4YG3A

Structural basis of glycan recognition in neonate-specific rotaviruses
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
163
structure length
163
Chain Sequence
GSLDGPYAPDSSNLPSNCWYLVNPSNDGVVFSVTDNSTFWMFTYLVLPNTAQTNVTVNVMNETVNISIDNSGSTYRFVDYIKTSSTQAYGSRNYLNTAHRLQAYRRDGDGNISNYWGADTQGDLRVGTYSNPVPNAVINLNADFYVIPDSQQETCTEYIRGGL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of glycan specificity in neonate-specific bovine-human reassortant rotavirus.
pubmed doi rcsb
source organism Rotavirus a
molecule tags Viral protein
molecule keywords Outer capsid protein VP4
total genus 31
structure length 163
sequence length 163
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00426 VP4_haemagglut Outer Capsid protein VP4 (Hemagglutinin) Concanavalin-like domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.120.200 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4yg3A00
1SLAA 1GLHA 1VAMA 5DXDA 2DUPA 2A3WA 4XJUA 4DRVA 2ZHLA 5L73A 4XTMA 1LHVA 2VU9A 3WLUA 1OQ1A 1ENRA 1ULEA 3BOPA 4LBMA 2ARXA 4P9XA 5H9PA 4ZXKA 4Q26A 3IKWA 4AGRA 4DFSA 5CAZA 3ZSMA 1CQ9A 1DQ4A 1PZ9A 1J1TA 3UK9A 1ONAA 2GMPA 4YGBA 2ZGKA 4XIOA 2D3PA 4PCRA 1LHNA 1N3PA 2D44A 5DG1A 3UJQA 2ZHNA 3ZXJA 1HLCA 3B69A 3N7LA 1H30A 1AF9A 3OYWB 3D5OA 1N1YA 2ZGUA 3A0KA 2A7AA 5DG2A 4K1YA 1MS5A 4FPGA 1S0DA 4XXAA 3M2MA 5KXBA 4TZDA 3ZXKA 2D43A 1F9KA 2JJ6A 2XG3A 2GNBA 2LTNA 2UWBA 2BQPA 3L2YA 4DPNA 3JU9A 4NOTA 2EXHA 4R9CA 2P2KA 2EALA 3WG1A 1SCRA 3M3OA 4BMEA 3ASIA 1LHWA 3FUOA 1R1ZA 3OPZA 3WDXA 1EPWA 1Z78A 2AR6A 1WUVA 1FV3A 1OFSA 2EXJA 3AX4A 1V6MA 1WW5A 3N3HA 4YM1A 4P9YA 2A6VA 5H9RA 5EWSA 3USUA 1DQ2A 1UZZA 4BOWA 3M3EA 1N1TA 4XMIA 4K1ZA 2ZA9A 2JE9A 1LOAA 4FPHA 1B09A 5SV8A 5CA6A 5IK8A 3APBA 4I30A 3TAYA 2CNAA 1GKBA 3VUOA 1S0BA 1IKPA 3FFZA 5GLTA 1DIWA 5IK7A 1MS4A 1F5FA 3CNAA 3AP5A 2WJSA 2CL2A 3B3QE 3AYEA 4PQ9A 1V00A 4M3CA 1G9BA 3OGGA 3AK0A 3JUUA 1JN2P 1LOFC 1NXD1 3MW4A 2VY0A 3RG0A 1RIRA 5T5PA 2DVDA 1QOSA 5LK5A 2WQZC 4Q27A 1IS5A 1W6NA 2WT0A 3DGTA 4JCKA 4C1WA 1G9DA 3M1HA 4AGGA 2A6ZA 5JOZA 4XJ8A 3W58A 3OBTA 1WW4A 4BM8A 1YO8A 5GZGA 1DYKA 5HCFA 1SLIA 1S0IA 1YXWA 3WDVA 1G9FA 3MW2A 1WD3A 1LGNA 3R4UA 4XMAA 1FV2A 2ZHKA 3W59A 3M3QA 3WZ1A 4XHXA 1Y7BA 3ENRA 4LBNA 1ULDA 2P3IA 2DV9A 4Y1YA 3WHUA 2KM2A 3N7KA 1MR5A 3ZXFA 5KXDA 2ZACA 4UW4A 1DQ1A 1DQ6A 1W6MB 4FPEA 4AVVA 5JLVA 3ZYPA 4M01A 1FATA 1JYCA 2OW4A 4GKYA 2D6LX 1MS1A 1AX0A 2DTWA 4XJZA 4Q8LA 4WVVA 1LU2A 1W6OB 1AXZA 2ENRA 1AXKA 1QNYA 4FVVA 3WUCA 3AP9A 5JMCA 1WBLA 2WT2A 1LOFA 2I2SA 3KM5A 5H9SA 1ENSA 1WW7A 4XOGA 4FOWA 5DUVA 2Q5TA 3OY8A 5BYNA 4FOYA 1QDOA 2VXRA 3LSDA 4PBOA 4D69A 1N3OA 1N1SA 5IK4A 3M3CA 4BQ1A 5GZEA 2GALA 2WNEA 5DUXA 1V6OA 1CN1A 4AYUA 5T52A 3VKFC 3FLTA 1WLDA 1Q56A 2GDFA 3RRDA 2R0HA 1CESA 2HYKA 4FOQA 4MYEA 3WG2A 3LSEA 3AJYA 4AVSA 1IKQA 2H0BA 4DRRA 1KITA 2D7FA 3O0XA 1CR7A 3VKNA 1V6LA 1BZWA 2YY1A 4ATFA 5CBLA 4LBQA 5GZDA 1C4RA 2ZGOA 5T50A 5T5LA 1SFYA 4R9DA 1UAIA 1CVNA 5GZFA 1SLBA 4FP3A 4XBQA 1LULA 4P9WA 1A8DA 4XILA 1WCSA 1AJKA 3O5SA 4R9AA 2WLQA 2V73A 2W39A 3AXDA 1WLWA 3B01A 3MPPG 4GALA 3AZVA 3IMNA 2JDZA 2DUQA 4Y24A 3A4UA 4Y1VA 4YGCA 4IQPA 3VKOA 1CPMA 1YYNA 2DVFA 4YW2A 2AYHA 3V64A 1MS8A 1JOJA 1HQLA 1H9PA 5EYYA 1O4ZA 3SH4A 2R1DA 2ARBA 1ULCA 2D6PA 2EXKA 4Q1RA 2ZHMA 3T1MA 1HDKA 3AYAA 3ZXLA 4YG0A 1JW6A 2A3YA 3D4KA 1W6PB 1FX5A 2JD4A 1KDKA 5JOXA 2FMDA 5IUQA 3MW3A 4UW5A 2VW2A 4FOVA 4WVWA 2WSUA 3IPVA 4Q2FA 1D2SA 3HMYA 4FPCA 3RSJA 1LODA 3GNEA 2ZABA 1JHNA 2PHUA 1GANA 3RS6A 1I3HA 1TEIA 4XBLA 1GZ9A 1S0EA 1ZA4A 1W0PA 4YM0A 4AGVA 2Z42A 1GNHA 1APNA 2E7TA 2VH9A 5GM0A 1GSLA 3R4SA 4YW4A 1G7YA 1W6PA 4M3CE 1G9CA 3U4XA 3N36A 3WCSA 3H0OA 1LEMA 1Q8QA 2YMZA 4GXLA 1I1EA 2R1BA 3PVEA 4JC1A 4Y22B 5JOYA 1LCLA 2PHTA 4F83A 4KBBA 4XXPA 3ZPYA 2ZGSA 2E7QA 1G9AA 2UWCA 4XHBA 1JXNA 1MS3A 1GBGA 2D6KA 2D6NA 3AZYA 3USUB 1W6NB 3WDWA 2SLIA 4FPJA 2A71A 3WDTA 1Q8VA 5DZEA 1QMJA 1WW6A 5EYXA 2DTYA 2CY6A 1KRIA 2NMNA 4Y20A 1GICA 1DZQA 1ULGA 1QF3A 1URXA 3LCPA 5FREA 2GNTA 2UURA 1Q8PA 3RQ0A 1WBFA 4BLJA 4RA0A 2A75A 1S0FA 2W08A 4UW6A 1C1LA 2D3SA 4Y26A 1SLTA 2ZGQA 3WNXA 4DQAA 2VW0A 1MVEA 1SBFA 2W68A 3B9CA 3T1LA 5JVVA 3WG3A 3SH5A 1V6JA 1G8WA 1DLLA 1W6OA 1W6QA 1WD4A 3R05A 4Y1UA 3BIWE 2FHRA 4FPOB 1YRZA 4C1XA 1KJRA 2EXIA 1MVQA 3WHTA 4DS0A 2P3KA 1LTEA 1N1VA 4ISQA 3RMXA 5JDBA 4ATEA 4L8QA 4ASMB 3V0AA 1RITA 3AP7A 1AXYA 4GKXA 4ISRA 1UKGA 4YZ4A 3Q9OA 2GN7A 4Y1XA 1S1AA 2PHXA 3OY8B 4YGEA 3BODA 5KXCA 4K20A 1AX2A 2WKKA 3NV3A 2GMEA 2JKBA 1GZWB 1SLLA 2ZKNA 2DVBA 5F9TA 1MS0A 4YM3A 1YI7A 5GZCA 2DUOA 3O12A 3AFKA 1MACA 3AZWA 2DU1A 5JOWA 3VKMA 1LJ7A 2ZAAA 2AGSA 1A3KA 3IM0A 4Y20B 4U2AA 2JECA 3ILNA 2OUHA 2UU8A 1LOBA 4LBKA 5DZFA 5GLZA 3V0BB 4AWDA 5GLWA 1LU1A 4P14A 3IN9A 4YG6A 5GLUA 2DU0A 4YFZA 1LGBA 3FUQA 4Q1PA 1SCSA 3SNMA 3NWKA 3POSA 1N3QA 3AYCA 5DUUA 3ZSKA 3T2TA 4JRAA 2DURA 2A70A 3C2UA 1SACA 5T55A 4AVTA 2NP0A 2GMMA 2ZGLA 4Q8KA 3UL2A 2ZGPA 2B7YA 3O0VA 1CPNA 4BPZA 2P3JA 2E6VA 2NYYA 4YG3A 1LESA 1LENA 3FLRA 2ZGMA 1BXHA 2XB6C 2G4IA 1W6MA 5F5QA 1DQ5A 4LBQD 1S0GA 2ZZJA 4XYXA 4BLIA 1H9WA 2CWSA 4SLIA 1LEDA 5EXOA 3IPVB 4CZSA 2OUJA 4HANA 2NMOA 4FPKA 2CYFA 1QU0A 4LBJA 4BMBA 4ITCA 