4YGZA

Crystal structure of the r111k:y134f:t54v:r132q:p39y:r59y mutant of human cellular retinoic acid binding protein ii with retinal at 2.06 angstrom resolution - visible light irradiated crystal -3rd cycle
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
137
structure length
137
Chain Sequence
b'PNFSGNWKIIRSENFEELLKVLGVNVMLRKIAVAAASKYAVEIKQEGDTFYIKVSTTVYTTEINFKVGEEFEEQTVDGRPCKSLVKWESENKMVCEQKLLKGEGPKTSWTKELTNDGELILTMTADDVVCTQVFVRE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Cellular retinoic acid-binding protein 2
publication title A Photoisomerizing Rhodopsin Mimic Observed at Atomic Resolution.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 34
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2015-02-26

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00061 Lipocalin Lipocalin / cytosolic fatty-acid binding protein family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4ygzA00
1IIUA 2YG2A 2G78A 5HZ5A 1MX8A 3VG4A 1NP4A 2AT0X 5EDCA 3DTQA 3TGBA 1KT4A 3C76X 5C0NA 4I3BA 1BRPA 2AT3X 2WEXA 4AZRA 2LKKA 3EYCA 4GETA 4OS8A 5AQ6A 4WFUA 5CE4A 2BLGA 1T68X 2RD7C 1EQDA 3FELA 3IA8A 1TVQA 3WJGA 2ASNX 3T1DA 4ZH9A 5LJDA 4YFPA 1A2DA 1OEJA 2E4JA 1JYDA 3TZSA 4IB6A 1JYJA 1JZUA 1BWYA 3JSQA 3HK1A 3BSZE 4XMHA 5LKFA 2PY1A 1MDCA 1CBRA 1SXYA 3PECA 2W2FA 1NP1A 1E5PA 5H9KA 3UEUA 1YWAA 1ICMA 3APUA 3F9DA 1FDQA 4HPAA 1ACDA 1XCAA 2LBVA 2JU8A 4ZHFA 1KOIA 4XMGA 1D2UA 1BLRA 5EPQA 2MM3A 4IB9A 4ORXA 1O8VA 1LIEA 4XMEA 2WQ9A 2EU7X 1EUOA 2IFBA 2P8GA 3FA8A 5H8TA 5BVQA 1DC9A 5FAZA 4YBPA 4NNSA 1T0VA 3FMZA 1QY1A 1FELA 4YFQA 1AB0A 2HYSA 2O62A 1EPBA 2CZUA 2RQ0A 1SA8A 3NR3A 3FLLA 3NP1A 4ZJ0A 2ALLX 3TGCA 1QABE 4IB8A 1S7DA 4HPDA 4A1YA 1OPBA 2KTDA 1GT1A 4AZOA 2X46A 1GM6A 4EFGA 3WBGA 3BRNA 1DZJA 4ES7A 4GH7A 2AL0X 2W2AA 4EXZA 4QZUA 4LKTA 3PP6A 3U0DA 2CBRA 3BX8A 3MBTA 3NX1A 3NPOA 2RCTA 4GE1A 3FW4A 1G85A 1ADLA 5HAEA 2CBSA 3ELXA 4NLJA 2QO6A 3APWA 4IAXA 4ORRA 3ZQ3A 5F7GA 1PEEA 3TF6A 3KZAA 1P6PA 2R56A 4OMXA 3P6EA 1NGLA 1E06A 4NLIA 2A3FX 1Z24A 4QYPA 3UEWA 5L8NA 4AZMA 1PMPA 5LJGA 1VPRA 2AT8X 4YCEA 1YWDA 2FR2A 4DQ3A 5LJBA 1GT4A 1YIVA 2OVDA 1ZRYA 3QKGA 1FEMA 1DZKA 1EW3A 4ZHDA 4I3CA 1BSQA 3KFFA 1SY1A 5B27A 1UREA 3D95A 3VG5A 5LJHA 1IFBA 2Q4NA 3G7XA 3IFBA 3GAQA 4Y0PA 2XKLA 3B2HA 1LF7A 5EZ2A 4ZH6A 1ZNKA 1KT7A 3BU1A 2DM5A 1MUPA 3PEDA 2R74A 5EDBA 3B2IA 4Y0QA 1S44A 2HLVA 4OS0A 4R0BA 3KFHA 3ZUIA 3P6CA 4YDBA 3FA6A 4NNTA 2X45A 2JU3A 4YGZA 5EEEA 3STNA 3WJBA 1QWDA 4UU3A 4IBAA 2CZTA 2ACOA 1O1VA 4NP1A 5HCEC 3ELZA 2OVEA 1A57A 1QY2A 1GKAB 1BSYA 1AELA 3WXQA 1GX9A 3BS2A 4ZHHA 2FT9A 1QFTA 3HWGA 1R0UA 3U9PC 2FS6A 1QG5A 2FWVA 4KIIA 4YMYA 1AQBA 3I0AA 3S26A 1TW4A 1ZNDA 4PSQA 3VG2A 4ORUA 3HWDA 3U03A 4XMDA 5HZ6A 3CBSA 2GJ5A 1KQWA 1ICNA 1EXSA 3BY0A 4YBUA 5K06A 1ALBA 3BX7A 3KQ0A 4QGWA 4QYNA 1X8UA 1S2PA 5L8IA 1X71A 3HWEA 1TOUA 5HA0A 4XMFA 1GT5A 1VYGA 2KT4B 1IFCA 2NNQA 3VG7A 3CQRA 5D45A 1LIFA 3RZYA 4WBKA 4YGGA 5H9LA 1X8PA 1TOWA 4IMOA 4ORSA 1RLBE 1GGLA 4AYHA 1RBPA 5JR8A 2A2UA 1ZNLA 2ANSA 5HTEA 3EM0A 5D47A 1JJXA 1IKEA 1HMSA 1PBOA 2OZQA 3Q6LA 4GNYA 2AMMX 1LFOA 2HZQA 4M6SA 4QGVA 5IO5A 3NQ9A 3O19A 1KT6A 1X8NA 3FEPA 4HFOA 1EIOA 3SAOA 1PM1X 2K62A 5IO6A 1HMTA 4EEJA 1KZWA 1OBQA 2LBAA 4A8ZA 4ZGUA 5KIDA 1B0OA 1JV4A 1HBPA 1I4UA 4OMWA 1EALA 1OPAA 1DF3A 1GT3A 3VG6A 4YFRA 3KFIA 1OEKA 4ZHGA 2MJIA 5HZ8A 2QM9A 2WUTA 2CM4A 2OVAA 1BBPA 5FFHA 4YDAA 4D6AA 4N7DA 1B8EA 4RUNA 1G5WA 4MVIA 1G74A 2A2GA 5D48A 3B2LA 1YP7A 4I9SA 5HA1A 2F73A 3OJYC 5LJCA 1QQSA 2LB6A 1MVGA 1A18A 3AKNA 4O9SA 4WFVA 1SY2A 4A1HA 2W2BA 4I9RA 4DQ4A 3CR6A 4BVMA 3B2JA 4ZHCA 2G79A 4TKBA 1XKIA 1CBQA 5D4AA 2Q39A 2N93A 1SXXA 2Q9SA 5H9NA 3B2KA 2A0AA 3C78X 4A60A 4IB7A 1DZPA 1BEBA 3FW5A 4TJZA 5HTDA 2FLJA 1BRQA 4EDEA 2WWPA 2LFOA 5BVSA 4NYRA 1KT3A 4AZPA 1HMRA 2HNXA 2Q2MA 3C77X 1YWCA 4LZVA 4TLJA 1SXWA 1SXUA 4QZTA 1JJJA 3FEKA 1KXOA 4IMNA 4NYQA 3WJFA 1VYFA 1JBHA 4AZNA 4AZQA 1E02A 1OEEA 3WJEA 5LJEA 3FENA 2WEWA 4LZUA 5EEDA 2R73A 3D97A 4YKOA 3BDRA 1GX8A 4Y0RA 3CWKA 2FS7A 2QO4A 3FA9A 2A13A 2CM9A 2OFMX 4TKJA 5L8OA 1X8OA 1H91A 1T8VA 4HPCA 4MVKA 4ZFXA 2AKQA 2JOZA 3FA7A 4YGHA 2WQAE 3RSWA 1CJ5A 5HCCC 4TKHA 5F6BA 1AVGI 1HN2A 3AKMA 4YKMA 2JU7A 1A3YA 1L6MA 2HZRA 5HCDC 4Y0SA 1IKJA 2RCQA 5DPQA 2Q2PA 4ORYA 4M7MA 3DSZA 1OBPA 1HBQA 5HZ9A 5HWZA 1O1UA 1SY0A 4YH0A 3STKA 2NNEA 1BJ7A 3WJCA 1ZNGA 4AW8A 3O2YA 4HPBA 1G7NA 3FIQA 5D8JA 4ALBA 1U18A 1LICA 3FR4A 1QFVA 1GXAA 5HZQA 2L67A 2XSTA 3MVFA 1FENA 3APXA 5HBSA 1KZXA 4I3DA 1I06A 2NP1A 3PH6A 3FR2A 4QAEA 2AH7X 3P6FA 4GNWA 5LKEA 3NADA 2FTBA 1DZMA 5F1EA 4GRJA 3EMMA 3NQ3A 1LIBA 4OS3A 3ZUOA 1YWBA 3WJDA 3O22A 1LIDA 1KT5A 3KFGA 1IW2A 2K23A 2QO5A 4TNNA 4ODDA 3EBKA 2AT6X 3P6GA 1ERBA 1LKEA 4YCHA 4CK4A 1U17A 4BOEA 3STMX 2L68A 1TXLA 4QGXA 3BLGA 2RA6A 1EPAA 1YP6A 5KHPA 1OBUA 1CBSA 3CQNA 1DV9A 1BSOA 2GC9A 5IO7A 2AT5X 4ZCBA 4GKCA 1D3SA 1UZ2X 4TQ2A 4N7CA 4LKPA 4RUUA 1DFVA 3PPTA 3UEXA 3HWFA 1U0XA 1KQXA 3NX2A 1GKAA 3TGAA 3CMPA 2MO5A 1ZNEA 5LJKA 2L9CA 2WR6A 1I05A 1YUPA 1LNMA 1BM5A 1I04A 2ACPX 5H9AA 2FR3A 1KGLA 2JN3A 1ML7A 3JS1A 1FTPA 3VG3A 1ZNHA 3UEVA 3APVA 2FRSA 4MVLA 2HMBA 1X89A 1EIIA 2G7BA 1LPJA 3D96A 3P6HA 4ORWA 2QOSC 1X8QA 1HQPA 2OFRX 1ERXA 2POAA 4ALOA 3F8AA 5FENA 3PH5A 3I17A 4XMCA 1E00A 2GTFX 2NNDA 3WVMA 5KICA 1CRBA 1B4MA 5F6ZA 1SY3A 1FE3A 3P6DA 4ARHA 2WSJA 3FR5A 1B56A 1N0SA 5B29A 1QY0A 2L5PA 4UU2A 1CBIA 3BU9A 3K3LA 3EBWA 4IAWA 3L4RA 4D6BA 5BVTA 4BQUA 1MX7A 3CBCA 5F58A 5DG4A 4K19A 4ZR2A
chains in the Genus database with same CATH superfamily
