4YHBA

Crystal structure of a siderophore utilization protein from t. fusca
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
261
structure length
261
Chain Sequence
b'ERTVEMYPLKSRLLEVVNVRRITPRMVRVDLGGSDIAGLRSDNFADHVKLWFPNPETGEHVLPVVEDDRCLNFRAPGVIYRDYTVRRFDAKARLLTIDFVVHDNGPGGRWAATAQPGDRLGVLGPRGTVYYPEADHYVLLADETALPAAARRIEELPRDASVTAFFEVADAAEEQELDAPEGAEITWLHRNGAAPGTTDLLLRALEQTEFPKGRVFVWAGGEADALKPIRRLLKERGLVRGRDFEVDGYWRRGVSNLDHHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-chelator utilization protein
molecule tags Oxidoreductase
source organism Thermobifida fusca tm51
publication title Structure and Mechanism of the Siderophore-Interacting Protein from the Fuscachelin Gene Cluster of Thermobifida fusca.
pubmed doi rcsb
total genus 64
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04954 SIP Siderophore-interacting protein
A PF08021 FAD_binding_9 Siderophore-interacting FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4yhbA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4yhbA02
3SJZA 3E20A 1K8AD 4LC0A 2RC6A 4EH1A 2YWHA 1DARA 4RCYA 4QHYA 3G6EB 3A1FA 3MHPA 2VNHA 3ZZUA 4C0SA 4WQMA 3CB4A 2BSAA 1TVCA 4PC6A 1FRNA 1EP1B 1D1NA 1S0UA 1OB2A 2YWEA 1E64A 2BVNA 3W2GA 4PC3A 1SKQA 1A8PA 1BJKA 2D74A 4RD0A 1JJ2B 4PC2A 4HE6A 4ZGQB 1B23P 1IB0A 5EMNA 3I1FA 2DERA 3ZBTA 1KTVA 4RD4A 4YAOA 3W5UA 1EFTA 4PC1A 3U6KA 4IW3B 1HA3A 3JQPA 4MYTA 3CC4B 3JQQA 1OGJA 4YHBA 1Q82D 2B5OA 3AVXA 3CCUB 3QSYA 3I56B 4YAFA 3CW2A 4FK8A 3MMPA 1QH0A 4M53A 4NBSA 1VQLB 1GO2A 3ES9A 4NCNA 1KK2A 4H9GA 1VQ4B 1U2RA 4B3XA 3CD6B 3W5HA 5FA6A 1EP2B 3ZZTA 1EFUA 1FDRA 1GJRA 3U6BA 2OTJB 3QFRA 1N0UA 1EXMA 1R5BA 4ACBA 3W2FA 4U9UA 1TUIA 3OZUA 4G1VA 3CC2B 1BX1A 3WYAA 2VYQA 3LRXA 2BM0A 1FRQA 4YALA 4ACAA 1TTTA 5THXA 4G5GA 4Y9UA 4P3YA 1SM4A 1G7SA 3CRZA 1G7TA 3OZWA 5GV8A 1YJNB 2GQFA 1GR1A 1YHQB 4UAJA 1XE1A 4QFMA 1QFZA 1M90D 2QEXB 3P27A 5TY0A 3CCEB 3AGPA 1ZM3A 1KD1D 4ZV4A 3VNUA 3B82A 3FPKA 2QDXA 4RD2A 5HXBA 1EFCA 3CCRB 3ZZ0A 4YAWA 4R71A 4RCZA 3G4SB 2BN4A 2GPJA 2HMAA 4TMWA 2C77A 3CXCB 1FNBA 4ZCMA 2BM1A 1Q81D 3QE2A 4G1BA 4K1XA 3U2QA 1D2EA 2BF4A 3WBJA 1OGIA 4FN5A 5H5JA 4AF6A 3CMEB 5JBQA 1DDGA 2CNDA 3P26A 1GVHA 3CCMB 1QUEA 1EWYA 4M4SA 3AVTA 3PENA 1NDHA 1J9ZA 1FNMA 5AN9A 2BGJA 2BGIA 3CCVB 3G71B 3W2IA 2J7KA 1YI2B 2DEUA 3QFCA 1KJZA 3LYUA 2NPFA 4MYUA 1ELOA 2C78A 2X3UA 1D8TA 1R5OA 2EFGA 1QGZA 1CQXA 4AF7A 2QA4B 1JNYA 3LO8A 4PC7A 1VQ9B 1N0VC 4Q7JB 1GAWA 3WNBA 1AMOA 1FNDA 3CCJB 4B47A 1WDTA 2QTLA 2HCJB 1KK0A 1JA1A 1DDIA 2VNIA 4ZCLA 2QN6A 4LBVA 1S72B 3QFSA 1VQ6B 2YWGA 3E1YE 1QX4A 1UMKA 5H59A 3CC7B 1Q86D 4RD1A 4PGOA 1E63A 3AGQA 2XNCA 3VO2A 1YITB 4TMXA 4DQKA 4M0LA 4RD6A 2XNJA 1KRHA 3OJWA 1TLLA 1VQNB 3AVVA 2VZLA 2E1RA 5KSWB 3WY9A 2DCUA 2BV3A 1K9MD 1W2BB 3W2EA 4LBWA 2FX3A 4LBYA 3AVYA 3VMFA 2OK7A 1ZM2A 1QFJA 1KK1A 3OW2B 4M2LA 3WNDA 1VQ5B 2PIAA 3B8HA 1KK3A 1BX0A 2VNKA 2BPOA 2VNJA 4N3NA 2DETA 2OTLB 1F60A 3J81k 1W34A 3JQRA 4TMZA 4ZCIA 1G7CA 1VQOB 2QTZA 1KQSB 1QVFB 1VQ8B 4B43A 2ZITA 1AIPA 1VQ7B 1E62A 1FNCA 3VO1A 1QFYA 1K73D 1QGYA 4Y9RA 1W87A 3W5VA 3AVUA 3CPWB 1QUFA 1XB2A 3V76A 2OK8A 1YJ9B 4YAUA 2BMWA 4B4DA 1G7RA 4B44A 4TN1A 1Q7YD 1CNFA 3AVWA 2PMDA 4RJLA 1N8RD 1I7PA 3WNCA 1IJEA 1JB9A 3QFTA 3WXMA 4P6VF 4HE5A 1YJWB 4RD3A 1VQPB 1ZM9A 4AC9A 2PLFA 1DG1G 1KC8D 3ZC3A 3WBKA 1H85A 2CRVA 1IJFA 1F20A 3CCLB 1NJID 2RC5A 1EP3B 2DY1A 2HDNB 4M1KA 1W35A 4N3GA 1CNEA 4DQLA 3VNVA 2YWFA 4TMTA 5GV7A 2B7BA 1OB5A 4C43A 5TV2A 3CCQB 3CMAB 1QGAA 3CCSB 1QVGB 4Y7CA 3OJXA 2EIXA 1M1KD 4ZGNB 3I55B 1VQMB 3LVBA 1GAQA 5TR9A 2AHOA 4BPRA 3W2HA 4TMVA 1ZUNB 4FWTA 3MCAA 4LBZA 3ZBUA 5DSZA 3FJOA 1VQKB 2B7CA 1BQEA 1QG0A 2QMUA 1YIJB 3OZVA 4F7DA 4B48A 1R5NA 1ZM4A 1H42A 1JA0A 1B2RA 4J0QA 2XEXA 2R6HA 3B78A
chains in the Genus database with same CATH superfamily
1JLSA 3DZDA 3FYUC 3ONUA 4I4TB 4C1NA 4EKNB 3OT1A 1MFPA 3D8UA 2Q41A 3N6VA 5DMHA 3TZ6A 1T1JA 3M3HA 1GPDG 1RJEA 2B4TO 3LM8A 1XJCA 2DJ5A 4M0MA 5LXTA 5DYTA 3HS3A 3R23A 4C7MA 4EUNA 2POCA 3JWJA 4EABA 5JFGA 3PYLA 1ZIDA 1ML4A 3GPCA 3GJ4A 2IH4A 4TTQA 4A16A 3RUDA 4ZN6A 3V1UA 4F1WA 4TV9B 4CLEA 1LPOA 2JI6A 4UU8A 2ISQA 5MDHA 1KQPA 1AK1A 3HP4A 4TUYB 1DWUA 1GGNA 1BE6A 2ADOA 3CU5A 3L04A 1Z45A 2HDOA 3GUUA 10MHA 3CUSA 1ONBA 3DW1X 4JCCA 4UZEA 2ZRFA 3CSDA 1IPHA 4GOXA 5E4FA 4Z4GA 4RDHA 2R60A 4Y2JA 3KKQA 1RHQA 2VPQA 3L7MA 3EXHA 3DZ8A 2C4TA 2YHAA 4LKOA 1T5EA 2NV6A 5CP8A 5DGHA 4UEWA 4EENA 3HB7A 1JGTA 3CH5A 2BVNA 2W90A 1I4DD 2HDWA 1V0FA 4FKMA 4AUEA 1CB0A 1XNQB 4XKVA 1UM8A 5CLLA 1TUEA 4JJ7A 3M0EA 3U7RA 1YR7A 4KI7A 4LZAA 2PX8A 3QVTA 3K0SA 3RC9A 1Q2XA 5J2UF 3OX3A 4GX0A 1AKQA 1HG0A 3PZRA 1ABFA 3EIXA 2CFCA 1IOWA 1PZXA 4JHLA 2DERA 3Q8MA 3ZHSA 1MLDA 1KTVA 3T99A 3GCWA 4OIMA 1O1YA 1TRHA 2C2YA 4G4JA 2V74B 3SXJA 4LGVA 4D0SA 5HWSA 3CVYA 4D44A 1RZVA 1QKJA 4IW3B 1L8XA 1O6CA 2V6FA 2C07A 3EH2A 4M36A 4HUJA 1VDMA 1J22A 3K6SB 1BOFA 1Q82D 4E0BA 3HPQA 3LPLA 4EKYA 3O84A 1PR6A 2XB9A 3RTCA 1VGVA 4Y2XA 3WV5A 4CM4A 1C8BA 1GUFA 2VPPA 2CHUA 4ZEWA 4ZYYA 4RJKA 1YB1A 2HWXA 5JSFA 4OUDA 3CS3A 3UTDA 2EJVA 4MRAA 1PFKA 5BMVB 5ALSA 1W2HA 1SXQA 4DZRA 4N7BA 3Q5GA 3RABA 1WTAA 1EG7A 5DNVA 4R8SA 3R6JA 1VIYA 