4YH6A

Crystal structure of il1rapl1 ectodomain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
321
structure length
313
Chain Sequence
CTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLEILWYKECRTKAWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Interleukin-1 receptor accessory protein-like 1
publication title Mechanisms of splicing-dependent trans-synaptic adhesion by PTP delta-IL1RAPL1/IL-1RAcP for synaptic differentiation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
total genus 52
structure length 313
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A03
3IU4L 6FABL 1HHHA 3JWDC 5D71H 1ZHKB 4LHQB 5FECA 1HCVA 4MXWH 4XX1E 5DSCB 1QSEE 5DI8B 5EBLA 1B3JA 3ZHKA 5MENE 3F62A 1NCTA 4MNGA 4MQXC 2X4SB 1MCEA 2YD9A 3ILQC 1MHCA 2ZPKH 1B90A 3BAEH 3JV0A 4X8XA 3IXAB 4JFQA 5F1SA 5DFVD 3GB7B 4LSQL 2HWZL 2C3VB 3TBTB 3HUJA 5CSZA 4LLWA 1XZ0B 2B8OT 2ADGB 5DGQA 4OCRL 1RZ7H 3DO7A 1B2WH 1YYLL 4Y5YB 3IJSA 1YC7A 5DR5L 1IGCH 3SBWC 4WWKA 3UJIH 1JF6A 4JKKA 4W81A 2X89D 4RA3A 3ZSTA 2Q86A 3WFBH 1MI5E 1HXMB 2A6KB 1NGPL 1M7IA 3SOBL 2EDXA 1MCLA 3LB6D 4F7EA 3V4UL 3RVTC 4YHLH 3VXUA 3RVXC 4K9EC 4ISVA 1J1OL 5HPMA 3GJFH 4QOKA 4Z7OE 1MNUL 4LSSH 3V6OC 1E27B 3N1PC 5BZDB 5KVEL 3LV3B 4O02H 2AJSL 4OGXL 5CILL 4EZMA 3DRTB 3KYMA 1K4CB 5A43C 4Z7QE 4OFDA 4YHIA 2J8HA 1YQVH 2GYSA 3ECBA 5MEQB 1QNZH 3BX7C 4OT1H 2X1OA 4TULH 5GISH 1HH9A 4QXTA 2EO1A 4HMDA 1F4AA 4WTZG 5DJ6A 2AQ2A 5FUZL 3KHOA 4YIQA 5JNYB 2QHRL 2P24B 4J23A 4OCLC 3RDTD 4R8WL 3CXHJ 1FZOA 4JZJA 4X7SL 1FYTD 4JE4B 1EO8L 2V2XB 1KPUB 3QO0A 2QR0B 4X5WB 1EGJH 2R4RL 1XH3A 4XNXH 5K59F 2I24N 3D0VA 1F5WA 1EZVX 1LDSA 1MFAL 2H32H 1HQ4A 2OMNA 1CU4L 3U6RB 3EUUA 3OX8B 3IDJA 2OTPA 1BZQK 1CGVA 3AB0C 4LQFH 5T3ZL 3EHBD 4M9PA 3U46B 2W1NA 1I8MB 1J87A 5D1QC 3MV7E 4G80A 1I1YB 1TVBB 3HG1D 3TIEA 3IYLW 4ZODA 3F7VB 2C3XA 1XF4A 4JPWH 1AGFB 4OZFB 5I71C 5I16A 4IRJB 5K9KA 1T6WA 3O2WH 4JO3L 1EAPA 3RI5K 2WLZA 4QRRB 3VFUA 5BRZB 3DXAE 4TNVK 4ZFFA 2H6PB 2COQA 3QR2A 2NNAA 4LPCA 5BVPL 3V8OA 4JKWA 4Z7NE 3P77A 3QIWD 5ANME 2I27N 1U8QA 5SX4I 5TQ0L 5KSUB 2XG5A 2A1WL 4LCCC 3CXDH 1JTOA 3VXME 1T6VN 3SKMA 3IVKB 4Y1AD 1ZA3A 4LHJB 1R3HB 1NC4D 5E08H 2AV1A 4V1DE 2NY1B 2X09A 3O4LB 2BDNL 5KSVB 4RGNE 3F7PC 2A77L 4A6YB 1LWRA 1Q0XL 5B8CC 4XH2A 1IC1A 1X4ZA 3GO1L 2BNUA 5HYSG 4NNXA 5E6IB 3MLWL 1BGXH 5EFIA 5E8PB 1FFPA 2NTFA 3KJ6L 5EU3B 4IRSC 3QB7C 4NDMA 3ULUE 1L4IA 4L8SB 2Y7QB 2IC2A 3B3IA 1MFCL 3BMVA 4DN4L 1A6AA 3WEXB 1YEJL 2BSRB 2IG2L 5E1AB 1BBDL 5K9OB 1T20A 5ELIA 3OG4B 5C7XH 3MLSL 1IEAB 5IHZB 5E8DL 5TDOB 1FJ1A 4YFLI 3TVMB 4TVPD 4APQA 3TP4A 2DQEL 4LLQA 1INEH 1BEYH 3B2VL 4OJFL 4OZIF 2APXA 3V52L 4G6AD 2VXTH 4GXVH 1LEKA 3FQNA 3IKCA 5F21B 4BH7B 4HD9A 2XZAL 3CVHL 4NUGH 4DVBB 3NCCB 2HLAA 3HNSH 2QQLH 3UO1H 4M03A 1QSFA 1UXWB 1HNFA 1OT2A 1V3KA 1IM9A 1CT8A 1ZVSB 1MHPH 3SDCC 4K7FB 2ZG3A 3KPQA 4PJ7B 1AHWC 3RZCC 3NGBB 2DBJA 4N0UA 1LNUA 2FCBA 1FIGH 1AO7B 3G5XB 3D18A 3VXOB 4PJIE 1P7QA 3LEXA 3VJ6A 2H8PA 5DRZB 3MV01 3U0WH 4PJCB 3QEQD 4NYLB 4KAQH 2CO7B 4M93B 4MCYA 2UY7A 1WJ3A 3BZDA 2LFGA 2AXGB 1QEWA 1EJOL 4LPYA 2DB8A 3R0MA 4JPKL 5C09D 5ICZA 4WFFE 3F8UB 4JG0L 1U8PA 2ORBH 3BZ4A 3MV9E 4DQOH 5D7IE 3QHZH 3MQIA 4LSVH 3MLRL 5ADOL 2YPVL 4HIEB 2GY7B 2LV4A 1W8OA 2CKBB 2GSIA 4OTXL 5ICXA 3QRGL 3CDYA 3F7YA 2R23A 2R39A 4BKLA 4GBXA 1ZHBB 1I7ZA 1CFBA 4LDEB 4XPHH 1G7QA 2FGZA 4RDQG 3UP1A 2AJ3B 2OR7A 3WUWG 4MGXA 1NCAH 3K4DA 3MJ9A 1KJMA 1DANT 1EEYA 1D5MA 4OFYA 1T89C 4Y16C 2VYRE 3T77B 2XTJD 2P44B 1RZKH 5EWIL 3O6KH 5IOPB 4QGTA 1FAKT 3QUXC 4EI5B 4PREA 2FJFA 1R0AL 3LKPB 4TPRH 3VRLF 4EIZC 2XWTB 1VFAB 3WDHA 5INDA 4Z7WF 4P5MB 1A14L 5H37H 2HG5B 1Z0NA 1C16A 1SM3L 2CIKB 5FEBA 3QUYC 3QHFH 1T03H 5D93C 4MD4A 3NZHL 1JFQH 4ZXBB 2ZG2A 3G6JE 2AK4A 4I2XB 5C86A 1JZ7A 1E4WL 3ARBC 3ARGD 1PEWA 4TTDD 5EU6E 4WUUA 2EKJA 2WUCL 4NQTA 2W0LA 1IBGL 1NFIA 4LPWA 3PQYB 1SY6H 1CFNB 1T04B 4FQLH 2YEZA 1T1WA 4FQXC 5FYJH 5C0EA 2NX5D 3BUTA 5HHQA 3NA4A 4L4VD 5L88L 2Y07H 3RY6C 1KPVA 4HX1A 2VE6B 2WQRA 5HYJE 1R3KA 2Y25A 5HTSA 3VFGH 3WUZA 1X5KA 2JJVA 4BFBD 3QUZD 3NAAH 2EXYC 4YBHA 1BBJB 2YPLA 1UZ8B 1ZLUK 3WS6A 4M00A 1Q72H 2NY0B 3FAXA 4AZ8A 3SPVB 1TIUA 3IRPX 4XMLH 4AQ1B 4ZS7L 7FABL 4K55A 4N0YH 2UVFA 3KPRB 3C08H 3HC0B 5CEXA 2GY5A 3IDYB 3TV3H 1AFVL 1U8OB 2AJUL 2HFGL 3MR9A 5J0BA 2X9WA 2GUOB 4ZSOB 4X0KB 3K2MC 5EUOB 1X5FA 1B0RB 3N9GL 2G60H 1WZLA 4DFHA 2VLKD 2GJ6D 2E8ZA 3ESVF 3K4ZA 4UQ2A 2ED8A 5E8EB 5L2KE 5L6YL 2G5BB 2IAMD 4QLRA 5DYOA 3U83A 3VCLB 1D6VH 5KSAA 5D71L 5IFHL 4F33B 2X9XA 3RUGA 4MXWL 5JHDB 2NY4C 2ESVB 3HB3C 4ZG1A 3SEPA 1P6AB 5IW6B 2WWMD 1FNAA 5E70A 2P45B 3LN4B 4OLWL 5IVXA 3REVB 2H9GA 3BAEL 5F9JB 4Y4FC 4X4XB 3VXNB 5E00B 1YY9C 3MV8A 4RAVA 2D4FA 3T0EA 1F8TH 1J7VR 4AYFA 5B38G 4H5SA 2QLVB 1RZ7L 1B2WL 4N0FA 1S7UA 5T1LA 4GRLB 1IGCL 3LIZH 3T3PF 3UJIL 1S9XB 2FEDC 3WFBL 1QACA 1GZQB 5GSRA 4JM2C 3GM8A 5F9WB 3SQBA 3O8XB 3P4OA 1A6PA 3QAZC 2BJMH 4YHLL 5FA4A 4U0RB 2B1AH 3BPLC 3RGVD 4LSSL 2D03H 2YSSA 4NOBA 3ZE2E 5EOCJ 5E94A 3QG6B 4I5BB 4O02L 1MCPH 1UH2A 3HZYB 1ZT1A 3QDGB 4OCXH 1JNHA 1IILE 3QZWA 3HCVA 4CU6A 5C0RH 5KN5A 1OVZA 2DQHH 1NH6A 5GIRB 