4YH6A

Crystal structure of il1rapl1 ectodomain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
321
structure length
313
Chain Sequence
CTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLEILWYKECRTKAWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mechanisms of splicing-dependent trans-synaptic adhesion by PTP delta-IL1RAPL1/IL-1RAcP for synaptic differentiation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Interleukin-1 receptor accessory protein-like 1
total genus 52
structure length 313
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A03
1GZQA 1GIGL 1YECH 1IC5L 4NZDA 4WFFE 2YD2A 1QFPA 4RA3A 4PRBB 1S78D 5C08A 3X14B 2VXTH 3MRHB 3LKSA 3PIQB 4XZUA 2VITA 1N2RB 4K8RC 1ACYL 1CF8L 1IMHC 1NUDA 1S9XA 2I9LB 1S7XA 1HHGA 5EBLA 2FR4B 1CGSL 2OL3B 3HI6L 5DS8A 1F11B 3SBWA 3HB3D 4RWYL 4IMLA 1EH9A 2O61B 3HHRB 3F7QA 3V6OA 3RUGE 2UUDH 8FABA 2YN3A 2I9TB 4OUUB 2X2YA 3V8CA 4TPRH 5KZCB 1XF5A 3GSQA 2WINA 4AG4L 4HJGA 1G84A 5LAXA 4XAWH 3DROB 3E3QE 4OM1H 5EZIH 3S7GA 5I66A 2H3NB 4Q74A 3CFDA 2QQKH 5D7JD 4R0LB 3MV01 5F7DA 5C0AA 1S7TA 5MEPB 2R1WB 3ME0A 4JAMA 1FGNL 1NFIB 3MV8B 4YGVB 3UTZB 3HE6D 3O8XB 4D0BB 4RX4A 4YDJA 2BNQD 5FECA 2PR4L 3X3FH 5AZEH 5C0DB 2F74B 4L9LA 2IPKB 4PJFA 3WNNA 5J12C 4NQEA 4U1HB 1BOGA 1N5AB 5GHWL 2PN5A 1J0ZA 3EOYG 2FH6A 2R4SH 4J3OC 5B4MD 4UOW0 3K1DA 5A16B 2JJWA 3BPNB 2X4UB 5LG1A 2ICEA 1DBKH 4L1HA 5JW4R 3GMRA 3QWOB 2NX5A 2EKJA 2BOBB 2WBJB 4HCRH 2DIAA 1TMCB 5EU4B 5HHVL 4I3SL 3VXQB 1T7XA 3INUH 3MR9B 3ZSTA 2OXHA 2Z31B 3LKRB 5DEGB 3BHBA 5IBTH 1F4WL 3OJ2C 4JN1L 2DQJH 4Y2OA 4M8QA 4H1LA 4LASH 5AYUH 3CVIH 3NCCB 1YMME 4ONGH 4QEGA 1MWAA 3FB5A 1RI8A 2MPAH 1F4YL 3VXSB 5FFLA 43CAB 4N0YL 4KXZI 2ZUXA 1RU9L 2OQJA 4B7IA 1HK6A 1JGEA 2QHLA 4G6AD 4P4RB 1T7WA 5C0GB 1OGAE 4EN3B 2L0DA 4RBPH 3UPRB 3U4BL 1VFAA 4HXBH 1EXUA 3QBTB 1L6ZA 3BKML 3MGOA 4M48H 3QO0B 2BHYA 4PLJD 1Q9WA 5EA0H 4ZAKD 4BH7A 1I9RH 5IR1B 1CFTB 1FNFA 2UYLB 3SHSA 3PGDA 1T04B 5D1QC 1IM9B 1DR9A 2FIKA 1XCQB 3FB7A 1GHFH 3WS3B 2R1XA 4EIZC 3QR2A 5EIIB 2BSSA 5I30L 2ZOKB 1EPFA 2XT1B 4WU7A 5FKAA 1EEYB 4N9GB 5I8CB 1I7UA 4RRPA 4FMFA 1JNHB 1KLUB 2A6IA 3NA9H 3UPAA 4P5TD 1BJ1J 4M7KH 4TULH 2JIXA 2AJUH 1YYMH 4YBLB 2RGSA 4MXQC 3P9WB 3REVB 3L3DA 5D7KD 4WNQB 4LLMB 5IESL 1YEFL 1XGRA 1U9KA 3CDYA 4JFXA 3WYRA 3TCXA 1ETZB 3FRPA 3P3YA 4NHUA 2GTZA 2QKIA 1BJ1H 2BSTA 5ANMB 3FB8A 4JDVB 4CN4A 3RU8L 3UAJC 4FFWD 3NA9L 3P11L 2BSTB 4NHUB 3C5JA 5H37G 4U49A 4OZHA 2B1AL 3VFRA 5C09D 1KEGH 5JHDA 4TSCH 3UTSA 1OAQL 2XY1A 3NFSL 1K2DA 4OT1H 2BY1A 3QIUC 4OFVA 4HKJA 4HV8B 4EQ3A 4W81A 3C60D 4B53A 1BFVL 2PO6A 4F8TA 5JW4N 1TJGL 4YAQB 5DA0B 3C6LA 1HH6B 5HVGB 4XTRD 1BLNB 2DQIL 1QQDA 3ZE0F 3TA3C 3KYAA 1ZLWH 3BPNC 2W9EL 2YHGA 1OQXA 1A1MB 1FCCA 3RPIA 3MV7E 1ZANH 3BP4B 1LNUB 3KR3L 2VDRH 4JFQA 3WEXB 4WY7L 3TBYB 4KC3B 1L7TL 3HC3L 2IGFH 2XTJC 4YPGA 3CVIL 5JOPE 1I1YA 3QDMD 2NY3D 3LZFL 3QUMH 3ZHDA 2FX8L 1D5BB 5HVWA 1JYWA 1S7SA 4Q2ZB 3WDHA 2JK5A 4ZSOB 3UYPA 3MLVL 1AY1H 4HBCH 3EO0B 2AQ1A 4JZOB 4WUKH 1V3MA 4P3WA 3A6BL 4X99B 1MNUH 3RNQA 5C0CA 1P69B 3CSYB 5I1KL 1OAZL 3VD3A 4FQXB 4RFOL 3G6AA 4NJAH 4LSQH 4FQCL 4BQ9A 3AB0C 2YRPA 2ZCLL 4JG0H 4PJDE 4W4NA 4PRPB 3FQTA 3OR7B 1DUYB 1DZBA 3MZGB 4OZFA 2AABL 4UZGA 5BV7B 5IOPB 4NZRH 3QUZD 1MCHA 4ODVL 1MJJB 3DARA 4NWTH 1EZVY 3U1SH 3GSNB 2D7TH 5FIEA 3QXTA 1MF2L 3X3GL 1TNMA 2D9CA 2W0FB 4L4VE 4XBPB 4NQCE 4CADB 4CVZA 1EBPA 4HBQA 2X4NA 1FGNH 4CMMA 3FB5B 5L8JB 3PWJB 3SDAC 5HPOA 5FYJD 2V6HA 1S9VA 3L5WA 4UQ3A 3WO4B 2XZCL 4IRJB 1S7VB 3H6JA 4LARL 2BVOA 4JFYB 1MCPL 4X0KB 3RAJH 2YUWA 4M93B 3OG6B 2BRRL 4G9DB 4JJ5B 1RVFL 4LIQE 2CUMA 3ARDB 5DLML 2X1WL 2GJ6E 1Q9LA 3MJ7A 3G04B 3FQNA 3O6FD 2CR3A 5CZXD 5F6IB 4P5TA 3QIBA 4OGAD 2XN9D 3VXOA 1FVDB 2BNRB 2SEBB 1AR1C 2XKNA 1UM5H 1KPUB 2WBKA 4CU6A 5IHUH 5GGRB 3NIGF 4F7TA 5TGBA 3IDUA 3I84A 4OF7A 4PJAA 4LCIH 1YN6B 4EVNB 1W72A 5EB9A 5BQ7A 2UY6A 5E8PB 2EIDA 3S96B 3BWAB 4NQED 5TQ2H 4PG2C 5E03A 3WFEH 3LSOA 3QJHB 3MYJB 3IDXH 4KKCD 4OZGB 2IC2A 2XG4A 4ZXBC 1KTDB 4YR6A 4P2OA 3L3DB 1RV6X 3GMPB 3KS0J 5L7XL 3WUWA 1NCWH 5BRZE 3BZ4B 2X1QA 3AS3A 5JHDD 1DL7H 5IHLB 1EBAA 1YUHA 2VSDA 4F57H 4JPKH 2H32B 4ONFH 3R4DA 5IFAH 3RWIA 4MJID 5DDHB 4TUKL 2HTLD 2NLJB 4XAKD 5T1KD 4CKVX 4PYHA 3R0MA 4ACPA 3EOAB 4XP4H 4CDHA 2AJVH 4G8FB 4GAYB 1HI6A 4LSRH 1H5BA 4OF0A 2X4SB 3VI4E 3LMJL 2J8UB 3QQNA 4G3YH 4IRZH 1SM3L 4QF1B 2EKSB 4PJXA 1MLBB 3QRFM 5IEHB 2DM4A 3S3PA 5B38B 1KPVA 3TO2B 4QY8B 3SE3C 4NQSA 1AGCB 4UV4L 3PGCB 3NGBC 3HFMH 4PY7B 1JCKA 1R3HB 4QRRE 1UM4H 4G9FD 2XIDA 4LLDA 3VW3L 4P57A 5B22A 3OXSB 1C1EH 5JLZA 5LCVL 3KNBA 1WWBX 1FH5H 4PLKC 3DSFH 3DVNB 3VI4F 2BZDA 2P8LB 1HWHB 1E0OB 4IOIB 3FO0L 4M62H 3L6FA 1FZOB 1G7LA 3LS4H 2J6EA 4O2EB 3DX6A 3QQ4B 4XNUH 5C0IB 5I8OL 1MRFH 5JW5A 4NO2A 5JA8B 5AWNL 3LPWA 4C83A 3TN0C 3T0VA 4U2YA 2VXVL 2FX7H 3ULVC 3MRNB 4NQDE 2UWEB 1QSFD 4FXKB 5MERA 1UM6L 4AMKH 1AC0A 1ZT1A 1S9VB 3L5WB 5J8OA 1OHQA 4U1IB 1KF9B 2QSTA 5I1KH 4DZBA 2ARJA 1R5IA 2AV1A 4N0UA 1OSZB 2KL6A 1MELA 2FBJH 1CL7L 4EBQH 5AUMB 1VGKB 1X5XA 2E9WA 1WBZA 4C56A 2GW5A 5K9KA 4AH2B 4H5SB 2AKRA 1X5GA 1FL5B 4MXVF 3CAFA 4GXVL 