4YH6A

Crystal structure of il1rapl1 ectodomain
Total Genus 52
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
52
sequence length
321
structure length
313
Chain Sequence
CTDWSVDIKKYQVLVGEPVRIKCALFYGYIRTNYSLAQSAGLSLMWYKSSGPGDFEEPIAFDGSRMSKEEDSIWFRPTLLQDSGLYACVIRNSTYCMKVSISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLEILWYKECRTKAWRPSIVFKRDTLLIKEVKEDDIGNYTCELKYGGFVVRRTTELTVTAPLTDKPPKLLYPMESKLTVQETQLGGSANLTCRAFFGYSVSPLIYWMKGEKFIEDLDENRVWESDIRILKEHLGEQEVSISLIVDSVEEGDLGNYSCYVENGNGRRHASVLLHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Interleukin-1 receptor accessory protein-like 1
publication title Mechanisms of splicing-dependent trans-synaptic adhesion by PTP delta-IL1RAPL1/IL-1RAcP for synaptic differentiation.
pubmed doi rcsb
source organism Mus musculus
total genus 52
structure length 313
sequence length 321
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00047 ig Immunoglobulin domain
A PF18452 Ig_6 Immunoglobulin domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yh6A03
2YEZB 2AXGB 4JKWA 1HKLH 3PHSA 3GSQB 2DD8L 3EDDA 4LRNL 1PJ9A 3DO3A 4M7JL 4A2MA 4QKXB 2CK0H 2BVOA 4O51B 5I1DA 2F9BT 2P8PA 3SDXB 1MCLA 2EXWC 4JFXA 1WISA 3RDTC 3FT4A 2NY3B 3LEVH 4K71C 3WLBB 3DTXA 3BN9D 4I1NB 4GW5A 4MDIA 2Z8RA 3B5GA 1ZVYA 4P2QE 2MHAB 1IGYA 4XCFH 4RMQA 3MUZ1 1ZLWH 2GAZB 1G9EA 1A7NH 3KDMB 3DGGA 4KKNA 4ZFGL 4RQQA 5BJTA 1A6UH 1ULVA 4EI6A 4JFEA 5C09D 3RZCD 4K8RL 4P5TC 3BDXA 1KLUA 4G3YL 4U3XA 1WFNA 1P1ZB 4OGXH 5BS0E 1XIWC 3BWAA 4MD0A 2XNAB 3H7LA 4OFIA 3BHBA 3LKQA 5DSCA 3VGGA 3V79C 5ANMA 4Y5XA 2QADC 4TTDC 3HS0B 5JIKA 1KNOB 2IH3B 3CK0L 1YMHB 3K46A 4HJ0C 4JO1L 5E95B 3PGFH 2WAHA 1U8IB 1ETZA 3I50H 5HHQA 2CO7B 4WI9A 5BRZD 3VRJA 4HHAA 3EO0B 3L3HA 4HS3A 4F15B 5DQ9B 2FR4B 1XGTA 2NZ9D 1S7RA 1M6OA 3ZTJG 2UWEF 4PJ7A 1A6AB 4G6KL 4I9WD 5IWLC 1R3JB 3PIQB 5FUZH 3T4AA 1R3IL 3LS5H 2NLJB 4X98A 4KTDL 3MV9A 1U95A 4W70A 4DN4H 1I1YB 3C6LC 4UOJA 3NIGE 1GCFA 1E28B 4M6AA 4YHKL 1QFWH 1DLHA 4AEEA 4PJ8A 4P2OD 4ODWB 2YSSB 1D9KC 1SJXA 1W2KT 1XR8B 1K4CB 3D0LB 4QWWD 4UU9A 4Z7UE 2UVFA 1ZHLB 3VFPA 1BBJB 5ILTL 3T2QA 1UADC 3CVHB 1KB5A 4C83A 5DRWB 5HY9B 1LNUA 1UM4H 2H8PB 2J8HA 2OI9B 3DBXB 3P40A 3ZDZE 1ES0A 4HJGA 4IIQB 4Z77A 4LQFH 2XQYK 1IT9L 5A40E 4QLRA 1KTDB 2L7JA 3WEXA 4JZOB 3I75A 5FO8A 3D25A 5IB3A 3MV9D 1RZ8A 1ACZA 5D6DA 1KB9J 4TUJB 1AXIB 3NBNA 2HKHH 5B38B 1HH9A 4R4FH 4XNUL 1G7JB 5EZIH 4BSWB 2H2SC 4L3EE 3ARFA 5BO1L 1AGBA 3RIFF 5SX4I 4WENB 3GMMB 3GNML 4WO4C 3SKNB 4D3CL 4R7DA 3MLSH 2PCPB 4WJ5B 3RVTD 4OZHA 5CEZE 4QRRD 4X6DB 3HI6L 4PJEA 3MREA 3B2VL 4BZ2L 1JL8A 3LIZH 2R2BB 2NY4B 4GKSB 3WBDA 2E5EA 1RK1B 3I85A 4J23A 4IS6A 1WC7B 1N5YH 5SV3A 5EIVA 1IGMH 3BP4A 4KRPB 4HLZG 3QP3A 5KAQF 4TSBL 1AGEB 3DNKA 3GK8H 2Z35A 4GLRI 1ZT1B 4YDLC 3T1FA 3EOBA 4I18B 2A74A 5FYKD 3JV0A 2V2XB 1VACB 4ZYKB 5DRNA 1BZ7B 3FCTB 2C1PA 3T1WA 4RBPK 5EWIL 1NFDA 2VL5A 1WICA 3DX9B 3QO0B 1TZHA 2YBRA 3BMVA 3T08A 1JTTA 1A2YA 1T7YA 3NCBB 1RUAH 3R1GH 4X4XB 3G9AB 4EN3B 4XCNB 3RWFB 1FNLA 2QQLL 5LCVL 4LFHG 4PS4H 5IB5A 3MYZA 3H2WA 5KSUA 3RVUC 4UDUB 3Q3GB 4AT6B 3B2UC 2GQHA 3SN6N 1YQVH 3B6SB 5IR1A 1QOKA 4DUWA 1YMMB 4Y5VC 1EEYA 4M7KL 4H1LH 5H94A 5TPWL 4M61A 1BM3L 3U0TA 2MCPH 4M1DL 4PTTB 3W82A 2XY2A 4LPUA 5E8DL 5JZ7D 4WUUA 3VDAA 4PJBA 5HHPB 5DMJB 1KCUH 2I26N 4S1QL 5GS0H 3LAFA 3U4BH 5LQBL 5JQ6H 2W0KA 5DC0A 2BMKB 5IB4A 3PHQA 1KEML 3L3IA 5DURB 4QHMB 5KOMC 2GJZB 1KG0B 4MLSA 3SY0A 4G43B 3TJEH 3D48R 2DI7A 4TSCH 4MQSB 3G5YA 3GSNB 1H15A 1KJ2B 4PP2A 1KB9K 4RFEB 5ESQB 5I1CH 3RNQA 3UDWC 2ZCKH 2Z93A 4QT5B 1KCRH 2VISB 8CGTA 1DVFA 5EN2B 2OQJA 5J0BA 3MC0A 4R3SB 4KK8C 1MIEL 4DUVA 3WFDH 1IFHH 3INUH 2YD4A 1BEYH 2OR9H 5GGQH 2QKIA 2AEQL 3F65A 5T3ZH 4G42B 4LEOB 4F3FB 4I0PB 5IFAL 5JHDE 1NGYB 4HX1B 1S3KH 5F21B 1NEUA 4NRZB 4DFHA 4OFDA 5IW1B 3WV0A 1X3DA 2YD5A 3L9RA 4JHWL 4JO2H 2EIBA 1MVFA 1ZLSL 1UYWL 1DVFD 5HYIA 1GXEA 2R1XB 2C1OA 3A6BL 1JI2A 4AEIH 5HPMB 4PUBL 5JTWA 2X4UA 3MBEC 1UWGL 3RU8L 4JFOB 1FGVL 4Z7WF 2XWBB 3W9EA 4PJCE 3VXUD 2OS7A 4Z76A 1J05B 3UTTA 3MNZA 1EUTA 5DFWH 2OJZH 1J12A 4LNRB 3B5HA 3T77B 4NM4H 2XA8H 2KL6A 1SJHA 2V2WA 1G6RL 3VWKC 2LVCA 2R0WH 1V3MA 5EBMB 4FXKA 2RB8A 4UTAH 3P11L 2ADFH 3TNNB 1F4AA 3IKKA 1W0WB 3P4MA 1OAXH 5EU6B 1YEIL 5F6HI 1LEIA 4IDJL 4EDXB 3MNVA 1JWUB 4WI2A 1F4HA 3MV7D 5IESL 4ELMF 5BZWB 3TWCH 2W9DL 1WJ3A 3BW9A 3PE9A 4U7KA 5FA3B 5C0JA 5KSBE 2V17H 1ITCA 1E27B 1NPUA 4OI9A 2YXFA 3HI1A 2RQ8A 5F88A 1MCKA 1J8HD 4XH2A 4WI4A 1V05A 5DJYB 1LDPH 1DBAL 5DK2A 3RI5F 2GFBB 3MRBA 3L7FB 1KACB 5E1AA 2LU7A 2VDPL 2A83A 4X4YB 5C0CA 1V7ML 1IJ9A 4HAFA 1NGWB 1UM5H 2ZCHH 2P5WD 4F7CB 3DVFA 4HT1L 4M62H 4CKVX 4ENEC 4ZNEA 1ZVHA 5K59F 2YOCA 5JW4R 5DDHB 3PGDA 1H3TA 2OX5A 3FB5A 5D5ME 1JPSH 4CW1B 4MA7H 2X9YA 1U92B 1WTLA 5D9SA 3LKOB 2ZOKB 3OKKB 4YO0A 1QTYT 4JY5H 4LSPL 4BFIA 7CGTA 2FGWH 1P7KA 5ISZE 4LF3B 4P3DA 5T1KA 2EDEA 5IT2H 1K8IB 3CXHJ 4TPRH 1OP3H 2ARJQ 4J12A 4Q6IC 1IKNC 1M05A 4PGBB 4HKJB 3KYKL 1X5JA 5GZNC 2X4SA 4J2XA 1HNGA 3MLTA 2QSVA 3HMWL 1NDMA 3TYFA 1MCOL 5CD5C 4PB0L 5D1QD 1F4YH 4I0CC 1JHLH 2BVOB 2JIXA 5H2BB 2P8PB 3FT2A 3OAUH 3OKDA 2NY0B 4J8RB 3MRLB 3WUWB 1ODAA 4NO5B 1QKZL 4JN1L 1IC1A 