1IIUA 2YG2A 2G78A 2Y3FA 5HZ5A 2OL7A 1MX8A 3VG4A 1NP4A 3T2WA 2AT0X 5EDCA 4I95A 3DTQA 3TGBA 1KT4A 3C76X 5C0NA 1SWCA 4I3BA 1BRPA 2AT3X 2WEXA 4AZRA 4BJ8A 4JO6A 2LKKA 3EYCA 4GETA 4OS8A 4KCAA 2KTSA 5AQ6A 4WFUA 5CE4A 4GGZA 3SZHA 2BLGA 1T68X 2RD7C 1EQDA 1K24A 3FELA 3IA8A 1TVQA 2A8GA 3WJGA 2ASNX 3T1DA 2Z4IA 2IZJA 4Z2OA 4ZH9A 5LJDA 3OD9A 1A2DA 1OEJA 1SLDB 2E4JA 4YFPA 4O4XA 1JYDA 3TZSA 1RXJA 4IB6A 1DF8A 1JYJA 1JZUA 4BX7B 1BWYA 4PJ2A 3JSQA 3HK1A 4Z27A 1SWGA 1KZWA 3BSZE 4XMHA 5LKFA 2PY1A 1MDCA 1CBRA 1SXYA 3PECA 5IRWA 1SWPA 2W2FA 1NP1A 1E5PA 2UZ2A 5H9KA 3UEUA 1YWAA 1ICMA 3APUA 3F9DA 1FDQA 4HPAA 1ACDA 1VWEB 1XCAA 4L3RA 3RY2A 2LBVA 2A5BA 1VWHB 2JU8A 2X8FA 4ZHFA 1SWNA 1KOIA 1SWOA 2AF5A 4KT5A 4XMGA 1D2UA 4YVBA 1BLRA 2IZLB 4C5PA 2MF6A 5EPQA 2MM3A 4IB9A 4ORXA 1O8VA 3VHIA 3HOEA 4CPHB 1LIEA 1VYOA 4ML7B 4XMEA 5KHPA 2WQ9A 2EU7X 5IRAA 1EUOA 2IFBA 2P8GA 3FA8A 5H8TA 3RDXA 2A5CA 5BVQA 1DC9A 2CAMA 5FAZA 4NNSA 4YBPA 1T0VA 3FMZA 1LDOA 1QY1A 1FELA 4YFQA 5B3MO 1AB0A 1GX3A 5B2AO 2IZCB 2HYSA 1SRJA 1NQMA 2O62A 1EPBA 2CZUA 2RQ0A 1SA8A 3NR3A 1NDJA 1MEPA 3QQ2A 2OFAA 3FLLA 3NP1A 3ZW0B 4ZJ0A 1MK5A 2RTPB 3MM0A 2ALLX 4MISA 2RTNB 3PDFA 4NV7A 3TGCA 1JQPA 1NBXA 1QABE 4IB8A 1S7DA 2VFBA 4YKMA 3ZZVA 4HPDA 4A1YA 2OYBO 3RDQA 1OPBA 2KTDA 4MEEA 3ZI8A 1GT1A 4QQ1A 4AZOA 2X46A 3PK2A 1GM6A 4EFGA 3WBGA 2RTJA 1DZJA 3BRNA 5CSEA 4ES7A 4GH7A 1RSTB 2AL0X 2IZFB 3S5XA 2W2AA 1SWTA 5AJCA 1KL5A 1SRIA 5FQ7E 4QZUA 3VHMA 4EXZA 5AEOA 4LKTA 2BC3A 3PP6A 5B10O 2Z4HA 3U0DA 2CBRA 1HXZA 4CDEA 3BX8A 3OE3A 4GDZA 1VWIB 1KFFA 3MBTA 3NX1A 5K67A 3NPOA 2RCTA 4GE1A 3FW4A 4BX6B 1G85A 2FHNX 1ADLA 4FQBB 1UYNX 5HAEA 2CBSA 3ELXA 4NLJA 2QO6A 3APWA 4GUZA 4IAXA 4ORRA 4Y59A 1RAVA 3ZQ3A 1SWUA 5F7GA 1AVEA 1PEEA 5KIDA 3TF6A 3KZAA 1P6PA 4ZGUA 2BSZA 2R56A 1W4TA 3P6EA 2RTOB 1NGLA 1E06A 4OMXA 4NLIA 2RTEB 3CKFA 2QOMA 2A3FX 1Z24A 4QYPA 3UEWA 5L8NA 2X32A 5IXGA 4AZMA 1PMPA 3VE1A 3RDMA 5LJGA 1VPRA 2AT8X 4YCEA 1YWDA 2FKGA 2FR2A 5FQ8E 4DQ3A 5LJBA 1GT4A 1YIVA 4U46A 1VWKB 2OVDA 1ZRYA 3QKGA 1FEMA 4IRWA 3RKGA 1DZKA 1EW3A 4ZHDA 4I3CA 1BSQA 3KFFA 4ZGFA 2G8CO 1SY1A 5B27A 1VWDB 5BYPA 1UREA 3D95A 4BX7A 2OF9A 2C1SA 3VG5A 1HY2A 1SRHA 5LJHA 1IFBA 2X4MA 1EI5A 2Q4NA 3G7XA 3IFBA 4FBVA 2X56A 3GAQA 2GTLO 1VWMB 4Y0PA 2FGSA 2XKLA 3B2HA 1JIWI 1LF7A 1VWJB 4GJSA 5EZ2A 4O4UA 3CKGA 2M4LA 4ZH6A 1ZNKA 1KT7A 3BU1A 2DM5A 1MUPA 2I5ZO 2R74A 3PEDA 3SLJA 3WZNA 5EDBA 3B2IA 2BHVA 4Y0QA 1S44A 2HLVA 2FKJA 4OS0A 4R0BA 3KFHA 3ZUIA 3P6CA 4YDBA 2KD2A 3FA6A 2X45A 2JU3A 4NNTA 4YGZA 4U8UM 5EEEA 3STNA 3WJBA 2X55A 1QWDA 1SWBA 4UU3A 3OBLA 2CZTA 4IBAA 4O4SA 4CPHA 2ACOA 1O1VA 2DJFA 4NP1A 5HCEC 3ELZA 2OVEA 3UAQA 1A57A 2VFCA 1QY2A 1GKAB 1BSYA 1AELA 3VE2A 1LELA 3WXQA 4OEMA 4CPIA 4BX5B 1UYOX 1GX9A 3VU1A 3BS2A 2OY7A 4ZHHA 2FT9A 1QFTA 3HWGA 1R0UA 3U9PC 2FS6A 3WYQA 1QG5A 1VWNB 2FWVA 4KIIA 3VGWA 3RY1A 4YMYA 1AQBA 3I0AA 2ZAIA 1TW4A 1ZNDA 3S26A 3ZW1B 4PSQA 3ZW0A 1VWPB 3VG2A 1Y0GA 4ORUA 3RDOA 3HWDA 3U03A 4XMDA 4EKVA 5HZ6A 3CBSA 2GJ5A 1KQWA 1LCWA 1ICNA 4Z2VA 1EXSA 3BY0A 4YBUA 5K06A 4I6SA 3RDSA 1ALBA 3BX7A 3KQ0A 4QGWA 4QYNA 1X8UA 4GDAA 1S2PA 2PI3O 5L8IA 1X71A 4DQ4A 3HWEA 1TOUA 5HA0A 4XMFA 1GT5A 2IZAA 1PBYA 1VYGA 2KT4B 1IFCA 2NNQA 3S5VA 3CQRA 3VG7A 4COTA 5D45A 1LIFA 3RZYA 3WOVA 4WBKA 4YGGA 5H9LA 1X8PA 1TOWA 4IMOA 4ORSA 1RLBE 1GGLA 3LHNA 1RBPA 4AYHA 4BX6A 5JR8A 2A2UA 1ZNLA 2ANSA 4Y5DA 5HTEA 3V8UA 1RXKA 3EM0A 3ZWEA 5D47A 1JJXA 1IKEA 1HMSA 1PBOA 2OZQA 3Q6LA 4GNYA 2AMMX 1LFOA 2HZQA 1SWFA 3JQOA 4M6SA 2WPUA 3MX7A 4CDCA 3T6FA 5F2BA 3EC5A 4QGVA 5IO5A 1JMZA 3NQ9A 3O19A 1KT6A 1SLFB 1X8NA 3FEPA 4HFOA 1EIOA 5FQ6E 3SAOA 1VWAB 3VPJE 1PM1X 2K62A 5IO6A 1HMTA 1KL4A 4FBOA 4FGIB 4EEJA 1VWOB 1OBQA 2LBAA 2RTQB 1SMPI 3P24A 1B0OA 1JV4A 3RWXA 2OY5O 3D4RA 2YMSA 4A8ZA 4B55A 2RTLA 1HBPA 1I4UA 2RTGB 4OMWA 5L3YA 1EALA 1OPAA 2IZIA 1GT3A 1DF3A 3PQUA 4I60A 5B5GA 3VG6A 4L1NA 1VWFB 2BT9A 1LCZA 4YFRA 3KFIA 1OEKA 4BCSA 4ZHGA 2MJIA 5HZ8A 2GTLN 2QM9A 2WUTA 3T6LA 3EW1A 2CM4A 2OVAA 1BBPA 5FFHA 4YDAA 4INNA 4D6AA 2OF8A 2JW1A 4N7DA 1B8EA 4RUNA 2IZGB 4MVIA 1G74A 2A2GA 5D48A 5JD2A 1SRGA 1N43A 1YP7A 3B2LA 5CHKA 3RE5A 4QRLA 4I9SA 5AJBA 5HA1A 2F73A 3OJYC 2QCBA 1MM9A 4Z28A 1E2TA 5LJCA 3T2XA 1QQSA 2LB6A 1MVGA 2IZDB 2RTHB 3H3IA 1A18A 2F01A 3AKNA 4O9SA 1SY2A 4WFVA 2W2BA 4I9RA 4A1HA 3CR6A 2F09A 4BVMA 4GK9A 3B2JA 4ZHCA 2G79A 4TKBA 1XKIA 1CBQA 2X34A 5D4AA 2Q39A 2N93A 1SXXA 1VWLB 1WBIA 4KC7A 2Q9SA 5H9NA 3B2KA 2DJGA 2A0AA 1WUBA 3C78X 4BX5A 4A60A 3D9WA 4IB7A 1DZPA 1BEBA 1AVDA 3FW5A 4TJZA 3AEHA 1Y52X 4JNJA 2I5VO 5HTDA 3SLOA 1LDQA 2FLJA 1BRQA 4EDEA 2WWPA 2Y3EA 2LFOA 4ON1A 4MVEA 1NC9A 3FYFA 4NYRA 5BVSA 1KT3A 4KH8A 3ZW1A 4AZPA 1FJ1E 1HMRA 3HPEA 2HNXA 2Q2MA 4OELA 4NW4A 3C77X 3LTWA 1SLEB 4CPEA 2AVIA 1YWCA 4LZVA 4TLJA 3WZQA 4CDFA 1SXWA 2MWHA 3GE2A 1SXUA 1VWQB 4O3ZA 3Q34A 4GGRA 1SWEA 4QZTA 3FEKA 4NV8A 1JJJA 1KXOA 4GZVA 3SZIA 4IMNA 4NYQA 3NBXX 3WJFA 2IZHB 1VYFA 2FHLA 4U3QA 1JBHA 4AZNA 4GJVA 1SWKA 4AZQA 4FBRA 3F6ZB 1E02A 1N9MA 1OEEA 2Y32A 2RTRB 1SWJA 3WJEA 4HWMA 5LJEA 3AUMO 1SWDA 2WEWA 3FENA 4LZUA 1KL3A 5EEDA 2R73A 1N4JA 3D97A 4YKOA 3BDRA 4O3XB 1GX8A 4Y0RA 2RTFB 1Y55X 3SOTA 4O49A 3CWKA 2FS7A 3HTYA 1SWHA 2OY8A 2QO4A 3FA9A 1VWGB 2RTCB 4CSBA 1STPA 2A13A 3N91A 2CM9A 2OFMX 2X8TA 4TKJA 1X8OA 5L8OA 1H91A 1T8VA 4HPCA 1SREA 4MVKA 4ZFXA 4LQZA 1VWBB 2AKQA 2JOZA 1I9HA 3FA7A 3WZPA 4YGHA 1VWRB 2WQAE 4MIRA 3RSWA 3LV4A 1CJ5A 5HCCC 4TKHA 1G5WA 5F6BA 1IJ8A 4U8UO 1AVGI 1HN2A 1HXLA 1STRB 3AKMA 2JU7A 1A3YA 1L6MA 2HZRA 3NQKA 4Y0SA 1IKJA 4BBOA 2RCQA 5DPQA 5HCDC 2OY1O 2Q2PA 4ORYA 4M7MA 3DSZA 2IZEB 3ZW2A 1OBPA 4IABA 1HBQA 2C1QA 1W5RA 1O1UA 1SY0A 4WHIA 4YH0A 