4GMTH 5T1DH 2WBWB 3D6GA 4BZYA 4NZRL 2G5RA 1E6JH 2BNUA 4GRWF 4NNYB 2IGFL 4BK5A 2J5LC 2QV2A 2F58L 4PP2A 4UOW1 5CEZH 3IKCA 4L3ED 4JB9L 4Y5YB 3OB0K 3V4PL 5I66B 3DX7B 3GMQB 1CD9B 3BKYL 3IFLH 3KDMB 3WIHL 1R3LA 4Z7WE 4P23A 1KPRB 5L2KA 3KPMA 2CDFB 2W65A 1VB9A 3AC0A 5ALBH 5C92A 5CINH 3HMWH 4BH7B 4O5LH 4NNXB 4HD9A 4QRTB 1CL7I 3A6BH 2OTWB 3OXSA 4MQXC 1S9YB 3O3DA 3ULVE 4LSPH 5FYJL 2XKUA 4BZ1L 1UACL 2ATKA 2ZOLB 3VA6A 1P5UA 3HNVL 3WUWB 5ITFB 4BQCA 3BWUC 2V2WB 4OZIA 1LNUA 5J7CC 2BX5A 5IMKB 1HZHL 3LKSB 2XY2A 3PIQA 3SQOH 2GAZB 2VDQL 3KXFD 2D4FA 4JKPH 1BP3B 1DSFL 4IBLT 3EJYD 4M8QB 3D48R 4GG6B 3GMMB 1IKNA 1LK2A 1NAML 1QRNB 4M6NH 2AV7A 1YN7A 3TJEH 3A67L 3CLEL 4K7PY 1MCFA 6FABH 5F93C 3GEWB 4PP1D 4ZTOH 4KGJA 4OI9A 4FQPA 3UJTH 4F7PA 3WKNA 1DP0A 4RAHA 3O45A 1C5CH 3QIWC 2X70A 4EZMA 4D3CL 1NUNB 3UTSB 4L8CB 3DLQR 3QO1A 3VFMB 3CGTA 1DQLL 3V52L 1CICA 2WBJC 2E6QA 3WBDA 2FYYB 1T1WB 3EIFA 4ZUVB 1E6JL 2AK4A 4ZFGH 5MHSD 5CZXC 1CU4H 4HGWA 1IKFH 2CDGB 4OGAC 1PKOA 2F54D 3MJ8B 3I75A 1WGOA 2ERJB 4XH2B 4JFPA 1P7QD 2DQHL 4QXTB 4DEPB 3WFCL 2HP4A 3GMLA 4JKMA 1QNZL 3FFDB 5C8JB 1WZLA 2VXQH 1K4CA 1D9KB 4MZ2A 2R1WA 3HLAA 2AGJH 3JWDH 1MJ8H 1PZ5B 1UA6H 2FJGB 2WUCH 3PG2A 4Y89A 3B4NA 5CILH 1YEJL 1TCRB 4TULL 4X9FA 3BRFA 2F8VA 1KIRA 2A74B 4LCCC 4I77H 1INQA 1K8DB 4MCYA 5JO5A 2P43B 2RJMA 2C1PA 1BQLH 4HH9B 4XVTH 3ULUF 3N85H 1U8OB 1GHFL 1VFBB 4KY1H 4WWID 3RWCA 3RA7H 4BSVB 5KVGL 1N64L 2P8LA 3SCMA 1CFTA 5FHBL 2Z92B 2QQNH 1P4BL 3E6FA 1MHCA 4MXWL 1UH4A 4X9BA 3BKMH 3GI8L 4KI5D 5MENA 4A6YL 1C5DB 5INCA 2GK2A 3FFCB 3FT3B 2YKLH 4M1GH 2MWCA 4XHJC 5KN5A 5K9JH 2VLJA 5KVEH 1OTSC 1G1YA 2HJLA 2ZSVA 3TO4A 2GEEA 5BJTB 5SWZD 1DJSA 1CDUA 3T8XA 2NZ9D 4Z95L 2C4FT 5GS3A 2X6MA 5BJTA 4K8RD 3RVTC 4HC1H 5ETUA 3GSRB 4M3JA 5DXWA 4G8IA 5BO1H 3CCHB 1I8MA 4R6UA 1IRAY 3VXUE 4A2MA 2AK4D 3O4OB 3RTQD 4LF3B 2P5WE 1EERB 4KK8C 3MBEB 5HGGS 1AO7A 1NBZA 5DT1L 1DQJB 2PUQT 4Z18A 2HVKA 4HKJB 1KXVC 4DQOH 1IARB 3MA9L 5E2TH 1QO3A 2QSQA 3NCJL 4NO3B 3B6SB 4PV8A 4LCCB 2R4SL 3HAEB 2VIRB 3IGAB 3NTCL 4YHNB 2YRLA 3RGHA 1LD9A 4HPOH 4DKFL 2BJMH 3MLWH 1QP1A 5ANMA 5GPRA 1NBYA 1IAMA 4BFGA 2IALA 3NZ8A 5D96B 4HFWB 1IFHL 5SWQA 3V95A 5I2IA 5C3TA 1KUMA 5IG7B 2Y36L 5DC0A 1HHHB 5D5ME 3RJDA 1TCRA 2ERJC 2P7TA 3H9SE 2NY3B 2EE2A 4KMTL 1J86A 3DIFA 3KLAB 2EIZA 2EECA 3TLRA 5C6TH 2B4CH 4HEPG 4XMLH 3ECBA 2EE6A 1YECL 2F19L 1BQSA 3OGOE 5GQBA 1CGVA 1C7TA 4TVPL 1CLYL 4HW6A 4JFOB 4OFKA 2IQ9H 5FCUL 1PLGL 1O0VA 2UYLA 1FIEA 5IMMA 2YPLA 5D1XB 3U9UB 4KXZH 1CGSH 1FN4B 1LWRA 3L95A 3FMGH 2H45A 4OZHE 5EU6A 5HYJB 2GT9A 3DTXB 1SMOA 3AAZA 3WXWL 3O2DH 3F6IA 5FA4A 2A6DA 4P2CG 3T77A 3A0OA 1NBZB 1MVFA 3EYQC 3EDJA 1IGJA 3QPXH 5IFAL 1OP3H 5GGRY 2EO9A 3BRGC 4ERSH 1YPZF 3NABL 1RUAL 2YUZA 3FB6A 3ETBF 1CVRA 3ZSSA 3OKYA 3VXUD 5HDBE 1N0XL 1V3LA 1A8JH 3PGDB 1G9ML 4H20L 4ZXBB 3GFUA 3CSYA 3EHBC 4WHYG 1GOFA 4P4KC 3PQYA 5DJ0B 5EBGA 4I0KA 1KV3A 2YPKB 1BJMA 1UC6A 4UU9B 1G0XA 1KTLB 1CDCA 4FQ1L 2H6PB 5J57B 3LRGA 4XPTL 3VI3E 4OZGA 1S7SB 1SYVA 3HG1B 3GKZA 3O11A 4M7LT 1HSAB 1ZVSA 4KUZL 2DLGA 2EDTA 3GI8H 2IAMA 5KOVC 4WEBH 3K3QA 4PJ9A 5BO1L 5K59F 1A4KA 1CGTA 3B8YA 1VPOH 3CVHB 3GSUA 2JTDA 4AK1A 1N3NA 4WY7H 5EU3B 4PJAF 5T3ZH 1R3IH 2EH8L 2YD9A 3RPKA 4K7PL 4L3EB 5JPMA 1WEJH 4XNQA 5GS0L 4WI5A 1IGCL 4L4JA 5T33L 3MTRA 3WJLA 2DLTA 1N59B 1WBYA 2AJZA 4AH2A 3MBXL 5FUOL 2R0WL 5JW3H 1K6QL 2NY5L 4FTVE 4JLRA 5LWYL 2NTFB 4KI5E 5L88H 4D0CB 2NY6D 5F7FA 3B8SA 3BD5A 1R5WA 5KSBA 5GGVL 5EOQL 1X5IA 1X7QB 3DUUB 5CEZD 3GIZH 4LNRA 2RIKA 1A2YB 4DGYH 3MJ9A 2BVQA 1U8MA 2G5BA 5CUSH 5FYLH 1UH3A 1X5FA 2DWEB 5IB3A 1XAUA 4FQXC 5CILL 3ESVF 2NY4B 1DUYA 1MSPA 2EKSA 3MRRB 4RFOH 4QF1A 5DURB 4O2CA 3V5KB 5JMRA 3IAGC 1MCNA 4MHHG 2AGJL 1MNUL 4FA8A 4S1QL 1TPXC 3A67H 3CLEH 3KPSB 1U8QB 3TYGH 2VR4A 1NMAL 4JZOA 4PJ8B 1ZSDB 2D3VA 4GKNA 1R3HA 4K3DH 3UC0H 3WJJA 4CVWA 4U6YB 3MNVB 3D3VB 5KTEL 1Y18A 3S3JA 4N90D 1CXIA 1I75A 4H88H 1QSEE 5IFHH 3ARGC 2P45B 2A6DB 4OFYA 3MREA 5KSUA 5I76B 3D9AH 4IIQC 4O2CB 4WDIB 5ACMA 1I8IB 3U9PL 4X8XA 3FN9A 4WEMB 1MWAL 2YZ8A 4KK5C 4S1RH 1T2XA 5JXEC 1Z5LB 2YZ1A 1B4JH 2YD8A 2GK0A 4M48L 3EOAA 3KPNA 3OPZH 4P9ML 3RVVD 3UMTA 1XGQB 2FLBT 3WL9B 3VCLB 4JFHE 5F97E 3WNKA 4Z8FL 1AD0A 4LAJH 5DRXA 2V7NB 4I0PD 4PRHE 4MJIB 1CFQA 1S7WB 1ITCA 2DQCH 3RWJA 2VLKD 3BPOC 5E6ZA 1UQSB 2HFFA 2R69L 5L9DH 5EZLB 4O9HH 3QNYB 4HLZH 2EICA 3GSVB 5B39A 1U8HB 3QHZL 5F1NA 4TSCL 5DRWB 5DYOB 1QOKA 5EPMA 2AJ3A 1A7QL 3VRJA 5KVMC 3IYLW 3OKLB 2FCBA 2J1KA 2CO7B 2YPVL 4QHMA 3U0WL 3BPOB 3SE9L 5ESAB 2VTFA 3IU4L 3TZVB 4B7LA 5I74C 1NFDB 3QXWA 3QG7H 1X5LA 2IBBA 2OTUB 3GMRB 5GRZA 3TVMD 4HK0B 3GSXB 3GJFA 2VLLA 1TZHA 2DQUH 3MROA 4MA1C 4ODUB 5E9DA 1N0LA 1V7NL 1X7QA 5HHNA 2HFTA 2GIYA 3NZHH 3O9WA 3EGSB 12E8L 4NO5A 3VH8B 4APQB 3DECA 4JFEA 4DZBB 4ODHH 4R9HA 4PRHA 2XN9B 3B6SA 4PV8B 3OKMA 3BKYH 3SKOA 1MJUH 2ILLA 3BN9C 1KIPB 2EYTB 3IKKA 4PJGF 4JB9H 4GRMB 4I2XE 1QLFB 4M61A 4RBPK 2QQLH 5HI3D 1Z3GL 2BNQA 1PQZB 3LKOA 2VOTA 5AZEL 1CZ8H 4RGMC 5IHZA 5DYOA 2R23A 4JPIA 1U8IA 3MRQB 5TE4L 5J56B 2Z9TA 4J4PD 4RMVA 5EA0L 4U31A 2A6KB 4TRPL 2EDXA 1NJ9A 4KROB 5DFTA 3IU3A 5E9DE 3MNWB 3KNBB 