52A 1GWMA 3MF9A 4B8EA 4C8DA 4DY3A 1KS4A 1PX4A 2DBIA 2LW8A 5KHIA 2BBVA 4FBFA 2VZ3A 3UGHA 1NT0A 4RN5A 1JYWA 1DZTA 3BTAA 2Q30A 3ILNA 3J7LA 4PCRA 3OBTA 3T30A 1MQTC 2YROA 3THDA 1BBT1 1S0DA 1S0EA 3GALA 4BQ4A 2H6CA 4TZDA 2VCMA 2WYSA 3MF6A 3C7EA 2PYTA 3VL9A 2PHXA 3RYRA 1VBD2 5HCFA 2WNUA 3AKRA 3VBSB 2WBKA 3FN9A 1BZWA 1NCRA 3BI3A 4EN9B 5J48A 2VVEA 3HNMA 5SV5A 1X36A 3GCXA 4XDPA 4ASLA 4C0BA 1OC1A 1E5IA 1UY2A 2GC1A 3IAPA 4QHBA 2WZR2 4Y5Z0 1H9PA 5A80A 3WD5A 1CIWA 5LK5A 1S0JA 5LBCA 2ZZQA 1V70A 3I2IA 5DUUA 1N3OA 1WCKA 1QJX1 3J7MA 1MR5A 2WNUC 4OQ8A 4YW6A 3LOIA 1NCRC 4GWIA 1FYUA 1TMF3 2AGSA 3J26N 3VHPA 4BK5A 4JKMA 5BXXA 3SHRA 3WNXA 1ZRRA 1GOHA 2DCZA 2P3IA 2GNMA 4Q26A 5FPBA 5FYSA 1AYN1 5BNOC 1Z7S3 2AENA 1QJY1 3HQUA 4QPWA 4UT5A 1BK1A 4XQDA 5C3OA 4CE8A 3UK9A 1H4GA 2GZWA 3E1F1 4XVHA 3B93A 4BMEA 1UOJA 1JW6A 1R082 1RUE3 3VL8A 5GLWA 4DQAA 2DWRA 1H8TA 3KV6A 5FFOC 4MZUA 1M06G 2ZJCA 1S2BA 3I2GA 2JKBA 4GMP3 5IWFA 4QGLA 2WWUA 4I3GA 3UKNA 1OD5A 1NLRA 1XJAA 2HWD3 4MGZE 3BIWE 3OPZA 4RR3A 4BQXA 2FBEA 1RC6A 2W1UA 2X8KA 4P5HA 3WDUA 2VQTA 1H8TC 1CGPA 2YYOA 2WQ8A 2PHTA 1AYM2 5FK7A 5C6CA 3AFKA 3IPVB 3JD73 3BUCA 3RG0A 4ZXEA 3FHIB 2QE3A 1GSLA 3FHAA 4AVVA 4RR3C 5K0UB 3POWA 1OVPA 4MH0E 2ZGKA 2RR11 2Y26A 2YZ4A 1GQGA 3B00A 3BN6A 5FPXA 1OVSA 1SHWB 1QJU3 2OXBA 4Q4W2 4XBQA 4JGZB 4JTOA 5IW0A 4YVWA 2ZAAA 1EY2A 4K7JA 4JGYB 2PQSA 4DOUA 2CWMA 4EWEA 1K5MB 3BU7A 1C3HA 4DRVA 4HANA 1I5PA 2W39A 1FNZA 3AP4A 2PHFA 3RWKX 3GHMA 2XPJA 1YC61 3H1MA 1C8M3 2YUEA 1LGCA 3KT4A 2Q8CA 4XBLA 3MIFA 1D0HA 5IK5A 5F32A 1R092 3TEWA 1FOD3 2WZEA 4YVWC 3C7GA 5LBEA 2VZOA 1JOPA 2XJVA 3K4AA 4PLNA 2BQPA 1C1FA 4I09A 1DP0A 5HXMA 3RS6A 1RUNA 4H7MA 5A33B 2RS11 3ZPYA 2J1SA 1Y9GA 1S0CA 1PVC2 4BQ5A 3VN4A 4GULA 2R041 1HDKA 1IS4A 4K1YA 4XDQA 4DB5A 5FYMA 2HWE2 3OD4A 5KHHA 5FMBA 