4YG7B

Structure of fl autorepression promoter complex
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
69
structure length
69
Chain Sequence
FQKIYSPTQLANAMKLVRQQNGWTQSELAKKIGIKQATISNFENNPDNTTLTTFFKILQSLELSMTLCD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Antitoxin HipB
publication title HipBA-promoter structures reveal the basis of heritable multidrug tolerance.
pubmed doi rcsb
source organism Escherichia coli (strain k12)
molecule tags Transcription, transferase/dna
total genus 16
structure length 69
sequence length 69
chains with identical sequence C, E, G
ec nomenclature
pdb deposition date 2015-02-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF01381 HTH_3 Helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.260.40 Mainly Alpha Orthogonal Bundle 434 Repressor (Amino-terminal Domain) lambda repressor-like DNA-binding domains 4yg7B00
2O49A 2A6CA 3ZHIA 2BJCA 2XSDC 3LISA 4Z59A 3CECA 3KZ3A 4I6UA 4PU7A 3SCHA 1PRUA 4I6TA 2PPXA 2BNMA 1ZZ8A 2CSFA 2KPJA 2O38A 4FBIA 3ZKCA 3G7DA 1X57A 4NDWA 2ICPA 2XJ3A 2L8NA 3PXPA 2GZUA 3F6WA 3SCFA 2KEKA 1IC8A 2XCJA 1NEQA 1ZZ7A 4FN3A 3HZIB 2WUSR 1JFSA 3F52A 4IWRA 1ZZ6A 4YG4A 1QP7A 1ZVVA 1UXDA 2IVGA 3H5TA 2B5AA 3QF3A 4Z5DA 3EUSA 4OB4A 1L1MA 1WH8A 3L1PA 1QQBA 3FMYA 1AU7A 4F8DA 4JCXA 3JXCL 1ZZCA 4J1WA 1LCCA 3U3WA 2LYJA 1RZSA 1RIOA 2WIUB 3OMTA 2CROA 2R63A 1O4XA 1S7EA 3R1FA 3B7HA 3F51A 1RPEL 4I6RA 3D1NI 3OQOA 2R1JL 1LQCA 1YSEA 2BNOA 4IA8A 4PU3C 1BDIA 4X4DA 1OCTC 2AXZA 2IV1A 2FJRA 3FYAA 3QQ6A 1WIZA 1CQTA 1JWLA 3G5GA 2PUDA 2PUGA 1WH6A 1CJGA 2AXUA 1QPZA 3SCGA 3RZZA 3FYMA 3VK0A 1ZUGA 3OP9A 1NERA 2BNNA 2L49A 3GN5B 3BD1A 4GQMA 1E3OC 1ZZ9A 4X4IA 1LMB3 1ADRA 2ICTA 1POUA 1ZPQA 1UTXA 3BDNA 3O9XA 2PUCA 1DWKA 2XI8A 4X4EA 4I8TA 2JVLA 4GHJA 2LYSA 1UXCA 2IVQA 2GRLA 1ZAYA 1QP4A 1PERL 4J1XA 1RZRA 1XWRA 3KJXA 2PE5A 1EFAA 4X4FA 1LCDA 2AUWA 3DNVB 3GN5A 4YG1A 4X4HA 1JH9A 2EF8A 2PUAA 4YG7B 3S8QA 2IVBA 2KEIA 5K98B 2D5VA 2LYQA 3QWGA 1R63A 2GRMA 3LFPA 2OR1L 2IUOA 2AXVA 4YARA 2JCGA 1HF0A 3OQMA 1LLIA 1ZS4A 3ZHMA 3GBFA 2AW6A 2LYLA 5A7LA 1B0NA 4Y42A 2MQKA 4JQDA 3IVPA 4PU8A 