1HORA 2WF8A 4HNAB 2R6DA 4KRXA 1ONPA 2DU8A 3PXXA 4RGVA 1BS1A 3NVKI 1JZSA 4B6SA 4TS9A 3MT8A 1EX6A 4KB5A 1EP2B 2W43A 1RFLA 1J9GA 2OXFA 4MVJI 1HLFA 3GEIA 4GF5A 4LOHA 4Z9XA 1KOLA 2YBEA 2YL2A 3K1TA 4LJLA 1VPVA 3DBHA 1DE0A 1KY5A 1UPCA 2ZB4A 1QRDA 2VHUA 3C3XA 5A71A 3ZIAD 4XPIB 5F23A 3D0OA 3PRYA 4JBXA 5HE9A 3G8DA 4IS2A 3RJTA 1NXTA 1EBBA 4KIUA 3UJHA 2NVUA 1NXQA 1MXHA 1XLTA 2NV4A 5AQ1A 1EK1A 3AFGA 2GF0A 4OXKA 5G1NA 4KRFA 1O8BA 1JMVA 1EGHA 5D5HA 3NM4A 5B30A 2DR2A 3JU3A 1JEJA 2I34A 2B1JA 4Q1CA 2YFQA 3BWXA 1Z7EA 3IUEA 1I4EB 4RVNA 1H8HD 3QVXA 4ND8A 1FXUA 2P40A 2OYCA 5TRTA 1DBSA 3Q1KA 2F43B 4XM2A 3VPDA 3ZWVA 1IXKA 1NW3A 2VBTA 2BEUA 4LXQA 4OHVA 1ANKA 2ADMA 1FLDA 1N33B 4V3CA 2WYIA 2YZKA 4YJKA 3LFTA 1XT6A 4OB7A 2HA4A 1SOMA 2HHCA 2I6QA 2ZTVA 3ELBA 4Q18A 1N8SA 3TSAA 1BVHA 3NATA 5REQA 4BCBA 4TZ0A 1Q0PA 5F21A 3UJCA 4GRAA 2XWQA 4WKBA 1W8DA 3AHHA 4XGQA 9GPBA 2P0EA 4Q4CA 5GIOE 1Y3BE 3SOZA 2OBTA 4WBNB 2ZQ5A 1D6MA 2GEVA 3CX6A 1MC1A 1YOBA 4HTAA 4M6WA 4Z5XA 1YU9A 2FW8A 2LW7A 3CRQA 3HN2A 4P08A 2YRXA 3B20A 1JI3A 3QZUA 5COAA 4WKNA 5CNJA 3MGBA 5CLFA 5ITZA 1DU4A 3B6ZA 5HA5A 1RHJA 1T0HB 1U8YA 2F4NA 2JC3A 4QC2A 1Z6YA 5HIIA 1RAIA 4QDZA 5KJEA 3HKCA 5EJ4A 2PV7A 1P2VA 5B3JA 3BG5A 4PO3X 5B37A 4Z86A 1C9DB 1P4MA 4FLFA 3ETNA 4QWWA 2PUJA 2C1XA 2BN4A 4NESA 1RZRA 1LQUA 1V25A 1ODJA 4OD0A 3F5SA 2ATEA 3KPYA 3Q15C 4H3HB 3K92A 2QU8A 4B74A 2VHVA 4REOA 1NC3A 1C7IA 4EO4A 3GYBA 4UTNA 5CG1A 1RXCA 4YDHB 1GZ3A 3A31A 3VR1A 4OEHA 4NCXA 3WSVA 1UZAA 1YGPA 4W5RA 1B00A 5FBHA 3V1NA 3W9BA 1AF4A 4GSYA 4U8GA 5C5CA 1PNVA 4CW7A 3TEFA 4FQ8A 4I14A 4JNCA 1GQOA 3T7RA 5TC4A 1Y80A 4ZK2A 1P8JA 2GREA 2FLVA 5AK5A 3GUHA 2C0PA 2QPAA 3T7JA 1MBZA 1L5VA 2MSNA 3GRZA 4WNAA 4Y6OA 3T9BA 3VPSA 1DADA 1PTJA 1A7UA 1CJMA 5DVZA 3OQOA 1KZHA 2I6TA 4YRPA 1G60A 3B7GA 4YP1A 1CJSA 3MWLA 4G0NA 4RDCA 3GJ8A 2HSGA 5FXMA 3HCBA 5HZMA 4D79A 2FPOA 1IL0A 1M2KA 4MYRA 3T52A 1PE0A 1QGED 4E07A 3WTCA 1BA3A 5DPMA 4J3JA 3QSGA 3ZU6A 4L27A 5IAOA 1VPTA 1X7HA 8ADHA 2CV0A 1Q74A 4EKDA 4ZAYA 3EDOA 2G6TA 4ZD6A 5C4MA 1MMFB 4YELA 1OWOA 3FNFA 2DR3A 2SECE 2W6MA 3A4LA 2AFHA 3NIGB 5M29A 4M88A 5FBZA 1C29B 3VM6A 1RP1A 4O4JA 4ALIA 3KU1A 4HNUA 3LF2A 3HKBA 3HY6A 1MPXA 2I8AA 3EZXA 3PA6A 4IEIA 1U99A 3ECCA 1BKDR 4UD2A 1UC8A 5DWQA 5LP6F 5AN9A 1XLVA 3F9RA 4MW5A 2Q7DA 4J76A 4M0DA 3G0DA 2I6UA 3H11A 1DAOA 3C5EA 2GBFA 2AX3A 2BEUB 2JBAA 3KHSA 1TLFA 3QU9A 4WACA 4TVSA 5AVXA 3CA8A 1J0AA 3RJ9A 3DLTA 1K7SN 4E5DA 3S55A 4ALNA 3EQ6A 2ONYA 2D5AA 5IDQA 1EUCB 4RGBA 5E3IA 1A5AB 5BQ3A 1W4CA 2J5QA 2R4UA 1V96A 4MTLA 4TV8B 5A88A 3OPXA 1Q3HA 3ZHCA 1NLFA 2VK1A 3WIVA 1B73A 5EUMA 3AWDA 3WQZA 2HRZA 3EY4A 3OETA 4IDPA 3ND9A 4JL8A 2J07A 3A35A 4OJQA 2OR3A 1LU9A 3CY6A 3P9PA 4DCGA 3P0IA 1I7SB 1W7AA 2WMYA 2ZQYA 1KZGB 3VZPA 3ZHQA 2O48X 2FWMX 1GA6A 3IV9A 1PV4A 2FW0A 1N0VC 5CCEA 5LQDA 3DOEA 3AL0C 4FCVA 4Z51A 3DO8A 3Q8WA 1XZLA 1A0OA 1AMOA 3KEQA 1E5VA 2QLFA 3GD7A 1U90A 2H1VA 5A1TA 1E66A 1WXGA 2H5EA 1RQRA 1TKBA 3VHXA 3UB3A 1E2LA 4CLHA 2Y9PB 2F2TA 4AMYA 1DL5A 4ZOLB 2ZOSA 2JCSA 2QQFA 1H4TA 3RAFC 1E5TA 1DC4A 3L84A 1OC4A 3DLPX 1ZH4A 3UUGA 3OKXA 3DMTC 4J0IA 4FW8A 1YU6A 4L4YA 4WOKA 5L6LB 1JG1A 4BZPA 1T13A 1THZA 4RZQA 5K0CA 2J9ZB 3G9UA 3HKDB 1VHJA 2B8WA 2ZXIA 4DLLA 4BP3A 3VPHA 5K6TA 3O8OB 3M33A 5LWQA 2I3GA 4DIDA 3QE0A 2F55A 1E2JA 1M7GA 3CTAA 4PAAA 2ZUSA 3GI1A 3VNAA 1TZCA 2PH5A 4X8HA 5FUMA 2BSQA 3E82A 2HT6A 4YCBA 3PF8A 1BXRB 1NVWQ 1E63A 3AUUA 1KDPA 3VO2A 2BFFA 4CU2A 3ER9A 1C1DB 1MTOA 2EGGA 4LV5B 4O5AA 1CY4A 1TYDE 4XOTA 2HRQA 4ZVRA 2QW8A 4JVOA 4AY6A 2V58A 4M0LA 3ESDA 2XB2A 4YCCA 5ECWA 2EIHA 2R25B 1CLUA 1DLJA 4PQRA 4TKOB 5ICCA 2ETVA 5E8RA 4CMEC 4F3CA 5CXQA 2AW3A 5KYKA 4MS1A 1CUIA 2FN9A 2JAQA 2NXNA 2XNDD 1XDUA 3MB8A 4JC8A 4L4RA 3SYNA 4OMFG 4BV9A 4YRAA 2H5JA 1RMTA 3AEKA 1H4QA 2VTEA 3DDWA 4QAQA 5B58C 2JPDA 1A8HA 2HDHA 3GV0A 4A6XA 4OQEA 5F12A 4WNAB 4Z4ZA 1M66A 2ZZNA 4HHEA 2O4CA 4TQUS 1TAQA 3GBPA 3W2EA 3GEGA 3HR4A 3NHRA 3H9NA 3SQMA 3AHFA 4ZO4A 4D3SA 5G3YA 3RYCB 2HZBA 5IU6A 4DCTA 5KHLB 3MJVA 1DTWA 5A3QA 2GLXA 3LAWA 4LQLA 3VMFA 3UK7A 2ZYAA 2LKCA 3NDIA 1H8EA 3GROA 1YHNA 2X1MA 2D3WA 1KFBB 3H1PA 4QELA 3EZYA 3N6XA 2II6A 3P0EA 2GF9A 2PZEA 4LY0A 3JPWA 4BMZA 3L8EA 2D0OB 4MV0A 2AT1A 2BKUA 1JKIA 2O4UX 4V1CA 5BOSA 1HYGA 4GU5A 4S2EA 2C4NA 3ZLVA 4IOJA 2RKWA 2Q1UA 3DZHA 5CVJA 3ICQB 4J2TA 1E2KA 3H5LA 1S2DA 1Q0LA 3L7DA 1UBRS 3EPKA 3AESA 4CEIB 4YI5A 5LC1A 2YVLA 5J4VA 5T67A 2ZXFA 2YW9A 1AHNA 5J63A 4NULA 4MVJA 2NQ8A 4UCWA 3O47A 5EQFA 1WKBA 2BONA 5EZ5A 4YV2A 1NE7A 3UYKA 1DLIA 4B81A 1I01A 2DFNA 4GX1A 2GCOA 2P4EA 2Q07A 2R11A 4W1RA 2AJLI 1B8VA 1XDGA 3PPVA 2ZPAA 5GZ3A 1XO1A 3KSDO 1KSHA 3FYTA 3L40A 1NQAO 3UB2A 1DIGA 1XZNA 4YJDA 3AEQB 1W29A 5LLSA 3LUGA 3NT5A 3L9WA 1UFQA 3H1BA 5EERA 1X8LA 2J3MA 2PMFA 1U3GA 2HCTA 2O6LA 1ECPA 1R27A 3A0UA 1E4VA 3BZWA 4Y9RA 3QVGA 5A1JA 5CEEA 1UXOA 1IEVA 4TRRA 4HCJA 1ZJ5A 1BLIA 2DWPA 2WWXA 4X07A 2OCAA 5EFOA 4QBKA 2VRCA 2GEJA 2V54A 2GAOA 3B2NA 4XE5A 1PJ7A 4EA8A 5CDYA 3CPWB 2BYTA 4PIPA 1KIFA 1PQUA 1QUFA 3ORQA 3LG2A 1LZLA 1N0IA 3JQCA 4B4DA 1V5FA 1E3XA 2XCUA 1G2OA 2Z2KA 3GP5A 3OF3A 1G7RA 1KU6A 2FQXA 3A3GA 2R00C 4IF6A 1EHIA 1OI7A 2DR0A 2QTTA 1S8AA 3M2PA 4FR5A 2GK6A 1PJ8A 4JB0A 