4YHBA

Crystal structure of a siderophore utilization protein from t. fusca
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
261
structure length
261
Chain Sequence
b'ERTVEMYPLKSRLLEVVNVRRITPRMVRVDLGGSDIAGLRSDNFADHVKLWFPNPETGEHVLPVVEDDRCLNFRAPGVIYRDYTVRRFDAKARLLTIDFVVHDNGPGGRWAATAQPGDRLGVLGPRGTVYYPEADHYVLLADETALPAAARRIEELPRDASVTAFFEVADAAEEQELDAPEGAEITWLHRNGAAPGTTDLLLRALEQTEFPKGRVFVWAGGEADALKPIRRLLKERGLVRGRDFEVDGYWRRGVSNLDHHA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-chelator utilization protein
publication title Structure and Mechanism of the Siderophore-Interacting Protein from the Fuscachelin Gene Cluster of Thermobifida fusca.
pubmed doi rcsb
source organism Thermobifida fusca tm51
molecule tags Oxidoreductase
total genus 64
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04954 SIP Siderophore-interacting protein
A PF08021 FAD_binding_9 Siderophore-interacting FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4yhbA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4yhbA02
4QHYA 2QA4B 1Q82D 1FNBA 1YJNB 4MYTA 3W2HA 2HMAA 1KK1A 2QTZA 2B5OA 4EH1A 3FPKA 1SM4A 1QVGB 1BX1A 1R5OA 3W2FA 1DDGA 3A1FA 1KJZA 2HDNB 2XNJA 4LBWA 3OZVA 1BQEA 2BMWA 3QFTA 4AF7A 3WNCA 3VNUA 3LVBA 5TY0A 1VQ4B 5FA6A 1QUEA 1ZM2A 1M90D 3AVYA 1K73D 1YIJB 3LO8A 4Y9UA 4LBVA 1N0UA 2OK8A 1QVFB 3G6EB 3AGPA 1BX0A 1I7PA 3AVTA 3FJOA 2BM1A 4G1VA 1KQSB 1TVCA 2B7BA 1XB2A 3MHPA 4HE6A 1TUIA 3G4SB 1KD1D 1JB9A 2CRVA 4ZCIA 1QFZA 1OGIA 4RD0A 1IJFA 1FRNA 2C77A 2QMUA 2VNIA 1SKQA 1DARA 4RD4A 3ZBUA 1D1NA 4G1BA 4U9UA 2YWFA 1JNYA 4J0QA 4H9GA 4RD6A 2VZLA 1M1KD 1ZM9A 1W34A 1WDTA 4RJLA 4B48A 4MYUA 2OTLB 3CC7B 2YWHA 1D2EA 1QH0A 3CCSB 1KTVA 3WYAA 3JQPA 1JA0A 1OB5A 3CC4B 1KK3A 3AVVA 2VNKA 4RCZA 1QFJA 1JJ2B 2DERA 4M0LA 3I56B 2VYQA 4ACAA 4HE5A 3CW2A 2R6HA 3VNVA 2VNHA 4YAWA 1YITB 2PLFA 1U2RA 