4YG7B

Structure of fl autorepression promoter complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title HipBA-promoter structures reveal the basis of heritable multidrug tolerance.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transcription, transferase/dna
molecule keywords Antitoxin HipB
total genus 16
structure length 69
sequence length 69
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4yg7B00
1PERL 2AWIA 3S8QA 2LYQA 1X57A 2LYLA 3TRBA 3D1NI 3EUSA 1LQCA 4Y42A 4X4EA 1EFAA 4JQDA 1LMB3 1UXDA 1NEQA 1LLIA 1VPWA 3OQOA 4YARA 1PRAA 1BDHA 2GRLA 2IVGA 3SCHA 2IV1A 4GHJA 2O38A 1QPZA 4X4CA 1O4XA 2IVQA 3CECA 3BD1A 2AW6A 4Z59A 4Z5HA 4PU3C 3BDNA 1QP7A 1GT0C 1WH8A 2PUAA 2D5VA 3L1PA 2OFYA 3PXPA 1WH6A 3OMTA 2FJRA 3QYXA 2PUCA 2HINA 3FYMA 3GBFA 2MEZA 1JH9A 1ZZ9A 2WIUB 1QQAA 1JFTA 3DNVB 3IVPA 3KJXA 2CROA 1HF0A 2ICPA 3JXDL 1YSEA 2MQKA 3ZHIA 3CROL 3GN5A 2ICTA 2KEIA 3ZKCA 1AU7A 2O4AA 2L49A 3LISA 2CSFA 4YG7B 3U3WA 4I8TA 1ADRA 1PNRA 4JCXA 4X4IA 1R69A 2LYPA 3JXBC 1WIZA 2KEKA 1Y7YA 4Z5DA 3OP9A 2PUEA 1PRVA 1ZZ8A 3QF3A 1RIOA 1X2LA 4J1XA 4Z5CA 1S7EA 3B7HA 4GQMA 1E3OC 2O49A 3FMYA 1CQTA 1QQBA 3HZIB 4I6UA 4F8DA 2XJ3A 1RPEL 2XSDC 1WETA 2EF8A 4IVZA 1BDIA 1RZSA 2GZUA 1Y9QA 2A6CA 4YBAA 2PIJA 3G5GA 3QWGA 4YG4A 3UFDA 1ZZBA 3QQ6A 2LCVA 1CJGA 2PUFA 1UTXA 2IU7A 1ZAYA 4X4FA 3CLCA 2XIUA 4PU4C 3O9XA 1PRUA 1DW9A 2B5AA 2PPXA 1ZPQA 2R63A 3R1FA 1RZRD 1JFSA 3F6WA 2KZ8A 3F51A 4NDWA 1B0NA 2LYJA 2R1JL 2GRMA 1DWKA 2H8RA 2JVLA 4I6TA 2BNMA 4YG1A 1LCCA 1NERA 2OR1L 1ZZ6A 1SQ8A 4OB4A 5K98B 3OQNA 3G7DA 3ZHMA 5A7LA 1ZZ7A 1UXCA 4I6RA 1ZZCA 4MCTA 3SCGA 1ZS4A 2EBYA 2LYKA 4FBIA 4X4DA 2IUOA 1ZUGA 2EWTA 4X4BA 3F52A 3FYAA 3KXAA 2L8NA 2AXZA 1QP4A 2PUDA 2IVBA 2LYRA 2PUGA 4O8BA 4JCYA 4X4GA 1LCDA 3SCFA 1RZRA 3RZZA 4IWRA 2XCJA 1ZVVA 4Z58A 1R63A 3VK0A 1IC8A 1QP0A 4X4HA 4J1WA 4FN3A 2AUWA 1XWRA 4PU7A 3JXCL 3OQMA 2PUBA 2BNOA 2LYSA 3H5TA 2KPJA 3GN5B 2BJCA 2KEJA 1L1MA 2WUSR 3BS3A 4PU8A 2PE5A 2JCGA 3MLFA 2BNNA 4IA8A 1OCTC 1POUA 2XI8A 4MCXA 3KZ3A 2AXUA 1JWLA 2HSGA 2AXVA 1OSLA 3LFPA
