4YH6A

Crystal structure of il1rapl1 ectodomain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
321
structure length
313
Chain Sequence
CTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLEILWYKECRTKAWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor accessory protein-like 1
publication title Mechanisms of splicing-dependent trans-synaptic adhesion by PTP delta-IL1RAPL1/IL-1RAcP for synaptic differentiation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 313
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A03
4HIIB 3MJGX 4XVTL 4Z7OE 1E27A 1U8OA 3L3JB 4PD4J 1D5MB 2Q76B 4YC2C 2E9WA 4L8CB 2ARJB 1T03L 4MQ7A 3GSOB 4NO2A 5D2NE 5MERB 5DGQA 4GG8B 3VXME 3BO8A 1CXIA 1T21A 3FN3A 4ZUWB 3KPSA 4MQXC 1TVDA 4Y19A 3RNQA 4QTHB 4XNYL 4WY7H 3CCHA 5FF6B 5IJKA 1DQQA 3ZTJG 2P5WA 1SYVB 4R8WH 3MODH 4DN3H 5DF0A 1XMWA 2FB4L 2NX5B 2W59A 3SDAD 4AEIH 4LP5A 3MJ8A 4RMTA 1QRND 1A3LL 1R3JB 2FWOB 2FX9L 4U6YB 2YOCA 4OCRH 4URTB 2G75B 2AEPL 3VXTA 2NNAB 2VZUA 4U1KB 1I1YB 3RL1A 2V7NA 4PJBF 2R9HD 2AXFB 1GVIA 4MS8C 2BX5A 3AAZB 2N7AA 3ZT5A 4YPGA 4DKFL 1WLHA 1I7TA 4JB9L 3WLBA 1ZVYA 3RDTC 3N1QC 4JN1H 1EH9A 4K3DL 2YPLA 4MJIE 4NWTH 1KOAA 3QUXD 3X14A 3G6AA 3HPJB 4RMRA 5DD6B 1XEDA 4F9LC 1WAAA 5FO9B 3VRJB 5DJ0A 1OGTA 4JHAL 4F7PA 4ZS6D 2XN9D 4MXVF 1FFNA 1OY3B 1TITA 3HUJE 3JUZA 4KMTH 1RZ7L 1TQBC 5KSBB 1GAFL 1FZMA 2VLRE 4Z18A 5HHVH 4NO3B 3TZVB 3O11A 1E4XH 5E2WH 3KPOA 4HXBL 4G8IA 5I9QB 4HD9A 3BI9X 4U7KA 4U7MA 3QNXB 5CMAB 5I6XC 5MEPA 4A2MA 1SVZA 4XI5D 4L4TE 2Z4QB 1BEYL 4NC0B 5B21A 1JPSH 2UUDH 3NPSB 1HOCA 4ZSOE 3VJ6A 1AQDB 3HNSH 1IE5A 3EDFA 4JQIL 1BFVH 3KPQB 4I0KA 1CN4A 5DD1L 5SWSE 1MREL 4OZIF 2ED7A 5JUEH 5I1GL 5EZIL 3SCMA 2GJZB 2V7HB 2V5RA 1TETH 1UCBL 4FN0A 2O61B 1TZIA 4G42A 2ZPKH 5KBNC 4H1LA 1QUNA 4DKEH 5EZOL 1ZLUK 4WCYH 5DQDL 5C0DB 4ZXBB 3S8WA 5I1KL 4WUUA 3ZLQC 5DTFA 5F3BA 1V7NL 1WBZB 5J6HA 4OLWH 2VUYA 1QYGL 1DBJH 1QLEH 3FL7A 5F1IB 4LVHB 1MNUH 4NQSA 4U6XA 4JN2B 3HS0B 3C08L 5ID0B 2A6DA 2ICWA 2YA0A 5HPMA 2DQGL 2Z31B 3VGFA 3W39B 2VXTL 1T80A 2CGRL 2PETA 4KKCD 5B8CB 3RWEB 1JPST 4X7SH 4HC1H 4ZOAA 4PJXB 2VSCA 4U1NA 3SDDB 3DUSA 1B0RA 1WZKA 1QFPA 1U2HA 5IFJB 3HE7A 1CFQA 1DANU 3P40A 5DC9B 5IMOA 4OI9A 3DV4B 4PR5A 3MNVB 4LCUB 4JM2C 5JPNB 4MAYB 1IILE 4EI5C 3KNBA 5CBAA 4JKLA 1HYRC 1RZJL 1U3JA 3MACL 4KK9D 2VWEC 4PJDB 3Q5YA 3KJ4B 1KJ2H 2L7JA 1T1WB 4CVXA 3QUZC 4JPVL 3GSXA 3FT2B 1GZPA 4TUKL 4KAQH 3WEXA 1OTTC 4XVSH 3L3IA 4JDZA 4OGXL 4KRNA 5I1CL 1RIUH 3KVQA 1RUAL 2IPUK 3AM8A 5KOMC 1FYHB 3RWDB 3O41A 3RBSA 1A6TA 1EV2E 1FNFA 4WO4C 4KZDL 1Q9KB 4ETQB 5DJCB 3FHAA 4LRIA 1FGVL 3ZDXF 4G43A 4NZRL 2CDEB 4U1GB 3TIEB 4TNWF 2Y07H 4NWUL 3WN5B 1CLOH 3VG0L 1QPXA 5IB1A 2DQDL 3M1BA 3O2VL 3C5ZA 4JCLA 4FOMA 3GI8H 1F2QA 3QWRA 3ULVE 4X6CE 1W72L 5BZWB 4NC1E 3VXRE 1C08A 3RKPA 4E42B 4YDIH 4PD4K 1DQDH 1S7UA 5J1AB 1EMTH 3PDDA 5E4EC 1NGYA 2OK0H 3KPRD 4WTZG 3MLRL 1TQCC 1FZJA 3P73B 5J6GA 4PJ9B 1EZVY 1S7VB 3SDXA 1H3WM 1MAJA 1BX2B 5FKPA 4KVCL 4N5UA 5GGUA 4M61B 1TJIL 3A67H 3ZHKA 1SY6H 1XGRB 5IFAH 4OT1L 2VZOA 4ODXA 4MJ5A 1QR1B 1KIUA 3DTXB 2FX8L 5L8JB 5FUCC 4LKXB 4OV6F 1L4IA 3NFNB 1LO3L 2IPTL 3EOTH 2Q8AL 3SQOL 1T5XA 4C4KT 1B0GB 3HLAB 3MBEC 2CR6A 5F7WC 3MLTA 1CDJA 4WEMB 5KVFH 3MRPA 2VDLH 4AMKH 2F5BH 3MRQA 4Y0GA 2YBRA 3QYCA 3FQWA 4IJ3B 2QSCH 5FECA 1KNOB 2VLLB 1AGFA 2WNGA 3VFVB 3DURA 1N5YH 1G9MH 2IAMB 1TZHA 3V0WL 1PY4A 3LEXA 4ZTPH 3FQXA 4Y8DC 3HB3C 2DMKA 1YEJL 4PUBL 3QUKA 4OB5L 1ADQH 2DM4A 5CWSA 5SWSD 4C56B 1B0WA 2ITDB 4P49A 4J3OC 5DGRA 1JFQH 3FAXA 1MCJA 3O9WC 1DVFB 2WBJD 5IK3B 2WQRA 1I8IB 4PLKC 5L2JB 2PYFA 3SKNA 2DLIA 4IMLA 4JDVB 5HHOE 4TNVK 4PY7B 2RAMA 3S88L 1RURH 3TBYA 4UIMB 4QOKA 2AW2A 5BV7H 4JDTL 3RUGA 32C2A 1KIQA 2AGJL 4LK4A 2YUZA 5LAXA 3C5SA 3UC0L 2HT3D 4ZFGH 3WJLA 4OF5A 2QKIB 2R2EA 4Z5RA 1CZ8L 3GMPB 4CJ0A 4GAJH 2ZUSA 4YNYB 5ALCL 2GIYA 3BD5A 3D69A 4QYOA 1LVEA 4P2OA 4Y4KC 5DYOA 4NZJA 5CJQH 4DGYL 2MQCA 4PJ7F 1LNUB 3QI9A 5CJXC 1DBBL 2X42A 2VL5A 3HC4L 2NZ9C 1NBVH 1MFCL 4LLUA 1WBXB 3WUWB 1YEFH 3CSGA 3WFBL 4Q74A 2AEIT 4M1GH 3U46B 2MOVA 3FQNA 4FQHA 1KT2A 1WC7B 3QH3B 4YBQC 3DSFL 2X2YA 3OAYK 2M26A 1TCRB 1MIMH 2R4RH 3I6KA 5JHDB 3BIBX 4EDXA 3ZT6A 4AH2B 4FZ8H 4JZJA 1FIGL 4V1DB 3QEGH 3ZE0E 3MPCA 4HWEH 4R0LC 3M17A 2R1XB 4NUJB 4J4PD 2V5MA 4Y88A 3KYNA 1CLYH 3ZKNC 5F6IC 1MEXL 4GXVL 1T0NB 4PRBB 5TE7L 1MCHA 4TUOA 3DSNA 1OARL 4LLMA 4NHUB 5T1LA 2KL6A 5IB2A 1KEGL 5B38G 3D3VE 2CLZB 2VXSL 1EHLH 1U3HA 4QNPF 5ITBH 4JO1H 3D5OF 4M6OH 1HH6A 5DQJB 4YHKL 3GGWB 4NNYA 3BPCA 4RX4A 4LF3A 2BVEA 3WV0A 1BWWA 2ICWJ 2IBGA 1JNLH 4C59B 5K9QG 3HI6L 2ERJC 4XWGL 5EU7C 5GGTA 3QCTL 3MRKB 5KG9B 1NFDB 4HHAA 1AGCA 2ADJA 5D1QD 2QEJA 1JBJA 4WV1C 1BREA 2PO6D 2VLME 5A2LH 2NXYC 2R0KH 3ULVD 1KV3A 3QR2A 4HZAA 1UWEL 3CLEH 3TJHC 3VXRD 1EVTC 1GOGA 1AO7D 1JNNL 1HQRA 4G3YH 2JK5B 4HJJH 2APBA 1F3JB 3AB0B 5F8RC 3GUTB 3NABL 2X1WL 3OZ9L 3PDOA 4OF0A 4XP1L 4AJ0A 3GI9L 1F4XH 4XNXH 43CAA 4JHWL 4ZQKB 4J6RH 4Z8FH 3WSQH 4IHOB 4R4FH 1K4DB 3HFML 3UTPE 1VACB 2BK8A 1ED3B 4U7SA 3ULVL 2NY1C 3FO0H 1W0YT 5HYJD 4K7PX 2MSPA 3B9KD 1GGBH 4FQXD 1MQKL 1H5BC 4TVPD 3A6BH 4N1CA 2JTDA 