1ZUNB 3AVUA 2BVNA 4IW3B 1EP3B 1VQ8B 1R5BA 3OJXA 5EMNA 2E1RA 3CCQB 1G7RA 3QFCA 1JA1A 4B43A 4ZGNB 2BGIA 3JQRA 2HCJB 4ZV4A 1VQNB 3WNBA 3QFRA 3MCAA 1TTTA 2CNDA 1GJRA 4N3GA 5DSZA 1EFTA 3V76A 4LBYA 3CMAB 1GR1A 1DG1G 4AC9A 3OZWA 4F7DA 1Q86D 4G5GA 4TMWA 3VMFA 5THXA 1N0VC 3P26A 4Q7JB 3I55B 1BJKA 4YAUA 1YJWB 4WQMA 1CNFA 1K9MD 4M2LA 3ZZ0A 3CCMB 2BGJA 5KSWB 1W35A 1DDIA 2FX3A 2PIAA 1EWYA 1FNDA 4PC1A 3AVXA 1G7TA 3ZC3A 1UMKA 1NJID 4AF6A 1EFCA 5JBQA 4ZCLA 3U2QA 4M1KA 4RD3A 3JQQA 2GQFA 3W2GA 4B4DA 1QG0A 1QFYA 1Q7YD 4QFMA 1VQMB 1HA3A 1FDRA 2EIXA 4TMVA 4M4SA 1R5NA 2DETA 1IB0A 1KRHA 3CB4A 4R71A 1ZM3A 4M53A 1QGAA 4TMXA 1K8AD 4PC2A 2QEXB 3SJZA 2PMDA 1IJEA 1GVHA 4LC0A 3QE2A 4C43A 1OB2A 1EP2B 3U6BA 4B44A 1Q81D 5HXBA 3W5UA 4RD2A 3LRXA 3OW2B 2RC6A 1B2RA 2ZITA 4RD1A 1G7CA 4LBZA 1H42A 3CCVB 2J7KA 4YHBA 4BPRA 3J81k 3CPWB 3B78A 3P27A 4B47A 2OTJB 3CCLB 2X3UA 4FK8A 3WBKA 3AVWA 1XE1A 2BN4A 4DQKA 4UAJA 3QSYA 2B7CA 2C78A 3CCUB 3W2IA 1YI2B 4ZCMA 3QFSA 1EXMA 3WY9A 4ZGQB 1N8RD 4Y7CA 3MMPA 5H5JA 3OZUA 1GAQA 1EFUA 1QUFA 3WXMA 1GAWA 4PC7A 1KK2A 5GV8A 4P3YA 1CNEA 1YHQB 3CMEB 2NPFA 3LYUA 4PC3A 2OK7A 1VQKB 2RC5A 4YALA 2DEUA 1G7SA 2BV3A 2QN6A 1B23P 4FN5A 2XNCA 1NDHA 1VQ9B 1E63A 2YWEA 2YWGA 3VO1A 1TLLA 1AIPA 1YJ9B 1KC8D 3CD6B 4YAOA 3OJWA 1FNCA 3E1YE 4YAFA 2BSAA 2DCUA 1VQOB 2VNJA 3CCEB 2BPOA 2QTLA 1J9ZA 1EP1B 1A8PA 2BM0A 1FRQA 1VQLB 4DQLA 2AHOA 1S0UA 5TV2A 3CCJB 1W2BB 1VQ7B 4FWTA 5H59A 3W5HA 1W87A 1OGJA 3AGQA 4P6VF 3CXCB 3WBJA 2GPJA 3G71B 5AN9A 4PGOA 3WNDA 4ACBA 4NBSA 3B82A 1VQ5B 4N3NA 4Y9RA 3W2EA 1D8TA 3B8HA 1E62A 3ZBTA 1AMOA 2D74A 5GV7A 1CQXA 2DY1A 3I1FA 1VQ6B 4B3XA 1F60A 1GO2A 3E20A 1VQPB 4PC6A 1E64A 4TMTA 3U6KA 2BF4A 2EFGA 4TMZA 1FNMA 1QX4A 1QGZA 2XEXA 1ELOA 1F20A 1H85A 1S72B 3CCRB 3ES9A 5TR9A 4NCNA 1KK0A 4RCYA 3CC2B 3W5VA 4TN1A 3VO2A 1QGYA 3CRZA 4K1XA 4C0SA 2QDXA 3ZZUA 3PENA 1ZM4A 3ZZTA