5HWZA 5HZ9A 2RTAA 3STKA 2IZKA 2NNEA 1BJ7A 1NQNA 3WJCA 1ZNGA 1PTSA 4AW8A 3O2YA 4HPBA 1G7NA 3FIQA 4O3WA 5D8JA 4ALBA 4GGTA 1U18A 1LICA 3FR4A 1QFVA 3VHHA 1GXAA 5HZQA 4Z2PA 2L67A 2XSTA 2RTDB 1W6FA 1FENA 3MVFA 5K68A 3APXA 4U9CA 5HBSA 1KZXA 4I3DA 1I06A 1SWQA 2NP1A 4DNEA 3PH6A 3FR2A 4QAEA 3KVNA 2AH7X 4GU8A 3P6FA 2UYWA 4GD9A 4GNWA 5LKEA 3NADA 2FTBA 1DZMA 2BS6A 5F1EA 2OL8O 2ZAGA 1OSPO 4GRJA 3EMMA 3NQ3A 1K3BA 1LIBA 4OS3A 3ZUOA 1YWBA 3WJDA 3O22A 1LIDA 1RXHA 1KT5A 2RTBB 3KFGA 1IW2A 4JHQA 2X8SA 3MG5A 1HQQA 2GH7A 2K23A 2QO5A 4TNNA 4ODDA 1N9YA 2BS5A 2AT6X 3EBKA 3P6GA 1ERBA 1LKEA 4YCHA 1STSB 4CK4A 1U17A 2LA7A 4BOEA 2QMIA 3STMX 5B5FA 3EW2A 5CYBA 3WYPA 2L68A 4CPFA 1TXLA 4KC8A 1SWRA 3BLGA 4QGXA 2JGSA 5B11O 2RA6A 1EPAA 1YP6A 1LCVA 1OBUA 1SWAA 3X00A 1CBSA 2OL6O 3CQNA 1SWLA 4BGFA 1DV9A 1Y9TA 1LUQA 1BSOA 2GC9A 2JMBA 1Y53X 2RN4A 3WZOA 2AT5X 4OKAA 4GKCA 4ZCBA 4EQAC 5IO7A 1D3SA 3PQSA 2G5LA 1UZ2X 4TQ2A 4N7CA 4LKPA 4RUUA 3S60A 1DFVA 2OVSA 3PPTA 3E3CA 2RTIB 2RTMA 3UEXA 3HWFA 1U0XA 1JJUA 2GTLM 1KQXA 4ID2A 3NX2A 1GKAA 3P02A 4CV7A 3TGAA 4O3YA 3CMPA 3HOLA 1RSUB 2MO5A 3SLTA 1ZNEA 5LJKA 1SWSA 2L9CA 2WR6A 1I78A 1I05A 3SZJA 1YUPA 4Z6JA 1LNMA 3FIDA 2OFBA 2VDFA 1BM5A 1I04A 4DCBA 2RTKA 2ACPX 5H9AA 1VWCB 2FR3A 1SRFA 1KGLA 2JN3A 1ML7A 3JS1A 1FTPA 3VG3A 1ZNHA 3UEVA 3APVA 2FRSA 4O4OA 4MVLA 2HMBA 1X89A 3RDUA 2G7BA 1LPJA 3D96A 3P6HA 4ORWA 2QOSC 1EIIA 1X8QA 1HQPA 2OFRX 1ERXA 2POAA 4ALOA 3F8AA 4JGLA 5IRUA 5FENA 3PH5A 3I17A 4U8UN 3FDCA 3RBYA 4XMCA 1E00A 2GTFX 2NNDA 3RE6A 3WVMA 1CRBA 5KICA 5F6ZA 1B4MA 1SY3A 1FE3A 1Y9LA 3P6DA 4ARHA 4QNIA 2C4IA 1SLGB 2WSJA 3FR5A 1B56A 2HKDA 1N0SA 5B29A 1QY0A 2L5PA 2IZBA 2MHDA 4UU2A 4CDDA 1CBIA 3BU9A 3K3LA 3EBWA 2KW1A 4IAWA 3L4RA 2ZSCA 4D6BA 5BVTA 4BQUA 1MOYA 1N7YA 1MX7A 3CBCA 5F58A 5DG4A 4K19A 1JMXA 4ZR2A
chains in the Genus database with same CATH topology
1IIUA 2YG2A 2G78A 5HZ5A 1MX8A 3VG4A 1NP4A 2AT0X 5EDCA 4I95A 3DTQA 3TGBA 1KT4A 3C76X 5C0NA 4I3BA 1BRPA 2AT3X 2WEXA 4AZRA 2LKKA 3EYCA 4GETA 4OS8A 4KCAA 2KTSA 5AQ6A 4WFUA 5CE4A 2BLGA 1T68X 2RD7C 1EQDA 3FELA 3IA8A 1TVQA 3WJGA 2ASNX 3T1DA 2Z4IA 4ZH9A 5LJDA 3OD9A 1A2DA 1OEJA 2E4JA 4YFPA 4O4XA 1JYDA 3TZSA 4IB6A 1JYJA 1JZUA 1BWYA 4PJ2A 3JSQA 3HK1A 3BSZE 4XMHA 5LKFA 2PY1A 1MDCA 1CBRA 1SXYA 3PECA 2W2FA 1NP1A 1E5PA 5H9KA 3UEUA 1YWAA 1ICMA 3APUA 3F9DA 1FDQA 4HPAA 1ACDA 1XCAA 4L3RA 2LBVA 2JU8A 2X8FA 4ZHFA 1KOIA 4XMGA 4KT5A 1D2UA 1BLRA 5EPQA 2MM3A 4IB9A 4ORXA 1O8VA 3HOEA 1LIEA 4XMEA 4ML7B 2WQ9A 2EU7X 1EUOA 2IFBA 2P8GA 3FA8A 5H8TA 5BVQA 1DC9A 5FAZA 4YBPA 4NNSA 1T0VA 3FMZA 1QY1A 1FELA 4YFQA 1AB0A 2HYSA 2O62A 1EPBA 2CZUA 2RQ0A 1SA8A 3NR3A 3FLLA 3NP1A 3ZW0B 4ZJ0A 2ALLX 4MISA 3TGCA 1QABE 4IB8A 1S7DA 3ZZVA 4HPDA 4A1YA 1OPBA 2KTDA 3ZI8A 1GT1A 4QQ1A 4AZOA 2X46A 1GM6A 4EFGA 3WBGA 3BRNA 1DZJA 4ES7A 4GH7A 2AL0X 3S5XA 2W2AA 5AJCA 5FQ7E 4EXZA 4QZUA 5AEOA 4LKTA 3PP6A 2Z4HA 3U0DA 2CBRA 3BX8A 3OE3A 4GDZA 3MBTA 3NX1A 3NPOA 2RCTA 4GE1A 3FW4A 1G85A 4FQBB 1ADLA 5HAEA 2CBSA 3ELXA 4NLJA 2QO6A 3APWA 4IAXA 4ORRA 3ZQ3A 5F7GA 1PEEA 3TF6A 3KZAA 1P6PA 2R56A 4OMXA 3P6EA 1NGLA 1E06A 4NLIA 2A3FX 1Z24A 4QYPA 3UEWA 5L8NA 4AZMA 1PMPA 3VE1A 5LJGA 1VPRA 2AT8X 4YCEA 1YWDA 2FR2A 5FQ8E 4DQ3A 5LJBA 1GT4A 1YIVA 2OVDA 1ZRYA 3QKGA 1FEMA 3RKGA 1DZKA 1EW3A 4ZHDA 4I3CA 1BSQA 3KFFA 4ZGFA 1SY1A 5B27A 5BYPA 1UREA 3D95A 3VG5A 5LJHA 1IFBA 1EI5A 2Q4NA 3G7XA 3IFBA 4FBVA 3GAQA 2GTLO 4Y0PA 2XKLA 3B2HA 1JIWI 1LF7A 5EZ2A 4O4UA 2M4LA 4ZH6A 1ZNKA 1KT7A 3BU1A 2DM5A 1MUPA 3PEDA 2R74A 5EDBA 3B2IA 2BHVA 4Y0QA 1S44A 2HLVA 4OS0A 4R0BA 3KFHA 3ZUIA 3P6CA 4YDBA 2KD2A 3FA6A 2X45A 2JU3A 4NNTA 4YGZA 4U8UM 5EEEA 3STNA 3WJBA 1QWDA 4UU3A 3OBLA 2CZTA 4IBAA 4O4SA 2ACOA 1O1VA 4NP1A 5HCEC 3ELZA 2OVEA 3UAQA 1A57A 1QY2A 1GKAB 1BSYA 1AELA 3VE2A 3WXQA 1GX9A 3VU1A 3BS2A 4ZHHA 2FT9A 1QFTA 3HWGA 1R0UA 3U9PC 2FS6A 1QG5A 2FWVA 4KIIA 4YMYA 1AQBA 3I0AA 2ZAIA 1TW4A 1ZNDA 3S26A 3ZW1B 4PSQA 3ZW0A 3VG2A 4ORUA 3HWDA 3U03A 4XMDA 5HZ6A 3CBSA 2GJ5A 1KQWA 1ICNA 1EXSA 3BY0A 4YBUA 5K06A 4I6SA 1ALBA 3BX7A 3KQ0A 4QGWA 4QYNA 1X8UA 1S2PA 5L8IA 1X71A 3HWEA 1TOUA 5HA0A 4XMFA 1GT5A 3S5VA 4COTA 1VYGA 2KT4B 1IFCA 2NNQA 3VG7A 3CQRA 5D45A 1LIFA 3RZYA 3WOVA 4WBKA 4YGGA 5H9LA 1X8PA 1TOWA 4IMOA 4ORSA 1RLBE 1GGLA 3LHNA 1RBPA 4AYHA 5JR8A 2A2UA 1ZNLA 2ANSA 5HTEA 3ZWEA 3V8UA 3EM0A 5D47A 1JJXA 1IKEA 1HMSA 1PBOA 2OZQA 3Q6LA 4GNYA 2AMMX 1LFOA 2HZQA 4M6SA 3JQOA 3MX7A 4QGVA 5IO5A 3NQ9A 3O19A 1KT6A 1X8NA 3FEPA 4HFOA 1EIOA 5FQ6E 3SAOA 3VPJE 1PM1X 2K62A 5IO6A 1HMTA 4EEJA 4FBOA 4FGIB 1KZWA 1OBQA 2LBAA 4A8ZA 1SMPI 3P24A 1B0OA 1JV4A 3RWXA 4ZGUA 3D4RA 2YMSA 5KIDA 1HBPA 1I4UA 4OMWA 1EALA 1OPAA 1DF3A 1GT3A 3PQUA 3VG6A 4L1NA 4YFRA 2BT9A 3KFIA 1OEKA 4ZHGA 2MJIA 5HZ8A 2GTLN 2QM9A 2WUTA 2CM4A 2OVAA 1BBPA 5FFHA 4YDAA 4INNA 4D6AA 2JW1A 4N7DA 1B8EA 4RUNA 1G5WA 4MVIA 1G74A 2A2GA 5D48A 3B2LA 1YP7A 4QRLA 4I9SA 5AJBA 5HA1A 2F73A 3OJYC 5LJCA 1QQSA 2LB6A 1MVGA 3H3IA 1A18A 3AKNA 4O9SA 4WFVA 1SY2A 4A1HA 2W2BA 4I9RA 4DQ4A 3CR6A 2F09A 4BVMA 4GK9A 3B2JA 4ZHCA 2G79A 4TKBA 1XKIA 1CBQA 5D4AA 2Q39A 2N93A 1SXXA 4KC7A 2Q9SA 5H9NA 3B2KA 2A0AA 3C78X 4A60A 4IB7A 1DZPA 1BEBA 3FW5A 4TJZA 5HTDA 2FLJA 1BRQA 4EDEA 2WWPA 2LFOA 4ON1A 4MVEA 5BVSA 3FYFA 4NYRA 3ZW1A 1KT3A 4KH8A 4AZPA 1HMRA 2HNXA 2Q2MA 4NW4A 3C77X 1YWCA 4LZVA 4TLJA 1SXWA 2MWHA 3GE2A 1SXUA 4O3ZA 4QZTA 1JJJA 3FEKA 1KXOA 4GZVA 4IMNA 4NYQA 3NBXX 3WJFA 1VYFA 4U3QA 1JBHA 4AZNA 4AZQA 4FBRA 3F6ZB 1E02A 1OEEA 3WJEA 4HWMA 5LJEA 3FENA 2WEWA 4LZUA 5EEDA 2R73A 3D97A 4YKOA 3BDRA 4O3XB 1GX8A 4Y0RA 3SOTA 4O49A 3CWKA 2FS7A 3HTYA 2QO4A 3FA9A 4CSBA 2A13A 3N91A 