1YQVL 4OLYH 4IM8A 1FFQA 5HHOA 1J1XH 1QNZL 4OT1L 4TULL 4L5FL 1JZ4A 5E8NB 3GM0A 1T1ZB 3I02A 3PWJB 3TO4A 1MWAA 2ZNWA 1O7SA 1DDHA 3RA7H 3GMPA 1QFWM 3GSQA 2R2CA 3B2UD 4IOFD 1A6VH 3KLAA 3OPZH 4PJXB 4ETQB 5EORL 5D7LD 3ES6B 3L3GB 1IQDB 1FL5B 5IMLA 4YFLF 4NKDA 4YNYA 1WIUA 1DR9A 4IDLA 4MDJA 5CIPA 1HEZA 4DZ8B 1EGJL 3BQUC 4M6NH 4OM1L 5JOPD 4K7PX 2UWEB 4HUVA 5I6XC 4OFVA 1XAUA 1NUGA 3DARA 4M7LT 5J12C 2Z93B 3CDGA 3KPSA 3DUHA 5T1KB 2HRPL 1LO4L 5ALBL 2FGWH 2DMCA 3SCMD 1CFQB 1ZOXA 4WIQA 2PW2B 4MNGE 4X5LA 3W11D 2XZCL 1RUPL 4LQFL 2OJEB 4XP5L 2FSEB 4XPAH 1JIBA 4PGBB 2ZUQC 3VFRB 4P46B 3V5HA 4LCYA 2F53A 3IT8D 3H9SB 3QYCA 2R1YB 3HUJE 4NJ9H 5IVZA 1P5UA 1ZT4B 4NRXA 4LLMA 3LQZA 2EDBA 5I8EB 2CUIA 4G8FA 4CVXA 5AD0B 1OSZA 1A1NB 1EV2E 2CLRB 1X5IA 3B9KD 4P2RB 3QJHB 4EOWH 1HIMH 3MUHL 4KWUA 4S1DC 2NZ9D 5GZOD 3QWQB 1EERB 4MQ7B 3T1FA 3MUY1 4ODSL 1SVCP 2HMID 1HOCB 5IF0B 1A6WH 3MNZA 4XTRC 1U3JA 3CXDL 5J1AA 3VXUE 1KEGH 4KDTC 4TSCL 3D2UD 3TZVA 5IB3A 3B6SB 3NPSB 4YAQA 1YMMD 4NQED 5E08L 1BQUA 3WLWD 1OCWL 1PZ5A 3BH9B 5C0BB 3SDDC 5DEFB 2BRQA 3OAZH 2GK0A 3WO4C 4L3CB 3V0VA 4YQXH 3HE7D 3RWEB 1YEEL 5JXAH 4E5XA 3PUCA 1MCKA 5FB8A 2VSCA 1BGXL 3DLQR 4Z8FH 3MMEA 4FMFA 5HGHB 4OV5A 1YN7A 1B88A 3FCTB 4P4KC 4MNHA 3J7HA 2GJZB 3GMMB 2EYTB 1MQ8A 5FYLE 3I75A 3O4OB 4Q9QH 3D39B 1FNGB 2X70B 3R06B 1WWBX 1CD1A 4I18B 5DMKA 1FV1A 4DVRL 3BH8A 3MRFA 3OG6B 3K0WA 4A2LA 4LDOB 3VGGA 5C7XL 3DROB 2ZUUA 4O2EB 2CO6B 5C08A 3RX8A 1Z6JT 5D5MA 4NWUH 4LNRB 2GSGB 2VXTL 3FHQA 1MIEH 3V95A 3JWDH 1LQSR 1RZJC 3QWOB 3OKMB 2Y06H 1MH5A 3C5JB 1F11A 5MP6L 4WEUD 5JOFA 3UO1L 1NCDH 2P8PB 4HWBA 4MDIB 1LGVA 1ZGLB 1I8IB 5CFHA 4M61B 3NTCH 4WNQA 4KTDH 3JWNC 5J1SC 2DWEA 3W0WA 3E6FB 3MA7A 4PJHE 4X9FA 1J0HA 3FQUA 3U0TA 2OJZH 5BZWB 4LF3B 4L8BA 1MCOH 3GSUA 3L3DB 3C60A 1S7XB 3OKDA 2CDFA 1TTUA 1N6QH 3EJYD 1C1EL 4PRHB 3MRIB 1U8LA 3U0WL 4I48A 4BYHA 1I1CA 2FNBA 1S9YA 5IEKA 5CLWA 3TWCH 2PXYA 3K46A 4NQXB 3ZT6A 5FUCE 3FFCB 1DQQB 1RJLA 1VGEH 4WW2C 2ORBL 1KCVH 4K9EH 2JELL 3BHBA 1FC2D 2P5EA 1H5BA 3QHZL 3BP4A 5CWSA 2L4OA 1U2CA 4LSVL 5CJBA 1X5AA 3ETBF 1IAOA 1LP9A 3B5GA 4HUMB 4QXUH 4G7VH 3BMWA 2LVEA 2QSTA 3QP3A 3BP6B 4GQ9L 3CFBA 4WHTA 3JV6B 3SGDH 5C3LD 4O4YH 3PWUA 1J0IA 4MA3A 2H2SC 4P5TA 4PJ7F 3QI9A 1FZJB 1SEBA 3P4MB 5EU7C 4KJYA 2ZOLB 2I07A 4M7LL 4NGHH 3O6KL 3KPLA 3GSVA 5I1HH 4JO2H 3ULSA 4TPRL 2ZCLH 3VXQA 4GLRI 4PJCF 2C9AA 4GOSA 1G7JB 1WC7A 1Y6KR 1MHHB 3CXHK 1RY7B 3FJTA 4IEFB 3QDJB 1F4YH 1MUJB 3UTPE 5D7JA 3UTSD 3TN0A 1I3GL 3TFKC 5C0CD 5JUEH 1UGNA 1T03L 2K9UA 5ESQA 2ITDB 3C5ZB 1T0NA 5AUMA 3WKMH 3LQAC 4D9LH 3QEUA 4LMQE 5JPMB 4OZHA 2MNUA 3PGCB 4QWWD 1OP5K 1G6VK 2B7DT 2VWEE 4HFWA 4N8VG 5ACMA 5CP3A 4GKSB 3EO0A 1P4LB 5T5NF 1SY6L 4FQLL 2AQ3A 4UINH 3TPKA 1C5DB 4EN3B 3MRJA 2PW1A 4UV7H 4NQSB 2CLVA 3EO1B 3VXSB 1IAIM 4HUXB 3VFGL 2P8LB 1GHFH 3WJLA 4LHUG 3P9MA 1DUYA 5BS0D 3NAAL 4CW1A 3RWHB 1JWMB 3RVWC 5L8JB 4Z95L 1Q72L 2UZYB 4XMLL 3GGWA 4NQCE 3OXRB 2X89A 3MX0A 3F7QA 1XGTB 2YD6A 3VFVA 4WFED 4M4RA 3IXTA 3OZ9H 1G1CA 1ITBB 1ND0B 5FIEA 3N1QC 4KJPD 4U7SA 3T2NH 2ED9A 2D31B 2G60L 4B50A 5C2BL 5D2NC 1BJ1H 1NAKH 4P2OD 1IGYA 3OB0K 5DK2A 3IFOA 3EJJX 5EZJB 1I85C 5FYKL 3WNOA 1M6OA 4Z6AT 3WCYA 4QTHB 3DMMB 1INQA 2P8MA 1CXLA 2E7CA 4F9LA 1D6VL 4ZFGH 4XBEL 3NABL 1A1MB 2CUMA 4KDWA 1WIPA 2A6DB 4HWZA 3W9EA 1P7KB 4POZD 1B0GB 3CZJA 4I1NB 4JPVH 4FHBD 1CL7H 2A6IA 5LG1A 2VZTA 3UTQA 4XRCB 4NUJB 3RDTA 4JY5L 1FYTA 3BDYH 2DJUA 3BPOC 1F8TL 5GRWA 2AK4E 3CVHA 2BSED 2P4AB 2CRMA 3P4NA 5ECJE 1MRDH 3PGDA 3ZKQD 1FRGL 1FZMA 4WUUE 1X5XA 3V0WH 3QQ4A 5C0FA 3LIZL 3OTTA 4OZGB 4KVNH 1XF3B 5I9QB 5EUOF 4EJ1C 3OAYK 3VD4A 2X44D 3O9WB 3I6LD 5INCB 3VRIA 1S5HA 3AAZB 4H1LB 2BJML 5ITFB 2EO9A 4WI7A 4UNTA 2C1PB 4U2ZA 1DQJB 4P57A 3CFJA 5EOCH 1MCPL 1NGYA 5CGYC 2YPLE 4W4NA 4PV9A 2WP3O 5C0RL 4Z77A 1HN1A 5CP7B 3VFPA 1J1XL 1ADQL 3FOLA 3BGFB 1QG3A 4ONOA 3QIWA 1UWEH 5EOTA 4D94A 4R2GB 3RA7L 3ULVE 3ZHDA 2F15A 1A6VL 4WFGE 4G43B 2B2XH 3SE4A 1A47A 4G8GB 4KI5E 1AKJD 4Y1AA 3UAJC 5CD5D 5I76A 1NC4A 5H2BB 3ROOA 5F7UA 3CZFB 3L3KA 3DIFB 4Y7MA 1J18A 4XC1H 1DVFC 1E4KC 1FVDA 3RUGE 3OJVC 4KHTH 3X14B 1K6QH 3S96B 4N9GB 3VXRD 1MAJA 3WS3A 5IVXE 2NQCA 4XNZB 5F3BB 5KSBB 1A7RH 4XPAL 3LKQA 2W38A 4LLAA 3MV8E 4RBPH 3GJFB 3U4AA 3LEVH 3FMGL 2DKSA 5FECB 5J6GA 4NJ9L 3QUMH 3EYFB 4O9HL 5DJCA 2IMNA 2XG4A 1Q9OA 4HZLA 4MNGB 2V6HA 1MHCB 2FX8L 5GRVK 3LZFL 3UMTA 4EOWL 4PJXF 1CDYA 3RVTD 4EUPA 3HC4H 2Z4QA 5LKNA 2H2PD 4NQVA 4YR6A 3BPCA 5JO5B 3ARWA 1FVCA 3S37H 1LO2H 1LO5B 2PN5A 3VH8A 2UWEF 1KEGL 1U0QA 4NBYB 4WWKB 1CZ8H 5ETUA 2LAGB 1OB1B 3F12A 5JIPA 4MX7A 2ICWA 4JFPA 1QLRA 3BXNB 2ZSWA 1M7IB 2JCCB 2VR9A 3MBXH 4WV1B 5FHAH 2VTFA 5LAXA 3RVVD 4ERSH 2NY2B 3N1FC 1YPZA 4MHHI 1UWXH 4LEOB 5HHOE 4YQXL 1CQKA 1T66D 5JXAL 5HPMB 4ISVB 2AJVH 4QOKB 3MUGA 4XP9H 4PRBB 1EK3A 3QEQA 4U7KA 5CJ8A 3DX6A 3KYMB 4P9HC 4M1DL 4N0CC 2C1OA 2WWKO 4Q9QL 2X4PA 4YXLH 2X4OA 3ECBB 2KPNA 5FM5M 4LIQE 3IDXH 4KQ3H 4QXTB 4YXKL 5DJ6B 5J11B 3ARFD 3IFLH 3QQ9D 15C8L 1WEJH 3KPSE 4CADB 4LBEB 4XX1G 3JWDL 4JKLA 5CEYA 3U79A 4UTAL 3O41B 3QO0B 5I8CA 3OKLA 3LKOB 1XH3B 1O7VA 2BXYA 5IVOA 5J13B 2UZXB 3HE6B 4WI2A 2FZ3A 