chains in the Genus database with same CATH superfamily
2ZTNA 5E6TA 3HUFA 3KTAA 4MYTA 3DKKA 3W2HA 2FRDC 2H4ZA 1UPCA 2BFCA 1U8CB 3LP8A 5EIHA 1GSOA 2IUSA 1LF0A 2ORIA 4WCFC 2ECOA 3TL3A 1KORA 1R88A 5JCJA 4YJFB 4DQUA 1E43A 3P0FA 3UK0A 3GLIA 4F60A 2B2CA 1E1KA 1BX1A 1EBUA 3QMPA 1CS0A 2Q2WA 3W5DA 4NBWA 5K51A 2PGLA 3K9BA 1SUIA 3A1FA 1OFTA 4ZJYA 5BN3B 2R48A 1UD4A 4BO9A 5EOVA 1JU4A 3A4NA 1DFHA 3RGWS 1BD3A 1EG7A 1BG6A 4IIHA 5EXDA 4RGVA 4EO7A 2GHIA 4G8BA 3H9EO 3GFPA 4AY3A 3LP5A 3IODA 2RK6A 5LBUA 5BUQA 2QUIA 5DNCA 1JSZA 1YJBA 5BQFA 3DTTA 1DBQA 2N42A 4GFDA 3S68A 4K9NA 1VLQA 3ZDAA 1DRKA 3SVZA 4LSGA 5LP6C 4EB0A 4PSCA 1LPNA 3TMAA 3WGTA 3PQEA 2VQFB 2Q1UA 1L4LA 3EDMA 5IAOA 2CYAA 1KMCA 1OTHA 2WWRA 1MVLA 4LQ4A 5D8DA 5LMCA 5BWLA 1Q0PA 2ZS9A 5JSHA 2FQXA 1PT5A 3DMTC 3OLYA 5IC5A 4N47A 1IATA 5IAEA 2P11A 4AUKA 4CEJB 3X1DA 1UZAA 1TUEA 3VPHA 2Y1LA 3TKYA 2AOUB 3GHYA 4H1VA 3A05A 3LIPA 5KQSA 3FJOA 2GBLC 4CF7A 2HX1A 1G63A 2VQ6A 4TMFA 3THXB 2FEWB 4ILKA 4DLWA 1KAOA 2ZVPX 1Z8HA 4WOCA 4GKAA 1M1ZA 4P5DA 1TUIA 4D8WA 4NCHA 3G68A 3OKCA 3G1UA 3FE2A 2VBCA 1TA9A 3IHLA 3OQNA 1WXFA 2OV4A 3E3OA 4REMA 1P7PA 1PZFA 1Y6QA 1OXTA 5COBA 1R27A 1NNSA 4IDBA 2C61A 3M70A 1JRLA 4JXJA 2AFIE 3CESA 1EQAA 1EUCA 1BDIA 4PG6A 3ZWMA 2ID9A 4REQB 2C9OA 1LJUA 2UUPA 3EXAA 2C5FA 4XDGA 3V7FA 4A0HA 2ZR0A 3ZBUA 1S2MA 3DBHA 1NI4B 3MWEB 2O50A 1ESDA 3TKAA 3WYNA 3ANYB 1WDWB 4GYKA 1YBVA 5IBRA 4CR6A 2VHUA 3WB0A 4GT1A 2ZBRA 4JLUA 3RBZA 3S2ZA 5B12A 3MYYA 1OHHA 2W22A 5KINB 1A3CA 4ISCA 1N6OA 1ISJA 3HXMA 1C9YA 4A8JB 2C7OA 3GVLA 4WSOA 1DX6A 1LGYA 5DYYA 3PUHA 1JEDA 2D0IA 2XWPA 3NTXA 2DBQA 1T5EA 3KLNA 2Y68A 1P8JA 1WUTA 2Z9CA 5IBQA 3H5NA 1UMBB 4BVKA 3NHJA 4XSVA 4S2EA 1MABA 1GADO 3S3TA 1YCGA 3OZXA 4B6EA 1FMFA 4H1UA 3EC1A 1EJ2A 2OHGA 4AO6A 2QN7A 3PWKA 1DXYA 4M0KA 4DRZA 2Q4TA 1KK3A 3RPEA 4E0BA 2OBRA 4R8LA 1I7SB 4RCZA 3F0TA 4AY6A 1GTJ1 3VHRA 5EZYF 4IH4A 