4WWKC 5BRZA 1A64A 4KRLB 2APTA 4XT1C 1QPPA 3T08A 4Y4HD 4FFZL 4M62L 4LCYA 3BAEL 3LKSA 1T0MB 4KJYA 3C5JB 1A4JA 3NCJL 3P9MB 4FFVD 3IXTA 5IVXA 1CGVA 3K46A 4PP2A 5E2VH 2A1WL 4UAOC 1BF2A 4AM0A 5E99H 4TVPL 1JGLL 1FNHA 3D85D 4ERSH 2Z0BA 1H3XA 2NXZD 4FQ1L 1NCAH 5FUOL 1MRFL 3S5LB 4D9RD 5C07A 4OV5A 5LVEA 4LIQE 1Y6NR 4HQQH 4N0RA 1IFHL 1NC4D 1EHNA 2QSVA 4NP4L 12E8H 1F6FB 3MLYL 5HHOD 3U7AA 1JP5A 1MFDL 3IDNB 5I30H 4YXKH 3CIQA 5MP6H 4CUCA 3QIBC 4KI5C 3L5HA 1KCVL 3NIGF 1D6EA 1R3HB 3PGDA 4ZS7H 3QRGH 4PJBA 8FABA 1RSFA 3QUMH 1KJMB 5T3ZE 3LHPL 3TM6A 3CC5B 4U1LA 3RGHA 2Z92A 4QXUL 1LP9F 3O2DH 1PX3A 5FKAB 5FO7A 5AUMA 3ARDB 1IKNA 3MLSH 5INCA 1U8PB 1VADA 4EN3C 1O7VA 3VGBA 3H3PH 3O81A 5GQBA 4P2QD 1JF5A 4ZYKA 1GYAA 1I9RL 3OKKB 5IB3B 3RY4A 3RWJA 3BEWA 1MJ8L 3TIDA 4WTZA 3UAJC 4I8DA 5ESQB 4XNUL 4OFYD 1BM3L 4X4YB 3O4OC 5DS8B 2YC1A 1ZHBB 4DTGH 3T1WA 4JPKL 2KDGA 4YBLC 1K4CA 4XHQA 4QRRD 1LEGA 5TQ0H 1FQ9C 3GO1H 5A3IC 4KUCD 3EGSB 1E4KC 5GRYA 3EUUA 3UDWA 4JFQB 3O3EB 5J1TC 1RJZB 4NJAH 4NO5B 4Q0XH 4HUVB 4OBRA 4HGMA 2GFBB 3D3VD 2JCCA 4L29B 2FR4B 3MRIA 4Z95L 5GXBB 4YH6A 4P5TC 4JFEB 4MA3B 4Y4FC 5D93C 5DVLA 5IR1A 1AQKH 4U0RB 3BE1L 4NHCL 3R1GH 4KFZC 3QAZC 4L1HA 3MGAA 4P4RB 5TPWH 4CMMA 1QEWB 4Z0XB 3O45B 3B8YA 4YDKL 5CD5C 2OJZL 1T04B 3K1DA 5CZVH 4LNRA 1H9VA 4LSDA 1CI5A 4LSVH 4CN1A 5HHQB 5IM7A 3V79C 1NMCC 3H7LA 1JNHB 4GKSA 3KJ6H 1U93B 4QXWA 1GOFA 3IFLH 3R8QA 2VLJA 1JZ2A 3DVNA 4H25B 3RP1A 3P30L 3MRCA 1XIWC 4NKOB 4Y5XC 1KFAL 5EPMB 2CIKB 3UTPD 5CJBA 1IVLA 2CDGA 5GGSB 4DGIL 2ZSVA 1DUZA 4OAWB 3C2AL 1KENL 3VFOB 1V7ML 3UYRH 5EBMA 4ODTL 1OT2A 1R3KA 3V5HA 3AREC 3G5YA 1FAIL 1G9MC 4I77H 4XP9H 1M6OB 4ZDHA 2AAVA 1WWBX 3MRBA 1MCIA 1C7TA 1X5XA 4AL8H 4TOYH 4NNXA 3BSZH 1FO0B 4NCC1 3MROA 2DYPA 3TC9A 3OL2A 1OVZA 3U0TA 1I1AA 1JGDB 4MXQD 5EB9A 3DO7B 1B88A 3RPIA 1I7UB 1DBAH 4JPWH 1MHCB 4MQXD 1IAIL 4XHJC 4N9OB 4JRXE 5K9KA 5MHSE 2WWKO 1WEJL 4KU1A 2FECL 4NO2B 5JIHA 5BV7C 4R2GB 7FABL 5TFSL 1H8OA 1T21B 2XKUA 3D0LB 3GSVA 4ODSH 5B38A 5GS2H 4Y19B 2G5BA 3RNQB 3HI5L 3ZDZE 5HYFA 2KQNA 4YWGH 3UPRB 3MOAH 1EJOL 4ZOBA 3CCHB 4BZ1L 5E8PA 3OXRB 3V5KA 4LIQL 3WLWC 2P5WB 4LVOC 3K80A 3SGDI 2BC4A 2P8LB 5C08B 2R1WA 4HK0A 4I0PC 4OGZA 4IRJA 1IGYB 3C87A 3QIUA 5I75C 3HR5A 2DWDA 3RX5A 4TRPL 3T4YA 4WHYG 2FO4A 5BZDA 1JWUA 5KSAB 3OKEA 3UZVB 3RDTD 3RFZC 1NMBH 2PYEE 3DNKA 2AERT 4PJ5D 4QEGA 3RL1B 1KXTB 2LU3A 3BIKA 5IFHL 3BKJL 4QHUB 4PJAF 2K1MA 4HCRL 1T6VN 3DROB 4N90E 3IB4A 4YPGB 5DRWB 1MLCB 1WZLA 3F7VA 3WLBB 5FUCE 2X09A 2AS5M 1E6OH 1KCUL 1R0AL 2CK0H 3X14B 3G6AB 3JTSB 1C8PA 4K7FA 1FNSH 4MWFA 1LD9B 5DJ0B 1XGYL 1V5JA 4H0HB 4B7LA 1I3RA 3DUUA 4S11A 3HC0A 1FFNB 5JZ7D 5E5RB 4I48B 3RKDD 1JWSA 4XMPL 2EDFA 1FZMB 3L3GA 3O11B 2C3XA 3BGMB 5F9JA 4JPIA 2BVOA 4G8IB 3NTCL 5FV1L 3LEVH 5TDPA 1X6LA 2IH1A 4Y5VA 2M2DA 4G5ZH 5CEXB 3ABZA 5MEPB 1NKRA 2AK1H 5T5FH 4UQ3A 2GAZA 1ZSDB 1SBBA 1I3VA 2X4SA 3FOLA 3R8BB 5IW6A 3TA3C 1OT1A 4H26A 3IGAB 1QLRA 2JJWA 4LQFL 3QRFM 5F1NB 4PGZA 1OGAD 4MDIA 1WCBB 4W6YB 1A6PA 1LEKA 3SCMB 3I6LE 3QQ4B 4KKLC 4X98A 4BM7A 4L5FL 1TZIB 3RWHB 2PTTA 3OG6B 4H1LB 3ARBB 3FFCD 5GJTH 2XZAH 4ZUSA 3FQUB 4DZ8B 3PV6B 4WUUB 5J13C 5DJ6A 1OF2B 2P49B 2ZKHH 1IAKA 4HIEB 5DTFB 5SV3A 5F3BB 3PWPA 2XZCL 1I85C 3LKPA 5DMIL 3VI4F 3O6FC 3HG1B 4XBEL 1IT9L 4XXCA 1H15A 5DWUL 2ZUUA 4NQSB 2FD6L 3LRSA 1J1OH 4GAFB 1KACB 3O8XC 2A6DB 2MTPA 1JL8A 4P48A 3T09A 3BH9B 3BKCH 5HPMB 4NFCA 5DHXB 1P69B 3HI1A 4O58L 5C6TH 2VC2L 2L0DA 1Q72L 3CFIC 1TZGH 3I9GH 2BRRH 1QHPA 4JM2D 3QDJB 4OGAC 4GRWB 2VH5L 5C0CB 2ESVA 4EI5D 1B0RB 1LO4L 1ZK9A 2DIBA 1UWXK 2HT4C 2YPVL 3HE7B 5EU3A 1V8HA 3O0RL 1KB5A 1CFQB 1BJ1J 2W9EL 4GSDH 1GPOL 4RGMC 5JORA 4PR5B 3QUZD 5F7NC 4Z7QF 1YPZE 3MV9A 1TTGA 1YNTA 3VH8B 5MENB 4I18B 1OTTD 2ZUQC 1A7NL 4HUMB 3V95A 4HKXA 4XMLL 4BUHA 2UYLB 4FQIH 3GMLB 5T1MB 4CVXB 5C0IA 1YMHA 2APVA 3GSXB 4WJ5B 4WO4D 2V17L 4CVUA 5L9DH 4Y89A 4P59H 3L3IB 4JDZB 1KJVB 2D2OA 4PRHA 5FGCE 4NFDA 3VE0B 2FATL 1A8JH 4WFGE 5T1KD 2VDKH 1QO3B 3VW3H 5L0QB 4W6XB 3EFDH 1A6TB 4U33A 2JJSC 1UM4H 3QUYC 5C2BL 4KTEL 4LLVA 5D71L 2XTJB 4HJ0C 4X80H 5EO1A 1N5AB 1UJ3B 1ACYL 1F58L 5IBUB 2DQHH 1D6VH 3T77A 5F7HA 4PPTA 5IB1B 1D5XA 5F9AC 1JGVH 3K8KA 1TNNA 1W0VA 4F37K 3LEYL 1DTUA 3PGFH 3BDBA 3DMMB 1S7UB 1ROWA 5D7LA 3C60A 1WFTA 1FZJB 4XNQB 1KJ3H 3E6HA 4PJGF 3SDXB 4PLNC 2G2RA 4Y5YB 4X4ZA 4AEHL 1QSEE 2N56A 5GGUB 3QZWG 3IDJA 3U83A 4MZ3A 3E3QE 3G5ZA 5KSVB 3QULA 3SKOB 4MJ5B 5D5MF 4CN4A 1S78C 1FORH 1ZA3B 5CINH 4RGOL 5JOPD 5I8OH 4LCCB 5M7QA 1IQDB 2P44B 1J0ZA 3ULSB 1MJUL 3HPLB 2VLKE 2FHBA 3FCTA 4DJMA 1EUUA 5FA4B 5F96L 3HB3D 2QHRL 3L3OB 3MNWB 1HYSC 1O0VA 4JY4A 1S9KC 3H9SB 2YBRB 2Z8RA 3FQWB 5FECB 4AK1A 1OSPH 3RTQD 2ATPA 1AGFB 2AV7B 4FFYL 3DURB 1V3KA 4ELMF 3O9WD 4OQ1A 6CGTA 4PLKD 4YO0B 1A6AA 5D8JL 1JYXA 1I3GL 2WIIA 4OTXH 3DHMA 1ITCA 2HG5B 3NCMA 4DZBA 4OGYL 3EOAA 4KI5E 3G5XB 1EGJA 1F3DH 3Q5TA 1KN2H 4JM4L 3I6LD 4QRTA 3ZE2F 1BOYA 4IMLB 5E8NB 1FC2D 3KDMB 1FNEA 1VEOA 2A0LC 5T5NG 1MJ7H 2C3HA 4LHUG 1DEEA 3KPNA 3ALXA 4UINH 3TBYB 3UTSD 5DO2C 4QOKB 2CXGA 4Q9CA 1KIPA 3RUGB 1RZKH 3OX8A 4OD3H 5L88H 4GG6F 3C5SB 4Y4KD 1MCQA 5C3LD 3W0WD 