4NN7C 2Y5EA 1FE8L 1NCDL 2ZG1A 1N3NA 3ARDC 1BIIB 2F53E 1HQ4B 1MIMH 5HY9A 2YPKA 5K33A 3GRWH 3HFML 1OTSC 2VDOH 3IDJB 1MJ7H 5JMOC 3UTZB 4WWID 3D6GA 4F58H 1S7VA 2ERJC 4R96A 3VWKB 1MCOL 2RHEA 4XAKD 1X9QA 4G80B 3TIEB 1Z2KA 1X5HA 5CBEA 3BYYA 1N6QL 3TBWA 5I16B 5K9KB 4L4TD 4FXGB 5IMOA 5GRUH 3OR7B 1OLLA 4OCSH 3VFUB 1JF1A 4MVBD 3I2CL 3TWCL 2O5ZL 4ZFFB 2B5IB 2JJUA 4HGKC 2NNAB 5FOBA 4FZ8H 1A3RL 3P77B 1OARL 4U1LB 1IRAY 3DX9B 1KCVL 4K9EL 5MEPA 1U8QB 4GRWH 2QQKH 4JGJA 5I1EH 1HQRB 4Q2ZA 4I0PC 4KMLB 2R4SH 1GL4B 5F7NC 3OKKA 4PLJC 4WHYG 4QXUL 3SKMB 4FP8H 4JRXB 4G7VL 4AM0A 1G9MH 1ZA3B 1VKXB 1JNJA 3MYJA 2NX5A 3CFCH 1UFUA 4UBDC 3QULA 4KTYA 5EA0L 3EYVB 2AV1B 4OF7A 2R9HC 4O4YL 3GMLB 4M48H 5HYIA 1A4KA 4R97B 2DLFL 5ISZA 1RJYB 3QUZA 5ID0A 1OY3B 2BNRD 3CC5B 2IWGA 4NGHL 5F7MC 1N0LA 5C08E 1H3WM 5I1HL 5D5ME 4ONHB 3IU3A 2NXYD 4HKZB 4XPBL 5DO2C 3Q6GL 3TLRA 2W9DH 1DBKL 2R1XB 5JPNA 4HS8L 4NO0B 3B3IB 1EEQA 4HEPG 1T7WA 4IMLA 1XT5A 3BRGC 5IROC 3X3FL 5JUEL 5E56A 2VC2H 4FFVC 3DGGB 2VLKA 4LCUA 2GJ6A 2J1KA 3WKML 1KJ2H 3W0WE 3HPLA 4D9LL 2IAMA 3B5HA 4EI6B 3M07A 4QHLA 4L3EA 1LEKB 3ZSSA 3MGOA 2DQGH 4W68A 3IKCB 1TCRA 4ODTH 1CXEA 3WNPA 5DJAA 1D9KC 3JVGA 3KAAA 3EOBA 5TFSH 4H8WC 1VERA 2HLAB 3QXWA 5FDYA 1QKZH 2J8UE 3QXUA 1QSFB 4UINL 5BVJA 1RUQH 4OF3A 4IS6B 5CJQH 2FWOA 1IM9B 1FNSH 4EDWL 1DQTA 2R56H 3KPQB 5LXGH 1BZ7A 1CFSB 4OGZA 4KJWC 4N0UB 1LNUB 1PGRB 4GXUN 5GJSH 4ZNEE 3BVNA 4F9PA 4U31A 5BXFA 4XHJC 1SJHA 3RTQB 3VJ6B 5GGUA 1QR1A 2J2ZA 1AR2A 3MOBH 1SYSA 4FRWA 4MCYB 3ZT5A 3P9LA 4PJGA 2IQAA 1UQSA 3D85D 5ICZB 4JFXB 1OGAB 1JE6A 2F54D 5L8KB 1U8NB 1U8PB 5FOJA 2LTQB 2HJFA 3T2NL 3RGVA 3NH7L 3CPLA 4LRIA 1FGNH 5EZOL 5C71A 2X7LA 5E2TL 3L5HA 1ZLVH 3D3VD 4GQPH 4F15C 4ZFGL 3O11A 5EU4A 1KYOJ 1OQXA 2R23B 4BKLB 4BZ1H 4ELKA 1VFOA 1ZLUH 2OXGA 2ADIB 3MNWB 2JE8A 1G7QB 2HRLA 1IGTB 4JPVL 1CL7L 3UJJH 3NN8B 5EBWA 5I1DA 1KJMB 3EAKA 3ARBD 1D5MB 5D7LA 1OTTD 1FYHB 5F6IB 4WO4C 4OD3H 4E42A 1KENL 3BDYL 4LHUD 5T3ZE 2FJFB 2QADD 3ZKXB 3KYOA 4UMGA 5A2LH 5INDB 3RL1A 1JNNL 4OZHE 3V0WL 5HYQA 3Q6FB 4KJQC 3BD4A 4NNYB 1C16B 5F3HB 3TYFA 4KVNL 4BA8A 4PRPD 4MD4B 1YEIH 6CGTA 3SCMA 3DETC 1T83C 2GTZA 2EDQA 4KVCH 3FB5A 4NKMB 3V0AC 4M6OH 3SDXB 4BFIA 1CR9H 4Y5YC 1F3DH 4Q58C 4GUPA 5EOCL 4KUCD 5KAQF 1G0YR 2A83B 3LN9A 3PABA 3GK8H 1I3VA 2YEZB 1E4XI 5HHQB 2E6PA 4ZUSB 3B9KA 1KPVB 3SKOA 4QRPE 3M8OH 2OTUA 4WTZA 2NR6C 5F9AC 1NCBH 1UWEL 5E99L 3MLPA 2ED7A 1MHEA 4HWEH 2B2XL 5F9OH 4MZ2A 1OAUH 2YKLH 2X4RA 4LSRH 3D2UA 2CJUH 1Z5LB 4HJ0C 4NQDD 2NY4D 4Q74A 2YD8A 4X80H 4YDJB 1YMMA 3QXDA 4NQEA 4OZGF 3DUUA 5GZNC 4YLQT 3S88L 3BRDA 4POUB 1QRND 1RUAL 2BY0A 5GRJH 4XCYA 2NY5C 5AAWA 2ZUYA 4KHTL 1GXEA 3O0RH 1G7LB 1RPQA 5C0IA 1K6QL 3KS0J 5CSBA 1UJ3A 4UQ2B 2ATKB 2XZQH 1A7RL 2WQ8A 1ZV5A 3STBA 1INDH 4P5KA 1GC1C 3VFSA 2DQJH 1FGVH 4HIHB 4WI6A 4MA1B 2HYMA 3LEVL 3VFTA 3FHAA 2CRYA 1UJTA 3QUML 1GGTA 2W60B 4G6MH 1R3LA 5T3XL 5J3HC 5JORB 2GAZA 5BV7B 1C5CH 3DYMA 2CH8A 2IPKB 3QNXA 1CGXA 3LQAH 3QFJD 4OM0H 3HC4L 1IMHC 3GUTB 4RAVB 4LLUA 3M1BA 3T0EB 3JTTB 4ELMA 4XHQA 5CMAA 3S37L 1LO2L 1I4FB 5DURD 4MAUH 4IRJC 1M7XA 4JDTL 3MGTA 4N0FB 1S7UB 1QA9A 4HMCA 2XWJB 4XMPL 5T1LB 1A5FH 2CK2A 1AGEA 1CXIA 1BZ9A 4JAMA 5FUOH 4W6XB 1NQBA 3TC9A 2CRIA 3IAGC 3R8QA 1CD8A 3IF1A 1RZIB 2EEAA 4ERSL 5I0DA 1T7XA 3KLHD 1B4RA 2DQTL 4MJIA 5KSBF 1KNOB 5BOZG 5HYSA 1IARB 3UZVB 2F9BT 4JLRB 5FA4B 2AJVL 1PEZA 2X05A 4XP9L 4JR9H 5B4MC 2OZ4H 5E94B 2Q87A 3H3BC 2ZSVA 4WEMB 4MHHG 1ZT1B 3S34H 1HYSC 1JNHB 4UNUA 3HCVB 1U95A 3KR3H 2F5BH 3RWFA 2W0FB 4KRPD 2D7TH 1RFDH 3IDXL 4KQ3L 3TO4B 4Y4HD 5MEOB 3HRPA 5IBLC 2JB6B 2BCKA 4LCWB 3GMPB 3OSKA 4OLUH 5E6IC 1YN6A 2OP4H 3UYPA 3KLAB 3IFLL 3ZE0F 3KXFD 5HHNA 1HK6A 4QY8A 1MELA 3N0PB 5IMLB 4NKDB 5L8LB 4Y0GA 4L8CA 4MS8D 4RFEA 5FAAA 1KULA 4L8SC 1LO0H 3ARPA 2AP2A 4MDJB 3T0WA 4UIKH 1M05A 2KL6A 4JFZH 4HUVB 2FDBP 4JN2A 4Z78B 2QV2A 2ICCA 3UZEA 1CLZL 3BWAA 3CSBA 3I6GB 2JCCF 4Z18A 4R6UA 4DW2H 4S1DD 3S35H 2VDOL 2A73B 1KIUA 1NMAL 2H1PH 3FN3A 4XMKH 1IFHL 1MJ7L 3MREA 1N6VA 4F58L 4R0LB 2LE9A 3H7LA 4Y2OA 1F6AA 3MLXL 2V2TB 5HI4C 5IVNA 5MERA 1KCSH 4MXQD 5HGGS 1UB5A 1C7TA 2DBLH 2G2RA 5IVZB 2IEPA 3UTSA 1KJVA 2ZUVA 1DLFH 4LLMB 3PHQA 5L7XH 5C0CA 3DX8A 3LQZB 4OCSL 3GNML 3MLYH 4PBVC 3DVFA 4U1GB 4Y4KA 4CVXB 4XWGL 1OSZB 3OR6A 4J8RA 5SV4A 5KZCB 3EOTL 4HBQA 3NGBC 3ET9F 4FZ8L 4NZRL 2VLMD 4X83A 4U1KA 4M4PA 1HI6A 5F8QC 5I1EL 5SWSA 3BD5A 5I73B 3MNZB 4F7PA 4P4KD 2FYYB 4BELD 4FP8L 2FX9L 4M93C 3TZVB 1LK3L 4QTIH 2OL3H 3TJHC 1VEPA 1ADQA 4HH9A 3GBMH 3QEQE 5EG6C 2AABH 1PZ5B 5IGXL 3WUWA 4XCCH 1FL3B 3MRRA 1OW0C 2GIYA 2GK0B 1PLGH 1WITA 2C3GA 5DRNB 2BY3A 1SMAA 4E5XB 4JJ5A 3MMEB 3AM8A 4OV5B 4NO5A 3QO1A 2IQ9L 3QWRD 1A7NL 3CJJA 3KPNB 1S7SA 3TJEH 1JZ5A 3I75B 2A0LD 4OUUB 1MI5D 5I1IH 5GS0C 1CD1B 1JBJA 1FV1B 3WN5A 43C9A 4R3SA 5TPWH 3BH8B 4NJAL 2BVQA 3TYGH 2BVEA 2VC2L 1DEDA 4P2OA 3FAWA 5DVNA 4EI5C 1B4JL 1KJ2L 4HPOL 2BY1A 1WLHA 3Q1SH 4OCYL 3RJQB 2DQGL 2DYPD 4L1DA 4ODTL 3GIZH 2GJJA 2EXWD 4JM4H 4C56B 2AEWA 1F11B 5JOFB 3TA3D 5TFSL 1OQOA 1QKZL 3QXAA 1FORH 4K2UH 4DFIA 3TIDB 4QRUA 4KKBC 3MJ7A 3E0GA 1RUQL 4ZXBC 5CJQL 3VDAA 2B1HL 4DOHE 2VL4A 