1O4YA 2W52A 3ZSLA 1CJPA 3AXEA 4TYSA 1N47A 1GNZA 2DVGA 1F31A 2OVUA 1VIWB 1KDMA 4Y1ZA 1LHUA 3WCRA 3WVJA 2NM1A 5KXEA 4M00A 2D3RA 4UW3A 1AVBA 2CWMA 4YFWA 2AH2A 1AZDA 1IOAA 1UX6A 3ILFA 5GLVA 5CB7A 2A6YA 4GA9A 4CRQA 1SLCA 4LBOA 4M3CB 1ENQA 2A6WA 2VW1A 2GN3A 2ZBJA 1C1FA 1FNZA 1GYKA 1Q8SA 1D0HA 3I8TA 3KQRA 2SBAA 4FPYA 1ZM1A 5FRAA 2A6XA 3SITA 2DWRA 2YZ4A 1MZ6A 2ERFA 3DUIA 3NV4A 2TEPA 1FAYA 4XJWA 3SLIA 1GZWA 1AX1A 1CONA 5E8AA 3I4IA 3ZYRA 1LOEA 4YGDA 5T54A 2ZGNA 1KQRA 3N7JA 1A78A 5GJ6A 3HR9A 1V6NA 3OYWA 4YZ1A 3WUDA 2P34A 1S0CA 2RHPA 2V5YA 2P37A 2ZMKA 4FQ4A 4M3CF 4YM2A 1W0OA 3V0BA 2PELA 4HL0A 1LGCA 3ZVXA 4RL7A 2YV8A 4WV8A 4PBPA 2PHRA 1IS6A 3AYDA 1C57A 5T5JA 4YLZA 3TB0A 5IK5A 4FPLA 5HCAA 3AZZA 2D6OX 2EIGA 5E88A 2NN8A 3WOGA 2C5DA 1UMZA 5AVAA 4CTEA 3POWA 3AP6A 1JYIA 4FPFA 3QCWA 4XTPA 5E89A 2E53A 2ES3A 4XZPA 2D6MA 1LOGA 4XJ9A 5DUWA 1V6IA 2ZGRA 1UL9A 3VKLA 1UN1A 1IS3A 1GZCA 3A0NA 4Z8BA 3RMYA 2R16A 2DYCA 2ZMNA 3SH3A 1DGLA 2ZMLA 1BJQA 1BYHA 1U0AA 1V6KA 2AREA 3FLPA 4YW3A 3UJOA 1QOOA 2PHWA 4XJAA 2GNMA 3NV2A 1VALA 1FNYA 1W6QB 4WZFA 1OKQA 1VAVA 4YZ3A 3WDUA 1DYPA 3AP4A 4K21A 5HCBA 1QNWA 4OZXA 1LHOA 1HQWA 1SBEA 3INAA 1JUIA 1X50A 5DZGA 1LOCA 1Z0HA 4W65A 2EF6A 3V65A 4FP2A 1G86A 3WG4A 1VLNA 3D6EA 3WV6A 2R0FA 1UPSA 3MEPA 4LBLA 1WLCA 1RINA 1QGLA 1UZYA 3WDYA 1PZ8A 2WT1A 4NO4A 3PJQA 3ILRA 1NLSA 1Q8OA 4PF5A 4YW1A 2NZ9A 1QKQA 1KJLA 4XIKA 3OBRA 1AJOA 2AENA 4GWNA 1DBNA 1S0JA 1ULFA 5GALA 3ZSJA 3GALA 4YZ5A 3BTAA 3FBYA 4GWMA 5IT6A 4XE9A 4YZ2A 4R9BA 4Y22A 2AUYA 4FQZA 1CIWA 4LBQB 3PVOA 2E51A 1MZ5A 2WSVA 1FYUA 3OJBA 1GV9A 5CNAA 4U36A 3NV1A 1BQPA 1XQNA 3PVNA 1BKZA 2YROA 2GNDA 2A3XA 2UWAA 3N35A 1DFQA 3O0WA 4XDQA 3V0AB 3PMEA 2A5ZA 1LECA 2EAKA 2C9AA 2VUAA 3VV1A 1DQ0A 1QOTA 2R49A 2JE7A 3AZXA 3POYA 1MS9A 5T5OA 3QLQA 1JBCA 3ZXEA 3SISA 3HN1A 2CTVA 1QDCA 4YW5A 3B00A 2YXSA 1SBDA 1IS4A 1YIFA 3N7MA 2LALA 5H9QA 3ATGA 4ZKTB 1PZ7A 3AJZA 1HKDA 4XBNA 4H55A 2PHFA 2ZGTA 1DHKB 2DVAA
chains in the Genus database with same CATH superfamily
1HB1A 2JDHA 5FMDA 1SLAA 2XVLA 5D8AA 3IB3A 1UU4A 4ZU4A 1R081 4EWEA 4K40A 3WLUA 5BNOB 3OG2A 4LTAA 4LBMA 4ZPIA 5F2WA 1TME1 1NY71 2ARXA 3PDQA 4B4QA 5BNNC 1H1IA 3HNMA 1UOBA 1PZ9A 1DQ4A 1X9PA 2VZQA 3UK9A 1ONAA 2GMPA 4HN1A 1LHNA 3UKVA 3VZKA 2D5HA 4AXOA 1COV3 2RM23 1U5YA 3ZXJA 4N53C 1HLCA 1W3VA 3B69A 2QQUA 5LWBA 3D5OA 1L7LA 2HWD1 2W1UA 1ND2B 1OPMA 1OFNA 3A0KA 1GP4A 3HAGA 3WEZA 1GP6A 4FPGA 2RS32 3M2MA 5FK8A 5KXBA 1PO23 3GBFA 4ARYA 4IEVA 3DV8A 3SC7X 1F9KA 1VRH1 2JJ6A 1J1LA 2GNBA 2XXZA 4AFMA 4CPBD 1KFXL 3JU9A 4CE8A 2NQYA 3FJSA 2EALA 4LE3A 1JYWA 3KMHA 5FZDA 3TEXA 5J98B 4L97A 1Z78A 3ZYHA 3QBQA 2PAEA 4LT5A 1C8M1 4UT5A 3AX4A 3N3HA 4P9YA 2A6VA 5EWSA 3USUA 5EPAA 4BOWA 4JDNA 4COVA 3A22A 4Z82A 2X05A 1GFF2 1LOAA 2WFF1 4FPHA 1XXNA 3WW1A 3VBRA 5BNNB 1O59A 1GQPA 4QQOA 5SV8A 5CA6A 1H2LA 2CNAA 5I0TA 1S0BA 4AI2A 1NCQA 1CAXA 1MS4A 3LDBA 3B3QE 2CL2A 5TSWA 1SEFA 1NZIA 3AYEA 4JGZA 4B8EA 5C8WA 3WNOA 1ZZCA 3ZFEB 3PHMA 2BBVA 3JUUA 4IEYA 2EIBA 2PAKA 3ROUA 2QQWA 1RUG1 1H4HA 2X10A 1W9YA 2YPJA 4K9SA 3RG0A 1RIRA 3J26N 5FLHA 3WW4A 4AAPA 4A7ZA 4Q27A 1IS5A 1G9DA 3S5QA 4GWIA 3M1HA 4AGGA 3WP5A 2WS93 1XYPA 2Y64A 1NCRA 2VUJA 3CL1A 1S0IA 3LQCA 4BQXA 3WDVA 2PLV2 1LGNA 2WDBA 2DCZA 1NCRC 3M3QA 4MHRA 3W59A 4XHXA 3ENRA 2K9ZA 3KZ4C 2J1AA 3EXUA 1PMJX 1R1A3 2P3IA 2DV9A 4M4RA 4PJYA 4Y1YA 4YVSC 3ZYGA 4A3XA 4CDQA 1MR5A 4UW4A 4QXKA 1RUNA 1UY2A 1DQ6A 4BJ0A 5I8TA 3ZYPA 1TMF1 4M01A 3NKGA 3VDDA 1FATA 1JYCA 1GWMA 4XF3A 4CYDA 1LB2A 1NXMA 4MGZE 1AX0A 4QB1A 2DTWA 1RUOA 4CP2A 3PL0A 2DBNA 1ALYA 4FT8A 5AVPA 1TNRA 4AE2A 4HN0A 1AXKA 4MXWA 3UGHA 4DEQA 1J3RA 3P1IA 3WUCA 3ZFGA 3RZLA 1D7PM 1FOD1 4XOGA 4FOWA 5FP7A 1OA3A 2Q5TA 3OY8A 1CAUB 1QDOA 1W8WA 2E9QA 1N3OA 5A6QA 1ASJ3 4CU8A 3K4ZA 1S2KA 4QKBA 1CN1A 5J37A 1X7NA 2AACA 2BRTA 1CZTA 5C70A 1Q56A 1OVPA 1PVC3 1RUE1 3MBWA 3PUQA 3KVAA 2HYKA 4MGQA 2GAUA 4WM7A 4EN6B 1KITA 3O0XA 4LIUA 4IV3A 5FP4A 5T3NA 4S2GA 1V6LA 2YY1A 1RUC3 5T50A 1UZVA 2R062 1JOPA 4R9DA 5EP9A 3VZLA 4AQSA 3OGJA 1UO9A 4KWJA 4A41A 4B1LA 1VB4A 4F7ZA 5FMBA 1AJKA 1O8PA 3HN3A 5EQUA 3W5NA 2RJ2A 3MPPG 2Y8KA 2HWF1 3A4UA 3BTYA 1K3IA 1IG3A 4YGCA 1QY4A 4P9IA 2VNOA 2DVFA 4YW2A 5ABJB 5D21A 5HI0A 4N8MA 4IESA 1UD1A 1Y3TA 2XVGA 4XUPA 1VBD1 2Y6LA 4N43C 4OQ8A 2W9XA 2HLEA 1ZA7A 5LATA 2Z4FA 2D6PA 2EXKA 3I2JA 4C0HA 1JW6A 3WW3A 5IVYA 4DZGA 3D4KA 2XGXA 2RS53 3A7QA 3ACGA 3J9SA 3RZGA 1ZBE1 5IUQA 4Q4W2 3MW3A 4QU1A 4BCUA 4QPGB 4XUTA 1RUE2 3ZMNA 2WSUA 4Q4W3 1D2SA 1RHI3 3RSJA 1W0NA 4MGYE 1JHNA 3PJYA 1I3HA 4E4HA 1TEIA 4YM0A 1ZA4A 4AGVA 1MEC1 4D7SA 2Z42A 5FPAA 3J8F3 4NIGA 1YJKA 2R061 4LR4A 5ACA3 3RFRA 2VVEA 4HLTA 2D40A 2C26A 3WCSA 5BNOC 4QQHA 4GXLA 3B93A 3PIGA 4TLFA 1PHMA 5IAVA 3CJXA 2ZGSA 4FSJA 2HWE1 4AEDB 1WGPA 5A1FA 1PX3A 4XHBA 5C4WC 4DY5A 1GBGA 4LXLA 4HK9A 4FPJA 3WDTA 1UX7A 4HPKA 4CEYA 4CDXC 5A3TA 2WBKA 4B4PA 5EYXA 1UW8A 2DTYA 4RSUA 3C7FA 1EUUA 1T6BX 3T09A 4RGAA 1DZQA 4D0QA 1F4AA 2IWGB 1QJY1 3AMPA 4IE4A 5FREA 4B4RA 5F37A 3VN4A 4JGYC 4XFIA 4GH4A 4H2AA 1DF0A 1RUH1 2VZPA 2A75A 5A7QA 5ACA1 2PFWA 1UU6A 2QDNA 3ACHA 4MGSA 4UW6A 1SLTA 2WNVA 5FJKA 4DXRA 4XFFA 4A42A 1OH3A 2OZ6A 3SH5A 2HWB2 3IIIA 1QQP2 3K46A 2C6SA 