4ZVSA 3ZR4B 1H2EA 1SD5A 2P5SA 3L1IA 2B35A 3R0ZA 4HPXB 3IOEA 4PYKA 2EKLA 4EG8A 4RYLA 1EFAA 1JB9A 2PZGA 4LHXA 2JLCA 3KKZA 5LN1A 2G82A 3B13B 5EZYB 1NVKA 1RXSA 2Z1NA 4G0VA 4WZAE 1Z34A 4LYDA 4B2IA 2J6BA 3AOEA 4WZLA 1TQ2A 1NPTO 3A8JA 1WD7A 3KFLA 2TRSB 3A2MA 1ZM9A 1Q50A 4NSNA 3IDAA 4RHFA 3OCUA 5CK4A 5K0SA 2Q1XA 3M4XA 1T0UA 2XUPA 3I9NA 4DPLA 1DX6A 1G8GA 5CCXA 1LXCA 4EJFA 4D9GA 2EBUA 2PKRA 3V7YA 3RFUA 3DQPA 2FDXA 1T8UA 1DXOA 4FFMA 5LQUA 2HL6A 3EFBA 3LU1A 3R6KA 3TTWA 1XEFA 4NATA 4LF5B 1TD1A 4RF5A 2BFFB 1K6XA 4CG2A 4DZZA 2D1TA 1PGNA 2R6AA 2PUEA 2YICA 2CBZA 2F67A 4D9NA 2EBHX 5IMSA 2D54A 2CWWA 1RYEA 1ZGJA 3NNDA 4JC4A 1N9GA 4K6GA 3ANNA 5EJMA 4F4UA 4F6RB 2Z1MA 1OB5A 1KNXA 2AGVA 3K0FA 1LPMA 4G36A 4PWYA 5HG0A 3RTAA 3SSNA 1HDCA 1W36C 1X6VA 2NTYC 2D4HA 4I9NA 4Y2QA 1I6WA 4BPBA 1LBHA 4F6CA 4NH0A 2XLBA 4ZKEA 2O2EA 4XR6A 2B0JA 3IXQA 1Q92A 1GGMA 2VTBB 1AQ6A 2CXUA 1AHIA 3ENKA 3AFHA 2P1RA 4R41A 3C4QA 3U0BA 1XKTA 3GJ6A 3OX1A 1C9MA 4URWR 1Y8ZA 5KYYB 1EXVA 1ISSA 2XDQB 3ABIA 1WOSA 2DG2A 4XAQA 4XOPA 2XB8A 2DT8A 2VFAA 4GC9A 1TVKB 1B41A 4EJSA 3PT5A 1F3LA 3NIWA 4TSRA 4BMYA 4Q1DA 5J43A 4NXMB 1JJIA 2P9QA 4IEEA 4C4OA 3UPUA 3QXHA 2H29A 3EWNA 5EVJA 1P3DA 1P2FA 4AX8A 2V9ZA 4I1OA 3P71T 5KHOC 2C7QA 2O8DB 2Q6OA 2V7XA 3ROTA 4KWHA 1LBTA 2GCNA 3R7BA 1J2UA 2B7CA 2XOKD 2J0UB 1EFKA 5KTYA 1UDAA 1ESNA 1M34E 4R8RA 1G3MA 1QOQB 1CT9A 1YT5A 2H31A 4OREX 4PO8A 1NV9A 3ZGLA 2M6KA 3DMYA 3H17A 3VJLA 1JA0A 1GCGA 4OHCA 4O1MA 5AQEA 4XDHA 1GZUA 4PAMA 3R9WA 1IULA 2ZYRA 3DMPA 3PUXA 1E2EA 4FMBB 5AK6A 3ZHUA 4J0QA 3B78A 1DTSA 1QCZA 5CVEA 5BQXA 1YFLA 1TQHA 4O1HA 2RGDA 1H1DA 1CUVA 1LBQA 1MA0A 3JQAD 4OYLA 4G0YA 3OZIA 1W19A 1YL7A 2Q1WA 3Q85A 3QNUA 3FFAA 3NS7A 4GPEA 3RUPA 4JH0A 1FNSA 2OMKA 3LQ1A 2VDUE 1OWMA 2NU8B 1A4RA 1SKBA 4XFKA 3HV2A 1WF6A 3F9CA 4CCSA 4US2R 2PBZA 5IC5A 3VZDA 4KFUA 5IABA 2C97A 4KV9A 5K3DA 1KKUA 2PNJA 1RHRA 2VYVD 2GCPA 2C5SA 3V34A 1ADCA 1TM7E 4ZZ1A 3AZQA 3HRHA 3UXEA 4C04A 4XD7D 2X0JA 3LUAA 2ZL5A 5FI5A 4X65B 3GIRA 2FWBA 3GJ0A 3O26A 3K1ZA 1YBMA 2JAUA 2OFOA 2BGNA 3R4VA 3MHPA 1Z47A 4BFLA 3U7FB 3OC6A 1BRTA 1LTKA 3DVLA 2IXTA 2AEJA 4M0CA 1DBPA 4KCGA 5A4DA 5JZBA 2CUNA 5I9LA 3VR4A 1L7QA 4IWYA 4OI4A 3ZJ4A 2OZEA 2I7TA 5HKKA 2H9YA 4UAVA 1EINA 2JI4A 2RK3A 4RH1A 2Y4OA 4J1TC 4P3KA 2GN8A 3OOCA 2ZYIA 3GRCA 4P0TA 1ZM7A 1E64A 3BHIA 1F5NA 1KFEB 1VLYA 4NBRA 3SM3A 3LY5A 4OAPA 3QPWA 5EIBD 3THYB 2PUGA 1M5RA 4WNCA 2C2WA 2ERYA 4B4OA 1AV7A 1PX0A 3AR6A 1CQIA 2HNAA 1JJ2B 4G89A 1HDRA 4KQXA 5FKJA 3LUJA 3V4LA 2BFBB 1AGNA 3UH1A 1W2WB 2JIPA 4RTQA 1WD5A 4Q3NA 4QGGA 1O4WA 1PDOA 3OQHA 2QTHA 1W49A 1CZHA 4LXGA 1J8YF 5FPKA 1RRCA 1U5AA 3QA9A 3H2GA 3NBKA 1KH2A 1XOIA 5KBYA 2D5IA 1E3LA 4GW3A 3CXUA 4MROA 4OHOA 2BMDA 4E1AA 2P35A 3NHPA 3TWOA 2BBWA 5P21A 3EGXA 1BYUA 3L6CA 2W37A 3KSMA 4UD6A 3MJTA 5AXCA 2ZZFA 1AE1A 1JALA 1GKLA 2EKDA 2YZ2A 1HRDA 2OGWA 3T1QA 1VL2A 1SIBE 3FPGA 4GLLA 3USCS 3MT9A 1ORDA 3ZD7A 4YAFA 4S0ZA 5HCNA 1PT7A 3BQJA 1NZFA 5GWXA 1T6BY 5JAPA 1I6MA 3EXG2 3THWA 3UT5B 3IPYA 4HXFB 1JXQA 4FJ2A 3QIAA 3A6GA 4FBLA 2IBTA 1DO8A 2FPXA 1HETA 3LE8A 4HG2A 4EB0A 1PEYA 1U7PA 5KYTA 1M6EX 3L46A 2X15A 4Q3KA 1JEEA 5TPZD 4J90A 1GVNB 4NCNA 2XUGA 2G4VA 5A0VA 4S05A 1PJTA 1BDJA 2IHKA 3GY0A 4MUXA 4LZNA 3H5OA 3NAQA 2E4AA 4X20B 1Z2NX 3AR5A 4CV0A 4JV5B 4A15A 4BMPB 4KO1S 2ZBDA 1KBQA 2Z3VA 2EL9A 4OXIA 2ECQA 4DA7A 2ZUVA 3HXPA 4OGFA 4P4GA 4R2IA 2PZFA 5AMXA 5IN4A 1FDIA 3KSZO 1EFUA 3DNMA 1GJRA 4C3OB 5IUNC 5EMMA 4WLNA 3QFRA 1QWSA 2Z30A 1LVHA 4YECA 2R5FA 1RAFA 3KLBA 5SYMA 4DJTA 3AWIA 4UXHA 4QPDA 2FN7A 3IDSA 1Z8HA 2JI7A 2IXAA 3ICPA 2OYNA 1ZLYA 1VC2A 3ANSA 3I32A 1XZDA 1P2GA 1B74A 3I6QA 4V0OA 2IH2A 4MV6A 1QHHA 4CMIB 1T2VA 4C76A 2W83A 1G64A 3O38A 2PZLA 2Q5LA 1LK5A 1G8HA 3AY3A 2BM0A 2ZSUA 3JYOA 4L4ZA 2NXJA 4F21A 1FRQA 2C5HA 4H7IA 4FGWA 5LIRA 2HQ1A 4PLTA 1PG2A 2WVGA 3CV3A 5BN5A 5BV8A 4P4TA 2QV0A 3U48A 1EFDN 2QMYA 3ONDA 2EATA 3OD1A 4DBVO 1OU0A 1XYVA 1NVUQ 4TTRA 4KAFA 3O8QB 1KH3A 1VYHA 5BRAA 3BJZA 1J2JA 1JQJC 4XIGS 1E2MA 3ANYB 1RWBA 5TY0A 3FXAA 4D3FA 1DFIA 2C99A 4GGOA 3QEOA 4CN9A 1PVOA 4E5SA 3LGSA 4P36A 2EGHA 3GJXC 1NQOA 1XL0A 2W6PA 2PE5A 2V5AA 4BB5A 1FSZA 4L8FA 4RV5A 3D4OA 5CLHA 1D2RA 2DTEA 3NOXA 4TXHA 5CT6A 1JHXA 3KB6A 4R01A 3REFA 5LLDA 2VLIA 3AM4A 4UOEA 2MSCB 4JXZA 2JLXA 3CGGA 1WLSA 3AHEA 1KJJA 3TI9A 4E15A 3FYUA 4RCZA 1TYBE 2C7GA 3H2YA 3G4SB 1NONA 2Q5JA 4A9AA 4RDJA 4BC0A 3PTAA 1PWXA 4K1LA 1NW9B 2CL0X 3OTHA 4I4CA 3ETGA 3UWOA 3WGQA 2VSNA 1IPEA 5HRUA 1YJ8A 2X0EA 2Q9UA 3VGPA 3HR8A 2NLOA 3T5CA 3DMDA 3JVDA 1M2NA 2RSLA 1PFUA 2G7MC 2BEVB 1IZ8A 3MTEA 2P2NA 1KO8A 4ZI2A 3C7CB 4E03A 1JXMA 4MUEA 4UOZA 2LVBA 2V7TA 4QDXA 4MV9A 3BKWA 3L0ZA 4IXMA 4AZ3A 4KFCA 1VJDA 2QLLA 2QGGA 3DOJA 3OY2A 3QWHA 4WFKA 2VF5X 1CRQA 1WXIA 1ENPA 3G49A 1HV8A 4JN6B 2R85A 2ZRHA 5KAMA 4L1KA 3DMHA 2HY7A 5AW9A 3WK5A 4KR7A 1ORTA 3W8EA 4KXNA 1BO6A 1UP6A 4FFVA 2PUFA 1URPA 2E85A 3DFKA 3HBLA 3OOJA 1ZIYA 4MTCA 2QRHA 4RLHA 1JEYA 2PGNA 2HLPA 3LY8A 2FG6C 4FZ3A 3USES 3FR7A 2IH5A 1JTVA 3QVMA 5B4TA 3ZD6A 4DY6A 3NHZA 2GEBA 5DLYA 4L0DA 3WIUA 3EQ2A 4C21A 4HH1A 4YJ2B 2N42A 1PW7A 3H94A 1K7EB 2LR0A 4HLDA 3MCVA 3TXAA 4YV0A 1J8VA 1QE3A 2XE8A 3HB9A 3WICA 1KOGA 4M1EA 5LBTA 1CUFA 