4M87A 2POQX 2O8BA 4ZAGA 4JB2A 1KZGB 1RVV1 4TS9A 4A26A 4F4HA 1N6KA 1RHKA 4QT4A 4YV0A 3FCSB 5DMHA 3KDSE 3ND5A 1J0CA 4HQLA 4PR0A 4ACAA 2OLJA 4YRSA 2PZFA 3D4PA 2CK3D 2RCNA 3FPAA 3G89A 4BO7A 1IZZA 4OPMA 4OFWA 4WY8A 1E5LA 1W0JA 4LGVA 4M99A 4D2IA 3ADBA 3WLKX 4ALJA 1RBMA 1WF6A 3URMA 3WNQA 3VR6D 4S1PA 3NYRA 3ORSA 4AI6A 1KI7A 2V7BA 3PG5A 4DR2B 3HDJA 4QAJA 2ZUBA 3TL2A 4IIBA 1GNQA 4L6CA 4DDHA 1VQ8B 4KIFA 5EE5B 3FFTA 5F1OA 4DBLE 4LHVA 1APBA 3T51B 1UQTA 2WNHA 3U16A 1F0NA 1ARZA 5E0OA 1SXJE 4FFWA 3AESB 4D98A 1NM5C 2EL7A 1VCNA 3WIEA 4B7CA 2XVZA 4EMTA 2Q3DA 5LWHA 2VJDA 2W6ZA 1Q2UA 1ZONA 3F6RA 3PUXA 3QJYA 1RWOA 1K7SN 2G4VA 3AT1A 4QPNA 4HH3C 1QRAA 4I0WB 4HQOA 1Y0BA 4FGJA 3TR0A 2JGFA 3AV0B 3TAXA 5JDIC 3PF8A 4YRCA 1N2CB 4ZRMA 3CE9A 3SYKA 4CDNA 1XA4A 1CRWG 1PEYA 3I72A 3OM1A 4LBYA 1Y89A 1YVRA 2J67A 1GTG1 3BB4A 2FZ5A 3T5PA 1NVMB 1J9GA 1Z6AA 1IOLA 1F5NA 5IFLA 1X7YB 4A0QA 1KDZA 1YIOA 1CPYA 2RHRA 2PGNA 4EWLA 4U6SA 3KQPA 1NNI1 1A5ZA 1L7OA 2WMDA 3ECCA 3R5FA 4MB6A 5FV7A 4ZMSA 3M3PA 2RHMA 4KVAA 3RBXA 1N5OX 2H4WA 4MGKR 5LA6F 4MUYA 2OBYA 4HVTA 3VDNB 4YUAA 4MTLA 2M9MA 4P9NA 1SUAA 4BNFA 5DM2A 5BQXA 3BDIA 1QIKA 5BWCA 2YRFA 3KYIB 1Q16A 3T5TA 1KQNA 4I46A 3M9LA 4QDOA 2EX0A 2I22A 4RX1A 3VU9A 4A27A 1RD4A 4R3NA 2GASA 4AF6A 1OTYA 4Y9DA 1Y3AA 3WJAA 3DL7A 1JIXA 4ZCLA 3T3MB 4CKCA 4MQ4A 1KPHA 2GHRA 1N2IA 2H2FA 2O3TA 3M6FA 1VC2A 3GVPA 3JWHA 1VP3A 3DWFA 4X7BA 2I62A 5JNWA 3KIPA 1W8IA 4C29A 4R1PA 5DT2A 2RGEA 3IVGA 4YASA 4DNXA 1HTWA 1H6AA 3X43A 5H81A 4AB1A 1JHDA 4UAGA 4B83A 5FDFA 1HA3A 3H18A 5AFSA 2RBGA 1NX6A 2FN3A 4H7EA 1NDUA 4UMDA 2ZR9A 3PDIB 2OCDA 2F8LA 3DT9A 5E2BA 3STWA 1CQWA 3WO0A 1JU3A 4M0UA 4J1NA 1VE6A 2X41A 4TS4A 4YTEA 3U44A 4C88A 1AH2A 1Z4PX 4RWEA 4AWBA 3MCVA 3BTVA 3E7XA 1ZAKA 4AMYA 3G1TA 1VLZA 3L7BA 2Y66A 4XIFA 5KNBH 1TTHA 4GXTA 2GHQA 2PGDA 3GLUA 3QKIA 2VSYA 3NTUA 3VISA 3DZCA 1KC1A 3HLTA 5H4HA 