1BDHA 2OFYA 4X4CA 1RZRD 4MCTA 2XIUA 1QP0A 2EBYA 3BS3A 3TRBA 1QQAA 4O8BA 2MEZA 2PUBA 2KZ8A 2PUFA 1PRVA 3MLFA 1VPWA 3JXDL 2LYRA 4MCXA 4Z58A 3OQNA 1SQ8A 1ZZBA 2LYPA 3KXAA 4X4BA 2HSGA 1JFTA 2IU7A 3JXBC 4X4GA 1WETA 3CLCA 1OSLA 2PUEA 3UFDA 3CROL 1GT0C 4PU4C 1DW9A 4YBAA 4IVZA 4Z5CA 2AWIA 2HINA 4JCYA 1Y9QA 1PNRA 2LCVA 2EWTA 4Z5HA 3QYXA 2PIJA 1R69A 2LYKA 2H8RA 2KEJA 2O4AA 1X2LA 1Y7YA 1PRAA
chains in the Genus database with same CATH superfamily
2FFHA 2XSDC 4I6UA 2BNMA 2KPJA 3ZKCA 2ICPA 2JQEA 2KEKA 2ODRD 4FN3A 3HZIB 2WUSR 1JFSA 3QOXA 4OB4A 1U2ZA 3L1PA 3ZPXA 1ZZCA 3U3WA 1RZSA 2HCNA 3R1FA 3B7HA 1RPEL 3DM5A 3OQOA 1BDIA 4X4DA 2FJRA 3GZDC 3FYAA 3QQ6A 1WIZA 4EK9A 3ME5A 1JWLA 1CJGA 3SX0A 2AXUA 3FYMA 1ZUGA 3OP9A 3M9LA 3A9XA 3GN5B 4GQMA 1E3OC 1ZZ9A 3OKZA 1LMB3 1POUA 3MEJA 3NROA 3G0TA 1PERL 4J1XA 4DE9A 1RZRA 1XWRA 3KJXA 1EFAA 4X4FA 4EZIA 2PUAA 2LYQA 2HFZA 3LFPA 2AXVA 4YARA 1HF0A 2PXLA 2AW6A 2PXBA 2M4HA 4JQDA 2LLWA 4X4CA 1RZRD 4MCTA 1QP0A 2EBYA 1PRVA 3MLFA 3JXDL 3OQNA 5DTRA 2LYPA 3A9ZA 2IU7A 3JXBC 2PUEA 4IVZA 1Y9QA 1PNRA 2LCVA 5GAHi 4Z5HA 2BJCA 1PRAA 2O49A 2A6CA 3KZ3A 1X57A 2L8NA 3R09A 4IWRA 4YG4A 1QP7A 1UXDA 4Z5DA 3EUSA 3NDBB 1L1MA 1WH8A 1AU7A 5DT2A 1RIOA 1O4XA 2CROA 1S7EA 3D1NI 2R1JL 4PU3C 3OWQA 1CQTA 3GZCA 1WH6A 1Y7YA 4ER7A 1ZPQA 3O9XA 2XXAA 4X4EA 4I8TA 4GHJA 4Q2JA 2LYSA 1LCDA 2AUWA 3A9YA 4YG1A 4X4HA 3S8QA 4ER5A 2IVBA 2PXKA 5K98B 5DRTA 2GRMA 2OR1L 2LLVA 5A7LA 4PU8A 1BDHA 2PXEA 1QB2A 3TFLA 1QQAA 2HCSA 4DE8A 2XXPA 2PUBA 2LYRA 1SQ8A 5DRYA 1WETA 1OSLA 1GT0C 1DW9A 2HINA 2EWTA 3QYXA 2PIJA 2LYKA 1X2LA 3ZHMA 4OBMA 3NZLA 3VWSA 3CECA 3SCHA 4PU7A 2YBDA 1PRUA 4I6TA 4FBIA 1ZZ8A 2CSFA 2O38A 2XJ3A 5DTQA 3PXPA 2GZUA 3F6WA 3KL4A 1NEQA 1ZZ7A 2PXPA 2IVGA 2B5AA 4JCXA 2J7UA 3JXCL 2PXQA 4J1WA 1LCCA 2MXDA 2WIUB 3OMTA 3F51A 3TEPA 1LQCA 1YSEA 2BNOA 1OCTC 2AXZA 4WVLA 3G5GA 2PUGA 3RZZA 3VK0A 1NERA 5GAGi 2BNNA 2L49A 3BD1A 4X4IA 2ICTA 1UTXA 3TELA 2JVLA 4EKIA 1UXCA 1ZAYA 2GRLA 3GZDA 3DNVB 1JH9A 4YG7B 2KEIA 3GUUA 2D5VA 1R63A 2IUOA 2JCGA 3OQMA 1LLIA 1ZS4A 2LYLA 3IVPA 2V3CC 2OFYA 3QOWA 4ER3A 4O8BA 2KZ8A 2PUFA 4Z58A 4HRAA 1ZZBA 3KXAA 4X4BA 