3ZDCA 1L4HA 4LI3X 1EWYA 1Y5LA 2YHUA 1S4MA 2ZJZA 3FTDA 5K0EA 2GEDA 2PSDA 2OHJA 1CZUA 4KQWA 1ODSA 3WXBA 1SWVA 4ZHQB 1Z13A 4WOJA 2O8BB 5THKA 1F6WA 3IXLA 1C7ZA 3C87A 3O2QB 1T10A 4R0MA 3JQGB 4F2GA 2H63A 4FT4A 2NZVG 2CNNA 3KZXA 1DZ3A 2HIAA 5JS8A 1WM1A 1LJUA 1MC8A 2DPGA 1KMMA 3BIJA 4Q4HB 3ZUPA 1EIWA 1AKNA 1RMQA 2OP1A 1MD9A 1MTZA 1XUOA 1DAMA 1ZO8A 2YWCA 4INJA 2XUHA 2FEPA 3VR4D 4QGSA 1POXA 4YT8A 1IRIA 2FHSA 1B3RA 2P2CA 2RH9B 3BCUA 5LNK1 3VJRA 4DR5B 1N1MA 3D43A 3LXUX 1GTZA 3V7AA 1VZ3A 3KB2A 3PFGA 4CTKA 3RWOA 3PC6A 1GAWA 2GZ3A 3K70D 3U7IA 2ZJ5A 2RHJA 3DSRA 5BYKA 4RPDA 1FNDA 5IBPA 4J07A 2SKCA 3V55A 5J4LA 1EUYA 3INTA 1OAKA 2YVAA 3N0RA 3NBXX 1IK6A 1QO0A 3C6ZA 3BT7A 4TS3A 1XYYA 4D81A 4OTZA 2EFEB 3DHYA 3E9QA 1U28A 2M98A 4K28A 4TQAA 3LDHA 3DEAA 3G0OA 3UVEA 3NHWA 1G6KA 3CNEA 3DVAB 2WIBA 4LHZA 1NNEA 3MRTA 3P4UA 3P32A 1R0LA 2BFNA 1S72B 1AZTA 2ZI5A 4R8MA 2D8MA 5IDVA 2YV5A 2HSJA 3L7CA 3ZCQA 2OCYC 3HYSA 4YUYA 3ZXYA 1QC5A 3PICA 5JZ9A 1Q3TA 1G20B 1NI4B 2IV7A 1G2PA 2NYVA 2YWGA 3OZEA 2C82A 4JP1A 5FP0A 3REQB 5JSZA 1IBKB 5EWLA 5AVUA 1OZ0A 1VYUA 4H4EA 4ML3A 3P4YA 3THXA 4IH9A 1TYZA 4RVSA 2ILVA 3CC7B 5HZKA 1ETUA 3DR3A 1IEWA 3TNFA 3PQ2A 1DC5A 4XRRA 3ILXA 4AMGA 4EJ2A 3I5XA 4FYJA 4PNHA 4I50F 1ZRHA 4C7VA 1GNQA 2Z8YA 5E6RB 4URYR 1DQSA 2WHEA 2XWBF 5K0ZA 2CW5A 1VL8A 1DC3A 1ZEJA 2EZ8A 2R66A 3L0CA 4MQLA 3X1KA 5BSXA 1Y4DE 2FETA 2I3AA 4KAXA 3WZ2A 1B8PA 1ILEA 1XEWY 5KDLA 2PLNA 4P53A 4QODA 4HDNB 4RPGA 5AWFC 3ZZ1A 4DV6B 2R2GA 3VKGA 2XMRA 3IVAA 1WY7A 3JATB 3HABA 4PYRA 1OH6A 2FUG1 3OQIB 3M6AA 3QMVA 2VJAA 3RFTA 1PUJA 2XNKA 5A4AA 2LBPA 4QM7A 2ZT6A 1XZPA 4IDDA 1OFHA 3KOMA 5AIBA 1COZA 2LCQA 3RSSA 5KNCA 1NT2A 4BFWA 4JDUA 4BGVA 3NHFA 2VQDA 4NZYA 1JSLA 2P41A 4M7PA 2FX3A 1ZK1A 2UUAB 4MPTA 4C3ZA 1EGMB 1ISHA 4CLRB 4N0PA 2XW6A 1Y5RA 2AG5A 3M70A 5CFQA 3BK2A 3JWEA 1NNI1 1AUXA 4AFNA 2Z2ZA 3WNDA 1C2TA 1R8QA 2KMLA 3ENVA 2R2AA 3EGCA 1H0KA 4GZ6A 3MWKA 2NZWA 3OSZA 3IB3A 5IARA 4GKJB 4AT1A 5LKAA 1XRQA 4GR9A 5LYYA 2DETA 4F9TA 4ZVVA 1T6ZA 2BFMA 2VBFA 2YIVX 3ZK7A 5EKUA 2VPWA 4AVZA 5BW5A 4EB6B 3HFGA 4XNFA 1CIJA 1WTCA 4MIOA 2ILTA 4PAGA 3WJ7A 1F60A 1Z6GA 4WY2A 3OFVA 2I7DA 1O94A 2WWFA 1JE1A 1UK8A 2WE7A 2Z5FA 2AR7A 1DHRA 1UWVA 3MTJA 4Q7EA 4C7KA 4Q16A 2ZBVA 1SVLA 2ON6A 4AURA 2DQKA 2Z8ZA 4M8NE 1W34A 2ZRAA 1G8AA 3RC8A 4V0MA 3DYBA 4R7GA 2WFLA 1TW3A 4Q1VA 1XU7A 4UEJA 4GG1A 1NBMA 1X38A 4YP7A 1OXBB 4AS3A 3G68A 3PC8C 4ZYTA 5I7OA 4K87A 4X92A 3EH1A 4E2WA 5EKTA 3JTMA 4M22A 1AOXA 1DCMA 4CU5A 1SUEA 1Z5UA 4DLWA 1F4LA 1C3XA 3KDSE 3UATA 1SRQA 5J4KA 2Q2QA 4KU4A 4RCVA 4TZKA 4AMUA 3K1JA 5T4FA 1L6RA 3MOGA 4G4SP 3V76A 3AZPA 4U7PB 5AI0A 3L1KA 1XXHE 3TLAA 4D97A 3FUVA 1BG6A 4UZSA 5D85A 2XMQA 2AOUA 1H5UA 3GIWA 1L4GA 4TN1A 1DAKA 1V3QE 3H2HA 3K72B 2C5EA 4MWZA 2FQWA 4JGIA 4UPVA 5BV2P 2PMDA 3AJRA 4GYWA 1ISGA 1A27A 4LVUA 4G56A 4MYHA 2Y1CA 4OJYA 2NPIA 4DC9A 4QTYA 3GA0A 4GMKA 1BDMA 1Q91A 4LCJA 5DP1A 4M0PA 2O8DA 3PPYA 2JAOA 2O52A 4H7FA 1QTIA 4JA0A 2FH5B 3I9FA 5B4VA 3KIPA 4MRMA 2KWIA 1PDWA 2CWDA 3PWTA 5HKLA 2QNBA 3TSOA 4DNPA 4QLBA 3CR7A 1Z0IA 1KI7A 2ZJ1A 3TRIA 5C53B 2PGLA 2QZSA 4G5XA 4YDSA 5ALTA 4GP7A 5IMBA 3G5LA 3LQKA 1W6UA 3W8RA 3SHFA 2YFHA 1P6XA 2GZHA 2MR6A 1IN5A 2ZROA 2PX5A 3PLNA 5ERYA 3PC4A 1LDGA 4JT2A 5TQ0A 2PZKA 1ZBQA 3RRBA 1CNEA 4D43A 2HQBA 4J4BA 3QPVA 3K8QA 2XHEA 5K2MA 1ZVVA 2A8YA 2J08A 5ELMA 5FO1A 4ZHQA 1O6FA 2EKQA 3CCQB 2ZJFA 4YO7A 2B7LA 4CIWA 1N77A 1WOPA 3PEUA 1KEWA 1RRPA 2XMDA 4YXWA 4FMDB 4HDOB 1JG6A 1VFPA 2Y0DA 3AR2A 4MQFB 5JS2A 4CQJA 3ZZMA 3BH4A 1UPXA 2ZIVB 2BZ1A 4FBMA 3UA4A 1W76A 1LKZA 4N1AA 3ESBA 5AVQA 1OR8A 1SPXA 4F06A 2V9CA 3UUEA 1CUJA 3OQMA 1W48A 3N1UA 4PLYA 2ZZMA 2KW5A 4MDHA 2BY4A 1PGQA 1UWLA 4XPZA 2I4TA 1T9BA 4N9WA 1W0KA 1UK7A 2I4OA 2QORA 3P9NA 1GDDA 3QNMA 3QYPA 2OMEA 2B99A 4NAHA 3ZE7A 4DANA 2PBLA 4URZR 2QUBA 4Z1OA 5I7EA 3QEBZ 4N9QA 4RKQA 5J3OA 5IPFA 4GS5A 1LLUA 2BEKA 2BFAA 1XTJA 3CBQA 3ID6C 2H0QA 2I54A 4GR4A 4IH4A 4M38A 1LLFA 1S3SA 2R8RA 5FBKA 4TGLA 1M1XB 2QP9X 4XEHA 3VAYA 2QG4A 3R6TA 3THYA 1N6NA 2ZRMA 5AJUA 5BT9A 4RTLA 1WB4A 1J9EA 1FFDA 1TZKA 4AK9A 4QYMA 3T0FA 4BV2A 4DJDC 1U9ZA 2JIOA 3PG5A 1Z4KA 3LW7A 3JR7A 5B53A 5HJ7A 4WEQA 4LF9B 4FFSA 2VSQA 4JT9A 1EVZA 2R8XA 2VUSA 1DC6A 5AVVA 3B3QA 3FKQA 2B6HA 4L9RA 2BBTA 2NO0A 3P5SA 1C9YA 3WKBA 4JDPA 4S24A 3GAZA 4JUDX 1CK4A 2XUZA 3U7QB 2PJUA 2E5FA 2FSIA 3A05A 4YCJA 3CT4A 2YWHA 1LC0A 3DL2A 1PNRA 4ZQGA 3TNLA 4QDKA 1Q2UA 4UVEA 3ZWCA 1UBCA 1ZIPA 2Y71A 2Z43A 3KEGA 3QX9A 1WA5A 1P2TA 1ZI9A 2F8MA 2Y1XA 3DOUA 3ACBA 3FOBA 4ZZIA 1Z0KA 4EF4A 5F2NA 1Y0YA 1AC5A 1SRRA 3ISTA 4XR9A 1YR8A 5DIFA 3I72A 4NK4A 3T56B 1OWNA 3DWIA 2W42A 2DRIA 3D8RA 2WAMA 1GPAA 1NNLA 4QVJA 1KC3A 2CNLA 2IEAA 3MT0A 1H0HA 2YZNA 1G8PA 2KI5A 1XZAA 4ER0A 5DTEA 5DS0A 2I6XA 3IAFA 3LKDA 4LCBA 1E2FA 2ZCUA 2V7QD 1KDVA 2EL7A 5ALFA 2QGNA 1NDQA 3BTSA 1H65A 4ZJZA 1P29A 3FX2A 1RLTA 521PA 1YQTA 4GQAA 5GONF 3II6X 3FUXA 1E6MA 3FPSA 3HY3A 1R3DA 4YFYA 3RIGA 3T7DA 2RHHA 2YNMA 1I2MA 2CGEA 4JXKA 1BJKA 5JH7A 4GZ3A 4RVHA 4HUQB 1MABB 3IX7A 1GZSA 4AY3A 3G2JA 4JMLA 2PMWB 2XY4A 3P2YA 1IM2A 3N2EA 4NVRA 1QANA 1RDFA 4PU0A 3T9EA 3UMSA 4FMPA 2IPOA 2QJRA 1N92A 4Q4DA 2FN4A 4FD3A 3KTOA 4M83A 1RBYA 4M9ZA 3VNSA 