2W2IA 1YRZA 5KC6A 3ZXAC 4DINB 1MVQA 5FZ6A 1JU3A 4DS0A 3NQHA 2VL4A 1H0BA 3Q8BA 2XLGA 1G6NA 4HKLA 1N1VA 2YFUA 5J36A 1OLME 3FC0A 5C3OA 4NPMA 1B35B 1RITA 1RHI2 4ISRA 2BPA2 2P17A 4AVAA 3Q9OA 1NA1C 4Y1XA 2LUWA 5FO9B 1S1AA 1KD7A 3LWCA 2WFF2 1KGYA 2UY9A 3JD72 3NNLA 4YGEA 1RUJ3 2R072 3VBHC 2UY8A 1ZRRA 3EQEA 2GMEA 1RVF2 1I5PA 3HD8B 3GZTB 3Q8FA 2ZKNA 4I3PA 3U1XA 2PQQA 2XJSA 3W5MA 2GU9A 3NMBA 3CZUA 4AI8A 4YM3A 1UF2C 2DUOA 3O12A 4XF0A 5GZCA 4META 1O3SA 2IFRA 1TE1B 4DMIA 2B42B 5CFDA 2ZAAA 3TEYA 1A3KA 3I97A 4Y20B 1VBB3 1UKRA 4LKFA 4U2AA 2JECA 3THCA 3BALA 4AEJA 3V0BB 5F3EA 5GLZA 3CJIC 3POJA 5EJ1B 2PLV3 4P14A 4YVSA 1JYNA 5FUPA 4YG6A 5CG8A 1O5UA 5GLUA 2DU0A 4QHOA 4JKMA 4LHSA 4CCMA 3RZMA 3NWKA 3S5AA 2Q1MA 1N3QA 1PK6B 1UY4A 5DUUA 3ZN4A 1W9WA 3VBOB 4J25A 4JRAA 3MI8A 3IDBB 1BBT2 2VQTA 2E63A 2WNVB 4OHVA 5T55A 2ZGLA 1WLTA 1PGL1 3M70A 5EIYB 4DEVA 4C8DA 3PIJA 2Z79A 4XF1A 1YC61 2P3JA 2Z2SB 3RZKA 4CP9B 4UXAA 3KS7A 1W9TA 3I2HA 3GCXA 4YG3A 4GB32 4FFGA 3ZFFA 3FLRA 1CIYA 4IGQA 3MIEA 1W6MA 1DQ5A 4CDUA 4QKDA 5IHRA 3I2IA 3JCIA 4BLIA 4SLIA 3ZKYA 4XF4A 3P3PA 4FFHA 3KCXA 3VDCA 2CYFA 5JXHA 4XDPA 3I7DA 4BMBA 4CP9A 3O7OA 1HXS1 3ITQA 2ID4A 4IE6A 3ZSLA 4UFLA 1NY72 4TYSA 5KHIA 5C9AC 4F3JA 1GNZA 2QE3A 5FXXA 4JDOA 5KHKA 4L11A 3I2KA 1F31A 2GP3A 4TWTA 1DGWA 5HV0A 2OVUA 3VBUC 2OIIA 1W05A 1ZREA 4IE7A 3VHRA 3J7NA 1KDMA 2OS2A 3LF7A 1XJAA 1YQ6A 3WVJA 2C0ZA 1AR62 2P5BA 1QQP1 1W9FA 4HETA 2BFUL 4OI1A 1UX6A 3ILFA 3K77A 4Q4X2 2J1EA 1TZOA 2A6YA 2OPWA 2A6WA 2ADEA 4IW3A 1GYKA 4QAWA 4FPYA 5FRAA 1D4M2 3KCCA 3FN9A 2A6XA 3HT2A 4IEPA 2E33A 2DWRA 4RQPC 1T6GC 4QM8A 1OBNA 3HQRA 2ZTNA 2JDYA 1H8TA 4DIQA 3LKJA 1VMJA 5B4XA 2JDUA 1NQDA 2W87A 1AX1A 3LIHA 3C7HA 4K3UA 1CONA 3VZOA 3I4IA 2Y60A 5T54A 4C91A 2ZGNA 1GUIA 3KHBA 2YU2A 2XLAA 3WF2A 4DXZA 5HXVA 4JV4A 1V6NA 4M0HA 3C8XA 2P34A 4XF9A 3BN6A 2V5YA 3IT8A 4FQ4A 4RFRB 5ISLA 1RJ7A 1Y4WA 4YM2A 4XW3A 1ND3C 1ZVFA 5CFCC 1LGCA 4QGLA 2ZEWA 4DY3A 1JHJA 2PHRA 3NJVA 4KG8A 5KR7A 2IVIB 3Q8EA 5HCAA 3VBFA 4GMP3 3AZZA 1YJLA 3SEEA 5E88A 2NN8A 5K7PA 1OKOA 1XBFA 1NLQA 5AVAA 4UFKA 4J6GA 2G9ZA 3NAPC 1DLCA 1ZBA2 2BU9A 1ZRFA 2VMGA 4LORA 4QDSA 4GJZA 2D6MA 1LOGA 4XZPA 5CU1A 2H6BA 4O9EA 4GH4B 4R4ZA 1XNDA 1UL9A 1IS3A 4Z8BA 4Q0QA 1AR91 3SH3A 4CEWC 2ZMLA 2W5FA 4I0BA 1POV1 4XQDA 2AREA 1U0AA 1OVSA 3FLPA 2GNMA 4AVBA 3KF3A 3O1TA 3L2HA 2MPFA 1IG0A 1VALA 1O3TA 1W6QB 4HONA 1VAVA 1R64A 2Y33A 4K21A 2ZXQA 4QX8A 4XFAA 4IEZA 2XBO3 5CFCB 1SBEA 2VD7A 1PNFA 1REDA 3K4DA 5K0UC 1QJY3 1R092 3EYPA 4AFAA 1O3QA 2HBUA 2EF6A 4OQ9A 3V65A 1YFWA 1UYYA 1VLNA 4RYDA 4NR1A 4BK4A 2R0FA 3O1VA 5K0UA 4CDWA 1UZYA 1QGLA 2DCKA 4JX0A 1FMD2 4G3YC 3NJYA 4YYOA 1AYN1 3U75A 4YW1A 1BEV1 4AQ2A 2VMIA 3J7HA 2GH2A 2XUEA 3PMSA 4P5YA 5F5CA 1TNFA 4LKSA 4RN5A 4XFCA 4GWMA 5IT6A 3O1UA 1DGRA 3ZLIA 1QJX2 3JZVA 2YBSA 1XE7A 2KA3A 3ST7A 5A7PA 4LBQB 1ODNA 2FDFA 2ZEXA 3AKSA 4L9BA 1FYUA 2MEV2 2QVSB 1GV9A 3AFGA 4JTNA 3NV1A 5F32A 3PVNA 2YROA 4Q4W1 1UPIA 1ND2C 3I3DA 1US3A 2IXCA 3EBRA 3N35A 1LECA 3RZJA 2VUAA 1KFUL 3R6SA 3H8OA 4P9LA 2V72A 4LQRA 4CU7A 3WQBA 3ZMOA 1YEWA 2VCCA 2CTVA 4E2GA 3BTZA 1CAXB 4H14A 4QXCA 4WVMB 4NWVA 1VBD3 3DYOA 2WWSA 1PO13 4PIYA 3ZYFA 5CFCA 1NG0A 2CAVA 4HVOA 3LEIA 3EB7A 2HWF2 2YBPA 4YVWA 2RV9A 3T30A 2A3WA 4XJUA 4DRVA 2P6CA 1Y9QA 2VG9A 1LHVA 4OHZA 4CTEA 3BOPA 3DN7A 5AC92 4DFSA 4Q26A 2BWCA 5CAZA 3K75B 1CQ9A 2WFPA 3ZSMA 1J1TA 4BQ4A 3PURA 2D3PA 4H7LA 1N3PA 2D44A 4QX5A 3KSCA 2EICA 2JIGA 3B94A 3H42B 4LO4B 1H30A 1VAKA 1Z7S2 1REEA 1ST8A 3RNSA 4CDXB 1MS5A 4W8JA 1AR82 1S0DA 2F6BA 1K5MB 1EV12 4JAAA 1W8NA 2QQLA 4I01A 4K8RB 4DO0A 4TZDA 5M0TA 4XCBA 2LTNA 5G04L 2C9KA 2JKXA 3OUIA 2BQPA 4OVEA 5FYSA 1AYM2 4J1WA 3SKJE 2EXHA 3CEWA 4HXCA 3FHIB 4AI1A 1SCRA 3IZOA 1W2AX 3M3OA 5K9YA 2BBAA 4P02B 4AFCA 1OI6A 1EPWA 1VBB2 1NYWA 2AR6A 1WUVA 3H1MA 3U78A 1OFSA 1MQTA 2XHNA 5LW9A 4GULA 1V6MA 5JWPA 2IXLA 4YM1A 5LA9A 1VBC1 4HSLA 4GQ7A 1DQ2A 4JKKA 4K6BA 5D8AB 4ZXEA 4NMIA 1PGW1 1U5IA 2JE9A 4ONUA 4RS5A 2I45A 4H3WA 3KVBA 3APBA 1CAWB 1ZNPA 2B39A 3TAYA 3VD3A 2Q8DA 3WNNA 4Y5Z0 1DIWA 3PTRB 2YC2A 3J7MA 5HV4A 4KG0A 1BK0A 1O5LA 1QJX1 5LA2A 2YYOA 3DXUA 5CFDC 3AB0A 1G9BA 3AK0A 3I3QA 1HRV3 3UGFA 2P6HA 1STMA 2RVAA 5FZ1A 5LBFA 1YFYA 4IEQA 5FK7A 4COZA 4BWOA 2WAOA 1Q43A 1V70A 1QOSA 2AEZA 5LK5A 2WQZC 2XHKA 2WT0A 4MOAA 4NRPA 3OEBA 1LKNA 4Q0PA 4FBFA 2VZ3A 4XJ8A 4E8CA 1D2QA 3OBTA 1CX4A 4HSJA 2IXHA 3P3NA 5FKCA 2VTXJ 1DGWX 5HCFA 3ZFGC 4ZY9A 5JIUA 2ZAHA 3I59A 4LK7A 4N9IA 4Q4V2 4D7TA 2OT7A 1G9FA 4XMAA 5BNQA 5ANNA 3J7LA 4EN9B 2D5FA 1HN0A 5DAVA 3WHUA 1UOJA 3GM8A 2Y38A 3ZXFA 2ZACA 4QHZA 5FTTC 5L9RA 5HPOA 1NE6A 3SCHA 1W6MB 4FPEA 4YNIA 5FPVA 4AVVA 1ZBA3 5JLVA 4L2NA 1I9RA 2O8QA 4QQ2A 1NA1B 2QTWB 3ZN5A 2OW4A 4HK8A 2D6LX 5JUVA 1NLRA 2JG9A 2Y6HA 3D3AA 5FBZA 3ZXDA 3MPBA 1J3QA 2ENRA 4FVVA 5IATA 1QNYA 2WO1A 2P4EA 3AP9A 5JMCA 3N4MA 2Q8CA 3LAGA 5FYUA 3KM5A 4MGIE 4FAHA 1OLRA 4OHYA 1JS9A 2CSGA 3ZPOA 4FOYA 1FPN3 3LSDA 4D69A 1SFNA 4XQWA 3U07A 1N1SA 5ABJC 5IK4A 1ZX5A 2VOTA 3M3CA 4BQ1A 1AL22 2WNEA 1JYTA 2I07B 1RJ8A 1V6OA 4AYUA 3EO6A 5SV5A 3ZIWA 1OLMA 4TXWA 4RFT0 2Y6GA 4W6WA 5C9AA 2Y0IA 3ELNA 3MIGA 1R093 2R0HA 3T0DA 3ZM8A 4CCLA 2H0VA 3LSEA 4K8FA 4YRDA 4DRRA 