1TPXC 3IDGA 3DGCR 2E7CA 1SEQL 1OTSC 1YQVL 3ZYIA 3QCVH 2NZ9D 1YEHL 2XIDA 2BNRE 2NY5H 4YBQD 5DYOB 2PKDA 3FAWA 1ZLUH 2HN7A 1F02I 3QJFB 4IRZL 5ICYB 1YEKL 4LLUB 2ICCA 3EJZC 3FQNB 1NCBH 3QEQE 2VE6A 4QRPE 1UB5A 3KYKL 2OR9H 4WTWA 3Q5OA 3I6KB 4FQJL 1NCTA 4EDXB 1JRHH 3ZKND 4JZJB 1FAKT 3MRGA 3MGTA 1CGTA 5D1ZB 2DM7A 3FMGH 3M17B 3T0EB 1HILB 3G6JB 2E27H 4NQCE 1MLBB 2Z8VC 1N0LA 4UDTB 2C3GA 2Z8SA 4XC3H 4HBQA 2B5IC 4TUOB 2FCBA 3ZYZA 1ZOXA 4LLMB 4APQB 4K7PH 5IB2B 3NH7H 3GSNA 2EYSB 5ETUA 5SV4A 1FC1A 1OW0A 4WY7L 2OL3A 4MX7A 4WEUD 1UEYA 1U3HB 5MEOA 2IMMA 3DUHA 1GSMA 3BPCB 2XQYG 3ARGD 2NXYD 1JUFA 2W38A 4R8WL 3MODL 3TJHD 4DN3L 4I1NB 4LSQH 5EOQH 1G0YR 4L4VB 4RRPG 4AEIL 1N64H 4XPFH 4FA8A 4GMTH 4HHAB 1NAMB 1DQJA 2PW1A 5GZOD 4Z7WE 4OCRL 1F45A 2J7LA 4Y1AD 2YHGA 1VEMA 1UM5H 1HINH 3TO2B 1TCMA 2J88H 4RAUB 2LABA 1WJ3A 3T3PE 4E41B 1HQRB 3EOYG 4Z7OF 1GXEA 2NY1D 2W0LA 3FO9B 5E08H 3O6MH 3H3BC 3PDOB 3WNKA 3OR6A 1KC5H 4JN1L 2HVJA 4NWTL 3SJVA 1A21A 4R97B 4WWKD 1QSED 3BGAA 4S1QH 3P77B 5DLML 1VGEH 5IMMB 1X9QA 3SPVA 5HYSA 5IHUH 3TNMB 3MBXH 4QRQA 2GY5A 5I8EA 4KMTL 4EVNA 5E5MA 3GBNH 3RZCB 5BRZB 4OZHE 5HHVL 4NFBA 4R3SA 5JQHC 2VLKD 3BQUA 1E4XL 5E2WL 4Y16C 3B5TA 4LCYB 3T4AA 4F9PC 3FO1B 4ONOA 4WUKH 1A6WH 2VXQH 2PR4H 4LVNB 5F7FA 3WIFB 4N0UE 3NA4A 2V9RA 1JPSL 2YD4A 4AM0B 1EA9C 3JV6A 3HNTH 3HNSL 1BFVL 2GSIB 1M7DA 3QDHA 4QT5B 1M71B 3QIBD 4KI5D 5JUEL 3T0WA 3IXAA 1MY5A 5GRXG 1IC5H 1RQ5A 1TETL 3OKYA 4K7PY 2CSPA 1GJIA 2ZPKL 5I9QC 1NSNL 1AC0A 4DKEL 4NM8H 4XPBH 3NCBB 2I07A 4WCYL 4TNWK 5IHLB 5CEZH 1FNAA 1D6EB 3HMXH 4XC1H 2GEEA 3M45A 2WIMA 4PJBB 3VXSA 4EN3D 1FVCA 3HUJF 4PJAA 4OLWL 4U1LB 2IBZX 5L2KD 5F71A 4RQQA 1DBJL 4PBXA 2NTSP 3ROLA 4AIZA 1MNUL 4JFFA 5IEKB 3ZYOA 5JLZA 5INCB 3MV7B 5DEGB 2FBOJ 35C8H 3QDMD 2WK2A 2B20A 2V9TA 3UAJD 4FQQA 5IESH 2X70A 2BNRD 3RJDA 1WIUA 4U1HA 5I1AA 3QFJE 3UTTA 4X8JA 4ZXBC 3TN0C 3HE6B 2IANA 4X7SL 5GRWA 4HC1L 1BZ7B 4YK4B 3NA9H 4PGBB 4F2MA 4KZEH 3IYLW 4H5SA 3IAPA 4FFWC 3RVVC 4I4WB 3BD4A 4LVHC 3K7UA 5DDHA 3B6SB 5A3ID 3TBWA 3OKNA 3VFMA 2YC1B 3QZWA 5TJWK 2VXUH 2R29H 1X4ZA 2MHAB 4BJLA 3LCYA 2Z31C 4ZAKC 4PGDA 5B8CC 4RISH 1LEGB 3ESUF 1KJ2L 3IJYB 3SDDC 3R06B 5J06A 2R69H 4OZIB 4P5TD 1PD6A 4KAQL 1CS6A 3CZFA 3VFPA 3QBTB 3RWCB 3TBTB 1X5KA 1RIUL 1PAMA 2DTMH 3OAYH 4X7TA 5GS0H 3MRIB 5HDBE 1A6VH 2UWEE 5B3NA 4MAYC 3RL2B 5T33H 2ZCLH 2HP4A 4KRPC 3V2AR 5IR1B 4QHMA 3EJJX 4PRPE 1Z9OA 3QXAB 3SO5A 1UEMA 1RFDH 4E9LA 2KQMA 2PW2A 2ZG3A 3BEVB 2Y07L 4N8VA 3D0VA 1CLOL 4JO4H 3C09B 1OM3H 3QPXH 5BVPL 2ICES 3GI8L 2ADFH 4LNRB 4J3SA 4LHUA 2IFGA 4YDIL 3I02B 1DQDL 5C0GA 1HXYB 3JWNC 1EMTL 4G7YH 3BWAA 2OK0L 2CPCA 2VLJB 1S7WB 1P4LA 5DJYA 4RMWA 4U1GC 3A67L 4PV8A 1SY6L 5HGDA 3U82B 3BDXA 3ARED 5IFAL 3WXWH 4FMFA 1U3YA 4PJCE 4LLYA 1DBMH 4HT1H 2D7NA 5I1IH 3EOTL 5F70A 3MRDA 5D7JA 4JRYA 1EAJA 4AQ1B 4YAQA 3V5HB 4G9FE 3T0VA 5KVFL 4PJ9C 3SE4C 2VDLL 4AMKL 5HYQA 3FJTA 2F5BL 3MRBB 2QSCL 1RJYB 2HFGH 1U42A 1LK3L 4XHJD 1YMME 3KG5A 4WENB 4M6NH 2ZCHH 1CVRA 1G9ML 3FT4A 5FGBA 3MROB 3EYFB 2DYPB 3IS0X 2PXYB 3OGCA 4ZTPL 3U0TB 4L8BA 3JZ7A 3UTZA 1A14H 4X6CF 3ULVF 1WBYB 1ADQL 3D39D 5D2LA 3FB8A 5SWZA 2R0ZH 4XCYA 1S7QB 1P5VA 4Z78A 1IM9D 1BVZA 2VZ3A 1G84A 5K9KB 3CDCA 4JKMA 2EDOA 1QKZH 3WLWD 4IJ3C 2P8PA 4YHMH 5CBEA 3GMRA 1RZKC 1YA5A 2EKSB 1J1XH 1RURL 3EFFA 2EIDA 2IAMC 4I0PD 5BV7L 2G5BB 1LE5A 1FO0H 1KPVA 1ACZA 4ZFGL 1MQ8A 4P46B 4JHZA 1AJ7H 5BXFA 4HK0B 1DVFC 4RRPA 2NY5C 4U49A 3MFGB 4PJGA 5EZJA 5F21B 1Z6JT 2FO4B 4DUWA 1S7XA 5GGRB 5IW1A 3PWVA 5CJQL 4HPYL 1MPAH 5D5MA 3O6KH 4OLXH 3WS3B 3QNYA 1F6LL 1NBVL 4HJGB 5FM4A 1YEFL 2J8UF 3VGEA 4LPCA 1XGQA 3PQYE 3ALPA 4M1GL 5E8DH 1AKJA 1D9KA 1MIML 2Z9TA 1VGKB 2R4RL 2YD2A 3SDAA 1YEIH 3OQ3B 1P1ZB 2XYCA 1QRNA 2HJFA 4FZ8L 4WW2F 5SWQB 4WW1A 2F74A 3VWKC 3QEGL 1KLUA 4ELMA 1A3QA 3DGGA 5DJ2A 4HWEL 2VQ1A 1GH7A 1I3RB 3DUUB 5IV2A 5D6DC 3LPWA 3DHJA 5EC2A 1JWSB 4NT6A 3JVGC 4FMKA 5D96B 3CFDA 1CLYL 3GJFK 4PJHE 5F9JB 1ZGLA 2EC9T 5IMKA 2BVOB 5H94B 4PIRF 5TDPB 5FGRA 3L3HA 4GW4B 3W82A 4PBVC 1CT8A 2EE9A 1EHLL 1A3RH 2H32B 5ITBL 4JO1L 2VDRH 1KTRL 4M6OL 4X4ME 2ITCA 4UQ3B 2GAZB 5GGSY 1KPRA 2X4SB 5F9WB 2Z8WC 5IROC 1LK2A 3UJJH 4PRPD 1JNLL 1U6AH 5ISZD 2XN9A 4KK8C 4YHLH 3P9LB 3RA7L 3MLXH 1HK6A 5E2TH 3HRZA 1LEKB 4RZCA 3CLEL 5I2IB 3L1OH 4NQDA 2F54B 3FONA 4G3YL 2A74B 2ID5A 4HJJL 4ZUSB 3ZE0F 3SGKA 4PJ7B 4TTDC 5DJ6B 5GIRB 4RIRA 2UY6A 3O8XD 4YGVA 1WF5A 2NY2C 1FV1A 1F4XL 4X6BB 1VFMA 2EH8H 5EZLA 2D0GA 3PL6C 3B43A 5D7SH 2G9HA 4J6RL 4Z8FL 3WSQL 4R4FL 3AROA 5KW9H 4OI8A 2O5YH 4JFXA 1VPOH 3IRPX 3FO0L 4OLYH 3DXAE 4OGAD 5HI5C 4F7CA 2VR9A 2ZNWA 1GGBL 4X6FB 4ZFZA 1XGPA 3A6BL 4PTTA 1MRCH 2HT4D 2GTZB 2BY0A 3AS1A 4JFZH 5ILTL 2ZUYA 4J1UB 2C3WA 3S6CA 3NZHH 2EO9A 4G9FD 3LQMA 4PRAB 5DMJB 1T89A 2EE2A 3O6LH 5C0FB 4DKDC 1AGBA 1T22A 5FYKH 4NDMA 1S7SA 2HVKA 3AS3A 5EU3B 2FNBA 5GGVH 5E2VL 5EU6E 3UBXI 1OL0A 5E99L 3FB6B 1U8LB 5LGJA 4ERSL 2X89D 3MV9B 4ORGB 1NCAL 1CFNB 1YNTB 3CGTA 3MLWH 4G9DA 2K7PA 2BNUB 1J88A 3IF1B 4M4PA 4P2RB 4HQQL 5C0IB 4JFDB 1YMHB 4Y8AA 5IB5A 12E8L 4WFEE 3QUYD 4YHIB 5I30L 4YXKL 5AEAA 2IG2L 4GRWH 4PRHB 4HJ0D 3QRGL 3ZSSA 3QUML 1H8SA 