3NPSB 5JLZB 3MGOB 1ODAA 1LK2B 1QRNA 1CFBA 1C12B 4DFHA 1LP9A 4K7PH 5T1MB 4KH2A 4I2XA 5C3LD 4ORGA 2NMSA 2HFEA 1IILE 4DAGL 3HI6H 4Y1AD 1J18A 2VITB 4MLSA 3MUZ1 3B2UC 5CBAB 1F4WH 4GXUN 3WLBB 1CXLA 1NFDF 5HD8D 1T3FB 4HIEB 2GFBA 3QXDB 3DX9A 3FO9B 4X8JB 2CIKB 3TIEA 4MNHB 4F57L 1RJYA 3O2WH 1NL0L 2H1PL 2HYMA 4WI3A 1WAAA 3FT2A 4QYOB 4U4BA 3WMSA 3QDJA 3P0YH 4PRIE 5C9JA 1DVFA 1KCVH 1NCWL 5DHYB 3KPLB 5HGBA 1VHPA 4OCWH 5HVFB 3CXDH 4W4OC 3NACH 4X6FA 1LK3L 3O3EA 1J1XL 3V0WH 1T1XB 1TITA 4NKMA 3MOAH 2R69H 1INEL 2CDEB 4MGXA 2ZZUT 1RHFA 2FRGP 4OD1L 5JOEA 4LKCA 1KN2H 5AD0B 5EN2A 3EYOB 2R0KH 3HNTH 3EYOA 5AZ2H 5IGXH 1ADQH 3MCKA 5HY9A 2XWJA 3TN0B 5HI4C 5DO2D 1RZ8A 4X7FC 1ZHKB 4L1DA 1XF2B 1CE6A 3C8KA 1EUUA 1S7QA 3S35H 4QRQA 1WIOA 1YEGL 4QHUA 4R8WL 4NN7C 1F3JB 3DRTB 1G0DA 3WSQH 2P5EE 4YHPB 3G9VA 2HVJB 4Z7VA 2FO4B 2YS4A 4KQ4L 4UIMB 2JB5L 3HZMB 4DVBB 4Z7UB 1R24B 2QHRH 4FG6C 4PG9B 3U0PA 3DMMD 4WW1B 5AG8A 3NGBB 3QXDA 2GFBB 3LQZA 3QSKB 1EX0A 4AM0B 2DOCA 2FWOB 8FABB 2ICWA 2B4CL 1OPGL 4XB7A 4QOKE 1FZMA 3ROOB 4IHOB 2ZSWB 4XTRC 4N0FA 3TA3D 4Y19A 1CD0A 3BT2H 2FDBP 4PGZA 4X6CA 5ITFA 1AQKH 3RKPA 3G5VA 4NJ9H 3UO1L 5F3BB 1NGWA 3LEYL 5C07E 5L6YH 2JIXB 1C5DA 3P0GB 1OP3K 5ACZA 3NTCH 4PRAB 3W0WD 4YEFA 5D71L 1M7DA 3C87A 5DGQA 2YPKA 3HI5L 2UZIL 1WVZA 3DUSB 4EUPG 2A77H 3S6CA 1BGXL 4FS0A 3SKMA 4V2BA 4ZUWB 1HKLH 2CDFA 3MA9H 3WIFA 1P5VA 4NO0B 5FYKU 1UWEL 4N5ED 4N8PA 5K9OA 1FFQA 4XCYA 4Q9QH 4Z0BL 1DDHB 1YQVH 5FO8A 5CCKH 5FKPB 4ZQKB 3U0TA 4JN2A 4KTYA 1WK0A 4LPWA 1UFUA 3WFZA 5DD3H 4G8GA 2DB8A 3MJ9L 4X6CE 1XZ0B 1DE4B 1QRND 1Q9KA 5T3ZD 1GH7A 1KJVA 4J3SA 1UVQB 3MQIA 5LGHH 2NY5C 4KJPC 2EH8H 2NZIA 3L95B 3VWKC 4M7LH 4IJ3C 4JRYB 5F96H 3BESR 4J2XA 3ARED 4N90E 2VDLH 4PRID 3B9KD 1FZMB 4HUKB 3VD4A 3K81A 3RY6A 3GSNL 1A3RH 1PSKL 3EOBB 3BDYH 2Y06L 2DQIH 2R0LL 5CCKL 5EO9A 5D9SB 4KUZH 4L29A 1YC7A 3NPZB 3CXHJ 1P2CB 2DQGH 4L8BB 4NKQB 4OCXL 1U42A 2AAVA 3MJ6A 4K94H 4LEOB 2I60L 5FHBH 3ZHLA 2JJSA 1AE6L 4HV8A 1KLFA 2FIRT 1YEIL 2GTWA 3Q6GH 1F6LL 2V5MA 4MNQE 1NUFA 4PS4L 5F1IA 3LN5B 3I9GL 4OQTA 1AGDA 3VRLF 3FO9A 1RAMA 1UB5A 1NBYB 3QZWG 2NXZB 2PKDA 3IB4A 4KKAC 3FQXA 5IVXF 4YXHL 4YBQD 4NJ9L 3GUTA 4MA7L 4GS7C 2LU3A 1CDIA 4NOBA 1BOYA 4Q6IB 2WIIB 4ZAKA 2NY3C 2ZUVA 1W0WB 2A1WH 2R1YB 3KYNA 2P8MA 1R6VA 5C07B 1Z9LA 5T1KB 1UVQA 1A1NB 1QR4A 4JQVC 2X4OB 2J88L 1J12A 1AO7B 4P2YA 3DHJA 1N6UA 2IMNA 1CD1A 3NFNA 3SGDI 4ZFGL 4OI8A 4Y4HD 3QEQB 3NPSC 3RWGB 4WVRA 4IJ3B 1SEBB 2H26A 4E41D 3CFBB 3ARTA 1U8QA 5CHNA 5CLTA 4E0RB 3ZLQC 1T04A 4Y4KB 3C08H 3PP4H 4Q9RH 5EZJB 3ILPA 4Z5RA 3T65A 5C6TL 4FQLH 3FAXA 1S3KH 5GXBB 3MNZB 1Y0LA 4JPVL 2VZSA 1A47A 2EDYA 3VDAA 2VZVA 5JNYA 2DWEA 4RNRB 5ERWA 2XICA 5FM8A 1Q0YL 4OIIH 1GPOL 4OKVA 4ZO9A 3ARWA 1KG0B 4H5SA 2PW1B 3GM8A 3MA7B 3MLWL 1W72B 1LQSR 2VWEE 4OZGE 4P4KA 3L3GA 3I6GB 3FKUS 2DLIA 2YBRB 3ZDZE 1KPUA 2G60L 3O2VH 4P59L 4LASL 5AYUL 4L8DB 3NCJH 3TYFA 3DX7A 3QHTC 3O3BA 4PBVC 3VXTA 3WIIL 3IAPA 3T0EA 4F7CA 4ETYA 1M7XA 4R4BA 5HHOD 1T6VN 1UACH 5M95B 15C8L 5IV2A 1YJDH 1MAMH 1I3RB 3BD3A 4ZNEA 4BKLB 3QEGL 5I1IH 4PRIB 3QEQD 5CINL 3OWEA 1ORSB 1KOAA 1Y6KR 4PJ9D 4UBDD 5TJWK 1EFXB 1FNLA 2JELH 1N7MH 4RMTA 1T0NA 3DURB 1XR8A 3K4ZA 3L3KA 4HQQH 2GJ6A 2R2EA 2W0FA 3BFOA 4WI7A 1AGCA 5I75B 5IBTL 2VQ1B 1A6TA 1A4JA 5C0BE 5K9JL 2ORBH 1AHWA 4Y5VC 3ZKNC 1A02N 3BRDA 3B2UD 3QULB 4LMQI 4RGNE 4OZFB 4HIXL 3MXWH 3C8HA 4LSSH 4UU9A 2UZYB 4Z7UF 4WDIA 3L3JB 2G75A 4GRLD 1NFDE 1HI6B 4OQTH 4M5YH 4KUCF 5HHOE 3HRZA 4FFVD 4LOUC 1B0WA 3A6OA 5FK9B 3IJHB 4HJGB 3BN3B 2G60H 1CT8B 4C56D 1MFBL 4XCFH 3V6FB 1I1FA 4J3VA 2IANA 3L3GB 1U95A 3H7LA 3OF6D 2IANB 4P9HC 1QRKA 3ZE2E 3VFNB 2A0LC 5GRYA 3PGCA 4U1KA 4YDIH 3MLRL 4WCYL 2EYSA 4K7FB 2KPNA 3JV6A 4KTDL 1G0YR 3K46A 1JBJA 3GHEH 4RNRA 5GJTL 4Y19D 3P4LA 4G6FD 5HYJA 5D1QB 1HHIA 3NZHL 1KTDA 4BZ2L 3WD5H 4KZEH 3MXWL 3C09C 3NCYS 4OM1L 1CIDA 2OJZL 3MYJA 2IPUK 4GAYA 3ZE1E 1EGJL 1LO4H 4HS8H 3T2NL 1JPTL 4QXUH 5I1AB 1WWCA 2B2XH 3IDNB 5CHNB 3D39A 5EUOE 2HTKD 2X09A 5I18H 4P2RE 5TGBB 4QKXB 3RWIB 3DXAE 3D5OF 5EZOH 5E8EA 1WIUA 1UCBL 2H32A 3VXOB 4P2RD 3D3VE 5AAWA 1MUJA 1CCZA 3MRBB 2A6KA 3G9AB 1S9KC 1JHKL 4GUPA 4QRRA 4NZUH 1FP5A 5DWUH 4KK9C 4NQDA 4U3HA 4NQCD 1KJ2B 3NMEA 2NCMA 4HEME 2YD7A 1WT5A 3NVQA 1I4FB 3KPSE 4YR6B 4LVOB 1MIEL 4JY6A 1TZIA 4IDJH 1YJDL 4Q0XH 3SDXF 4N0UE 5IF0A 1CGWA 1FVEB 1GL4B 2CXGA 2BVPA 3SE9H 5HDQL 5BZDA 2NY2D 4X6EA 2R2EB 3K7UA 3WHXB 1RIHL 5JR1H 4D8PA 4MS8D 5E99H 1CG9A 1H3UA 3MSPA 5E00B 1R5IB 3X11B 4JY4A 2DLEA 3NIDF 1FVDA 1RZ7L 2BNRA 4XX1G 3VWJC 1TFHA 3ARDC 1CLOH 2F74A 3I6KA 1X4XA 1BHGA 5DRZA 1SJHA 2ZUTA 1I9JH 3WFEL 3DO7A 5D5MF 2CH8A 3IFNL 1I1AB 5C86A 5D2NE 3JTTB 1RPQA 4YIQA 1Q0YH 1ZGLP 2B0SL 5EPMB 3H9SB 1I4FA 3CCHA 1I8MB 4L29B 1NAMA 1HYSD 2W9DH 4TTGA 2PCPB 4NKIH 3BH9A 3I3BA 3HZVB 5FXCH 1B90A 1NCDH 4ZTPH 4XPAL 3ULUD 5KS9A 1CDHA 3WNLA 1AGBB 1JFQH 1HINH 1U0QA 3Q48A 4Z7UE 1JK8B 2AVGA 3GNML 4C59B 4RAUB 4X7CC 5KSAA 3VFWA 3KYKH 2Y72A 5J3HD 2BNRE 3NBNA 4CU7A 1MPAL 4X5WA 1B6UA 1X5ZA 4W70A 4FZEL 2XZCH 4KPHL 1MFDH 3B5GA 3JVGA 4DCQA 2BNQE 3MLSL 2DDQH 4NN5B 1W0WA 5DD1L 2XI9A 4RGOH 5IW6B 4JHZA 4MJ6A 2ZPKH 4NFBA 