5HGHA 1FG2A 4ONGL 4X8XA 5T1KD 1ZLUH 4V1DA 4KDTA 2P49B 5F96L 2R1YB 2WIIA 1GGIH 4QYOA 4X9GA 4KI1A 2NY5C 3MLUH 3N0PB 3JV4A 2KH2B 3KYOA 2O5ZH 3UTZA 2VQUA 3MGAA 3BWAB 4OLWL 5DSCB 3RY4A 5MP6L 3U83A 4ZQKA 2IMMA 2JCCA 5D93B 1UKTA 4BKLB 3VG0H 3IFNH 4RGOL 3TCLB 3QEQA 1NGPL 1A7OL 2EKJA 5KVDL 1WVZA 4Z18A 4JDVB 1QFPA 1QPXA 4M9OA 5DMYA 4LARH 3ESVF 1KCLA 4V1DD 2JK5B 2BSED 5F3BA 2A73B 3OPZL 1JHKL 1JRHL 4RMUA 4ERSH 5J3HD 5B22A 3NFSH 3PWVA 3SGJC 1OQOA 1CE1L 1RJZA 3RGHA 1YEHH 3VFUA 5C86A 4X98B 3UJTH 3SQOH 4OCRH 5HD8C 2W65A 2F8OA 5MENB 4MXQC 5A2FA 3O6ML 5F6HJ 4G9DA 1MCFA 4YDIL 1MH5B 4M1GH 4OCWH 2APWA 3IGAB 1RAMA 5TDNA 3X3FL 3MLZH 1A22B 4H1LB 1NCWH 3L5WB 3IDNB 4HJGB 3BT2L 4Z77B 4F7TA 5IMMA 1FGNL 3ULSB 1YDPA 1U8JA 3C5ZD 2X5PA 5EO1B 2VQ1A 3QNYB 1JZ8A 4PG2C 4LDOB 1G7MB 1XF3A 1OTTD 5IK3A 1H8OA 4YDJB 5FA4A 2NX5E 3QG6A 1NCDH 5AG8A 4S1DD 5HHMD 4RFOL 4MAYD 5K9JH 1EK3A 3MRGA 4P5TB 5I17A 1HYSC 1CDIA 4OJFH 5DD6A 3CXHK 5DZLA 3BRFA 2WQRA 5CZXC 1OPGH 5GZOD 2IBGA 3I6KA 3TO4C 4X5XA 2X4QB 5IHZB 4PG9A 1MFCL 2WANA 4QRQA 2I07B 4JCMA 1P4BL 4ZXBC 1CT8A 2COQA 5C8JA 2HKFH 1LO5B 1QYGL 3HAEH 3MREB 4HPOH 2BFVH 3HZMB 4XNYL 4X6BA 1T83A 2WZPD 4FQHA 3ZKSD 4L5FL 4AG4H 4F9LC 2VJXA 1IGJB 3FQRA 5ESAA 1ADQL 1CFTA 1F3JB 1U8OA 1BD2E 3EBAA 4KV5E 3ZL4L 4Y2DD 3DURA 3D3VD 4Y16C 4NNYA 4OLZL 1OGAE 4JY4B 3TV3H 1NGZA 3RWIB 3WSQH 5E2WH 3E2HC 4KROD 1MHEA 5F9OH 3BVNA 4ODHH 3ULVF 5GRWA 3ULVC 4L8BA 4OD2A 3H0TA 3BAEH 1HIMH 5K93A 3CSGA 3REWA 5I1EH 2EZ0D 3D39E 1B9ZA 2E9BA 1I3UA 4MWFB 5TDPA 4OF0A 4XXCA 4XWOC 5C0DA 2C1PB 4U7MA 5D8JH 4KKCD 4Z78A 1P5VA 1BAFH 3VXPA 2VXQH 3IXAA 1E4WL 1IGTA 4RGND 3KHOA 3RGVD 2XZCH 1NC2B 2G60L 5I0ZA 5I1HH 1MVUB 4X6EA 5C0IB 4PRHD 2Q7NA 1C12B 5C3LD 1BOGB 5DR5H 1D5XA 5IB5B 3P77B 3H7BB 3TBVB 3VFSA 3BGFC 3BE1H 1GHFH 3ZHDA 1MI5A 3GMLA 5IR1B 5K9OA 4M6OL 4OGAD 5H94B 4G9FA 2RR3A 3U0TB 2W60A 1ZA6B 3QA3B 1RPQA 1S7QA 1AGCA 4WUUB 1FFRA 4PJBB 5DJ2A 2V2TA 2P8LA 1FC1A 3JTSA 2I5YH 4PRIB 3QDMD 3QUXB 4Y4FA 3L3IB 4KJYB 3RX7A 5CSBA 1X5ZA 1OQXA 3Q5OA 4PJHE 1Q9OA 4QXWA 5F3HB 43C9A 3G9VA 4JFQA 2DM2A 2ITDB 5EG6C 2P5ED 3JV6A 1BBDL 1CLCA 2AJ3A 1XCQB 3T04D 3DROA 2YPLE 2VE6B 2DIJA 5CKGA 1YY8B 4MD4A 3GM8A 1VPOL 3AAZB 1AFVH 1LGVA 1DR9A 3QUZB 4OV5A 4G9FD 4C56A 2NY6D 4N0UE 1QSEB 5FEBA 1EVUA 1S7VA 2Z9TA 3HPJB 3LKPB 1AXSB 2VKWA 3DX8B 5T33H 1BREA 4HMCA 1TZGH 3DRTB 4M03A 4ODUA 3TH4T 3H9HA 2XN9A 5HHXH 1YJDC 5I19L 3LN4A 5D7SL 3VDCA 3RWJA 3V6FA 4MJ5A 2AP2A 1KOAA 1AIFB 1D5IH 5SWZE 1CGTA 3G5VA 1JK8A 2KUTA 4WFHE 4JQXA 2G2RB 3MRFA 1LE5A 5IVXB 1K5NA 1S7XB 4LKXA 3MRCA 1CICB 4H26A 4PJGA 5JOFA 1H0DB 5LGJB 1IKFH 1MSPA 2A9ML 3HZYA 1MREL 2XN9D 4LOUD 2XICA 4E9LA 4JO4H 5L9DH 35C8L 4P2QA 1KGCD 1HQ4A 3FB7A 4M4PA 1O5DT 3QCTH 3U48A 2NMSA 1TIUA 2VLRB 3MFGB 1J1XL 4PJAA 4A6YH 4ZS7L 5ICZB 5IQ7L 1YC7A 1EJOL 4L1HA 3RRQA 1IC4H 1F6AA 2ICWI 1JWMB 2QR0A 3P4MB 4LMQE 4K3JL 3TH3T 4G7YL 3U7WH 3O2WH 3LPGA 1BQHB 1FZKA 1MJUL 1MWAL 3GBMH 2FL5B 1FNSH 4M6ML 3PQYE 2BSSA 2ZWLT 5F1NA 3IS0X 2XV6B 4K3EH 5F88B 3HRZA 2OZ4L 5I6XB 3PWPA 3R06B 5SWSE 5ALCH 4P2QD 4GQ9H 4QTIL 3VFWB 4YXKL 2GJ6E 3L95A 3MGOB 2VDOH 1YEFH 5E1AB 3BI9X 4ALAH 4IOFD 1HXMA 4URTB 5JXEA 5D1XA 3SE9L 4WV1C 3N1MC 2EYSB 4PLJC 2C5DC 1DQJB 4D9LH 3HLAA 5BS0D 4EDWL 2JB6B 4FQJL 4OD1H 2DQCL 4F7MA 4MGXA 4FQQA 4N9OB 1YECL 4BFIB 3C5JB 3OQ3B 5BW7A 2DIAA 1GVIA 3FO9B 1RIHL 3MBEB 4NUGH 5BQ7B 5FKPB 5I1LB 2IC2A 4UNVA 2Z91B 1I1AC 3NAAH 3DV4A 4HAGA 2HLAB 4U1GC 3EYUH 5A43C 2YD9A 4HPYH 5I30H 2YN3A 1S8DB 4JM4H 1A21A 2JLLA 1FIGH 2WBJC 3TGXA 2QHLA 1BVKB 2OMBA 3RKDC 3T0EE 2R69L 5CEXB 4L8CA 4GAJH 3FT2B 2RCSL 2BNRE 2MTPA 3CFKB 3C5SB 1NLBL 5GRYA 3TBTA 3PP4L 1PLGL 4KVCL 1I9JL 3HAEB 2WBWB 5C0GA 2HFFB 3T2NH 5MEOA 4FQ2H 1EEZB 4QRSB 4NP4L 2P47B 3KJ6L 2EDOA 1R5VA 4UIKL 4Z7QE 1DBBH 4C59B 5D1ZC 4TYUA 1T5WA 2GTZA 5FKAA 2DQTH 4FQXD 4HH8A 3KLAB 4CJ1A 5I9QC 5C0FA 3V52L 4X4ME 5IJVB 4PJ5E 4Y19A 5F7EL 4P59H 4KJQC 2ZCLH 5CHNA 4LEXL 1FL3B 3U46B 3B3IA 4L3ED 4Q9RL 3NA9H 3O3AA 3I9GL 3P4OB 4GUPA 1BF2A 3IXTB 2C3HA 4D0BA 2ZG2A 3R8QA 4IJ3B 4XZUB 5ERWB 5DJ0A 1RZKC 1T7VA 3V9FA 1KJ3H 3OX8A 4S2SB 1AO7A 3O2DL 5D7LE 5CEZD 1H3VA 3ARPA 3HMXH 3GI8H 4U1MB 2ENYA 2KBGA 3VFRB 3T0WA 4H5SA 4ONFH 1AI1H 3OL2A 1L4IA 2XG4A 1YJDH 3P3YA 4FNLH 4MQ7A 3V0WH 2HT4D 4YJZL 2D7OA 2ICWJ 3QRFM 1EEQA 1U8HA 3WDJA 4P49A 3KPPA 5E9DE 4R7NB 1YN6B 4O00A 5HI4D 4JAMA 2NY7L 4ZPVA 4FQCH 1CBVH 5LVEA 2W92A 1OT1A 5E2VL 3KS0H 5I66B 2I9TB 3GGWB 1G0YR 4YQXH 3QFJB 3MRDA 5IK3B 3QG6B 3V6ZA 3HI5L 4X0KB 1MUJB 4DVRH 4JRXB 2YK1L 2VDRH 4OM1L 3KLDA 4OCSL 1SMAA 4Z0XA 1GSMA 3BN9C 1MFBL 2ZUYA 5CJQH 3PWNB 4KGJA 4YFDB 3DVGB 3OZ9H 1DL7L 2FJFB 4OLYL 3RZCC 1CDYA 4QHNA 4JVPA 1W72H 1HINL 3RL1B 1FV1A 4PBWD 3AXLB 4FZEL 5HYJB 1OP9A 1WBYB 1CFNB 4LLUB 4JCLA 4KK5D 2BSRB 5HVGB 4OZGB 1U8OB 2WUBH 4PJXE 2C4FU 5INCB 3GDBA 5TE4H 3VRIA 1MHCB 5I8EA 4LSUH 3RZWA 5FM4A 3WXWH 4EUPH 2FB4H 4LCUB 3CC5B 3IT8D 4UT7L 2B1HH 5JHDA 3FONB 2RHEA 2NZ9C 3MLRL 4ISVA 1CFQA 5K33A 1DN0A 3NTCH 4PYGA 4AIOA 3OJDB 5B3JF 3QIBA 1KCVH 4MNGA 2D7PA 3QQ4B 5E70A 2O5XL 1MHPH 1T2QL 4B0MM 5GJSH 5IROA 3WJJC 2ADGB 2X09A 2ZUWA 3UYRL 4YPJA 3MJ8A 4K2UL 2EEDA 3QULB 5TQ0L 2FBOJ 1WFUA 3CSYA 3IXAB 4ZNCD 4AH2A 4P2OC 