4NPYB 3HMWH 3H7BA 3QDGB 3O2DL 3DIFA 2VXVH 1L7TH 2Q20A 3H2WA 3JWDH 4X9GA 1FCCA 3ESVF 3MLSL 4IMKC 5EO1B 5D2NA 3VMOA 3ARFB 3HN3A 5EG6C 3ZKMC 1MH5A 3QJHA 3VXMA 3H3PL 2IWGA 1FG2A 2Z93A 1U8MA 2FHFA 2VQUA 1G7IA 3TT1L 1ZLWK 3AUVA 1FL3B 1I1CA 4M6MH 5FA3A 2GCYA 1W72A 1M7IA 3DRTB 4PGCA 4M7LH 4PB9L 3C60B 4X6DB 1Q38A 3NCFB 5TDNA 1RK1A 1S78D 2AQ2A 3KR3H 2EXWC 4DN4H 4ZFFB 1OWRM 3E6HB 2AQ3A 5I1LA 3BMWA 3ARDC 2I9LA 1U8IA 4DTGL 3MJ6A 1W8OA 5JXEA 1GC1C 4KKAC 1UZ6F 1UADC 1HYSD 4MD0B 4XPTH 2NW2B 4JFPA 5FYJH 1SEBA 5T3XH 5HHNA 5TQ0L 3GJFB 5D7IA 5C6WH 1Z9SA 1CGSH 4HXAL 1OSZA 4NRXA 3GMQB 5GS0C 3KPRA 3EIFA 4NQED 1HHJB 3V6ZB 4PJIE 4M93C 2GI7A 4NJAL 4JY4B 1MSPA 2CLVA 2D7PA 4UOJA 5KSBE 2ATPB 1SHMA 4WFHD 4P3DB 2NR6D 1BBJA 5HVHB 4HKJA 1D5IH 1UH3A 5C07E 1YYMH 1A6AB 2D0FA 5F88A 1AQKL 2A0LD 5CLWA 1E28A 4M43H 4PRIE 3HUJA 5DHYA 1Q1JH 3R1GL 3PJSA 1LP9B 3MV8B 5TPWL 2VLRA 5DO2D 4AG4H 5HHPB 4FTVE 4ZPVA 2B1HH 4RWHA 3BPNC 1WFOA 1N4XH 2ATKA 5HYEA 5CZVL 2EDLA 2HLAA 3MYJA 3V5DB 4WIQA 4XP5H 1CWVA 1EFXB 2GJ6D 3QPQC 1DEEB 3KPNB 3O3AB 2A83A 1SM3H 4XVTH 1OTSD 4L4TA 3KJ6L 1PBYA 4JVUA 3IFLL 4ODHL 4U4BA 1KIPB 4Z7UB 2C3VB 1PG7X 2A38A 4ZSOA 4LU5H 2HLFC 3KPPB 4U0RC 2W91A 5SWSA 3TH4T 4P99A 2EXYC 1UA6H 3O2WL 3IDGB 5IQ7H 1I9EA 5MI0B 4LSSH 2WBJA 5A43C 3F62A 4XCNA 3MV01 2YRLA 4ISVA 3LN4A 5HHMB 2VDOH 3HR6A 4P4KD 3EJZD 3PXJA 3WHXA 2LTQB 3MRMB 3C8HA 1CE6B 3UYRL 4JZOA 4NN7B 1N2RA 2HN7B 2DQCH 1EO5A 1VKXA 4I77L 1YECH 4XP9L 4ODUA 4BQBA 3LKOA 3RY6C 3UX9B 4AL8L 1J8HD 4LPXA 2VE6B 5DRXA 5ENWA 4TOYL 3BSZL 4YGAB 2FX9H 3KLHC 5EU6D 1A6ZA 4PJXE 5IQ9B 1U2CA 5CSBA 3TH2T 4Q7DA 1KBGH 5GS2D 1DBAL 1NFIB 3MRGB 2MCPH 5E03A 2OZ4L 4FG6D 5B4MC 4U3HA 5BS0D 5DRNA 1E4JA 4I3SH 4DKAA 1Y6MR 2P42B 4W4NA 2YN5A 1MCFA 1NGPH 5AZ2H 4JB9H 1F4YH 1WWWX 4DW2H 3G9VA 1NGWA 3V7AE 2JCCE 5F6HI 3WL9B 5ADPL 2A73B 4PJDE 4ODSL 2I26N 1UWXH 1ND0B 3GSNB 2CO6B 2JJTC 2OL3B 3MOAL 4RGNB 1A1OA 1ZLVK 3UZEA 2OCFD 2W1NA 5KJRH 1ZVSB 1CXHA 1LWRA 1ONQB 1DE4A 1IAOB 4R7NA 2BSED 3L5JA 4J4PA 3OKDA 2XG5A 1T0PB 1DQJB 2PW1B 4R2GC 4HDIA 4PYHA 1DLFH 1MELA 3B3IA 4UB0H 2FHCA 1NMBL 1NBZB 2ICWI 2VOTA 2P46B 2F9BT 2GY7B 2I5YH 2NX5D 5I71B 3O3BA 4DOHB 2QJDA 1INQB 3E2HB 3OR6B 5EFIA 2EYTA 4KMQA 4U3XA 1E6OL 3AFLA 2CK0L 3SJVB 2JKXA 1FLRH 1P7HL 4JZNA 2EDHA 3DWTA 5KSAC 5GSRA 3H42L 2Y6SC 3RVTD 3D2UB 3KPLA 2PO6A 4PLJC 4RSVA 5IBTH 5HYSB 1FL5B 5I1KH 4X6CA 1NAMH 3VXRA 4QRQB 2NY4B 3A6OA 4EVNB 2ORBH 4KV5E 3S98A 2AXHA 4R3SB 2EIEA 2F53B 2H2SC 3FOMA 3T4AB 4S0SD 3B83A 3LEVL 4UBDC 1I1FB 4LFHG 4KVNH 3ZHLA 4G5ZL 3T65A 3TZVD 2AK1L 2EDKA 5T5FL 5CUSH 1IC1A 4OM0H 5HYJA 2XOTA 2VXTH 3U48A 4GAYA 3JV6B 2DQJH 5KS9F 5IHZA 2IQAA 2MNUA 2F8VA 3PNWA 4HKBA 1Q8MA 1RUKH 1YN6B 2GSGA 3IU3B 1N6UA 1I3UA 4JAMA 5CIPA 4Y4HA 3IXAB 1AD9B 1QVOA 5HGAB 1QFUH 4D0CA 4C56E 3F12B 2FSEB 5GJTL 2XZAL 5DHVA 5HGGS 2VITA 4JFOB 5KZCB 3QQNA 2ZKHL 1T20A 1CDCA 3VXSB 3D85A 2EDRA 1DEDA 4PJAB 1H3TA 4N1HB 1TDQA 1KLGA 1F11B 1NLDL 3X12A 4ZXBD 2ED9A 3RHWF 2P24B 3ROLB 5IMLA 4B0MM 4AIZB 1X7QA 4CDHA 2QQLH 4JFFB 1NC4A 4MCZA 4DWHA 1J1OL 4K8RH 1R5WB 2WW8A 4OGXH 3BKCL 4FQQB 2C26A 5HHOA 2RFXA 2X70B 4FFWD 4WW2A 4ZNEE 3RVVD 1T7VA 5I1AB 3ARBC 5C6TL 4X8JB 3LY6A 3BKYH 3ULUH 4MNQB 3I9GL 4L8SB 2BRRL 2P5EE 1N7MH 1QQDB 5HD8C 2VL4A 5DK0A 4F2MB 3TF7C 2Z31D 3BIAX 3S96A 2DN7A 3QNZB 1I8KA 4GSDL 2AK4B 4G6FB 3REVB 5DDHB 3SDDD 3TBWB 3OKNB 1BZ9B 1CU4H 3LPFA 4C54A 1F4HA 2QQKL 1KG0A 4LHJB 4HFWA 2IBZY 4NRZA 2XY2A 2X4OA 4KK5C 4FQIL 5LG1A 4X5XA 1JYVA 4YFLI 5I1HH 1H0DB 1U92B 2OTWA 2D31A 4MAYD 3AY4A 3HKFA 2D9CA 4ZO8A 5L9DL 2OMNA 1MFBH 1TJIH 4P59L 3CZFB 3IJSB 4KDTC 4OFYA 3CVHL 2L7UA 2VDKL 3IETB 5ALBH 3VW3L 3OPZH 2FX8H 3JWDC 4HUWA 5A2JH 3PDGA 3EFDL 1N59A 4I18C 3SQOH 3WD5H 1GGTA 1UM4L 5EIQA 4DEPC 5C8JB 5EC1A 4QRRA 1C1EH 4ZPTA 2G60H 5DUML 2QR0A 5HVWA 4X80L 1S5IH 1PQZB 4GT7A 3SGEI 3KYOA 2DQHL 1D6VL 3ARSA 4N8VB 3D0VB 3EYOB 4X6EA 2AI0H 1JGVL 4ZODA 1CL7H 2IADA 1YPZF 3D3VA 1YYLH 3PGFL 1NFDE 5L0QC 5GS3A 5FM8A 1BJ8A 5C0GB 2Z91B 5EBLB 3OGOE 5J56B 1K8IA 2E6QA 5E2JA 4YHYB 5DJYB 1KJ3L 3MRHA 2XTJC 4JG1L 2BHUA 1BD2B 1H3PH 1EEUA 1UJ3C 3LKNA 3FRUA 4MA1B 5GRJH 2Q7YB 5HGDB 2O5ZH 2YA2A 3NGBB 5CHNA 1BJ1H 4PJ9D 5D6CA 4LLYB 5DD0H 3P9WB 1FORL 5CINL 4KHXH 2UZIL 4ZMAT 5I8OL 4P0DA 1DL7H 3DMMC 2AGJH 3U79A 1JMXA 2ZZUT 1D3CA 1WT5C 1U58B 3TH3T 3KLAB 3DARA 2K7QA 4GBXB 4Y5YC 1OSPL 5JOEA 2DTSA 1FFOB 1R5IA 5EIIA 2YSSB 2R2BA 1Q94A 4CW1B 1U91A 4L8BB 5CEZE 4PJEE 1HHIB 4TUJA 1RULH 4HS3A 1BJMA 3FB8B 4XCYB 4JFYA 4LCCC 4Z78B 2IAMD 1MFCH 2EE3A 1KN2L 4Q58C 4MSWB 3S36X 3N1FC 3VFUA 3UJIH 2FJGA 1IM3A 1FP5A 4RMUA 4C56D 1NUNB 2P8PB 1MJ7L 5CBEB 3ES6B 4J8RB 3EFFB 4ZG1A 4UINL 1QSFE 4HEPG 3W9DB 1DVFD 4H0IA 5H37G 4OD3L 3T2NL 5L88L 1LE5B 4K94H 3RX8A 2XPGB 3CDGA 4M6AA 1AIFA 5EOTA 4LEXH 2DICA 5L6YH 1MEXH 3CU1A 4GXVH 5HDLA 3FB7A 4PJGB 1ZT4A 3OB0K 4OFPA 1KEGH 3LS5H 5KAQF 5IW1B 2NY5L 1KF9B 3HRPA 5INDB 2BDNL 3N85H 5IW3A 3T0AA 3FQRB 2WLYA 4CVWA 3S4SB 1YY9C 1NUFA 3QNYB 3BW9A 4MYWB 1KCLA 1MOEA 1F13A 3TBVA 3KLDA 1Z3GH 3HI6H 5ACZB 1NCBL 4XWGH 1HHGA 4KI5F 1QR4A 1AKJB 1D9KB 5C0BB 2OR9L 3FO2B 4RNRA 4AENA 43C9B 1HCVA 1JRHL 3FKUS 