1W8ZA 3ZR5A 3AMQA 1Y9GA 5A33B 1ENXA 4Q4V1 5FZCA 3VKNA 4ATFA 2WZR3 5A7WA 3TWIA 5GZDA 1VPHA 2ZGOA 3THDA 1W99A 3KV5A 1RUF2 3WF1A 2BOJA 1PGW2 3H3LA 4P9WA 1QEXA 4XILA 3AKTA 1ODMA 3O5SA 2JX9A 5JPNB 2J1SA 1B35A 1OURA 1WCUA 1NOVA 2W39A 4PF1A 4XACA 4ES9A 2HWD3 3MLKA 1V9U3 1P8JA 4NHMA 3D0SA 1HJGA 1DU3D 3AZVA 2JDZA 4LO6B 4NN0A 3VZJA 5A3PA 4FTEA 3UYJA 3GHNA 3VKOA 5A1LA 4BIOA 1B35C 1YYNA 4FAGA 2X5IB 5C4WA 1X36A 2AYHA 2FCUA 3V64A 3ETPA 4XDOA 5A7SA 3WX5A 1HQLA 2XKOA 5EYYA 2WO7A 2BFUS 3ZDSA 5F39A 1F5JA 3SH4A 4W50A 4A6SA 1DZRA 4PT6A 5F2SA 2BGOA 1ND3A 1RTVA 2XQXA 1HDKA 3KQ4B 2VMDA 4UBHA 1HV0A 1XRUA 3C3VA 4YG0A 1FX5A 2R32A 3MIDA 5A70A 3CDZB 4LJHA 5C33A 4UW5A 3S30A 2C1FA 2XDVA 1ZRDA 1RXFA 2VGDA 2IXJA 4FOVA 4P5HA 3VHPA 5B4NA 2Y6FA 4FPCA 2VCMA 3GNEA 5DQ0A 4A4AA 2PHUA 3DL3A 5JZGA 3ZO0B 5LZ6A 2ZX2A 4XBLA 1GZ9A 3NRUA 4GMP0 1W0PA 4UOJA 4LUKA 4AHWA 4DUVA 1GNHA 4IEWA 5FUNA 1APNA 3GZUC 1JU4A 1WZXA 1S4CA 1GSLA 3R0RA 4MUVA 1VB2A 1W04A 1QHDA 5GM0A 2FZ1A 3WY6A 3U4XA 3H3ZA 2VO5A 1E5SA 3LE0A 3H0OA 2YMZA 1K42A 1J58A 2R1BA 4Y22B 4DUXA 1LCLA 2PTMA 3JB8A 4KBBA 5C8CC 2VR4A 1PNGA 1VBE2 3ZPYA 3FMGA 5L7OB 1G9AA 1ZZ9A 2WABA 3CO2A 2UWCA 1JXNA 1MS3A 5FR3A 2D6NA 1UYXA 3WDWA 4MGKE 1W6NB 3N9PA 1YQ2A 2A71A 2VBBA 2VM9A 4URTA 1H2NA 5DZEA 3ZYIB 4HKOA 1OOPB 3ON7A 1WW6A 5F5AA 3OBAA 1KRIA 4COWA 1Q3EA 2CGPA 1URXA 1WMEA 2GNTA 1EPZA 2F4LA 3HT1A 5A3NA 3RQ0A 1X82A 5FY8A 4RA0A 4CU9A 4P08A 2B8MA 3MLLA 2YHJA 1OUXA 3I2FA 4Y26A 1C1LA 1IPSA 1R1A2 2D3SA 2IUWA 1KXGA 2ZGQA 2VW0A 1MVEA 2JDNA 3B9CA 3ZFGB 4DQAA 5JVVA 4KBZA 3DXTA 1V6JA 3NNFA 5A7WB 4AR2A 2MNGA 2P1BA 1OT5A 1WD4A 4QD2A 4Y1UA 2RR12 5AFBA 2XMLA 1KJRA 2R042 2HYXA 3VBUB 5LEJA 3I3MA 1EAH3 1DG6A 1WCDJ 2PXJA 4XVHA 5C8CB 2E7AA 2WC2A 3N9NA 5I0SA 1E57A 2ET7A 4MADA 3V0AA 3AP7A 3KLSA 1AXYA 2BEOA 1XNCA 5C3RA 2PHXA 3OY8B 2AEYA 4IETA 1KS4A 4OYUA 1AX2A 4NHLA 2VMCA 5IVJA 1SFPA 1IGOA 1ASJ2 3RZZA 3T4HB 1BMV2 1GZWB 1SLLA 2DVBA 5F9TA 3RPQA 1QH6A 5C3SA 3E6DA 4LO7A 4AF9A 1QJU2 3IAQA 4WM8A 4WM7B 2WRAA 3BTXA 4AHYA 1HRI2 1NZCA 2JG9B 2W1WA 3F95A 3VDDB 3VKMA 1YLLA 1LJ7A 5FPBA 4CU6A 2W0XA 5FDBA 3ILNA 4QPIA 1LOBA 4LBKA 5DZFA 4AWDA 5A6YA 5GLWA 1LU1A 3NNGA 3IN9A 1W03A 1X33A 1WWYA 2QNKA 3EMRA 1LGBA 3FUQA 3B5LB 4LUMA 4R52A 4YFZA 3N9QA 1SCSA 2IVJA 3V56A 4CSWA 2RS33 3POSA 2VAUA 3AYCA 3T2OA 4E2QA 3ZSKA 1GR3A 1WCKA 2VECA 3T2TA 1SHWB 2J42A 1QXPA 2YU1A 4QKNA 5F5IA 1NCQB 2VBPA 1AR93 4AK3A 4AVTA 4AI0A 1HB2A 1W8UA 1LAJA 2VZTA 4IGOA 1K45A 3O0VA 2J1TA 4BPZA 4DXSA 3VBRB 2VZSA 5I93A 3BIEA 3POBA 4OI4A 2A73B 4ARXA 2OXBA 1S55A 3LA3A 1UMIA 2B4KA 1UIKA 2H6CA 1W39A 1QQP3 1S0GA 3MZHA 4XYXA 3H8XA 2CWSA 5F3CA 1UY0A 2LRPA 2GP5A 4MG2A 2ZKLA 3FE5A 4QPWA 2VQUA 3MUY1 2NMOA 4FPKA 4UYBA 2IFWA 5FWJA 3JBG1 3KT7A 2BGPA 4FI9A 2W52A 3RYRA 3O1OA 2WIIB 5JAXA 3DYPA 1CJPA 5KWRA 4GB33 3CJIB 2DVGA 3HWJA 5I0RA 5FYVA 4RQPA 4A44A 4FFFA 1RUD2 1E5RA 1I6XA 2QQNA 5FP9A 1AYN2 5LRSA 4I09A 4Y1ZA 1LHUA 1RUG3 4KWKA 3RJRA 5CKNA 4L0PA 4QPIB 3X29B 3POFA 4UW3A 4XETA 2AH2A 5HBAA 1AZDA 1IOAA 2GC2A 1XNTA 5GLVA 4N53B 1QXRA 1ZYBA 5CB7A 3BU7A 4UI9L 3OD4A 1JMUB 2C24A 1GU3A 1UZ0A 4ZZ8A 3E6CC 1HRV1 2WA3A 4XFBA 1MZ6A 1REFA 4MH0E 4W6YA 4XJWA 1FAYA 3OCPA 4D6QA 4RR3A 5A6XA 5FZOB 3VBFB 4CDQC 1LOEA 3POIA 4GJYA 1KQRA 3MICA 2BWAA 3N7JA 1RUI3 3T2QA 1VBC2 5GJ6A 3HR9A 4YZ1A 3WUDA 1POQA 1S0CA 5JIAA 1YQ5A 3UT0A 3OTFA 3ZN6A 1PVXA 4EROA 4N90A 2JE8A 3ZYJB 4G9SB 1HRI1 5FMOL 1IS6A 4NIDA 1H1MA 1C57A 5T5JA 1JYVA 5IK5A 1CD3G 2G9FA 4IDZA 2RS52 4FPLA 4QT6A 4B7KA 2EIGA 2V5DA 1RUE3 2LW8A 4IE0A 3HBKA 3EJKA 3OOXA 5IAXA 3ALQA 3AP6A 3GDBA 1EYBA 1FPN1 3LFMA 4NVPA 2ZOEB 5E89A 2ES3A 1SDWA 2JB4A 3BPZA 1C8NA 4KWLA 4NIAA 1VBA2 3VKLA 2WZ8A 2VOXA 1CWPA 3HBZA 4E27A 5LA1A 2VCBA 5FPLA 3AKQA 3HPNA 3RMYA 4Q4X1 2XPJA 2HWD2 1PIV3 3QD6A 4FXGB 2HWB1 1AUYA 3FZ3A 1QOOA 2PHWA 4XJAA 2JDKA 3DEMA 3VD9A 4GIQA 1O6UA 1JZ6A 2B9UA 2I74A 3JQXA 2VOVA 4EN8B 4CXYA 2XJVA 1AR63 1OKQA 4YZ3A 5FQ0B 5L7OA 1W2OA 4NE9A 3ABZA 5K8SA 1W28A 1AYM1 2R063 1QNWA 2J7MA 3PVBB 4BQWA 5JXJA 1JZ4A 1QXJA 1HQWA 5A7OA 2EIDA 3INAA 4W4ZA 3CJIA 3A21A 3BYWA 3GHMA 1JZ7A 2HWE2 3U0ZA 1Z0HA 1CX1A 3O1MA 4FP2A 5DDJ3 3WG4A 2BUKA 2R071 1V0AA 3D6EA 2GH8A 3WV6A 4KGQA 3USSA 1M4WA 3MEPA 5FZ9A 1WLCA 3WDYA 2RMU3 2WINB 3KD4A 1PZ8A 5FZIA 1XU1A 2RS51 3PJQA 1NLSA 2FCVA 2VUDA 2NZ9A 3MIHA 5D1IA 5A80A 5JCTA 5HCHA 2PQSA 1OC1A 1ULFA 3ZFFC 3BTAA 5FOBB 5FCCA 1NT0A 3VBOC 3UESA 1H1AA 5C3QA 1CIWA 4QGMA 4XAAA 1MZ5A 4LOSA 4U36A 1XQNA 3OGRA 2BNMA 5IVCA 2WN2A 4MGTA 1BKZA 1J3PA 1EUTA 3ACFA 2WZPP 3JBG3 4XDQA 2OYZA 5CISA 3V0AB 1GMMA 3PMEA 4MZUA 2EAKA 3IMMA 4D7YA 4LITA 4E4SA 3FHQA 5J09A 1QOTA 3AZXA 2VMHA 4CDUC 4EWAA 3BGAA 2VTFA 3DPRB 3HN1A 3QACA 1VJ2A 1QDCA 4NROA 1V9U2 2YXSA 4PIXA 4WM8B 3ZSEA 5LCWL 5A3LA 2VZUA 3HEIA 5ANQA 1R091 2LALA 5H9QA 3ATGA 2Q1FA 4ZKTB 4AVCA 4BISA 3AJZA 3U10A 5B2GB 4XBNA 3T08A 2PHFA 3T3YA 5GZFA 1IQDC 2V4AA 5L19A 1GLHA 4ZZ5A 3RZHA 1LNSA 2DUPA 1CGPA 2EA7A 4CP0A 4XTMA 4MV2A 2VU9A 5FY4A 1OQ1A 3NNJA 1ENRA 5H9PA 4ZXKA 3RWNA 4CUAA 3LOIA 5K4LA 3IKWA 3H7YA 2YG0A 4LKDA 5C8CA 4XIOA 5DG1A 2BOIA 2JXAA 3NKTA 2ZHNA 2XJQA 2W46A 2VJXA 1FMD3 1N1YA 3J4UH 3N9OA 2BP6A 2A7AA 2P3YA 2ORZA 1PM4A 2PAMA 2QZ2A 4JTOA 