2PXUA 1JFTA 3CLCA 4PU4C 4YBAA 4Z5CA 4JCYA 2AWIA 1HQ1A 2J7WA 2KEJA 2VEOA 4EQZA 2MQKA 4ER0A 3ZHIA 3LISA 4Z59A 1NW3A 2PXVA 5DTMA 2PPXA 5JUWA 3G7DA 4NDWA 3SCFA 1IC8A 2XCJA 4EKGA 3F52A 1ZZ6A 1ZVVA 3H5TA 3QF3A 1QQBA 3FMYA 4F8DA 2LYJA 2R63A 4I6RA 4IA8A 2IV1A 4ER6A 2PUDA 1QPZA 3SCGA 1ADRA 1MFQC 1DULA 3BDNA 2PUCA 2L1PA 1DWKA 2XI8A 2PXTA 2IVQA 1QP4A 3UWPA 3SR4A 2PE5A 3GN5A 1QZXA 2EF8A 3QWGA 3GBFA 3NXHA 4Y42A 3LQXA 3PE5A 2XIUA 3BS3A 3TRBA 2MEZA 1VPWA 4MCXA 2XXQA 2HSGA 3CROL 4X4GA 3UFDA 5DSXA 3QFIA 2PXFA 2LNMA 2PXDA 1R69A 2H8RA 2O4AA 1B0NA
chains in the Genus database with same CATH topology
2O49A 2A6CA 3ZHIA 2BJCA 2XSDC 3LISA 4Z59A 3CECA 3KZ3A 4I6UA 4PU7A 3SCHA 1PRUA 4I6TA 2PPXA 2BNMA 1ZZ8A 2CSFA 2KPJA 2O38A 4FBIA 3ZKCA 3G7DA 1X57A 4NDWA 2ICPA 2XJ3A 2L8NA 3PXPA 2GZUA 3F6WA 3SCFA 2KEKA 1IC8A 2XCJA 1NEQA 1ZZ7A 4FN3A 3HZIB 2WUSR 1JFSA 3F52A 4IWRA 1ZZ6A 4YG4A 1QP7A 1ZVVA 1UXDA 2IVGA 3H5TA 2B5AA 3QF3A 4Z5DA 3EUSA 4OB4A 1L1MA 1WH8A 3L1PA 1QQBA 3FMYA 1AU7A 4F8DA 4JCXA 3JXCL 1ZZCA 4J1WA 1LCCA 3U3WA 2LYJA 1RZSA 1RIOA 2WIUB 3OMTA 2CROA 2R63A 1O4XA 1S7EA 3R1FA 3B7HA 3F51A 1RPEL 4I6RA 3D1NI 3OQOA 2R1JL 1LQCA 1YSEA 2BNOA 4IA8A 4PU3C 1BDIA 4X4DA 1OCTC 2AXZA 2IV1A 2FJRA 3FYAA 3QQ6A 1WIZA 1CQTA 1JWLA 3G5GA 2PUDA 2PUGA 1WH6A 1CJGA 2AXUA 1QPZA 3SCGA 3RZZA 3FYMA 3VK0A 1ZUGA 3OP9A 1NERA 2BNNA 2L49A 3GN5B 3BD1A 4GQMA 1E3OC 1ZZ9A 4X4IA 1LMB3 1ADRA 2ICTA 1POUA 1ZPQA 1UTXA 3BDNA 3O9XA 2PUCA 1DWKA 2XI8A 4X4EA 4I8TA 2JVLA 4GHJA 2LYSA 1UXCA 2IVQA 2GRLA 1ZAYA 1QP4A 1PERL 4J1XA 1RZRA 1XWRA 3KJXA 2PE5A 1EFAA 4X4FA 1LCDA 2AUWA 3DNVB 3GN5A 4YG1A 4X4HA 1JH9A 2EF8A 2PUAA 4YG7B 3S8QA 2IVBA 2KEIA 5K98B 2D5VA 2LYQA 3QWGA 1R63A 2GRMA 3LFPA 2OR1L 2IUOA 2AXVA 4YARA 2JCGA 1HF0A 3OQMA 1LLIA 1ZS4A 3ZHMA 3GBFA 2AW6A 2LYLA 5A7LA 1B0NA 4Y42A 2MQKA 4JQDA 3IVPA 4PU8A 1BDHA 2OFYA 4X4CA 1RZRD 4MCTA 2XIUA 1QP0A 2EBYA 3BS3A 3TRBA 1QQAA 4O8BA 2MEZA 2PUBA 2KZ8A 2PUFA 1PRVA 3MLFA 1VPWA 3JXDL 2LYRA 4MCXA 4Z58A 3OQNA 1SQ8A 1ZZBA 2LYPA 3KXAA 4X4BA 2HSGA 1JFTA 2IU7A 3JXBC 4X4GA 1WETA 3CLCA 1OSLA 2PUEA 3UFDA 3CROL 1GT0C 4PU4C 1DW9A 4YBAA 4IVZA 4Z5CA 2AWIA 