2CM9A 2OFMX 2X8TA 4TKJA 1X8OA 5L8OA 1H91A 1T8VA 4HPCA 4MVKA 4ZFXA 4LQZA 2AKQA 2JOZA 3FA7A 4YGHA 2WQAE 4MIRA 3RSWA 3LV4A 1CJ5A 5HCCC 4TKHA 5F6BA 4U8UO 1AVGI 1HN2A 3AKMA 3NQKA 4YKMA 2JU7A 1A3YA 1L6MA 2HZRA 5HCDC 4Y0SA 1IKJA 2RCQA 5DPQA 2Q2PA 4ORYA 4M7MA 3DSZA 3ZW2A 1OBPA 4IABA 1HBQA 5HZ9A 5HWZA 1O1UA 1SY0A 4WHIA 4YH0A 3STKA 2NNEA 1BJ7A 3WJCA 1ZNGA 4AW8A 3O2YA 4HPBA 1G7NA 3FIQA 4O3WA 5D8JA 4ALBA 1U18A 1LICA 3FR4A 1QFVA 1GXAA 5HZQA 2L67A 2XSTA 3MVFA 1FENA 3APXA 4U9CA 5HBSA 1KZXA 4I3DA 1I06A 2NP1A 3PH6A 3FR2A 4QAEA 2AH7X 4GU8A 3P6FA 4GNWA 5LKEA 3NADA 2FTBA 1DZMA 2BS6A 5F1EA 2ZAGA 4GRJA 3EMMA 3NQ3A 1LIBA 4OS3A 3ZUOA 1YWBA 3WJDA 3O22A 1LIDA 1KT5A 3KFGA 1IW2A 2X8SA 2K23A 2QO5A 4TNNA 4ODDA 2BS5A 2AT6X 3EBKA 3P6GA 1ERBA 1LKEA 4YCHA 4CK4A 1U17A 2LA7A 4BOEA 2QMIA 3STMX 5CYBA 2L68A 1TXLA 4KC8A 4QGXA 3BLGA 2RA6A 1EPAA 1YP6A 5KHPA 1OBUA 1CBSA 3CQNA 1DV9A 1Y9TA 2JMBA 1BSOA 2GC9A 2RN4A 5IO7A 2AT5X 4ZCBA 4GKCA 4EQAC 1D3SA 3PQSA 1UZ2X 4TQ2A 4N7CA 4LKPA 4RUUA 3S60A 1DFVA 2OVSA 3PPTA 3E3CA 3UEXA 3HWFA 1U0XA 2GTLM 1KQXA 4ID2A 3NX2A 1GKAA 3P02A 4CV7A 3TGAA 4O3YA 3CMPA 3HOLA 2MO5A 1ZNEA 5LJKA 2L9CA 2WR6A 1I05A 1YUPA 1LNMA 1BM5A 1I04A 2ACPX 5H9AA 2FR3A 1KGLA 2JN3A 1ML7A 3JS1A 1FTPA 3VG3A 1ZNHA 3UEVA 3APVA 2FRSA 4O4OA 4MVLA 2HMBA 1X89A 1EIIA 2G7BA 1LPJA 3D96A 3P6HA 4ORWA 2QOSC 1X8QA 1HQPA 2OFRX 1ERXA 2POAA 4ALOA 3F8AA 4JGLA 5FENA 3PH5A 3I17A 4U8UN 3RBYA 4XMCA 1E00A 2GTFX 2NNDA 3WVMA 5KICA 1CRBA 1B4MA 5F6ZA 1SY3A 1FE3A 1Y9LA 3P6DA 4ARHA 4QNIA 2WSJA 3FR5A 1B56A 1N0SA 5B29A 1QY0A 2L5PA 2MHDA 4UU2A 1CBIA 3BU9A 3K3LA 3EBWA 2KW1A 4IAWA 3L4RA 4D6BA 5BVTA 4BQUA 1MX7A 3CBCA 5F58A 5DG4A 4K19A 4ZR2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IIU A;  2YG2 A;  2G78 A;  5HZ5 A;  1MX8 A;  3VG4 A;  1NP4 A;  2AT0 X;  5EDC A;  3DTQ A;  3TGB A;  1KT4 A;  3C76 X;  5C0N A;  4I3B A;  1BRP A;  2AT3 X;  2WEX A;  4AZR A;  2LKK A;  3EYC A;  4GET A;  4OS8 A;  5AQ6 A;  4WFU A;  5CE4 A;  2BLG A;  1T68 X;  2RD7 C;  1EQD A;  3FEL A;  3IA8 A;  1TVQ A;  3WJG A;  2ASN X;  3T1D A;  4ZH9 A;  5LJD A;  4YFP A;  1A2D A;  1OEJ A;  2E4J A;  1JYD A;  3TZS A;  4IB6 A;  1JYJ A;  1JZU A;  1BWY A;  3JSQ A;  3HK1 A;  3BSZ E;  4XMH A;  5LKF A;  2PY1 A;  1MDC A;  1CBR A;  1SXY A;  3PEC A;  2W2F A;  1NP1 A;  1E5P A;  5H9K A;  3UEU A;  1YWA A;  1ICM A;  3APU A;  3F9D A;  1FDQ A;  4HPA A;  1ACD A;  1XCA A;  2LBV A;  2JU8 A;  4ZHF A;  1KOI A;  4XMG A;  1D2U A;  1BLR A;  5EPQ A;  2MM3 A;  4IB9 A;  4ORX A;  1O8V A;  1LIE A;  4XME A;  2WQ9 A;  2EU7 X;  1EUO A;  2IFB A;  2P8G A;  3FA8 A;  5H8T A;  5BVQ A;  1DC9 A;  5FAZ A;  4YBP A;  4NNS A;  1T0V A;  3FMZ A;  1QY1 A;  1FEL A;  4YFQ A;  1AB0 A;  2HYS A;  2O62 A;  1EPB A;  2CZU A;  2RQ0 A;  1SA8 A;  3NR3 A;  3FLL A;  3NP1 A;  4ZJ0 A;  2ALL X;  3TGC A;  1QAB E;  4IB8 A;  1S7D A;  4HPD A;  4A1Y A;  1OPB A;  2KTD A;  1GT1 A;  4AZO A;  2X46 A;  1GM6 A;  4EFG A;  3WBG A;  3BRN A;  1DZJ A;  4ES7 A;  4GH7 A;  2AL0 X;  2W2A A;  4EXZ A;  4QZU A;  4LKT A;  3PP6 A;  3U0D A;  2CBR A;  3BX8 A;  3MBT A;  3NX1 A;  3NPO A;  2RCT A;  4GE1 A;  3FW4 A;  1G85 A;  1ADL A;  5HAE A;  2CBS A;  3ELX A;  4NLJ A;  2QO6 A;  3APW A;  4IAX A;  4ORR A;  3ZQ3 A;  5F7G A;  1PEE A;  3TF6 A;  3KZA A;  1P6P A;  2R56 A;  4OMX A;  3P6E A;  1NGL A;  1E06 A;  4NLI A;  2A3F X;  1Z24 A;  4QYP A;  3UEW A;  5L8N A;  4AZM A;  1PMP A;  5LJG A;  1VPR A;  2AT8 X;  4YCE A;  1YWD A;  2FR2 A;  4DQ3 A;  5LJB A;  1GT4 A;  1YIV A;  2OVD A;  1ZRY A;  3QKG A;  1FEM A;  1DZK A;  1EW3 A;  4ZHD A;  4I3C A;  1BSQ A;  3KFF A;  1SY1 A;  5B27 A;  1URE A;  3D95 A;  3VG5 A;  5LJH A;  1IFB A;  2Q4N A;  3G7X A;  3IFB A;  3GAQ A;  4Y0P A;  2XKL A;  3B2H A;  1LF7 A;  5EZ2 A;  4ZH6 A;  1ZNK A;  1KT7 A;  3BU1 A;  2DM5 A;  1MUP A;  3PED A;  2R74 A;  5EDB A;  3B2I A;  4Y0Q A;  1S44 A;  2HLV A;  4OS0 A;  4R0B A;  3KFH A;  3ZUI A;  3P6C A;  4YDB A;  3FA6 A;  4NNT A;  2X45 A;  2JU3 A;  4YGZ A;  5EEE A;  3STN A;  3WJB A;  1QWD A;  4UU3 A;  4IBA A;  2CZT A;  2ACO A;  1O1V A;  4NP1 A;  5HCE C;  3ELZ A;  2OVE A;  1A57 A;  1QY2 A;  1GKA B;  1BSY A;  1AEL A;  3WXQ A;  1GX9 A;  3BS2 A;  4ZHH A;  2FT9 A;  1QFT A;  3HWG A;  1R0U A;  3U9P C;  2FS6 A;  1QG5 A;  2FWV A;  4KII A;  4YMY A;  1AQB A;  3I0A A;  3S26 A;  1TW4 A;  1ZND A;  4PSQ A;  3VG2 A;  4ORU A;  3HWD A;  3U03 A;  4XMD A;  5HZ6 A;  3CBS A;  2GJ5 A;  1KQW A;  1ICN A;  1EXS A;  3BY0 A;  4YBU A;  5K06 A;  1ALB A;  3BX7 A;  3KQ0 A;  4QGW A;  4QYN A;  1X8U A;  1S2P A;  5L8I A;  1X71 A;  3HWE A;  1TOU A;  5HA0 A;  4XMF A;  1GT5 A;  1VYG A;  2KT4 B;  1IFC A;  2NNQ A;  3VG7 A;  3CQR A;  5D45 A;  1LIF A;  3RZY A;  4WBK A;  4YGG A;  5H9L A;  1X8P A;  1TOW A;  4IMO A;  4ORS A;  1RLB E;  1GGL A;  4AYH A;  1RBP A;  5JR8 A;  2A2U A;  1ZNL A;  2ANS A;  5HTE A;  3EM0 A;  5D47 A;  1JJX A;  1IKE A;  1HMS A;  1PBO A;  2OZQ A;  3Q6L A;  4GNY A;  2AMM X;  1LFO A;  2HZQ A;  4M6S A;  4QGV A;  5IO5 A;  3NQ9 A;  3O19 A;  1KT6 A;  1X8N A;  3FEP A;  4HFO A;  1EIO A;  3SAO A;  1PM1 X;  2K62 A;  5IO6 A;  1HMT A;  4EEJ A;  1KZW A;  1OBQ A;  2LBA A;  4A8Z A;  4ZGU A;  5KID A;  1B0O A;  1JV4 A;  1HBP A;  1I4U A;  4OMW A;  1EAL A;  1OPA A;  1DF3 A;  1GT3 A;  3VG6 A;  4YFR A;  3KFI A;  1OEK A;  4ZHG A;  2MJI A;  5HZ8 A;  2QM9 A;  2WUT A;  2CM4 A;  2OVA A;  1BBP A;  5FFH A;  4YDA A;  4D6A A;  4N7D A;  1B8E A;  4RUN A;  1G5W A;  4MVI A;  1G74 A;  2A2G A;  5D48 A;  3B2L A;  1YP7 A;  4I9S A;  5HA1 A;  2F73 A;  3OJY C;  5LJC A;  1QQS A;  2LB6 A;  1MVG