2DM4A 5EO9B 4A6YB 2JKXA 6CGTA 2G5RA 3SJVA 1WWAX 5E56A 1VERA 2ED8A 4F7PA 3BP7A 3JUZA 3VDBA 2HFGH 3TO2A 4FRWA 4ODVH 2X10A 4YGVB 3IDJA 3L5JA 5ABDE 1YEGL 5LGHL 1Y6KR 4PJ7F 1K6QL 4G8GB 2DDQH 1L9MA 1OAUL 4TUOB 2UZIH 4XCCL 4XTRD 5EUOA 1RHHB 1N8ZB 5D2LE 3RPKA 2Q6WB 4P4RB 4JR9L 4NHCL 2JJSC 5JO5B 2Z92B 3DX6A 1D7FA 4JZNB 1RVFL 5BV7C 3I6LE 1XR9B 5DJ2B 4OZFA 3C8KA 3BJ91 5KSBA 2BJML 2ZP0T 1DEDA 5FHAH 1PG7H 5CSZB 1V3JA 4LLMA 3SHSA 1R0AL 1F5WA 2IALB 2FBJH 1Q9OB 2FO1A 2XQBL 3CFDB 1A6WL 1FZMB 1CCZA 3QNZB 1W0VA 4HK3J 3U7AA 3K2UL 1Y6NR 5L2JB 3RWEB 5J8OA 3NPSC 5HHVL 4Y16B 3MYJB 5KBNC 1HHGA 5D70H 3S6CA 3TN0A 5IV2A 3IDIA 1L7IL 4PFEA 1HWGB 3E2HB 4YZFF 3FQUA 4LVNC 1JYXA 4R9HA 3RAJH 5C0EA 3BEVA 3OGCA 5E6IA 1UQSB 2VNCA 1MCSA 3VXMB 3TBSA 4R96B 5GS2H 4AENB 2OTUB 1IE5A 1RMFH 4HG4K 1WEJH 5HGDB 4BQCA 3KYAA 1G1CA 3OAZH 3KXFB 3HNSL 3W81A 5DXWA 3CPLA 3O6KH 1EBAA 1KTLA 1JK8B 1U8KB 4NDMB 3CD4A 1MCCA 5IOPB 5FGBC 3PGCB 4PJEF 5KSVA 1LE5B 4NO3A 3TN0D 1MCPH 3PDGA 3DSFL 4QCIA 5C0BE 3LEYL 4Z0BL 1ROWA 3Q1SL 4U0QB 4PJGB 2B7DT 3BGFB 5T1LD 4EKXA 3OR7B 3VFNA 4LSQH 3EYSL 2E9JA 5DHXB 1G6RA 5J4MA 5J9PA 1A3QA 2JTDA 2V7NB 5ISZD 3G04B 4L4VA 3MOBL 2EDBA 4P5KA 4NHUB 3OKMA 5GS1C 2X4NB 1DJSA 4HWBH 1FORL 2MWCA 3U4AA 3HE6D 4BM7A 4HWZA 1CZ8L 4XBPB 2JF1A 4KPHH 4DK3A 3EFFB 1JTPA 4XC1L 4G6FD 1CGSH 4JRYE 1J5OH 1AQKL 2J6EH 1T7XA 1G9MH 3CCHB 1NFDF 3WD5H 2NTFB 5IB2A 2R2HB 3TLRA 5JZ7C 1MJ7H 4QY8A 4XC3L 4JFDE 1T03H 4ODXB 5F1NB 3X11A 4K9EH 3ZE2F 2VLKB 3ZKXC 5SV4A 4GAGL 5HPOA 3ZKMC 4ZUSB 4KFZC 1Z3GH 1Q9WB 2D7TH 4PJFB 1ZXQA 2NY1B 2CDFB 1IGIL 2HRPL 4N68A 1G7IB 3K1KC 2D4DA 1HCFX 1N2RA 3B9VA 4R4BA 5I8OH 3S5LB 1ZVSA 5DYOB 3H9SB 1CIDA 3KPSB 5DRZA 4JQVA 1NBQA 1SY6H 3CFEA 1K8DB 2BY3A 3IS1X 2R4RH 1MY5A 3FQXB 2YD3A 3WIIH 1FVEB 1I7ZA 3UBXA 3OGOE 1JF1A 4YXLH 3MLWL 1IAII 2AAVA 4RCAA 2EDFA 4WW2A 5T1MB 4EZMA 3F12A 4QOKB 2BVQA 3MLVL 5DJ8A 1S78D 4U1NA 3MUHL 2PO6A 1UXSB 4F2MA 3KNBB 2R0KL 5FCUL 4NNPL 4KUCD 5CWSA 2DLFL 5J12C 3N9GH 4KMTH 1EERB 2LFGA 1E4XL 5IBLD 3VG9B 3AREB 3KPRE 2Y06L 3VXRE 1DVFC 1F4XL 1FAKT 3DHJA 4UV4L 1RZFH 1IEBB 3O8XA 5IM7B 1FVCA 3SO5A 4MCZB 4G8EB 2FSEA 1U8MB 1MCIA 3MUGB 3VW3H 1YEKH 2LTQC 5B39B 2GITB 4X80H 5CILH 1A1MA 1QA9B 2FX9L 5F8QC 1W72B 3X13A 1NLDL 1EGJH 2B8OT 5AD0B 2ADJA 1HSAA 3QISA 3VXOA 3V5KA 4O9HL 5BV7H 4HCRH 3SO3C 5JR1L 3EGSB 2W9EL 4APQA 4JM2B 3O8XD 1QRNE 5CJ5A 1MJ8H 2YA1A 2NX5D 3ULUE 4EUPB 3BQUD 4YHPA 5F9WC 1IM3A 3EOTL 1XF4A 1OY3B 5D2NA 4OCYH 3NCMA 3RPIB 2A9NH 4HV8A 1BX2A 2AQ2A 2XZQL 5ADOH 1OGAA 3P0GB 1WBXA 3MA7A 3DPBA 2R2EB 3OHXA 4HZLB 1JGDB 3QWOB 3UMTA 3D18B 4JFYA 1C5BH 4GRLD 4M8QA 4H5SB 4XPFH 4UT6L 1A9EB 1GC1C 3ARXA 1UWXH 1OLZA 1E6JL 1XZ0B 5DGRA 5GJTL 4NOBA 3QUMH 4PYHA 5CIPA 1I1AB 4DEPC 1EHXA 2BX5A 4U1GB 3DLQR 3BP6B 1NANH 4GW1B 5D7JA 1BD2D 3TJHD 5IW6B 3DYMA 3BO8A 2EO9A 5DI8B 4LCWA 1RSFA 5FYKH 1OGAD 3ARDD 3BFOA 4MCYB 4P46A 4P4KA 5HVHC 3DETD 4NKDB 4OT1L 5DJ6A 5DJDA 3P4LA 4E41B 3MLXL 5FUCE 1HSBB 3HNTH 3UO1L 5DLML 4X7SL 2PXYD 3D39D 1WF5A 1WV7T 1Q94A 3C60D 1Z5LA 4NZJA 3D85A 3MRPB 3DIFB 1GOHA 5D1QC 3SPVA 1EEUA 1NSNH 5L8LB 3KJ4C 4X5WB 2YA0A 3VXTA 4XGZB 3MROB 3W39A 1ZLVH 1RUMH 3IF1A 5D1ZB 3UZQA 1S9WA 4Z0XB 3U6RB 4OSUL 4NN5B 5E5MB 1OSZB 4JLRA 4P4KD 3BGMB 5I2IB 4PJHA 3MCLL 5I9QB 5C9JA 4R97B 2VZUA 3RWCB 1FJ1A 1HHIA 3QUYD 4MYWB 3EFDL 2Q8AL 2YPLA 4Y4KD 1KC5H 3EOYG 3UXFA 4NO2B 3I2CL 1I7UB 3UJIH 4ZTPH 4NRYA 3VI4F 3ARTA 1ADQA 4BZ1L 3DHMA 1CL7H 2CMRH 4LAQH 2XI9A 3FOMA 5AZEH 2W1NA 4MXWH 1EO8H 4LSSH 7FABH 4ONOA 5C07E 3VXSA 4UUJB 5DUPH 4FA8A 5TDOB 4L8DA 1NCCL 4LCIL 1ZHKA 4O5LL 3RVWD 1GIGL 2YMXL 1MNUH 5J11C 1INEH 5EZLB 3T09A 3G6DL 1VGKA 1VENA 3TBYA 5MHSE 3MRHB 5DVNA 2E7MA 3L3KA 2DYPD 2YPLD 5EUKB 3WNPA 5KVMC 4AMKH 1TJHH 4NZUH 3SKOA 1AQDB 2D9QB 4XP9L 2VOTA 4LVHC 2BXZA 4HUWB 4W81A 5HYQA 4JG1L 2P24B 1WWBX 4QF1B 1QEWA 4J4PA 1FAIL 3MACL 3IDXH 4EXKA 4ZUWA 3KYMA 1OF2A 4Z7OF 2ARJB 1P6FA 2UUDH 1JFQH 2CD0A 1H3UA 3DUUA 4DCQA 2XKUA 4JPVL 4R90L 4U6VH 2BY0A 2P8MB 1XF2B 1ZSDB 5F9DC 1OCWL 1I4FB 2WWMC 1UKSA 4PJIB 2WNGA 3TVMD 2HFEB 1OGTB 1PYWB 4UILL 3FO0L 1U8QA 5HYSG 1VFAA 5KTEH 5SWZD 4O02H 5BVJA 4KKBD 1JMXA 3C5ZC 4WFHD 2EH8L 4AM0B 1KFAH 1XMWA 1QBMH 2XXMB 3STZB 1NJ9B 1J1PH 1HQRA 1P4IH 2BERA 1Q9KB 3GUTB 1OTTC 1FFPB 5INDB 3ZYIA 2H3NA 5IMKA 4XMKH 3EAKA 4MAYC 4OZFB 5E8OA 3GSVA 3S35X 5C09B 1KIRB 2V5SA 3D0VB 4GMSH 2FX7H 3HUJF 4IOIB 3F7PC 1S5HA 1ND0B 2AI0H 3P0YH 4PGEB 5E5UB 3NCJH 4EIZC 5CZVH 3HG1E 5GZOC 2Y72A 1F42A 4LIQH 1FZJA 4XP6L 1A4JB 2GJ6A 4BK5A 1GZQA 5K9QI 1SJEB 2NW2B 4OZIE 3FN3A 4LCYA 1ORSB 1PG7W 2E6JA 5BRZB 4PJDF 4IMKA 2NXZD 4LVOB 2PTUA 2NR6D 3EO9L 5ACZB 3SKUD 5J56B 3DRQA 1AKJD 5GS3A 2ICCA 1CQYA 2WINA 1MF2H 4YPGA 4XWGH 3PQYD 5D6CA 5C1MB 5HTSA 2B5IB 4Y2DC 5ID0B 1R6VA 4ZFOB 3SDDD 5SWSD 4LQ1A 4I3RL 1GZPA 1ZE3C 3TF7C 3O6FD 4KROC 4ZFZB 3K4ZA 4ORGA 5DD5L 3O81A 4L4TE 2VXTH 4FP8L 4P23D 2E27L 3DVNA 1GC1H 2VN4A 1BFOA 2E7CA 5D72L 4X8JB 1A1NB 1OSPH 1KXQE 2Z31D 2EZ0C 1I3GL 2R15A 5DHYB 1I75A 4NYLB 1VADB 1S5IH 3E6HA 5ACMA 2VLLB 4KKCC 3PWLA 3G6JE 4NC1E 1N3NB 2BNQD 4P5MB 4RGNC 4Z7NE 5GIRA 3T0EA 3BKCH 3RGVC 5GHWL 1MQ8A 2BNRA 2EDTA 1UXWB 4RBPH 3V0VA 1LP9E 1M7DA 1CDUA 3MFFA 3W9DB 3MRMA 