5TGBA 1FNSL 4XPFL 1EIBA 2XKNA 1K9TA 1P9MC 5LXGL 3MRQB 3C8KA 1VENA 1J0JA 3GSUB 3JWOC 4JQXA 3C60B 5GGSB 3UYRH 5DJYA 4MSWA 4U3XA 1WFTA 2CDFB 5GJSL 4PJDB 3QCVH 1RD6A 4AEEA 1XGPA 1HSBB 4MCZB 2LQRA 4I48B 5EOQH 3OAUH 1S9YB 2BY2A 5IEKB 5E5MA 1EEUA 4TUKH 5A1AA 5F88A 3W5MA 5DHVH 1H8OA 4XXDA 5HDQH 2AV7A 4XNMA 2E7LC 2CSPA 4QT5A 4Y2DD 3FTGB 3CMGA 3WNLA 5LGHL 3MV7D 5F96H 2P48B 1LE9A 3STLA 2P5EB 1PSKH 1FGNL 4XNYH 1H5BB 1BHGA 2NY0C 3BP4B 5CWSB 3P30H 3ZKMD 3U4BH 5ISZE 5IFAL 4QKXB 1IAOB 1LP9B 1CG9A 4P9HH 4LOUC 3DXAD 3IDYC 4X5XB 3CFBB 4E41B 1TVHA 5CZVH 2RBLA 1K5NB 2FH8A 4ZAKD 3ROLA 3GIVA 4MA3B 4P5TB 3QI9B 2J12B 2VAAA 4W4OC 3UJJL 4GSDH 1H15A 5A2JH 3AUVA 4KJYB 3HR6A 1ZGLM 3IDMA 1AKJA 3VXMD 1CLOH 1XEDA 4QHNA 5B38A 3J8F7 3ULSB 3E8UH 2EDHA 4N8CL 1RZJL 2VXVH 1KB5H 3ZTNL 3B4NA 3VXQB 1IE5A 2P1YA 3OB0H 1CGYA 4L3EE 3WFZA 5KW9L 3CK0H 4V1DD 3G6AB 5I66A 1EEZB 4RGND 3BZEA 5CINL 3FO1A 5D7JB 5C70A 4WU5A 4YH6A 3TN0B 3VXRA 4DCQA 1IKFH 4LLYB 2O5XH 2D7MA 4OAWA 1T0NB 3OBAA 4OLVH 5AUMB 5A3IC 1J8HD 2MQ0A 4LL9A 3K2UH 2CDGA 4M6OL 4FOMA 4YC2B 1CR9L 2D9CA 3P9WB 1NUFA 4GRLC 3SJVE 3MFFA 3EO0B 4OQTH 2O26U 5B39B 4MJ6A 3EO9H 3NFPA 3LQMA 2VQ1A 2EC8A 4XPTH 3AGVA 4G7YL 1NBYA 5ID1A 1J11A 2PW1B 5F9WC 32C2A 3O8XC 4PIRF 3V6OA 2CLVB 4S1QH 2A38A 1GAFH 4PJGE 4C4KO 1JV5A 1HCFX 4U0RC 3P9MB 4HGWA 4HWEL 4HUWB 5F9OL 3UJTH 3P2TA 4CW1B 4CVZB 2YKLL 3KJ4B 3OGCA 1XGRA 4AEIH 2QBWA 3R1GH 5EH1A 2V5YA 4P49A 4OLEA 2CJUL 3FO9A 1UXSA 3KYKH 3HC3L 1NGWA 2WW8A 2VH5H 2VLJE 1VB9A 3DSNA 1CGWA 3OB8A 1K85A 4AIXA 5I74B 2HT3C 1G6RL 3IXTB 3O0RL 3MUZ1 4PGJA 1BREA 3C6SA 2V2WA 3HS0B 3SDXF 2DRUA 2BVOA 2WBKA 2XZQL 3IFOB 3CSYA 1CXKA 1V3MA 3VFMA 4NZTL 5D7LE 2R0LH 1ZAGA 1QFWL 2HTLC 4G8IA 1LHZA 1J0ZA 1FGVL 4N1CA 3BIKB 3ZMRA 4HWZB 3QXTA 2YBRA 4GMSL 1D5IH 2GCYA 3SGDI 1LEGA 1Q1JL 5I8OL 3C87A 3OJ2C 4WFFD 5I1JH 5FA3A 1YC8A 4U1HB 3ARFA 1REIA 5C0DA 3DUSA 3QEHB 2XA8H 1C5CL 1AR1D 4J4PD 1VHPA 4NT6A 3D87B 3UTQB 3LQAL 3RDTB 4OI9A 5D7SH 4KZDH 5M95B 4GG8B 5DS8B 1FYTB 4NO3A 4O51A 1FLTX 3MPCA 4P46C 4TUOA 4K94H 1C12A 4MAUL 3P4NB 4H8WH 3QQ3B 3PGDB 1FZMB 3H6JA 2WUBH 1G0DA 4JRYD 5FUOL 4AT6B 5IW3A 5T1MA 3SE8H 1G7IA 2HFTA 2FO4A 1JZ6A 1MFEH 4KKCC 4XVJL 1H3PH 4M43L 3QHTC 3RKPA 5J1TC 1ETZA 5CS7A 3PDDA 5DRWB 3HG1B 1Y0LA 1RHHA 3FQTA 1G9NH 3BN3B 2EEDA 2B20A 4P57B 4ORGA 2DDQH 3NPSC 1NGYB 1NANH 4PJBA 4PV9B 1DVFD 2IFGA 4JB9H 5D9SA 4FZEH 2ZOKB 1QOKA 4YDIH 5FGBA 1GGYA 1RFDL 3FOLB 3PXHA 2IPUG 3QIWB 2PO6D 4LKXB 2AXFA 5T33H 4OLUL 5EU6D 2BZDA 1BFOB 1LD9A 2OP4L 5FV2A 5D8JH 4IRSA 3T4YA 4KHXH 1BWMA 1FN4A 3C09B 5ESVB 5CJ5A 4EDXB 1EX0A 4HCRL 5SX4H 4Y1AB 3DRQA 2EZ0D 1AP2B 3O4OC 1WBZA 3PJSA 1NC4B 4I18C 4JFZL 4UT9H 1CD0A 2HH0L 3ROOB 2MSPA 4O2CA 3A0OA 5HYJD 2DLEA 3UBXB 4XB8A 1F3JB 4DW2L 4XMKL 2H1PL 1BAFH 5ENWB 2BNRA 3HR5B 3PV7A 1QSZA 1MCJA 2Z31D 1UCTA 2JLLA 1JNLL 1KCSL 5JDSB 4CVUA 4ORZC 3UTTB 4YXHL 4ELME 2ZP0T 1ONQA 1A2YB 4H26A 1Q9OB 4PJ8C 5ICYA 2FX7L 3MLYL 1AHWA 3RL2B 1BD2A 2G9HB 4AJ0A 2VAJA 3FT4A 4HW6A 1OAQH 2F19H 3BPCB 1FVCB 3G04A 1DP0A 1H3XA 4MJIE 2IBZX 3VH8B 4AH2A 3IJHA 3H7BA 4N0CD 1DQLH 1GZPB 2KH2B 5DHYA 1TTGA 1RMFH 4X4YA 3A67H 5D1XD 2OL3L 4U0QB 5EO9A 3O3BA 3Q2CA 3GBML 1CF8H 1NFDB 4MX7B 4JFPB 4ZOCA 5TDNB 1QLRB 5IQ7H 2ZSWB 5I18L 5LAXB 1JI1A 1YPZB 2HJKB 1PLGL 3ARED 3VGDA 1DL7H 1MAMH 5FO7B 3OHXA 3PL6D 1OTUD 4ODBD 2VZ3A 3QPQD 1PFCA 1KIRA 1IT9H 2CIIA 4P3DB 3QEQB 5FYKE 4HLJA 4U6XA 3TJEL 1QLFA 2C1OB 5GS2H 5E24E 3VGHA 2R0ZH 3D85A 2LAAA 5C09B 2DQIL 2NY5H 1NMBH 2X4OB 3IDGB 3WHE0 4OLXL 4KK9D 1T89A 3RFZC 3MRMB 2F54A 1M1SA 5TPWL 2ADFH 4IOIA 3TYGL 4UDTB 3QIUC 4NM8H 1A1OB 4D0BB 5EDXA 2ARJA 2YZ1A 1NBQA 3L5WB 1GC1H 3GI9H 3Q1SL 1BIHA 5CEYB 1I9JH 5I8CB 3GIZL 3MRHA 3OKLB 5DJ2A 4JM4L 1F13A 5E2UH 3VXPB 3QUYA 1PZUB 3I3DA 4KGJA 2Z35A 1OM3H 1FORL 5HJ3A 1N3NB 1TITA 1WAAA 3C5ZC 5DMJB 3G5YA 5HY9B 4JFDA 4RMVA 3PHOA 2HTKD 1IKNC 2XY1A 3ARBA 3QISA 1S9KC 1N0XH 3VW3H 2XTJB 4KH2A 4PJEA 4YPJA 1KLFA 3WHE1 4ZYKB 4LHUA 3MO1A 5AZ2H 4OZFH 1R5VA 5GQBA 2BSSB 4K7PH 3GMOA 3L5JA 2OQJA 4P2CG 5F7WC 2WBJD 3RGHA 3LCYA 3TBWB 2G75A 4X6CE 1EO7A 4FQXA 4QF1B 3WNNA 4HK3N 3MCKA 5SWSE 5JIHA 4DOHB 3HNTH 5IMOB 3QZWG 1J86A 5EOQL 3OAUL 2VRAA 4PRPA 4EN3C 4GG6A 5IMMA 4HFUL 5HHPA 1RIVH 3ARXA 1WBXA 5JIKA 5HDQL 5FOBB 2CKNA 4LU5H 5BW7A 3ARGB 1UACH 3HPJB 5MEPB 3VI4F 4OF6A 5ALCH 1PSKL 1AIFB 1AQKH 1KLGA 3MXWH 4HV8B 4Q2ZB 2PTTA 5F93C 3P30L 3OKKB 3GSRA 3LEYL 3LAFA 3EFDH 4P9HL 4AM0B 4JFYA 3ARUA 3MYJB 2NX5B 4L4VB 2HLFD 3SO3B 1UM5H 3O45A 1KTLA 1A6ZA 3WFDH 4PGCA 2P5WA 3RJDA 3DPBA 1D5XB 2XY2A 4GSDL 4MNQA 4XCEA 5LWYH 2MCPH 1AY1H 5ID0B 5DD6B 1UVQA 5C0JB 3ZE1E 5JTWA 3G08A 4PJDF 2MHAA 3VXUD 3DMMC 2WIIA 1VESA 4NQDA 3IU3B 2VXVL 1F2QA 3C5SA 2JK5A 3KWWA 4H88H 1CGSH 4TNWF 3ARRA 2RJMA 4PP2A 3RIFK 3MRCA 4FXKB 1QRNA 1AGCB 3CK0L 5E9DE 4ZD3H 1I3RB 4IMLB 3D0LB 3R8BB 3O81A 5B3NA 2X4NB 1IL1A 1IKFL 5F97E 1FC1A 2DMKA 2VLKB 4LCUB 1J12A 1FAIH 2GJ6B 2O5XL 1FH5H 1ZWIA 2IAMB 1CE6A 3K2UL 1XR8A 5JW4R 1AC0A 1LP9F 3MGOB 1MJJA 1BFTA 3K8KA 5FCSH 4YEEA 1TCRB 4UB0H 2ICWI 4X99A 4NO2A 5DJAB 3Q0HA 3EOBB 2W65A 4OF5A 5DMIH 4OQTL 5I9QC 2FJGA 4DKFH 1OP3H 3NVQA 4Z0XA 3EO9L 