A;  1A18 A;  3AKN A;  4O9S A;  4WFV A;  1SY2 A;  4A1H A;  2W2B A;  4I9R A;  4DQ4 A;  3CR6 A;  4BVM A;  3B2J A;  4ZHC A;  2G79 A;  4TKB A;  1XKI A;  1CBQ A;  5D4A A;  2Q39 A;  2N93 A;  1SXX A;  2Q9S A;  5H9N A;  3B2K A;  2A0A A;  3C78 X;  4A60 A;  4IB7 A;  1DZP A;  1BEB A;  3FW5 A;  4TJZ A;  5HTD A;  2FLJ A;  1BRQ A;  4EDE A;  2WWP A;  2LFO A;  5BVS A;  4NYR A;  1KT3 A;  4AZP A;  1HMR A;  2HNX A;  2Q2M A;  3C77 X;  1YWC A;  4LZV A;  4TLJ A;  1SXW A;  1SXU A;  4QZT A;  1JJJ A;  3FEK A;  1KXO A;  4IMN A;  4NYQ A;  3WJF A;  1VYF A;  1JBH A;  4AZN A;  4AZQ A;  1E02 A;  1OEE A;  3WJE A;  5LJE A;  3FEN A;  2WEW A;  4LZU A;  5EED A;  2R73 A;  3D97 A;  4YKO A;  3BDR A;  1GX8 A;  4Y0R A;  3CWK A;  2FS7 A;  2QO4 A;  3FA9 A;  2A13 A;  2CM9 A;  2OFM X;  4TKJ A;  5L8O A;  1X8O A;  1H91 A;  1T8V A;  4HPC A;  4MVK A;  4ZFX A;  2AKQ A;  2JOZ A;  3FA7 A;  4YGH A;  2WQA E;  3RSW A;  1CJ5 A;  5HCC C;  4TKH A;  5F6B A;  1AVG I;  1HN2 A;  3AKM A;  4YKM A;  2JU7 A;  1A3Y A;  1L6M A;  2HZR A;  5HCD C;  4Y0S A;  1IKJ A;  2RCQ A;  5DPQ A;  2Q2P A;  4ORY A;  4M7M A;  3DSZ A;  1OBP A;  1HBQ A;  5HZ9 A;  5HWZ A;  1O1U A;  1SY0 A;  4YH0 A;  3STK A;  2NNE A;  1BJ7 A;  3WJC A;  1ZNG A;  4AW8 A;  3O2Y A;  4HPB A;  1G7N A;  3FIQ A;  5D8J A;  4ALB A;  1U18 A;  1LIC A;  3FR4 A;  1QFV A;  1GXA A;  5HZQ A;  2L67 A;  2XST A;  3MVF A;  1FEN A;  3APX A;  5HBS A;  1KZX A;  4I3D A;  1I06 A;  2NP1 A;  3PH6 A;  3FR2 A;  4QAE A;  2AH7 X;  3P6F A;  4GNW A;  5LKE A;  3NAD A;  2FTB A;  1DZM A;  5F1E A;  4GRJ A;  3EMM A;  3NQ3 A;  1LIB A;  4OS3 A;  3ZUO A;  1YWB A;  3WJD A;  3O22 A;  1LID A;  1KT5 A;  3KFG A;  1IW2 A;  2K23 A;  2QO5 A;  4TNN A;  4ODD A;  3EBK A;  2AT6 X;  3P6G A;  1ERB A;  1LKE A;  4YCH A;  4CK4 A;  1U17 A;  4BOE A;  3STM X;  2L68 A;  1TXL A;  4QGX A;  3BLG A;  2RA6 A;  1EPA A;  1YP6 A;  5KHP A;  1OBU A;  1CBS A;  3CQN A;  1DV9 A;  1BSO A;  2GC9 A;  5IO7 A;  2AT5 X;  4ZCB A;  4GKC A;  1D3S A;  1UZ2 X;  4TQ2 A;  4N7C A;  4LKP A;  4RUU A;  1DFV A;  3PPT A;  3UEX A;  3HWF A;  1U0X A;  1KQX A;  3NX2 A;  1GKA A;  3TGA A;  3CMP A;  2MO5 A;  1ZNE A;  5LJK A;  2L9C A;  2WR6 A;  1I05 A;  1YUP A;  1LNM A;  1BM5 A;  1I04 A;  2ACP X;  5H9A A;  2FR3 A;  1KGL A;  2JN3 A;  1ML7 A;  3JS1 A;  1FTP A;  3VG3 A;  1ZNH A;  3UEV A;  3APV A;  2FRS A;  4MVL A;  2HMB A;  1X89 A;  1EII A;  2G7B A;  1LPJ A;  3D96 A;  3P6H A;  4ORW A;  2QOS C;  1X8Q A;  1HQP A;  2OFR X;  1ERX A;  2POA A;  4ALO A;  3F8A A;  5FEN A;  3PH5 A;  3I17 A;  4XMC A;  1E00 A;  2GTF X;  2NND A;  3WVM A;  5KIC A;  1CRB A;  1B4M A;  5F6Z A;  1SY3 A;  1FE3 A;  3P6D A;  4ARH A;  2WSJ A;  3FR5 A;  1B56 A;  1N0S A;  5B29 A;  1QY0 A;  2L5P A;  4UU2 A;  1CBI A;  3BU9 A;  3K3L A;  3EBW A;  4IAW A;  3L4R A;  4D6B A;  5BVT A;  4BQU A;  1MX7 A;  3CBC A;  5F58 A;  5DG4 A;  4K19 A;  4ZR2 A; 
#chains in the Genus database with same CATH topology
 1IIU A;  2YG2 A;  2G78 A;  2Y3F A;  5HZ5 A;  2OL7 A;  1MX8 A;  3VG4 A;  1NP4 A;  3T2W A;  2AT0 X;  5EDC A;  4I95 A;  3DTQ A;  3TGB A;  1KT4 A;  3C76 X;  5C0N A;  1SWC A;  4I3B A;  1BRP A;  2AT3 X;  2WEX A;  4AZR A;  4BJ8 A;  4JO6 A;  2LKK A;  3EYC A;  4GET A;  4OS8 A;  4KCA A;  2KTS A;  5AQ6 A;  4WFU A;  5CE4 A;  4GGZ A;  3SZH A;  2BLG A;  1T68 X;  2RD7 C;  1EQD A;  1K24 A;  3FEL A;  3IA8 A;  1TVQ A;  2A8G A;  3WJG A;  2ASN X;  3T1D A;  2Z4I A;  2IZJ A;  4Z2O A;  4ZH9 A;  5LJD A;  3OD9 A;  1A2D A;  1OEJ A;  1SLD B;  2E4J A;  4YFP A;  4O4X A;  1JYD A;  3TZS A;  1RXJ A;  4IB6 A;  1DF8 A;  1JYJ A;  1JZU A;  4BX7 B;  1BWY A;  4PJ2 A;  3JSQ A;  3HK1 A;  4Z27 A;  1SWG A;  1KZW A;  3BSZ E;  4XMH A;  5LKF A;  2PY1 A;  1MDC A;  1CBR A;  1SXY A;  3PEC A;  5IRW A;  1SWP A;  2W2F A;  1NP1 A;  1E5P A;  2UZ2 A;  5H9K A;  3UEU A;  1YWA A;  1ICM A;  3APU A;  3F9D A;  1FDQ A;  4HPA A;  1ACD A;  1VWE B;  1XCA A;  4L3R A;  3RY2 A;  2LBV A;  2A5B A;  1VWH B;  2JU8 A;  2X8F A;  4ZHF A;  1SWN A;  1KOI A;  1SWO A;  2AF5 A;  4KT5 A;  4XMG A;  1D2U A;  4YVB A;  1BLR A;  2IZL B;  4C5P A;  2MF6 A;  5EPQ A;  2MM3 A;  4IB9 A;  4ORX A;  1O8V A;  3VHI A;  3HOE A;  4CPH B;  1LIE A;  1VYO A;  4ML7 B;  4XME A;  5KHP A;  2WQ9 A;  2EU7 X;  5IRA A;  1EUO A;  2IFB A;  2P8G A;  3FA8 A;  5H8T A;  3RDX A;  2A5C A;  5BVQ A;  1DC9 A;  2CAM A;  5FAZ A;  4NNS A;  4YBP A;  1T0V A;  3FMZ A;  1LDO A;  1QY1 A;  1FEL A;  4YFQ A;  5B3M O;  1AB0 A;  1GX3 A;  5B2A O;  2IZC B;  2HYS A;  1SRJ A;  1NQM A;  2O62 A;  1EPB A;  2CZU A;  2RQ0 A;  1SA8 A;  3NR3 A;  1NDJ A;  1MEP A;  3QQ2 A;  2OFA A;  3FLL A;  3NP1 A;  3ZW0 B;  4ZJ0 A;  1MK5 A;  2RTP B;  3MM0 A;  2ALL X;  4MIS A;  2RTN B;  3PDF A;  4NV7 A;  3TGC A;  1JQP A;  1NBX A;  1QAB E;  4IB8 A;  1S7D A;  2VFB A;  4YKM A;  3ZZV A;  4HPD A;  4A1Y A;  2OYB O;  3RDQ A;  1OPB A;  2KTD A;  4MEE A;  3ZI8 A;  1GT1 A;  4QQ1 A;  4AZO A;  2X46 A;  3PK2 A;  1GM6 A;  4EFG A;  3WBG A;  2RTJ A;  1DZJ A;  3BRN A;  5CSE A;  4ES7 A;  4GH7 A;  1RST B;  2AL0 X;  2IZF B;  3S5X A;  2W2A A;  1SWT A;  5AJC A;  1KL5 A;  1SRI A;  5FQ7 E;  4QZU A;  3VHM A;  4EXZ A;  5AEO A;  4LKT A;  2BC3 A;  3PP6 A;  5B10 O;  2Z4H A;  3U0D A;  2CBR A;  1HXZ A;  4CDE A;  3BX8 A;  3OE3 A;  4GDZ A;  1VWI B;  1KFF A;  3MBT A;  3NX1 A;  5K67 A;  3NPO A;  2RCT A;  4GE1 A;  3FW4 A;  4BX6 B;  1G85 A;  2FHN X;  1ADL A;  4FQB B;  1UYN X;  5HAE A;  2CBS A;  3ELX A;  4NLJ A;  2QO6 A;  3APW A;  4GUZ A;  4IAX A;  4ORR A;  4Y59 A;  1RAV A;  3ZQ3 A;  1SWU A;  5F7G A;  1AVE A;  1PEE A;  