4EJSB 3W5UA 4DUGD 1U0SY 3KYIB 3UNXA 4BNDB 6ADHA 3WGIA 3TXYA 1MR3F 4BC1A 4B46A 4N5IX 3E22B 5BWLA 3HO6A 1B76A 4YRCA 2CN1A 3LKBA 4I9FA 1NY6A 1T36A 3FOEC 4PZYA 4N41A 1A76A 1TA9A 2UVDA 4OAOA 4BNXA 1AUVA 4QQFA 2OZKA 3QYAA 2L2QA 2DUJA 2CD7A 3M6VA 1UBGA 4O2AA 3Q7IA 3BL6A 1TU0A 3VSBA 1EWQA 3CKLA 5BQPA 1SGWA 1LPAB 2QSYA 3B7WA 4G01B 4OM8A 4QTUB 1RM4A 3TR6A 3EK2A 4C3VA 2NGRA 1HNXB 3PA2A 4BQOA 4C88A 1JR4A 1E96A 2CNOA 4NFSA 2ZIFA 1MIHA 4TVOA 4ZVPA 4NOMA 5HILA 3UM9A 3V2IA 1IMJA 1FTNA 1RQXA 1SCDA 1RADA 3NM5A 2ANCA 2H1WA 3HBAA 3PXAA 4H60A 3HO8A 4RVUA 2ID9A 4NENB 1XEXA 3EUEA 1Q7BA 3KPUA 3OUZA 2O0JA 2VN8A 4QUGA 4WGGA 4L75A 3N87A 5FA6A 2FW6A 1Z8NA 2QNRA 4W4TA 2IYSA 2XCIA 5A04A 1CUGA 3C1UA 3HADA 1GQFA 2P0AA 2ZPUA 2AXEA 2YS6A 3IJ5A 4CTJA 4GPD1 4NCIA 1N0UA 1PJQA 3I2JA 3OKPA 3PUWA 1ZVMA 5HBRA 1D6SA 3WFIA 1SXGA 3PVCA 1JHMA 4A2CA 3RS9A 4IXNA 1NBIA 4KRYA 1FYDA 2VPZA 4XQ0A 5JE8A 2W2KA 3MGGA 4KK3A 1WCIA 2YJZA 5IT5A 2NP6A 3ISXA 4FPXA 2XXAA 3GF4A 3DEZA 4U9UA 3K35A 4ZI3A 3UK0A 5GJCA 3QM1A 2VYCA 2XZLA 2GTHA 2CYBA 4PGFA 2OCIA 3FRJA 2HN9A 4X00A 5TIIA 1X7XA 3VJMA 1RQPA 2GK7A 5EL0A 3D6AA 3SIRA 3T0IA 3IKMB 1KVSA 3CNHA 3PIDA 2DYKA 4D42A 3OHSX 3L18A 4J0GA 1DBVO 1YJAA 3D8TA 1MORA 2D1QA 2NXWA 1AO3A 3I9KA 1P0PA 2PDAA 1OLSA 5HQ3A 1YJNB 4M1YA 4ABTA 3A8KA 4KDRA 2QUZA 4BMSA 3AXSA 5A4MS 2WJWA 2HOQA 2VBUA 2YOGA 4K9NA 4DC0A 4BZQA 1QK3A 4WCVA 4EVIA 5JSQA 2M5SA 2R8EA 5LA6B 3OZSA 2BFEA 2ID4A 3G5TA 4ENQA 3HWX1 4B34A 5IAJA 2FF7A 2GCOB 4YLYA 1W4ZA 3DC2A 4OX9Y 4ENTA 5EIEA 2GWRA 2JLWA 5CB6A 4WBXC 2O20A 5E95A 3I04M 3NFRA 3R5JA 2IT1A 1HDYA 3IAUA 2ZT7A 3F3MA 5EE3A 4WZ6A 2PRYA 1I3CA 2RH8A 2WEKA 1QFMA 1CUUA 4BNLA 2JKZA 1HZZA 3IRVA 3JQBC 1DEAA 1YJXA 3F74A 1XTUA 3T9CA 1KHHA 4OQPA 1Z6XA 3UHJA 2K7ZA 5COQA 5AKLA 4EELA 1UJNA 3BCFA 1VB5A 1N08A 4LTMA 1T24A 4UATA 3A1EA 4H1UA 1XRRA 1G3QA 1P1JA 2DKFA 2I2BA 3FI0A 3UC5A 3PDJA 5IVPA 4RESA 1T2DA 3TK1A 1JNXX 4Q4HA 1ECBA 4DLPA 4RACA 2XZDA 5LYJA 1MDFA 3AL3A 4ALKA 3MWJA 2V96A 1SCBA 1XG5A 4UFOA 1WP4A 3RVDA 5C8ZA 4HN4B 3OMXA 3QVLA 1R37A 2Z9DA 1EVIA 4OH7A 3TQHA 4ER6A 5KREA 4AG5A 3CEAA 1T29A 2P0YA 4QDOA 4U00A 2RGNA 2IYTA 4FN5A 1LI4A 3CWZA 3OCCA 2RHTA 4ASUA 1HK7A 3V3KA 2A0YA 4Q01A 4EYOA 3RF7A 1J2EA 2GN6A 2JJ1D 5E9JA 5AFSA 1CVLA 1T4BA 3VR6D 4RSRA 1YBVA 3MQ4A 4MOWA 5ESXA 2Z57A 3BA6A 3PJRA 3ETEA 3RJZA 4QOSA 3I6IA 3R7SA 2ZRJA 1WWKA 1IK4A 5H0IA 3WBBA 2OGTA 4IF4A 2LP4Y 1M6HA 3DUFB 4UE3S 1Z18A 2QD5A 1ZUD1 4L95C 3KQUA 1UD6A 1QIDA 2YFYA 2B3DA 3H13A 5SY4A 4YPOA 5BT8A 1U2GA 3GWGA 4K9QA 4NHOA 2JIDA 2PANA 3MXTA 5HR5A 1EDZA 5K0NA 5F9FA 4Q03A 4BTEA 2Z4SA 3LHFA 4GO1A 3CVWA 3D6VA 5A5DA 3OP1A 3G1TA 4M9XA 1X7WB 5BURA 1NDHA 2QXTA 4GI3A 3EVTA 3PLRA 2FXIA 3GLUA 4EGQA 2A57A 2I76A 2P6PA 2QRUA 4E6PA 1ZMRA 4WZAA 1XDWA 2A9PA 1R0ZA 5ITWA 4TYWA 2G40A 2WA2A 3DT8A 2OL4A 1LQ2A 1KO1A 5FUQA 1RKQA 2ZI4A 1VBMA 3EZGA 4K0RA 4YRJA 5NLLA 4AD8A 3M82A 1DBWA 1R4NA 1ZPDA 4L9SA 4CR8A 2NWQA 3GRYA 1N5IA 2I99A 3IVMA 1EFVA 2NQ2C 1I5RA 4ZYWA 3ZD9A 2IYFA 3GUVA 1DJQA 1EK6A 2CHQA 3NHBA 5KTNA 3OESA 1OLOA 1ORRA 2WM8A 1LSSA 3HN6A 3MD0A 2OT3B 1ZNZA 4H3SA 3P2IA 4HWOA 4O4LF 4CKCB 4FOOA 3RIYA 4LYYA 4JVSB 4P83A 3SHWA 2B6NA 3EFOB 1CFJA 3STXA 1RRMA 4RQAA 2GN9A 4FKZA 3N86A 3FGPA 4P54A 2I4RA 3CCJB 1U5BB 3OKCA 2P9TA 1YCFA 3RSZA 3VZRA 3C3CA 2WTBA 3E9EA 3BRWD 4HMPA 4NC9A 1QVZA 5AW7A 3KTAB 3SCZA 1EZ4A 4CM9A 4N5MA 1RS0A 4PHGA 5AHRA 5IXSA 4MS4A 4D9EA 2QGFA 5JS7A 1KK0A 4TV8A 3RUAA 3HJRA 2MMCA 5JNUA 3OG9A 2XOKA 5EJ7A 3GLHE 4YP6A 1PJ3A 3IDZA 4GPTA 2H1OA 4BNMA 3IPCA 3QFSA 3KT3A 1M6YA 3D7MA 1ZY2A 1WIWA 4NZ9A 1PS0A 4QECA 2IZZA 4QT4A 1MN6A 1E6UA 3ECSA 2BGUA 2HT1A 5CVTA 3L02A 5JYBA 4FCTA 1GG2A 3H9JA 4F5DA 5JJBA 1J39A 2DUMA 3LK6A 3WRWA 4AWXA 1OU4A 4B3SB 5BN3B 5ALQA 3CEMA 3FAKA 4KH1A 3GU3A 4UMVA 5HK8A 5BMVA 3FD8A 2DQ4A 1L8QA 4BLUA 5JD5A 2VCEA 1RYZA 5AO9A 4YUVA 5C46F 4BVHA 1E61A 1NLMA 3M7IA 1A8UA 1Q1QA 1Z9BA 4ZT4A 4G63A 3MS7A 2Q5CA 1PP4A 3LGAA 4ZHSA 4OA5A 3HK2A 5CK5A 1JQ3A 2Q6IA 1M6NA 1MQ8B 2FDRA 3B9QA 1EU1A 1W5AA 3M83A 4O6VA 4QRIA 2I7XA 4E14A 4XVHA 1JB1A 5ESRA 4FDTA 3MB5A 5LSAA 1L5MA 2XX3A 5LDHA 1CUZA 2BHTA 4G09A 4QXMA 4B6FA 4CDGA 1X2BA 3COZA 4V1CB 1FK8A 1FP7A 1HSZA 3SF8B 1X9IA 3VC7A 1TT5B 3VC2A 3ZHYA 4M1ZA 4BFYA 2X5JO 4C4PA 1N1EA 1V43A 1ZAKA 2GCIA 3LL7A 3TYXA 3HDHA 2O8EB 3MWDB 2QR5A 3F97A 4YJHA 5C8YF 3FZQA 1E9EA 3AI1A 4CTNA 1KK1A 1JEDA 1OBCA 2W2NA 4OK6A 4UM5A 1QYDA 2WRZA 1JFSA 1GLVA 4OHKA 4FWBA 3G17A 1LRKA 3E4CA 4ERXA 4DV4B 1TZMA 5I3ZA 1IXSB 3EAFA 4BKQA 2O2HA 3G8BA 4BDTA 2BL4A 1FDUA 1X70A 1U94A 1NYLA 3UV7A 1ACJA 2HXSA 3GQBB 2YWRA 3K94A 3MERA 1KK3A 1SNYA 2ZWOA 3KSUA 2E4ZA 4KRGA 2GNAA 3WJ1A 1JAIA 2GZDA 1QIHA 3GNLA 3TO5A 3DYIA 4P32A 1B3BA 3CEHA 5DM4A 3VH4A 3ZCUA 1T4DA 5FRDA 4RORA 5G2OA 2OSBA 5ADHA 1JQLB 2AEFA 2IKSA 5JADA 2XUDA 3QLUC 3IDFA 4TWBA 3LZCA 4J29A 4UTXA 5FWNA 1O03A 2EF0A 3OOWA 4K6CA 4KO4S 1Q15A 3FMVA 4GI7A 4EA7A 2H4HA 4K8OA 1KQSB 4Y2TA 3FUWA 3U19A 2PKQO 2OHFA 2XITA 2XYVA 4P7GA 4IGEA 2V0CA 5C35A 4DSNA 1AIPA 3OEEA 3S28A 1FNCA 3OJCA 2NYRA 1HOTA 5BVHB 5HNKA 5IS2A 3QWIA 2OHVA 3EXFB 3GGPA 2G3YA 3K9QO 1GDTA 4OI0A 2VBGA 4MRRA 4HVAA 3GVXA 3JR3A 3TAHA 1YDGA 2P3OA 2O19A 5T4HA 3H16A 2XMCA 1JBQA 5FAXA 