3EFFB 4JM2A 5BVJB 4RGMB 4KFZC 4XPTL 1E6OH 2FWOB 3O9WC 3QFJA 5I1AB 2Q8AH 3WE6A 1Q0YH 1NEUA 2IF7A 1BZ7B 4M5ZL 2E3VA 1FO0L 4OZ4A 4ZUWB 4QNPE 3UJTL 3FN9A 4KPHH 4K8RD 3BVNB 4GKZA 3R1GL 1QYGH 1SJHB 4Z7UB 2FATH 2DTML 5GGUB 4YHKH 5D6DA 3ALWA 4Q7DA 1SYSB 1K4DA 3WD5L 3BGFC 5EIQA 3P9LB 4PJGB 2IQAB 5CEZL 1UQSB 1UYWH 4R2GC 3WIHH 2EKSB 4BQCA 1BOGB 4WO4D 2HJFB 4H25A 3RGVB 2I9LA 4YZFE 4GAGH 2CKBH 5DUPH 5J6HB 1FFNB 2H3NA 5MHSE 2JJSC 3VDCA 4ACPA 1PKOA 1EUUA 1XR9A 4LEXH 4NFBA 1HDMA 4RMUA 5I1JL 4Y4HA 3TPUB 5F7LB 3AY4C 5I1DB 4XNZC 5JW3H 4DGIH 5D7LB 4D0CA 4E42B 3PWVB 4KROD 3UPRB 4L9LB 2MCG1 1AXTH 3KYOB 4YDKL 5TDPA 4H8WL 5B22A 3EYQD 4FQIL 4XZUA 3U9PH 1EHXA 3MRKA 1P4IH 3TYFB 2VDQH 5IB5A 3VFWB 2NY6C 4WI4A 2Y23A 3L3HA 2R2HA 2PYFA 4PJFB 2GTZB 5GJTH 4XNQA 4APQD 2F8XC 4DUVA 3U9UA 1MVUA 3RPIA 3BEVB 5H94A 3V6OE 1PKQB 4X8JA 5I19H 1H8NA 4LVOB 1T4KB 2DDQL 4WWKC 3UTPD 3HMXH 5CGTA 3PABB 4I4WA 3S37X 3SDDA 3WFCH 3ZLQC 4HBCH 5GSVA 5IESL 4JB9L 5TJWK 2BK8A 4FZEL 3B9KB 4WV1C 2NY2C 4XCFH 4YDIL 1CGTA 4ZPTA 4F7MB 3B9EA 3BUYA 1MRFH 2NCMA 4Z7VA 5T33L 2YD5A 4L8DA 5CCKL 1T7ZA 5D8JL 4YHYB 3CLEH 1MHEB 3HLAB 1F2XK 4P4KA 2X4RB 5EC2A 1QSVA 1NAMB 2C26A 2HP4A 3X13B 2VMFA 1DANU 2N7AA 3CFEA 1VACA 1IEBA 1WFUA 1YMMB 3QXDB 4MLIA 4NQEB 4Y89A 3DUUB 4UT9L 2VISA 4U49A 4JVPA 5J11C 4FTVD 4QYOA 3T08A 1FG9C 3HE7B 4TQEH 1BAFL 1KLUA 1O0VA 1JMXA 5C0IB 1AQDA 3PV6A 3UXFA 4C83B 3OKEA 3SE9H 1YEFH 5EO0A 4OGAC 1IQWH 2Z91A 4NQCD 2KKQA 3KPPA 4KK5C 2EDNA 3VFSB 5J13C 1P5VA 4NRYA 2KZWA 3HE6C 5E1HB 4WVRA 1R3IH 4U1SB 1R3LB 2NZIA 4GBXD 1NC2D 2PCPB 2GAZB 4NPYB 3SQOL 1MCWM 4JZOA 4BSWA 2HT2D 3QNXB 2N7BA 1X5JA 3VWKC 2FLRT 4I3RH 4GAJL 1OAQL 2I9TB 2F19L 4PJAB 2M26A 3M1BB 2DYPA 1T7YA 2O93L 5CMAB 3OKOA 3FN0H 4HXAH 1JYWA 1QLEH 4JGMA 3MGTB 1QA9B 1DQLL 2GT9B 1AGEB 4M1CC 1RMFL 4Q6IB 5E8OB 1BZ9B 3O6LL 3A67L 2Y4SA 2B5IC 2PYEE 4Q0XH 1QFHA 5DXWA 4PJBE 5IQ7L 1O5DT 3WDIA 1SYVA 1TENA 2NW3B 3IF1B 1MCRA 2DS4A 5D72H 4ZO9A 4DJMA 3HAEG 3LD8B 3NA9L 3RY4A 1A21A 1W0WB 5HYSB 5IFJA 2AK4D 3N06B 3PNWA 3RI5F 2IANE 1DL7L 1MAML 2XWBB 1EDQA 4TNVF 1WSST 4WUUD 1GGCH 3EGSA 4XCNA 1FFRA 3RHWF 3TBSA 2F8VA 2BHUA 2X4TB 1U95B 4C59B 5IIEA 1D5BA 1ORQA 3RWFB 4FFYH 1S78D 1G6RA 2NY5L 1NMBL 4R97C 2ADFL 1JI2A 3MV7A 2J7LA 4GFTB 2KQMA 3S3JA 5EBMB 2D9QB 2DQCH 3LKNA 1I9IH 4QY8B 1K3IA 4D3CL 1DBJH 1WCBA 1GC1L 2AJXL 1CE1H 4RFEB 4G9FD 4YHZH 4L29B 4FQQA 5E2UL 1M05B 1JRHH 1RHFA 2Z8SA 5C1MB 4FABL 4JN2B 1NFDF 1PVHA 4UILH 3VRJB 1FPTH 2J6EA 3KYNB 8FABB 4HIJA 5ANMA 4D2NA 3FQWB 2O61A 3ULVD 1YPZF 2XKSA 4XBGB 3V6ZB 4WFGD 4YWGH 3W5NA 3VW3L 3MREB 1AO7D 4EQ2A 4LKCA 3VXMA 4PB0L 3VMNA 5DQJA 1BD2E 4KI5D 1F6AB 4ZUVB 5AZ2L 3VA2C 4K7PL 2YZ8A 5E7BA 3NPZB 4GO6B 2ENSA 5GGTA 2V5SA 1FFOA 2XN9B 3NIDE 5F9DC 2G2RB 5KSAD 4KMQA 2FR4A 3UTSB 1KJVB 1CK0H 1NKRA 2P7TB 3PHQB 1RK1A 5C0CB 3QH3B 3DX8B 4J3TA 4UQ3A 3BWUC 5FK9B 1RIVL 4J8RB 1KIQA 1J8HA 2AJYL 3WO3B 3AXLA 1UACL 4U1KB 2WBWB 1HI6B 1U93A 5ALCL 3MV8D 3TH3T 1RZKC 1AQKL 1BQHG 2I5YH 4JHAL 4OD1H 4F7PB 3RTQC 3WFHA 4UT7H 1PQZA 3T3ME 1IZKA 1W0VB 1KOAA 2UY6A 4H0GA 1TZGH 5F89B 5C0AB 3U36A 3RBGA 3WXWH 4A6YL 2HT4D 3BISA 3RKDC 1A0QL 2VL5B 2A6JA 2VZUA 3WUWB 2LTQC 5B21A 5I1KL 3FT2A 1UKTA 4EI5D 1I85A 5BS0B 4OF8A 4HCRA 1AY1L 2MCPL 4FFWC 1H3GA 3IAPA 2Q7YA 3GEWB 1PYWA 4EVNA 1CI5A 5JXEC 2OSLA 1I1FB 4MWFB 1ZA6A 5CHNA 4NO5B 3QO1B 2YUXA 4H88L 5KBNC 1CGSL 4V2CB 2IALB 1T21B 1ZS8B 4KK8D 5ERWA 2ZCKH 1WIOA 4IDJL 4G6JH 3WN5B 43C9B 1IGFL 5E2WH 1FVEA 4PRAA 4R3SB 5T3XE 5ITBH 2X1PA 3DVNB 1X4YA 5F6IC 3ULUH 3IJYB 4YK4B 4P2OB 2FH6A 4EUPG 5CGMA 4Y88A 2HJLA 1FH5L 4JFDE 1NGQH 3ZKXC 1T0MB 1W72A 4BK4A 1WBYA 7CGTA 2QSQA 4UB0L 4Q97A 3W2DH 4DGVL 3UPCA 2R2EA 1N5AA 5DMIL 4DZBA 4DKFL 5FYJU 4QRUB 4M7KL 3OF6A 5IJVB 1E6OL 4K3DH 5IHUH 4ZTOH 2HKHH 5KVMC 2YWZA 3KPSD 4GG6E 1OP9A 3FO0H 2Q8AL 1J05A 4KK6C 1F90H 1DE4A 4OLZH 1YDPA 4P3CH 4PP1D 4XC3L 3FB6A 5D96B 5DJYB 3W9DA 3FFDA 4JY4A 4MSWB 2VR4A 4KPHL 2UYLA 3LRSB 4LOUD 4UAOB 3BIBX 1QYGL 4XI5D 3S4SG 4POYA 1JWUB 1KC5H 2FATL 2HVJA 2EE3A 2F53D 4U1IB 1KB5B 4WUKH 4YHKL 5DMGC 4JRYA 1RULL 5E5MB 3L5XH 2DL9A 1QTYT 1JGDA 1GPOH 2R8SL 3H0TA 3K8LA 2AV7B 1UYWL 4YDLB 3GZKA 4QT5B 3L7FA 2BMKA 4NC1C 3SKNB 2LABA 3FO2A 2NXZD 2P5WE 4X6DB 1LE9B 3STLB 1QRKA 3WS6C 1KB9J 4RAUA 5F7HA 1ZT7A 2CKBL 3DBXB 4MNQE 5DUPL 4BM7A 4M6MH 1NSNH 1CG9B 5D2LB 2L0DA 1Q9WB 1TCMA 4G9DA 4ODWA 2HVKA 2CXGA 3BGMA 1DVFA 4JN1H 5GS0L 3EOYG 1TVHB 1A22B 3G6JA 2Y6SD 3PGFH 2WINA 3D25B 4CVWA 2RR3A 4M7ZB 3ROLB 2PO6A 3GIVB 1QRNE 4HWUA 5EU6A 4HS6A 2VAAB 5DT1H 4CDHA 1CICB 2IH1A 1H15B 2DQUH 4DGIL 4CRPA 5A16A 3MACL 1NEZG 1AKJB 4LSUL 4QHNB 5B38B 3MFGB 4CKVX 2MWCA 1EBPA 4Z7UF 4MA1C 3GSNH 4K3JH 5AYUH 4RIRA 3FONB 3ZDXE 1S7QA 2ID5A 3U9PL 2VR5A 3BZEB 4PJGF 4HT1H 3TBYB 5HYJA 1P4IL 4AG4L 1U8HB 4ALAH 2EDRA 2VDQL 5BV7C 4WU5B 1RIHL 1DEEA 1T1YA 3O8XD 3IETA 3VXRB 2QKIA 1P4BH 2Z31A 1KBGH 4OIIH 5IB4A 1NLBH 2YXMA 2EDOA 5C6PB 5C08D 1FL6B 3T0EC 3S5LA 5GJTL 2CDGB 4GRMA 1N6UA 1IC7L 4GRWE 1UM6L 1YEGH 4BUHA 4NHUB 5F1OB 4ODHH 5TH2A 12E8H 2MKWA 3WFCL 4WRLA 1ZEAH 3NFPB 2VQ1B 2VIRA 5D7KE 1KIPA 4NFCA 1NBYB 4KV5F 1U8KA 1J5OH 1U91A 3CMOL 