4IMJB 2P4EA 5BMVA 5KX5B 3QUSA 4UPVA 1OI2A 4UEWA 1RAHA 5FYQA 4D0RA 2YXPX 3DL0A 2C9CA 3EXEB 2XUGA 4E7OA 4I3FA 4ZEVA 4OK3A 3RG2A 3PPVA 1ZD1A 3MLBA 3MTGA 3PHBE 2QP9X 4I4LA 4WXMA 2DBRA 1ULBA 1YZKA 3QV2A 2H85A 4NMLA 4NV0A 4RV4A 3UV7A 4D1YA 7YASA 3D8TA 1I13A 1GLVA 1U4OA 3BDAA 1XHFA 1L1QA 1J5PA 2FG6C 3R6GA 5EQFA 4C0QC 2J7KA 1J20A 4RTNA 1QOQB 1TVMA 4J8PA 4ZT4A 3UQYS 5ICCA 5CVDA 1IBMB 4ZC8A 3L8FA 1IMOA 3A8KA 2IEYA 4RQAA 3OX2A 3BULA 2OORC 1NTOA 3TS1A 1L5VA 1ZOOA 1JKMA 3UY4A 3TUZC 2Q8QA 5E6RA 5DHFA 3KZMA 2RBKA 1OT5A 1SHKA 2H54A 3HRHA 3V4PB 2Z5LA 4UXIA 3O6VA 4X0EA 3ZY5A 4L9AA 5K0GA 2IPNA 3N8DA 2FU5C 1XTRA 1YGPA 2AR9A 3BD6A 3OUZA 3KEMA 5KCZA 3WZMA 4R1LA 4U9IS 1OR8A 1C7EA 1RYZA 3QVXA 5FBHA 4HQ6A 5BSFA 3MWLA 4W5TA 1N2BA 1N5LA 3KEGA 2A84A 4E12A 4ZAWA 1KYVA 1R4NA 3E8SA 3R2JA 2V4DA 3VR2A 3QFSA 4NBKA 5ISMA 1EXMA 1B15A 2UUBB 2W43A 2ZT6A 2QGGA 3LWDA 5LCXA 3CZQA 3H8VA 3OM0A 4D3ZA 4DSOA 3VO9A 1SHLA 4HGPA 3MSCA 4R01A 3PUMA 5PNTA 1VIVA 3HNPA 2LZ0A 4Q9LA 4NOJA 5EIOA 3T5DA 3FYHA 3N5CA 3Q7SA 3IKTA 4A8TA 4LNUA 4KREA 1J2EA 1AE1A 3HB0A 1FFAA 4Q34A 3QW2A 5H5JA 2I7DA 1U7XA 2XNHA 3T99A 1X0XA 4BASA 3OQBA 4BMZA 2ZJ3A 4RQBA 3N7TA 1ZLYA 5DM60 2H59A 2HMTA 5LVAA 1GAWA 5FL7D 1XMQB 1GR0A 5LIRA 2AMJA 2ZJOA 4ZU6X 3D0RA 3LUCA 1FYFA 1WLSA 3I9V1 4F3TA 3OF5A 3HBAA 1PE0A 4TKUB 1BXGB 3N6XA 4RM3A 4ZDKA 1ITZA 1Z5UA 3DVAB 5FPKA 4QXAA 2QNBA 4CNBA 3H2KA 2C42A 2PFKA 4CIBA 4K6CA 5CMLA 2W6NA 2CE7A 2GD6A 1PZNA 3OC6A 4GR9A 4EECA 3PQ5A 1EHYA 2PJUA 3FPBA 4LWZA 3UC5A 5JCOC 3NT5A 1RXSA 1Q15A 1J8YF 4RA9B 3JATB 1JFSA 2YWGA 1NBAA 1RAEA 2HREA 3EGIA 3N1UA 4UPEA 3VO1A 3BWEA 1OXVA 4ZK2A 5BV8A 3I62A 1GAJA 2A3RA 3CD6B 4TPKA 1OA0A 2R6JA 1QPGA 3OJWA 2W7TA 3COPA 4QDZA 4W6QA 3DFUA 5L45A 3U56A 1N2OA 2WKRA 2IZ7A 2ZRKA 4PAMA 4RTKA 5H8WA 4YAFA 1FB5A 2DWUA 2GAIA 3I6IA 4JGIA 5DHQA 4I2VA 4HAZA 4O5OA 4PNEA 4WNCA 4B80A 3WMGA 4JEHA 