4CKWB 3ORHA 1NP3A 3AIOA 5EWMA 3TEJA 4TMYA 2G1UA 4HATA 2IEDA 3AW8A 3CEPB 1QBGA 3I76A 1E5LA 3LLSA 4I2VA 5E3JA 5F35A 1BZYA 3BN3A 1MT3A 4GQBA 1KVRA 3TZLA 2WJIA 3M1IA 2DBRA 5TB5A 3E8SA 5JOQA 1SKUA 3QEKA 1AQJA 5F3WB 4WADA 1TUGA 3AL2A 1NC1A 2TS1A 3AEXA 3WE7A 1BWQA 2B82A 3MCUA 5CYPA 3D4LA 1U5BA 3LDFA 4ZOAA 2PWBA 3ND7A 4DL9A 2OV8A 2O5EA 4RELA 4IGAA 3TLZA 5JCZA 1DAEA 3VZBA 2LZJA 2PUHA 5F5LA 3VHQA 4BWGA 2FUG6 4PZEA 2MCFA 1QDUA 3L1HA 4YACA 4Z4EA 4Y9SA 2C57A 2WBLC 4HYQA 5TE9A 4P12A 2ZEJA 3O93A 1ZXXA 4H7JA 4CLOA 1KOFA 1XXHA 3IODA 4ZT3A 1C3OA 4KR6A 3N76A 1HKHA 2A0WA 2J46A 2XDWA 1EIZA 1L5SA 1RSZA 2ZTGA 2YDXA 3KOXA 1ATIA 2VJCA 3OUUA 3PQ7A 2DC1A 3Q8XB 4KQHA 5IYWA 3PHHA 3KU4A 4M1KA 2HADA 1EFRA 5J5VA 2FXVA 5CEJA 4N3GA 1XKLA 2QEQA 5G53C 4TKMA 4N12A 2E9SA 4CFYA 1G42A 2RGBA 3JSAA 3VH1A 4S04A 4I5EA 1ULHA 2XMBA 2YXBA 2FPUA 3K2QA 1R0CA 4R4JA 4EB8A 2E4VA 1I8DA 3RIMA 5FOQA 4ILEA 3W1WA 3GVIA 2M6SA 3OI7A 1J0EA 4CF7A 3I0NA 2B4QA 5I5EA 1UK6A 2D0IA 3DE7X 2CZCA 2ZW9A 1AUQA 3G9XA 1RAAA 1J0DA 2HIGA 3KBBA 5KTRA 5ES3A 1M1KD 1JG3A 4HSEA 1J97A 3OWOA 3VTAA 4W5HA 4NYIQ 4C6TA 3IVCA 4UDOA 1SOWA 5A6VA 2OXRA 2OHOA 3OZBA 4LHEA 1FIUA 1Z6ZA 2NO4A 3AVQA 3A26A 3KAKA 1CEYA 2IC5A 1KSJA 2BRUC 4FHZA 1QE5A 3NTUA 1B2LA 3EXIA 1YDHA 2IUYA 1K8ZB 2PVPA 1J2YA 3AFIA 1PQPA 5FQOA 3WIEA 1ZUNB 4XYLA 3GEHA 3ZV6A 4RTNA 3R7DA 3MS4A 4R81A 1QWOA 3W04A 5DTJA 3VU0A 3R9KA 3T6KA 4MI6A 1JHOA 2HUPA 1XJQA 4Q12A 2OBRA 4WOBA 1IB6A 5DOZA 4LE1A 4OPOA 5ELXA 1XTIA 1E0JA 2CHVA 1PDVA 4MWEA 1G41A 4QRHA 3RUIA 2D2XA 5L3VA 4P93A 3BXPA 4DPKA 3KQQA 3QVOA 5IAAA 2QW1A 5DM70 1QYRA 1XA0A 3ICEA 2EU8A 1YA6A 4LWOA 5JLAA 1YFKA 4ZCTA 3KXIA 4ZXFA 3KKOA 5BV0A 1V3TA 4OOXA 3FZEA 3CURA 3D7SA 4L07A 3GJ7A 4KQ6A 3ZTWA 2IZ1A 3CTPA 3D3WA 4R40A 4CGYA 1YRQA 1LF0A 2N1MA 3LI2A 1KSGA 4BNHA 5GJBA 1ZGZA 3REQA 4R16A 4XGIA 1FJGB 1JLKA 4DBZA 1NP7A 2C2XA 3JQAB 3ZBQA 4H7DA 4RA9B 1W5SA 1ZL0A 4ARZB 4BP9A 1ISMA 3KR9A 3P2OA 1VKHA 3BDVA 4NTZA 1XCGB 1Z7GA 1L5KA 1TMKA 4PQGA 4PSCA 3S2IA 4IG9A 2D59A 3CF6R 3IKJA 1CZKA 3T1NA 3EWIA 4EJ0A 2GM4A 3SF0A 4YUWA 4I5DA 3U1TA 4TXJA 3CRW1 1XWIA 5C8VA 5IUJC 2XVZA 2R6ZA 4EG5A 4I9UA 3PJFA 5AKYA 5EJ2A 4B6JA 1OY1A 6GPBA 2G63A 4XM0A 1VJCA 1YVDA 1GA1A 2EQAA 2XOXA 4K2AA 1AKTA 2HK9A 1N2GA 4PQFA 3TNJA 3RHTA 5TF0A 2UYOA 4A6DA 4YYZA 1HH4A 2VAXA 3KPVA 1D1NA 1HQKA 3R44A 1ZJ6A 4EO9A 2L69A 4PZLA 4B35A 3VBEA 3ROKA 3A1CA 3ELWA 3L4SO 4DLBA 4OOEA 4EVQA 5B2EA 3GQVA 4JFAA 4PRKA 4EO7A 2PH7A 3I83A 3IP6A 3WLSA 2XWPA 3AF0A 3WL7A 5FLYA 4WT7A 4W7HA 3LGXA 1N2XA 2IV2X 4YBZA 4P7BA 5K0TA 4DR7B 2H4JA 5DU2A 5IM4A 2WJZB 3BHNA 4NQRA 1X8KA 4OXYA 1GNTA 2YVQA 4QQRA 3CP8A 2I4LA 1EM6A 2FRDA 2VXBA 5CFNA 1MRNA 4IXWA 5K4AA 2RKBA 1A95A 2C2HA 5K0JA 3TG2A 4MULA 4YRRA 1AN9A 2KQUA 1EVEA 5IF9A 4GLFA 3IBFA 4J9UE 1W25A 1BVYF 2R6JA 2OYRA 1ZD9A 4LYAA 3RYTC 3HSKA 5BNFA 1YNOA 3AONB 1ZICA 3JQQA 2V3WA 4X85A 4BQEA 1UKYA 5SY6A 2WV9A 1CWUA 2PRSA 4L08A 4PZ0A 1QLHA 4XR4A 3GRRA 3BL8A 3RAPR 3GCGA 3TTVA 1ONSA 1KIAA 3H2BA 1IIRA 1YR1A 1Z8FA 2YC2C 1G98A 5K8UA 1JECA 1LTQA 2NM0A 2OEPA 4XQGA 1YC5A 4CYMA 4F9EA 4XUCA 5BV7A 3QLEA 4AN1A 4M53A 2ZS7A 4W5JA 2BE9A 4B82A 3HNOA 4R3WA 4XCQA 2W6CX 4GKKB 1HDOA 1VXOA 1WDWB 4MV4A 2BSXA 4HPJB 3U0VA 3FA2A 1GNSA 1OFTA 2VH5R 3CD6B 1LEHA 1AS2A 2YZMA 3NGXA 3R6DA 4GE0A 4E4RA 4UM9B 5E6SA 2JLZA 1KDTA 2GN0A 3IP9A 4LRSB 3ZHTA 2EJBA 2Y92A 4KXMA 4MEJA 4NV3A 4YV7A 2C96A 1ZC3A 2OORC 4MXDA 4D5EA 4K40A 2GTIA 4XKJA 1C7JA 2QE7A 1EUDA 3C98A 2C1EA 3W5AA 3UH0A 2DCMA 4LYHA 3STUA 4NP6A 2GUWA 2VKQA 1ZUNA 4ZIRA 3ILYA 4GSLA 1TCAA 2QYSA 1M0SA 3W6ZA 4ENRA 4UTPA 2VK8A 2IE8A 3OSUA 3SC4A 4DT1A 1SUSA 1UPBA 2IIVA 2IEZA 4TWAA 1IY9A 2CMHA 2VS1A 3DUFA 5MFPA 5AVRA 1U81A 3ASVA 2O2XA 3QTBA 1NJSA 1P9WA 2P5UA 3RAGA 3NVMB 4J0FA 4MP8A 3PFBA 1BX1A 2PPVA 2JFGA 3F71A 5K8CA 1T35A 2D00A 2P79A 1GKIA 1TZ2A 2NVBA 2XYRA 3PQEA 5DBOA 5KNDH 3ZJUA 3PGXA 3TPCA 1MJNA 4EATA 2R87A 1C9NA 4KOEC 2DTXA 3OW7A 1VF7A 3Q9LA 5B1YA 4NF2A 5JJIA 3Q6RA 1R74A 4IICA 2YVKA 4DYDA 4QBHA 5HS6A 2I3BA 4EF5A 5JCOC 5CRIA 2LDBA 3ANTA 4J75A 2PFGA 4Y2UA 4CE6A 4AYXA 4P1VA 1Y63A 3L1JA 4PG4A 3WGKA 3FHTA 1L4BA 2C1ZA 2ZJAA 1VL0A 2WAOA 3PEVA 4QVGA 1YFZA 3WLQA 1OXTA 2MIIA 3Q7SA 4I55B 4DS3A 1A1VA 3NOOA 4QTXA 2QPOA 3A9WA 5DZSA 4C7JA 4B33A 5JW6A 2JJ2A 2RK4A 3D9QX 1HYEA 4DA0A 4KUGA 3RHSA 2CJXA 3VNUA 4DJFC 1GSOA 2J3LA 3ZJYA 2VEOA 5ALYA 4TRNA 1FPQA 2C5LA 3KB8A 2V6GA 3LC0A 5BXQC 2A1TS 5M2QA 2XA9A 5DEIA 4ZXPA 4AYWA 3RYFB 2YMLA 2CXHA 1QHFA 1SY7A 1FP6A 3H75A 3IKLA 3ZE0B 3JWPA 3RVSA 1L3IA 4C4AA 4QT0A 3HEAA 1N1DA 2QU7A 3F90A 2I22A 3GBSA 3JASA 4RFSB 3GOHA 3CXCB 1UT5A 2B2NA 2XDQA 1JIUA 1T2FA 3FWHA 3LVFO 4POAA 5K0LA 5BSHA 4DM7A 4YEDA 1XZQA 1P33A 4DQUA 3LSTA 4NMMA 2H2GA 1SVWA 2NUBA 3CLHA 3GEBA 4Y8VA 5BVGA 1ZHOA 4D80A 1U8ZA 5JTTA 1DAFA 2OD7A 1T0JB 3B5IA 5AW3A 4FDUA 4ZRMA 2YQ4A 3TL3A 2GA8A 3T61A 5AW0A 3KYDB 2VA8A 5J2UA 1WMAA 3FHOA 4UUMA 3WOHA 1NR5A 2REQA 2WU8A 3ZNPA 4BBAA 3DFIA 3AXTA 3WL8A 2O1SA 2SBTA 3NVDA 5L3SB 3BZBA 2WSBA 4FYKA 1N36B 2WKRA 1UEXC 2B30A 3HCEA 3N0XA 4MIEA 4L0CA 1N3YA 3CRNA 4J03A 3TM5A 4QBIA 1AHHA 3LNCA 2PJRA 2XTNA 5EC8A 3RSHA 4O4LA 2AUTA 1IN6A 2CBGA 2FRDC 4EY7A 3ESCA 4YWHA 1KEKA 5FFNA 1QDEA 4LXYA 2IY7A 