3W0WD 1MRFL 4Z0BH 5C9JA 1ED3A 4UUJA 4JQIH 5JDJA 3CLEL 4HGWB 3WKNA 3MA9L 3OGCB 1XGRB 4R90H 1MF2L 1L7IH 1JGVL 5D1XA 5DZOA 1N4XL 1T5XA 1NGWB 4YGVB 43CAB 2Q76B 1ZTXH 4UDUB 5DEGA 5F6HJ 2UV3A 3TO4C 2PXYD 3V5KB 1BJ8A 4PJFF 2V9QA 3RVUD 3AREA 4R7NA 1BECA 4TQEL 1RUMH 5BQ7A 1U92A 3BP7B 3EBAA 1H3UA 3PL6A 1QD0A 1NCWH 2BVOB 4KMTH 3H9SD 1CLYH 2AI0H 2L7JA 3CSYB 3SE9L 3WL9A 4AQOA 1YEFL 4OBRA 3MRLA 1IQWL 4HIIA 1WZKA 3IFNH 3ARDA 3T0XA 3INUH 4DGYH 2GCYB 4HLZG 5HGBB 1LEGB 3HKFA 1R3IL 4P2RD 1QR4A 5IM7A 2ZJSH 3ARFB 5C0DB 1KT2A 4R0LC 4I3RL 1EBAA 5E4IA 4NO3B 2Y5TA 3EJZD 1EXUB 4O51B 1EZVY 3O3EA 1VGKA 3S35X 4TUOB 5IB1A 4QHMA 1AD0B 4HXAL 1QLEL 3MCLL 5HDBF 4JY6A 4CAGA 5GS1B 4U1GC 3GMQA 5C0GA 4Q0XL 3B43A 3LN5A 4GS7B 2FIKA 5ADPL 5E03A 5T1MB 2V7NA 5F71A 1VADA 1ZLWH 3UZQA 3TH4T 4H1LH 2ICEB 5FM5O 5D72L 3JZ7A 1FO0A 3U0PA 5T3ZD 1ETZB 5I73C 1Y0LB 1RHHB 3FQTB 4Z7WA 4NP4H 5DTFB 2VLME 4Z7VE 4PLKD 5FDWA 5IR1A 2EIZB 4L4TB 3V4VH 3TZVC 4ORGB 4QRSB 5C0ND 2X4UA 3L95A 4WCYL 4PRNB 4FFYL 3NIGE 1G7HB 1UA6H 4YDVA 4KC3B 1PX3A 2AXFB 1DBBH 3LHPL 2EE2A 4NRZA 4PJAF 1CDUA 3PP3K 1IAKA 4E9LA 3T4YB 5HI5C 1DQMH 3GFUA 1I9IL 5E0QA 3O3AA 4WTWA 1DBJL 2F74A 1CE1L 3MRBA 2VDMH 3V5DA 3PWNA 1WBZB 3QDME 3V7MA 3PJSB 1UB6B 5IROA 4GXUM 4NSKA 1PBYA 3Q5TA 4PJ8D 3TNMA 4FA8A 4QRPD 4UILL 2KQNA 1FPTL 1UZ6F 4O2CB 4KKLD 3ZYOA 3L3JB 3RWGA 3DO3A 1KSRA 1XFPA 3S36X 3P11L 5DD3L 3WNKA 2VDPH 4JHZA 1NBVH 2BNRB 4X98A 2FECI 4MYWB 2DLGA 1IGML 3F7RA 1JPFB 1D9KA 2NXYB 4BJLA 4HC1A 4XXCC 3HNVH 1D6EA 4LSTH 4J1UA 4DKDC 2EC9T 3VI3F 4H26B 2GTWA 1FG2B 5KVGH 4EBQH 2AKRB 1CK0L 3MODH 1P53A 5ICYB 5ABDE 1MFDH 3QJFA 1KTKE 3TESA 1I7UA 5HYEA 3FT4B 1OWWA 3C60C 1EVUA 3BJ91 4R4NC 3TBVB 5DVOA 3G04B 3RNQA 2I5YL 3NBNA 1DSFH 4OD1L 5IMKA 3O6MH 5F7DB 2FEEI 4F3FA 3BN9D 3DHJA 3IJHB 5DQ9B 4UT7L 3QFDA 5DHYB 3OJDA 3QXVA 2XPGA 1P1ZB 4LLDA 3CNKA 5EO9B 4KY1H 3NCEB 3O3BB 4PB9H 3BIAX 3M17A 1K2DB 4DKEH 1A3QA 3QIUD 3ZDYE 3GDBA 4DK6A 1H5BC 2GKIA 5EUKA 2MPAH 4YX2H 3OHXB 3RRQA 2EDTA 3EDEA 1RURL 1HINL 1NANI 4YHNA 2CIIB 4ODXA 4QRTB 4OSUL 5H37G 2K3TA 1GGIL 2R0KH 1DZBA 4PGDA 1Q9LA 4U6XB 4YBQD 3KPOA 1GOGA 4PJHA 3GKZA 2YD3A 4D8PA 3D85B 4P5TC 1HZHH 4OD2A 3PWLB 4QXGL 3QI9C 4G6JL 5DGRA 5E2WL 1F4HA 2JIXD 1CXHA 2F54B 3KPTA 4R7DA 5ITBL 4WO4A 1BM3H 4ZFOB 3ULUL 4G8EB 2WLYA 1RIUH 2XQBH 3CUPB 5FYLH 2IADB 1ZHKA 1T5WA 1NGQL 1QFOA 3FRUB 2QSCH 2ARJB 3D3VB 5DSCA 3X11B 4U33A 1A7QH 2OI9B 2B0SH 2X4SA 5DJ2B 4N8VB 3W2DL 4EN3D 5DJZB 1KF9B 5HJ3B 4U1JA 3MLVH 3QA3A 3G5YB 4X4MA 1W8NA 4HKJA 4K3DL 4BH8A 4RMQA 5IHUL 3VD9A 4K8RH 1DBAH 4HJJL 4ONGH 3FO0L 4HIXH 4PJEB 5IT2H 1F90L 4LHUB 3SDYH 2IPTH 4OLZL 5TE7H 3MO1B 4Y5YA 1T2XA 2QADB 1R5VB 3HZMB 4HXBL 4YC2C 3GMOB 4ZNCD 1J8HE 2OQJB 5HHMB 5IQ9A 5IW1B 3T2QA 4PBWD 2FBJH 5CBAA 1HXMA 1KC5L 2A6KA 4XBPA 4QHUA 3MCKB 5GRZA 4N90E 4PRPB 3L5XL 1WT5C 5DFVC 5HHPB 4JFFE 5ESAA 1BVKA 5J06A 1GPOL 4QCIB 1RZ8B 1E27A 4OIBA 1UG9A 4X6EA 3IKKA 2DF3A 3WJLC 5HBBA 4NNPH 3LV3A 3IGAA 2Y36L 3LKRA 3DMMD 5D2NE 3DRTA 1K4CA 3KJ4C 4P0DA 3GSOA 1ZE3C 2PTTB 4MA7H 4M6ML 5MEQA 3E6HB 2C3WA 4JKPH 3RAJH 4GW1A 1N2RA 3L1OH 4JFYB 3SDAB 4M02A 2OK0H 4JN1L 1MY5A 5IBUG 5JW5B 1IM3A 1P2CA 4OB5H 3O45B 1KTLB 5I74C 5EIIA 5DD0H 4BSVB 2P24A 1CN4A 3LB6C 1E4XH 3VD5A 2IFFH 5DT1L 2V2XA 2G5RA 2DQUL 3SHSA 3UC0H 4X5WA 1BVZA 5DD1H 1OAKL 2V9RA 1UVQB 3F6IA 2ARJQ 4LPVA 3G08B 2PR4H 2MHAB 1A9EA 1MQKL 3S3SA 4F9LC 4NQDB 4LVNB 4Z9KB 1TVDA 3KDMA 3BO8A 4I3SL 5DUBA 1OHQA 4PP2B 4K3JL 3EDDA 3OX8A 4MAYD 2JKXA 2YK1H 4ALAL 4FTVA 3Q3GB 1FDLH 1JJUA 2CK0H 3U46A 4FS0A 3RDTC 2P42B 1I1YA 4V2BA 3CSPA 3BEWA 4OIIL 1KCLA 1AGFA 4X6DF 1GGBH 3QIBB 5F1IB 1CE6B 1XR8B 4NQCA 4NCDA 2XZZA 4LRNH 5D2LF 5DJXA 2YD7A 1YEGL 2AGJL 3NCMA 4DAGH 4ODHL 5K59E 2W65B 2R2BB 12E8L 3G6DH 5GXBB 4MD5B 1U3ZA 4NKQB 1NC2A 1ZEAL 3LH2H 2OMBA 4WI5A 2AS5M 3JV5A 1T80A 3O6FB 2WAHA 3GHBH 3QFJB 4HGMA 1NL0H 4GAYA 4JRYE 4QHKI 4Z0BL 2EDJA 4JQIL 3CFKB 4HDIB 4AMKH 3NIFF 5DURB 2BRRH 3O3UN 4GKZB 4K23H 1YA5A 4R90L 1MREH 1U8MB 5KS9B 3MRDA 5KSVA 2JB5H 4Q9CA 4A6YA 3HMWH 1YY8B 5CUSL 1DQDH 5HGDB 1LO3H 1ZTXL 3QQNA 5E6IA 3I85A 3QIWC 1HILA 2RQ8A 2EDEA 4PRDA 5E8PA 3OGOE 4M5YL 5DUMH 5EU3A 1X4XA 1RUML 3C09C 3G5VB 1I1AD 4DUWA 3SE4C 3SY0A 2DJ4A 4L8SA 3OL2A 3WEXA 1NCWL 2EYSB 1S9WB 2AI0L 3QPXH 1JHLL 5TDOA 4KRPB 4DGYL 1V7MH 1XR9B 3BT2H 2YN5A 5LQBH 1BFSA 4CBPA 2NY6D 1ES0A 1BQLL 1QVOA 3MJ9H 5LBSL 4Y4HB 5KVDH 2ZJSL 3U7WH 5JQ6H 4KUZL 4JVUA 3N85H 3KXFB 1A6TB 5IKCB 4K7PY 3WDJA 5ISZD 3VFNB 4I77H 1U8IB 3W39B 2YD4A 4G9FA 5F1NA 1UXWA 2R1WB 1M71B 2A9NH 2VLRB 5I1GH 5TDPB 1OLZA 1ZVSA 4LSPH 5A2FA 2DI7A 2WSKA 5FKPA 3HZKA 4G42A 5IB5B 1DFBL 1WK0A 2W9EH 4PD4J 1XIWD 4RZCB 2Q3AA 1FHGA 1JL8A 4G6AC 4J6RL 1AO7A 3G5XA 1NDMA 1RJZB 2PYFB 3VXOA 1MRCH 4I8DA 1BJ1J 4KKAC 4OZIE 4RAHA 1L7TH 1DN0A 1U9KA 4JFEB 4NKOA 4YPGA 5DRZA 1MVUB 3U9UB 1CIDA 4PJCA 4NYLA 5H94B 3DV6B 4NP4L 4X8JB 4J3VA 5C6TH 4L3ED 5HDLA 2DKUA 4MB4A 5T1DH 5FV1L 3BKMH 1Z9OA 4I4WB 1PX4A 3QNYB 1JPTH 3MBED 2NY3D 1XCQB 2ZPKL 3GBNH 3BUYB 2E6JA 4Z7VB 1DBBL 1QO3B 4LP5A 4HIEA 5AWNH 3GMNA 4OGAD 1QSEB 1MCQA 3SJVD 1ZHLB 5MENB 2VDML 4ODUB 3RIAK 3FZUC 3H2WA 3CFEB 1VACB 1IEBB 