4IV1A 4XXAA 1NUKA 4Y5TA 5LBEA 2WO3A 1QIQA 2EIEA 3ZXKA 2D43A 2TBVA 3VLBB 3L2YA 3H7JA 1HV1A 4UF0A 4R9CA 3AL6A 3ZOIA 5C7GA 4S2DA 3ZIXA 4BMEA 3WG1A 4E8DA 1F2NA 1LHWA 4LULA 3OPZA 4XUNA 3WDXA 4BK5A 3VL8A 4WZCA 1FV3A 3GBGA 3GCWA 1ZZ6A 4BH9A 3WQ0A 3JXSA 2QQPA 4ASKA 3VBSB 1HIXA 1UZZA 2GSYA 2ZA9A 1L3JA 5FMOS 2WS91 1AYM3 4EYUA 4HVQA 2GC1A 3D8CA 5IK8A 2BNOA 3BVCA 1GKBA 3FFZA 5GLTA 5C5TA 2Y6KA 3CNAA 4X6QB 4QGNA 5F6KA 2WJSA 5FO7B 4UAPA 3SCGA 4PQ9A 3VD4A 2OPKA 1XSRA 2FDGA 4Q0VA 4QB2A 4NUBA 5FMCA 3FHAA 1RUJ1 1RUH2 1AR61 3M7AA 3S6PA 1JN2P 3S57A 1FPN2 2CDOA 5FY5A 5T5PA 2VOWA 4CDUB 1VMHA 1W6NA 1XYNA 4C1WA 4JCKA 5AC93 2JG9C 1AL23 1AR81 2GZWA 4IXLA 4LPLA 3WP6A 4UF0B 1L7QA 1CJDA 3GBWA 5FY9A 1E5HA 3P6BA 3BI3A 4BM8A 1YO8A 4FTSA 3LD8A 3URFA 1SLIA 1BBT1 1ND3B 3OB8A 2YUEA 3TRSB 1WD3A 4OULA 2ZHKA 3I49A 3P5BA 4BIFA 3WQ7A 3K48A 3WZ1A 4DUWA 3AL5A 4LBNA 1ULDA 2J1VA 2WO2A 2BJSA 2KM2A 1XOYA 4D3WA 1DQ1A 1RGSA 1LR5A 4BA6A 4A6OA 2XH6A 4XUOA 3NJXA 3VBRC 4MX3A 2BNNA 1HRI3 3LEGA 2RJLA 4GKYA 5CFDB 1UMHA 2Q30A 5EJZB 5J3UA 1E5IA 3IIAA 4WVVA 2LROA 1LU2A 3MDPA 1W6OB 4X8PA 3R4DB 4AHZA 2VOKA 1XU2A 4AHXA 1WBLA 2VBDA 2WT2A 2XL7A 1LOFA 3B9IA 1XPWA 2D98A 3C7EA 4RGGA 5FZHA 1ENSA 5H9SA 4YPJA 3ZX7A 1PO22 5JSOA 2XONA 5BYNA 4TTGA 3ZR6A 4PBOA 4ZS2A 5A33A 2HBTA 3UKTA 5IVEA 4Z92B 1JH5A 2GALA 2TUNA 2W3JA 4LNVA 5DUXA 5FY1A 3I54A 5FO8B 1BVVA 4GMP1 3WF4A 1RMU3 2FCTA 5T52A 3FLTA 1WLDA 3VKFC 4YSFA 2WYFA 2B9VA 3E5XA 4R4XA 3K2OA 1CESA 1RMU2 1YNAA 3WG2A 2HEVF 5CG9A 4SBVA 1IKQA 3I3BA 1DGRN 2O0OA 1W8HA 2D7FA 1VBB1 1CR7A 3LEKA 1YQ8A 4LLOA 3KGZA 3ACLA 5CYYA 5A3MA 1QWRA 2PN5A 1HRV2 2PLV1 4Q0UA 3M8LA 5T5LA 3TEZA 4X6RB 1AR71 5EZWA 5JZGC 1BK1A 4GAZA 4FP3A 3D82A 3CU7A 1WCSA 2V73A 2FD8A 4L99A 3AXDA 1ZZ7A 1HXS2 4OMDA 4UFHA 3N9LA 4Y24A 5DPNA 1PIV2 3AM2A 1CPMA 3GXUA 1AYN3 1US2A 3W21A 1BMV1 3PU8A 2OQ6A 4CEYC 4WVZA 1ZZ8A 4IV3C 2HKXA 1GOGA 1O4ZA 4A7KA 1OA2A 1RUG2 2VVDA 2WQ8A 3KCYA 2ZJCA 2ZPXA 2ARBA 3J8F2 4Q1RA 3I59B 1OOPC 5F8PA 3AYAA 3VB9A 3ZXLA 2W95A 1ZZBA 2Y6JA 5ACA2 2A3YA 2QQVA 3I2OA 1W6PB 1F8VA 2JD4A 2XUMA 5JOXA 2FMDA 3PUSA 2WNOA 4PQQA 3AMHA 4Z07A 2VW2A 1K5JA 1LRHA 3WNLA 4WVWA 2RR11 3HMYA 2ZABA 4CDWB 4CEWA 4D6SA 3KB5A 1GANA 4OUMA 5FZGA 3RS6A 4CCKA 1TG7A 1S0EA 3NL1A 4B7EA 4BB3A 5F6LB 2NLRA 5A32B 2HEYF 2E7TA 4XFGA 4BQ5A 5BUVA 5AFEA 1G7YA 4JKLA 4M3CE 4IEOA 5E16A 1SPPA 3N36A 4LHNA 4LHKA 1LEMA 1Q8QA 5BXXA 3S0MA 4CXWA 1I1EA 2WNVC 2G1MA 1OF3A 3E97A 2RM21 2XWJB 5LRRA 2D6KA 4Q4Y2 3W9AA 4DNYA 3USUB 3VDBA 2R7EB 5AC91 5FJHA 4Z2WA 3T4VA 1EAH1 3MLJA 3MYXA 3IAPA 3LZZA 3JBG2 3H1YA 2CY6A 4OI2A 2NMNA 1GICA 4QXHA 5FYYA 3WINE 2HJIA 3WP3A 3OBZA 3J8F1 4CCEA 4Y5SA 1AHSA 1VBE3 4CUBA 1Q8PA 4DB5A 4INDA 3K3NA 5FXVA 2W08A 4YVWB 3HQXA 4DXTA 4RR3B 1PMIA 4EWDA 3SXWA 3U14A 4EQVA 3T1LA 3VHNA 4NIIA 4COYA 5IYYA 1BEV3 1RVF3 4WVMA 3K4AA 1NX9A 1DLLA 2ZX0A 4QKFA 1YHFA 4OFGA 2FHRA 2IXIA 1YCIA 2XJUA 2EXIA 4FPOB 4C1XA 2VNRA 4ZU7A 2XJTA 3BPSA 1LTEA 4N53A 2DF7A 4LA2A 3RMXA 3K3OA 4CVUA 4NIHA 5JDBA 4ATEA 4L8QA 3TN93 5LASA 4ASMB 1SMVA 1YFUA 5BNOA 1WA4A 4GKXA 5FYCA 1UKGA 2ETEA 3NSTA 4YZ4A 1OLQA 3UETA 3TN92 4S2HA 3ME2A 4XQ4A 2A1XA 5FY7A 1F35A 2WR9A 3BODA 4NJ4A 5KXCA 1RUH3 3FL7A 2DBIA 4K20A 4QX3A 4AL9A 4AFDA 3NV3A 4RQPB 2HWB3 5DAPA 1GWLA 2JKBA 2R043 2HWF3 1K5MA 2X29A 5FXWA 1MS0A 4CDXA 3AFKA 1MACA 2BVVA 2ATFA 3C7GA 4QX1A 3OEAA 4EN7B 5JOWA 5FYBA 2AGSA 3TOJA 3IM0A 3ORJA 5EJ3A 4A2UA 2OUHA 2UU8A 5IFTA 2ARAA 3OPWA 5C3PA 2XVKA 1ZBE2 4E4ZA 1CZSA 2JG8C 3CZJA 4IGPA 1NQJA 1CZVA 1ZBE3 2VE1A 3HVDA 4BQ2A 3CQOA 2FQPA 1AL21 1AR83 3OGSA 4CCJA 4DOUA 3CF6E 3ECQA 2JG8A 2A70A 3C2UA 3KT1A 4Y3OA 1VBA1 4NHKA 1K12A 1W06A 3KV9A 4NWWA 1U5ZA 3CIHA 3TBDA 4Q8KA 1RXGA 2ZGPA 4I0WB 1CPNA 1RYYA 4GWJA 2FDJA 2E6VA 2VUCA 5A1AA 4HKWA 3KT4A 3B7MA 2NYYA 1LENA 3VBHB 2ZGMA 4RHV1 1PX4A 4CCCA 2XB6C 1R083 5F5QA 4KU7A 1C8M3 1OQDA 3W20A 2ZZJA 5FZ0A 2QKDA 3ETQA 4KH9A 4Q4Y1 1C8M2 3IPVB 1QJEA 1W3XA 4CZSA 2OUJA 1EAH2 3LB9A 1QU0A 4LBJA 1X8EA 4XUQA 4ITCA 5F7UA 4JVAA 4AI9A 1QJY2 3QH6A 1N47A 2RMU1 1FOD2 2B46X 5EFUA 3H3UA 1PO21 5BNPA 5L36A 2HWC3 5BNNA 4BU2A 3FBMA 4COUA 1O4TA 1PK6C 4XCAA 1MEC3 2QCSB 1UZWA 4N7IA 5CADA 2CDPA 4QPGC 2BTVC 2NM1A 5KXEA 2CWMA 3PUAA 4YFWA 4CUCA 1OH4A 2VMFA 1W2NA 5FPZA 1H6XA 2ZZQA 3T0BA 1SLCA 4LBOA 4M3CB 1ENQA 2ZBJA 5FP3A 5I0UA 5A3OA 1QJU3 5FOJB 1D0HA 1QJX3 3LOBA 1ZM1A 3SITA 1HXS3 3MV11 3LDKA 3L9JT 5LY2A 2EVXA 2WFF3 1RUC2 2TEPA 5FZFA 5LY1A 3SLIA 4OZOA 4EZHA 5LB6A 1C5IA 3WSOA 4UFIA 2JWPA 2F4PA 3MF6A 1OF4A 4EN0A 4PLNA 5DABA 4K7JA 5FZMA 3H50A 3IDCB 5CIRA 4D94A 1ACCA 1IPJA 1XC6A 5KHGA 4KWUA 2RHPA 4XZUG 2P37A 4ZHNA 4UWDA 5C9AB 1VP6A 2PELA 4FFIA 1PIV1 1TVGA 3ZVXA 4HBNA 2YV8A 1F15A 1H2MA 4WV8A 4CA9A 3O14A 5DDJ2 5I0DA 2ZEYA 3AYDA 3FWEA 4D8MA 4YLZA 2J1RA 3AKPA 1QJZA 2QBXA 5EV7A 2JD9A 1JZ5A 1VBD2 2NPIA 3E5QA 1RL3A 2RMU2 4ES8A 5IWFA 2D6OX 2RR13 3PTYA 1NE4A 1H8TC 2RG4A 3WNMA 1JZ2A 2WNUA 2VULA 5FZAA 5E1RA 1JYIA 4FPFA 4ET7A 2XBO2 1BHGA 4KMQA 3H9AA 3ZFEC 1W2TA 2G9GA 4AAXA 5IW0A 4OI0A 1UN1A 4AI3A 1BVP1 5F1RA 1R1A1 1MZEA 2R16A 5FZKA 1PVC1 3WF0A 1JYXA 4QXBA 5LK7B 1BJQA 1POV0 3QH7A 1BYHA 4CCNA 1XNAA 2YGLA 4JGZC 3GJBA 4Q5OA 2F17A 4TN7A 2WZR1 3CLPA 3HOBA 4Q0SA 