3AR4A 1A9ZA 1EVJA 1YJ5A 3CBGA 3ZVNA 5J43A 1K8YB 3HU1A 1YV9A 1WOYA 4NI5A 3OIFA 3C1OA 1NQWA 2BPOA 5CYGA 1O6BA 1UBKS 1YJQA 1UPBA 5IEBA 5JJCA 2D00A 4KPEC 4JQSA 1IZ7A 1F8FA 1GPYA 1SZDA 2EZ9A 1CV2A 2OEPA 4HB4A 4OK6A 4QQKA 1FRQA 5AMXA 2JGMA 2NVOA 5FL3A 3BHMA 4KBFA 1VQLB 4M9XA 4AF8A 4RSRA 4C4OA 2J09A 2Q2VA 3GJSA 3D0KA 3IOBA 4BGIA 4WBNF 3U7FB 1MJFA 3C4VA 3GROA 4H4CA 5JYCA 4KFTA 2XMGA 4ABYA 2QRMA 4K6MA 4YBRA 2LCQA 3VR4A 3GIDA 2HRZA 4OXNA 5DDIP 1S8NA 1GRVA 5BRNA 3UT0A 3AGQA 1SQ6A 4KTTE 3W5JA 3Q3IA 1UDRA 3EPPA 1QH9A 4KHZA 5TGDA 4FFVA 1KDYA 4JUFA 2UXBB 2VBUA 4MRNA 1ADCA 2R85A 2HHCA 2OHVA 4H6PA 4JQOA 5JNVA 1X39A 3NEAA 5JEEA 3HJTA 3FNQA 4NL4H 2C7BA 4RKWA 1IULA 1ZN2A 3VHXA 1VI5A 3KLMX 2A6PA 4WN3A 2GQ0A 4D0SA 1W4CA 3RYIA 2D06A 1DADA 3QPCA 1SKAA 2VDNB 3HJAA 5TPZA 3OFKA 4N48A 4NLLA 3L6CA 3F6EX 3AY7A 3JAWB 3C8DA 1HOXA 4BVBA 1Z4MA 4QSMA 5ERGB 5KYUA 2OZLA 3IEPA 1O95D 1RI1A 2HJSA 3GBPA 5REQB 4WUVA 4C6HA 4MHTA 1CFZA 4OXQA 1OBVA 1XXLA 3QKRA 4WAUA 3R9XB 1FXSA 3I3SR 4G0OA 4Q3OA 4XLLA 4V0MA 2GBPA 2QTAA 3V1LA 1ACMA 2OG1A 1ZNZA 4TLAA 2PXAA 2G88A 3FMFA 3H1EA 2W90A 5HF9A 3G2HA 3RYHA 4UTNA 3AVPA 1IIBA 3VYUB 3GFOA 2FZLA 2KMLA 4GVLA 5KWVA 1T29A 4M9CA 2W4IA 5DCLA 4YAJA 1Y37A 3INRA 3WLOA 3EIWA 3PWZA 4BXOB 4ER6A 4S1VA 4I4IA 4IGFA 1RPZA 3W8NA 2HT1A 3EQ2A 2J85A 1RPJA 4UOEA 3ZEAA 3U4MA 3MBOA 3OEHD 4PYQA 2EX4A 4DQXA 4GPEA 2DLDA 3R0VA 4D42A 3W5SA 3EDQA 3P94A 1U3CA 1Y1KE 3QX8A 4KG7A 1GZ6A 1JR3A 2V4MA 4IDOA 4K9QA 4PICA 3NVKI 1YZVA 1SVUA 1B16A 4MKHA 1ELOA 1T5OA 2Z5FA 4NZMA 2B34A 4MV0A 4JR0A 1E77A 2TRSB 4PZEA 2J3MA 5JZVA 1DBVO 2BI7A 5IBCA 5DNWA 4PCAA 1JG6A 1MX5A 1R0ZA 2IYAA 3LMKA 1REQA 5T6BA 3FMOB 3TSOA 1XRLA 1JFLA 2V54A 1DAKA 3SXUB 6AT1A 2W42A 2J41A 5AP9A 4IJQA 1E3XA 5TR9A 1BMDA 1P7CA 4E14A 2P6UA 2EOAA 3PGMA 5DVZA 5EWLB 2P62A 3OLZA 2O8DA 4RYLA 2PR7A 4F6CA 4C0SA 1R74A 4FGUA 3P0EA 4JBGA 2FUCA 3A26A 