4U6YB 2QQKH 1R5IB 4KRMB 4HK0B 3FTGA 2P4AB 4BELD 1CE6B 3LRGA 3MV8E 1WAAA 4HLZH 4JB9L 3CVHL 4B50A 4RISL 1MFNA 4PRAA 2CDGA 4D8PA 1MWAA 4OGAC 4RNRA 4JN2B 4LCCC 4XXCC 4QXUL 25C8H 5EU7E 1U3JA 4E42A 3MRQA 2PTTB 1EFXD 1F90H 4P57B 5ESVB 1J0KA 1G7PB 5ITBL 3AU1A 4XXDB 3LKSA 2XT1B 2O5YH 4PLNC 2W0FB 3UPCA 4X4MA 2OZ4A 4PJ5A 5T5FL 3SDXE 2ED7A 3X11B 5D7IA 4QHLB 5FO9B 1GRWA 4QTHB 4C55A 4UINL 5KSAD 2HVJB 1ZWIA 1RI8A 1FO0H 2J2ZA 3C2AL 3H3PL 3QUMB 1KELH 3WXVL 4R4BB 2FH8A 4I77L 5D7LA 2ARWA 4NZDA 4ZPTA 3QDGA 4GKZA 3NCYP 4W4NA 1I8MA 5FFLA 1JN6A 2BRRH 4YHOH 2VQTA 3QR2A 2NY6C 1CF8L 1TMCB 3D87B 4XNXL 3F7YA 2AEPL 4ZD3L 3IJSA 3PNWB 2OJEB 4XVUD 4K7FB 3FB6B 3GB7A 2KPNA 3S37L 2BVQB 3PV6A 4M93C 1DDHB 4YHYC 1ACYL 4O2CB 3O45B 4WEBH 3SDCB 2DQHH 1ZANH 2XZAH 3BP5A 2VIRB 4Y89A 4IMLA 5DQJB 5I73C 5EFIB 4PD4J 1UH2A 5CD3B 4LDLB 1A7RL 2H32A 4QXGH 4JJHA 3HNVH 4JPWH 2RFXB 3WE6A 1BVZA 5E94B 5T3XL 3MRNA 4WNQB 2IEPA 1MFEH 5GS1B 4JPKH 1YN7B 5EZOL 2VDQH 3S35H 3U1SL 5HYSA 1OVZA 4R0LA 5JLZB 4JANB 4P9HC 4WU5A 1A6VH 3MNWB 2CDEA 1DQDH 3QPQC 4LOUC 3VFGL 3VU2A 1EPFA 4E5XB 4WGWB 1RU9L 4NQEA 4P9MH 1MAKA 4N8VA 3QB7C 1A1MB 5C6TH 3O9WD 5E9DD 3WJLC 5GXBB 3IB4A 3X13B 1OTUD 1DUZB 4Q0XH 3TPUA 3BPNC 2Q86A 5LBSL 1NMAH 4JQXC 1I8LA 2ZPKH 4APQB 3RIFK 1XGYL 5FF6B 4I4WA 2HA1A 1MPAL 3QO1A 3GKWL 1U8NB 1I7TA 1MIMH 4Z7VB 4MXVE 3EO1B 2DQIL 1XF4B 4R8WL 5D2NB 4HIJB 1TZIA 2A1WL 3QI9A 4DN3H 3HPLA 1KBGL 3GSUA 3VD4A 4P48A 5ELIA 4U1SA 5GSVB 5C7XL 4X7TB 4LHUD 1P6AB 1UWEL 4OIIL 3OKEB 5HYEA 3O2DA 4IOFC 1CXLA 5KOVC 5CJOL 2GT9B 4EQ2A 3GSNL 1KJ2L 4X6DE 4M8QB 4YH6A 4F57H 5IJKC 3EDJA 4QRUA 1ZHBA 3UTQB 1IGFH 3X14A 4LSTH 5J12B 1HWHB 1VEMA 5DEGB 3FFDA 2IFFL 3AMKA 3CDFA 2P43B 4NN7B 1FYTD 1F8TL 4LLWA 3BO8B 1KTRL 4RAUA 4UQ3B 5EBWA 1BLNB 2A77H 5I1IH 1RJLB 3SOBL 2X4PA 1OP3K 4LL9A 3VXUB 5FM8A 4KZDH 1FNEA 2OK0H 1YYLL 5E8PA 2XKNA 5JXEC 2LTQB 5D1XC 2ESVA 4MQXD 1CLZH 4JQIH 1HKLL 4GG6A 3GBLA 3L5XH 5MERA 5DJXA 1T4KA 2CKBB 3KG5A 3QEGH 4TSAH 2CK0L 5IKCA 2A6JB 3RX8A 4RMVA 4F33A 3NIGF 1KJMA 2PW2A 5E0QA 4OI8A 3LEVL 3W39B 1IBGH 5H35A 3MA9L 5DEZA 2C3XA 2CRMA 4Z7UF 3MV7B 4PD4K 3WYRA 4GBXA 5BW7C 5EA0H 3RDTD 4O58H 4UIMB 2DL9A 4XCFL 4WW1A 1EO5A 2PYFA 4WWKA 3ARBA 1A7NL 1QLFB 2VXSH 3FOLB 5CMAB 1A6UL 4MHHG 3CH1B 2YR3A 2VRAA 2OTWA 3F58H 3Q6GH 5SX4H 2AK4A 2VLJA 1G84A 4KQ4H 3O11B 3BH9B 1YMME 4OCXH 4FQXC 4KAQH 3G08B 4FS0A 2HJLA 5GGUA 3NIDE 4M3KB 5HJ3A 3U7YH 1TCRA 4NQVA 5HHNB 3W0WA 4GH7B 5JXAH 4MA3A 2P5WB 4TUKH 3PGFL 4Y4HB 4PGDA 3I50L 2N4IA 5E2UH 2DB8A 1UZ8A 1A6ZB 4Y1AB 1KXVC 3EOAB 4DEPB 1IRAY 3WIHH 2ATPB 3ARBD 3BZ4A 3GMQB 3GSRB 3UCRA 3C6SA 1PAMA 1M7IB 3T65A 1LO3H 5F6IC 4NFCA 5J89A 4ZUTB 4MA1C 1BFTA 4RIRA 4EI5D 4X6FA 3LS5L 5CJBA 4YDVA 4L9LA 1J1OL 4U0RB 1K4DB 4GLRH 4GOSA 3FFCD 1XT5A 1Y0LB 3PUCA 1QFWL 3D5OF 3LEXB 2C7UB 1TTUA 3B4NA 5JMRA 3C6LD 2FHBA 1QFUH 2HT4C 2OM5A 3U36A 1SJVA 2XWJB 3DARA 3KYMB 4ZUWB 3RA7H 3DYPA 4OAWB 1UM4L 1AR1D 3P0VH 5D1QB 1TQCC 3LQAH 3KJ4B 1QQDA 3OKLB 5HI4C 1C16A 2AABH 5BVPH 3LRSB 1CD1B 2YC1A 1KIPB 2L4OA 4LQFL 1WCBB 1R3KB 2A6IA 2D0HA 2ZKHH 2DI9A 1U8QB 4V2CB 4PRDA 4E0RB 1PDKA 1LD9A 3K2MC 4LAJH 1YPZF 2IANE 5C0BD 4HEME 4P9HH 1G7LA 2HKHL 4HGWA 4R4FL 4K7PH 1F00I 3PHOA 3L3DA 1IGCH 1CDGA 3QG7H 5EZIL 2XY1A 4NQSB 1DE4A 4JFDA 4WFFE 2VDLH 3V4VH 2J5LC 1GAFH 1NFKA 3L3JB 5JORB 5EU3B 1FO0B 4G6AD 2XIDA 2CGRH 5ICYB 1JHTA 1LE9A 1U8LA 1FSKC 1PQZA 5HDBE 2HN7A 4MMXC 2F54D 3RUGB 4LSRH 2MKLC 3MLSL 3U0PA 3NCYS 3RNKA 2YD8A 1BZ9A 1HXYB 5E2TH 3IYLW 4R2GD 1IAOB 1MRFH 2X1WL 5EU6E 2ZNXA 3G5XA 4JRYD 5J11B 3TFKD 2CUMA 2YWYA 5GGRY 1EHLH 4EQ3A 1XGUB 1N5YL 3O6LH 3OB0H 5EO0A 3HC0B 3RI5K 1PKOA 4RMTA 4KK5C 4JFDD 1UACH 4WGVB 4PY8I 1IGML 4U1LB 5LAXA 2OL3H 1EBPA 4HW6A 3N1FC 3EYVA 3GK8L 3X3GH 1GZPB 2FWOB 3AB0C 2ZSVA 3DV6A 4B7IA 2YD6A 2Y7QA 1N7MH 3EIFA 3BN3B 4FG6D 2FHFA 4ZDHB 3DX7B 2F19H 1QHPA 1QSFA 3PWJB 2Q8BL 2FX8H 5SWQB 5E8NB 3LPFA 3IJYB 3GSOA 2YZ1A 1C1EL 4G8FA 4QXTA 4QRPD 4F7EA 1RUAL 3HE7D 3C5ZB 2ITCA 1KSRA 4G6JH 2E7LA 1HI6A 3TZVB 2X70B 2ZUXA 2VN7A 1FDLH 1S9VB 4YNYA 4MJIA 5H37G 4PS4L 3DMMD 3WHXA 1WZLA 5HHMB 3Q2CA 2K9UA 2M26A 2EH7H 1YQVL 5C2BH 1BHGA 4W6XB 3D6GA 2JJTA 4YIQB 5DMKB 3B2UD 4XTRC 1QLRA 5DUMH 5T5NF 3QNXB 4R26H 3KPRD 3I3DA 1RK0A 5DK3A 1C5CL 2IGFH 2MCPL 3VXRD 2HLFD 4HKZB 4IRSA 1QRNA 2BOBA 3QIUA 1KCUL 5GS0L 3LKRB 2I27N 3AU1B 4NT6A 1YNTA 3U4BL 1A1OB 3Q5YA 4PJCF 5JQ6L 2VDNH 4CU8A 4PJDB 2CIIA 1IL1A 1CD8A 4WDIA 3CIQA 4OFPA 5D7IB 3LMJH 4Y5YA 2FEDD 1PY4A 3IAQA 5F1OB 3TJEL 4TSCL 5DVMA 1HILA 1I1FB 1NC4A 2OSLB 1L0YA 4GKOA 1ZWIB 3QJFB 4NUJB 5I1CL 2ZCKL 1KCRL 4HIXH 4Y2DB 3D3VB 4LLQA 4WHDA 4DUXA 1G7QA 5BCAA 3K1DA 2EE9A 5JUEH 4JFEE 2C3VA 2FH6A 1ZGLA 4HJJH 3WNKA 1UVQB 4MD5A 3S88L 4KROB 3WFDL 1IFHL 3IDUA 3LKNA 3INUL 2BXYA 4LP5A 1BEYL 1QRND 2OR9L 4I48A 3QIUD 1NBYB 4LU5L 5FK9A 3BUYA 3ULUD 5KSBF 3DI2B 1VFBB 5T3ZL 3S4SA 3P73A 2X40A 5EC2A 1AD0A 5IMLA 2NY2B 2VZTA 1I9EA 3OB8A 3MR9A 1F02I 1S3KL 4RGNB 5CEZH 5FDYA 1NC4D 3B9AA 3BP5B 3RGVB 4P2YA 4JO2L 1I8IA 1U3HD 2H1PH 5I1AA 3OR6A 3GIVA 4PRHB 2B4CC 1KULA 3TN0C 4AEIL 2C4FT 3IAGC 4FXGB 1C5DA 2CPCA 4BZYA 3DO7B 3CX5J 5D5MF 3CZFA 4NKIH 2DLIA 5E6IC 3UROR 4ELKB 2OJZL 5DUBA 3V5DA 1QLEH 2XTJE 2F74B 