5DJZB 4WW1B 1N6VA 1MHPH 3GBLA 1KLUB 4ELMB 3RDTA 5DJ2B 2VQ1B 4OZFB 3FMGL 3NABH 4LGRB 1J87A 5JHDD 2E27L 4HUUB 4NUGH 2XY1A 3OB8A 5JW4R 4CRPA 4NT6B 4V1DD 4F9LA 1BOGB 3CFDB 4XC3L 5ICZA 3MYZA 3UCRA 1UC6A 2VAAB 5IVOA 1EERB 4K7PL 4KK8D 3NH7L 4DFIA 5HVFB 4XVJH 3L3HB 1CT8B 3HTLX 2CQVA 1F42A 5ANMA 4JZJC 1OQOA 1IAMA 1KPRB 1LK2B 5CSZA 5D1ZC 4BFIB 3T0EC 2KKQA 1NBYA 1QFHA 4LSQL 4GG6B 5EOQL 4M62H 1N64L 1CQYA 4XPFL 4GMTL 3P3YA 4TTDD 5F44A 4R96A 1KB9K 2UZXB 3NZ8A 3QO0A 4ZS6C 3NIDF 1KIRA 2CUMA 1A9BB 4RWYL 1HH9A 4APQC 1UM5L 1HINL 3QO1A 3LKQA 4X0KB 2J88L 2A1WH 4NQDB 1F90H 4J2XA 1JGLH 3FONB 4OCXH 4XTRC 4WI5A 5E08L 3O6ML 5HI5D 3OXSA 1CGWA 3VA6A 2WSKA 2H32H 1FV1B 1KC5L 3BP5A 4RFNB 1C12A 2RHEA 4N8PA 2FH6A 5JW3H 1XF4A 5LBSH 4NP4H 2Q86A 4S1QL 1U8NA 3L95B 4OZGF 3L3DA 2Q1EA 2KH2B 4F7CB 3TWCH 1E6JH 1I9IL 1XGPB 4CVZB 4L3CB 3GBNL 4PTTB 4G8FA 3FFCA 2H3NA 3RX7A 3VCLB 1O5DT 4MNHA 4Z7NE 1NDGA 5DT1H 3FB5A 2JE8A 4QHNA 1A6WL 2VXQL 4R97C 5I15H 4FQLH 4Z7WF 1CICA 1OD7A 4ODBD 5LGJB 5CEZD 3HNTL 5GGRY 2Q8BL 3T3PF 3RZCC 4GW5B 5A2KH 1FPTH 1Z0NA 2E7BA 4JHBA 1WFNA 3DVGA 4G6ML 4EI5A 3EYUH 2H8PA 5IB5B 4LVNC 1VERA 4NM8L 1J86A 4XPBL 2X4QA 3WIHH 5KAQG 1L7IH 1C7SA 3ILQD 5CEZL 2FGZA 6FABH 3HMXL 2WWKT 4X7EC 3QUZA 3WS6C 4OLVH 3ZKMD 2ZOKB 1FJ1A 4MGXA 3HZMA 2FGWL 4G7VH 4K8RC 4X7FC 5IG7A 5BVJA 1CD9B 2YD8A 5D2NB 35C8L 1MH5B 2LQRA 1VFAA 3CXDL 3VXMB 5IESL 3ULUC 1FG2B 2Z93B 2P7TA 2BVQB 1U8MB 3P4OA 4UOW1 1G7IB 4WO4A 5C08E 1IEBA 2EXWD 4KRMB 1YZZA 3ARDD 4MHHG 2FIKA 3KS0J 1FLTX 1XGUB 5T1KA 4DVRH 3NA9L 3CFJA 5HSFA 1SJEB 1JZ7A 2HTKC 5JOFB 2AVGA 1M7IB 4KKAD 4KZEL 1BQSA 2VIRB 3CJJA 1UACH 1RK1B 3MRLB 1FVDB 5GRVK 3L5IA 5I1LB 4R4BA 5MEQA 1IKNC 3VFTA 2I9LB 2OJZH 5HTSA 4LL9A 4MCYB 5C0JB 2VXUL 2R29L 4EI6A 4KROB 5GS0D 1LMKA 1I8LC 4J3WA 2PYEA 3HE6C 5DZOA 1PG7H 4RISL 1U8KA 3LN5A 1AR2A 5HHNB 3TCLA 5GS1B 5E9DB 4YK4C 5J11B 2X9YA 4M02A 1UXSA 4U1JA 2R69L 3VXOA 5BJTA 5IJVA 2Y36L 2Q87A 3FT3A 2DTML 2NMSA 4MJIB 5GS0L 2YD1A 1A6VL 4NQXA 1P2CB 3MBEA 3MJ7B 1V7MH 5E1AA 1FSKC 5T33L 2ZCLL 4CAGA 5EBWA 4ODTH 4TSCL 3EW3B 2BHZA 3HUJB 3OV6A 2NY6B 5E8EA 5GGQH 1RFDL 3PJSB 5K9QI 3SY0A 2VLRB 2W0PA 5I1DA 4JFED 4JO4L 1FZKB 3DYOA 4M9PA 4ZPVB 2JLLA 3T1FA 5IKCA 5C0AE 2P8MB 1OM3L 3QPXL 3GJFH 1KEMH 2HLFD 2ADFL 3O4LE 3OHXA 2ZUTA 1HHHB 2EXYD 2JIXB 4RA3A 3GKWH 2A83B 2OTPA 1X3DA 5H2BA 3T0XA 4G7YL 4L4TB 4NO0B 3SO3B 3T2PA 4TYUA 4EBQH 5CZKA 3WJJC 3F7PC 3P4MA 4ZSOB 5CD3A 1REIA 3S35X 1A4KA 5I8KH 1HKLH 3EYVB 4CGTA 5FYKE 1M05B 3UTQA 2IH3A 3QIWB 3C09C 3WXWL 2WBJB 5FHBL 2JELH 2XNAB 3L7EA 2DI7A 2AXGB 3KXFB 1DBML 3LN4B 4HT1L 4HGWA 4ORZC 5I1IL 1CGYA 2UWEF 2XZQH 3HG1E 4RAVB 4QXTB 3MRRA 3D18B 4KXZI 3KLHD 1RK0B 5K33A 4AT6A 2B4CH 4JY6A 3UYOD 2DIJA 3QXDA 1VKXB 4WRLA 3BZEA 3MTRA 3ORJA 4Y4KA 4X4XB 3VXUE 5JW4Q 2HFGL 5B4MD 4M1DH 4M6NL 2ZCHL 4LARH 1G7MB 4TRPH 1JPFA 1R5VA 5CJXA 3T2QA 3QDJE 1A14L 2EDQA 2NTFA 3CDYA 2R0ZL 5I76A 5H8DA 4FNLH 4CNIA 5HPOA 1VDGA 1T1YA 2HFEA 4U1IA 1QKZL 1RIHH 1QG3A 1FIEA 1KCUH 5EO0A 1R0AH 3HC3L 4NZDA 5GISH 3JSSA 4UUJB 2R39A 1J1XL 4XBGB 1N3NB 4R0LA 1QFOA 1MI5E 3GMMA 1DN0B 4G8GE 1AD0A 2PXYC 3ET9F 5DI8A 2CIIB 1YPZA 4M7JH 1FO0L 5E8OA 4R2GD 1A1OB 1XGTA 3I3EA 3EHBD 4F3FA 2D4FA 3OAUH 1QLFB 1CGXA 1AJ7L 1RPQA 1TVBA 1S9YB 1A02N 1CFBA 3MX0A 3LSOA 3NCYP 2P5WD 2I9TB 4UQ2A 4MNGB 5C08D 3B3IB 2H41A 4QRSB 3SQBA 5E00A 3PWNB 1MPAL 3O6KL 4LLQA 4OLXL 2BVPA 5C86A 4PJ8B 3QEUA 2A77H 5KSAD 5FYLE 2LV4A 2Y6SD 3GSNH 4XB7A 4PLJD 4P46C 5E8DL 3STLA 2EYTB 3KYAA 2OL3H 4ZOCA 1OAZH 5E6IB 4BH7A 3N06B 2XACC 4E0RA 1YEIL 2Y7QA 2AV1A 2VDPH 3MGOA 4JZNB 1BZQK 2H2SD 1GHFH 2PO6B 1I8MB 3GSUA 4TPRH 4UBDD 4X6CB 1ZLWH 4EQ3A 1WIOA 4JJ5B 5TF0A 2E7HA 5SX4I 1VENA 1CFSB 4CN6A 4D0DA 4TULH 3RZWA 1H5BA 4XAKE 1K8DA 2M8XA 1PSKH 1BP3B 5EU4B 1E4WH 4WWKA 1QSEA 5F7DB 5JO5B 1A3RL 2VDRL 1I4FA 3T65B 4YJZL 2D03H 5D2LE 1CIUA 4OD2A 3UJJL 5IHZB 1U6AL 2HAZA 1Q72H 2IQAB 4YHLL 4O9HH 2FLBT 3PNWB 2YRZA 3PHQB 4HKBB 3S37X 1RZGA 3BUYA 4ONFH 3MLXL 3B9KC 4U3CA 4FQXC 4WWID 1L0XA 2VLKA 4L3EE 4JAMB 4M7ZB 5E2TL 2XA3A 5CGMA 1QVOB 3L1OL 3ZMRA 1CCZA 2IFFH 4IOFC 4N9GA 2DL9A 3PWJA 5DC0A 1X6NA 3SCMD 2VITB 1PKQE 1MHEB 5FM5M 1T20B 1FH5H 5F9WC 5I17B 2EH8L 5D7SL 1JF1A 2J8UB 3ARBD 2VR5A 3MMEA 4MJ2A 4F7TA 2A6JB 4WDIA 3X12B 5KW9L 3QIBA 4WUUD 3AS0A 1VPOL 3GB7B 3C9NA 4PJHF 5FYKD 5ITFA 5E4IA 2NXZC 1X7QB 4OLYL 5HD8D 1ZS8B 3OJ2C 1HNFA 1I7RB 5IB4B 3HG1D 1MRCL 4LPYA 4W4OC 4JFZL 2A2QT 3OMZA 5C2UB 1MUJA 4F15C 2DKSA 1ZT7A 3NZHL 5DK0B 3O6LL 1CD0A 4HC1A 3TFKC 2YD5A 5L2KA 4XXCC 5ESAB 1QRNE 4KK5D 3W5MA 1WQVT 5F3HA 1JYWA 1MCOH 1XR8B 5DQ9A 3QDJD 3U7YL 3UXFA 5C0CD 2EC9U 2R0LL 1YUHA 4RMQA 1EJ6A 3QDMA 1DUYA 4OFKA 3MLWL 2BNRA 3HE7D 4HFWB 4NRZB 4R7DA 5JPMA 4S2SA 4P57A 3QQ9C 1QSZA 4D9LH 5J12C 4WNQA 5DVOA 1Q9LA 1JF6A 2OTWB 2D31B 2B2XH 1RU9H 5MEND 1KJ2A 3P4LA 4ZUTA 4GMSH 3QEQA 4QRPA 3B5HA 5KSUB 2V2TA 4KKBC 4XCCH 4HX1A 3G6JE 1CR9H 1HDMB 1P7QB 4G8GD 1BQLH 3DX8B 4LAJH 2QADB 1E4KA 4HUWB 4XXDB 5ELIA 3HMWL 3GNMH 3QQ3B 1JCKA 2VXVL 4XBPB 1EEZA 1L7TL 3K2UH 5EC1B 4HIHB 3JWDL 4Q97A 1A6UL 4ZPTB 2IGFH 1MCDA 4U05A 2D7TL 4OKVB 4U2ZA 4NQCA 4L9LA 3JWOH 2F58H 1C16A 