chains in the Genus database with same CATH superfamily
3S8QA 1X57A 2LYLA 5DRYA 1UXDA 1LLIA 3NROA 2LLWA 1BDHA 4EZIA 3GZCA 3FYMA 3GBFA 2MEZA 1QQAA 1JFTA 3IVPA 2CROA 1HF0A 3GN5A 1AU7A 3LISA 2CSFA 5DTQA 4I8TA 1PNRA 4JCXA 1R69A 1Y7YA 3OP9A 1X2LA 2L1PA 4Q2JA 3B7HA 1E3OC 2O49A 3FMYA 1QQBA 3HZIB 4F8DA 2EF8A 1BDIA 1RZSA 1Y9QA 1ZZBA 5DT2A 2XIUA 3NDBB 1QZXA 1RZRD 3F6WA 2KZ8A 2GRMA 2H8RA 4I6TA 2VEOA 4EKGA 1NERA 4OB4A 5K98B 1ZZ7A 1UXCA 4MCTA 1ZZCA 1ZS4A 2EBYA 1ZUGA 2EWTA 3FYAA 1QP4A 2PUGA 4IWRA 3RZZA 3SX0A 4FN3A 4ER3A 2V3CC 2BNOA 3H5TA 2KPJA 3BS3A 3DM5A 3GZDA 4PU8A 2PE5A 2BNNA 4IA8A 4ER6A 3A9ZA 4DE9A 2AWIA 5DSXA 3D1NI 4Y42A 1NEQA 3KL4A 4YARA 4WVLA 3SCHA 4X4CA 3CECA 3BD1A 2AW6A 4Z59A 4Z5HA 1WH8A 3VWSA 4DE8A 3LQXA 2D5VA 2OFYA 3OMTA 2FJRA 5JUWA 2J7UA 1JH9A 2ICPA 1YSEA 1MFQC 2MQKA 2PXKA 2KEIA 1ADRA 4X4IA 3TEPA 3TFLA 1PRVA 1RIOA 4Z5CA 1S7EA 2PXUA 1CQTA 2PXDA 2XJ3A 1WETA 3R09A 5DRTA 2PIJA 3A9XA 5DTMA 3CLCA 2IU7A 1PRUA 1DW9A 3M9LA 4ER5A 1U2ZA 3SR4A 1JFSA 3OWQA 1B0NA 2LYJA 2JVLA 2BNMA 1LCCA 1SQ8A 5A7LA 4I6RA 4X4DA 4FBIA 4X4BA 3F52A 2PXVA 3NXHA 2XXQA 2PUDA 2IVBA 4JCYA 4X4GA 1LCDA 2PXTA 2XCJA 1ZVVA 4Z58A 1IC8A 1QP0A 2AUWA 4PU7A 3OQMA 2LYSA 1OCTC 2PXBA 1POUA 2XI8A 1JWLA 3GUUA 3LFPA 1PERL 2HCSA 3G0TA 3TRBA 3QFIA 4X4EA 1EFAA 4JQDA 3OQOA 2IVQA 4ER0A 4PU3C 2ODRD 1QP7A 2MXDA 2PUAA 3PXPA 2PUCA 2J7WA 4ER7A 2LNMA 1DULA 2ICTA 3ZKCA 2O4AA 4EK9A 2LYPA 2PUEA 1WIZA 2PXFA 4J1XA 1RPEL 2XSDC 2XXPA 3PE5A 2GZUA 2HCNA 4YG4A 4YBAA 3QWGA 4EQZA 3NZLA 3QQ6A 1CJGA 4X4FA 4PU4C 2B5AA 2PXLA 4YG1A 3MEJA 4EKIA 1ZZ6A 3SCGA 2FFHA 3KXAA 2L8NA 3GZDC 2PXPA 4O8BA 3OKZA 3A9YA 1R63A 2YBDA 2WUSR 5DTRA 2PXEA 3QOXA 3ME5A 3KZ3A 2XXAA 2HSGA 4HRAA 2LYQA 3EUSA 1LQCA 1LMB3 1VPWA 1PRAA 2GRLA 2IVGA 2IV1A 4GHJA 2O38A 1QPZA 1O4XA 4OBMA 2M4HA 3BDNA 1GT0C 2JQEA 3L1PA 1WH6A 3QYXA 2HINA 1ZZ9A 2WIUB 3DNVB 2HFZA 3KJXA 3JXDL 3ZHIA 3CROL 2L49A 4YG7B 3U3WA 3JXBC 2KEKA 4Z5DA 1ZZ8A 3QF3A 1HQ1A 4GQMA 3ZPXA 4I6UA 4IVZA 2A6CA 3G5GA 3UFDA 2LCVA 2PUFA 1UTXA 1ZAYA 3O9XA 3UWPA 2LLVA 2PPXA 1ZPQA 2R63A 3R1FA 1NW3A 3F51A 4NDWA 2R1JL 1DWKA 5GAHi 2OR1L 3OQNA 3G7DA 3ZHMA 2PXQA 2LYKA 2IUOA 2AXZA 2LYRA 3TELA 3SCFA 1RZRA 3VK0A 4X4HA 4J1WA 3QOWA 1XWRA 3JXCL 2PUBA 2BJCA 3GN5B 1L1MA 2KEJA 1QB2A 2JCGA 3MLFA 5GAGi 4MCXA 2AXUA 2AXVA 1OSLA