2PHZA 3IHWA 1KFCB 2EQBA 1XRPA 4JKYA 4ROTA 5EXXA 1F2VA 3DDSA 3PI7A 2H2AA 3ZU2A 1RKVA 4XX1A 3V97A 1FTQA 2AC7A 2B4YA 4FYHA 4WXYB 3RVBA 1WZUA 1U8EA 5FV4A 1ECFA 5LQMA 1M8FA 1GD1O 3W3AH 1ODFA 4CM8B 1A5BB 1DAIA 3LL4A 3ISJA 2V7GA 3V1TC 4KWTA 4C5BA 4L72A 3I4CA 4M3NA 1ODIA 3BQ9A 1GRVA 3EZ7A 1K5GA 2ODPA 4B3JA 4Q7QA 2ZAOA 4GOLD 1XFAA 1O94C 1YI2B 3Q7EA 3IVRA 2O8EA 2BZ0A 2E4UA 1U0TA 4WIAA 1CYDA 3STHA 2IHBA 1J7KA 1I2AA 3E5HA 3MINA 3ZDRA 2WHPB 4EW2A 4RNCA 2PX2A 2HZ7A 3SYKA 2OYSA 1IHXA 1NBHA 2CDNA 3DE5X 2NPFA 2M1ZA 3A3BA 2PVSA 4MYUA 1Y1TA 2L18A 3IJEB 4W1SA 4B76A 4PZCA 3AUKA 1G5FA 1JZQA 1VI6A 3QVGB 1K8RA 2MHCA 4MQ5A 4EHNA 3EBLA 1QGZA 4MJ7A 1BXGA 1KYIA 2X40A 3ONNA 3BYZA 4L5JA 4HFJA 3RQIA 4GKAA 5CT8A 4L6CA 3LDAA 1RJGA 3WNBA 3ZU3A 4A8JC 2P6MA 3A32A 3O7WA 4YA6A 1D2AA 5TQ2A 1DJPA 1YUNA 2PSJA 5J3JA 3IV6A 3C70A 3O95A 4CR7A 2E7ZA 1QRTA 1I7LA 1KMIY 3QX7A 2MYUA 2OV3A 2WUGA 1UJ2A 3DL0A 4WKOA 3R7LA 3ZQUA 3R20A 4L28A 1LJLA 3A4YA 4BMCA 1Z7BA 1EJBA 2G9RA 2WY2D 5JDCA 5ALWA 5CTAA 4D4MA 1H2BA 3BJEA 1L4YA 3CN7A 3DTVA 1WZ2A 2UDPA 3DXFA 1U1EA 1PUIA 1KBOA 3GYGA 4M98A 1SCNE 4LE2A 4QSHA 1YKGA 3RFXA 4E94A 1P0MA 3ANXA 3HACA 3T1VA 3K8YA 3BCDA 4ZYVA 3E1YE 1QX4A 5C5DA 3T5PA 3LVQE 2OQVA 4YBRA 2FE4A 2WP8J 3SSAA 3FWNA 1OYOA 2VDNB 3H3XA 3N5KA 5COBA 4IVRA 4LJYA 2F43A 3JAMA 4POOA 1D6NA 4QXRA 4O4IB 1QQAA 1F8UA 3WP1B 1TA0A 4KQEA 1HT3A 1E5DA 1XZJA 4G5QA 1OIWA 4IIXA 4ASUD 9ABPA 3GGJA 1NDUA 3TEMA 4IDGA 7AT1A 2P9GA 3QTTA 5EIOA 4L85A 3TBFA 2POQX 1P7VA 1C9KA 1F0KA 3D2LA 3P20A 1VLMA 3T53B 2C2MA 4P3PA 3GELA 4H4DA 2RHLA 3R77A 2OBBA 4J7CA 4RE5A 4CPDA 2VZLA 1Z73A 3U4AA 3HMQA 3EA4A 2XQFA 4AYTA 3LTNC 1E6WA 1L5RA 3UENA 4PG5A 2AJ8A 3JYNA 4YUXA 5LWHA 2XJ9A 3CZCA 3H5WA 5AI8A 3KZ1E 3P9IA 3OO1A 1ZI8A 3SZMA 3BSSA 4CETA 2D2VA 1WR8A 3JXEA 3UUFA 1V47A 3KPJA 3MILA 4XQCA 1CTQA 1SCJA 2WLTA 1C1DA 1WW2A 3MGCA 4NYIR 2B1GA 4LBWA 5LZ2A 5JTUA 4J0JA 1XMSA 5BW4A 4HDSB 2RH4A 4YR7A 1QH9A 5ALPA 1II0A 1I2BA 3GLGB 2WIKA 3V1KA 1SU7A 2WD7B 2ZPTX 1QFJA 3ORYA 3EGIA 5BSTA 2B1QA 1P8AA 2JFQA 1FOEB 4HDRA 4Z1MD 1P81A 2OO5A 1GM5A 5EQJB 3ASTA 4EPWA 3EPRA 1A5SB 4N82A 2Y6UA 3AF2A 1P72A 1YHYA 3QUBA 5FTKA 3ZJTA 1L7NA 3IVXA 3CBGA 1A7AA 4UBJA 3KWFA 2BPOA 3AETA 3SICE 4Y2SA 1QU3A 4AQ7A 3D5EA 1L4NA 4C87A 4EAAA 2EZ9A 2ETXA 2K87A 5BR7A 3IO3A 1B6RA 1C4OA 2GD6A 3BIOA 3BMCA 3DQZA 2JLUA 2Z98A 4CLOB 5LUBA 3ONEA 4JP8A 2AJCA 1Q1ZA 1U6KA 2A78A 4P9NA 5TPWB 3NB0A 4UULA 5CLQA 2O1XA 3JQRA 1P17A 3V6MA 4BNWA 1CHNA 5HMLA 3ZH2A 4ZO8A 5DT9A 5EZSA 5B1SA 1ZIXA 2EG5A 1I80A 2WKWA 3VVBA 2PUCA 3W7VA 1AXRA 3LECA 3LKZA 3VO1A 3TQIA 1J1UA 2E0IA 3DHEA 1P2SA 3HCPA 1QGYA 4ID9A 3JQ6A 1THTA 7MHTA 4DOMA 1ZR4A 4XH9B 5JSZB 1M0EA 5JAZA 3G05A 3QIVA 4URFA 2BKVA 3I5UA 1Z4OA 3PD1A 4HADA 3C6MA 2X9LA 3T3HA 4AUMA 3D59A 1EJ6A 2I6SA 3IKTA 5LA6A 3NUGA 1RC1A 1POWA 2BMWA 2VSFA 2CE7A 2ZZEA 2CF4A 3PBKA 5C1IA 3WB2A 1FL9A 3M5PA 1IN8A 5D51S 2BFPA 3B3GA 3EVDA 4UDYX 3EXFA 2ORVA 2EARA 2OSVA 4J0EA 5BUCA 1Y6GA 4URUR 1H6CA 2C5FA 1N9KA 1V7PC 2OB1A 2V7EA 3WL3A 3QFTA 1PR1A 3AG6A 3DE4X 1P5RA 2CVOA 1VQ1A 2YH2A 2ZU0C 3JRXA 4IOLA 4MWCA 5EFZA 4DVJA 1LZKA 1XWFA 3MA0A 4QJBA 4Q66C 1ZD2P 3GL9A 4R9VA 5JPCA 5JEEA 2ABWA 2DBQA 4JBNA 1UQRA 2I8LA 3B53X 1VSTA 4I5FA 4QARA 3QEAZ 1AZLA 5D86A 1QXSA 4UMFA 1II8B 3HA7A 2ACVA 3C3YA 2CRVA 4IFTA 1DIBA 2KLHA 1QGUA 1P61B 3KKNA 1X9HA 4M9SA 1PIWA 1Y5MA 1V9SA 2GYYA 2JFBA 4UHDA 5TGTA 2RC5A 3IIEA 3IEVA 1RYMA 5GM2A 1A96A 3KKLA 2CEKA 4FSHA 1Z08A 3A36A 4L8VA 1ORHA 1ZOLA 3IQFA 1S3GA 3UY4A 1XCJA 3JQAA 4UPEA 13PKA 4C43A 2WC1A 1XQ9A 3A2NA 3HLTA 2PEZA 1KEZA 3O03A 4KVAA 2HPAA 2XGMA 4M9CA 4PRZA 2GK4A 4FE3A 4BE4A 1CJBA 3O3CA 2JGKA 3T51B 4AQYB 4ND5A 4NEQA 1FYFA 3I8OA 3RE1A 4YAGA 1RRKA 4ISBA 3K20A 3IE2A 5FWAA 3WGJA 4IKOA 3UB4A 3UK1A 2OO7A 4D8VA 3Q8LA 2AL7A 1H94A 1GAQA 3LJKA 1K0FA 1Z56C 2R7LA 2AHOA 5AUOB 2FQ1A 1XNHA 3KR2A 4HNGA 1GGKA 1RRFA 1U80A 4BAUA 1ZJWA 1F6DA 4LBZA 3K0AA 3UZUA 2VWPA 2JGRA 3TDKA 3ZDDA 2OZPA 1WZCA 3CH6A 1N6HA 1NPDA 1DJMA 3COSA 1YMQA 5HKKD 5TVGA 1YQQA 1BQEA 2CSUA 1XFDA 3JQ9C 1BXZA 4OHUA 5CD9A 1KP2A 3WQHA 4CODB 4XGNA 1ESMA 3QMMA 2DFVA 4I7EA 4YP0A 2O5VA 4GVPA 1H42A 1WY5A 4NPCA 5AD1A 5F2EA 5EKXA 4BX3A 4EYSA 3FYSA 3HDJA 2C9CA 2MDTA 4FFDA 3T0GA 1RXYA 1IAVA 3B1XA 3BGWA 4X7BA 3DPSA 1MRZA 3EFHA 5JSYA 2KYRA 2Y66A 1WPCA 1M8PA 2RG1A 3TAUA 5AJZA 4JENA 4B4VA 2B92A 4PBRA 2IWHA 1JFTA 2RJNA 1AGYA 4JZKA 3SJZA 2CJYA 5E3HA 5IEJA 4MA5A 4RKWA 1ATZA 2B94A 3ZWXA 2DSNA 5DX1A 5A9RA 5B2FA 5AK3A 4V03A 1UEIA 5LOVB 3M8KA 1JXAA 4U6QA 1O97D 1XZGA 2I4NA 4KFTA 3HZHA 3WHLA 2HM7A 3ROFA 1GZDA 4HNQA 4G7XA 1XQVA 1YZHA 1ZSNA 2GD2A 3R75A 4AJ1A 4AJ9A 1AT1A 4CCWA 4X1YA 3SJBA 1Y9DA 2J0EA 5EZYA 3KTAA 3A3YA 1B4DA 1R9MA 4GQIA 3ZHZA 5LD2B 2HJSA 1OLUB 2CEAA 3KZCA 2FFQA 1SZJG 2VL7A 1LFAA 4V0ME 1YSCA 1L7OA 2OBNA 3KT0A 4K9MA 4P80A 5EEGA 5ERXA 2FP4A 2MTBA 4XLHA 4WL0A 3KJIA 4PC6A 2F3RA 2YYAA 4UBIA 4OQXA 5SZHB 3F67A 4GNRA 3KAPA 5ICGA 2P9BA 2ZB3A 4P7KA 4GM1A 2LIPA 2YVUA 1SKAA 2YV4A 1W6RA 4IDHA 4Z49A 4R1LA 2GN4A 3DO6A 1NN3A 1Z4JA 5C0OE 2IBSA 3NEJA 1M54A 1TJYA 1YCHA 2ZSBA 4XYGA 5FA5A 4BQSA 2PKEA 3E7PA 5FOUA 3OJ0A 5CXSA 4DRYA 1N5DA 3DCYA 3OE1A 5ALOA 1E94E 1P91A 5DYNA 3VO8A 4CIXA 2HMUA 2NTEA 