4Y4FA 4X6EB 1X4YA 3PHOA 1GCFA 2KUTA 2XTJD 2D7QA 4M6ML 1ZHLA 3DRQB 3MCG1 1PZ5B 4RBPK 3F5WA 5FYJD 3LKRB 1JK8A 5T3XD 5D8JH 3E0GA 5IWLC 1X5ZA 4Y2DB 4M7LL 4QHLB 4P9MH 1ZLVH 1D5ZA 1ZVHA 3DO3A 3P4NA 3RWFA 4HWUA 4DN4L 1OWWA 3MRHB 5DMKB 2H26A 4E41E 3DMMD 1AHWC 4YX2H 3ARFC 1Z9MA 3FRUB 1A9EB 3DI2B 4YFEA 5CHNB 3RVXC 4ODVH 4R90H 5D6CB 1SY6A 1QFWI 3NFPB 1JHTB 4XPTL 5FYJL 5T3XL 3MUGA 1XIWA 4Y5XA 1EHXA 2DLFH 3D25A 3WHE0 3IDYB 1WIPA 1CGSL 1L9NA 3TBSA 3WXVH 1IZKA 5TH2B 3C60C 3GK8H 3LV3A 1OAXH 4P9HH 1URLA 3RNKB 1YEHH 5FUZH 4M4RA 2R4SH 4BKLA 1KTLA 2D7OA 3BPOB 5DK2B 4S1RH 1D5IL 2R2BB 3AREA 4DAGH 1YYML 4YR6A 1Q94B 1U91B 4HSQA 2UZYB 3H9SD 3ARYA 3F8UB 4TUJB 4HKZA 4HS3B 4M43L 5DEFA 2NZIA 1Q1JL 3F6LA 4IRZH 4OZHA 4K55A 4XZUB 5CCKH 3RWGB 1V3MA 1SJXA 2VTFA 1N4XL 4GUPB 3WNMA 1ZMYA 3CFEB 1WK0A 1B4JH 4XP5L 3WNOA 4N0UA 1SM3L 2EIZA 2CUIA 1T7WA 4IRSB 5FYKU 1OB1A 4IDLA 4LU5L 3ULUE 3EO0B 2ADGA 3D39A 3IFPA 1UA6L 3CDGB 2BCKA 4MXQC 1LEIA 4WI3A 1KXQE 4BSJA 4F7EA 4QOKD 5IQ7L 1G7PB 1Q9WB 5EOTB 2V2WB 4LSSL 1YY9D 2X4PA 4PJIF 4PRNA 5IVXF 3BP6B 1PDKA 3FB7B 1J9CT 5I1EH 1ZT4B 2VDOL 2YD9A 4DCQA 1S5HB 2B4CC 4CADA 1F3RB 3VFSA 1DFBH 3PXHA 2FJFB 1NGXA 2EEBA 4I0PA 3AGVA 2DQCL 2OMBA 2YEZA 1YECL 2GK2A 1WSST 4XX1E 4GKOA 4AEEA 1XH3A 1YNKL 1ES0A 5MI0C 1UB6B 4RNRB 1NBQA 1PEZA 3CX5J 4OF8A 1KCSH 2HMID 2EECA 3SKUD 1KBGL 3U36A 2J8HA 1HE7A 2MCPL 2LTQC 4PV9A 3E1F1 3QFJA 5D7IE 3OR7A 4I3SL 2OBGA 4NN7C 3ZKXC 3DBXA 3Q6GL 4IIQB 1NGPL 3KPRE 5AZ2L 4DW2L 1F4YL 5FOJA 3BUTA 5A2IH 2J8OA 2XT1B 5FDWA 1EXUA 3C8KA 4P3CH 3C2SA 5ICZB 3DX9A 2XKSA 1YEDA 1IC4H 4OCMC 5D1ZD 3T0ED 1JPGA 5DLMH 5HI3C 1FHGA 3UO1H 3ZT7A 4AYFA 4QY8A 1M1SA 3VXQB 4XAWH 1JV5A 4LLWA 5KJRL 4APQD 4ESKA 1EBPA 3FTGA 3CX2A 3G08A 1U3HD 3VGDA 4XTRD 1ZA6B 4XNMA 3GHEH 1GRWA 3ZKQD 3LQAL 4OZFH 3NZ8B 1JZ6A 5E2UH 5JZ7C 4UB0L 1DLFL 1BHGA 3TA3A 5CP3H 5D1XB 3RKDC 4YBHA 2LE9A 4S0TD 5CKGA 3BKMH 2I5YL 4L4VD 4XCEA 5I74B 2XQBH 2UWEA 3M07A 4RGNC 1HHKB 4NRYB 4XH2A 3CPLB 5IUSA 2AJYH 2RGSA 1G6RB 5D7KD 4JKWA 5AG9A 4AIXA 4PRPA 5ISZA 4H8WH 3V8OA 1X5FA 4E41D 1C12B 1FLRL 3QA3A 4GKNA 1XF4B 3IDXH 4OQTA 4PP1C 1NSNH 1U8NB 2JCCF 2Q86B 4UZGA 4B41A 4I2XB 3L3DB 4F8TA 1I85A 5IBTL 5C7XH 3PWUB 1NAML 5F9OH 1YY8A 3RWIB 3O6FA 4JE4B 4IS6A 3E6FA 2ORBL 1IL1B 3W9EA 2Q7NA 1FYTB 2OJEA 4R6UA 4MNHB 5KVEH 1NDGB 5DEZA 4MD5A 3S3JA 3MNZB 4QHNB 1U8HA 4UILH 5K9OB 3RZCD 5BRZD 4KVNL 4C55A 1S7RB 4J3TA 4MB4A 4J23A 5CUSL 3QG7H 4GKZA 5BQ7B 3IKCA 1CICB 4FS0A 4OM0L 4OZ4A 4PJCA 1PJ9A 2DQJL 1XCTB 2NY4C 4EKXA 1RUKL 4UDUA 5J1SC 1IC7H 3HZVA 1HQ4B 1ZWIA 3CVHB 3OJMB 1NMAH 4G9FA 5ACMA 1CD1A 5FEBA 2GUOB 5CEYB 4EI5B 3L9RB 1QFUL 2GTWA 3ARWA 4P23A 4K8RD 1YMMA 3MLVH 2BMKA 1HXMA 4S10A 5HDQL 3KLSA 3QUZB 3GSWA 3ZDXE 3ULUD 5C0EA 3EZ8A 4ALAH 4MLSA 1FE8H 3HZMB 4KV5F 3QUMA 2DKUA 3OG4B 1IEAA 2IPKB 3SGJC 4M8QB 1XF2B 4JRXB 3TO4B 3O2DA 2QQLL 4G80B 5F1KC 1P6FA 1Z5LA 5EO9A 4K8RL 2HTKD 3VGGA 2IALB 2JJSA 3QUYA 3QFDA 3GRWA 2ZSWB 4QO1A 4EJ1C 3BKYL 3ULUL 4HAGA 4N0FB 3MV7D 1N7ML 4LQ1A 2PN5A 2XWBB 4LCWB 1EK3A 5DJAA 5LGHL 2HH0H 3HE6D 3Q0HA 4J3XA 1MIEH 1EAPB 1DQTA 2WWMC 4GQ9H 4JQXA 4GW1B 2VZ1A 2R2HA 4G8EA 1INEH 5DC4B 4UNVA 2XWJA 5BVPH 1CU4L 3PABA 3VRIB 4OCWH 3OB0H 1AO7E 3K0WA 1SYSA 2PYEB 2XA8H 5FGSA 5C0RH 5KS9B 5CP7A 3LN5B 1U8KB 3TCLB 2HYMA 4L8SC 3S35H 5I1HL 4I9WD 3J8F7 1XCQA 4U1JB 4V2BA 3PQYA 1VFBA 3PF2A 5IJVB 5EU5B 1MFBL 2J1KA 1IGMH 2DBLH 4Q9BA 1FNGA 3FT3B 5HYJE 1UM6H 5ALBL 3OPZL 4Q6IA 1KELH 2SEBA 4A6YB 3MBEB 4EUPB 4TVPE 5TQ2H 3WD5L 1JTOA 2HFFB 3X3GH 2DL2A 5E24E 2WBWB 1C1EL 2G60L 1U8JA 1A7BA 3LS4L 1S5IL 4MDJA 1EO7A 3SY0B 4O4YH 4PJHA 1LK3H 3V7AG 2BNQB 1P84J 5E6YA 5IKCB 3DI3B 2AI0L 2ICEB 1T3FA 1UG9A 5C09B 1CL7L 4JKPH 1YYLL 3KGRA 4P5KA 4X4MA 1KGCD 1T2XA 4D9RE 1TTFA 3RTQC 3P4MB 2HKHH 5DSCA 3SDCB 3K74B 1H3PL 3NIFE 2X4UA 4WHTA 1QA9A 1DDHA 4HUXA 1TVHA 2YUXA 5GRJL 2CDFA 3RQ3A 4PJ7E 3UTQB 4CBPA 1UCTA 4UU9A 1CFTA 3X13A 2IH3B 2O5ZL 2VLJD 5JTWA 2BOBA 1MVUB 4YDJA 1BQHG 5JQ6H 5DD0L 4YHZH 1R24A 4KHXL 3EAKA 1AGEA 1DL7L 1P7KA 4P9HC 1K2DA 4AT6B 3HAEB 3QG6A 4JY6B 1EEQA 3WE6B 1DZBA 3GJEB 2GITB 4KGLA 2E7LC 1FBIH 3X3FH 3MCKB 3WO4B 3PG2A 4ENED 2R8SL 4MA1C 1O7SA 1R5VB 4P2QE 4Z9KB 3DXAA 4KJPC 4HPYH 1Q9OB 2NTFB 1FRGH 4QRUA 1RULL 2WZPD 1T1XB 3OAZK 3T8XB 5I76B 1NFDF 5K93A 1RJLA 2ZG2A 4EXKA 2DYPD 3IDMA 2PXYD 3PWLA 4Z7VA 2HFEB 5BW7A 4LKCA 5I66B 4HWBA 2CKBA 2W0FB 4RMVA 3UJIL 4QNPE 1HSBB 2UY7A 2ZP0T 5EO0B 2AJVL 4GBXC 1HEZA 4MJ6A 5CJOH 3DYMA 2JB6B 1MCRA 1J8HA 4YHNB 2B39A 4R0LB 5M95B 5F6HJ 2OP4H 5EU6A 3GMMB 5AD0A 2FEEL 1ZHKA 2FJHA 5EA0L 4HV8A 3RVWD 3GKZA 4FXKA 3PGCB 4QRRE 4K94L 4YDVB 2NW3A 5E8OB 1AP2A 1CIDA 2EDNA 1RHFA 1SJHA 3NAAH 3O3DA 4LEXL 1S3KL 3TGXA 5L6YL 1TVBB 2VZTA 4KMLB 4HIIA 3V0VB 1QP1A 3V52L 3L3JA 3LS5L 2NPLX 4P46D 1D5MA 2RJMA 3N85L 1GOHA 1HSAA 5E00B 4L8CA 2ARJA 5FGCB 4GAGH 4MD4A 2C1PB 2ERJB 2R15A 3GSOA 4OLZH 4PJEF 2BVPB 3NMEA 4GH7B 1U0QA 4GG8A 1IMHC 3S37H 2DLGA 3VXPB 1Z3GL 4IOIA 3TYGH 4ZUWA 3RA7H 3RGVA 3Q3GB 4BH7B 3BH8A 3C6LB 2OI9B 2OQJB 1L0YA 2Y7QB 3ARGC 2AV1B 2BY2A 1BAFH 1MHPL 4X6DE 1RUML 1T4KA 3GSUB 5E56A 3QSKB 4TNVF 2NX5A 5GZOC 1EIBA 4UT9H 