chains in the Genus database with same CATH topology
1PERL 2AWIA 3S8QA 2LYQA 1X57A 2LYLA 3TRBA 3D1NI 3EUSA 1LQCA 4Y42A 4X4EA 1EFAA 4JQDA 1LMB3 1UXDA 1NEQA 1LLIA 1VPWA 3OQOA 4YARA 1PRAA 1BDHA 2GRLA 2IVGA 3SCHA 2IV1A 4GHJA 2O38A 1QPZA 4X4CA 1O4XA 2IVQA 3CECA 3BD1A 2AW6A 4Z59A 4Z5HA 4PU3C 3BDNA 1QP7A 1GT0C 1WH8A 2PUAA 2D5VA 3L1PA 2OFYA 3PXPA 1WH6A 3OMTA 2FJRA 3QYXA 2PUCA 2HINA 3FYMA 3GBFA 2MEZA 1JH9A 1ZZ9A 2WIUB 1QQAA 1JFTA 3DNVB 3IVPA 3KJXA 2CROA 1HF0A 2ICPA 3JXDL 1YSEA 2MQKA 3ZHIA 3CROL 3GN5A 2ICTA 2KEIA 3ZKCA 1AU7A 2O4AA 2L49A 3LISA 2CSFA 4YG7B 3U3WA 4I8TA 1ADRA 1PNRA 4JCXA 4X4IA 1R69A 2LYPA 3JXBC 1WIZA 2KEKA 1Y7YA 4Z5DA 3OP9A 2PUEA 1PRVA 1ZZ8A 3QF3A 1RIOA 1X2LA 4J1XA 4Z5CA 1S7EA 3B7HA 4GQMA 1E3OC 2O49A 3FMYA 1CQTA 1QQBA 3HZIB 4I6UA 4F8DA 2XJ3A 1RPEL 2XSDC 1WETA 2EF8A 4IVZA 1BDIA 1RZSA 2GZUA 1Y9QA 2A6CA 4YBAA 2PIJA 3G5GA 3QWGA 4YG4A 3UFDA 1ZZBA 3QQ6A 2LCVA 1CJGA 2PUFA 1UTXA 2IU7A 1ZAYA 4X4FA 3CLCA 2XIUA 4PU4C 3O9XA 1PRUA 1DW9A 2B5AA 2PPXA 1ZPQA 2R63A 3R1FA 1RZRD 1JFSA 3F6WA 2KZ8A 3F51A 4NDWA 1B0NA 2LYJA 2R1JL 2GRMA 1DWKA 2H8RA 2JVLA 4I6TA 2BNMA 4YG1A 1LCCA 1NERA 2OR1L 1ZZ6A 1SQ8A 4OB4A 5K98B 3OQNA 3G7DA 3ZHMA 5A7LA 1ZZ7A 1UXCA 4I6RA 1ZZCA 4MCTA 3SCGA 1ZS4A 2EBYA 2LYKA 4FBIA 4X4DA 2IUOA 1ZUGA 2EWTA 4X4BA 3F52A 3FYAA 3KXAA 2L8NA 2AXZA 1QP4A 2PUDA 2IVBA 2LYRA 2PUGA 4O8BA 4JCYA 4X4GA 1LCDA 3SCFA 1RZRA 3RZZA 4IWRA 2XCJA 1ZVVA 4Z58A 1R63A 3VK0A 1IC8A 1QP0A 4X4HA 4J1WA 4FN3A 2AUWA 1XWRA 4PU7A 3JXCL 3OQMA 2PUBA 2BNOA 2LYSA 3H5TA 2KPJA 3GN5B 2BJCA 2KEJA 1L1MA 2WUSR 3BS3A 4PU8A 2PE5A 2JCGA 3MLFA 2BNNA 4IA8A 1OCTC 1POUA 2XI8A 4MCXA 3KZ3A 2AXUA 1JWLA 2HSGA 2AXVA 1OSLA 3LFPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PER L;  2AWI A;  3S8Q A;  2LYQ A;  1X57 A;  2LYL A;  3TRB A;  3D1N I;  3EUS A;  1LQC A;  4Y42 A;  4X4E A;  