4K21A 3O1VA 4J6GA 1JUIA 2WNVA 1D4VB 1OFNA 4FPJA 1FPN1 1JU4A 1QQP1 1RUD1 4QDSA 5FIXA 3KCXA 5DQ0A 4ZKTB 1CAVB 1VBA2 1LGBA 1WD4A 3IBMA 5L9BA 4L2NA 2WRAA 4QX5A 4XFGA 1AR83 4RS5A 1RVF2 1MZ5A 2JDHA 3CJIB 3VD3A 3BTYA 1YQ5A 1DZQA 4JTNA 5FP8A 3USSA 1LHVA 2WNVC 2PN5A 1N1YA 4MSVA 3SEEA 5C3SA 4ZHNA 3BPZA 3HN1A 2HEWF 1PZ8A 4W8JA 1CAWA 4CPBA 1HV0A 2HLEA 3MI8A 2HWC1 5FYBA 1YIFA 1FI2A 2D93A 3DV8A 2B9VA 4B1LA 5GZEA 4XIKA 5LBBA 2ZACA 3VBFA 3IB3A 2EICA 4I0BA 2BFUL 4HMZA 4GWNA 4RS5C 1R1A3 1HQNA 2D44A 2YXSA 3EO6A 1DFQA 3F2ZA 3I59B 1HX6A 4GIQA 3ZVXA 4Z2WA 5CFCA 1BBT2 2PHRA 2FZ1A 1AR71 3J9SA 4LO6B 1PMHX 4BWOA 1J3RA 2R063 1MS4A 2WSUA 3GJAA 1O4YA 3ILRA 4LEJA 5CA6A 3VBFC 4GJYA 1JZ7A 1WCSA 3VBUA 1XNBA 2HYKA 5T3NA 4FPKA 2PLV2 3WG4A 4DUXA 5HPOA 1DF0A 5CFCC 4GB31 1J84A 4OLLA 3V0BA 5CAZA 1DU3D 4FOYA 2CY6A 1VMJA 1QJX2 2RMU3 2Y6KA 4IEWA 5BV6A 3VBUC 3WDTA 5FUNA 4OUMA 1XNTA 2HWF1 3AYAA 3OGGA 1O3TA 1HRV3 1OKOA 4L0PA 3TEXA 4DNYA 3NL1A 1AYN2 1PO22 2H0BA 2R30A 1QJY2 3K75B 2NPIA 4BQ3A 2C24A 5LRRA 2JICA 4EV0A 4K6BA 4Q1PA 5C9AB 1VBC3 5F8PA 2JE7A 2WO1A 1RUF3 1GP6A 3HD8B 2DFBA 3ES4A 1DQ2A 1NYWA 2ZEWA 5A7WA 4H3WA 5FOBB 4ISRA 3VDAA 5K4LA 1MS5A 3I4IA 2RDSA 2O1QA 5FR3A 5D21A 4UFIA 3S5QA 4H2AA 4FPGA 2P5BA 4KWJA 4XJ9A 2I74A 5FZBA 3I54A 4XIOA 2D3SA 2JB8A 3LSEA 5G05L 3Q8BA 2JD4A 3DKQA 1X9PA 3ASIA 4QKFA 4BIOA 1W0NA 2PELA 4LBOA 1VB2A 2JG8A 4BM8A 3WDWA 2YDEA 2Z79A 4G4FA 1RB8G 1XQNA 1QH6A 2RR12 1S0IA 4OMDA 1UF2C 2QQWA 1MS0A 5CFDA 3NNFA 5IAVA 2Z2SB 4EN8B 5IUQA 2EXIA 3CLPA 1V9U1 3OBRA 4E2QA 3E5XA 5DAPA 2N7GA 4L97A 3ZDVA 4I01A 2JG8C 1R64A 1W6QA 4ZZ8A 1N1TA 2H6BA 3ACLA 1RUI1 3DECA 3NAPA 4KU7A 5A3TA 3ZFEB 1RUH3 1TQ5A 3JD71 3AZWA 5JOXA 5CFDC 4MGTA 2ZGNA 4NIIA 1OOPB 5J7MA 5LRSA 1LOEA 3BALA 2OVUA 3H9AA 1LTEA 1LULA 4EN0A 4DO0A 3N3HA 1W8TA 5FMOL 3NAPC 