3MN1A 4MEAA 5B58T 3FYSA 4BFZA 4CLDA 1RLJA 5AD1A 1QP0A 1DGQA 1AS2A 4EVSA 4V1CI 3O94A 3MHTA 1FFHA 1K7FB 4W7SA 4G7XA 1JIIA 4X97A 1KAEA 5LZ8A 4YMUA 4KITB 2B9VA 5CT6A 1IONA 1AQ6A 1C7IA 4FXUA 1UD2A 2HIHA 4JX9A 3AIIA 1AKQA 3K09A 1OLUA 3KZXA 3ABSB 1TKAA 3VYRB 4FONA 1PZEA 1OY1A 4QOSA 3KSUA 4OL0A 3OBIA 2RI1A 3GUZA 4Y2RA 3MT7A 3FPKA 2OAEA 3AJDA 3D4BA 3H84A 3JWJA 4FQ5A 1BPLA 2G70A 3FBGA 4JYZA 1K4YA 1ZBDA 4JQCA 3EW9A 3BJZA 2CFSA 5IYWA 3QBTA 1NF8A 3SGLA 2IDKA 4DUZB 4KQ1A 2Y76A 3OOYA 2NXEA 2WVJA 1ZK2A 5JC1A 1J4AA 4AF7A 5JMOA 3KPJA 1UK8A 2XKBA 3B1KA 3D6UA 2XB2A 4GRDA 4IFIA 1NW8A 4BTVA 3SQDA 5FA6A 1KQPA 4DWOA 3IGFA 1AUOA 2WV7A 4HAVA 1CY4A 2RGXA 4JOQA 3WWDA 3F3SA 1RU3A 4I81A 3ZLBA 1OSNA 3I42A 4DUGA 4IXDA 3RUHA 1CR6A 4DCUA 2OBNA 1SBIA 1OX6A 2XYRA 1DCKA 3IUBA 4JMLA 1TE2A 5EKSA 3IOEA 5I7AA 2QJTA 2X1VA 3VVBA 4ATNA 4DYHA 4E5KA 1EESA 3NT2A 2H5LA 1CR4A 4DEXA 4EGAA 5I47A 2C5LA 1RADA 1V47A 2Y93A 5B3LA 1AF4A 4WK6A 1GFWA 1UJMA 5BSHA 1NSFA 2VHTA 3O8OA 3E7WA 3LX6A 4HKTA 1UC9A 4PU0A 5GM1A 1N2GA 1QF7A 1R0KA 3RSGA 1NQ5A 2PX0A 2P2DA 4Y2XA 4E7PA 4MKZA 5KBYA 1XTTA 1V0JA 4J4HA 4XQEA 2B7BA 1U3WA 2EKQA 2FEPA 2G67A 2HSGA 3ZHCA 4FZ5A 4HE6A 5EE0A 3AHFA 1HZEA 5HOEA 3AY0A 4I55A 1H9AA 3P4XA 2PM8A 1SKYE 5HR5A 2ZBVA 2A0FA 2IDZA 2Q5QA 4YR7A 3MTBA 1IH8A 2GZ3A 1IHOA 4OSOA 1M2VA 1ZOSA 4M3NA 2A1TS 4A4DA 5B7GA 2ENUA 1HLFA 3EGCA 4XTRA 3DLCA 3DW1X 3I2FA 2I80A 2HB6A 3FHCB 3LFHA 1OASA 1XPOA 4B3TB 1YB2A 2VOJA 4IZHA 4MZXA 1UZUA 1S8AA 5KYYA 2DBYA 4WCFA 1VGRA 1Z5WA 3BIJA 1G5TA 3ADKA 2ZLBA 4J1QA 4KAAA 5I8WA 3P96A 2W2QA 3NHBA 2OCGA 1C0KA 4ARZA 2B1GA 1RQRA 4MW2A 1OWLA 3OY2A 5AUPB 1HQDA 1RQNA 1IQUA 3QUAA 5CDSA 2D1RA 3MCWA 3G3EA 2WAAA 4NQZA 2D1YA 2EATA 4RK5A 1W34A 1KI6B 4YLGA 3DLBA 5HKAA 5FR2A 3BMOA 3ZD9A 4KIUA 5FBKA 3D3WA 4MWSA 3ROFA 2AS0A 2QV0A 2ZT7A 3D1LA 3MEQA 3OOWA 2OCBA 3DMFA 3DM9B 4JLOA 4KQ9A 1EBBA 2X9VA 2ZIXB 