2HINA 4JCYA 1Y9QA 1PNRA 2LCVA 2EWTA 4Z5HA 3QYXA 2PIJA 1R69A 2LYKA 2H8RA 2KEJA 2O4AA 1X2LA 1Y7YA 1PRAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O49 A;  2A6C A;  3ZHI A;  2BJC A;  2XSD C;  3LIS A;  4Z59 A;  3CEC A;  3KZ3 A;  4I6U A;  4PU7 A;  3SCH A;  1PRU A;  4I6T A;  2PPX A;  2BNM A;  1ZZ8 A;  2CSF A;  2KPJ A;  2O38 A;  4FBI A;  3ZKC A;  3G7D A;  1X57 A;  4NDW A;  2ICP A;  2XJ3 A;  2L8N A;  3PXP A;  2GZU A;  3F6W A;  3SCF A;  2KEK A;  1IC8 A;  2XCJ A;  1NEQ A;  1ZZ7 A;  4FN3 A;  3HZI B;  2WUS R;  1JFS A;  3F52 A;  4IWR A;  1ZZ6 A;  4YG4 A;  1QP7 A;  1ZVV A;  1UXD A;  2IVG A;  3H5T A;  2B5A A;  3QF3 A;  4Z5D A;  3EUS A;  4OB4 A;  1L1M A;  1WH8 A;  3L1P A;  1QQB A;  3FMY A;  1AU7 A;  4F8D A;  4JCX A;  3JXC L;  1ZZC A;  4J1W A;  1LCC A;  3U3W A;  2LYJ A;  1RZS A;  1RIO A;  2WIU B;  3OMT A;  2CRO A;  2R63 A;  1O4X A;  1S7E A;  3R1F A;  3B7H A;  3F51 A;  1RPE L;  4I6R A;  3D1N I;  3OQO A;  2R1J L;  1LQC A;  1YSE A;  2BNO A;  4IA8 A;  4PU3 C;  1BDI A;  4X4D A;  1OCT C;  2AXZ A;  2IV1 A;  2FJR A;  3FYA A;  3QQ6 A;  1WIZ A;  1CQT A;  1JWL A;  3G5G A;  2PUD A;  2PUG A;  1WH6 A;  1CJG A;  2AXU A;  1QPZ A;  3SCG A;  3RZZ A;  3FYM A;  3VK0 A;  1ZUG A;  3OP9 A;  1NER A;  2BNN A;  2L49 A;  3GN5 B;  3BD1 A;  4GQM A;  1E3O C;  1ZZ9 A;  4X4I A;  1LMB 3;  1ADR A;  2ICT A;  1POU A;  1ZPQ A;  1UTX A;  3BDN A;  3O9X A;  2PUC A;  1DWK A;  2XI8 A;  4X4E A;  4I8T A;  2JVL A;  4GHJ A;  2LYS A;  1UXC A;  2IVQ A;  2GRL A;  1ZAY A;  1QP4 A;  1PER L;  4J1X A;  1RZR A;  1XWR A;  3KJX A;  2PE5 A;  1EFA A;  4X4F A;  1LCD A;  2AUW A;  3DNV B;  3GN5 A;  4YG1 A;  4X4H A;  1JH9 A;  2EF8 A;  2PUA A;  4YG7 B;  3S8Q A;  2IVB A;  2KEI A;  5K98 B;  2D5V A;  2LYQ A;  3QWG A;  1R63 A;  2GRM A;  3LFP A;  2OR1 L;  2IUO A;  2AXV A;  4YAR A;  2JCG A;  1HF0 A;  3OQM A;  1LLI A;  1ZS4 A;  3ZHM A;  3GBF A;  2AW6 A;  2LYL A;  5A7L A;  1B0N A;  4Y42 A;  2MQK A;  4JQD A;  3IVP A;  4PU8 A;  1BDH A;  2OFY A;  4X4C A;  1RZR D;  4MCT A;  2XIU A;  1QP0 A;  2EBY A;  3BS3 A;  3TRB A;  1QQA A;  4O8B A;  2MEZ A;  2PUB A;  2KZ8 A;  2PUF A;  