1EFA A;  4JQD A;  1LMB 3;  1UXD A;  1NEQ A;  1LLI A;  1VPW A;  3OQO A;  4YAR A;  1PRA A;  1BDH A;  2GRL A;  2IVG A;  3SCH A;  2IV1 A;  4GHJ A;  2O38 A;  1QPZ A;  4X4C A;  1O4X A;  2IVQ A;  3CEC A;  3BD1 A;  2AW6 A;  4Z59 A;  4Z5H A;  4PU3 C;  3BDN A;  1QP7 A;  1GT0 C;  1WH8 A;  2PUA A;  2D5V A;  3L1P A;  2OFY A;  3PXP A;  1WH6 A;  3OMT A;  2FJR A;  3QYX A;  2PUC A;  2HIN A;  3FYM A;  3GBF A;  2MEZ A;  1JH9 A;  1ZZ9 A;  2WIU B;  1QQA A;  1JFT A;  3DNV B;  3IVP A;  3KJX A;  2CRO A;  1HF0 A;  2ICP A;  3JXD L;  1YSE A;  2MQK A;  3ZHI A;  3CRO L;  3GN5 A;  2ICT A;  2KEI A;  3ZKC A;  1AU7 A;  2O4A A;  2L49 A;  3LIS A;  2CSF A;  4YG7 B;  3U3W A;  4I8T A;  1ADR A;  1PNR A;  4JCX A;  4X4I A;  1R69 A;  2LYP A;  3JXB C;  1WIZ A;  2KEK A;  1Y7Y A;  4Z5D A;  3OP9 A;  2PUE A;  1PRV A;  1ZZ8 A;  3QF3 A;  1RIO A;  1X2L A;  4J1X A;  4Z5C A;  1S7E A;  3B7H A;  4GQM A;  1E3O C;  2O49 A;  3FMY A;  1CQT A;  1QQB A;  3HZI B;  4I6U A;  4F8D A;  2XJ3 A;  1RPE L;  2XSD C;  1WET A;  2EF8 A;  4IVZ A;  1BDI A;  1RZS A;  2GZU A;  1Y9Q A;  2A6C A;  4YBA A;  2PIJ A;  3G5G A;  3QWG A;  4YG4 A;  3UFD A;  1ZZB A;  3QQ6 A;  2LCV A;  1CJG A;  2PUF A;  1UTX A;  2IU7 A;  1ZAY A;  4X4F A;  3CLC A;  2XIU A;  4PU4 C;  3O9X A;  1PRU A;  1DW9 A;  2B5A A;  2PPX A;  1ZPQ A;  2R63 A;  3R1F A;  1RZR D;  1JFS A;  3F6W A;  2KZ8 A;  3F51 A;  4NDW A;  1B0N A;  2LYJ A;  2R1J L;  2GRM A;  1DWK A;  2H8R A;  2JVL A;  4I6T A;  2BNM A;  4YG1 A;  1LCC A;  1NER A;  2OR1 L;  1ZZ6 A;  1SQ8 A;  4OB4 A;  5K98 B;  3OQN A;  3G7D A;  3ZHM A;  5A7L A;  1ZZ7 A;  1UXC A;  4I6R A;  1ZZC A;  4MCT A;  3SCG A;  1ZS4 A;  2EBY A;  2LYK A;  4FBI A;  4X4D A;  2IUO A;  1ZUG A;  2EWT A;  4X4B A;  3F52 A;  3FYA A;  3KXA A;  2L8N A;  2AXZ A;  1QP4 A;  2PUD A;  2IVB A;  2LYR A;  2PUG A;  4O8B A;  4JCY A;  4X4G A;  1LCD A;  3SCF A;  1RZR A;  3RZZ A;  4IWR A;  2XCJ A;  1ZVV A;  4Z58 A;  1R63 A;  3VK0 A;  1IC8 A;  1QP0 A;  4X4H A;  4J1W A;  4FN3 A;  2AUW A;  1XWR A;  4PU7 A;  3JXC L;  3OQM A;  2PUB A;  2BNO A;  2LYS A;  3H5T A;  2KPJ A;  3GN5 B;  2BJC A;  2KEJ A;  1L1M A;  2WUS R;  3BS3 A;  4PU8 A;  2PE5 A;  2JCG A;  3MLF A;  2BNN A;  4IA8 A;  1OCT C;  1POU A;  2XI8 A;  4MCX A;  3KZ3 A;  2AXU A;  1JWL A;  2HSG A;  2AXV A;  1OSL A;  3LFP A; 