3VMNA 4NUGL 1R3JA 1UVQA 4U6YA 2YK1H 2G75A 4WGVB 2EO1A 4U1KA 4D0DB 1K8DB 2E9IA 4XVJL 2AXFA 2W92A 4QHKJ 3VFGH 1WVZA 3AAZA 3WUWG 1I4FB 4ZUVA 2XG4A 4Y16A 3V6OC 5ILTH 4F9PA 2FBJH 4PRDB 5EUKA 2GJJA 4IOFD 4HULB 1D7FA 2HT2C 2DMBA 2QBWA 3HPJA 2BOCA 1RZGB 3BUYB 4HFUH 3BZ4A 5DD6A 4UAOB 5E7FA 4WFFD 1TFHA 2VLKB 5FO9A 3BT2H 5I73C 2V5YA 2X5PA 4PJIA 1C5DA 5IT2L 1IGJB 3SGDH 4KTDH 1F90L 2JF1A 5KSBA 1LP9E 3MV8E 4OCXL 3WMSA 1T6WA 3CXHJ 2A9NL 2NY3B 2AEQH 3I6GA 2IPUG 3H6JA 2F54D 1JF1B 4PRIA 3AMKA 3QNXA 5CMAA 4K9EH 4F7TB 3CMGA 5JW3L 5LBSL 2XFXB 4PJFE 2Z4QA 4FTVA 4PFEA 4Z7UE 1BFTA 1OTUC 1CTOA 2IG2H 1AQDA 3TWCL 1E6JL 3ZYJA 3TFKD 1CQKA 2HJLA 3HZKA 2MPAH 2QQNH 3NACH 3MO1B 5DA0B 1QSVA 1IGFH 1ZT7B 2GJZA 2V7HA 2VN4A 1XF3B 5DT1L 3JV4A 1T7XA 1N8ZB 3M8OL 1PYWB 1DP0A 3AU1A 5C0DA 2ARWA 4ZXBA 3TN0A 1RZIB 5I15L 3IU4H 4FQLL 3QQ9D 1RVFH 1OP5K 3SKJL 1KYOJ 5DQ9B 3TT1H 1NUGA 4PJ5E 1ORSB 1DUYB 2VKWA 1S9XB 2HTLC 3BISA 4R7DB 5JPMB 4RDQG 4KKBD 1FPTL 4XCFH 3QEHB 2EDWA 2VDNH 4PB9H 5FOBB 4WNQB 4JN2A 5C9KA 3MV9D 1MY7A 3EYUL 5A40E 4ZUTB 2Z31A 4JJHA 2E9JA 3W39A 2RB8A 4ZAKA 2XKNB 2DWEA 3QEQB 3QXWA 2HWZH 4U6HA 4UI2A 4QRPB 3WIHL 2BFVH 1L7IL 4P2RD 5ANME 2V2TB 4HX1B 3RWEA 4LMQE 6FABL 5JW5B 1X5GA 2VISB 4PJXA 3SDDA 4JFDD 1AXSB 5E94B 4OLVL 4YXLH 1KB5L 3QHFH 4O51B 1RUQH 5IFJA 4OCLC 1BFSA 2UVFA 4G7VL 1T2JA 5FIEA 1EEZB 4PRHD 4HXAH 4Z7NF 2X4RA 3MNVA 1D5BB 4NQCB 3K81A 2KBGA 4L9LB 4MAYA 4F80A 3QDGD 1F97A 4Y4FB 3S5LG 3UBXB 4OZGB 4PJDA 3G04A 1WWAX 3CNKA 3MLPA 3MJ9H 5L8LB 1T1WA 1ZHLB 2B1AH 3ARFD 4DVRL 4POZC 2A6KA 3FT2A 2LFGA 1N6QH 4JVWA 3RVXD 4GRLA 3DVFA 1UACL 3ETBF 4JRWA 4BK5A 4K23H 3RWFB 1OGAE 3V0AC 2OLDA 3RWDA 1EX0A 5D2NC 5DJ8B 2X4NB 4NC2B 1A2YB 3C60D 2ZOLB 5D72L 3AXLB 4Z7WB 4F7MB 3FFCE 1BQHA 1Q9KA 1IGTA 1CXKA 1LHZA 5DJCA 1PG7L 3MUGB 1XIWB 4ODHH 4ZO9A 4GXUM 2CDEA 3D25B 3TIEA 2VNCA 4FXGA 3C8DA 4YQXH 2DOCA 4NYLB 3O2WH 4B5EA 3B2UD 5BZWA 1XF1A 1MAKA 4E42A 3NN8B 1A7RH 5IVZB 4BKLB 1KTLB 1NGZB 4KROC 4LSTH 5LKNA 1YN7B 2F53E 1ETZB 3P73A 2EDBA 4PJ9A 1AXTH 3SE4A 1C5BH 2F5AH 5GS1C 2FRGP 3MOBH 4M61A 5J11C 3U6RB 5GGQL 2EIBA 4NCC2 4ZO6A 5L7XL 3VXNA 5KOVC 2VWEE 2YN3A 3JTTB 4LKXA 1KPUB 3MA7B 1CF8H 1KEML 3NFNA 3MV8D 3GKWL 4HLZH 4N0UB 2EIZB 1E27B 1U8OB 4EBQL 4YDLB 2OZ4H 5EOCH 1OB1B 4CJ1A 4TSBH 2X6MA 5FM5O 3LRGA 4JQVC 5I8KL 1EFXD 1HKLL 3IFPB 4MQ7B 1Y6KR 2NY6C 2BCKB 2IAMA 4UMGA 1AGDA 3BO8B 2X4PB 3JV5A 4PRNB 4MB3A 5ADPH 1K3IA 3KPSB 2JELL 4DCQB 4C56A 2ITDA 3CVIH 2XZQL 1PLGH 4MJ4A 5B39G 4L9DA 1DQQB 2B4CL 5IK3A 3SO3C 2DF3A 3BDYH 1I8IA 3QHZH 2YEZB 2FIRT 5HHMD 3WFZA 4WI9A 3DV6A 5ECJE 4M1DL 4KI1A 1XH3B 3MJ8B 4LARL 1ES0B 2MJWA 4MNQE 3GBML 3QIWC 2C4FT 3VXTB 5D9SA 1FCGA 3F7RA 3B4NA 4WI2A 2V7NB 2QKIA 4ZNEA 5DD5H 3CXHK 4N0YH 3QFJB 4FNLL 4YHPA 2AK4E 5HI3D 1RY7B 2P5EA 3BJ91 1I7TB 5IOPA 1RIHL 4BQ9A 3VWKA 5GISL 1X5HA 2YPLB 2H1PH 3DX9B 2KZWA 1LNUA 1YEDB 5T3ZH 5D6DA 3CH1A 3H42H 4QF1A 3WUWA 3JVGA 4M7JL 1OGTB 4F7PB 5JOPE 3OAUL 3QH3A 1JV5B 1EFQA 1F2XK 3T0BA 3G08B 3KPOB 4RGND 4XNMB 3TVMA 5HYIA 2BRQA 4O2FA 3UTOA 1KYOK 1DLHA 5BO1H 5FHAH 3TA3B 5IROA 4JGJA 2GYSA 4WHDA 3IDIA 2R1XA 2BSSA 1ZHNA 4NUJA 1FFPA 1HOCB 1IKFH 2UWEB 4PP1D 3VJ6B 1J0HA 2A77L 3VD9A 4PRBA 1T0NA 1IGIH 3GSNL 1NANI 4NHUA 2OL3L 1F4WH 1OAZL 3BN9C 2CLZA 3EYQC 4KKNA 2PCPA 3QA3B 4GKNB 2VDPL 3V4UL 5DQJA 4G42B 5J13B 2ZUVA 4JY5H 1EVUA 1GHFL 3S34L 1A22B 4TPRL 3PL6A 3UTSE 4BSVA 4X5LA 3SJVD 1YY8B 1BD2E 3L3KA 1TENA 3O6FB 4JLRA 3E6FB 5KG9A 1NFDA 4PJ8C 1TJHH 5J6HB 2C4XA 4RBPH 4QTIH 4D9QD 2E8YA 3WFCH 3D2UD 1NLDH 3AC0A 3W0WE 1S9VA 1T66C 3ARTA 4MD5B 4TULL 1Y0LA 1LO0H 4Z7QE 5E6IC 3AVEA 1U8HB 2NY4D 1PSKL 1VA9A 1E4WL 4U6XB 1G1CA 4WI7A 1F3JA 5T5NF 4F58H 1G6RH 2D03L 2ICWB 2F53D 1ZEAH 1OP9A 1QBML 1ITBB 4ZQKA 2ED8A 4O9HL 4IHOA 2DQIH 4U1NB 3DUSB 4MB5A 1K4DA 2YXFA 4ONFL 3UPAA 3WYRA 4RGMB 1DJSA 1CD8A 4HLJA 4L1DA 4NNPH 2CKNA 2VSDA 5IMOB 2N7BA 4BUGA 5HJ3A 4P23B 3CFBA 2IFFL 2Y1VA 1YMMB 4YLQT 2BMKB 4F33A 2QQKH 3KYMA 2M1KA 3VD7A 3KNBB 1J11A 5CBAB 4K9EC 2X40A 1FH5L 3GSWB 4PJEA 5C0EB 1UKSA 3HMXA 1KCKA 3P9MA 1IEAB 4I3RH 1MCPH 1GZPB 5KZCD 2MMXA 2DI8A 3VXSD 2WLZA 3WEXB 5E1HB 3VWJA 2I60H 3S5LA 3CVHH 3OJVC 5EU7E 1M4KA 1MCBA 1MFEH 3QFDB 3CMOL 1YJDH 1HZHL 2NCMA 2WWMD 5D2LF 3O41B 1QSFA 4JFFD 5FV2A 2WUCH 4IMKA 5DUMH 2AKRA 2J5LB 3IDNA 4G43B 4MNQD 1R3HA 2R2HB 1MCOL 2MKWA 2DAVA 2B0SH 3M1BB 4Y1AE 1YDPA 3C5ZB 1KJMA 4OKDA 3PABB 1OAQL 1BF8A 1C08B 1F3DJ 4I5BA 5FKAA 5F7EH 5C0BE 4KQ4L 2AK4D 4G6FD 4D9LL 1NGYB 3ARDA 4HMCA 1AE6H 5J6GB 4ACPA 3P0GB 3SBWC 2B2XL 1W0WA 1RU9L 1IAII 2FEDC 3PQYB 3V6OE 5TE4H 1U41A 4GMSL 4JG1H 5FKPB 4LNVA 4BK4A 3OKKA 4XCCL 2FECI 1CR9L 1LO2H 3IVKA 1BQLL 2QTEA 4QWWC 4ODXB 3BJLA 3OF6D 4GS7B 4Q6IB 2EDDA 3BMVA 3VFNA 3GNML 2UZIH 4LPVA 1T5XB 3K2UL 2RBLA 1DSFH 4NCDA 2IGFL 5DS8A 1U8JB 4JREC 1ZHBA 3MLTB 2CH8A 3JWOL 2F58L 3MRPB 5IIEA 3MRQB 3PP3K 3VH8G 4PJHB 2FX7H 2QV2A 4HG4J 3E8UH 1TZHB 2PTVA 5GSVA 2DQFA 4GG6E 1AXIB 1B4RA 2QADC 3LEXB 3EGSA 3FQXB 3K4DA 3QUKB 1G0DA 2CXKA 5CWSB 3O3EA 4P9ML 4NO5A 4HUVA 3S36L 4A6YH 4D8PA 4EUPH 4L29A 2NR6C 4GLRI 5DSCB 1ZLSL 2WP3O 3T3ME 5TF1H 1NC2A 4CU6A 2EH7H 2PYFB 2X4UB 4YX2L 