1PRV A;  3MLF A;  1VPW A;  3JXD L;  2LYR A;  4MCX A;  4Z58 A;  3OQN A;  1SQ8 A;  1ZZB A;  2LYP A;  3KXA A;  4X4B A;  2HSG A;  1JFT A;  2IU7 A;  3JXB C;  4X4G A;  1WET A;  3CLC A;  1OSL A;  2PUE A;  3UFD A;  3CRO L;  1GT0 C;  4PU4 C;  1DW9 A;  4YBA A;  4IVZ A;  4Z5C A;  2AWI A;  2HIN A;  4JCY A;  1Y9Q A;  1PNR A;  2LCV A;  2EWT A;  4Z5H A;  3QYX A;  2PIJ A;  1R69 A;  2LYK A;  2H8R A;  2KEJ A;  2O4A A;  1X2L A;  1Y7Y A;  1PRA A; 
#chains in the Genus database with same CATH topology
 2FFH A;  2XSD C;  4I6U A;  2BNM A;  2KPJ A;  3ZKC A;  2ICP A;  2JQE A;  2KEK A;  2ODR D;  4FN3 A;  3HZI B;  2WUS R;  1JFS A;  3QOX A;  4OB4 A;  1U2Z A;  3L1P A;  3ZPX A;  1ZZC A;  3U3W A;  1RZS A;  2HCN A;  3R1F A;  3B7H A;  1RPE L;  3DM5 A;  3OQO A;  1BDI A;  4X4D A;  2FJR A;  3GZD C;  3FYA A;  3QQ6 A;  1WIZ A;  4EK9 A;  3ME5 A;  1JWL A;  1CJG A;  3SX0 A;  2AXU A;  3FYM A;  1ZUG A;  3OP9 A;  3M9L A;  3A9X A;  3GN5 B;  4GQM A;  1E3O C;  1ZZ9 A;  3OKZ A;  1LMB 3;  1POU A;  3MEJ A;  3NRO A;  3G0T A;  1PER L;  4J1X A;  4DE9 A;  1RZR A;  1XWR A;  3KJX A;  1EFA A;  4X4F A;  4EZI A;  2PUA A;  2LYQ A;  2HFZ A;  3LFP A;  2AXV A;  4YAR A;  1HF0 A;  2PXL A;  2AW6 A;  2PXB A;  2M4H A;  4JQD A;  2LLW A;  4X4C A;  1RZR D;  4MCT A;  1QP0 A;  2EBY A;  1PRV A;  3MLF A;  3JXD L;  3OQN A;  5DTR A;  2LYP A;  3A9Z A;  2IU7 A;  3JXB C;  2PUE A;  4IVZ A;  1Y9Q A;  1PNR A;  2LCV A;  5GAH i;  4Z5H A;  2BJC A;  1PRA A;  2O49 A;  2A6C A;  3KZ3 A;  1X57 A;  2L8N A;  3R09 A;  4IWR A;  4YG4 A;  1QP7 A;  1UXD A;  4Z5D A;  3EUS A;  3NDB B;  1L1M A;  1WH8 A;  1AU7 A;  5DT2 A;  1RIO A;  1O4X A;  2CRO A;  1S7E A;  3D1N I;  2R1J L;  4PU3 C;  3OWQ A;  1CQT A;  3GZC A;  1WH6 A;  1Y7Y A;  4ER7 A;  1ZPQ A;  3O9X A;  2XXA A;  4X4E A;  4I8T A;  4GHJ A;  4Q2J A;  2LYS A;  1LCD A;  2AUW A;  3A9Y A;  4YG1 A;  4X4H A;  3S8Q A;  4ER5 A;  2IVB A;  2PXK A;  5K98 B;  5DRT A;  2GRM A;  2OR1 L;  2LLV A;  5A7L A;  4PU8 A;  1BDH A;  2PXE A;  1QB2 A;  3TFL A;  1QQA A;  2HCS A;  4DE8 A;  2XXP A;  2PUB A;  2LYR A;  1SQ8 A;  5DRY A;  1WET A;  1OSL A;  1GT0 C;  1DW9 A;  