#chains in the Genus database with same CATH topology
 3S8Q A;  1X57 A;  2LYL A;  5DRY A;  1UXD A;  1LLI A;  3NRO A;  2LLW A;  1BDH A;  4EZI A;  3GZC A;  3FYM A;  3GBF A;  2MEZ A;  1QQA A;  1JFT A;  3IVP A;  2CRO A;  1HF0 A;  3GN5 A;  1AU7 A;  3LIS A;  2CSF A;  5DTQ A;  4I8T A;  1PNR A;  4JCX A;  1R69 A;  1Y7Y A;  3OP9 A;  1X2L A;  2L1P A;  4Q2J A;  3B7H A;  1E3O C;  2O49 A;  3FMY A;  1QQB A;  3HZI B;  4F8D A;  2EF8 A;  1BDI A;  1RZS A;  1Y9Q A;  1ZZB A;  5DT2 A;  2XIU A;  3NDB B;  1QZX A;  1RZR D;  3F6W A;  2KZ8 A;  2GRM A;  2H8R A;  4I6T A;  2VEO A;  4EKG A;  1NER A;  4OB4 A;  5K98 B;  1ZZ7 A;  1UXC A;  4MCT A;  1ZZC A;  1ZS4 A;  2EBY A;  1ZUG A;  2EWT A;  3FYA A;  1QP4 A;  2PUG A;  4IWR A;  3RZZ A;  3SX0 A;  4FN3 A;  4ER3 A;  2V3C C;  2BNO A;  3H5T A;  2KPJ A;  3BS3 A;  3DM5 A;  3GZD A;  4PU8 A;  2PE5 A;  2BNN A;  4IA8 A;  4ER6 A;  3A9Z A;  4DE9 A;  2AWI A;  5DSX A;  3D1N I;  4Y42 A;  1NEQ A;  3KL4 A;  4YAR A;  4WVL A;  3SCH A;  4X4C A;  3CEC A;  3BD1 A;  2AW6 A;  4Z59 A;  4Z5H A;  1WH8 A;  3VWS A;  4DE8 A;  3LQX A;  2D5V A;  2OFY A;  3OMT A;  2FJR A;  5JUW A;  2J7U A;  1JH9 A;  2ICP A;  1YSE A;  1MFQ C;  2MQK A;  2PXK A;  2KEI A;  1ADR A;  4X4I A;  3TEP A;  3TFL A;  1PRV A;  1RIO A;  4Z5C A;  1S7E A;  2PXU A;  1CQT A;  2PXD A;  2XJ3 A;  1WET A;  3R09 A;  5DRT A;  2PIJ A;  3A9X A;  5DTM A;  3CLC A;  2IU7 A;  1PRU A;  1DW9 A;  3M9L A;  4ER5 A;  1U2Z A;  3SR4 A;  1JFS A;  3OWQ A;  1B0N A;  2LYJ A;  2JVL A;  2BNM A;  1LCC A;  1SQ8 A;  5A7L A;  4I6R A;  4X4D A;  4FBI A;  4X4B A;  3F52 A;  2PXV A;  3NXH A;  2XXQ A;  2PUD A;  2IVB A;  4JCY A;  4X4G A;  1LCD A;  2PXT A;  2XCJ A;  1ZVV A;  4Z58 A;  1IC8 A;  1QP0 A;  2AUW A;  4PU7 A;  3OQM A;  2LYS A;  1OCT C;  2PXB A;  1POU A;  2XI8 A;  1JWL A;  3GUU