3AP4A 4OZXA 1OMIA 4Y4RA 2UYBA 1VBA3 3NAPA 1T2XA 2DCJA 5I8YA 4NHXA 5J48A 2RM22 1RHI1 1JUIA 5IVFA 1X50A 2Y26A 1PMHX 3M3IA 3VBOA 1EY2A 4JGYB 3KV6A 3SKVA 2Q8EA 1OXCA 2VQAA 1GQGA 3VDDC 5LBCA 4WM8C 4LBLA 4W6XA 4QMAA 3VD7A 1R082 4AEMA 2WT1A 2W94A 3ILRA 5JI7A 5J1XA 3KHCA 5JR2A 1IQAA 3AC0A 1F4HA 4H7MA 4GH4C 3LA2A 1AJOA 2BGCA 4GWNA 1DBNA 1S0JA 4OMCA 2HWE3 4YZ5A 3CBNA 3GALA 4Y33A 4YZ2A 4R9BA 4Y22A 2AUYA 1BCXA 1BBT3 4A3ZA 1A8MA 3Q8CA 4E9KA 1SZBA 1C5HA 3U37A 1EV11 2N7GA 3PVOA 3WNPA 1W8FA 5FAXA 3QOPA 3OJBA 4A45A 5CNAA 3RI8A 2Q0AA 1BQPA 5FYHA 2LS6A 1UXZA 2GNDA 2PHDA 3Q8AA 1W2UA 1XE0A 4MVTA 2A5ZA 3LIGA 4LLFA 3VL9A 4RGKA 1MS9A 4V2VA 5T5OA 2JDAA 1JBCA 1WA6X 2XKPA 1UNBA 1W8OA 2MHFA 1OA4A 2ZS6B 3POGA 3NNMA 4UFJA 4YW5A 2FBEA 3HJRA 2E32A 3HIFA 5FLJA 4AFBA 2WNUB 5BV6A 2YPDA 3N7MA 3NAPB 1RUF3 1PZ7A 1UOFA 2MEV3 4JHZA 1HKDA 3O1SA 2GC3A 1D4VB 2ZGTA 2PMWB 4H55A 2DVAA 1EV13 4O61A 1TMF3 1VBE1 2B5HA 4WBBA 1VAMA 5DXDA 2ZHLA 3DPRA 1A6CA 5L73A 3AMNA 4YVSB 1ULEA 4AQTA 1NA1A 4P9XA 1AR73 4MHUA 3IDEA 4AGRA 3SMHA 5CEHA 4OCTA 4TSVA 4PIZA 1TQ5A 2Q1ZB 2GC0A 4YGBA 2ZGKA 3RJ2X 2DDUA 4LA3A 3AVRA 4PCRA 4N43A 3UJQA 5FZ3A 3GGLA 4CEYB 5IVVA 2WAAA 5E6HA 2WYSA 3N7LA 3OD0A 3OYWB 1AF9A 1NAEA 1BLZA 2YBKA 2ZX1A 1O91A 5JSRA 2ZGUA 2Y0OA 1RUI2 4HG6B 1W9SA 1QH7A 4K1YA 5DG2A 4MSVA 1MZFA 4BYYA 3DKWA 4ZONA 2XG3A 2Q4SA 2UWBA 4YW7A 3I3EA 1UYPA 3S7EA 3VHOA 5C5UA 4DPNA 5HXMA 4NOTA 3RYPA 4URAA 4RHV2 2VMEA 2P2KA 3D0JA 2PYTA 2VC9A 5CZKA 5FXZA 3IWZA 3ASIA 1GOFA 4QB6A 3FUOA 1R1ZA 4RHV3 5IJRA 4HOOA 5LEKA 2EXJA 3PU3A 1WW5A 2BW8A 2RDSA 2O1QA 4Q4Y3 5H9RA 4EJRA 4QPGA 1Q5OA 2ZCWA 3M3EA 3MIFA 1VMFA 1N1TA 4XMIA 1X8MA 4K1ZA 4I3GA 3TYJA 1UYZA 5C6CA 1XNBA 3WP4A 1JOBA 3KWVA 2ORXA 1UY1A 2WWUA 3GF6A 5C71A 5DMYA 1B09A 4I30A 3VUOA 3T2PA 1IKPA 4IEUA 5IK7A 1F5FA 3OSDA 1RUD1 3AP5A 5FYIA 3MGUA 1QJU1 4OHXA 4CPBA 5FQ0A 1V00A 4M3CA 4YWAA 2FZ2A 2X09A 2AC1A 3OGGA 4LOTA 3ZDVA 1DYOA 5F3GA 3A23A 3UNPA 1LOFC 1JTZX 1NXD1 1WMFA 3MW4A 2VY0A 3SQOA 4LEJA 5FYMA 2XBO1 1VRBA 2DVDA 3MUZ1 4AQ6A 3DGTA 4EE2A 4M0NA 2RS31 2X5IC 1FI2A 4JGZB 1DCSA 2A6ZA 4AEDA 5JOZA 1ULPA 3W58A 1L7RA 2B45X 1WW4A 5BNPB 1XSQA 1AR92 3G6JB 5FZ8A 5GZGA 1DYKA 5EHDA 3CKHA 4KNCA 2WN3A 1YXWA 2JG8B 5LBBA 3VBSC 3MW2A 4OLLA 3R4UA 4O9GA 1FV2A 3POEA 4QX2A 2OZJA 3WNKA 1Y7BA 2WWJA 4JDMA 4BQ3A 1JODA 5KXDA 1MEC2 3N7KA 2O8OA 3OPTA 4QU2A 3VBSA 3DF0A 4AG4A 2Z5WA 1JI6A 5JXGA 3LFIA 5F3IA 1X9TA 3VBHA 1M06G 1YI9A 2HH9A 2ARCA 4Q29A 1MS1A 4S2FA 4UBGA 5DAXA 4XJZA 4Q8LA 1GNYA 1C28A 5DAQA 4Q4V3 1AXZA 4XABA 3WR0A 5KBFA 2CGOA 1Z7S3 1UU5A 5FZOA 3UKNA 1GP5A 3VZNA 2I2SA 4I0AA 1WW7A 4RS5B 3LDRA 5FUIA 1D0GA 2HWC1 2CU5A 5DUVA 4OUSA 2VXRA 1SQ4A 3S7IA 1RUJ2 2R073 4RD7A 5GZEA 4E4DX 3HQUA 2JEMA 1VE0A 2YFZA 5FYZA 4JHTA 1YWKA 4PDWC 2WZEA 4PI0A 4BXFA 1HJFA 2GDFA 2CGNA 3RRDA 4NAOA 4ORFA 3PLQA 3NJZA 4FOQA 4MYEA 2MEV1 4AVSA 3AJYA 5KHHA 3O1PA 4LHLA 4AEKA 2H0BA 4LO5B 2VZOA 4P9JA 5CBLA 1BZWA 4LBQA 1C4RA 4NRMA 2R041 1SFYA 2FDIA 1OHFA 1UAIA 1CVNA 4C90A 1AL0G 3ZKUA 1SLBA 4Q4X3 4XBQA 4N7UA 1LULA 2O14A 5IFPA 1A8DA 3FX3A 5JR7B 1DZTA 3EHKA 5FWEA 4X8NA 1U5XA 4R9AA 2WLQA 2XJRA 1JZ8A 3C7OA 4KQ7A 1WLWA 1FMD1 3B01A 4QDRA 1YQCA 4GALA 5I91A 4AZZA 3IMNA 2XQRA 2DUQA 4Y1VA 3NO8A 1GQHA 3SEPA 4IQPA 4AOCA 4E2SA 1PM7A 1OUSA 3AKRA 2D97A 1MS8A 3LGRA 3TNPB 1JOJA 1H9PA 2J1UA 2VZRA 2W1SA 3MFCA 3DCQA 1W90A 1POV3 2R1DA 2Y34A 3AVSA 1XNKA 1HB4A 1ULCA 3RI9A 3RWKX 3MHZA 5FYTA 5KC5A 2ZHMA 3T1MA 4KU8A 1UXXX 2HEWF 4MXWB 2VVFA 3MO4A 1RUD3 3LA7A 1NCRB 1H4GA 3K51A 2QFEA 4NHYA 5A32A 1KDKA 1COV2 4WM7C 2BYVE 1RUI1 1J83A 1VR3A 2TNFA 4XC9A 4V2WA 3IPVA 4Q2FA 5I8SA 1LODA 2JENA 2WNUC 4LMFA 4QHBA 3MV01 4HFSA 4QWNA 2VH9A 3ZFEA 1PGL2 3R4SA 4XPVA 1W6PA 3KF5A 4YW4A 3CHXA 1G9CA 1AR72 2YGMA 2Q8OA 1W8TA 2VCAA 3MIBA 5CKMA 2JDMA 4GB31 3BCWA 1S2EA 3PVEA 2V09A 4JC1A 5JOYA 2PHTA 1KEXA 5FZBA 4F83A 4QQPA 4XXPA 1RVF1 2BDRA 2E7QA 3TNQA 4B3NA 3H8RA 1FXZA 5DDJ1 3SHRA 3KV4A 3AZYA 2SLIA 1TME2 1H6YA 1Q8VA 2QZ3A 2QJVA 2XL9A 1YFXA 1QMJA 2VNGA 1K5MC 4Y20A 3NVCA 5K0UB 5FV3A 1ULGA 2AZ5A 5CVRA 1QF3A 3LCPA 2D93A 1KS5A 1WMDA 1GOHA 3WXPA 3ZXGA 2UURA 1CAVA 5A6ZA 4FCAA 1WBFA 4BLJA 4UFMA 2QUOA 2ZX4A 1S0FA 2QQKA 3WNXA 4BZ4A 3OUJA 3AMMA 5JMOA 1SBFA 2W68A 3MFAA 2OQ7A 4CXXA 2FDKA 3JD73 3WG3A 1G8WA 1H2KA 1W6OA 1W6QA 3R05A 4O65A 4A7YA 3BIWE 4ASLA 2ET1A 2JICA 4G4FA 4MO3M 3WHTA 3JQWA 2P3KA 1FT9A 2DCTA 4ISQA 4LO8A 4FXKB 3H1WA 4NPRA 4QPIC 1NCQC 1O3RA 4GZ9A 2IC1A 4JRLA 4EV0A 3WW2A 1IZ3A 2YDEA 2GN7A 5GKAC 3GYDA 1GZTA 3PUHA 2ILMA 1I5ZA 2R6QA 3VZMA 3BU0A 2XJPA 5FFOC 2QQJA 2UYAA 2WKKA 4F8AA 1RB8G 2W91A 3E5UA 4M4PA 1UY3A 2QQIA 2V4VA 4NRQA 3I2DA 2KD7A 3LEMA 2K46A 3IBMA 5J7MA 2QQOA 4RS5C 1YI7A 5LA0A 5A3WA 3DPRC 3AZWA 4Y4YA 2C4XA 2DU1A 2PHLA 4P00B 4PHZA 2CV6A 1VRH3 5FZ7A 3U11A 5FBJA 2QDRA 5FPUA 2HWC2 1COV1 4HPKB 1HB3A 2YB7A 3BKZA 4LIVA 4Q1PA 4IV1C 3SNMA 3ZFFB 1OD5A 1UWWA 1SDDB 5A3UA 1Z7S1 2YC4A 5FKBA 4MLOA 4CCDA 5IVBA 2DURA 3FFQA 4QX7A 4PI2A 1H8TB 5CKQA 1SACA 2NP0A 3DYMA 4Z1VA 2GMMA 1YUDA 3UL2A 3MF9A 2B7YA 5FZLA 4GD4A 1SPPB 1PVC2 2JB8A 4IUGA 3NW4A 4Z2AA 1PK6A 3G7DA 4IEXA 1LESA 4XFHA 4ZS3A 1WCQA 4CCOA 1BXHA 2KXLA 2G4IA 4PLMA 3DECA 4LBQD 2RDRA 1OOPA 2X8KA 