2HIN A;  2EWT A;  3QYX A;  2PIJ A;  2LYK A;  1X2L A;  3ZHM A;  4OBM A;  3NZL A;  3VWS A;  3CEC A;  3SCH A;  4PU7 A;  2YBD A;  1PRU A;  4I6T A;  4FBI A;  1ZZ8 A;  2CSF A;  2O38 A;  2XJ3 A;  5DTQ A;  3PXP A;  2GZU A;  3F6W A;  3KL4 A;  1NEQ A;  1ZZ7 A;  2PXP A;  2IVG A;  2B5A A;  4JCX A;  2J7U A;  3JXC L;  2PXQ A;  4J1W A;  1LCC A;  2MXD A;  2WIU B;  3OMT A;  3F51 A;  3TEP A;  1LQC A;  1YSE A;  2BNO A;  1OCT C;  2AXZ A;  4WVL A;  3G5G A;  2PUG A;  3RZZ A;  3VK0 A;  1NER A;  5GAG i;  2BNN A;  2L49 A;  3BD1 A;  4X4I A;  2ICT A;  1UTX A;  3TEL A;  2JVL A;  4EKI A;  1UXC A;  1ZAY A;  2GRL A;  3GZD A;  3DNV B;  1JH9 A;  4YG7 B;  2KEI A;  3GUU A;  2D5V A;  1R63 A;  2IUO A;  2JCG A;  3OQM A;  1LLI A;  1ZS4 A;  2LYL A;  3IVP A;  2V3C C;  2OFY A;  3QOW A;  4ER3 A;  4O8B A;  2KZ8 A;  2PUF A;  4Z58 A;  4HRA A;  1ZZB A;  3KXA A;  4X4B A;  2PXU A;  1JFT A;  3CLC A;  4PU4 C;  4YBA A;  4Z5C A;  4JCY A;  2AWI A;  1HQ1 A;  2J7W A;  2KEJ A;  2VEO A;  4EQZ A;  2MQK A;  4ER0 A;  3ZHI A;  3LIS A;  4Z59 A;  1NW3 A;  2PXV A;  5DTM A;  2PPX A;  5JUW A;  3G7D A;  4NDW A;  3SCF A;  1IC8 A;  2XCJ A;  4EKG A;  3F52 A;  1ZZ6 A;  1ZVV A;  3H5T A;  3QF3 A;  1QQB A;  3FMY A;  4F8D A;  2LYJ A;  2R63 A;  4I6R A;  4IA8 A;  2IV1 A;  4ER6 A;  2PUD A;  1QPZ A;  3SCG A;  1ADR A;  1MFQ C;  1DUL A;  3BDN A;  2PUC A;  2L1P A;  1DWK A;  2XI8 A;  2PXT A;  2IVQ A;  1QP4 A;  3UWP A;  3SR4 A;  2PE5 A;  3GN5 A;  1QZX A;  2EF8 A;  3QWG A;  3GBF A;  3NXH A;  4Y42 A;  3LQX A;  3PE5 A;  2XIU A;  3BS3 A;  3TRB A;  2MEZ A;  1VPW A;  4MCX A;  2XXQ A;  2HSG A;  3CRO L;  4X4G A;  3UFD A;  5DSX A;  3QFI A;  2PXF A;  2LNM A;  2PXD A;  1R69 A;  2H8R A;  2O4A A;  1B0N A; 
#chains in the Genus database with same CATH homology
 2O49 A;  2A6C A;  3ZHI A;  2BJC A;  2XSD C;  3LIS A;  4Z59 A;  3CEC A;  3KZ3 A;  4I6U A;  4PU7 A;  3SCH A;  1PRU A;  4I6T A;  2PPX A;  2BNM A;  1ZZ8 A;  2CSF A;  2KPJ A;  2O38 A;  4FBI A;  3ZKC A;  3G7D A;  1X57 A;  4NDW A;  2ICP A;  2XJ3 A;  2L8N A;  3PXP A;  2GZU A;  3F6W A;  3SCF A;  2KEK A;  1IC8 A;  2XCJ A;  1NEQ A;  1ZZ7 A;  