2XA8L 4H0IA 4LCCB 4OFVA 3WS3A 1Z2KA 4M6NH 5J57B 2YPKA 4WCYH 2R0WL 3UPAA 4FFVD 4N8VB 3JWOH 5F44A 4UTAL 4IRJA 5F89B 3P9MA 3VD9A 2ADFL 4ZAKD 5JIPA 2IAMD 2FLBT 5CBEA 3SE8H 3VXNB 2VDMH 3QDMB 2EIZB 3HE6C 1OAXL 3IETA 2WBKA 5IW3A 2ERJB 1ONQA 1ZS8A 1I3VA 1HDMB 1IM9A 4OGZA 4L9DA 2ZOLA 4WUKH 2P5EB 3TWCL 3U9UA 4DGVH 4OF3A 3L3OB 2VWEE 2YN5A 5A2LH 4JPIB 1N6UA 1DQQB 3KPNA 4DOHE 5IEKA 1O7VA 4AIZA 1R24A 4XMPH 3UEZA 1X4YA 1RY7B 5KANI 4LLDB 5C07A 3RL2A 1TZIB 1XGPA 2NY6B 5EU4A 1KPRA 2ICEB 4XPHH 5F9AC 1LDPL 3UJJL 1TNNA 2V5TA 4U1SB 4GG8A 3FRUA 4I13B 1I7RA 4NQXA 3A6OA 3QQ9D 2IG2L 3T0BA 1UM5L 2ZCHL 3QCUH 1CLYH 4UBDD 5FDWB 3FMGH 2R23B 1QACA 1TETH 4M62L 1IM9D 2EYTA 2ZUQC 5FOJA 2UV3A 3H42H 1MFAH 3U0WH 2BVPB 3AY4A 2X4TB 3GNMH 3KS0J 4ENED 1JPSL 1N6VA 2A2QT 3M17A 4MA7L 3TNMB 5A16A 5I73B 4X9BA 3ARRA 4JY5L 5C71A 4MNHA 2FGWL 4L3CB 3O3BB 1S78C 1BECA 2P7TB 2MOVA 3AUVA 4BZ2H 2PYEB 5IT2L 3MCG1 5FGCB 4Q58C 4TPRL 1Z6JT 1QVOA 4MSWB 4KUCF 5MHSD 4MZ3A 1T1WA 5LWYH 3PDOA 5IBLC 1FPTH 4NRXA 3NIFE 5KJRH 4I2XB 2R56H 4JDZA 5HHOB 1F4YL 1OAQL 1JHLL 2AGJH 5IKCB 1A4KB 4OBRA 2PW2B 3QIWD 4K07A 3RFZC 3E6FA 5KVGH 4WI7A 3CFJB 4HWNA 3QUKB 4MX7A 3SGKA 3V5HB 5IFJA 3MV11 1JNLH 4YBQD 2MCG1 1TITA 2FYYA 3GSXB 3RTQA 3HG1A 3GJFA 2M2DA 3WIFB 1GGIL 3VFOB 3FQWB 4OZIA 1RFDH 3NFNA 4UT9H 4JEGB 5AUMB 4JHAH 5TGBB 4NZTH 4GAYA 3MLUL 5F9JA 2OL3B 2O5ZL 3O8XC 5FOBB 2GSIA 1FCCA 1S7UA 2FIKB 5E8EA 3ME0A 3BQUC 4WUUE 2ORBL 4PJBE 4NQVB 3O3EB 3VG0L 4U3CA 3IFNL 3BZEA 4HQQH 1DEEA 5DJCA 2H9GA 2VABA 2FDBP 3BZDA 5BS0B 1HE7A 1I9RH 4LARL 4GAFB 3FN9A 5TPWH 5DHVH 4M1DH 4ERSL 3BXNA 3CDYA 3NFSL 1NEZA 4JGJA 5E00A 2WSKA 4YDKH 4OIBA 1I3RB 4U1JA 3PL6D 1INQB 1D3CA 4Q9QH 5MEPA 3L7EB 3JWDC 3UJTL 3OKOA 2FJHA 4PJ9A 3EYOA 1FL5B 4OCRL 3SQOL 3BRDA 2VH5L 3VI3E 1XH3B 4LASH 1QSEE 2RJMA 1K3ZA 1Y6MR 2NNAA 1P9MC 2E6PA 1GGTA 1RV6X 3G6JA 5DS8B 1JV5A 1SEBB 1ZT7A 3CX2A 4HK3N 1AP2B 4KV5F 4WI6A 3TJHC 2WV3A 4M1GL 4BH7B 1B90A 3F7VA 3DXAA 4YHIB 4ZSOA 4OCWL 4NQDA 4YEFA 2Y5TB 3ARDC 3MLZL 2GEEA 3KPLA 1NCWL 4AJ0A 1ZTXH 1PX4A 2B4CH 4X6CB 5IHLB 4L4TD 4NPYA 5I18H 1QBBA 3WNOA 3O41A 3MV8A 4Z7UB 2DQDH 4XVJH 4HKBB 2DTMH 4FHBD 2F8XC 1SYSA 3NPZB 5D96B 5CJ8A 3C60C 2LAGB 1Q9LA 5IVXE 4J7RA 1B4RA 4X9FA 2YEZA 4HGWB 5K9JL 3M1BB 4ZO6A 3GSQA 1AHWC 2HMID 2IADB 3RBGA 4OJFL 5JW4M 3DSNA 2M1KA 3UTTE 3SDXA 1OPGL 4FQXB 2HWZH 3WLBA 4M9PA 1RUQH 4P4KC 4JFFD 4H25B 4WVRA 3V6OC 1PGRB 3QUYC 3BESR 2H26B 2MHAA 2HKFL 2VLRE 1UWGH 3MV8D 5EIQA 2GAZA 4KJPD 4L3EB 3KDMA 1FH5H 4Y4KC 4HPOL 5E08H 3AVEA 1BQLH 2BFVL 2GUOB 1F4WH 4MQTB 4ODBD 3QEUB 4AG4L 1P1ZA 4RRPG 2FJGB 2PW1B 5F6IB 4YLQT 4QEGA 5F7DB 3CZJA 4MA1B 1DQMH 4KVNH 2XNAA 1NCUA 2R39A 1Q72H 4YE4H 4PREB 3TV3L 1JYVA 3HS0A 2EYRB 1KNOA 2NY3D 2IH3A 5E2WL 3WSQL 4Z6AT 5KS9B 2P45B 3VWJB 5F9OL 4PJHF 1U8IA 4DKAA 3RVWC 3QAZC 2VDKH 3DV6B 2EICA 3TYGH 1TVHB 3OKNB 4ODHL 3EO0A 3ZE1E 3ROLB 5DQ9A 3BAEL 4MA8L 1IAKA 3ARWA 5I1EL 1DFBH 5C0CE 2VITB 2AJZB 2IH1B 1A6AA 3ZMRA 1JE6A 3PIQA 1NANI 4JG0H 4PBXA 1IC7L 2VXQL 3BWUC 2NLJA 2AV1A 4KHXH 2XZCL 1I1YA 1DTUA 1QFOA 1E28A 1T5XB 5I1HL 1YPZB 3QFDB 4YNYB 1GGUA 2E3VA 4ODWA 2YSSA 3CSBA 5DR5L 1FRGL 1UM6H 1XR8A 3D0LA 1HH6A 1ZHLA 4XX1G 2BNUB 4JO3H 3S37X 3CVHA 3VGFA 5JW3H 5HY9A 2H8PA 2OLDA 5E7FA 3DBXA 3BE1L 3QT2A 1GHFL 5DTFB 4KKBC 3S9DB 3ZKQD 4HKXB 4HFUH 1KTDA 5AG9A 1DUYB 2VL4A 4YX2H 4JZOA 3NACH 4ZO8A 4KU1A 4WTZG 1H3XA 3QWRD 1UGNA 4GRMB 1SHMA 4NT6B 1CXIA 1H3PH 2D2OA 4TUJA 5DVKA 4JZJB 5B38A 3GMNB 3PABB 2IPTL 1G7JA 4BSWA 3QXDB 2HH0H 1YNLH 4IEFB 1OARH 3GMMA 3SKNA 4Z95H 1PKQB 3IFPB 3O4LD 3B9DA 4TVPE 3VGAC 2LU3A 1AFVL 1CL7I 4M7LL 5IIEB 2PCPA 1PEWA 4WJ5A 3AB0B 2NXZC 1ZGLB 3DWTA 4X6DA 2NR6C 1FLTX 4XPGL 1NMCC 5T33L 2R2BA 3C09C 1QPPA 1TZGL 3BPLC 4GKSA 3S96B 1UEYA 5HHXL 4DZ8B 1WC7A 3OAZK 4YFLI 2F5BH 3SDDC 1IZJA 3L6FB 3QEQE 1N6QH 3NMEA 3O6FC 1EAPB 1AGEA 4OGYH 1D5IL 4P23C 5CCKL 1Q0XH 3JWDH 2XRAH 5HGGS 2OP4H 3D9AL 3SCMD 5MP6H 4I18A 2Z31C 3P9LB 4OLUH 5IVZB 3ROOB 2V2XA 1F58H 3RWDB 4BA8A 3HR6A 4ONHB 1VACA 1K9TA 2N56A 4MDJA 4ZYKA 3S34H 1A7OH 1BZ7A 3DUHA 2NY4D 3FCTA 4NO0D 1IKFL 1K2DB 1EV2E 3QO0A 1JHKH 4DVBB 1F3DH 1OP5H 4JO4L 4F58H 5L9DL 4X4XA 4GXUN 4EN3A 1U91B 3OF6D 3QCTL 4XCNA 1X5YA 3RWFA 1CG9B 5AAMA 4A6YL 3QQNA 1X5GA 5L6YH 4PJCB 4ZTOH 1BVLB 1KIQB 1IC4L 1MFDL 3SE3C 1Q38A 4NBZB 4UDUA 3Q3GA 4AT6A 2K7QA 3Q6FB 3WUWG 4O4YH 3IU4H 5CIPH 3U7WL 3O6MH 5TF1H 4G5ZH 3O2WL 2G5BB 3B6SA 3WL9B 1LK2B 2ZOLB 1YMMA 2GY7B 3GBML 5GGRB 2V7HA 3QFJE 4NQTA 4PTTA 5FV1L 1R3HB 3X3FH 3T0EC 5DHVB 1Q0YH 4K3EL 3N1GC 5HHPA 4XRCB 1FGNH 1LO2H 4M5YH 5ALCL 3ZDXE 2BK8A 4LLVB 4EN3D 1A8JH 2BMKA 4POZD 4GQ9L 2DLEA 4MNQD 1CK0L 3VRLE 4QHMA 3RKPA 2VDOL 2GJZA 1KG0A 3TBWA 5KSAC 4ALAL 4G43A 4RRPA 1F97A 3CXDH 4U49A 3GSNA 1KJ2A 3IDYB 4RFOH 3SBWA 3HTLX 4RFEA 4Z7QF 5ESQA 2PKDA 1P5UA 4D9LL 4QT5A 4KTEH 2VISA 1YMMD 5EN2A 3M45A 4HMEA 4R3SA 3WCYA 4OD1L 5HYJE 5A16B 1SYVB 2PN5A 3UTOA 1ZEAH 1P4BH 4XVUC 4PV9B 5MEQB 4OZGE 3KPOA 2QHRL 4WHCA 4NUGL 5I1JH 1BFSA 4LEOA 5D5MB 4F3FA 4M48H 4XNYH 4U6XB 3NAAL 4I0PA 2XTLA 5T1LB 5TE7H 4L8SC 3U2SB 1NGYA 4HX1A 4L5FH 3EYUL 4NRZA 3ZO0A 4M3JA 2H6PB 4HPYL 3ZE0E 5I30L 5IW1A 1YZZA 1RULH 4JM4L 2FECI 1FIGL 1IQDB 1MHHB 4YWGH 5ISZB 