4MQ7A 2Z8RA 2WWMD 5D7IB 2A38A 3SKMB 5KS9E 4NYLB 5LQBH 4MCYB 4L8SC 5C0AE 3VFSB 4I4WB 4PGBB 5BOPA 3VXQA 3SDCA 4QOKB 3PHOA 2IAND 3Q6GL 4MQSB 1D6EB 4LHUG 2FECI 1VA9A 1S5HB 5HPMA 3TO4D 2O26U 3T08A 35C8L 5I8KH 2EDOA 1K5NA 2MNUA 3DRTA 3TBVA 3WUWG 4HS3B 1LP9E 3SOBH 1D9KA 4IRJC 1K4CB 1NAKH 2P24B 1KB5B 4G8EA 4Y1AA 1A1OA 4PJ5D 3QUMB 3NAAL 4P5MA 3S34L 4WO4A 4J3UA 3L7EB 2Y06H 2VXSL 5AG9A 3C6LD 1J0HA 5EN2B 4KAQL 1GYAA 3O4LB 3IFNH 2Q1EA 1YYLL 2H8PB 1QEWB 3F8UB 3IDIA 1NCCH 5DMKA 3PWVB 1R24A 1YC8A 3RVXC 5E56A 1JZ6A 1A6VL 3UCRA 3H3KA 2E5EA 3CK0H 4NC1E 4NC0B 5FM5O 4LGPB 3O3EB 4MDIA 1IBGH 4MNQD 1HILB 2Z8VC 3GRWA 5DUPL 1OAYH 1A6WL 4E41B 2B8OT 4PJEF 5D2NB 4MDIB 5C0EA 1LO3L 4G8GB 4KKCC 1UG9A 3WE6B 1K2DB 1IGIH 3ZYOA 1AFVL 4HX1A 1RK0A 5EIIA 3U30C 3P77B 1FZJB 3WXVH 2HKHL 2BVOB 1KIQA 3CC5B 4M6AA 4ODTH 4DN4L 1A6ZA 4ONFL 3MV7B 4DTGH 2EDLA 1G6RL 3UYRL 5MENE 1VFUA 4FQ1H 5CJ8A 5DUBB 1MHHA 2ZSVB 3TO4B 4JRYA 4YHKL 3MODH 3S4SB 3L3OA 4WU5B 2W59A 1BEYL 1RZ7H 3L9RB 4WNQA 4PD4J 1LK3H 1BWMA 4O00A 4M93C 4JE4B 3SGEH 3W5NA 5E99L 5HYSA 5E6YA 1T66D 3FOMA 2Z93B 3IDXL 1JRHH 4MA3B 3R0NA 2QL1A 4HJJH 2YOCA 5ADOL 1RUAH 1KYOJ 3AS1A 3SDCD 2WW8A 1T5XA 4KHXH 3PWNA 1PKQE 1QFWH 2Q8AH 5KS9F 5LXGL 2QSVA 1QHPA 5C0BD 3LV3A 3K1KC 5FF6A 1UKQA 1BMGA 3OR6A 2QTEA 3L5HA 2HLFD 3ARUA 1F00I 3FB6B 2F53D 4R96B 1UCBH 4XBEL 3QYCA 2R2BA 3HKFA 2LVEA 4JRYE 1VACB 1LDPH 4NKDA 3UBXA 3D25A 1IC7L 3B9VA 5JXAH 5INCB 3MJGX 3O4LD 1OAUL 2Q86B 5BRZA 3MUHL 1F4XH 4U1SB 4YHMH 4YBHA 4K07A 4OQTL 4ODSH 2JJSC 4I48A 4WW2F 3MNWA 5FAAA 3RWEB 3WD5L 5H94B 3FO2A 5DUBA 5KAQG 4KROC 1RUQL 4JFDA 5EH1A 5JMOC 1A6ZB 4GRLC 2ID5A 2C1PB 5KG9A 5FM5M 3U1SL 5ACLA 5HGAB 4B5EA 2NW2B 1ZGLA 1NDMA 5TF0A 1SQ2N 1QBBA 2XZAH 1VKXB 4XNZC 5D2LA 1J1OH 4LCUB 4QLRA 3HZKA 1FBIL 4R7DB 4LEOA 3TBWA 1VERA 4LSQL 4X9HA 4JY5L 1NL0H 1Q72H 2H1PH 4ZDHA 3VFRB 1Q94B 1F3DJ 4XXDA 2H8PA 5I1EL 1PJ9A 1ZOXA 2CDGA 5IJKC 3O9WC 1P4IL 2LVCA 3VRLE 4CN6A 5I1EH 3L5IA 4OB5L 2FX8H 3WLWD 1DBKL 2VIRA 1PW3A 3C2AL 1JPGA 3D2UD 4HWEH 5SWZA 4YO0A 3MRLB 5L0QB 3MNZA 2C3XA 4PRPD 4N8VB 5HXMA 1DQJA 5E7BA 4H25B 3FN0H 4LF3A 3K2UL 2HN7A 5C6WH 5BXFB 4ZD3L 3BP7A 5E95B 1U3HB 1UXWB 1OLLA 1UCTA 3HZYB 5IQ7L 1SY6H 4N68A 4P4KD 1DBAL 2R4RH 5T5FL 5K9OB 3HZYA 1B0RB 2XPGB 2FD6H 2WWMC 4GMSL 1X3DA 3IF1A 4FQJL 3T8XB 1KC5L 2Q7YA 3HS0A 4V1DB 3WFBH 2QQKL 4XWOC 1MI5E 4Y4FA 5JQ6L 1WBXA 4GBXB 2XZQH 4UUJB 2J7LA 2DQHH 4HWBH 3VD9A 3QISA 1URLA 1RK1B 4OGYL 2X9YA 3ZKXB 5LJYH 3JUYA 4K8RL 1RZKL 1EEZB 2HH0H 1D5IL 3CU7A 3DXAD 3F5WB 1E4XH 4P9HL 1YY8B 1JGEB 3PXJA 1QLFA 4ENED 3PJSA 4LIQL 3UZEA 5CP7A 4D3CH 5D7IF 4JRWA 2RBLA 2DQEH 2Y7QA 4HPYH 1AGDB 4Y88A 2FSEB 4F3FA 5IVXB 4JPVH 3QIBB 2F54E 2RQ8A 3BEWB 3SGKA 5H37H 2VZ1A 3VWKA 4FN0A 5E8OB 5EU5A 2NX5D 4KRNA 4MJ5B 4XCCH 4YHYB 2HLFC 1IKFL 5IB3B 1CFVH 1X44A 5FGBC 5SWQB 3EHBD 1G7IB 3KPPA 3MLUH 3NCBB 5CJOH 4NN7B 5C0ND 4X0KA 5JPMB 3VXTB 1RSFA 5F8RC 5FYKD 1GCFA 4IRJA 5LGKA 4MX7B 4IOIA 3F7VB 4XHQA 2PO6C 1IAKA 3I85A 5E7FA 3ARFD 3I6GA 4OCXH 2CPCA 5GSVA 1VADB 4FZ8L 3WHXA 1A4KB 2A1WL 3PWPD 2VLLB 3WL9A 2HKHH 2P5ED 1HOCA 3B83A 3B43A 1QPPA 3KPNB 1BFOA 3LN4B 4K7PX 4P5KB 5T5NF 3CX5J 1H8OA 1JWSA 1MWAH 1YEHL 2VZ3A 4QHLB 2FX9H 5D1QD 1I8IA 1IAIH 4ELMF 4F7MB 1GXEA 3CNKA 4N0YH 4UTBH 2FB4H 3C8DA 1U91A 5CEYB 1PG7H 1BQHG 1IGMH 2C9AA 5TF1H 5E4EB 1YMMD 1IVLA 2AK4E 2C3HA 2I07B 1S5IH 1UH2A 4JR9L 1QSEA 2L4OA 4RA0C 5MHSE 4GRLB 2DQGL 25C8L 4K3EL 4MA8L 4NQEE 4PJ8A 2EDDA 4ZUTB 4PY7A 1N6VA 1XGQA 4EN3C 4GAGL 1CYGA 1JIBA 4L4VB 1KPVB 3KLHC 3HUJA 4ZS7H 3SJVD 4CNIA 1F11A 4BFBD 3F12A 4N8VA 2EYRB 4R4FH 1NDGB 3K74B 1RMFH 5FUCE 2Z91B 5D72H 1MQKL 4HS6A 1WITA 4HF5L 3O6ML 2R9HD 1NDGA 5GRJL 1TTUA 1MCIA 1H5BB 2K3TA 3ET9F 2JE8A 3PUCA 3P0VH 3MGTB 4MNQB 3BQUD 4AEIH 1ZTXL 4B0MM 2F58H 2J8HA 1H3WM 2HWZL 5J1AA 5HYJE 1BM3L 1K4DA 1ITBB 1IM3A 5MEOA 3MRJB 4GXVH 1EJOL 3SBWC 2P49B 3KPMB 1I8LC 1K6QH 3U83A 1G6RA 1RUQH 4LHUB 2X4OA 1IGYA 3MLYL 4WO4C 4DWHA 2GT9B 1JTOA 4JO3L 1U2CA 3N1PC 4AMKL 5F1SA 2XV6B 2X89A 4E41E 4JQVA 4NM4H 4MWFB 1JPFA 3MUY1 4GFTB 5AWNH 3V5HA 4WO4B 1MCOL 1OARL 4JG1L 3QNZA 4O4YH 2E6PA 1YEGH 2XKNB 1PG7X 4P2RA 1ZT1B 1QR1A 5HHNB 1MIMH 1U92A 2F5AH 4N0CD 4GAJH 4RMWA 1IFHH 1KEMH 1RJYB 5EBWB 4JPKL 3BGMB 3HE7C 4NHCH 1INEH 1WF5A 1YJDC 5J11B 3MV9B 1H5BC 2A6JB 1HYRC 1K4DB 2OP4H 3L6FB 1S8DB 2R8SH 4HMEA 4MJ6B 2X41A 2ZJSL 4FG6D 4IRZL 3S8WA 1S7WA 4K3JL 4NQXA 5IBLD 3VH8G 4ZO6A 2E7LC 4E42A 3BUTA 4NSKA 4J3WA 5KN5B 2Z91A 3RIFF 4ERSL 3TESA 3VXSE 3H9HA 5FOBA 3G6JB 3KWWA 5CP3A 4XVUC 4ZOBA 4AL8H 5HYQB 1T4KB 3M17B 1T0MB 1UB6A 4LSVH 2Q3ZA 2LTQC 3LEVL 2PW2A 4NNPL 2DD8L 1VACA 5IHUL 5E5MA 5K93A 1NPUA 4OD1H 4OLYL 1JUFA 3IETB 3MV9E 3VI3F 5I76A 2XOTA 1LO3H 1JHKH 3C5SA 3HR5B 4LNVA 2EIEA 1NGZA 5TDNB 3VXRD 4JG1H 4LLVB 3KJ4B 3OKKB 4TOYH 3VFPA 5DHVB 4WV1C 4L5FL 2GSIA 1T89A 1CDGA 3QCUL 1ES0B 4CUCA 5KVDH 2IQ9L 2JJVA 3DUSA 4PG9A 3I50L 1RK0B 2AJYH 2C1OA 3HPLA 5TQ2L 1KIRB 4OGZA 4U2ZA 4HS8L 1DN2A 1QSED 4X6DB 2XTJD 2PYEE 2VJXA 3MLYH 3T0DA 1KIPA 2EYTA 3T0XA 2D03L 1E4WL 3MC0A 3VXSD 4D9QD 3L3HA 4FRWA 1NEZA 4MD4A 1OD9A 4HIJB 4NWTL 1B0GB 4P3CH 4ODUA 5E9DB 5JIPA 4FXKA 