4FN3 A;  3HZI B;  2WUS R;  1JFS A;  3F52 A;  4IWR A;  1ZZ6 A;  4YG4 A;  1QP7 A;  1ZVV A;  1UXD A;  2IVG A;  3H5T A;  2B5A A;  3QF3 A;  4Z5D A;  3EUS A;  4OB4 A;  1L1M A;  1WH8 A;  3L1P A;  1QQB A;  3FMY A;  1AU7 A;  4F8D A;  4JCX A;  3JXC L;  1ZZC A;  4J1W A;  1LCC A;  3U3W A;  2LYJ A;  1RZS A;  1RIO A;  2WIU B;  3OMT A;  2CRO A;  2R63 A;  1O4X A;  1S7E A;  3R1F A;  3B7H A;  3F51 A;  1RPE L;  4I6R A;  3D1N I;  3OQO A;  2R1J L;  1LQC A;  1YSE A;  2BNO A;  4IA8 A;  4PU3 C;  1BDI A;  4X4D A;  1OCT C;  2AXZ A;  2IV1 A;  2FJR A;  3FYA A;  3QQ6 A;  1WIZ A;  1CQT A;  1JWL A;  3G5G A;  2PUD A;  2PUG A;  1WH6 A;  1CJG A;  2AXU A;  1QPZ A;  3SCG A;  3RZZ A;  3FYM A;  3VK0 A;  1ZUG A;  3OP9 A;  1NER A;  2BNN A;  2L49 A;  3GN5 B;  3BD1 A;  4GQM A;  1E3O C;  1ZZ9 A;  4X4I A;  1LMB 3;  1ADR A;  2ICT A;  1POU A;  1ZPQ A;  1UTX A;  3BDN A;  3O9X A;  2PUC A;  1DWK A;  2XI8 A;  4X4E A;  4I8T A;  2JVL A;  4GHJ A;  2LYS A;  1UXC A;  2IVQ A;  2GRL A;  1ZAY A;  1QP4 A;  1PER L;  4J1X A;  1RZR A;  1XWR A;  3KJX A;  2PE5 A;  1EFA A;  4X4F A;  1LCD A;  2AUW A;  3DNV B;  3GN5 A;  4YG1 A;  4X4H A;  1JH9 A;  2EF8 A;  2PUA A;  4YG7 B;  3S8Q A;  2IVB A;  2KEI A;  5K98 B;  2D5V A;  2LYQ A;  3QWG A;  1R63 A;  2GRM A;  3LFP A;  2OR1 L;  2IUO A;  2AXV A;  4YAR A;  2JCG A;  1HF0 A;  3OQM A;  1LLI A;  1ZS4 A;  3ZHM A;  3GBF A;  2AW6 A;  2LYL A;  5A7L A;  1B0N A;  4Y42 A;  2MQK A;  4JQD A;  3IVP A;  4PU8 A;  1BDH A;  2OFY A;  4X4C A;  1RZR D;  4MCT A;  2XIU A;  1QP0 A;  2EBY A;  3BS3 A;  3TRB A;  1QQA A;  4O8B A;  2MEZ A;  2PUB A;  2KZ8 A;  2PUF A;  1PRV A;  3MLF A;  1VPW A;  3JXD L;  2LYR A;  4MCX A;  4Z58 A;  3OQN A;  1SQ8 A;  1ZZB A;  2LYP A;  3KXA A;  4X4B A;  2HSG A;  1JFT A;  2IU7 A;  3JXB C;  4X4G A;  1WET A;  3CLC A;  1OSL A;  2PUE A;  3UFD A;  3CRO L;  1GT0 C;  4PU4 C;  1DW9 A;  4YBA A;  4IVZ A;  4Z5C A;  2AWI A;  2HIN A;  4JCY A;  1Y9Q A;  1PNR A;  2LCV A;  2EWT A;  4Z5H A;  3QYX A;  2PIJ A;  1R69 A;  2LYK A;  2H8R A;  2KEJ A;  2O4A A;  1X2L A;  1Y7Y A;  1PRA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...