2YC0A 3JB4C 4BE3A 4CEWB 1H9WA 1TMF2 5EXOA 1LEDA 4KGGA 1HN1A 3HNYM 4FTBA 2R30A 3BOWA 4HANA 2OA2A 1J84A 4C0BA 1O4YA 5KHJA 5JI9A 5G05L 4YVWC 3THPA 4JQTA 2WQ4A 4TLGA 3AXEA 1Y9MA 4PDWB 1J59A 1UQXA 1D4M3 4IV1B 1ULOA 4L92A 5FLIA 1U12A 2KR2A 2RS11 4BHPA 3O1RA 1VIWB 2WUHA 4NAMA 3U4SA 4B1MA 1HW5A 5ABJA 4XAEA 3ES1A 2ZEZA 2W1QA 4QQLA 3GJAA 2E31A 2WA4A 3WCRA 3BUCA 2FDHA 1DDLA 3WT3A 4XEZA 5FPXA 4M00A 2D3RA 1AVBA 5JPMB 1O8SA 1RMU1 2FMYA 4O7XA 2BV4A 1QJFA 3HNBM 1VRH2 4R8HA 5BY5A 4CRQA 4GA9A 4CUGA 5JXIA 2BERA 1FOD3 2VW1A 2GN3A 1C1FA 1FNZA 1HQNA 1Q8SA 3I8TA 3KQRA 4HZFA 2SBAA 4CP1A 2JIJA 5BPXA 2YZ4A 4YW6A 2ERFA 3DUIA 1PO11 2WZR2 1RUF1 3NV4A 1C3HA 5J96B 1GZWA 4HMZA 2DFCA 3JD71 5E8AA 3ZYRA 4YGDA 5JSPA 3TEWA 1A78A 1Y43B 2X5IA 3GZAA 3GZEA 4FO9A 3OYWA 4AEDC 5C4WB 2G19A 4LK6A 3SCFA 2ZX3A 3H8UA 2IXKA 2ZMKA 2DCYA 2W92A 2WS92 4M3CF 4N43B 1W0OA 3V0BA 3THTA 1V9U1 4HL0A 4JZRA 4RL7A 4XURA 2VZVA 4JQRA 4PBPA 1OSGA 3I2GA 3TB0A 5D8AC 5FP8A 1WMXA 3VBUA 1EP0A 5L9VA 5APAA 1BEV2 4LKEA 1GWKA 3WOGA 4N9HA 4QX0A 2BZDA 2C5DA 1UMZA 2RE9A 5D2AA 4BDVB 1OPOA 5A7NA 3T0AA 4KI5M 1O7FA 2J22A 4I02A 1VBC3 2RDNA 1MQTC 1ZRIA 2X53S 3POWA 4RR3C 2L9LA 3OUHA 4IL7A 4IE5A 3IDAA 3QCWA 4XTPA 3N9MA 1CAVB 1XYOA 4OHWA 2E53A 3ZYBA 2XR4A 5DUWA 4EZ4A 4XJ9A 5ERLA 2K0GA 1V6IA 1OQEA 1SG3A 2ZGRA 4QDQA 1GZCA 3A0NA 4IERA 2K2SA 1UCXA 2DYCA 2ZMNA 1DGLA 4HT1T 3BB6A 4YW3A 3UJOA 1V6KA 3VBFC 3VD5A 4CDQB 1IHMA 1IPKA 2VPVA 1ZRCA 3CMGA 3NV2A 2CHHA 3ACIA 1FNYA 5L7OC 4WZFA 1RUC1 3WDUA 5BNPC 4OUEA 1RC6A 2VZ1A 1DYPA 1HX6A 1XE8A 3UGGA 5HCBA 2BVBA 4MXVA 3WD5A 1LHOA 4D6RA 4QPYA 4PDWA 2RJKA 3UV9A 2VQ0A 4LE4A 3DKQA 4QM9A 5DZGA 1LOCA 1WKYA 4KL1A 4NPLA 4W65A 5FY0A 3RVHA 3RYKA 5L9BA 3RDIA 1G86A 3KGLA 5FIXA 1JZ3A 1UIJA 1H8VA 1UPSA 1ASJ1 5FZ4A 3OF1A 4P9GA 1RINA 2RS12 1A34A 5JZGB 1MQTB 4NO4A 1Q8OA 4PF5A 2VTXA 2XWBB 2RS13 1QKQA 2LM3A 3LPFA 4PLOA 2EAAA 1KJLA 2CAUA 1YIPA 2PA7A 3OGVA 4XIKA 3B02A 3OBRA 2AENA 4JGYA 2XLFA 3E6BA 5GALA 2OKXA 3ZSJA 3FBYA 3PUIA 3VDAA 2WLPA 5DN2A 4XE9A 4V1PA 4HVRA 1ZBA1 4FQZA 5DAWA 2WL1A 4BXSV 1D4M1 2VNVA 1UOGA 3ES4A 2E51A 3RGBA 4YARA 1DP0A 2WSVA 4IV3B 4B29A 1PO12 4J1XA 1JUHA 2A3XA 2UWAA 1TME3 2DFBA 5FZEA 4BQYA 3O0WA 1DFQA 3LPGA 2QQMA 1NKGA 3M4FA 2C9AA 2W47A 3VV1A 2XOMA 3F2ZA 4ZU5A 1DQ0A 2R49A 3POYA 2JE7A 2IZWA 3TN91 3WQ1A 3ZN6B 3QLQA 3ZXEA 2JDPA 2OX0A 3SISA 2Z69A 3E1F1 2E26A 3B00A 1SBDA 1IS4A 1CAUA 1MPXA 3VGIA 1XB9A 1YIFA 4CDWC 1CAWA 1S2BA 2VXJA 2ADDA 4I2OA 4AW7A 1PGSA 3WF3A 1OD3A 2RDQA 3PNAA 1DHKB 1ND2A
chains in the Genus database with same CATH topology
1SLAA 2XVLA 5D8AA 1UU4A 4ZU4A 1R081 4EWEA 4K40A 3WLUA 5BNOB 4LTAA 4LBMA 1TME1 1NY71 2ARXA 4B4QA 5BNNC 1H1IA 1PZ9A 1DQ4A 3UK9A 1ONAA 2GMPA 4HN1A 1LHNA 3UKVA 3VZKA 2D5HA 4AXOA 1COV3 2RM23 1U5YA 3ZXJA 4N53C 1HLCA 3B69A 3D5OA 2HWD1 3HAGA 1ND2B 1OPMA 1OFNA 3A0KA 4FPGA 2RS32 3M2MA 5KXBA 1PO23 3GBFA 4IEVA 3DV8A 1F9KA 1VRH1 2JJ6A 1J1LA 2GNBA 4AFMA 1KFXL 3JU9A 2NQYA 3FJSA 2EALA 4LE3A 3KMHA 5J98B 4L97A 1Z78A 3QBQA 2PAEA 4LT5A 1C8M1 3AX4A 3N3HA 4P9YA 2A6VA 5EWSA 3USUA 4BOWA 4JDNA 4COVA 4Z82A 1GFF2 1LOAA 2WFF1 4FPHA 1XXNA 5BNNB 3VBRA 4QQOA 5SV8A 5CA6A 1H2LA 2CNAA 5I0TA 1S0BA 4AI2A 1NCQA 1CAXA 1MS4A 3B3QE 2CL2A 5TSWA 1SEFA 3AYEA 4JGZA 4B8EA 5C8WA 1ZZCA 3ZFEB 3PHMA 2BBVA 3JUUA 4IEYA 3ROUA 2PAKA 1RUG1 1H4HA 4K9SA 2YPJA 3RG0A 1RIRA 3J26N 5FLHA 3WW4A 4A7ZA 4Q27A 1IS5A 1G9DA 3M1HA 4AGGA 3WP5A 2WS93 1XYPA 1NCRA 2VUJA 3CL1A 1S0IA 3WDVA 2PLV2 1LGNA 2DCZA 1NCRC 3M3QA 3W59A 4XHXA 3ENRA 2K9ZA 3KZ4C 3EXUA 4PJYA 4YVSC 1R1A3 2P3IA 2DV9A 4Y1YA 3WW1A 3ZYGA 4A3XA 4CDQA 1MR5A 4UW4A 4QXKA 1RUNA 1DQ6A 5I8TA 3ZYPA 1TMF1 4M01A 3NKGA 3VDDA 1FATA 1JYCA 4CYDA 4XF3A 1LB2A 1NXMA 4MGZE 1AX0A 2DTWA 1RUOA 4CP2A 4FT8A 4AE2A 1ALYA 5AVPA 1TNRA 4HN0A 1AXKA 4MXWA 1J3RA 3WUCA 3ZFGA 1FOD1 4XOGA 4FOWA 1OA3A 2Q5TA 3OY8A 1CAUB 1QDOA 2E9QA 1N3OA 1ASJ3 1S2KA 1CN1A 5J37A 1X7NA 1Q56A 1PVC3 1RUE1 2HYKA 2GAUA 4WM7A 4EN6B 1KITA 3O0XA 4IV3A 5T3NA 4S2GA 1V6LA 2YY1A 1RUC3 5T50A 2R062 4R9DA 3VZLA 4AQSA 3OGJA 4KWJA 1VB4A 4F7ZA 1AJKA 3MPPG 2HWF1 3A4UA 4YGCA 1QY4A 4P9IA 2VNOA 2DVFA 4YW2A 5ABJB 5HI0A 4IESA 1UD1A 1Y3TA 2XVGA 1VBD1 4N43C 2D6PA 2EXKA 4C0HA 1JW6A 3WW3A 4DZGA 3D4KA 2XGXA 2RS53 3J9SA 1ZBE1 5IUQA 4Q4W2 3MW3A 4BCUA 4QPGB 1RUE2 3ZMNA 2WSUA 4Q4W3 1D2SA 1RHI3 3RSJA 4MGYE 1JHNA 3PJYA 1I3HA 1TEIA 4YM0A 1ZA4A 4AGVA 1MEC1 4D7SA 2Z42A 3J8F3 1YJKA 2R061 4LR4A 5ACA3 2VVEA 4HLTA 2D40A 3WCSA 5BNOC 4QQHA 4GXLA 3B93A 4TLFA 1PHMA 3CJXA 2ZGSA 4FSJA 2HWE1 4AEDB 1WGPA 5C4WC 4XHBA 4DY5A 1GBGA 4HK9A 4FPJA 3WDTA 4HPKA 4CEYA 4CDXC 4B4PA 5EYXA 1UW8A 2DTYA 4RSUA 4RGAA 1DZQA 3AMPA 1QJY1 2IWGB 5FREA 4B4RA 3VN4A 4JGYC 4XFIA 4GH4A 1DF0A 1RUH1 5ACA1 2A75A 2PFWA 1UU6A 2QDNA 4UW6A 1SLTA 2WNVA 4XFFA 2OZ6A 3SH5A 2HWB2 1QQP2 1YRZA 5KC6A 3ZXAC 4DINB 1MVQA 4DS0A 1H0BA 2XLGA 1G6NA 4HKLA 1N1VA 5J36A 3FC0A 1B35B 1RITA 1RHI2 4ISRA 2BPA2 2P17A 4AVAA 3Q9OA 1NA1C 4Y1XA 2LUWA 5FO9B 1S1AA 1KD7A 3LWCA 2WFF2 2UY9A 3JD72 4YGEA 1RUJ3 2R072 3VBHC 2UY8A 1ZRRA 3EQEA 2GMEA 1RVF2 3HD8B 3GZTB 4I3PA 2ZKNA 2PQQA 2XJSA 2GU9A 4YM3A 4AI8A 5GZCA 1O3SA 1UF2C 2DUOA 3O12A 4XF0A 4META 2IFRA 1TE1B 4DMIA 2B42B 5CFDA 2ZAAA 1A3KA 