3E1F1 2OTUA 1RD6A 2QQLL 2WK2A 4HIJA 4KKLD 1VGEH 4S2SB 2VUOA 4J1UB 4UAOB 2A74A 5C70A 4P23C 1RIUL 3LQAH 3BYYA 3CPLA 3QUZA 1WZMA 3RNKA 2JJTA 4XMKH 5HPMB 3TN0D 5DD1H 1IQWL 5GRXG 4NBYB 3FT2B 4QYOA 4WU7B 1IZKA 4PJ5A 1ZKAA 2ZOKA 1BIIB 1FLTX 3QG6A 4WO4D 4KTEH 2VSCA 2XXCB 2ZG3A 4RWHA 2HWZH 3KYKL 5IKCB 4FFYL 3QIBC 1ZTXH 2DQFB 1PG7L 1F5WA 4I48B 4JFXB 3BDXA 4GW5A 3FQRB 4MD5B 5EC2B 3VE0B 4W6YB 4KQ3H 4OQ1A 1U2HA 1NSNL 3B9EA 5HGBB 4R4FL 3RP1A 5DO2C 1S5HA 1FE8H 3HS0B 2Y07H 3UBXB 1GZPB 3RX5A 5BRZD 4NN6C 4HBCL 1BAFH 4I18B 2IQAB 2VLKE 2BSSB 3E0GA 4G6JH 4M5ZL 1Z0NA 3Q2CA 4NKOB 5BMFH 1ES0A 2FIKB 3VRIB 1U3HA 5JDSB 1I9JL 2MCG1 1XGTB 2WV3A 4JHWH 2OBGA 4PJIB 4NWUH 1FAIH 3FAWA 1CLOL 1CLZL 3S36L 1IGML 4XAKE 5TF1L 4YHZH 4OT1L 2V2XB 1CLZH 4YXLL 4M8VA 1GGIL 3BI9X 4S0SD 1RUPL 4P2OD 4CMHB 4U7SA 2KZWA 2DQCL 4LVEA 3VFGL 1JPGB 2FEDC 4TSAH 1OWWA 4Y7MA 4X5WB 4G7VH 1T2QH 3E6HB 5HHMB 1SYSA 4UQ2A 1A6AB 1A4JB 1A6TB 5MENB 5LVEA 3CDFA 4AEHL 2EC9U 3DNKA 3V4UL 3C5ZC 2ZNWA 43CAA 1MHCB 4K3GA 2R0ZH 2OLDA 3VFUB 2IG2H 3SKJL 1MLCB 4X7DC 5I1JL 4H1LH 1KT2B 5E8NB 4FQHA 3H8NA 3LS5L 1YNLL 1LEKB 3GGWB 4OCNC 5IROA 3MXVL 1W72L 4RGND 4ZFFB 2DM3A 2VZOA 3K8MA 4POYA 1M7IA 1FDLH 4NO2B 1YMMB 5JW4Q 3O6KL 1ZGLB 2PO6B 1KJMB 4P99A 3FFCD 2F15A 1ZA3A 2MQCA 3MRPB 1CK0L 2COQA 1PZ5A 1A64A 4JQIL 3FFCE 3KPRA 2R0ZL 3WFBL 1ORQB 4FQHB 4MAYA 5D2LE 5JHDB 3TNMA 2YPLE 5HI4D 2ARJB 3S5LG 4APQC 3SE8H 3RGVA 3G5XA 3TJEL 2P5EB 3EFDH 2JCCA 2DQEL 4HPYL 4EI6B 1NAMH 3VXPB 4KTDH 5DMJB 4ZD3H 3RX8A 4ZUVA 4LIQH 3GSNA 1Z6JT 2WUBL 3HMXH 3IGAA 5BZWB 4JFFA 4Z78B 5DSCA 4DGYL 5I30H 3IVKB 3DUHA 3B5HA 2HH0L 1EMTL 1BZ7B 4AT6B 2IADB 3C2SA 1HN1A 3UZQA 1Y0LB 2IH3A 2V5RA 4ZS6C 5E08L 5FA3B 3E2HB 4OLUH 4X6FB 2HT4D 1IT9L 1WCBB 2GUOB 4AIZB 3G6AB 4L4VA 4FQIH 4O02H 2WQRA 4LDLB 3QUYD 1XGUA 5T1LD 3ESUF 3U79A 3CVHH 2HFFB 1EHAA 2F5BL 5SWZE 4LP4A 3QNXA 1C1EL 4HAGA 1DBML 5IVXE 3ARDD 3WN5B 5HBBA 3QNXB 5IB2B 1SY6L 4ZSOA 2E8ZA 4MMXC 3RWHA 4RISH 1IGCH 5GS0H 1D5BA 2YWYA 5GS2H 3RZCB 2W0LA 5KVDL 3BGFB 1HXYA 3DYOA 2ZUQB 2GK0B 1G9EA 4LVNB 1MCSA 2AEQL 4TOYL 3RRQA 3B9KA 1JN6B 4ORZC 3BE1L 1TQBB 3BPCA 2R1YA 1QUNA 2X42A 3ARVA 5SWZB 3MZTA 5CZKA 5GGSB 2EYRA 4OM0H 5E2WH 4XB8A 1C8PA 1CICD 1U8MB 2G5BB 1AGEB 1MEXL 5L2KD 5EO0A 3FHAA 5IIEB 1LO5A 4WWKC 3CFCH 3WN5A 5I1LA 3QDGD 4IIQA 1OB1B 2FBJL 4XPTH 1RIVH 2I07A 3C60A 3FMGL 2AJSL 2AEIT 2EDEA 3MCLH 1VEPA 3QUZC 5J1SC 5CEYA 3QFJD 4F7EA 1AXSA 1FNEB 2HTKC 3G04A 3O9WD 4U0RC 2AJZB 1JMXA 1XR9A 3TGXA 3RGVD 1FBIH 1KB9J 4U0RB 1D5MA 1UJ3C 3FONB 3Q6FA 3WUZA 4P5KA 5ICYB 4HFWA 4DW2L 3VFOB 3UO1H 2F19H 2NX5B 4PJIE 1SJHB 2Z4QB 5D8JH 4H26A 1T83C 3GGWA 4UT7H 1LEKA 1ERNA 4EI5D 4TTDC 1DBJL 1X6NA 1MJ7L 1Q38A 4JFPB 1MIML 5FO7B 4XPFH 3V5HB 3RVWD 3VW3H 1IEAB 4JEGB 3GJFB 3FQNB 5BZDB 4PD4K 5ISZB 3MJ7B 3EJZC 1N59A 1WBYB 1MCCA 3PHQB 5DD6B 1FFRA 5HTSA 1GC1L 3KPPB 2NPLX 3PDOA 4C83B 4LGRB 2ATPA 1ZLWK 4IRSD 5IV2B 1RK1A 4Z6AT 5GSRA 4Y16A 3ORJA 3RL1A 5C08D 2AQ2A 4F7CB 5C0BA 5TQ0H 4U0QB 4R7NB 4NCC2 4NRZB 4DKEL 4QRRB 4K71B 1S7VA 3H3PL 1MCEA 2APTA 4XPFL 4YH6A 1WTGT 4QO1A 9CGTA 1MUJB 1BFTA 4YDVA 1T5WB 3C60B 4UILL 1A5FL 3DETD 1I7ZA 2YBRA 1YN7B 3QO0A 4URTB 4LSVL 5K9QG 1I3VA 1EDQA 2Y36H 1XF3B 2FJFA 1YUHB 4WIQA 5TPWL 1OF2A 3SY0A 1E27A 1JRHL 2I9LA 1IEBB 3G5ZA 3GHBH 4UTAL 1OAYL 1TETH 4WJ5B 3CJJA 4HH8A 5D1QA 3D39E 5EUOA 1FN4A 5CKGA 1KCVL 3VXUB 2ZUSA 4ZODA 1YQ2A 1P1ZA 5C0NC 1MHPL 1SJXA 3FO1A 3D3VA 3GB7A 3U46B 5I1HL 5L2JB 5B8CA 4ZUTA 1UB5B 4ODTL 3CFCL 3MLVH 3JTSA 5C71A 5J9PB 1QSEB 3ZKMC 2F5BH 5HGDB 3KPSA 3W5MA 3P4OA 5D5MB 3QXUA 3N1FC 4FOMA 1HH9A 3HE6C 5GZND 1AIFB 1BVKA 2FNBA 4N9OB 4F15B 2BVEA 4JM2A 2VDLL 5CGMA 4ZUSB 1KB5H 3ZYJA 3RL1B 1WISA 4PGDB 5C07A 5C09E 2FGWH 1T03H 1MCOH 4RFEA 4YXKL 4KZDL 1D9KC 2BRRH 4XH2A 1QLRA 3TN0A 2VZTA 3BWAA 4HZAA 4HKBA 2FEEL 1C08B 3DBXA 1WBZB 4C56B 1K3ZA 3DBXB 1W0VA 2VLMD 4W6XB 2NW3A 4Z7OE 4OZFH 3VWJB 5T3XE 3EYSL 4CMMB 1UJ3B 4AYFA 3RTQA 1N5YH 4JKWA 4TSBH 1QNZH 3WFCH 4NFDA 3C6LC 5C0AB 4KK6C 2V5TA 1QD0A 2NYYC 4EN3D 5TE4H 4G8GE 1BVKB 3VFOA 1FDLL 1CFNA 3MRBA 1FO0L 4R0LC 4D9QE 1DQTA 1KEGL 2B5IB 5I6XC 4L9LC 1I9EA 4R96A 1VEMA 4MDJA 1DQLH 3D69A 4X8JA 3ZT5A 4DN3H 4OUUA 5FGSA 2C3VB 5D93C 1UZ6F 2EXYC 3O4LE 4N5UA 2W91A 3BT2L 3Q5TA 2CUHA 1FFNB 4M9OA 2P4AB 1SJVA 1PD6A 1JZ7A 3C6SA 4DVRL 3QIWA 1GGTA 1HCFX 3R1GL 4DGIH 1PFCA 4MVBC 5HYIA 3ARGD 1TZGL 3T3PE 1I3GL 2X7LB 3ILQC 3TNNB 4CNIB 3ULUH 4X98A 4WI2A 1T21B 4MA8H 5HYQA 4RAVB 4XC3L 5HJ3A 4TVSa 3HPLB 1H15B 5F9OL 1GZQB 1RZJH 5EOTB 3SCMD 1F45A 1NQBA 2A9MH 3MXVH 5ETUB 4N1EA 1C5BH 3LIZH 5IFJB 4O9HL 1AI1L 3SCMB 3DVIA 5IFJA 4ZFZA 2D0HA 2E7HA 3U0PB 1EHLL 4QRPB 4QXWA 2DL9A 1JGUH 1NANI 4IDJL 2DS4A 4RAVA 5HJ3B 1FG2A 3DETC 1NCAL 4XPHH 4UAOC 3OV6A 4N1CA 1KN2L 3MOBH 4HIIA 3TZVC 5E0QA 3MLZL 5E8DH 1U3HC 1JZ2A 3CD4A 3BPLB 3L9RA 1VGKA 1EAJA 1RFDH 4H88L 2CKBB 5HHPB 4QXTA 2D31A 5FDWA 4ODXA 4ZUUA 2VDPL 5GS1A 4L4TB 3MJ8A 1A1MA 1H3XA 1T1ZB 3ARZA 3I02B 2Y9RT 3UROR 5E5UB 4J6RH 3O41B 1KJ2L 4LSUH 4PJ9C 1ZS8A 3QUKB 1YNKH 4P2QA 4P5MB 2OI9C 3T2NH 5ITBH 2I5YH 4PJ5B 1BAFL 2Z31A 3QO1B 3VFMA 5E1AB 5IMLA 3DVGB 2YC1B 1FE8L 4S1QH 1BQUA 1CFNB 