A;  3LFP A;  1PER L;  2HCS A;  3G0T A;  3TRB A;  3QFI A;  4X4E A;  1EFA A;  4JQD A;  3OQO A;  2IVQ A;  4ER0 A;  4PU3 C;  2ODR D;  1QP7 A;  2MXD A;  2PUA A;  3PXP A;  2PUC A;  2J7W A;  4ER7 A;  2LNM A;  1DUL A;  2ICT A;  3ZKC A;  2O4A A;  4EK9 A;  2LYP A;  2PUE A;  1WIZ A;  2PXF A;  4J1X A;  1RPE L;  2XSD C;  2XXP A;  3PE5 A;  2GZU A;  2HCN A;  4YG4 A;  4YBA A;  3QWG A;  4EQZ A;  3NZL A;  3QQ6 A;  1CJG A;  4X4F A;  4PU4 C;  2B5A A;  2PXL A;  4YG1 A;  3MEJ A;  4EKI A;  1ZZ6 A;  3SCG A;  2FFH A;  3KXA A;  2L8N A;  3GZD C;  2PXP A;  4O8B A;  3OKZ A;  3A9Y A;  1R63 A;  2YBD A;  2WUS R;  5DTR A;  2PXE A;  3QOX A;  3ME5 A;  3KZ3 A;  2XXA A;  2HSG A;  4HRA A;  2LYQ A;  3EUS A;  1LQC A;  1LMB 3;  1VPW A;  1PRA A;  2GRL A;  2IVG A;  2IV1 A;  4GHJ A;  2O38 A;  1QPZ A;  1O4X A;  4OBM A;  2M4H A;  3BDN A;  1GT0 C;  2JQE A;  3L1P A;  1WH6 A;  3QYX A;  2HIN A;  1ZZ9 A;  2WIU B;  3DNV B;  2HFZ A;  3KJX A;  3JXD L;  3ZHI A;  3CRO L;  2L49 A;  4YG7 B;  3U3W A;  3JXB C;  2KEK A;  4Z5D A;  1ZZ8 A;  3QF3 A;  1HQ1 A;  4GQM A;  3ZPX A;  4I6U A;  4IVZ A;  2A6C A;  3G5G A;  3UFD A;  2LCV A;  2PUF A;  1UTX A;  1ZAY A;  3O9X A;  3UWP A;  2LLV A;  2PPX A;  1ZPQ A;  2R63 A;  3R1F A;  1NW3 A;  3F51 A;  4NDW A;  2R1J L;  1DWK A;  5GAH i;  2OR1 L;  3OQN A;  3G7D A;  3ZHM A;  2PXQ A;  2LYK A;  2IUO A;  2AXZ A;  2LYR A;  3TEL A;  3SCF A;  1RZR A;  3VK0 A;  4X4H A;  4J1W A;  3QOW A;  1XWR A;  3JXC L;  2PUB A;  2BJC A;  3GN5 B;  1L1M A;  2KEJ A;  1QB2 A;  2JCG A;  3MLF A;  5GAG i;  4MCX A;  2AXU A;  2AXV A;  1OSL A; 
#chains in the Genus database with same CATH homology
 1PER L;  2AWI A;  3S8Q A;  2LYQ A;  1X57 A;  2LYL A;  3TRB A;  3D1N I;  3EUS A;  1LQC A;  4Y42 A;  4X4E A;  1EFA A;  4JQD A;  1LMB 3;  1UXD A;  1NEQ A;  1LLI A;  1VPW A;  3OQO A;  4YAR A;  1PRA A;  1BDH A;  2GRL A;  2IVG A;  3SCH A;  2IV1 A;  4GHJ A;  2O38 A;  1QPZ A;  4X4C A;  1O4X A;  2IVQ A;  3CEC A;  3BD1 A;  2AW6 A;  4Z59 A;  4Z5H A;  4PU3 C;  3BDN A;  1QP7 A;  1GT0 C;  1WH8 A;  2PUA A;  