1RL3A 1TME3 4YG0A 1JYVA 1I6XA 1QNWA 2R042 1V0AA 3PTYA 5HXVA 2W5FA 1GYKA 2W3JA 3A4UA 1K5JA 2MHFA 3M2MA 4OUSA 2HWB3 3ECQA 1FPN2 1YO8A 2ZEYA 1C8M1 2F4PA 4MHUA 3H0OA 4FPHA 4L99A 4ZY9A 5B4NA 5LASA 4FOVA 2CGNA 1KFUL 1GQHA 2ZMLA 5FTTC 5GALA 4X6RB 3VD7A 3AZVA 5C8CB 3ZXFA 3BPSA 1VBB1 3TNQA 4LUMA 3NVCA 5D8AB 2VUJA 3FBYA 3OCPA 1ENRA 2DU0A 4OUEA 5FYUA 4BQ1A 4NE9A 4JRLA 4D7YA 3RI8A 1SPPA 4HOOA 1DQ4A 1UY3A 1SFYA 4J1WA 2RS31 4HK8A 4HKOA 3T0BA 2BGCA 2C9KA 1UY4A 2R1BA 2ZOEB 3AJYA 3I2JA 3HT1A 3V56A 3O1UA 2IXIA 3WNOA 5BNPA 3MLKA 4AAXA 1UO9A 1QNYA 3S7IA 3URFA 1VAKA 4NRQA 3JU9A 1XYPA 4NMIA 5LEKA 5E6HA 1AR81 3MO4A 3O1SA 1AR72 3FL7A 3WV6A 2ID4A 3DYMA 1J3QA 5JSOA 1VBD3 4LBQD 3NNGA 4W65A 1KQRA 1NZIA 4P00B 4Y33A 5BNPC 1BKZA 1D0GA 3HNBM 1H2KA 3MW4A 1IG0A 4COVA 2C4XA 1XC6A 2VOTA 4HSLA 4BQ2A 1JYXA 2W0XA 1UZVA 4GAZA 1NY71 3LSDA 4HZFA 4GB32 2WZR3 3AFGA 3AZXA 3MW2A 4AQSA 1R1A1 2JEMA 5GLTA 3PUHA 3T4HB 1NQJA 2VU9A 3OGVA 2G9ZA 2GC2A 3HVDA 3Q8CA 2FD8A 4YW5A 3WF4A 3CZUA 3CZJA 4V1PA 4UWDA 2WINB 3VB9A 1DQ6A 1RUJ1 3FZ3A 4HN1A 3VBHA 1VMFA 1OLRA 3AMPA 4LO4B 1F31A 3BTZA 2FDFA 4RYDA 3ITQA 1KFXL 4CU9A 1URXA 3FLPA 4O9EA 2XJTA 1PM7A 2BOIA 3PU3A 2BZDA 2D3PA 4AI8A 2XG3A 4META 5FZDA 5FYCA 1JHNA 2PTMA 5EJ3A 5ERLA 4QDRA 2VMEA 1QU0A
chains in the Genus database with same CATH topology
5FQ0B 5FO7B 3VBHC 5CG9A 4YVSB 1W6NB 3KT1A 4DS0A 5I91A 2WZPP 1TMF2 2P3KA 1YFUA 1BMV1 4FPFA 4AW7A 2JXAA 3B5LB 1Z7S2 2OPKA 4XF1A 4JCKA 2NQYA 3IN9A 4UBGA 3VKMA 2ZTNA 2EALA 1VP6A 1VRH3 4RQPB 4AE2A 3WDXA 2DTYA 2PHUA 3G7DA 5FLJA 3VUOA 2CAUA 2IFRA 1AR61 3K48A 4WM7B 1N3QA 2A71A 2WQZC 4FQ4A 4HPKA 1OKQA 5K9YA 1TE1B 4Q4W3 2LUWA 3VDDB 2HWD2 1YUDA 3EJKA 3B7MA 1V9U2 2BNOA 3QBQA 4KBBA 4YM3A 1ZYBA 3T1LA 4I0WB 4XHBA 3VZNA 3GZTB 3RYPA 1G9CA 1DGWX 4DINB 3JD72 4PIZA 1ZBE3 5BNNA 