5JIIA 1QBML 1G7QB 1XGPB 5ALBL 4BSWA 4HIHA 3PHOB 3MLRH 2FJHB 4UDTA 2FX7L 4MS8C 2EEAA 1RUMH 3OQ3B 4U6TA 1F13A 3QDMA 5D9SA 3WKMH 1N5AA 4YEEA 4U1HA 1GGBL 2XYCA 4Y2DC 1HQ4A 3OKOB 2FATH 3KVQA 5DJ6B 1YY8A 1PG7W 4MD0B 5B3JE 4YPJA 4PJGE 3RIAF 1J88A 1JVKA 4GBXD 4OZIB 4NKMB 1UWGL 5JHLL 2VR5A 4N8VG 2YK1L 3UPRA 5JHLH 4CBPA 4FNLL 5ILTH 5D7KE 4S1DC 3RZCA 4XP5H 3BIBX 1F4XL 1XT5A 1ZLVH 3P4MA 4IMKC 4QGTA 3H42H 5E6IC 3PWPB 1T22A 4W68A 1YPZE 1MRDH 5FKAB 5DI8A 2PTUA 2LE9A 4NOFA 3QCUH 1QFUH 4W4OA 1ZT4A 5T3ZL 5BV7L 2XWTA 2EC8A 3RIFK 1FL6A 4RIRB 1IKNC 4HDIA 5HI5D 3KDMA 3DYPA 1AO7D 4J12A 3ULVD 4NKOA 2G75B 2D03H 1KELL 32C2B 2VN7A 5GISL 2HA1A 1VFAB 3IS0X 2DQUL 2NNAB 1T89C 5JPNA 5HHVH 4Q6IA 1QKZL 5FHAH 5BZWA 2F54B 3SDDB 2RCSL 4JZNB 4IRSB 4LSUL 5HYJD 4XRCA 2ICWI 3THML 4I13B 5A16A 5CGYC 3DX8B 4AQ1B 3DOSA 4P59H 2HRLA 4U1LB 5KSBB 4KKAD 3TNMB 4WI8A 1NLBL 1JE6A 2DWDB 2DICA 1OP9A 4JGJA 1S7UA 2Z4QA 5CBEA 5KSBF 3ISWA 1EAPA 1J8HB 3RKDD 1JHLL 4KVCH 2JLLA 1HH6A 1G7MA 2DI8A 4PBWD 1YMHB 3BP5B 1JZ4A 2BY3A 5J13B 4Z8FH 1FYTD 3SE4C 1G7MB 3MFGB 4CJ1A 3VWKB 5ISZA 1TTFA 2EDFA 3LPGA 4PB0L 4V1DD 1ZT7A 2ADIB 3BSZH 1Y6MR 2N4IA 4ODSL 5D1ZA 1LILA 1N3NB 1VESA 2JCCF 2EDWA 3D18A 5DJZB 3OAUL 4RQQB 2K1MA 1C5BL 2EE9A 4L3EE 3AMKA 3C5JB 4M4RA 5KTEH 1CLYH 1L4IA 5DJDA 5DD5H 1WV7T 1NC4A 4GQ9L 3V0AC 3AUVA 3JWOC 3STLB 4OKVB 2IFFH 5F88B 1FQ9C 1BZ9B 2NNAA 3ZDXE 4OIIL 4XVJH 3V4VL 1PEZA 3OKDA 2UV3A 3CMGA 3TCLA 3UJIH 3UP1A 1DBJH 2EEDA 3T2PA 5EU5B 4PJBE 5ENWA 3GJEB 1EJOH 4U1KB 2BDNH 4NRYB 4MA7H 4Y4FD 1KTRL 3LD8C 3RVUD 1OOAA 4UMGA 1BVLB 1D5ZA 1OTSD 1TDQA 3WDIA 2ZUWA 2WP3O 5DK3A 4ZAKC 3W0WB 3CSPA 2DLFH 1MAKA 1WQVT 4L8SA 4GQPH 4PJDF 4N5EC 2YA2A 3GIZL 2KQMA 5F44A 5LQBL 5C0RH 2GHWB 1I1YB 1Q9WB 3R8BB 4Z7WF 3VGGA 4D0DA 3HE6B 4HF5H 1M71B 1IM9D 2YWZA 1ND0A 3KPOA 5EC2A 5DK0B 5FGRA 1M71A 1JN6A 4ZOCA 3HE6A 4J3TA 3V0VB 1TXKA 4ZAKB 1WBXB 4GBXA 2B4CC 4KKNA 2NY7H 3X3GH 1G6VK 1N26A 4EI5B 1NMBL 7FABL 4KPHH 2YR3A 4FZEH 2HJFB 3RWDA 2C7UB 25C8H 4K3EH 2NLJA 3HAEG 3BISA 5KSBE 3R06A 2VL5B 4QTIH 1TLKA 1Q0XL 4H1LG 5TDOB 1CR9H 3HC3H 5DJZA 2FHBA 5K33A 3A6CH 4HWNA 1T5WA 3BE1H 2CMRH 3F58L 3GNMH 4ZYKA 5J89A 1QVOA 5LGHL 1KB9K 2GYSA 1P6AB 3CLFH 1OLZA 3QB7C 3GSWB 1OAZH 5IW1B 5TFSL 1RMFL 1EFXD 1NGQH 2O5YH 3TWCH 4E9LA 4X80H 2UUDK 2C26A 5F3HA 2VXUH 3PGFH 5ID0A 2QADC 3HC4H 3QP3A 1TJGH 4PGEB 5LKNA 1UWEH 5I9QB 4MXWH 3NIGE 4EI6A 4Q6YA 3IXTA 1LMKA 5IVZB 4JR9H 4G7YL 4JRXB 1HKLL 4NC2B 4GS7B 3PWPE 1IQDA 3CLFL 1PYWA 2ED8A 1HSBB 1EMTH 1J0YA 3SO5A 4HS3A 1XH3B 1KG0A 4M1CC 1N0XH 1NFDA 5FYJE 4GBXC 4QCIB 3DJ9A 4I5BB 4QHMB 2E7BA 1YMMA 4X6BA 1DBBH 3BZFB 3GK8H 4Y8AA 4YHLL 5IW1A 4JAMB 3DVFA 3T0EB 3LH2H 5DQDH 1MJ8L 4NQDB 1IGYB 1NCTA 1U8HA 5JDJA 2VXQL 5I9QC 3FCTB 3RTQC 1KCRL 2DWDA 2GI7A 3BJLA 4S10A 4AEFA 1H0DA 3VGFA 5F9AC 2WP3T 3FTGB 3AB0B 4YJZL 1P4LB 1ZHBA 2HG5B 3RJQB 4ZPTB 4EDXB 4OZ4B 3VGEA 5EOTA 3JUZA 3SDAA 2MCPH 5I1DA 4NRXA 1TJHL 5J1AB 2OJEB 5JZ7C 2BRQA 1MJJA 1CFVL 2E7LA 3V0VA 2XKSA 4QXUL 4BUHA 5LBSH 3PDGA 5L8KB 3WSQL 4PJEE 4Z7VE 2ADFL 1I9RL 3ALWA 5FDYA 2MKWA 1OW0C 3CH1A 3MREB 5JXEA 1TCMA 2PYFA 3M45A 5CMAB 3Q3GA 4BZ2H 1YY9D 2QQQA 3LEXB 4I0PB 4AEHH 2HFGL 3JV6B 4NUJA 1QSVA 3STBA 1A7OL 3TT3H 5IGXL 1ZLUH 2Q6WB 2C3VA 5CIPA 2ZKHL 3BGMA 5F7EL 1AKJD 4PFEA 4Y19E 4MXVE 5DD5L 4Y4FC 3RVUC 2VLRD 1W0YT 3KPQA 4K8RH 2H2PD 2P5WB 2NXZC 1A7RL 1TVBB 5EO1B 1BZQK 2MJWA 2R39A 3OJDB 5D7LB 4LPXA 3TBSA 1D6VL 1PBYA 3TEUA 4KHTL 2BVQB 5GZOD 3UZVB 3BXNB 4M6OH 5CWSB 5GGUA 1JPFB 5SWSD 2Z8SA 1C08A 3REWA 1KTKE 1UYWL 3T2QA 4IOFC 3MRIA 3NH7L 4H8WL 3MRDA 5E2WL 3MRMA 3CFEA 4PGDA 4KWUA 3OB8A 5EO1A 3O45B 2DBLL 5CEZL 4JM2D 5TH2A 4LHUA 3LRSB 4JRYD 3CXDL 2D2OA 1FG2B 5HHXL 1DLFH 1DEEA 5F7HA 4PRPE 1F3RB 3C2AH 3OJMB 4L3AA 1G7PA 4K23L 2Z35A 4FHBD 1QZ1A 2YKLL 4GG6A 3REWB 3DGGB 3EOTL 1IGTA 2BCKB 3J8F7 4FNLH 1R3KB 5H8DA 4A6YH 5IVNA 4MMZC 4J7RA 4LLVA 4RGNC 1D6VH 1L7IH 3JV4B 3SGEI 4F3FB 4JY5H 4UIKH 5C0JB 3BH8A 5DC9B 3QH3A 4ZFOA 5AAMA 4EXKA 1IL1A 2H2SD 4EN3A 2HVKB 1DE4A 1I3UA 1QYGL 3MRHA 3PF2A 4PJXF 2OZ4L 5A43C 5C0CE 2IAMC 4KJWD 5I17B 1KGCD 2PTTB 4KK5D 3VXRB 4EJ1C 4RAUA 4LU5L 4YX2H 4NNXA 4WTXA 1JNJA 4XXCA 5A2IH 4UIKL 1IZJA 3JV4A 2X4QB 3RI5F 1D3CA 3OXRB 5ADPH 4GRWB 4P3DB 2QBWA 2W0PA 5F71A 3MV9A 3DMMB 3RUGB 4M43L 1IAIM 3QRGL 4JPIB 4PRAA 3GO1L 1WC7B 1YEEL 1CU4L 5FM4A 3LN4A 1U58B 5HHXH 3QQ3B 4M9PA 1LDPL 2ITDB 1Z3GH 4YPGB 3VGHA 3I6KB 3CU1A 3FQRA 1OCWH 5AUMA 2XN9A 4N0FB 1YNLH 2AV1B 1EFQA 3FTGA 3NH7H 4H8WH 5ECJE 3RQ3A 5J11C 4OFIA 1QPXA 5A2LH 4PGCB 1M4KA 3QEGH 5F1OB 4L9LB 1R3KA 3ZYIA 3OKOA 1HQ4B 1KIUA 2QSCH 4LKCB 1FZJA 1MRCL 1QLEL 4XP1H 4YLQT 1U8NA 1LO2L 5IMOA 1A7NL 2CDEA 3MLTB 4UIMA 5D7LD 3ARFC 5GS0C 4FTVA 3SO3C 4NP4H 5EU4A 1NFIA 3ZE1F 2HVJA 1T20B 5IBUG 3EYUH 4O58H 4DUWA 1J5OL 3RNKB 2A83B 1WFNA 4LDOB 4ZYKB 4TVPD 4X4MA 4C4KT 4JHBA 1CIUA 5MP6H 1RZ8B 4NUGH 4U6XA 4XNXL 5FYLD 1JF1A 3ULSA 5D70L 3I75B 1G7HB 2EE3A 5CZVH 4IRJD 5IJVA 4JZNA 3QUYB 5T1LB 4PGCA 4DGIL 1A3LH 1JGUL 3RGVC 1L6XA 3BDYL 4MD4B 4APQD 1FNGA 3HB3C 1KCLA 2VH5H 3TVMA 4Y1AB 1T1XA 5JUEL 3GMOB 3SOBL 3ALXA 4KQ3L 1A14L 2DJSA 3LAFA 1T7YA 4MAYD 3I3EA 