4YGIA

Crystal structure of suvh5 sra bound to fully hydroxymethylated cg dna
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
163
structure length
150
Chain Sequence
b'QIIGTVPGVEVGDEFQYRMELNLLGIHRPSQSGIDYMKDDGGELVATSIVSSGGYNDVLDNSDVLIYTGQGGNVGKKEPPKDQQLVTGNLALKNSINKKNPVRVIRGIKKNYVYDGLYLVEEYWEETGSHGKLVFKFKLRRIPGQPELPW'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase, H3 lysine-9 specific SUV
publication title Mechanistic insights into the recognition of 5-methylcytosine oxidation derivatives by the SUVH5 SRA domain
pubmed doi rcsb
source organism Arabidopsis thaliana
molecule tags Transferase/dna
total genus 34
structure length 150
sequence length 163
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02182 SAD_SRA SAD/SRA domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.30.280.30 Mainly Beta Roll PUA domain-like PUA domain-like 4ygiA00
3Q0FA 3Q0DA 3Q0CA 3Q0BX 4YGIA
chains in the Genus database with same CATH superfamily
3F8IA 2ZO2B 4PW7A 3Q0BX 4YGIA 3FDEA 3OLNA 4OC8A 3Q0CA 2PB7A 4PW6A 3CLZA 2ZO0B 2ZKGA 3Q0DA 3BI7A 4F0QA 4R28A 2ZO1B 4PW5A 4NJ5A 3Q0FA 3F8JB 2ZKFA 3DWHA 4F0PA 2ZKEA 4RZLA 2ZKDA
chains in the Genus database with same CATH topology
3Q0FA 4OC8A 3Q0DA 3Q0CA 3Q0BX 4F0PA 4F0QA 4YGIA 4R28A 4RZLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3Q0F A;  3Q0D A;  3Q0C A;  3Q0B X;  4YGI A; 
#chains in the Genus database with same CATH topology
 3F8I A;  2ZO2 B;  4PW7 A;  3Q0B X;  4YGI A;  3FDE A;  3OLN A;  4OC8 A;  3Q0C A;  2PB7 A;  4PW6 A;  3CLZ A;  2ZO0 B;  2ZKG A;  3Q0D A;  3BI7 A;  4F0Q A;  4R28 A;  2ZO1 B;  4PW5 A;  4NJ5 A;  3Q0F A;  3F8J B;  2ZKF A;  3DWH A;  4F0P A;  2ZKE A;  4RZL A;  2ZKD A; 
#chains in the Genus database with same CATH homology
 3Q0F A;  4OC8 A;  3Q0D A;  3Q0C A;  3Q0B X;  4F0P A;  4F0Q A;  4YGI A;  4R28 A;  4RZL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...