4EJRA 1W0OA 2LALA 2VUAA 3H7YA 4AQ2A 3GF6A 3WG1A 5JSRA 4MGKE 2A6WA 3IDEA 3QOPA 4AGVA 1QJU2 3MICA 1R1ZA 1PVC3 1BCXA 2BWCA 1ZBA1 2UURA 3ZIWA 5BNNC 4PBPA 2YC0A 3BOWA 3A0KA 4R9CA 2NMOA 2WS91 4LHKA 2QNKA 4IEYA 1DGRN 4XFHA 1C8M2 1IPJA 2UY9A 4XJAA 1VBA3 1ZZ6A 4P9WA 4Z07A 3C3VA 4DFSA 1LHUA 4HETA 4E4DX 4QQ2A 1Q8VA 4RFT0 2VW0A 4URTA 1VBB2 3V0AB 1RVF3 4WZFA 5F6LB 4NOTA 2B8MA 1Q5OA 1V00A 1TME1 5KC6A 1HV1A 2ZGQA 5J36A 3JQWA 1GZWA 3H3ZA 2RS32 4CDUA 1SLLA 2ERFA 1YFWA 4K9SA 3VZLA 1LEMA 4IEZA 4JRAA 4CEYA 3N35A 5K8SA 2XJQA 1AR82 1BBT3 4CDWB 3SCGA 2RE9A 4CDUC 1A8MA 2HKXA 2A7AA 1V6OA 5DXDA 2XVKA 2PAEA 3AYEA 2FZ2A 2BTVC 3KT7A 1TNRA 3ZFFA 1PO11 4PDWA 3PJYA 4CEYC 2XVGA 1N1SA 5J96B 1NY72 3DN7A 1YI7A 2X5IB 1N1VA 4FXKB 1R1A2 2PAKA 2R073 3ZXGA 4AHYA 4C91A 1QJX3 4JC1A 3JCIA 3POYA 3ZFFC 1DLLA 4PDWC 2TBVA 1YYNA 4WVMB 2IXCA 4AFCA 4QQPA 1AYN3 1NQDA 2KA3A 3MIHA 5J98B 4Z1VA 4M3CE 2ZGTA 1BVVA 4R9DA 2P37A 4Q8LA 1ULFA 3PVNA 2VMIA 4YZ5A 1PNFA 5JMCA 4BH9A 5CG8A 4LBKA 1AZDA 3VBRB 4O9GA 4CYDA 3MYXA 4OI0A 4Y1UA 4ZU5A 2RMU2 1G9DA 2DF7A 2E7AA 1OPMA 2KXLA 5E88A 4QPGB 4AFBA 3MEPA 4B4PA 1IS3A 1LKNA 4TWTA 2Z5WA 1RJ8A 4BLIA 1B35B 4AVCA 5F1RA 2A5ZA 2ZGPA 1CESA 2GSYA 1VBC2 1EP0A 3SCHA 1Q3EA 5JI7A 3UJOA 1RUF2 5KBFA 3J8F1 1H1IA 1C57A 4ATEA 4N43B 4M00A 4LT5A 4C0HA 4DPNA 1LU1A 3AK0A 3HIFA 3WHUA 1YFYA 2ZS6B 4KG0A 1YWKA 3ZXEA 1X8MA 4A7YA 1ND2B 4LNVA 2WNEA 4YM0A 4IEVA 3Q9OA 4Z82A 1WW6A 1AR91 4NN0A 4ASMB 4WM8B 3IPVA 3WY6A 3L2HA 2R49A 4BPZA 2K0GA 3VZJA 5K0UA 4AVSA 3ZSJA 1O5LA 4FTEA 3IT8A 2DVDA 1SBFA 4JDOA 4AEKA 2RS13 1UZZA 2RJLA 3E97A 4JGZA 4A3XA 2VVFA 2ZMNA 1K5MA 4I30A 5I8TA 3SMHA 5K0UC 1QQP3 1C28A 1RUD3 1RUH2 2DYCA 2ZX2A 2ZX0A 1WUVA 3CEWA 3RWNA 3AYDA 4JGZC 2OIIA 4AQTA 3ZO0B 1K5MC 5A33A 1JOJA 1RUG1 1T6GC 1AUYA 1TME2 4XFCA 4AVAA 1XE8A 3E6DA 5LEJA 