2C3WA 3GBNL 3L5XL 3B5TA 4WUUD 1G9MC 3KGRA 3AU1B 1LE9A 4Z7QF 3QDJB 4GKOA 2D0GA 3S5LA 3IF1B 4ZPVB 5CEXA 3QDJD 5IBLC 3WS3A 3ULUL 5CEXB 1P9MC 2ZPKL 2HJFA 5C0AD 3BPLC 1A9EA 3IDGA 2UWEE 5L88L 1J0IA 1XGUB 2H41A 5E6IB 4JVWA 3B2VL 5JW3L 4PB9H 4D9RE 4EBQL 2OL3A 1BD2B 2DDQL 2PXYB 4L4VD 4D94A 5GIRB 1LEGA 3C5ZD 1LVEA 2OR9L 3TO4C 1BZ9A 2NXZD 2DIJA 4QRPD 5HHOB 5F70A 3U4EA 4JFFB 1N8ZA 2OSLA 3OX8A 4AY0A 4JFDE 4PJHF 3GUTB 4K9EL 1E4KC 1FNHA 3VXPA 1FPTH 3VXMA 2X9WA 3UXFA 1G7HA 1X5JA 2EO1A 2KKQA 5F7NC 4RGNB 2FGWL 3L3KB 2GSGB 2Z8WC 4HUNB 1RZJC 2VAAB 4ODWB 1I8KA 3IXTB 2F9BT 3GJEA 4KI5F 2E9JA 3CDCA 4WWKD 4ELKB 4PGEA 1U41A 4WEBL 4Y5YA 1G7QA 1H9VA 3QT2A 4OF5A 1T20A 3HUJE 3ZE2F 5IW3A 3QAZC 5CZVL 2H32H 3QUML 3HFML 2V17L 2V7HB 4HGKC 3TJHD 2D7OA 1XR9B 4PRDA 1HXMB 2EIBA 4CAGA 3I6LE 3W9EA 5F72S 5I0DA 4KKLC 4ODXB 4ZUUB 3ZTNH 1KNOA 1JNLH 2DQDH 2Y5TB 1CG9B 4WUUA 5DHXB 5BS0B 1DQML 1Z0MA 2ZUYA 1ZT7B 2ADIA 3VG0H 4DK6A 5EO0B 5BRZB 4G6KH 1BREA 4F37K 2QSCL 5AZ2L 3P4NB 4TUKH 4V1DE 3HPJA 5EBMB 3HG1A 3TFKC 2B0SH 4Q9QL 2DTSA 2XQYG 1GRWA 3O2DL 4HKXB 5GGVY 1OM3H 1DDHA 3KLSA 5FO8B 2JJTC 3DSNA 2I25N 5DMIL 1QRNE 2VLRB 2ICES 5B3NA 4L8DA 3LKQB 4XCNB 4BELD 1I7RA 2XFXA 3EO0A 5BS0E 4IIQB 1BVLA 1D5ZB 4HZLA 3TV3L 1JMZA 4LBEA 4PJBA 3SPVB 4BUGA 3PWNB 1X9QA 4PUBH 1LO2H 1QKZH 1RUKH 3FO1B 1R0AL 4I0PA 2XQYK 2NZ9C 2QR0B 5FA4B 5JNYB 3F62A 4XPGL 4FP8L 3HG1E 5TE6L 1ND0B 3KPOB 1MH5B 5C0JA 4UUJA 3H3PH 3F7RA 4KK8D 3BP4A 3RDTC 1OTUC 3HUJB 4OF6A 4DKEH 3LKPA 2EYSB 4K7FA 1PDKA 5DMGD 5DJ6A 5ESQB 3VU2A 4KJPD 3SPVA 3E8UL 2J6EH 3RGVB 5IP4A 1UADC 5GGRA 4C55A 2NY6B 2YXMA 1AQDA 2LABA 1ZHLB 3LY6A 1DLHB 3P40A 3VD5A 1QSFE 4LLWA 4R7NA 5TDPB 1IC4H 3MV9D 4TRPH 2BY0A 3LOWA 3N06B 3C8KB 2MQ0A 1UJ3A 4HJ0D 2FH8A 5CJXA 1BFOB 4OZHB 4XP6H 1MEXH 4YBLC 5IM7B 1QSZA 3QA3B 1SBBA 3DV4B 3C5ZA 4WFED 4XBGB 1EO8L 1FSKC 3RHWK 3VFTA 1YN6A 4EVNA 3BKCH 4PRHB 1FORL 1MCDA 3W11C 2X4PB 4OGXL 1T66C 4QXGL 3V6ZA 4PY8J 4JRXA 4AQOA 1ORQA 2WM0A 3VGBA 3H0TB 4PREB 5H35A 1FV1B 1MQKH 3MACH 3SDDD 1QBMH 3U2SB 3HE7A 1V7NH 3X12A 2XA8H 2Q8BL 1DBMH 5SV4A 1QSFA 3EAKA 1XGYL 5ISZD 2DMKA 2EDRA 5SX5K 3C9NA 2WWKO 2BSED 4HCRL 5JW5B 2NW2A 3WIIH 1HIMH 3LZFH 4ALAL 4JO4H 3O3BB 1A7QH 3AROA 5SWSE 1JTPA 3TYFB 4NDMA 4MQ7B 3RVVC 4TNVK 1CI5A 4Z95H 2VDPH 3O2VL 3ZKND 4DAGH 3U7WL 3QEHB 1N64H 3NFPA 5CLWA 1RZFH 3VXUA 1FORH 1NGYA 3CH1B 4I0PC 2PTTA 3VXRA 2XZAL 3T1FB 4I18C 3MMEB 3DI2B 5A40E 5C1MB 3MA7A 5KANI 2EXYD 2HJKA 2KDGA 4X83A 2PW1A 3WHE0 1HSAA 5EOCJ 1MOEA 2Z93A 5KSAC 3PL6B 4N8CH 1JI2A 1U8JB 1DQQA 2KUTA 2WANA 4KROD 3TBTA 4E5XA 3U48A 4NPYA 4JZJB 5I1DB 4PJXB 3C6SB 4L3CA 4YHOH 1U8KA 4YQXH 4ONHB 1BFVH 5D7JA 5I0ZA 4Z5RB 2DQFA 4DZ8B 3CFIC 2NY0D 5ANME 3T4YA 1A0QH 3WFHB 5E08H 3QPQC 2BCKA 1U8OA 3IFOB 5IQ9A 3D69B 1H3PH 4ZFOL 4I3RL 3QI9B 5DUML 3GJFK 3H9SA 4UDTB 4DUVA 5F7EH 4CRPA 3GSOB 1NMAH 2WLZA 3EFDL 5D2NA 3U2SA 3BKJH 2ICWJ 4OFYD 3SE8L 5INDA 2FLRT 4YBQC 5CJXC 1S3KL 3ES6B 3ARRA 1RHHB 3QNZB 4XVSH 5DMKB 1BX2A 4RMQA 4LL9A 3RY5A 4HXAL 2RFXB 5HI5C 5HVHC 1ADQA 3MV7A 3VXNB 5BQ7B 5C0DA 3O6KH 4PG2A 4M00A 1FGVH 4HAFA 5TE7L 4JKPL 4XX1E 2QADB 3W82A 1ZLSL 3TPKA 3QXAB 3O0RH 5FV2A 4YHZL 4U7MA 1SVCP 2CGRH 2BC4A 4NWUL 4LPYA 1EVTC 1JGVL 2QADD 5EG6C 5F9JB 4R0LA 3IRZA 4ONOA 2H3NA 5I1JH 3TA3A 3KPQB 2NY2C 1KCRH 3MOBL 2BC4B 3MBED 4YQXL 2VAJA 2YD5A 5IEKA 3MRMB 3ELAT 3EYSH 2YMXH 3OZ9H 3GKWH 5E1AA 3IJYA 5IMLB 4FQJH 3VFSA 3PWVA 1BQHA 2R0LH 3T0ED 5EOCH 2YD3A 4G7VL 3IFOA 1LO5B 1NGQL 2M26A 2X4TA 3FOLB 4ELMA 2VDOH 3GI9L 5I1CL 4R2GC 4KKBD 4NUJB 2RFXA 3RKDC 2VDKH 2DQDL 3MGTA 4MNQA 3HR5A 5J12B 1R3IL 5M7QA 4JREC 2P24A 4PRHD 3IETA 1GGYA 3BW9A 3JWDC 4C57C 1FNSL 5INDB 2EXWD 3W11D 2DIBA 4XI5C 3LRHA 4XZUB 2X1PA 3ZTJG 1F42A 4M03A 1NC2D 4PIRF 3QIWB 3HI1B 3VFNA 2DM7A 3RZCC 4MNHA 5KSAB 5I71B 1UKSA 2APFA 5DDHA 3UDWC 2EDHA 4QRTA 1A3RL 1PSKH 3QCTH 3NFPB 3WN5C 5ICXB 1JHTB 4NO0A 5IT2L 3I3DA 4GG6E 2JCCE 1P1ZB 3U6RA 5F96L 4C54A 4S1SH 2A6JA 4QXGH 1U6AH 5IK3B 1JUFB 1F2XK 3QFJE 4K9EH 4FFYH 2GCYA 1CS6A 2ZG2A 4FTVD 3TPUA 5I17A 3U7AA 1NEZG 1CE1L 1TJIL 1E27B 1FO0H 1YA5A 1NBQA 3OF6A 3ZKSD 3IDMA 2ESVA 5BW7A 3DUUA 2X4UA 4Y8DC 2XNAA 4Z0BH 2I27N 2AS5M 1RURL 4UV7L 3BUYB 4UINL 3S4SA 3EDDA 4Y19B 1P4LA 2O5XH 3IU3B 1IJ9A 3TFKD 4OF8A 4IHOA 3WNOA 2XXMB 4LSDA 1HDMA 4XMPH 3V7AG 4BSVA 4D9RD 1RIUH 3G08B 4HKBB 4UV4H 1UM6H 3BHBB 2QHRL 1I1AD 4KRPB 3MRQA 3QDMB 1VGEL 2F53E 4JKLA 1BJ8A 1E6OL 5DQJA 2ENYA 4NFCA 3UTZA 2X70B 4JCLA 1RZGB 5C0EB 3QFJA 3EYQD 3DXAB 3KJ6L 1DN0A 5TH2B 3KPSD 2CIIA 4LSRL 5DHVH 1DLHA 4XPBH 1X5AA 5DK2B 3STZB 1AC6A 2V9TA 4PLNC 1BECA 1HQRA 1HCVA 1BF8A 1UKTA 3MFFA 2CK0H 2OL3H 3OG4B 4RX4D 2N1KA 3OHXB 4FXGA 1CXEA 4PJ8D 4YDLC 2NY4D 2UY7A 1U3HD 2I9TA 5GRUL 4OUOA 1I9IH 4LKXB 5A3IC 4EI5A 4U1MB 2X1OA 4L4TA 4HJJL 4GQ9H 2JB5H 1P9MA 4S1DD 5SV3A 4Q97A 1KB5A 4G8EB 3QDAA 3OJDA 4OBSA 3NACL 1B2WH 5F7DB 4ZUSA 4QNPE 4HIIB 2DKMA 3THMH 1QVOB 4HWZA 3S35L 4CJ0A 4PB0H 4BK4A 1I9IL 4R90L 2AV7B 5I15L 4GAJL 4GRLA 4LCYA 3MBEC 4WWKB 2IQAA 1AFVH 2MMXA 1JHLH 1HE7A 4KVCL 5TDNA 4X5LA 2DRUA 4KI5C 3PWUB 1YPZA 4AIZA 4F9PA 3SDCC 5C0BB 1JNLL 2XTJE 5FGCB 3TBYA 3KHQA 4HS6B 1Y6NR 