5KID A;  3TF6 A;  3KZA A;  1P6P A;  4ZGU A;  2BSZ A;  2R56 A;  1W4T A;  3P6E A;  2RTO B;  1NGL A;  1E06 A;  4OMX A;  4NLI A;  2RTE B;  3CKF A;  2QOM A;  2A3F X;  1Z24 A;  4QYP A;  3UEW A;  5L8N A;  2X32 A;  5IXG A;  4AZM A;  1PMP A;  3VE1 A;  3RDM A;  5LJG A;  1VPR A;  2AT8 X;  4YCE A;  1YWD A;  2FKG A;  2FR2 A;  5FQ8 E;  4DQ3 A;  5LJB A;  1GT4 A;  1YIV A;  4U46 A;  1VWK B;  2OVD A;  1ZRY A;  3QKG A;  1FEM A;  4IRW A;  3RKG A;  1DZK A;  1EW3 A;  4ZHD A;  4I3C A;  1BSQ A;  3KFF A;  4ZGF A;  2G8C O;  1SY1 A;  5B27 A;  1VWD B;  5BYP A;  1URE A;  3D95 A;  4BX7 A;  2OF9 A;  2C1S A;  3VG5 A;  1HY2 A;  1SRH A;  5LJH A;  1IFB A;  2X4M A;  1EI5 A;  2Q4N A;  3G7X A;  3IFB A;  4FBV A;  2X56 A;  3GAQ A;  2GTL O;  1VWM B;  4Y0P A;  2FGS A;  2XKL A;  3B2H A;  1JIW I;  1LF7 A;  1VWJ B;  4GJS A;  5EZ2 A;  4O4U A;  3CKG A;  2M4L A;  4ZH6 A;  1ZNK A;  1KT7 A;  3BU1 A;  2DM5 A;  1MUP A;  2I5Z O;  2R74 A;  3PED A;  3SLJ A;  3WZN A;  5EDB A;  3B2I A;  2BHV A;  4Y0Q A;  1S44 A;  2HLV A;  2FKJ A;  4OS0 A;  4R0B A;  3KFH A;  3ZUI A;  3P6C A;  4YDB A;  2KD2 A;  3FA6 A;  2X45 A;  2JU3 A;  4NNT A;  4YGZ A;  4U8U M;  5EEE A;  3STN A;  3WJB A;  2X55 A;  1QWD A;  1SWB A;  4UU3 A;  3OBL A;  2CZT A;  4IBA A;  4O4S A;  4CPH A;  2ACO A;  1O1V A;  2DJF A;  4NP1 A;  5HCE C;  3ELZ A;  2OVE A;  3UAQ A;  1A57 A;  2VFC A;  1QY2 A;  1GKA B;  1BSY A;  1AEL A;  3VE2 A;  1LEL A;  3WXQ A;  4OEM A;  4CPI A;  4BX5 B;  1UYO X;  1GX9 A;  3VU1 A;  3BS2 A;  2OY7 A;  4ZHH A;  2FT9 A;  1QFT A;  3HWG A;  1R0U A;  3U9P C;  2FS6 A;  3WYQ A;  1QG5 A;  1VWN B;  2FWV A;  4KII A;  3VGW A;  3RY1 A;  4YMY A;  1AQB A;  3I0A A;  2ZAI A;  1TW4 A;  1ZND A;  3S26 A;  3ZW1 B;  4PSQ A;  3ZW0 A;  1VWP B;  3VG2 A;  1Y0G A;  4ORU A;  3RDO A;  3HWD A;  3U03 A;  4XMD A;  4EKV A;  5HZ6 A;  3CBS A;  2GJ5 A;  1KQW A;  1LCW A;  1ICN A;  4Z2V A;  1EXS A;  3BY0 A;  4YBU A;  5K06 A;  4I6S A;  3RDS A;  1ALB A;  3BX7 A;  3KQ0 A;  4QGW A;  4QYN A;  1X8U A;  4GDA A;  1S2P A;  2PI3 O;  5L8I A;  1X71 A;  4DQ4 A;  3HWE A;  1TOU A;  5HA0 A;  4XMF A;  1GT5 A;  2IZA A;  1PBY A;  1VYG A;  2KT4 B;  1IFC A;  2NNQ A;  3S5V A;  3CQR A;  3VG7 A;  4COT A;  5D45 A;  1LIF A;  3RZY A;  3WOV A;  4WBK A;  4YGG A;  5H9L A;  1X8P A;  1TOW A;  4IMO A;  4ORS A;  1RLB E;  1GGL A;  3LHN A;  1RBP A;  4AYH A;  4BX6 A;  5JR8 A;  2A2U A;  1ZNL A;  2ANS A;  4Y5D A;  5HTE A;  3V8U A;  1RXK A;  3EM0 A;  3ZWE A;  5D47 A;  1JJX A;  1IKE A;  1HMS A;  1PBO A;  2OZQ A;  3Q6L A;  4GNY A;  2AMM X;  1LFO A;  2HZQ A;  1SWF A;  3JQO A;  4M6S A;  2WPU A;  3MX7 A;  4CDC A;  3T6F A;  5F2B A;  3EC5 A;  4QGV A;  5IO5 A;  1JMZ A;  3NQ9 A;  3O19 A;  1KT6 A;  1SLF B;  1X8N A;  3FEP A;  4HFO A;  1EIO A;  5FQ6 E;  3SAO A;  1VWA B;  3VPJ E;  1PM1 X;  2K62 A;  5IO6 A;  1HMT A;  1KL4 A;  4FBO A;  4FGI B;  4EEJ A;  1VWO B;  1OBQ A;  2LBA A;  2RTQ B;  1SMP I;  3P24 A;  1B0O A;  1JV4 A;  3RWX A;  2OY5 O;  3D4R A;  2YMS A;  4A8Z A;  4B55 A;  2RTL A;  1HBP A;  1I4U A;  2RTG B;  4OMW A;  5L3Y A;  1EAL A;  1OPA A;  2IZI A;  1GT3 A;  1DF3 A;  3PQU A;  4I60 A;  5B5G A;  3VG6 A;  4L1N A;  1VWF B;  2BT9 A;  1LCZ A;  4YFR A;  3KFI A;  1OEK A;  4BCS A;  4ZHG A;  2MJI A;  5HZ8 A;  2GTL N;  2QM9 A;  2WUT A;  3T6L A;  3EW1 A;  2CM4 A;  2OVA A;  1BBP A;  5FFH A;  4YDA A;  4INN A;  4D6A A;  2OF8 A;  2JW1 A;  4N7D A;  1B8E A;  4RUN A;  2IZG B;  4MVI A;  1G74 A;  2A2G A;  5D48 A;  5JD2 A;  1SRG A;  1N43 A;  1YP7 A;  3B2L A;  5CHK A;  3RE5 A;  4QRL A;  4I9S A;  5AJB A;  5HA1 A;  2F73 A;  3OJY C;  2QCB A;  1MM9 A;  4Z28 A;  1E2T A;  5LJC A;  3T2X A;  1QQS A;  2LB6 A;  1MVG A;  2IZD B;  2RTH B;  3H3I A;  1A18 A;  2F01 A;  3AKN A;  4O9S A;  1SY2 A;  4WFV A;  2W2B A;  4I9R A;  4A1H A;  3CR6 A;  2F09 A;  4BVM A;  4GK9 A;  3B2J A;  4ZHC A;  2G79 A;  4TKB A;  1XKI A;  1CBQ A;  2X34 A;  5D4A A;  2Q39 A;  2N93 A;  1SXX A;  1VWL B;  1WBI A;  4KC7 A;  2Q9S A;  5H9N A;  3B2K A;  2DJG A;  2A0A A;  1WUB A;  3C78 X;  4BX5 A;  4A60 A;  3D9W A;  4IB7 A;  1DZP A;  1BEB A;  1AVD A;  3FW5 A;  4TJZ A;  3AEH A;  1Y52 X;  4JNJ A;  2I5V O;  5HTD A;  3SLO A;  1LDQ A;  2FLJ A;  1BRQ A;  4EDE A;  2WWP A;  2Y3E A;  2LFO A;  4ON1 A;  4MVE A;  1NC9 A;  3FYF A;  4NYR A;  5BVS A;  1KT3 A;  4KH8 A;  3ZW1 A;  4AZP A;  1FJ1 E;  1HMR A;  3HPE A;  2HNX A;  2Q2M A;  4OEL A;  4NW4 A;  3C77 X;  3LTW A;  1SLE B;  4CPE A;  2AVI A;  1YWC A;  4LZV A;  4TLJ A;  3WZQ A;  4CDF A;  1SXW A;  2MWH A;  3GE2 A;  1SXU A;  1VWQ B;  4O3Z A;  3Q34 A;  4GGR A;  1SWE A;  4QZT A;  3FEK A;  4NV8 A;  1JJJ A;  1KXO A;  4GZV A;  3SZI A;  4IMN A;  4NYQ A;  3NBX X;  3WJF A;  2IZH B;  1VYF A;  2FHL A;  4U3Q A;  1JBH A;  4AZN A;  4GJV A;  1SWK A;  4AZQ A;  4FBR A;  3F6Z B;  1E02 A;  1N9M A;  1OEE A;  2Y32 A;  2RTR B;  1SWJ A;  3WJE A;  4HWM A;  5LJE A;  3AUM O;  1SWD A;  2WEW A;  3FEN A;  4LZU A;  1KL3 A;  5EED A;  2R73 A;  1N4J A;  3D97 A;  4YKO A;  3BDR A;  4O3X B;  1GX8 A;  4Y0R A;  2RTF B;  1Y55 X;  3SOT A;  4O49 A;  3CWK A;  2FS7 A;  3HTY A;  1SWH A;  2OY8 A;  2QO4 A;  3FA9 A;  1VWG B;  2RTC B;  4CSB A;  1STP A;  2A13 A;  3N91 A;  2CM9 A;  2OFM X;  2X8T A;  4TKJ A;  1X8O A;  5L8O A;  1H91 A;  1T8V A;  4HPC A;  1SRE A;  4MVK A;  4ZFX A;  4LQZ A;  1VWB B;  2AKQ A;  2JOZ A;  1I9H A;  3FA7 A;  3WZP A;  4YGH A;  1VWR B;  2WQA E;  4MIR A;  3RSW A;  3LV4 A;  1CJ5 A;  5HCC C;  4TKH A;  1G5W A;  5F6B A;  1IJ8 A;  4U8U O;  1AVG I;  1HN2 A;  1HXL A;  1STR B;  3AKM A;  2JU7 A;  1A3Y A;  1L6M