1KRIA 1CONA 5GLUA 5JI9A 1ND3B 2D6NA 4FPOB 2HWC3 3ZYJB 2LM3A 2IWGB 3MIEA 4QMAA 4AEDB 3PHMA 1SQ4A 3ST7A 3POSA 3HBZA 4Z92B 4COYA 3HMYA 1ULCA 4GKYA 1G86A 3QACA 3P3NA 4XF0A 1WD3A 2ZHKA 2OUJA 2P2KA 2JENA 4XZPA 1POV0 4AI3A 5DUVA 2CL2A 2Q1ZB 4AFAA 1RGSA 3D0JA 4GB33 5C4WB 3C2UA 1KDMA 1UCXA 1OHFA 1NOVA 1DG6A 2GN7A 1SDWA 1LEDA 1Y7BA 4FOWA 4D69A 1APNA 2HWF3 3I59A 1CX4A 5DZFA 3ZXKA 5AC91 1GICA 1QGLA 2DUPA 2Q1MA 3OGJA 4Y20B 4XYXA 5JZGB 1QF3A 3IDBB 1QDOA 4M3CB 3MFAA 1UL9A 2E7TA 5T54A 2XGXA 1CN1A 2WLPA 4XHXA 2CAVA 2GH8A 2R071 5LK7B 3GZAA 3CL1A 3WCSA 4AVBA 1LOAA 4AG4A 1U0AA 3AMMA 4HSJA 3VLBB 4YGEA 3WW3A 2RM23 1OMIA 4P9LA 2PAMA 2WIIB 4BLJA 3GBWA 2ZX3A 1V6MA 5H9QA 4OZXA 2WJSA 5C9AA 3B69A 5EV7A 2ZZJA 4Q0SA 5E1RA 3ZX7A 1ZZCA 1GFF2 3KZ4C 1KD7A 1H8VA 2ET1A 5GZGA 2DCTA 2WLQA 1HRI3 1WGPA 4D7TA 5BY5A 1EAH3 2DFCA 3WUCA 1H1AA 1WCDJ 3FUQA 1V9U3 3AKPA 2GNTA 5GZCA 1YHFA 1W6PB 1VIWB 5C9AC 2ENRA 1RUI3 2XWJB 1MS8A 1W6OB 4Q4Y3 1LB2A 1AR92 1VAVA 3KGLA 2XKOA 1VRH2 3ZDSA 4ISQA 5FCCA 4Q1RA 5CIRA 4NVPA 4LUKA 1HW5A 1UU6A 4K3UA 4FO9A 4H7LA 2XLAA 3M3QA 4KG8A 1LOGA 1CR7A 4ATFA 2XBO1 2VQAA 4MXWB 1ASJ1 4GXLA 3N4MA 4QU2A 4IEQA 5GKAC 2AYHA 5ABJB 1SLCA 5T5PA 1PVXA 5FO8B 1SLTA 3PJQA 1RTVA 1ZBE2 3ZFEA 4R4ZA 1H4HA 3MW3A 4CEWB 4IERA 5EWSA 2ARXA 1OOPA 5HBAA 2NLRA 1VBB3 4XMIA 1RHI1 4TYSA 1Y9QA 3FE5A 4FPYA 1PK6B 4W6XA 2BYVE 1HXS1 3ZFEC 2EVXA 4KGQA 4XQWA 3R05A 3B02A 2RS33 3BODA 1NE6A 1OOPC 4D94A 4I3PA 3FLRA 5C8WA 1MACA 4DY5A 5E89A 3IKWA 3RI9A 1GNHA 5JCTA 1XNCA 3D6EA 5E16A 1CAXB 1WLCA 1BYHA 4NHKA 1SBEA 5KXEA 3WVJA 3ZN5A 2QVSB 5D8AA 4HKLA 5T5LA 4YNIA 4LR4A 2VULA 4N53B 1ZZ9A 1EPWA 2EXHA 4FSJA 1O91A 1REDA 4Q0QA 4R9AA 2Q8OA 1WA4A 4PLMA 1OQ1A 2D6PA 3B01A 1J1TA 2AZ5A 2GMPA 1QOTA 5D8AC 1X33A 1BJQA 2H0VA 1UPIA 2BFUS 1HQLA 1UX6A 1V6IA 4YM2A 3TN93 