3PE4A 3E9CA 3MJEA 5FUXA 3T41A 1QLJA 3TD9A 5AXAA 7YASA 1U3TA 1WMSA 2IZOA 2O07A 3C4VA 2IPNA 3I9OA 1KO5A 1KOJA 1CY1A 3H9EO 4YLGA 4M1TA 1P2BA 4NKRA 4D5GA 2FVXA 3FNHA 3JYPA 4TT3A 1D4AA 2IVZA 2ZUBA 3FTEA 4NBKA 1B26A 1GAJA 4IO1A 1IVSA 1M72A 3PVDA 2O7RA 1CQZA 1SPBS 3DKKA 4EM6A 2I66A 2WNHA 5M34A 5CFPA 3UHOA 2D62A 4Y18A 2BEJA 4HZIA 4PABA 2X77A 2GJ4A 2CXOA 3ASQA 2YC4C 4ALJA 4LMAA 1S9HA 3ABRB 3MTGA 4OM7A 3VJKA 5HTOA 1V5VA 3AK4A 3G8CA 4DLAA 1UDXA 1N5JA 5D8DA 2VQSA 4KMRA 4RO0A 1E8MA 3I52A 1UADA 3B51X 3MJHA 1UXIA 1C0EA 5F1PA 821PA 1YE5A 2J09A 3NBMA 3PD0A 3COWA 4M60A 2C42A 4NYJR 4XD2A 2VDOB 5DM2A 4FM9A 3EWSA 1MZPA 1XGKA 2IXBA 2XNSA 3AG5A 4KLAA 4WSOA 1KEEA 1QO9A 1T9CA 2HWUA 4GRDA 4JELA 2IUFA 2FI1A 1M1YB 4U2BA 4IIUA 3STTA 2HX1A 2WICA 4ZEMA 2VRBA 5THQA 2WQ6A 3B1WA 4XCXA 2IPMA 1J00A 3A0RB 4AP6A 4E2XA 2VK2A 4O2BB 4QOGA 4ZI7F 5FORA 4W6QA 3VR2D 2C3OA 2KE5A 3RRFA 5HJ5A 4DR3B 1NLUA 3CSSA 1W36B 3F6SA 3V4VB 2YY7A 2IHUA 3D0KA 3ORFA 5FOXA 4EI2A 2DFKB 3IPAA 3FGOA 2FMUA 1W4LA 1FFHA 3FPPA 1T2NA 1TQDA 3S2FA 2DX7A 5CDUA 4HI0E 2GCEA 3OZUA 4IP0A 3RTEA 1FMCA 5ABPA 3KOZA 3ZGVA 1MB0A 3DDHA 4OGWA 4L3VA 2VYQA 3OEHD 5DIZA 5JT1A 4ACAA 4O4HB 2BISA 4IO0A 1XMQB 1YRLA 1ZN7A 2H4FA 3EOAI 3N8IA 1C8KA 1PG0A 2IP2A 5I7WA 3U4MA 2UXCB 4FI3C 5DXAA 3QLVA 3RU9A 3GA7A 3K09A 4BATA 2RARA 1FP4B 4OGLA 4NU5A 5IX8A 4B3MB 3EC2A 1RCUA 4MVJM 3BCSA 2W93A 2ZCVA 4D8TA 1YHQB 3UG6A 4BVLA 1TD9A 3EXG1 4O2AB 3A70A 4EKGA 3ERCA 5MN4A 3CUVA 4KPYA 1PHPA 3CF0A 3PNYA 5EG5A 1GTVA 1XKQA 1SXHA 1IQRA 2QR2A 4RHCA 1SCUA 2W8BB 1J8DA 4YYEA 4UUOA 2P30A 3BRSA 4XTCS 1TJ5A 3P96A 1CEEA 1QYVA 4QQ8A 4EGSA 2ERXA 1N1GA 2IYWA 1MENA 1Q7GA 3IIJA 4KLCA 4QGHA 3FPCA 3K0BA 4MEBA 3RRYA 5LOVF 4RDKA 5A6SB 2IGBA 2QLTA 4FHGA 4BNTA 1STOA 4YPVA 3SX4A 4HGQA 2R4QA 3E35A 3EGEA 2W2OA 5K3OA 1QS0B 1KWGA 3M6LA 2X9QA 2AOTB 1UF9A 4YEJA 2GPWA 1YB6A 4NAUA 2Z2IA 5JSUA 4CXMA 3MRSA 3H8SA 3U4HA 2R47A 4UUPA 1H69A 1Q16A 4MVJF 2Z3WA 4DEXA 1EUQA 1XTZA 1SHTX 2QQEA 3L8HA 4K3VA 5CLGA 1VFNA 2DWOA 3LXXA 4J16A 1HMPA 3WI7A 4E08A 1FW6A 3DLBA 2PL3A 3G8AA 3UKDA 2OGUA 1AXEA 3BCHA 3SEJA 4U8HA 2C5GA 4JLSA 4O8CA 3Q3EA 3L0OA 4X71A 5KWEA 3KSAC 4JI3B 2F4VB 3F1LA 1TF5A 4X94A 5I01A 3J7AC 2Z6AA 1P9RA 4JOBA 3DF7A 5BR4A 3C6KA 2QM8A 3GUCA 5IM5A 4D25A 2H7YA 1SHUX 3OIGA 1TM5E 1JPJA 2AF3C 1L1RA 1XDDA 3K9FC 4UE6A 1XD2B 2JBWA 2VAWA 4Y3UA 3RC2A 3RASA 5IG2A 4H3KB 3W5DA 1XCMA 4M7OA 4BFVA 2X1VA 1EAMA 3EGDA 1G0NA 4R9UC 5KWJA 1Z2PX 2CV2A 1O5OA 1P0CA 4IVPA 2OHIA 5L4SA 2OKCA 5CCDA 1NXOA 2VJNA 1PR0A 4MX8A 2GSDA 5A3VA 3NCTA 1JIQA 1EWRA 2PMKA 3OZDA 1U9IA 5AKEA 2F59A 5B64A 3SDZA 4YJFB 3QKIA 3IEPA 4CG1A 4YV1A 1PEDA 2UYYA 4JI8B 1PAUA 4WKPA 4DNOA 3KUDA 3MK31 3RVKA 4U39A 3VTKA 3ST7A 2IL1A 3HH8A 4R0NA 3ABZA 1KY3A 2C94A 3KXKA 3O75A 3PNLA 5H9VA 2NO9A 3IQGX 4UZFA 4BFCA 1T9ZA 2XUIA 1WV1A 3PXEA 3W2IA 1UM9B 5HRCA 4FCWA 3JQ7A 4I99A 3PLAE 1KJIA 1VIVA 4YJHB 4F97A 3CMCO 3HI4A 3NUQA 2DLCX 5FBRB 3RROA 2VJKA 2KM1A 3LO5A 4XM1A 4OHBA 3AJ9A 5TS2A 2F8SA 1BH2A 3I04A 1PK7A 4JI7B 4YDRA 1C7QA 4AKHA 4NXNB 4IILA 3HKDA 5K8JB 1PYGA 3QVSA 1TJNA 3RS4A 1KC1A 1XTTA 2XCTB 4IIBA 5CD1A 3BE6A 6NULA 5AK4A 1GPNA 1VQ9B 1P62B 2I2FA 4JYMA 4MKHA 1E98A 1EEHA 4UMEA 4ZAGA 1Z8DA 3ZCRA 4E13A 1U2TA 5A5GA 3OO0A 3U40A 3OCXA 4RPHA 4IDCA 3NH6A 5C32A 5BYJA 1DBIA 1O7JA 4OBXA 4RY2A 1ADBA 1JHDA 2FW9A 2AVNA 2WFZA 3N2GA 1J25A 3BXGA 4MB6A 5HF8A 4Z8YA 1F4PA 1K6EA 2JZNA 3RVJA 2DHDA 3ASSA 4Y0AA 1QM5A 1J0XO 4BFTA 1NL3A 3WGLA 3CKYA 2FP3A 2J30A 4S3MA 1T2CA 2ZIAA 3ZHXA 1S1MA 4TWJA 3MWDA 5KQSA 3UMFA 4B87A 4NOKA 2RAPA 2ZJBA 5HKBA 4OP2A 3V7WA 4N49A 1WHSB 4BMXA 1RXVA 2JLAA 1JAYA 3LX5A 2HIMA 1UXKA 4FGSA 4D9JA 2P77A 3KJFA 1O6BA 4Q48A 2I67A 1BNCA 1GPJA 1PR5A 3OEWA 4UASA 2CZGA 3I6BA 3OFSA 1ECCA 4DLUA 4ZAFA 4C0AC 2GA9A 4C89A 3PPWA 2M32A 1IHPA 2GNOA 2WWTA 4GZLA 4RZ3A 4X3OA 3KVVA 1YITB 5MFZA 1F8XA 1E9SA 3JRNA 4CKEA 1PK8A 4L8WB 3ZGYA 5AIAA 2VDRB 5KVAA 4BTVA 1SBHA 2JJMA 3V00A 1JZTA 1LI7A 4ID3A 3UPTA 2X6QA 3F8SA 5JY6A 2YHBA 4HEJA 1VQNB 4FGZA 4PYLA 2AUMA 3LKVA 3TJZA 1XTSA 4BWYA 2IS6A 3OOHA 1SMKA 3D5TA 4LISA 2OFPA 3Q7PA 4PLFA 4BO0A 1U2PA 3MUOA 1ODKA 4YJ2A 1GQRA 4WZTA 4EPTA 4HD8A 3Q0IA 1M3SA 4FEGA 2BGRA 3AVOA 2YJ3A 4ARSA 2FPPA 1E3DA 5G0SA 1OH7A 1XRNA 5F1OA 3N7TA 5BUSA 4LZLA 3O4HA 5F7ZA 3IO5A 1TEVA 3C3BA 1CG6A 4ZQIA 3K4QA 5I8WA 2VQFB 2IDKA 1TMOA 3AETB 3KFXA 2DF8A 3R09A 4EAQA 4DR1B 3HY4A 5ED4A 3QXSA 1ACMA 4JGGA 5E1OA 1PV2A 2G08A 3FPFA 2ZDGA 4ESOA 5D5PA 1PJ5A 3FWKA 3LBIA 3QU7A 2XVMA 1PFVA 5FI3A 5EHNA 2NO7A 4EPXA 1XMOB 1AX9A 2X19A 3SX0A 2GZMA 5JCJA 2Z09A 4NZMA 1N2CE 3C43A 1VKNA 1XNGA 1SR8A 2OWDA 3FSJX 1BX0A 4HGZA 4N5HX 1ISIA 2DJIA 1E0SA 2NACA 3IILA 1PJ4A 4G1FA 4XI9A 1DCFA 1FY2A 2WA1A 1X3SA 3ZCPA 1ZSYA 5LMNB 4P25A 5DTRA 1H2AS 4P22A 5IWAB 1YACA 3NTVA 3H9QA 1LX7A 1H3NA 2CLMB 2WVJA 1T25A 1MX5A 1BPLA 4GNKA 3L92A 1K6IA 1SZDA 3PGVA 5T8KA 2FB9A 3HKCB 2YHIB 1FFBA 3SU8A 2GAIA 2Y6VA 1QVFB 3HBJA 4X3CA 2J5KA 3L7BA 5KYUA 5AW2A 5CT5A 2ZIXA 5IYPA 3PA8A 2BKXA 3EBPA 2UKDA 1NKSA 2G76A 1Y8QA 4AZVA 1RU3A 3CO0S 1QPZA 4KWEA 4LW8A 4KHPB 3X3HA 4BUZA 4D57A 4IUBS 4C2UA 3GFPA 5BSRA 1NQUA 2V1UA 2WD9A 3R4CA 3H4VA 4BKMA 1RWQA 3AKYA 2PZAA 3QRWA 4MUMA 4OHMA 1SHKA 3KD2A