1JPGB 1EIBA 3SGEH 3IVKB 1RZGA 2R1XA 5HPMA 4ZO7A 5J6HB 4H1LG 5B8CB 5CLWA 4OFKA 4JFOA 2XWBA 1P7QA 2QTEA 4G6FB 2WW8A 1J05A 2DS4A 4LNRA 3RIAK 3RTQB 3T2NL 3O9WC 3T77A 4FQ2L 3BEWB 2MMXA 5C9KA 1OLLA 1OTUC 5D4QA 5EBMA 1TPXB 3P9WB 1ED3B 3TNNA 2HFTA 4NN6C 4GAYB 4L1DA 1MI5E 2DQTL 2G60H 2IAND 4BQ9A 1WCQA 4YBLC 4CVUA 5F7UA 5EU6A 5C0AD 4JFZH 4EDXA 1FQ9C 1JWUA 5J6GB 1S7UB 1CDCA 5BZWA 5E8EB 4ZOEA 4P59L 2ZCLL 2VLME 4UDTB 1PVHA 3GHEH 5AYUH 4WFFD 5FA3A 3NA9L 4J1UB 4NM8H 3WKNA 5EULV 3THMH 2ZUQB 5HI3D 1E27A 1I1RA 1QO3B 2JE8A 2P46B 2YKLH 4GW4B 1ZAGA 2CXKA 3I02B 5DJYA 1KJ3L 3CVIH 4N0CD 2GFBA 3L7FA 5FUOL 3HMXL 3GI8L 1I8LC 3B9KA 4X4YA 1AI1L 1A5FH 4OQTH 4F7CA 3WO3B 1YJDL 4FNLL 2Z0BA 1JNNH 3V0WL 4XNZC 4C56E 1LO4H 4XP4H 1WBZB 2BC4B 1U2HA 5DDHA 2MNUA 4XNQB 1GGBH 2LAAA 1YQ2A 4LGPB 4CW1A 4PJXF 5EC1B 1U92A 4M00A 2F53B 3LKOA 3GRWH 2ZOKA 3OKKA 1A47A 4FQCL 4MS8D 1UJ3B 4LF3A 1CBVL 1ZT4B 3QXTA 5KW9H 1K8IA 4MQXC 4ZOCA 2QEJA 2IPKB 4YQXL 2ICWB 4YXHH 4PGBA 4HKJA 5C3TA 2CK2A 4R6UA 3F7RA 4DVRL 1ZLVK 2DQEH 3T2PA 3Q0HA 2VDRL 4PJGE 2BOCB 3QZWA 1NUDA 1Y18A 5H2BA 3VGDA 1P84J 3MXWH 4J8RA 3WUWA 3MRLA 5CJQL 1U2CA 4NO5A 3DJ9A 1JIBA 3OWEA 1H5BC 4JVUA 2NX5B 3WN5C 3OZ9L 3BQUB 3WFCH 4LP4A 3ARGD 4HGKC 2YPVH 5J13B 4PJAE 3LS4H 5DD1H 4OCMC 5EZJB 5E4EC 1W72L 5D2LF 2R1YA 2PUQT 3NABL 1BJMA 4XPTH 4I5BB 1CWVA 2WUBL 3J8F7 1E4KA 2FZ3B 3IAPA 5TE4L 2VB5A 3I6GB 4OF7A 1EJOH 4KMQA 1VHPA 4GRLB 2NY0D 4LSUL 4GBXC 3WXWL 3T4YB 5HGAB 4BKLA 4RAVB 3PWPE 2B1HL 1VFUA 1E0OB 2VLKE 3TCLA 4K3JH 4HWEH 4IHOB 4HFWB 4G7YH 3ARBC 5I75B 4JDVA 3NTCL 3FAWA 1MJUH 4PJFE 1IAKB 1BD2B 2JK5A 2A73A 1MHPL 1JUFB 4EI5C 5GJSL 2YRZA 4JFED 4YHMH 3MX0A 3H9SE 3VGBA 1X5XA 5K9KB 2M8XA 2AV1B 4XB7A 1FVDB 1MOEA 1JYNA 2UUDK 5GSRB 1DBMH 1T3FB 5GPRA 2PXYB 3D39B 3C60B 5F1KC 5MENA 2CLZB 4GFTB 2HFGL 1AR1C 1IAMA 1HH6B 4QOKE 2CLRB 4WRLA 1AHWB 4ODVL 1EMTH 1MH5A 1NCTA 1ZKAA 2DDQL 3IGAA 1FL6B 1LK3H 4H1LA 2UZIL 3L5WA 1U93B 3IDNA 4Q74A 3ULSA 4L9LC 5HBBA 2MPAH 1YECH 2Z4QB 5EO1A 3O4OC 3QNYA 1UFUA 4J3OC 2ICES 1HYRC 1G7MA 4KJWD 5FHAL 4YDJA 4Y4KB 1EXUB 5J1TC 4D0DB 3C2SA 5F1IB 3W5NA 4PJ8D 5GRUH 4DWHA 4P5TA 2XTJD 4XAWH 4G6AC 2FBJL 1A6TB 1R3LB 1MEXL 1U0QA 5DQDH 4CAGA 1BQHG 1MLBB 5IHZA 2R29H 2X4QA 4FFYH 3MQIA 4OUUB 3JBG7 5SX5H 1ZGLP 5D70L 2I07A 2HJFA 3FQTB 4OIAA 4R2GC 3QYCA 1TJGH 1LO5A 1UCBH 3QAZB 1L7TH 5GS0D 3ALPA 3TFKC 4RWHA 3HZMA 3RAJL 1ZV5A 4S11A 5DGQA 2DYPB 3JTTB 5C92A 2UWEA 4KXZI 3WFEH 2DJSA 3ESUF 1IGJA 4Y19E 4NP4H 1F3JA 1RMFL 1WEJL 3KJ6H 4N0UB 4OFYA 1AGDB 3ARFD 5ID1A 1AR2A 4JY4A 4CBPA 2A6DB 3RWIA 4Z8FH 4FG6C 1IAIH 1MCPL 1QNZH 1T66D 1AO7E 4Q9RH 3AS1A 4MWFA 2IQAB 4RDQG 3TVMB 4MDJB 4MLIA 4ZOAA 5L8KB 4PTUA 5SWZB 4LSQL 3HE7C 1EX0A 1B4JL 1RD6A 1DLFL 1NC2A 3ETBF 1MVUA 3DMMC 1VEPA 4TNWF 5C0IA 1XGRB 1C12A 4HLJA 1BOGA 4MB5A 1AC0A 3SDAB 3MMEB 4FZ8L 4HWBL 4D9QE 4ZOBA 2IBZY 3P77A 3H7BA 2FEEL 4KPHL 3TBVA 4E41E 3ECBB 1CGSL 4JJ5B 1J5OL 4XB8A 2J6EL 5TE6H 2HLFC 1G9ML 3WD5L 1FYHB 1MJ7L 2AJUH 1WLHA 1EHNA 3HAEG 4HXAH 2V7HB 3VGAB 2VO5A 1T03L 1ZA6A 3QA3A 2HTLD 3BSZH 1W0YT 2UYLB 4K9EL 4TRPH 1CFBA 4NQCA 4PRIA 2AEIT 4NWUL 2QV2A 3QUXA 1HHKB 2FEDC 1AKJB 1EH9A 2CLVB 4KJYA 1Z3GL 3QEHB 1NMCB 5DT1H 2D7TL 2YUVA 1CGVA 3C09B 3CMGA 3LQZB 3TBWB 5F3HA 3S3JA 3ZKMD 3MCKB 2ITDA 2F58H 4RGMB 5I8OL 2AV7B 1KLFA 1XCQA 4KUZH 3SDDB 2VE6A 1SY6L 1YY8A 1IEAB 5AEAA 3O6FB 1OT2A 3AAZA 2R4RL 1DCLA 1T1YB 4P23B 5GISH 1T21B 3QIUC 3QUZA 4GRWF 5E4IA 3UPRB 1JZ7A 1QSEA 1YUHB 4YXLL 3ULUC 1L6XA 4WUUD 3ULUF 2Z31B 3HPJA 1CR9H 3LKPA 1TCMA 1AXSA 3W2DH 1CFSB 3WMSA 3DX8A 3WFBH 1MJJB 2G9HB 3KPOB 1P69B 3DRTA 1NCBH 2HYMA 3QUXD 4OF6A 4Y5YC 1PZUB 2Q20A 3D2UA 1URLA 5DA0B 2BNQB 2QJDA 3U9PH 2P1YA 2IPUK 4ZFOL 3N9GL 1AIFA 1U3HC 4KMTL 3WKMH 4OM0H 1UB5B 4XHQA 1KT2B 1MCRA 4MNGE 4UAOC 1RZFL 2AJSH 1J0JA 4B41A 2G2RA 3CDCA 4P2CG 5IVXA 1S7XA 1RZGB 3QUZD 5E6ZA 3GMPB 4NBYB 3RJQB 1QSED 3WDIA 4U6HA 1CICA 1EA9C 1P7QB 3VW3L 1YEKL 3CFBB 1H0DA 3FHAA 5LGJA 4X80L 5CILL 2D4FA 1XGQB 3SJVE 1EFXB 4FFVC 4W68A 15C8H 1DQTA 4DKEH 2Q7YB 1T2QH 5C0RH 1EGJL 3D1MC 3UTSB 5LJYH 4FMFA 4ZAKC 2IAMC 5EIIB 4PJIE 2VLRA 3GMOB 5FUCC 5AAWA 5ICZA 4HCRL 1A9BB 5EUOE 1JWMA 2HVKB 2IBZX 1MJ8L 4K3DH 3RVVC 5KSAB 4FMKA 3SKJH 2J8UF 2I60L 2DBLH 1LO0H 4HUKB 1BQHA 5IB1B 5CINL 5HI5D 2CH8A 2YHGA 2FL5A 4OCYL 1YEGH 5LGHH 4QHUB 1KN2H 1OWWA 2A9NL 4POYA 5ADOL 1M7XA 3UTTD 1KN4H 3R06A 3ZHLA 3VGEA 1B2WH 4RX4A 3H3KA 1EAJA 3TP4A 2DAVA 1QZ1A 1EHAA 3DUSA 3VFWA 1CVSC 2VLRD 3EJYD 3MOAH 3QQ9C 3MGOA 4UBDC 1C5BL 4O2FB 3B9KB 4FQIH 4XPFL 1CTNA 2X9XA 1BGXH 3PXJA 3QUML 1S7SB 4EVNA 1R0AH 2EYSA 1DQJA 3IDGB 5KN5B 4TN9A 2FATH 1S9XB 3U4EB 2JB6A 3EUUA 5JHLH 3E3QE 5FYKL 1OAZL 2HG5B 3BD5A 5DFTA 3J7HA 3C5JA 3FO9A 3MBEA 5F7HA 4Z7WA 3HNTL 3GSWB 1RJYB 4CVZB 5BQ7A 5FKPA 5I1LA 2P42B 5IG7B 4YAQB 4YK4C 5ETUB 4EIGB 2Z91A 4BK4A 5C0CD 1GPOH 4U1IB 1XCTA 4JFHE 4LHQB 2HLAA 2ED9A 3O9WB 1B88A 5E9DB 4OLXH 1T22B 2EE6A 2VXVH 4XBEH 1NSNL 1TENA 1S8DA 2C3WA 43CAB 2HJKB 5L88H 2X1XR 1BVKA 1RUML 3QIWC 3QZWB 2F8VA 3KLHD 2HRLA 5CEXA 1Y18B 4JY6B 4Q7DA 1HN1A 1P2CA 3CFKA 3C5SA 5CBAB 4DGYH 4YBQC 4NIKB 4ELMA 4ZUUB 4XI5D 2B1AH 3KPQB 3ZSSA 4ETYA 3HAEA 4L4VE 3MZTA 3HFMH 4FFWD 3Q1SH 2CR3A 2HFFA 