A;  2HZR A;  3NQK A;  4Y0S A;  1IKJ A;  4BBO A;  2RCQ A;  5DPQ A;  5HCD C;  2OY1 O;  2Q2P A;  4ORY A;  4M7M A;  3DSZ A;  2IZE B;  3ZW2 A;  1OBP A;  4IAB A;  1HBQ A;  2C1Q A;  1W5R A;  1O1U A;  1SY0 A;  4WHI A;  4YH0 A;  5HWZ A;  5HZ9 A;  2RTA A;  3STK A;  2IZK A;  2NNE A;  1BJ7 A;  1NQN A;  3WJC A;  1ZNG A;  1PTS A;  4AW8 A;  3O2Y A;  4HPB A;  1G7N A;  3FIQ A;  4O3W A;  5D8J A;  4ALB A;  4GGT A;  1U18 A;  1LIC A;  3FR4 A;  1QFV A;  3VHH A;  1GXA A;  5HZQ A;  4Z2P A;  2L67 A;  2XST A;  2RTD B;  1W6F A;  1FEN A;  3MVF A;  5K68 A;  3APX A;  4U9C A;  5HBS A;  1KZX A;  4I3D A;  1I06 A;  1SWQ A;  2NP1 A;  4DNE A;  3PH6 A;  3FR2 A;  4QAE A;  3KVN A;  2AH7 X;  4GU8 A;  3P6F A;  2UYW A;  4GD9 A;  4GNW A;  5LKE A;  3NAD A;  2FTB A;  1DZM A;  2BS6 A;  5F1E A;  2OL8 O;  2ZAG A;  1OSP O;  4GRJ A;  3EMM A;  3NQ3 A;  1K3B A;  1LIB A;  4OS3 A;  3ZUO A;  1YWB A;  3WJD A;  3O22 A;  1LID A;  1RXH A;  1KT5 A;  2RTB B;  3KFG A;  1IW2 A;  4JHQ A;  2X8S A;  3MG5 A;  1HQQ A;  2GH7 A;  2K23 A;  2QO5 A;  4TNN A;  4ODD A;  1N9Y A;  2BS5 A;  2AT6 X;  3EBK A;  3P6G A;  1ERB A;  1LKE A;  4YCH A;  1STS B;  4CK4 A;  1U17 A;  2LA7 A;  4BOE A;  2QMI A;  3STM X;  5B5F A;  3EW2 A;  5CYB A;  3WYP A;  2L68 A;  4CPF A;  1TXL A;  4KC8 A;  1SWR A;  3BLG A;  4QGX A;  2JGS A;  5B11 O;  2RA6 A;  1EPA A;  1YP6 A;  1LCV A;  1OBU A;  1SWA A;  3X00 A;  1CBS A;  2OL6 O;  3CQN A;  1SWL A;  4BGF A;  1DV9 A;  1Y9T A;  1LUQ A;  1BSO A;  2GC9 A;  2JMB A;  1Y53 X;  2RN4 A;  3WZO A;  2AT5 X;  4OKA A;  4GKC A;  4ZCB A;  4EQA C;  5IO7 A;  1D3S A;  3PQS A;  2G5L A;  1UZ2 X;  4TQ2 A;  4N7C A;  4LKP A;  4RUU A;  3S60 A;  1DFV A;  2OVS A;  3PPT A;  3E3C A;  2RTI B;  2RTM A;  3UEX A;  3HWF A;  1U0X A;  1JJU A;  2GTL M;  1KQX A;  4ID2 A;  3NX2 A;  1GKA A;  3P02 A;  4CV7 A;  3TGA A;  4O3Y A;  3CMP A;  3HOL A;  1RSU B;  2MO5 A;  3SLT A;  1ZNE A;  5LJK A;  1SWS A;  2L9C A;  2WR6 A;  1I78 A;  1I05 A;  3SZJ A;  1YUP A;  4Z6J A;  1LNM A;  3FID A;  2OFB A;  2VDF A;  1BM5 A;  1I04 A;  4DCB A;  2RTK A;  2ACP X;  5H9A A;  1VWC B;  2FR3 A;  1SRF A;  1KGL A;  2JN3 A;  1ML7 A;  3JS1 A;  1FTP A;  3VG3 A;  1ZNH A;  3UEV A;  3APV A;  2FRS A;  4O4O A;  4MVL A;  2HMB A;  1X89 A;  3RDU A;  2G7B A;  1LPJ A;  3D96 A;  3P6H A;  4ORW A;  2QOS C;  1EII A;  1X8Q A;  1HQP A;  2OFR X;  1ERX A;  2POA A;  4ALO A;  3F8A A;  4JGL A;  5IRU A;  5FEN A;  3PH5 A;  3I17 A;  4U8U N;  3FDC A;  3RBY A;  4XMC A;  1E00 A;  2GTF X;  2NND A;  3RE6 A;  3WVM A;  1CRB A;  5KIC A;  5F6Z A;  1B4M A;  1SY3 A;  1FE3 A;  1Y9L A;  3P6D A;  4ARH A;  4QNI A;  2C4I A;  1SLG B;  2WSJ A;  3FR5 A;  1B56 A;  2HKD A;  1N0S A;  5B29 A;  1QY0 A;  2L5P A;  2IZB A;  2MHD A;  4UU2 A;  4CDD A;  1CBI A;  3BU9 A;  3K3L A;  3EBW A;  2KW1 A;  4IAW A;  3L4R A;  2ZSC A;  4D6B A;  5BVT A;  4BQU A;  1MOY A;  1N7Y A;  1MX7 A;  3CBC A;  5F58 A;  5DG4 A;  4K19 A;  1JMX A;  4ZR2 A; 
#chains in the Genus database with same CATH homology
 1IIU A;  2YG2 A;  2G78 A;  5HZ5 A;  1MX8 A;  3VG4 A;  1NP4 A;  2AT0 X;  5EDC A;  4I95 A;  3DTQ A;  3TGB A;  1KT4 A;  3C76 X;  5C0N A;  4I3B A;  1BRP A;  2AT3 X;  2WEX A;  4AZR A;  2LKK A;  3EYC A;  4GET A;  4OS8 A;  4KCA A;  2KTS A;  5AQ6 A;  4WFU A;  5CE4 A;  2BLG A;  1T68 X;  2RD7 C;  1EQD A;  3FEL A;  3IA8 A;  1TVQ A;  3WJG A;  2ASN X;  3T1D A;  2Z4I A;  4ZH9 A;  5LJD A;  3OD9 A;  1A2D A;  1OEJ A;  2E4J A;  4YFP A;  4O4X A;  1JYD A;  3TZS A;  4IB6 A;  1JYJ A;  1JZU A;  1BWY A;  4PJ2 A;  3JSQ A;  3HK1 A;  3BSZ E;  4XMH A;  5LKF A;  2PY1 A;  1MDC A;  1CBR A;  1SXY A;  3PEC A;  2W2F A;  1NP1 A;  1E5P A;  5H9K A;  3UEU A;  1YWA A;  1ICM A;  3APU A;  3F9D A;  1FDQ A;  4HPA A;  1ACD A;  1XCA A;  4L3R A;  2LBV A;  2JU8 A;  2X8F A;  4ZHF A;  1KOI A;  4XMG A;  4KT5 A;  1D2U A;  1BLR A;  5EPQ A;  2MM3 A;  4IB9 A;  4ORX A;  1O8V A;  3HOE A;  1LIE A;  4XME A;  4ML7 B;  2WQ9 A;  2EU7 X;  1EUO A;  2IFB A;  2P8G A;  3FA8 A;  5H8T A;  5BVQ A;  1DC9 A;  5FAZ A;  4YBP A;  4NNS A;  1T0V A;  3FMZ A;  1QY1 A;  1FEL A;  4YFQ A;  1AB0 A;  2HYS A;  2O62 A;  1EPB A;  2CZU A;  2RQ0 A;  1SA8 A;  3NR3 A;  3FLL A;  3NP1 A;  3ZW0 B;  4ZJ0 A;  2ALL X;  4MIS A;  3TGC A;  1QAB E;  4IB8 A;  1S7D A;  3ZZV A;  4HPD A;  4A1Y A;  1OPB A;  2KTD A;  3ZI8 A;  1GT1 A;  4QQ1 A;  4AZO A;  2X46 A;  1GM6 A;  4EFG A;  3WBG A;  3BRN A;  1DZJ A;  4ES7 A;  4GH7 A;  2AL0 X;  3S5X A;  2W2A A;  5AJC A;  5FQ7 E;  4EXZ A;  4QZU A;  5AEO A;  4LKT A;  3PP6 A;  2Z4H A;  3U0D A;  2CBR A;  3BX8 A;  3OE3 A;  4GDZ A;  3MBT A;  3NX1 A;  3NPO A;  2RCT A;  4GE1 A;  3FW4 A;  1G85 A;  4FQB B;  1ADL A;  5HAE A;  2CBS A;  3ELX A;  4NLJ A;  2QO6 A;  3APW A;  4IAX A;  4ORR A;  3ZQ3 A;  5F7G A;  1PEE A;  3TF6 A;  3KZA A;  1P6P A;  2R56 A;  4OMX A;  3P6E A;  1NGL A;  1E06 A;  4NLI A;  2A3F X;  1Z24 A;  4QYP A;  3UEW A;  5L8N A;  4AZM A;  1PMP A;  3VE1 A;  5LJG A;  1VPR A;  2AT8 X;  4YCE A;  1YWD A;  2FR2 A;  5FQ8 E;  4DQ3 A;  5LJB A;  1GT4 A;  1YIV A;  2OVD A;  1ZRY A;  3QKG A;  1FEM A;  3RKG A;  1DZK A;  1EW3 A;  4ZHD A;  4I3C A;  1BSQ A;  3KFF A;  4ZGF A;  1SY1 A;  5B27 A;  5BYP A;  1URE A;  3D95 A;  3VG5 A;  5LJH A;  1IFB A;  1EI5 A;  2Q4N A;  3G7X A;  3IFB A;  4FBV A;  3GAQ A;  2GTL O;  4Y0P A;  2XKL A;  3B2H A;  1JIW I;  1LF7 A;  5EZ2 A;  4O4U A;  2M4L A;  4ZH6 A;  1ZNK A;  1KT7 A;  3BU1 A;  2DM5 A;  1MUP A;  3PED A;  2R74 A;  5EDB A;  3B2I A;  2BHV A;  4Y0Q A;  1S44 A;  2HLV A;  4OS0 A;  4R0B A;  3KFH A;  3ZUI A;  3P6C A;  4YDB A;  