3AZYA 4GA9A 5AC92 1RUJ3 3M3IA 1S1AA 2XVLA 4IEUA 5I0SA 1MQTB 4FOQA 5DUWA 2XLGA 4RL7A 3KSCA 4H14A 2DCJA 1UU4A 2WT1A 3NO8A 3LOBA 1AL21 4LBQB 2R16A 3V64A 4CP0A 4L8QA 1G7YA 3DPRA 4XTMA 2R072 5GJ6A 3R4SA 1GLHA 4Y4YA 4OFGA 2BEOA 1O4ZA 3WOGA 3DPRC 4L92A 4XETA 5BNOB 5JVVA 4CDXB 1QDCA 2JG9B 1D4M3 1FV2A 3TRSB 1AR63 3NKGA 3D5OA 2UWBA 4H55A 4G3YC 4YZ2A 1Q43A 5FQ0A 1EYBA 1W6NA 4Z8BA 1MS1A 3HQXA 4F8AA 2OW4A 2UWCA 1X7NA 2XJPA 3OYWB 4COWA 4QQOA 1AHSA 2RM21 4RD7A 4Y24A 2BUKA 4RHV1 1LODA 3NSTA 2I07B 3GBFA 1D2QA 1Z0HA 1YIPA 2Q4SA 4RQPA 4UW5A 4MLOA 4K40A 2QDNA 4TSVA 1G9BA 4WM7A 1OA3A 4FPEA 1HRI1 1EAH1 2VNRA 1PZ7A 2ZHNA 5KWRA 4UBHA 1ASJ2 2TUNA 2VW2A 3DL3A 3VDDA 4HLTA 4EN7B 4IESA 1ZBA3 1NA1B 3NJZA 3PMSA 4R4XA 4RQPC 4EWDA 5IK8A 2WS93 2ZGRA 4N90A 4Q4Y1 1PHMA 1WLTA 2NM1A 3AB0A 4WM7C 1W0PA 4YG3A 2WQ4A 2JJ6A 2D3RA 2ZABA 4HVRA 5GLVA 3VDDC 1ZRCA 2P34A 5K7PA 3T2TA 1ZRDA 3H8UA 1RHI2 4YVWB 1UN1A 2RS12 4YLZA 3MIGA 1HXS2 4M01A 4Q4V1 5FMOS 1AJOA 5F5QA 4XFFA 3O0WA 5EZWA 1XNKA 1QQP2 1AX0A 1RUD2 2EAAA 3AP9A 4OI4A 5DG1A 3WG2A 2ETEA 2JDZA 2FHRA 1AX1A 2VW1A 3JBG1 3UKVA 2CV6A 1VJ2A 3ZN6B 1KS5A 1X8EA 3IWZA 3IMNA 3KS7A 1F9KA 2HWC2 1PO13 3LGRA 3PNAA 4AI0A 1J3PA 1PGSA 1NE4A 2EAKA 4Q27A 2SBAA 1OPOA 4IV3A 2ARBA 3ZSKA 4GWMA 1FMD3 4U36A 4JDMA 2D40A 3JB8A 1TEIA 5IK7A 2BVVA 4AVTA 2XJUA 1CAWB 5IK4A 2CWSA 3VBOB 4IV3C 4A2UA 4FQZA 1UMZA 2W68A 3U0ZA 4NHLA 2IXLA 4LLFA 3WCRA 1IOAA 2X5IA 2CGOA 3RYKA 3TN91 1F2NA 2HWF2 1JH5A 2QDRA 2IC1A 1WBLA 3LAGA 1DIWA 5FLHA 2VMHA 2OA2A 4Y26A 1MS3A 2AREA 2B46X 2X5IC 3M3OA 4P9GA 4AI1A 1FV3A 1NLSA 1Q8SA 3ZYGA 1EV11 3J8F3 4X8PA 1UKGA 1H0BA 4DXZA 1GR3A 2A6YA 1JN2P 4HFSA 4R9BA 4PIYA 3VBRA 4A7KA 3E5QA 2Q0AA 4FVVA 4AQ6A 2I2SA 4HK9A 3M70A 2PHLA 4QPGA 4NPRA 1DYPA 1KXGA 1UD1A 2C0ZA 2UY8A 4LLOA 4K1ZA 1ZZ7A 2RM22 4RHV2 2YHJA 