2D5V A;  3L1P A;  2OFY A;  3PXP A;  1WH6 A;  3OMT A;  2FJR A;  3QYX A;  2PUC A;  2HIN A;  3FYM A;  3GBF A;  2MEZ A;  1JH9 A;  1ZZ9 A;  2WIU B;  1QQA A;  1JFT A;  3DNV B;  3IVP A;  3KJX A;  2CRO A;  1HF0 A;  2ICP A;  3JXD L;  1YSE A;  2MQK A;  3ZHI A;  3CRO L;  3GN5 A;  2ICT A;  2KEI A;  3ZKC A;  1AU7 A;  2O4A A;  2L49 A;  3LIS A;  2CSF A;  4YG7 B;  3U3W A;  4I8T A;  1ADR A;  1PNR A;  4JCX A;  4X4I A;  1R69 A;  2LYP A;  3JXB C;  1WIZ A;  2KEK A;  1Y7Y A;  4Z5D A;  3OP9 A;  2PUE A;  1PRV A;  1ZZ8 A;  3QF3 A;  1RIO A;  1X2L A;  4J1X A;  4Z5C A;  1S7E A;  3B7H A;  4GQM A;  1E3O C;  2O49 A;  3FMY A;  1CQT A;  1QQB A;  3HZI B;  4I6U A;  4F8D A;  2XJ3 A;  1RPE L;  2XSD C;  1WET A;  2EF8 A;  4IVZ A;  1BDI A;  1RZS A;  2GZU A;  1Y9Q A;  2A6C A;  4YBA A;  2PIJ A;  3G5G A;  3QWG A;  4YG4 A;  3UFD A;  1ZZB A;  3QQ6 A;  2LCV A;  1CJG A;  2PUF A;  1UTX A;  2IU7 A;  1ZAY A;  4X4F A;  3CLC A;  2XIU A;  4PU4 C;  3O9X A;  1PRU A;  1DW9 A;  2B5A A;  2PPX A;  1ZPQ A;  2R63 A;  3R1F A;  1RZR D;  1JFS A;  3F6W A;  2KZ8 A;  3F51 A;  4NDW A;  1B0N A;  2LYJ A;  2R1J L;  2GRM A;  1DWK A;  2H8R A;  2JVL A;  4I6T A;  2BNM A;  4YG1 A;  1LCC A;  1NER A;  2OR1 L;  1ZZ6 A;  1SQ8 A;  4OB4 A;  5K98 B;  3OQN A;  3G7D A;  3ZHM A;  5A7L A;  1ZZ7 A;  1UXC A;  4I6R A;  1ZZC A;  4MCT A;  3SCG A;  1ZS4 A;  2EBY A;  2LYK A;  4FBI A;  4X4D A;  2IUO A;  1ZUG A;  2EWT A;  4X4B A;  3F52 A;  3FYA A;  3KXA A;  2L8N A;  2AXZ A;  1QP4 A;  2PUD A;  2IVB A;  2LYR A;  2PUG A;  4O8B A;  4JCY A;  4X4G A;  1LCD A;  3SCF A;  1RZR A;  3RZZ A;  4IWR A;  2XCJ A;  1ZVV A;  4Z58 A;  1R63 A;  3VK0 A;  1IC8 A;  1QP0 A;  4X4H A;  4J1W A;  4FN3 A;  2AUW A;  1XWR A;  4PU7 A;  3JXC L;  3OQM A;  2PUB A;  2BNO A;  2LYS A;  3H5T A;  2KPJ A;  3GN5 B;  2BJC A;  2KEJ A;  1L1M A;  2WUS R;  3BS3 A;  4PU8 A;  2PE5 A;  2JCG A;  3MLF A;  2BNN A;  4IA8 A;  1OCT C;  1POU A;  2XI8 A;  4MCX A;  3KZ3 A;  2AXU A;  1JWL A;  2HSG A;  2AXV A;  1OSL A;  3LFP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...