2KD2 A;  3FA6 A;  2X45 A;  2JU3 A;  4NNT A;  4YGZ A;  4U8U M;  5EEE A;  3STN A;  3WJB A;  1QWD A;  4UU3 A;  3OBL A;  2CZT A;  4IBA A;  4O4S A;  2ACO A;  1O1V A;  4NP1 A;  5HCE C;  3ELZ A;  2OVE A;  3UAQ A;  1A57 A;  1QY2 A;  1GKA B;  1BSY A;  1AEL A;  3VE2 A;  3WXQ A;  1GX9 A;  3VU1 A;  3BS2 A;  4ZHH A;  2FT9 A;  1QFT A;  3HWG A;  1R0U A;  3U9P C;  2FS6 A;  1QG5 A;  2FWV A;  4KII A;  4YMY A;  1AQB A;  3I0A A;  2ZAI A;  1TW4 A;  1ZND A;  3S26 A;  3ZW1 B;  4PSQ A;  3ZW0 A;  3VG2 A;  4ORU A;  3HWD A;  3U03 A;  4XMD A;  5HZ6 A;  3CBS A;  2GJ5 A;  1KQW A;  1ICN A;  1EXS A;  3BY0 A;  4YBU A;  5K06 A;  4I6S A;  1ALB A;  3BX7 A;  3KQ0 A;  4QGW A;  4QYN A;  1X8U A;  1S2P A;  5L8I A;  1X71 A;  3HWE A;  1TOU A;  5HA0 A;  4XMF A;  1GT5 A;  3S5V A;  4COT A;  1VYG A;  2KT4 B;  1IFC A;  2NNQ A;  3VG7 A;  3CQR A;  5D45 A;  1LIF A;  3RZY A;  3WOV A;  4WBK A;  4YGG A;  5H9L A;  1X8P A;  1TOW A;  4IMO A;  4ORS A;  1RLB E;  1GGL A;  3LHN A;  1RBP A;  4AYH A;  5JR8 A;  2A2U A;  1ZNL A;  2ANS A;  5HTE A;  3ZWE A;  3V8U A;  3EM0 A;  5D47 A;  1JJX A;  1IKE A;  1HMS A;  1PBO A;  2OZQ A;  3Q6L A;  4GNY A;  2AMM X;  1LFO A;  2HZQ A;  4M6S A;  3JQO A;  3MX7 A;  4QGV A;  5IO5 A;  3NQ9 A;  3O19 A;  1KT6 A;  1X8N A;  3FEP A;  4HFO A;  1EIO A;  5FQ6 E;  3SAO A;  3VPJ E;  1PM1 X;  2K62 A;  5IO6 A;  1HMT A;  4EEJ A;  4FBO A;  4FGI B;  1KZW A;  1OBQ A;  2LBA A;  4A8Z A;  1SMP I;  3P24 A;  1B0O A;  1JV4 A;  3RWX A;  4ZGU A;  3D4R A;  2YMS A;  5KID A;  1HBP A;  1I4U A;  4OMW A;  1EAL A;  1OPA A;  1DF3 A;  1GT3 A;  3PQU A;  3VG6 A;  4L1N A;  4YFR A;  2BT9 A;  3KFI A;  1OEK A;  4ZHG A;  2MJI A;  5HZ8 A;  2GTL N;  2QM9 A;  2WUT A;  2CM4 A;  2OVA A;  1BBP A;  5FFH A;  4YDA A;  4INN A;  4D6A A;  2JW1 A;  4N7D A;  1B8E A;  4RUN A;  1G5W A;  4MVI A;  1G74 A;  2A2G A;  5D48 A;  3B2L A;  1YP7 A;  4QRL A;  4I9S A;  5AJB A;  5HA1 A;  2F73 A;  3OJY C;  5LJC A;  1QQS A;  2LB6 A;  1MVG A;  3H3I A;  1A18 A;  3AKN A;  4O9S A;  4WFV A;  1SY2 A;  4A1H A;  2W2B A;  4I9R A;  4DQ4 A;  3CR6 A;  2F09 A;  4BVM A;  4GK9 A;  3B2J A;  4ZHC A;  2G79 A;  4TKB A;  1XKI A;  1CBQ A;  5D4A A;  2Q39 A;  2N93 A;  1SXX A;  4KC7 A;  2Q9S A;  5H9N A;  3B2K A;  2A0A A;  3C78 X;  4A60 A;  4IB7 A;  1DZP A;  1BEB A;  3FW5 A;  4TJZ A;  5HTD A;  2FLJ A;  1BRQ A;  4EDE A;  2WWP A;  2LFO A;  4ON1 A;  4MVE A;  5BVS A;  3FYF A;  4NYR A;  3ZW1 A;  1KT3 A;  4KH8 A;  4AZP A;  1HMR A;  2HNX A;  2Q2M A;  4NW4 A;  3C77 X;  1YWC A;  4LZV A;  4TLJ A;  1SXW A;  2MWH A;  3GE2 A;  1SXU A;  4O3Z A;  4QZT A;  1JJJ A;  3FEK A;  1KXO A;  4GZV A;  4IMN A;  4NYQ A;  3NBX X;  3WJF A;  1VYF A;  4U3Q A;  1JBH A;  4AZN A;  4AZQ A;  4FBR A;  3F6Z B;  1E02 A;  1OEE A;  3WJE A;  4HWM A;  5LJE A;  3FEN A;  2WEW A;  4LZU A;  5EED A;  2R73 A;  3D97 A;  4YKO A;  3BDR A;  4O3X B;  1GX8 A;  4Y0R A;  3SOT A;  4O49 A;  3CWK A;  2FS7 A;  3HTY A;  2QO4 A;  3FA9 A;  4CSB A;  2A13 A;  3N91 A;  2CM9 A;  2OFM X;  2X8T A;  4TKJ A;  1X8O A;  5L8O A;  1H91 A;  1T8V A;  4HPC A;  4MVK A;  4ZFX A;  4LQZ A;  2AKQ A;  2JOZ A;  3FA7 A;  4YGH A;  2WQA E;  4MIR A;  3RSW A;  3LV4 A;  1CJ5 A;  5HCC C;  4TKH A;  5F6B A;  4U8U O;  1AVG I;  1HN2 A;  3AKM A;  3NQK A;  4YKM A;  2JU7 A;  1A3Y A;  1L6M A;  2HZR A;  5HCD C;  4Y0S A;  1IKJ A;  2RCQ A;  5DPQ A;  2Q2P A;  4ORY A;  4M7M A;  3DSZ A;  3ZW2 A;  1OBP A;  4IAB A;  1HBQ A;  5HZ9 A;  5HWZ A;  1O1U A;  1SY0 A;  4WHI A;  4YH0 A;  3STK A;  2NNE A;  1BJ7 A;  3WJC A;  1ZNG A;  4AW8 A;  3O2Y A;  4HPB A;  1G7N A;  3FIQ A;  4O3W A;  5D8J A;  4ALB A;  1U18 A;  1LIC A;  3FR4 A;  1QFV A;  1GXA A;  5HZQ A;  2L67 A;  2XST A;  3MVF A;  1FEN A;  3APX A;  4U9C A;  5HBS A;  1KZX A;  4I3D A;  1I06 A;  2NP1 A;  3PH6 A;  3FR2 A;  4QAE A;  2AH7 X;  4GU8 A;  3P6F A;  4GNW A;  5LKE A;  3NAD A;  2FTB A;  1DZM A;  2BS6 A;  5F1E A;  2ZAG A;  4GRJ A;  3EMM A;  3NQ3 A;  1LIB A;  4OS3 A;  3ZUO A;  1YWB A;  3WJD A;  3O22 A;  1LID A;  1KT5 A;  3KFG A;  1IW2 A;  2X8S A;  2K23 A;  2QO5 A;  4TNN A;  4ODD A;  2BS5 A;  2AT6 X;  3EBK A;  3P6G A;  1ERB A;  1LKE A;  4YCH A;  4CK4 A;  1U17 A;  2LA7 A;  4BOE A;  2QMI A;  3STM X;  5CYB A;  2L68 A;  1TXL A;  4KC8 A;  4QGX A;  3BLG A;  2RA6 A;  1EPA A;  1YP6 A;  5KHP A;  1OBU A;  1CBS A;  3CQN A;  1DV9 A;  1Y9T A;  2JMB A;  1BSO A;  2GC9 A;  2RN4 A;  5IO7 A;  2AT5 X;  4ZCB A;  4GKC A;  4EQA C;  1D3S A;  3PQS A;  1UZ2 X;  4TQ2 A;  4N7C A;  4LKP A;  4RUU A;  3S60 A;  1DFV A;  2OVS A;  3PPT A;  3E3C A;  3UEX A;  3HWF A;  1U0X A;  2GTL M;  1KQX A;  4ID2 A;  3NX2 A;  1GKA A;  3P02 A;  4CV7 A;  3TGA A;  4O3Y A;  3CMP A;  3HOL A;  2MO5 A;  1ZNE A;  5LJK A;  2L9C A;  2WR6 A;  1I05 A;  1YUP A;  1LNM A;  1BM5 A;  1I04 A;  2ACP X;  5H9A A;  2FR3 A;  1KGL A;  2JN3 A;  1ML7 A;  3JS1 A;  1FTP A;  3VG3 A;  1ZNH A;  3UEV A;  3APV A;  2FRS A;  4O4O A;  4MVL A;  2HMB A;  1X89 A;  1EII A;  2G7B A;  1LPJ A;  3D96 A;  3P6H A;  4ORW A;  2QOS C;  1X8Q A;  1HQP A;  2OFR X;  1ERX A;  2POA A;  4ALO A;  3F8A A;  4JGL A;  5FEN A;  3PH5 A;  3I17 A;  4U8U N;  3RBY A;  4XMC A;  1E00 A;  2GTF X;  2NND A;  3WVM A;  5KIC A;  1CRB A;  1B4M A;  5F6Z A;  1SY3 A;  1FE3 A;  1Y9L A;  3P6D A;  4ARH A;  4QNI A;  2WSJ A;  3FR5 A;  1B56 A;  1N0S A;  5B29 A;  1QY0 A;  2L5P A;  2MHD A;  4UU2 A;  1CBI A;  3BU9 A;  3K3L A;  3EBW A;  2KW1 A;  4IAW A;  3L4R A;  4D6B A;  5BVT A;  4BQU A;  1MX7 A;  3CBC A;  5F58 A;  5DG4 A;  4K19 A;  4ZR2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...