4W70A 1JZ2A 3WJJA 3FB8A 4F7TA 2VISB 4TOYH 3T77A 2FJHA 4HUNB 2DOCA 5IOPA 2C7UA 1EMTH 2YMXH 4EI5A 5E2VH 3VWKD 2VDPL 5FO9B 1KLUB 1NBVL 3AU1B 1VPOH 1VFAA 5CKGA 1JZ8A 1OAYH 2OS7A 1DBMH 2HG5A 1G1YA 2X4QA 4XAWH 1JPSH 3CDFA 4WHDA 4UV4H 2VLJD 3HNVL 4CJ0A 1MI5B 4LSTL 4WEBH 5C07D 3IRZA 1G9MC 4YBLB 5BV7H 4HPYH 5SWZE 4EBQL 4X9HA 1MCSA 1P9MA 5GISL 1MFDL 2ZWLT 2BFVH 2XTJC 1GYAA 4PG2C 1RV6X 4OCWH 1S7WB 1S9VB 2RCSH 5KANG 3B9VA 4P59H 3PG2A 4M1GH 1YMHA 3SKUD 4P23D 3RU8H 2DYPB 3ARSA 4ZPVA 1ITCA 1CFNA 1T04A 3OKOB 3K4AA 3VRLE 5FCUH 2NY7H 1MCBA 3O6ML 3TA3B 1FNEA 4BFGA 4O5LH 5C9KA 1G7PB 4RX4D 1J88A 5J9PB 4XNXL 4Z7WE 4PJ5E 1KN2H 3IDNB 4UT6H 1KCRH 4BQ8A 2E7LA 4FQ2H 4IMKA 2PETA 4KY1L 2BNQD 4PB9L 1AC6A 4U1MB 3H9HA 5HI3C 1BBJA 3ARGC 1SYVB 5CEZE 4TTDC 4DKEL 4YEFA 2J4WH 5JZ7C 5IFJB 4IIQB 4ZOBA 1JYXA 1NLDH 2A74A 4U6YB 3BP5A 3KPRA 3HC0A 4WY7H 4NO0D 4ZO8A 2PTUA 2BSTA 5F44A 4JPWL 3P0VH 1U8OA 3AS0A 4XCNB 3RWDA 2GUOA 4YFEA 4ZSOA 3TBSB 4X0KA 3SO3C 2F8OA 2R0KL 4ONFH 3O2WL 5EUOA 1D5BB 1J9CT 2CPCA 5C92A 1MWAH 3QSKB 3F5WB 4HUUA 1HZHL 2VZSA 5E8EA 4NZJA 4Y2DB 1BM3L 4PJ9B 3MV7B 4RMTA 1RIUL 2XQBL 4F57H 4OI7A 5FYLL 5M7QA 1BVLB 1BP3B 4U1NB 2E7HA 2QSCL 5CIPH 2YUWA 3WIFA 1V5JA 3U48A 4LIQH 1NCCH 3REVA 3DXAB 4HQQH 4FQQB 1YNTA 4U6HB 4PFEA 5F9JA 4X4XA 4ZAKB 3VXNA 4RFNB 5F7EH 5E00A 3LY6A 3WV0A 5CZKA 4HIJB 3BSZH 5ANMB 2O61B 3MLVL 4PRIE 4WDIA 4Y19E 3QCTH 1DBAL 2IAMC 1TDQA 3IS1X 4HIXL 4P2QE 2BVUA 3VXMB 3DI3B 4NHCH 4R26H 3SDYL 4L3AA 2IPTL 3A6BH 5TE7L 1T2JA 5IJKA 3QUKA 4S1SH 5DJDA 1EHNA 3JVGC 1S9XA 2WWMC 3O2DA 4V1DB 1GZQA 4RGNB 1F4XH 5JOEA 4RGMC 1XGUB 3O8XA 1RK1B 1VEMA 4ZOEA 4IHOA 2DKMA 1Y18B 2BVYA 3QG6A 4M3JA 4NNPL 1INEL 1EFXD 1UEMA 1BEYL 3QDGA 1U93B 1E6JH 2VXQH 4GXVL 3O2VH 2AW2A 3L5IA 4MA7L 5FKAB 1SBSH 1JVKA 3WFHB 1XCTB 4OIAA 4JKPL 4NUGL 1EJ6A 1T1ZA 2BERA 3L1OL 2OK0L 3BPNB 3GJEB 3HNSL 2QQLL 1LEIB 1WAAF 4OB5L 3T3PE 3U36B 2EDDA 4PJXA 5DD0L 4OKVA 3ES6A 1TLKA 1FL5A 1MHPL 4S2SB 1E4XL 1RZFH 2IFFL 4PJEF 3REWB 3RGVC 4MA8H 4HKBA 4LRIC 3MRNB 4XPGH 3UC0L 4DZ8A 2F58H 4MJID 2Q20A 2Q7YB 2PR4L 1WTLA 2D7PA 1PYWB 3VG9B 4EVNB 1CFVH 1FIGL 1HHKB 5CHNB 5IBTH 2J8UA 2VUOA 2OR9H 1NJ9B 5D1ZD 2AVGA 1YECH 5K9QI 4KAQL 1CFQA 1TXKA 2YK1L 2OJEA 3B2UC 4IOFC 1FVEB 3S6CA 3C2SA 2CK0L 1HXYB 3IU4H 3VWJD 1JPST 4KK6D 3AS1A 1EFQA 4P46A 4ZNEA 1GH7A 1GGBL 2QHLA 3CVIH 3H9SA 4DQOL 2HJLB 4X4ME 4L9LC 4PJIB 4CN1A 3H42H 1W72B 1ZT4A 4KUCF 5FYKD 1U3HD 1JRHI 2H26B 4LRNL 4HWBH 4KI1A 5DMGD 3CX5J 2EECA 3C2AH 4OKDA 4P2RA 3DURA 3QJHA 4ZS6D 4DZBB 2YR3A 1MEXH 1P6FA 4XPHL 3LH2L 3MV9B 4AEHH 2HWZH 4LPTA 3W11C 5D7IB 1HOCA 5DJ0A 5IF0A 2ADJA 3GHBL 1NL0L 4ZDHA 1NCAL 4KGLA 1QBBA 3NCJH 5DEZA 1DE4B 1FIEA 1RZKL 5DR5H 3FB6B 4P4RA 3B6SA 1CFTA 3FFDB 4JY4B 4UI2A 3U1SH 2BRRL 4LVOC 2V7HB 2HN7A 1CXFA 2UYLB 4K23L 4LVEA 1MREL 2D0FA 1H8SA 5DD5H 2JB5L 1NGPH 3BH9A 5IB2B 5DEFA 4XP4H 3HMWL 1Q94B 4JRYB 4PS4H 3GSNB 3IB4A 4L3CA 3B9KC 1DQDL 4IJ3B 3V4UH 4PG9A 2NZ9C 3QHFL 5GZOC 1JGDB 1J1OH 2FB4H 3H0TB 3FQXA 1JFQL 4KQ4H 4Y4KD 3L7FB 2NYYC 3R4DA 2HMIC 2BMKB 4YHYC 3FO2B 5CILH 3AVEA 2GJZA 3GMMA 2EYTA 4Q9BA 4RAUB 3D39A 2X70A 3R06A 4I18A 3QPXL 5SWSD 4N5ED 1CTNA 4MB5A 3WLWC 4AIZA 4G9DB 3WMSA 5CJXC 1TMCB 2BHZA 1A4JA 3PWPD 4XGZB 5FUZH 3BT2L 3G6JB 4KKNA 3KNBA 5LQBL 1AI1H 5FYJL 4YJZL 3MJ9L 4R8WH 2Y07L 5KVDL 3HE7C 2PO6B 4WU7A 5I1CH 5EU6B 3U7WL 1EO8H 5JQ6L 3DYOA 3N85L 2X10A 4FTVE 3QWOA 2W07A 3OKMA 2R4RH 5A16B 1GSMA 3U2SB 4I77L 2YC1A 4GKOA 5KS9F 4MDIA 3IDIB 1ZGLA 1I8IA 1JHTB 4M61A 2A9NL 1XF1A 5I2IB 5I1GL 2QTEA 3E6FA 4PJ8A 3C6LB 5JMRA 4RIRB 4N0YL 4QRPA 1S7QB 1OAZH 3C08L 4QRRE 5BRZE 5HYJB 5BZWA 4LF3A 2NMSA 5T3ZH 1DEEB 3TV3L 1D7FA 1T1YB 3L3DA 4ZQKB 5SV3A 2Z31B 3HAEA 3K7UA 5IB4B 2FLBT 4PRHA 3MRIA 3OWEA 4GRMB 3FOMA 3X12B 5CP3H 2MQ3A 3OAZK 1E4JA 3K81A 5C6TL 3N1GC 4NQXA 5E9DD 5DJ8A 4Q6IC 1R3JA 1BFVH 5T1DL 1KCKA 1TTFA 5TH2B 3BKML 3FFCA 5KJRH 2AJZA 2JJTA 4M9OA 3O4LE 3E2HB 2VIRB 4RCAA 1G0XA 3GBNL 5CD3A 3L7EB 3LD8C 5L2KB 1U8KB 5BCAA 1U91B 1HWGB 5KTEH 3OKNA 5M94B 4JGUA 4UUJB 3JUZA 3EJYC 1OL0A 4GKNA 3ZDZF 3WYRA 1KGCE 1I8KB 4XWOD 3HA0A 3HRZA 3FRPG 3PDOA 4NIKB 2BDNH 3U4EA 3JV6A 2ZUTA 1SMOA 5D1XB 4UNVA 2A77H 1T5XB 1FZJA 3CH1B 2CD0A 3GO1H 2ZOLA 3ILPA 4TOYL 3MLWH 3QIUA 1JK8A 1S7TA 2YMXL 1SQ2N 2GFBB 3AREB 5E2VL 4N8PA 5BQ7B 1U92B 1VPOL 3PL6B 1OAYL 4JDVB 1SJEA 2B1AL 2FD6H 1AXIB 2D03L 2IG2H 4GMTH 5B3JE 1F3DJ 3DV4A 3PE9A 4XAWL 1JPSL 4L9DA 3BJLA 4UV4L 4LVHB 3MLSH 1N5YH 2ITDA 1N26A 4OCXL 4W6WB 4R4BA 3ZYIA 4Y8AA 4MXVF 1L0QA 4G9FE 2DQHL 4HPYL 2DQEH 5BV7L 1IKNA 4OJFH 2JIXA 4OLYL 3SGEI 1TETH 4Z7VF 2BFVL 5JPMA 4PJ7E 3PGCA 4OCWL 3LPFA 2VABA 3CVHH 2AEPH 4HULB 4JANA 3OPZL 4P59L 1X5GA 1FSKB 2AQ1A 4M1GL 1BQHA 1P4LA 1QZ1A 1AO7E 2VZ1A 1VGKB 3EYOA 3O3EB 4NKIH 3SGKC 5MHSD 4JRWA 2XICA 1C5DA 5FCUL 2NY7L 3WLBB 2A9MH 3NFSH 4EN3A 4PJCE 4X9BA 4F8TA 4M6NL 1WF5A 4XVUC 4JY6B 1KN2L 4UT6L 1KCRL 4MQXD 3GMQB 5C0GB 3ILQD 3LN5B 4GW4B 2YD1A 5DRXA 1VADB 1N8ZB 2FGWL 4XNUH 4J3XA 3VD3A 3U0PB 3HZVA 2J4WL 4RRPG 4F2MB 1F3RB 4QWWC 1PJ9A 3OXRA 1Z3GH 2WBJB 4WY7L 5IR1B 1UADC 1HHHB 1EJOH 3P0VL 1JGLH 4JPKH 4KRMB 5IEHA 4XT1C 2X4UB 5EBLB 2R69H 3L95B 