4Y20B 1VBB3 1UKRA 4U2AA 2JECA 3BALA 4AEJA 3V0BB 5GLZA 3CJIC 5CG8A 2PLV3 4P14A 4YVSA 4YG6A 1O5UA 5GLUA 2DU0A 3NWKA 2Q1MA 1N3QA 1PK6B 3ZN4A 5DUUA 3VBOB 4JRAA 3MI8A 3IDBB 1BBT2 2E63A 2WNVB 4OHVA 5T55A 2ZGLA 1WLTA 1PGL1 3M70A 2Z79A 4XF1A 2P3JA 2Z2SB 4UXAA 3KS7A 4YG3A 4GB32 3ZFFA 3FLRA 3MIEA 1W6MA 1DQ5A 4CDUA 3JCIA 4BLIA 4SLIA 4XF4A 3P3PA 3KCXA 2CYFA 4BMBA 3I7DA 3O7OA 1HXS1 3ZSLA 1NY72 4TYSA 5KHIA 5C9AC 4F3JA 1GNZA 2QE3A 4JDOA 5KHKA 4L11A 1F31A 4TWTA 1DGWA 2OVUA 3VBUC 2OIIA 1ZREA 3VHRA 1KDMA 3WVJA 2C0ZA 1AR62 1QQP1 4HETA 2BFUL 4OI1A 1UX6A 3ILFA 4Q4X2 2A6YA 2A6WA 1GYKA 5FRAA 4FPYA 1D4M2 3KCCA 2A6XA 3HT2A 4IEPA 2DWRA 4RQPC 1T6GC 4QM8A 2ZTNA 1H8TA 3LKJA 3VZOA 1NQDA 4K3UA 1AX1A 1CONA 3I4IA 5T54A 4C91A 2ZGNA 2XLAA 4DXZA 5HXVA 4JV4A 1V6NA 4M0HA 4XF9A 2P34A 2V5YA 3IT8A 4FQ4A 1RJ7A 4YM2A 4XW3A 1ND3C 1ZVFA 5CFCC 1LGCA 4QGLA 4DY3A 2PHRA 4KG8A 5HCAA 3VBFA 4GMP3 3AZZA 1YJLA 5E88A 2NN8A 5K7PA 5AVAA 4J6GA 3NAPC 1ZBA2 1ZRFA 2VMGA 4XZPA 2D6MA 1LOGA 5CU1A 2H6BA 4O9EA 4GH4B 4R4ZA 1XNDA 1UL9A 1IS3A 4Z8BA 4Q0QA 1AR91 3SH3A 4CEWC 2ZMLA 4I0BA 1POV1 4XQDA 2AREA 1U0AA 3FLPA 2GNMA 4AVBA 3L2HA 2MPFA 1VALA 1O3TA 1W6QB 1VAVA 4K21A 4XFAA 4IEZA 2XBO3 5CFCB 1SBEA 1PNFA 1REDA 5K0UC 1QJY3 1R092 4AFAA 1O3QA 2EF6A 3V65A 1YFWA 1VLNA 4NR1A 2R0FA 5K0UA 4CDWA 1UZYA 1QGLA 2DCKA 1FMD2 4G3YC 4YYOA 1AYN1 4YW1A 1BEV1 4AQ2A 2VMIA 2GH2A 3PMSA 1TNFA 4XFCA 4GWMA 5IT6A 1DGRA 1QJX2 3JZVA 1XE7A 2KA3A 3ST7A 4LBQB 3AKSA 4L9BA 1FYUA 2MEV2 2QVSB 1GV9A 3AFGA 4JTNA 3NV1A 3PVNA 2YROA 4Q4W1 1UPIA 1ND2C 2IXCA 3EBRA 3N35A 1LECA 2VUAA 1KFUL 3R6SA 4P9LA 3ZMOA 2CTVA 4E2GA 1CAXB 4H14A 4WVMB 4NWVA 1VBD3 2WWSA 1PO13 4PIYA 5CFCA 1NG0A 2CAVA 4HVOA 2HWF2 4YVWA 2A3WA 4XJUA 4DRVA 1Y9QA 2VG9A 1LHVA 4OHZA 3BOPA 3DN7A 5AC92 4DFSA 4Q26A 2BWCA 5CAZA 3ZSMA 1CQ9A 2WFPA 1J1TA 2D3PA 4H7LA 1N3PA 2D44A 4QX5A 3KSCA 3B94A 4LO4B 1H30A 1VAKA 1Z7S2 1REEA 3RNSA 4CDXB 1MS5A 1AR82 1S0DA 2F6BA 1K5MB 1EV12 4JAAA 4TZDA 4I01A 2LTNA 4OVEA 2BQPA 1AYM2 4J1WA 2EXHA 3CEWA 3FHIB 4AI1A 1SCRA 3M3OA 5K9YA 4AFCA 1OI6A 1EPWA 1VBB2 1NYWA 2AR6A 1WUVA 3H1MA 1OFSA 1MQTA 4GULA 1V6MA 5JWPA 2IXLA 4YM1A 1VBC1 4HSLA 4GQ7A 1DQ2A 4K6BA 5D8AB 1PGW1 1U5IA 2JE9A 4ONUA 4RS5A 2I45A 4H3WA 3APBA 1CAWB 1ZNPA 2B39A 3TAYA 4Y5Z0 1DIWA 4KG0A 1O5LA 1QJX1 2YYOA 5CFDC 3AB0A 1G9BA 3AK0A 1HRV3 1YFYA 4IEQA 4COZA 4BWOA 1Q43A 1V70A 1QOSA 5LK5A 2WQZC 2XHKA 2WT0A 1LKNA 4Q0PA 4FBFA 4XJ8A 1D2QA 3OBTA 1CX4A 4HSJA 2IXHA 3P3NA 1DGWX 5HCFA 3ZFGC 5JIUA 2ZAHA 3I59A 4N9IA 4Q4V2 4D7TA 1G9FA 4XMAA 5BNQA 4EN9B 2D5FA 3WHUA 2Y38A 3ZXFA 2ZACA 5FTTC 1NE6A 3SCHA 1W6MB 4FPEA 4YNIA 4AVVA 1ZBA3 5JLVA 4L2NA 1I9RA 2O8QA 4QQ2A 1NA1B 3ZN5A 2OW4A 4HK8A 2D6LX 1NLRA 2JG9A 5FBZA 3ZXDA 3MPBA 1J3QA 2ENRA 4FVVA 1QNYA 3AP9A 5JMCA 3N4MA 4FAHA 3LAGA 3KM5A 4MGIE 1OLRA 4OHYA 4FOYA 1FPN3 3LSDA 4D69A 1SFNA 4XQWA 3U07A 1N1SA 5ABJC 5IK4A 1ZX5A 3M3CA 4BQ1A 1AL22 2WNEA 2I07B 1RJ8A 1V6OA 4AYUA 3EO6A 5SV5A 3ZIWA 4RFT0 5C9AA 4W6WA 2Y0IA 3ELNA 3MIGA 1R093 2R0HA 2H0VA 3LSEA 4K8FA 4YRDA 4DRRA 3AMQA 5A33B 1ENXA 4Q4V1 3VKNA 4ATFA 2WZR3 3TWIA 5GZDA 2ZGOA 1RUF2 1PGW2 4P9WA 4XILA 3AKTA 3O5SA 2JX9A 5JPNB 1B35A 2W39A 1NOVA 4ES9A 2HWD3 3MLKA 1V9U3 4NHMA 3D0SA 4LO6B 1DU3D 3AZVA 2JDZA 4NN0A 3VZJA 4FTEA 3GHNA 3VKOA 4BIOA 1B35C 1YYNA 4FAGA 2X5IB 5C4WA 1X36A 2AYHA 3V64A 3WX5A 1HQLA 2XKOA 5EYYA 2BFUS 3ZDSA 1F5JA 3SH4A 1DZRA 1ND3A 1RTVA 1HDKA 4UBHA 4YG0A 1HV0A 1XRUA 3C3VA 1FX5A 2R32A 3MIDA 5C33A 4UW5A 3S30A 2C1FA 1ZRDA 2VGDA 2IXJA 4FOVA 4P5HA 3VHPA 4FPCA 3GNEA 2PHUA 3DL3A 5JZGA 3ZO0B 2ZX2A 4XBLA 1GZ9A 4GMP0 1W0PA 4AHWA 4LUKA 1GNHA 4IEWA 1APNA 3GZUC 5GM0A 1GSLA 3R0RA 4MUVA 1VB2A 3WY6A 1QHDA 3U4XA 2FZ1A 3H3ZA 3H0OA 2YMZA 1J58A 2R1BA 4Y22B 1LCLA 2PTMA 3JB8A 4KBBA 5C8CC 1PNGA 1VBE2 3ZPYA 3FMGA 5L7OB 1G9AA 1ZZ9A 3CO2A 2UWCA 1JXNA 1MS3A 2D6NA 3WDWA 4MGKE 1W6NB 2A71A 4URTA 1H2NA 5DZEA 3ZYIB 4HKOA 1OOPB 1WW6A 1KRIA 4COWA 1Q3EA 2CGPA 1URXA 1WMEA 2GNTA 1EPZA 3HT1A 3RQ0A 1X82A 4RA0A 2B8MA 3MLLA 2YHJA 5FMOS 4Y26A 1C1LA 1R1A2 2D3SA 2ZGQA 4DQAA 1KXGA 2VW0A 1MVEA 3ZFGB 3B9CA 5JVVA 1V6JA 2MNGA 1WD4A 4QD2A 4Y1UA 2RR12 5AFBA 1KJRA 2R042 3VBUB 5LEJA 1EAH3 1DG6A 1WCDJ 5C8CB 2E7AA 2WC2A 5I0SA 1E57A 2ET7A 3V0AA 3AP7A 3KLSA 1AXYA 2BEOA 1XNCA 2PHXA 3OY8B 4IETA 1KS4A 1AX2A 4NHLA 3RZZA 1IGOA 1ASJ2 1BMV2 1GZWB 1SLLA 2DVBA 5F9TA 3RPQA 1QH6A 3E6DA 4LO7A 4AF9A 1QJU2 4WM8A 4WM7B 4AHYA 1HRI2 1NZCA 2JG9B 3VDDB 3VKMA 1YLLA 1LJ7A 2W0XA 5FDBA 3ILNA 4QPIA 1LOBA 4LBKA 5DZFA 4AWDA 5GLWA 1LU1A 3IN9A 1X33A 2QNKA 4LUMA 4R52A 4YFZA 1LGBA 3FUQA 3B5LB 1SCSA 3V56A 2RS33 3POSA 4E2QA 3AYCA 3ZSKA 1GR3A 1WCKA 2VECA 3T2TA 1QXPA 4AK3A 1NCQB 4AVTA 1AR93 4AI0A 3O0VA 5I93A 4BPZA 3VBRB 4OI4A 2A73B 1S55A 3LA3A 1UIKA 2H6CA 1W39A 1QQP3 1S0GA 3MZHA 4XYXA 2CWSA 2ZKLA 3FE5A 2NMOA 4FPKA 2IFWA 3JBG1 3KT7A 3RYRA 2W52A 2WIIB 5JAXA 1CJPA 5KWRA 4GB33 3CJIB 2DVGA 3HWJA 5I0RA 4RQPA 1RUD2 1I6XA 1AYN2 5LRSA 4I09A 4Y1ZA 1LHUA 1RUG3 4KWKA 3RJRA 4QPIB 3X29B 4UW3A 4XETA 2AH2A 5HBAA 1AZDA 1IOAA 2GC2A 5GLVA 4N53B 1QXRA 1ZYBA 5CB7A 3BU7A 3OD4A 3E6CC 1HRV1 2WA3A 4XFBA 1MZ6A 1REFA 4MH0E 4W6YA 4XJWA 1FAYA 3OCPA 4RR3A 3VBFB 4CDQC 1LOEA 1KQRA 3MICA 2BWAA 3N7JA 1RUI3