5EULV 3SKNB 2P1YA 4HUXB 1EEYA 3X13B 3QWOA 4JFEA 4UU9B 2DLEA 5KVMC 4ODVL 4R90L 3G6JF 1UH4A 1BD2D 1R24B 2DLFL 3HCVA 4BFGA 1AGEB 2NYYC 1KIQB 1P5UA 32C2B 3ARVA 3T2NH 5B39A 3OBAA 1P7KB 5IBUG 5LAXB 3WXVL 3V7MA 1K2DB 4Y2DC 3O45A 4KJPD 4M00A 5L2KE 2R2EB 3GK8L 4Z5RB 4UV7L 4ZFOA 1LE9A 1OAXL 4P9HL 1FDLH 3DETC 4HS8H 1JNHA 5FUZL 2R4SL 3QDME 2P48B 3D69B 4QYOB 4S1RL 4P2OB 4JFHE 3DXAB 4DAGL 2BDNH 3IDUA 4HAFA 3RY6A 4H25A 3QI9B 4GBXD 4KK6C 4OI7A 2VL5B 2CIKA 1MWAA 5CCKL 3IDMB 1NCWH 4F37F 4P4KC 4FQHB 3R0MA 1KT2B 1UZ8A 5GGSA 2CKBB 1MAMH 4OAWA 1L6ZA 3VFOA 1EO8H 4POYA 1B4JL 3HAEH 4NQTA 4D3CH 1JZ4A 2VB5A 1CK0H 3BPOC 4N5EC 4XWOC 1T83C 5AD0B 2FJHB 5DURB 3TPKA 1RZFH 3CZJA 4HV8B 5J57B 1M6OA 2YUWA 4FXKB 1AP2B 3F65A 5DUPH 3MCLH 1SJHB 2AQ1A 5HGHA 3HA0A 3KYNB 1JGDA 4KDVA 1VFOA 4FG6C 5I1EL 3DO7A 3D6GA 5T1LB 1I7UA 3RIAF 4M1CC 4L4JA 3I3DA 1MHCA 1X5LA 1X5IA 1DFBL 1HSAB 1HH6B 4NNYB 4MD4B 1KCRH 4IRSC 4LF3B 4UTBH 3U9PH 2OR8A 4R26H 1SVCP 1A7QH 4LHQB 1RUPH 4IOIB 3D0LA 2YZ8A 3RGVB 2W0KA 1AGCB 2ADJB 3BH8B 1G9NH 3UPRA 4RWYH 1KCSL 5JDSA 4IDJH 3OXRA 4N1EA 2D4DA 1T4KB 4MZ2A 3UJTL 1AKJD 1D9KD 2P8LA 4TN9A 5C08A 2GHWB 3G6DL 5C0BD 2VZSA 4XNZB 4WVRA 1OD9A 3IRZA 1IGYA 3SE3C 5JW4M 3L6FA 4E5XA 1HIMH 2DRUA 3ULUF 4ETYA 1UVQB 43CAB 5KSAA 4P3CL 1C5CH 1ULVA 1IC4L 5J9PA 2IC2A 1S8DA 3H3KA 2HT2D 5E9DE 1WITA 1CDBA 4QHUA 5DVMA 3UO1L 5E0QA 3DROA 3JV0A 2CMRH 1I9IH 4ZUVB 5DRWA 1MLCA 4Y16B 4XAWL 1MCKA 5LGKA 4NM4H 5EUKB 4IIQC 4Q9RH 2BOCB 3RVTC 3GHEL 3JTSA 3LKSB 4KJYB 3BZ4B 1A4JB 1LD9A 4JCMA 1LO5A 5E2UL 2DS4A 1BLNA 4PJIB 4U2YA 1C5DB 3IXTB 5IVXB 3S97C 3BKML 4PP2B 4XPGH 1J7VR 2E5EA 4I48A 2P4AB 2XQBL 1LQSR 1G6VK 1P4BH 4CL7A 2O26U 2Q8BH 3S3PA 3BGMA 3D39E 5D7IF 1OTUD 2EZ0D 2OYPA 2AJYL 5C07B 4OV5B 1QNZH 2MKLC 3I6GB 4NQDD 3TZVC 4H8WL 2KPNA 4PG2C 4PRIB 5CEXA 3OJDA 4G6MH 3A0OA 3IDXL 3F7QA 1ZSDA 3CSYA 4FTVB 5ADOH 5C0AA 4HBCH 5C7XL 5D1XC 3IGAA 2RCSH 3O4LA 2X1PA 5F9OL 2HJLB 3HZKB 5I74C 3PGDB 5F1NA 2IMNA 3NPSC 8FABB 4DUXA 1WCBA 1BIIA 1JZ3A 2Z92B 3QQ4A 5KVEL 2FGWH 3QCUH 3JV4B 3KXFE 3RWHA 5FO7B 4MXWH 4UILL 5AUMB 2HTLD 1G7HA 3ARBA 1VADB 3FQUA 3AU1B 4DQOH 4DZ8A 3TN0B 3PV6A 4HG4K 4LSRH 4K2UH 3F58H 1OF2A 3CXDH 3GSQA 4HIEA 4QXGH 3QG7L 1F00I 4JFHD 3P0VH 4OBSA 3VI3E 4D94A 4ZYKB 3A6CH 3HG1A 3RWJB 3BEWB 1IC7L 3EDDA 3TIDB 4KJQD 1NMAL 1P4IH 3BH9A 3VXUA 4ZAKB 7CGTA 2DWEB 3MLVL 4U6HB 1XZ0A 4O2EA 2OM5A 1K4CB 4PGJA 3QDJA 1CICC 5E5UB 5C0CA 1CXLA 1R6VA 3WKNA 4ALAL 1FE8L 4OJFH 3EO9H 4KDTA 3OAZH 2LU4A 4OM1H 3U9UA 2X4RB 1K6QL 2Y36H 4HF5H 1YJDC 4POZD 4MQTB 3VH8A 4I18A 5MENA 1ZTXH 2JCCB 2HRPL 4KRPB 3BOVA 3R0NA 3G04B 1MI5A 2UYLA 3GMLA 1MJJA 4BQCA 4G8GA 5T1MA 3MQIA 2JB5H 5IBLC 4FQPA 2A6KB 3VXMD 4TSCH 5ISZE 4WJ5A 3KJ4C 1L9MA 4GRLB 2YA1A 4MNGE 2HH0L 3P2TA 1KJVA 1MIEL 4GQ9L 3TO4C 3VE0A 3N1GC 1INEL 4CMMB 1QO3A 4UT6H 4NGHH 2J6EA 4OCWL 1BQHB 5IM7B 1IGTB 2XA8L 4GKSB 5C0RL 3I50L 1N5AA 5CZXC 1UJ3A 3S35L 4AEFA 3DVNB 4M5YH 4KROD 5JXED 4FXGB 3ECBA 3MRCB 4LGPB 4XX1G 1IGML 2DBLL 3ARUA 3WN5C 1GGCH 2DJUA 5E9DD 1UM6L 3DMMA 3V4PH 5FHBH 2CDGB 4AQOA 2IQ9H 2ZSVB 1DUZB 1H3GA 1KELL 1Q0YH 4LAQH 4LOUC 1WT5A 5TQ2L 2N4IA 3X3GL 3ARXA 3L7FA 4XNQA 4GQPH 4X9FA 5EBMB 1JVKA 3RU8H 3I84A 4MJID 4Y5YA 1R3KB 4BSWA 5LCVL 3G5YB 5FXCH 3FFDA 4ZDHB 4O4YL 2HRLA 5KSVA 3SKOA 3VXNB 5CAYB 3SN6N 4NNXB 1J8KA 2CRMA 5CKAA 1ZA3A 2VUOA 4EDWH 2NY6D 4JKPL 3WO3B 4LCCA 1I1AB 1OAUH 1IQDA 2VLRD 3ULSA 3HPLA 3RPIB 1IEHA 5FA4A 5KANG 3L3OA 3TT3L 4G6KL 3MNWA 3GM0A 3H9SA 5F7KC 2F19H 4GXUN 2BXYA 2HKHL 2JIXD 2DLTA 2AV7A 2VAJA 1AGDB 4L4TD 4NO0D 3BP7A 4L3EA 3HC3H 5F93C 1WUNT 4YO0A 3BRFA 2HFTA 3GSVB 3PIQA 5JQ6L 2QSTA 1NEUA 3LH2H 1PY9A 5B38B 4YHZL 2J8UE 3ZDYE 2HG5A 4ONGH 4UNTA 1FFRA 3G5XA 5E8PB 3QIWD 3V5KB 1PKQA 3JXAA 3K1KC 5C70A 3RAJH 3KXFD 1WTLA 2BC4B 2YPKA 3FRPG 5E8NA 1NL0H 2R1WB 3KDMA 1LGVA 3DV6B 3SDCC 1FBIL 4IRJB 3EOBA 3X3FL 2DQEH 3QIUB 3HR5B 2DWDB 1E4XI 3B8SA 3T4YB 4WHCA 1JWUB 4XP4L 5BZDB 3IT8D 3OKEB 3VG9B 5D9SB 5GZND 4I3GA 1FRGL 3BIKB 1XR9A 4K71B 3CFKA 4YHPB 5ID1A 1VB9A 2P5EB 3F7VB 5IOPB 4HK3J 4UIKH 1EBAA 2B8OT 3D9AH 3NIFF 3VWKB 5CJOL 4F57H 4Q9QH 3WO4C 1J5OH 1A47A 3EYSH 1UWGH 4JR9H 2OP4L 1LDSA 3CH1B 3QJFA 4K7FB 4MWFB 4QF1B 5ICYA 1VESA 1OP5H 2C7UA 3V9FA 3HC0B 3SDYH 3NAAL 3H9HA 3L3GB 2OXGA 5IVNA 1TMCB 4JPIB 2DBJA 4OUOA 4NQEE 4NBZB 5JIKA 3TVMB 2IJ0C 4O2FB 4K3HA 4Y5VB 2IH1B 3QUXA 4MVBD 1DLHB 4WFHE 5D1ZA 3BN9D 3T0EA 3IDIB 1HILA 2BSSB 3G6JA 1ZHNB 4GAGL 3EYQD 3MXVH 4OLZL 1MLBA 1H8NA 1FFPB 3FOLB 5IW6B 4MHHI 4H26B 4UDTA 3S37L 1QLRB 1G9NC 3TYGL 1BIHA 2XWTA 2QHLA 4APQA 2FO1A 4MDIB 2EYSA 4N0CC 4PY8J 4PJ8D 2PCPB 5JHLH 4X98B 2PTTB 4KC3B 1BAFL 2AJXH 3F6IA 2AJZA 1T66D 2GJ6E 3VDCA 1I9JH 2NY2B 3W2DH 3HZYA 5E6ID 2C9AA 3PL6B 1A7PH 4BSVB 4L4VA 4UT9L 3L3KB 1IAKB 1FNLA 1MHHA 2VQTA 2R1YA 4JLRB 4OFIA 3SEPA 1GZQA 3PWPB 3GIZH 5HXMA 1NAMA 4U1MA 2YK1L 4XVUC 3LKPB 4KUCF 5CSGA 1A1MA 1S9VB 3TO2A 1Y0LB 1H15B 4RAUA 3C6LC 4U6VH 5A16A 2OI9C 1ORQA 4E41A 3LRSB 1P9MC 5GRVL 3VFGL 4O2CA 3FO9A 4JO3H 5EUOE 3HI1B 4EIGB 1U9KA 2FBJL 3AB0C 4OQTH 4Z7VE 2F8XC 4H1LH 4W6WB 4HFUL 2ESVB 1BGXH 3P77A 4X9BA 5IMMA 4PG9A 1ZANH 3BT2L 2AJUL 2ENYA