4Z5RA 1W0YT 2DJSA 3B8YA 5GRXG 1P7HL 4Z7OF 2FIRT 3MJ6A 5EZJA 5ADOH 1KXQE 5HGAA 4JFQB 4JG1H 1HIML 1AH1A 4QTHA 1A3LH 3DMMA 3RVXD 4F57L 1IAKB 1JGEA 1A1MA 2A6DA 4Z7QF 3HUJB 1Q38A 3O3AB 5CSZB 5I75B 1A6WL 1JHKH 2F74B 4LLWB 4L1HA 1HKFA 3MRBB 3V5DB 3DO7B 4QEGA 4HQQL 3IJSB 1GJIA 4MQTB 2VITA 3TNMB 3WN5C 4G6KH 1GVIA 5F7EL 2Q86B 1NBZA 2W9LA 4KJPC 3RWGB 3BSZL 4YK4C 4P2OC 5F7KC 2DQFA 2CR3A 3L9RA 4X98B 5CJOH 4R4ND 4F7EB 3RPKA 4NHCL 4R26L 3VXUB 1CIUA 2YA0A 4NWTH 4Z8FL 1S7RA 4OZGA 1J0YA 3S4SA 4RISH 1XGQA 4POZC 4YGAB 1JTTA 4MAYA 4J1UB 3PQYE 1R5IA 1F4XL 4MLSA 2GTWB 4TVPH 4YHIB 5INCA 1E4WH 5I8KH 4EUPH 2DN7A 5ITFA 1HH9B 1IAII 2AEQH 1DQJA 5D96C 4YIQB 1IBGH 4NWUL 5D1QD 3Q48A 1FZOB 4JZJB 4PD4K 4X7EC 4BSJA 1E6JL 2VXQL 4HAGA 4GW5A 4UAOC 3O2VL 3RNQB 4PBXA 1MIEL 4P99A 5CP7A 3F65A 4F3FB 2Y06L 2CMRH 2XYCA 4TUJA 1HE7A 1TJIH 3D0VB 3KPRE 3OJDB 2XPGB 3MOAH 4Z7NF 3RWIA 4OFPA 4YDLC 4G43A 1OD7A 3NTCL 4ZSOE 3M17B 4KTDL 3FKUS 4YHPA 5EUOE 1HNGA 4G8GA 1RZFL 1U3YA 2OJZL 4ZS7H 4F15B 5EUKB 1NEZA 5H2BA 1XF4B 5IBTL 1AFVH 4YHNB 3DIFA 2AJUH 2HFGH 4ODXB 4YO0A 2ESVE 2PYED 1ORSA 3X14A 1YECL 1EAPB 3KPOB 1IAMA 2CGRH 3N9GH 4PJHB 3RQ3A 1CD9B 4M7ZC 3MGAA 5JW4Q 1CICC 4JQVC 1I1AA 1VGEL 2B39A 3F58H 4N68A 3SGJA 2IAND 5K9QG 2XTLA 3GJFA 3ULUF 5IFHH 3ZKSD 5L2JA 3CVIL 1T5WB 5CD5C 3H42L 4IRSD 2QSVA 3EYFA 4OLWH 1WZ1H 3ZTJG 4HWBL 3T8XA 3C2AL 3LVEA 1MEXL 1CVRA 1YYMH 4U1JB 3QA3B 4AEHL 5JO5A 2QJDA 4HKJB 4BH8B 1LO5A 4XH2B 4BQBA 3NCJL 4KROB 1WGOA 2BNUB 4NZUH 4NNXB 4LAJH 5EFIB 3U1SL 4JO2L 1FFPB 2NTFB 5IQ9B 1EGJA 1OB1A 3GHEH 1T7VA 2ZCLL 4NDMB 3QDGE 5CBAB 3BXNA 4XBPB 5DD5L 4QHUB 2JCCA 1A6AB 4WV1A 4XP4L 4PS4L 2H32A 1F4YL 5FM8A 4LEOA 3EYSH 1XIWA 3SDCD 5ESAB 1BVKB 3NCYP 1T20B 2FB4L 2H2PC 4KQ4L 4X6EB 1FJ1B 1BD2D 4PRBA 5MI0B 4APQB 3RZCD 4PJXE 4LLQB 3BESR 3IGAB 4PJIF 4X6BA 3LKRB 1A6UH 5BOPA 3GSOB 3FQNB 4M8QA 5FGCE 4K94C 2K7PA 4E0RA 4L5FH 5ACZA 4GW1B 1N2RB 2UWEE 3JUYA 3RY5A 3MBEA 1IM3B 1P2CB 3RVVC 5EIIB 1AI1L 4RBPK 5EORH 5D7IF 1CT8B 2WNGA 1T66C 5I1CL 4CADA 4LBEA 4UV7L 3O41A 3LKOA 1GHFL 1M4KA 4OM1H 5AZEH 3SJVA 5DVKA 4JFOA 3HE6A 1A9EB 3ALXA 3D18B 3KDMB 1G9NC 1BIIA 3BO8B 3H9SE 5DUBB 2Z92A 1P7QB 3LEXB 3T65A 2H8PB 4KXZH 2HRPH 1LO4H 5ALBH 1GRWA 1OAZL 3UTZA 4JREB 1HH6A 3VGAB 2XZCH 1RUPH 3S97C 4XP5H 3ARFC 4FTVB 5C8JA 1QEWB 3VWKA 4M6AA 4P2RE 3QQ9C 1IEHA 1D5ZA 1PY9A 4FQCH 3BKCH 4Y16D 3OZ9L 3BEWB 3BZ4B 3QG7H 1SBBA 1HYRC 3QUXD 4YHOH 1NAKL 4P9MH 3KPMA 4NQCB 4FXGA 3O3DA 3OR7A 2VLJA 4HLZH 3LSOA 5DJXB 3HN3A 4JZNA 1UWXK 4IBLT 2GQHA 5C07A 2GSIB 5ICXB 1BFVL 5GS1C 3F7YB 3G6JF 1II4E 4GS7C 3QUYD 5KJRL 4GBXB 5T3XD 4U1LA 1I7ZB 3RHWK 1NC2B 3DX9A 3FT3A 5C0BE 4ODSH 1HQRA 5DLMH 4GAYB 4JFDD 4UU9A 1EEYB 5J7CC 5KTEL 4JRXA 4P23A 4TSCH 3T09A 3VG0H 5HDOA 3F6LA 1VKXA 4PREB 1AXSA 3WSQH 2DLTA 3EYVA 4RX4A 1OCWH 3MRDB 5C2UB 1MRDL 3GMLA 4MVBC 3D39E 4FQXD 1WUNT 3VGFA 4BZYA 1RJYA 4JPIA 1RSFA 2BNQA 5FGBC 1YEEH 1GCFA 4EQ3A 2DLIA 3CC5A 4GH7B 2RB8A 1H0DA 5I15H 3VMOA 1HILB 2QL1A 3H9ZA 4PRDB 2M2DA 1WV7T 2BOBA 2AK4B 4HKZA 4ONHA 2IH3A 3JV4A 1PW3A 3W81A 2R1XA 2EXYD 3SY0B 2J8OA 4NO0A 3K1DA 2XV6B 4WUUB 3UTTD 2FD6L 3ISWA 4GMTL 1FZKA 2HFFA 4DVRH 1NFIB 1N5YL 3DYPA 4Y5VA 1WVZA 3A6OA 2X9YA 3DGGA 1LE5A 1T1WB 1DUZA 5C0EB 1ES0B 1QVOB 4EI6A 4HX1B 3MNVA 5IG7A 1TETL 2VN7A 2P5WD 4KKAD 2WP3T 1R3KB 3ZKNC 2AEPL 3PIQA 2NXYC 1A9BA 5MP6H 4MNQD 4HK3J 1XMWA 4NKIL 2YPLB 2ZKHH 4G9FB 4PRHE 1R6VA 5F1NB 1NUNB 4IS6A 3HB3D 2A9ML 3NFSL 4DUXA 2BC4A 4FN0A 1EPFA 2EEBA 5CEXB 5FKPB 3T1WA 2DAVA 3HZKB 4G42B 1UENA 4D9RD 1CFSA 3MR9B 4XC1L 1CDBA 3DOSA 3FFCE 3DHMA 4GJTB 4Y4FD 3CLFH 3CX5K 1YY9D 1NDMB 1E0OB 4XNUL 3U7YH 1C1EH 4WJ5A 3RTQA 2Q1EA 1DN0B 4MJ2A 4NKOB 1PD6A 4YPGB 3N50A 4GAFB 1C08A 1Z3GL 5DYOB 3FZUD 3U82B 5KSAB 1JGLL 4LFHG 2XI9A 4JFXA 4LMQI 1OGAA 2YN3A 3RUGB 5IP4A 1AD9A 1FQ9C 1U8NA 4WFHE 2R69L 2FEDD 1IC4H 2JELH 3EZ8A 2GITA 5IVXB 4JM2D 2H9GB 2EH8H 2CUHA 4FMKA 3ZE2F 3MUJA 1EFXA 4TSAH 4JG1L 3VE0A 1A3LL 5JXEA 3GMNB 1NAMH 3MV8B 4PYGA 1I9RH 3VFOA 1MFBH 5GRYA 4GQ9H 4CJ1A 1YEHH 1JHKL 4LQ1A 4H5SB 2ADIA 3MNWA 1IGTA 2DI8A 1SY6A 3P0GB 3QDJE 5D7KD 3BZFA 3NN8A 2ZUWA 3FB8B 4F7TB 1CZ8L 4G6KL 2FJHB 4M7LH 4FQ1H 4JJHA 2HKFH 2C7UB 5GSRB 3MBXL 5FHAL 3P4OB 5CJOL 3TT3H 3I6KA 3WIIH 3S5LG 2OI9C 3BRFA 4G6FD 3MRGA 3Q6FA 4NNYA 5F3HA 4NWTL 2YSSB 2X4QB 3BQUD 5D1ZA 5C6WH 4QRQA 4RISL 1I3GH 1I1RA 1OPGH 1IC5H 3QZWB 5KN5B 2NY1C 4TVPL 4FNLH 4YXLL 5HHOB 5I8KL 5HI3D 1OTTC 1OSPH 4MJ4A 3TEUA 3VWJA 3LPGA 5L0QB 3I02B 4NKMA 1MWAB 3SDXA 5JZ7D 3TH2T 3VXSE 1DDHB 1N59A 2APWA 2WWKT 3GSQB 2AEQL 3K1KC 2QADC 3WHXA 3HUJF 2E9JA 1WEJL 1YMHB 1U3HA 3H3KA 3QCUH 2A83A 3V4PH 4ZPVB 4YNYB 3I50H 5D4QA 4FQHA 2Z8WC 3E3QC 3UPAA 4ZUSA 5CIPB 1FNEB 1HEZB 4NC0B 3STZA 2CMRL 1IZJA 1TJIL 3ARZA 3MOAL 1ZLVK 1RAMA 1TPXB 4CMHB 1LVEA 4BQ9A 3CDGB 1MIML 3H9HB 3KPSB 3TVMC 1T3FA 3GRWL 5BW7C 1E28A 1KXTB 2VZOA 4F37K 4Z95H 1Z5LA 4YDJA 2VERN 2A74B 3BP5B 4XTRD 3UDWA 2V17H 1A7BA 4MMZC 3FB7A 4P48A 3V5HB 2BSTB 1BX2A 4LCYB 3SDAC 2F53B 3RWDB 1MCNA 1T22A 3QDAA 1G7LA 4NRXB 2CGRL 5GRUL 4HJGA 5C2BH 4PR5A 4HUUB 3SDDD 1CGUA 4G8FB 2ATKA 3TCXA 2YRPA 3PHSA 4MB3A 5FYKH 3T0DA 1I75A 3F58L