1SM3H 1KC5L 1EEZA 4QRSA 1DBKH 5FYLL 5B21A 1JPFA 3UJIL 2ZNWA 4OF8A 3TA3B 1N64H 1RZJC 4N90E 4LHUB 5I76B 1MCDA 4XMLH 5GGSY 1CL7L 2CMRL 4LAQL 2I9LB 1TQBC 5AZEL 4S1SL 1UEMA 2MQ3A 2V9RA 4MXWL 1EO8L 4LFHD 4LSSL 7FABL 1D6EB 4JGUA 3KLAA 5JPMB 2JIXD 4KQ3H 5DUPL 1D5BB 5IJVA 3H3BC 3K8MA 3ZT7A 1HHJB 1MNUL 2QSTA 1FL3A 1SQ2N 2BSTB 4XNZB 1INEL 1B0RB 3U46A 2X6MA 3FQNB 4DKDC 3V8OA 3P4OA 4UNTA 3IXTA 1L9NA 3S8WA 4XZUA 4TVPD 1FYTB 5ERWA 5KVFH 1NUNB 4OZIF 1JGUH 3PL6C 3MO1B 4GRWH 5DD0H 4NZUL 1RUKH 4S2SA 1I85A 3ULUH 9CGTA 4U1MA 4CL7A 1NMBH 4PV8B 3VFRA 3K4AA 5JPNB 2X89A 3WNLA 5ADPL 3IDXL 1IGIH 1JFQL 1IKNA 5CGYD 1FBIH 4XPBH 4U6VL 3EHBD 3S98A 4F8QA 3QHTC 1H3GA 3QEQD 2EKSB 4C4KO 4NKOB 4R7NA 1YN6A 5KTEL 5F97E 1ZA3B 4O02L 2WWMD 3P30H 4QNPE 4L4JA 4U7SA 1DP0A 4CVXB 4M5ZH 1QBML 3RDTB 4K71B 1J1PL 1UH3A 1P4IL 4HIHA 1H5BB 3MLWH 2L0DA 3WN5B 4RZCB 5I66A 4HUVB 2I9TA 5FECB 3NGBC 3GGWA 4XMKL 3MLVH 3QDJB 3OTTA 2VYRE 3G6JF 3QFJA 4GMSL 4NC1C 2HMIC 4Z7NF 1RZIB 2AI0L 2CKBL 4X0KA 1MUJA 4RWYH 4JRXA 3P0YL 1ITBB 5CZVL 4S0SD 4LSVH 1LP9F 4LIQL 5IFHH 4FTVA 1F4XH 2E8YA 2ADIA 4UV4H 1OOAA 3PWNA 1XIWB 5FYLE 2DF3A 1FE8H 4X7FC 3H9ZA 1FNGB 2QADB 3DVGA 3RP1A 4KJPC 2HJFB 3KYNB 5FHBH 3MJGX 2FJFA 4H8WC 5HGBB 1U3YA 3OB0K 5EU7C 1MF2L 2DWEB 4XWGL 3RL1A 1T20B 4FFZL 3AXLA 5HYJA 3BPCB 5FM5O 1WBYA 1GGCH 2GK2A 4EI5B 1CFNA 2UWEB 4LLUA 5LKNA 3SGJA 4Z7VE 2BSRA 2XPGB 4OZGA 5D2NE 3FFCB 2NY3C 5INCA 5ID1B 1MHCA 4GSDL 3PF2A 1YEEH 2VXTL 2W9EH 2YD2A 3MLYH 3C6LB 1GC1L 4LCUA 3CC5A 3JWNC 3QJHB 2E8ZA 1OSPL 3FONA 2D03H 4H20H 3TCXA 1D9KB 2VUYA 3OJDA 4Z5RB 4KDVA 1S5IL 4F9PC 2CUHA 3QQ4A 4L29B 5AYQA 2XZQH 2ADGA 5FXCH 4KKAC 3BKCL 4PTUB 3QULA 1KCSH 5HYJD 1U6AH 2VAAB 1B6UA 5HDQH 5C0BB 1QR1B 3OKYA 1CD0A 2O93L 5EO9A 4A6YA 1FG9C 2QQKL 1QG3A 4LCWE 3SEPA 4HIEB 4TQEH 4X4ZA 4F15C 3LY6A 3VXUE 3MTRA 4YGVA 1INDH 1JGLH 4G8GA 4TUOA 3BIBX 1T7ZA 2FD6H 3LB6D 1RHHA 4KY1H 2F54B 1F90L 1N8ZA 4WO4B 5B39G 2Q6WA 4P4RA 5DVLA 4KDWA 5JO5A 2O5YL 2Z92A 2P48B 5CGMA 2A0LD 4XBGB 4R2GB 3NFPA 4JZNA 4ODTH 1XR9A 3KPMB 3I84A 4JRYB 4KTYA 4NQCB 4ESKA 5CSZA 3MV7E 1JCKA 2IALA 1FO0L 3CFDA 3QXUA 1FZMA 4F9LA 1RZJH 1KELL 1JNHB 3V4UL 3QNZA 2NY5H 4K94C 4EUPG 3QXAB 3VMNA 4IIQC 5L2JA 3RWEA 1WUNT 1T2JA 3PV7A 2BRRL 1NAKL 4Y16A 1MI5D 3MYJA 1T1ZB 4OSUH 2IQ9H 2CIKB 2EDNA 3MXVH 2VSDA 3NCFB 4YDLB 1TLKA 1TVBA 2FNBA 5I16B 2VLMD 5HVWA 4HUMB 2N7AA 1S9YB 4JREC 3GJFH 1F3RB 4MXVF 3SQBA 2CRZA 1UQSA 3VXSE 3QHZH 4Y4FD 3V95A 4WEBL 3WDHA 1LEGB 3VXMA 3I2CH 4R96A 2DQHL 1ZANL 1NBZB 2XZAL 3D2UB 3FT3B 3IJHB 4QRPB 4Y1AE 2OTUA 5T1DH 3HZVB 4AENA 4DFIA 3HE7B 1NGXB 5HGDA 4W6WB 1I9IL 4NKMB 3KXFA 4R4ND 4QXGL 2AXHA 3SCMC 3PDDA 3HNVL 4JPWL 4M7ZC 4RSVA 4NDMA 1U8KA 3L3GB 2GSGB 5IOPA 3DMMB 4X6DF 3PGCA 1NH6A 1MFEL 4JPKL 2EDXA 4AYFA 3CH8A 4KI5E 4PY7B 5C08B 4KRLB 1L6ZA 3IFOB 3VCLA 4C56D 2VDQL 1GIGH 2NY4C 3S35L 4U6HB 1JWSB 1A6VL 2X7LB 1DQDL 3BH8A 1T6VN 3KPRB 3ZDYE 1T04B 4N8PA 2FO4B 3VXRB 3OR7A 1VB9A 2Y5EA 5DF0A 2VERN 4Y5VB 5C6TL 1NAMH 3QPQD 1T1XB 1J0IA 2V7NA 4HUNB 4PRBB 3G04A 4PP1C 3UBXI 1UG9A 1NMAL 1MLCB 4NHUA 2X4NA 4WHYH 4I18C 1FAIH 2DKUA 3ES6B 1TVDA 3CJJA 4XBPA 1LEKB 2Z8SA 2Y07H 1B3JA 1J9CT 1HHHB 2HT2D 3EFFA 2YXMA 3CDGB 4HSQA 1MIML 3MV01 1NCNA 3CCHA 2NTFA 2R2HA 1C8PA 4OCNC 2J88H 4UILH 2QQQA 3FO0H 4DN3L 4ODXA 4EN3C 4POZC 1IC5L 3RY6C 4GRWB 1PFCA 2PTVA 2VLKA 2EE2A 12E8H 3HMXA 3MRRB 4H8WH 3RUGE 3DUSB 4HS6B 4ZUSA 6FABH 1J10A 1Q9WA 4PJFA 2CDFA 1G7IA 4F57L 1DANU 3S5LA 1IGFL 4EVNB 2DLGA 3H9SA 5DYOA 3KPSA 1QFWM 4BSVB 5L2KA 4LSTL 1U3HB 1K8DA 5TFSH 3NIDF 4BJLA 1Z9LA 1CD9B 1F11A 3FQXA 2ZSWB 4UAOB 1FVEA 1II4E 2A77L 3O3DB 5I1IL 1NBVH 2GTWB 3PWPD 5T1MA 3EYFB 2VLKD 4QOKA 1FFOB 1KPVB 3ULVH 4KZDL 2OK0L 3MRIB 1OM3H 4Z7WB 1UXSA 4O2EB 2NTSP 1VCAA 3T8XB 3KNBA 2VMFA 5DJZB 2NY1D 4QGTA 4JQIL 4HZAA 3AS0A 1YY9D 1XCTB 3MRKB 4RA0C 5JXED 2AW2A 3EZ8A 5D1XD 3QEGL 4TSAL 3AREA 1X5LA 3VWKB 5EORH 4ZAKB 4KMLB 2IAMB 1OAKH 2F5AH 1IEBA 3AMLA 1JI1A 4J3VA 3OV6A 5IM7A 2VZ1A 1IBGL 2B39A 3FB8B 5GQBA 2YZ8A 4LLYB 4MCZA 2E27H 4G8EA 1X5IA 2EDQA 3D69B 3A67H 5EA0L 4O58L 1U8MA 1P2CB 4HH9B 5A2IH 3MUGA 4P2RB 2DWDB 1WTGT 4ELMB 2J8UB 2VXSL 4MB4A 4QOKD 5EU5B 3VD7A 5B39A 2GITA 1QA9A 3JV5A 5HHME 4ZODA 4HBQA 3OBAA 1W72A 3ET9F 3F58L 1AY1H 3Q6GL 4OZFG 2CQVA 1WAAE 4KQ4L 5AD0A 1JPFB 1KXTB 2L7UA 2VC2H 1GOGA 3T3ME 3VH8A 4N0FB 4OCXL 3KAAA 1CXHA 4KAQL 5EDXA 3EGSA 4JM2A 2VZOA 3M07A 5JXAL 4TUKL 3EJZD 4WEMB 1BZQK 5E2UL 1CN4A 4EUPA 1A14H 1L0XA 5HI3C 1QBLH 1PG7X 2AJYH 3WIHL 4K94H 5D7IE 3RPIA 5HDBF 4PRPB 3BKYH 1LO3L 3CAFA 2R2EA 4N0CC 4TULL 3L5HA 4K8RD 5KVEH 4CU7A 5T5FH 4HZLA 1JGDA 4N0YL 1HOCB 3QWOA 5GGVY 2ATKB 3D18A 3QDGE 4OTXL 5HVFB 5KZCD 5I1GH 1MQKH 1A9EA 1R5WB 4U1KB 3PWUB 4HUXB 1QFUL 1XZ0A 4YK4B 2A6KB 1I1AA 5EOCH 4LLAA 3RA7L 1MCJA 1FFNB 4HDIB 3MBXL 4Q6IB 5IBUB 4Y19D 2G75B 3BP6A 4GW1A 2EC9U 3P0VL 4U05A 1AH1A 5F7FA 3LQAL 1ORQB 5M95B 5IW6A 2AABL 5BVPL 5EOQH 5DI8A 4MS8C 2ZKHL 4MCYA 3QIWB 4NKDA 3SGEI 3MGTA 1DBJH 1X5KA 2AKRB 4E41A 5J7CC 1HSBA 4DGIH 4HIHB 4PRHE 5A2KH 1AO7D 4LPXA 4P9HL 3ARZA 3N85H 5EBLB 1A7BA 4HC1H 1IGCL 4KK6D 1ACYH 4NC0B 1CVRA 3MRPA 3ZYJA 3DIFA 4G6MH 3OXSB 2VDLL 3V4VL 1GAFL 3QH3B 5CAYB 4X5WA 4MVBD 3G5ZB 4HS8H 