2TEPA 3N7LA 1GZCA 1OSGA 1AR93 3VBRC 1ZM1A 1IKPA 1H2MA 3MLJA 5GLZA 3MPPG 4YFZA 3TWIA 5FRAA 1D4M1 1PGW1 4QPGC 4IV1B 3TNPB 1DBNA 1DYKA 1HRI2 4N43A 1EAH2 3O7OA 4YW2A 2JX9A 3NKTA 4KNCA 4MYEA 4LA2A 1GBGA 1COV1 1ZVFA 4YGCA 1RUI2 4Q4Y2 2YGLA 4S2GA 3SH5A 2D5HA 3RSJA 4MV2A 4N43C 4WM8A 4PIXA 2A3XA 1E57A 2K2SA 4N7IA 3GHNA 1YLLA 1MEC1 1RUG3 4W6WA 4NHMA 2V09A 4Q4V2 3KCYA 3NAPB 2V5YA 4WM8C 1CPNA 4C1WA 2ILMA 4LO8A 5HCAA 4JV4A 3SNMA 4QT6A 3WDVA 5J37A 1EPZA 2RS53 2VOKA 3ZYPA 3M4FA 1I3HA 3W58A 1XRUA 2NN8A 5GZDA 3WW4A 1L3JA 1WBFA 4MUVA 4RSUA 3WUDA 2CNAA 1NXMA 3ENRA 4U2AA 1MS9A 3OY8B 4IL7A 2B5HA 3MZHA 3AMQA 1GNZA 4AEDA 2GN3A 1W39A 3SXWA 2E6VA 4MGIE 4YM1A 3ZN4A 2B42B 5AC93 2WC2A 3DGTA 4CDQA 3ZFGA 2CTVA 1NG0A 4JVAA 3RQ0A 1OQEA 4AEDC 1W6MB 2ZKLA 5JOZA 4QPIA 5E8AA 2FMDA 4XPVA 3VZKA 2RHPA 4CDQC 1QHDA 3ZFGC 5C4WA 1RIRA 5L36A 3TN92 1QH7A 1FMD1 1U5ZA 4NWVA 2B39A 1RUJ2 4QPIC 1OI6A 5JZGA 1I9RA 2W08A 4HT1T 1DGRA 2ET7A 4YW4A 5C4WC 3H3UA 4RA0A 4M3CA 3VBSA 4QM9A 4LE4A 1LESA 1ENQA 4IETA 3FMGA 1CAUB 1XE7A 1LENA 3WR0A 4CZSA 2WFF3 2YMZA 4ONUA 3NW4A 5JZGC 1GKBA 3VKNA 3M3CA 4HL0A 3O14A 1LCLA 2ZGUA 5F6KA 3AM2A 3VBSC 4GH4B 1BMV2 2ZMKA 1LU2A 1ZZBA 4L9BA 4R8HA 4YFWA 5T5JA 3PMEA 4GMP0 4NO4A 4FTBA 4DMIA 3WQ1A 2C1FA 1D4M2 4YW3A 1AR62 3U10A 1S0GA 4Q0PA 4XQ4A 5CBLA 2QZ3A 2TNFA 5EYXA 4EROA 3QH6A 2CYFA 4FAGA 2XBO3 5KXCA 1ASJ3 5CNAA 4OHWA 3BOPA 4BE3A 5I8YA 4AWDA 1LR5A 1COV2 1W6PA 2R0HA 1SEFA 4QD2A 2B7YA 4PF5A 5BPXA 3RJ2X 1W6OA 3DF0A 1R081 5T5OA 4HPKB 1XXNA 5T50A 1RHI3 1MEC2 2AR6A 3QH7A 5FBZA 1RUOA 4LULA 4CTEA 3DKWA 5I0UA 1HXS3 2XL9A 4MXWA 5SV8A 1ZBA2 2SLIA 2G9FA 1O7FA 4ORFA 4JGYA 4YSFA 3EXUA 5JLVA 1BXHA 3IM0A 5ABJA 2WS92 1AYM1 2E9QA 1A6CA 1D2SA 1JUHA 3THPA 4P9JA 2D6LX 2XH6A 1MVEA 1W2UA 4AFMA 1ONAA 4CEWA 1F8VA 1C1LA 4S2DA 4YZ3A 1UKRA 4JGYC