3T4AB 5ACZB 3DO3A 2EDQA 4NM8L 2K9UA 1T21A 3K4AA 2X89D 3FFCA 3FT3A 4NM4L 4X4ZA 1NCCL 5IKCA 3EDKA 1J8KA 4XWGL 1MY7A 3ARXA 5I19H 2R56H 1CDYA 3FOLA 4PJ7F 1WCQA 1S9YA 3O3DB 4JDZA 4WHYH 2GJ6B 1FL3A 1QQDB 1QA9B 5C9KA 1I7RB 4QWWC 3L7FA 4U6HB 4G42A 3TH2T 3V7AE 2YEZA 5T3XL 5ALCL 3OGCB 3RFZC 1XIWC 1EZVX 1MF2H 4WHDA 2GUOA 5JIHA 3DXAA 5FUZL 4WCYH 1BVZA 4WFEE 5JOFA 1JWSB 2YC1A 1KGCE 4DW2H 4HKZA 4FTVB 4Z7OF 4J1UA 3QIUD 1D5XB 1E6OH 2VWEC 2GITA 2WUBH 3HMXL 4PJ7E 4Z78A 2CLZA 1J8HA 3STLA 3FL7A 5AYQA 3EOBA 4F9LC 1FV1A 1U36A 1LE5B 5C07D 5B8CC 1MFEH 3NCMA 1HDMB 3HMXA 1I8KB 5EU3A 4ZO8A 5GS1B 5IVXA 5IT2H 3D18B 4U1LA 2NTFA 3QCTL 1RJCA 4HIXH 2OCFD 4LSSL 3JWNC 3MV8E 3ZDZF 4G6FB 1RURH 5JTWA 1CK0H 1K3IA 4JGUA 3WS6C 1CVSC 4P48A 5ERWB 1CZ8L 1D5XA 2Y6SC 2BNRD 5I73B 1YMHA 3BP5A 4CVXA 3MRCB 1F58H 1FNSH 5GIRA 4HQQL 1SJEB 1J0KA 4LVNC 5D7SL 3BD4A 4GKZB 4MYWB 4UTBL 2LFGA 3BEWA 5DFVD 4FQCH 4TNWF 4U6HA 5JUEH 3GSUB 3ARBA 4WFFD 3LDBC 4LLDB 2W9DL 4IOSD 1GGCH 3EDFA 4JVPA 3S37X 1UXWA 2VLJB 4LQFH 2D7MA 4AEEA 4MCZB 3ROLA 1T2QL 1BBJA 3F5WA 2CSPA 4PGJA 3M17A 3O11B 1A1NA 3E2HC 3T3MF 3ARQA 5D4QA 2QQNL 5EFIB 1JGVH 1KLGB 4P2OB 3D9AL 4J23A 5CSZB 4G8GD 1HZHH 4NIKB 1EIBA 1CGXA 1P6FA 5E2UL 3BIKB 3IVKA 1A21A 5KZCD 2KZ1B 4O2FB 1OF2B 5L9DL 2Q7YB 1JGDB 1FJ1B 1IAIL 1XF3A 1KCSL 3AXLB 4E0RA 2D7NA 3BOVA 3QIUA 4ZNCD 1BWWA 2MOVA 1V7ML 1D7FA 2DMCA 1BPVA 2ZCHL 4HUVA 1R3JA 4MAYB 4XVSL 4NRYA 4QRUB 4RMUA 1U91B 1WFOA 1NSNH 1U92B 4JQIH 3DIFB 4ENEC 3V5KA 3L3JA 5FGBA 5BOZG 4QOKD 3CFJB 2BNUB 4PLOB 4Q9CA 5IFHL 1IC1A 4GW1B 3F65A 4ZFFA 1OAQH 4YC2B 5DJXB 3O6FC 1LD9B 4MB3A 5DJXA 3B9DA 4HLZG 2YUXA 2GTZB 1OWRM 3BZDA 1VADA 1HHKA 2L7UA 3KLDA 3TYGL 1OQOA 4F7TB 2Y5TA 2NY5H 1WWAX 5A1AA 5GGSY 3R8QA 2CLVA 2GTWB 2VQTA 1YEFH 4Z0XA 1ACZA 2A0LD 2MTPA 2Q76A 2W07A 3KLAA 4HUXB 3TT1L 1U93B 3AY4A 1S78C 1Q9OB 3Q5YA 1DBBL 1DBAH 4Y4KC 4QHNB 5B3JF 3MRJA 1OT2A 4Y5XA 3KXFB 5CFHA 3FN0L 1D5IH 3CDGB 3QIUB 4GH7B 4KRMB 1RZKH 5FYKL 3OKKA 1CDBA 4Y4HA 1MFBH 5DZOA 4RMRA 3S36H 5IBUB 1ZVHA 3T4YB 4G80B 3PWJA 5DS8B 5CMAA 2LU7A 3CUPB 3LV3B 1U8KB 5DA4A 3CSGA 2R0WH 2E27H 3K4DA 5I1LB 3H9SD 4YHOL 3DRQA 4HHAA 1T80A 4Z77A 3LDBB 5CJBA 3TWCL 5D1XC 1UXSB 5I1HH 4JHAL 4O5LL 2VDMH 4NRXB 2R2BB 1ZLUK 5F89B 2H2SC 4HUMB 4NQXB 3QDGE 5GGTH 2OYPA 2A9NL 1G9NC 4Y4FB 1B88A 4OGXH 4UTAH 1KPRA 1P84J 3MNVA 2D7PA 4NDMB 4ONGL 3OJVC 1RJLB 1U3JA 1N4XH 1VPOL 5ICXA 1FRGH 4U6VH 5TPWH 1V5JA 3NABH 5DEGA 2OX5A 4GMTL 5T1DL 4F7MA 4PLKD 3EFFA 5GSRB 5C09A 5EBWA 3QPXL 3SE4A 1DEEB 3K8KA 3RZWA 1UXSA 3WV0A 1T0MA 1UB6B 1XIWD 3AFLA 2NY1B 4PJ8C 5DJAB 3WIHA 4Z77B 3G5VB 7CGTA 3GMPA 2HT3D 3ARSA 4P49A 1OGAA 3QXAA 1A7BA 1I85C 4AG4H 2VLJE 1CBVL 2UZIH 2C4FU 2X4PA 3O9WB 4D8PB 4G80A 4TPRL 1TETL 1S7RA 3O4LA 3UTOA 5IB4B 5F21B 4YUEH 4BQ8A 3VFVA 5GGUB 2X4TB 3PDDA 3RWCB 3VXNA 3GRWL 4PJAB 4PRNB 3E3QC 2Z35B 4X7SL 1Q94A 2VABA 3W39B 4GSDL 2BDNL 4U6XB 5I1GH 5I16A 1F02I 1F6FB 1UJTA 2VR9A 5MEQB 3TP4A 3EO9H 4JDTL 1VFOA 3PWLB 3CXHK 3SDYH 3TBVB 5T3XH 4O2EA 5C0IA 2AQ3A 2DQTL 4WENB 4NQDD 2P5WA 3V6OC 1AXSB 1FNEA 1P53A 1RZGA 5LAXB 5D8JL 1QFWM 1UQSA 4O4YL 3DVGA 3QXVA 1IC5H 4PUBL 5HGDA 4LPCA 5I19L 5DJ8B 3MCKB 5HY9B 4NYLA 2C7UA 5CWSA 3WFHA 4PV9A 4N0CC 5FDWB 4G3YL 4KI1A 4RFEB 1KJ3H 5IEHA 1JNNL 4HK3J 3DPBA 3WO4C 5DMYA 3T1WA 4DQOL 1LO0L 5DVLA 4KJQC 4P46A 2O5XL 2OXGA 1K5NB 1MJ7H 5J1TC 3SDYL 1SYSB 2ZOLA 2DTMH 5T1MA 43C9B 3MBEA 1MREL 5DQDL 3EO9L 2ZP0T 2ESVD 2R2HA 3H9HB 3D2UA 5FOBB 5DJCB 5CJQH 4RFNB 1OP5K 4EOWL 1YNTA 4PPTA 4PGBA 4YXHH 4JM2C 4DKFH 4NT6A 3PL6C 2W65B 2WWKT 3MUGB 4MAUL 3WLBA 4KV5F 3CIQA 1MCKA 1OGAD 1KFAH 2DI9A 1F8TL 4R26L 3J7HA 2OP4L 3BIAX 3DV6B 1A9BA 4HFUL 4K94L 2Z31D 1H15A 3GIVA 2HFEB 2IH1A 2XN9E 1LEIA 3UDWA 4XT1C 5H2BB 4QCIA 5EU6E 3HNSH 4YDKL 5C0GA 4BFEA 4Q9BA 2PYED 4MCZA 4JFED 4RFNC 4XGZA 3N9GH 1NC2B 1WAAF 5TFSH 1NGYB 5E00A 4GW4B 2ZSWA 5J4MA 3MFFB 35C8H 3H7BB 5I8KL 3ROOA 1G1CA 1ZVYA 3ZKMD 3BVNA 4ELMB 3MGAA 4MXQD 3TZVA 1G7JB 1FVEA 5E94A 1Q0XH 4X4YA 3PP3K 1WT5C 3SKNB 4NCDA 1KN4H 1NC4D 1RQ5A 5EOCL 3SKNA 5I8EA 5CEZE 4JO3H 5GS1C 1S7TB 2BOBA 3LRSA 4MJIE 1F90H 1HOCB 1EAPB 4FQ2H 2ICEB 2XQBL 5E6ID 3DROA 1P7KA 1VENA 1UWGH 3UTTD 2IANE 2E27L 1C16A 3U36A 3MV7D 4EKXA 2OMBA 3QUXC 2YSSB 3O8XC 1P4BH 5EU7E 5H94A 4LCWE 2XG5A 3UTTE 2AI0H 3EGSA 1XFPA 2MHAA 4NO5B 4APQA 4BFIA 2D7TL 1PZUB 5FCSH 3IDIB 2XWJB 1BGXH 1JZ8A 5K9QI 5FYKH 1XCTA 1V3KA 2Q86A 1ROWA 1RUML 4G43B 1PY4A 5EORL 4EEEA 1YEJH 1ZA6B 4MJ2A 1NKOA 4PBXA 3ZL4L 5D6CB 5M94B 4UDUB 3VA2C 3FZUC 3O6FA 3QIBD 3MRKA 4GAGH 3BJ91 3VRIA 2XPGA 2FSEA 1EHNA 4M7KL 3U0WH 2GJ6D 2IFFL 1KJ2H 2VISA 3OAYH 2ZG1A 4FFZH 3OAYK 1GZPA 1DVFC 5IR1A 3AVEA 1QHOA 4DGVH 1IL1B 2B1HL 3EYUL 1J5OH 1FNAA 2VDKL 4WJ5A 1OVZA 4TQEH 3UYOD 4HMCA 3W9DB 3ZZ1A 3AM8C 3KLHD 1SEQH 4UT6L 4G9FE 1UEYA 3EKCA 4YFDB 1JGLH 4S11A 1QG3A 1EHLH 1NCBL 5JQHC 3RL2B 4NQCB 3FN3A 2OI9B 3LVEA 3K2UH 1U3YA 3Q1SH 2B1HH 5D1ZB 3LKQA 3UBXI 3V0WL 5DJ2B 1GSMA 1MVUB 3GMNB 2G2RB 2PCPA 1O7SA 4OCRL 5F9OH 4JPWL 3IFPA 3V9FA 1AP2A 1KJMA 3KPRD 4QHLA 3LQMA 1FGVL 1HHHA 1TTGA 2NXYB 2OS7A 3T0BA 1ZA6A 5C7XL 3HRPA 3P11H 5CJ5A 3V5DB 1A6UL 4PJEA 3O2WL 3K80A <