4XGZA 1KJVB 2CGRL 3MROA 5D1ZA 5TJWK 2GI7A 5FYJL 3GJEB 3DOSA 2RIKA 4FTVB 2QQNL 4LSRL 4NQEE 2ADIB 3U6RA 4NFBA 5E5MA 1OSZA 5JW5B 1RURL 5E2TL 3PJSB 3BGMA 4BH8B 5I2IA 3ARGC 3RWCA 3VFMB 1MRFL 4FQ1H 5EZOH 5CEYB 3QDME 3QPXH 4Q97A 3WFHB 2R0LH 3HKFA 4NO2A 1N0XH 4U1HB 1EHLL 1I7UA 1CU4L 2HT3D 1UACL 4M02A 1S9KC 3PL6B 1C08B 5JIHA 3S97C 2OL3L 1C7TA 3X17A 2NY0C 4LMQI 4DK6A 3T3PE 2CO6B 3GO1L 3LVEA 4ZFFB 4UUJA 5TDOA 1F3DJ 4U3HA 1N7ML 5AWNH 3NZ8B 1NCAH 1CLOH 2V5MA 3HR5B 3LDBC 5EZLA 3W5MA 3UBXG 4X7EC 3MRHA 4ETQB 2DQIH 2B2XH 4R8WH 4P3WA 2FX8L 5EUKA 5F7WC 4L4TB 1NAMB 1AQDA 4G6JL 3TIEB 4FOMA 4HUWA 3UTPE 5ENWB 1FDLL 1E4KC 2P24A 4QF1A 4Y5XC 4CVWA 1CIUA 4UB0H 1JPTH 2IJ0C 2QLVB 2OYPA 4FABH 5MI0C 3NGBB 2ARJA 4HWBA 1A7PL 1KJ2H 2EH7L 1J7VR 4GXVH 2KDGA 1XF2A 1N59B 2P8MA 1ZSDA 3CMOH 1I4FA 2PYEE 1E6OH 5JHDD 4PJIA 4MJ6B 3SKMB 2HFEA 1OGTA 2J6EA 4R26L 5DUML 2NW3B 1PYWA 2IGFL 2LE9A 5DD3H 4DAGH 1LP9B 3QIBD 4JFFB 2ESVE 4UOW0 4QRTB 3NN8B 1F8TH 4NCDA 4AM0A 3QQ3B 4GG6E 5GGSB 1NJ9A 3STZA 3TO4B 3CGTA 5HHOE 1Q9KA 2VDNL 4KJWC 4Y8AA 3GUTA 1FFPA 3LN9A 4ZXBB 5INDA 3NFPB 3BKMH 5FYJE 3RQ3A 1JZ3A 5C09A 1KIRA 3LMJL 4PJ8C 3RZCA 3D0VA 2XTJC 5JA9A 4IOIA 2EDDA 4JDTH 4RMSA 1ND0A 3SJVD 4Q2ZB 2J4WH 4NSKB 4PGEA 2D7MA 1BFVH 4XP5H 3PP3H 4P99A 4HIXL 4HD9A 1A4JA 2EIEA 5JUEL 1SY6A 4GMTH 5DMGD 4HJJL 3E8UH 1SJEA 2NW2A 3MA9H 4UV7H 2AK4E 5CUSH 2VLJE 1ORSA 5GS0C 1G0XA 5BRZA 3X12B 3BDBA 5ACZA 4N9GB 5DWUH 2VWEC 1TVBB 5D6DC 4BFGA 1X4ZA 3BD4A 3W0WE 5CP3H 2DQFB 3WHE0 2VXUH 3WJJA 3ARFC 5ID0A 5CEZL 4YHNB 1RZKH 4ZFOA 3VXQB 1T0NB 3HC4H 2H1PL 1PEZA 4ZFZA 4P0DA 3C08H 4P2OA 4G80B 1JGEB 1T66C 4OZHF 1WZ1H 4X8JA 1A1NA 3EDKA 1A3RH 1KV3A 1N4XH 3KWWB 5DHYA 2BCKB 1U42A 1K85A 4NYLA 1VADA 3VCLB 4NKIL 1OP5K 2VLLA 5FYJU 2W59A 1QLEL 2JELH 3BH8B 2XQYG 1N3NA 4P5MA 2X4OA 3GIZH 4M6NL 5C0ND 4WCYL 1ZHNB 1UC6A 2VR5A 5E6ID 1YYMH 3JWOL 1EGJA 1UXWA 4CNIB 1J1OH 2JJSA 3VE0B 1D5MB 3SGDI 2EDHA 3W9DA 3SE8L 2VDML 4U6YA 4HCRA 5FO7B 1R5IA 4X6CE 4HK0A 5CP7B 2R4SH 1B0GA 3MODH 1F6FB 4JHZA 3WFZA 1CE6A 3F62A 1TFHA 1FP5A 5F93C 2NXYD 3NIFF 4WUKL 2LU4A 4JFHD 4J3XA 4DGVL 4OB5H 1HEZB 3OMZA 1PD6A 2I25N 3O4LB 4JN2A 4JGMA 4U2ZA 2Y6SC 5DFVC 5ALBH 4XMPL 1M71B 3H6JA 4DZBB 2PTTA 4P57A 4TOYH 2HTLC 3LZFH 3RWHB 5ESVA 1G7PA 4XXDA 1G9NC 1U3ZA 2W0FA 4QRRA 2YWZA 4XPHL 2W91A 3BZFB 3WNNA 4QHLA 3ZT6A 5FO9A 4QTHA 4L4VD 4JREB 3MJ6A 3QCUL 1CLYL 1PSKH 3VA6A 3FMGL 1TETL 2HVJA 2Q76B 8FABB 5BXFA 4PGCB 3QUMA 5BMFL 2FCBA 3H42L 1MFAL 4IRZH 3U0WL 4DQOH 2GK0B 4N90D 4YFLF 2YUZA 2AXFB 5L2KB 3SCMB 4PJBF 4M7ZB 1F11B 2C26A 5GGVH 5FGBA 3QCVH 4M43H 3WUZA 3PNWA 2OJEA 4K7FA 3QUXC 4D0CB 3FB6A 1T2XA 4NO0B 5KS9E 3EYQD 1DDHA 2CKNA 5AZ2H 4O2CA 3O45A 3SDCA 3ELAT 2DL2A 4V2BA 3UC0H 1JVKA 5LWYL 2VIRA 3TT1H 1FPTL 5DQJA 3C9NB 1PX3A 3F5WB 5KJRL 1J0YA 5EFIA 2R56L 5CD3A 4QGYA 3CU7A 4NOFA 1KPUB 1QSFE 2AGJL 4U31A 3EJJX 2CJUH 2RFXA 3QUZC 3VI3F 5E94A 3OG4B 4WNQA 3HZKB 5GS1A 1A02N 4LSDA 5KVGL 1YN7A 3FRPG 2D7QA 1JGVH 1JNLL 5L7XH 5IF0B 1YPZE 1TJIH 3IU3B 4JANA 2ZUVA 5JLZA 3MNWA 1VKXB 4MJIE 4OKVB 4E5XA 4TNVF 2R0ZL 3ARSA 2Q8BH 1PY9A 3SDCD 2PO6D 5L8JB 1C1EH 1RFDL 4UT9L 5IVOA 4C54A 4JHAL 1DUZA 4NZTL 4OZ4B 3REVB 3VH8B 3KVQA 4MNQB 4KKLD 1GGYA 1ZK9A 5IVXF 4HMDA 4BYHA 4AQOA 2EE3A 5FF6A 1M1SA 1F2XK 5FV2A 4WHTB 1CICC 1KYOJ 1U58B 5HI5C 4HQQL 5CSGA 1U8NA 5I74C 5IUSA 5A3ID 4WV1B 1KB5H 4XP1H 4Z7VA 5JNYB 3UAJD 1I9RL 3EO1A 2O61B 1OHQA 4HIJA 4J3UA 1C5CH 3LV3B 3OAYH 5GSVA 4BFEA 3FO1B 4YDKL 5FYLD 4X7TA 3HCVB 1PKQE 3EJYC 3OKEA 2R1WB 1RUPH 4Q9QL 3RWGB 2EO1A 4XCEB 4NJAH 5H8DA 4WY7H 1CGXA 2GT9A 3BMWA 1FN4B 4LASL 1F45A 5ECJE 2IPUG 4APQD 4XVSH 3UTQA 3P4NB 4ZS6D 1FLRH 4I0KA 4NQUA 3CLEL 3TEUA 5DEGA 4KWUA 2J3SA 1ZTXL 2WBJB 5I6XC 2B4CL 3S88H 1BIIB 4UQ3A 5I18L 1BLNA 3JVGA 3ZE1F 1RJLA 2DQDL 4XVJL 5JA8B 2DTML 3MGTB 2EDJA 3VXUA 4LU5H 5KG9B 2DQJH 32C2B 5I1KH 2VTFA 4MJ2A 4LKCB 1G7HB 1UZ6E 3CLFH 1S7WA 2CKBA 5DO2D 4LRIA 2A6JA 2X2YA 3KLHC 3C8HA 3BKJH 2HWZL 2IANB 3ILPB 4G8IB 1G1YA 5C0AB 1RUQL 1YEDB 5D7JD 1U8PB 3GI9L 1GH7A 3MV7A 3QHFH 2D31B 4LCWD 4RDQF 3T0DA 4UIMA 1T0MB 4XI5C 2R8SH 4P46D 4X83A 3IDMB 5TQ2H 4FFWC 1QLFA 1FH5L 4ODSH 5TH2A 3FOLA 5CKAA 5E08L 5CMAA 1BQLL 4UTBH 1F4WL 3S36X 3CH1A 3G6AB 1QRKA 5BZDB 3ISWA 1QP1A 1J8HA 1G9NH 3O11A 3BH9A 3C87A 3D85D 1DQML 4KVNL 3G08A 1BJ1H 1Q72L 4YE4L 4PB9L 5DVOA 1BQUA 5HHNA 2P5WA 4YR6A 4Y4HA 2VDKL 2KZWA 3TYGL 1N5AB 1A6ZA 3QRGH 4Y1AA 1NDGB 3EOAA 4GS7C 4B5EA 2ATPA 1DFBL 1P4LB 3GMQA 3GSRA 4KDTC 3TPKA 1KYOK 2X1QA 3OJMB 1M7IA 5ITFB 4JG0L 1FZOA 3NZHH 4ZUTA 4HULB 4XNMB 4NWTH 4P3CH 4PLOB 1RZ7H 3LOWA 1K4DA 1AGFB 5DK0B 3UJJH 4KHXL 1X7QB 2YS4A 1Y0LA 2X4RB 1X4XA 4I3SH 3LEXA 2C7UA 4EXPX 5IP4A 4PR5B 1REIA 5CGYC 1UM6L 2IG2H 2JCCF 1CYGA 4Y4HD 1MELA 3EHBC 2XWJA 1QHOA 3GMRA 3VXSD 4JO3L 4OAWA 1CFVH 5JW3L 4XVTH 4Y1AD 2DQUH 5D1QA 5EPMB 3OKLA 3IKCB 4IJ3C 3RVXD 3LRSA 1CD1A 1KIPA 3FRPA 5I8KH 3HC3L 4HFUL 1WCBA 1R3KA 2DRUA 4YX2L 5FB8B 5GGTL 3NACL 1I85C 4E0RA 3EKCA 3P2TA 3ARGB 4N8VG 1DQLH 4NJ9H 4KI5D 1A3LL 3ZTJH 1H3PL 1Q1JH 3ZTNL 3UZEA 4M4RA 1I8KB 3MRJB 2GCYB 4J4PD 4NQSA 3RZCB 2HH0L 2XFXB 5DEFB 1YNLL 3L3JA 5M94B 5JORA 5EU3A 1FO0A 1OARL 2DM7A 4GT7A 2PR4H 4Z95L 2IBBA 5SX5K 2V5YA 5ICYA