3WIBA 5EMHA 4V24A 2YCLA 3DFIA 4FKZA 3GD7A 4HR7A 3JQPA 1Y4AE 3UK1A 4U8HA 5SYNA 5TS3A 1Z18A 2YH2A 4Z0TA 2BGUA 2GAFA 2PXXA 4UAVA 5EJAA 2AYYA 5BMOA 4KKTA 1OB5A 1T4CA 1W2WB 1J2RA 1SD5A 1K8XB 3PHGA 1KOJA 3PS9A 4I14A 3RDPA 1M1UA 4GKBA 2PZAA 1J22A 2V03A 2AZTA 3TGWA 1U28C 2BT4A 2E0IA 3HKBA 1QYXA 3NEPX 4V39A 5AJXA 4NYJR 1D2AA 2ZS7A 1V7ZA 3ZKWA 1PX2A 2RIRA 4HL6A 1IUOA 1Z3CA 1E7SA 2Z43A 2VJBA 4TN5A 2Q5HA 3KT6A 4FYHA 1CHDA 4D8XA 5CEJA 4FMPA 4BLOA 1IPEA 3BIXA 1CCWA 2EZUA 4N4AA 4MO9A 4RV9A 1YITB 2C03A 2D13A 3LY8A 1ZUNB 1LTKA 2A5GA 1MB4A 1W19A 3KJZA 1G41A 4TZTA 1Y8AA 3MINB 1NXTA 5ALUA 4BVEA 4DWVA 3ZIAA 4ZIRB 3C3YA 2WYRA 1P81A 1VGVA 4LHEA 3ZDDA 3LUFA 4RPBA 1NLZA 1HDIA 3GT4A 4AZ3A 4IEEA 4PLTA 4LFCB 1GXSB 3MJEA 2JFHA 2ICAA 4UCQA 2Q29A 5FTKA 1Y80A 3B1VA 1EX9A 4FYPA 1ZGGA 3QY9A 1GGKA 3VDMA 3IR5A 4KKUA 2YHAA 3KYCB 5LBIA 3LBAA 4UM9D 3KEOA 2E4AA 2R3SA 4YJDA 3KSMA 3ZKAA 1R3DA 1RRFA 1F2VA 1FLDA 4LZAA 2X0KA 3KB2A 1TTTA 2O54A 4O4HB 4Y2GA 4N0DA 1BSVA 3GFSA 5DTJA 5I7EA 2DKFA 5TARA 1BJRE 2W37A 5LQDA 4ZO6A 4NOMA 2MYTA 1VCIA 2JGRA 4O3MA 3ESBA 3RRNA 1MT0A 3C74A 2CLIB 3NVDA 1TXGA 1UC5B 1P4AA 3KE8A 1LV8A 3DOJA 2ZB4A 1SH7A 3ZR4B 3QF4A 1KSFX 3KO8A 1TA0A 3SBEA 4COKA 4U7PB 1N7IA 1K6IA 3NHYA 4S0XA 4ZAYA 4DIBA 4WQMA 2JFGA 3JR7A 3QXXA 4W8OA 3HYNA 3WQZA 3WKAA 4LX8A 2I4RA 2XUZA 3WLAA 4MS1A 1Q22A 4AN0A 1SXQA 3HVJA 3PK0A 4QUAA 1Y98A 2PIAA 4M1TA 3PE3A 2VP4A 4LSZA 1F4VA 1ZVQA 1G7TA 1QP4A 3S27A 3ZC3A 2A58A 1LDMA 3A1UA 1J56A 1AM4D 1HE1C 1ZIOA 4HWPA 4XYGA 1Z0FA 5H82A 3THYA 1G59A 3D6JA 1FA9A 3W6PA 2G1UA 3FPEA 5JECA 3TRFA 3V7AA 1UT5A 1OE0A 2KLBA 3ID6C 3PSHA 4KPGA 3V32A 2DYKA 2J3HA 5JROA 1EFHA 1AC5A 4NARA 5KNCA 1IC6A 2IKQA 4JT8A 2YN0A 1I2AA 3LE8A 1M3SA 3ANXA 3CLUD 3OWOA 1NKVA 4UM5A 3V1MA 5CB8A 3NALA 4FLFA 2ZJ8A 3FDXA 3F73A 3BBLA 3HUDA 2DY0A 1R8SA 1IB6A 1X87A 4ZICA 3FZEA 3WSTA 2OUKA 2BHSA 2QN9A 2DETA 2VDKB 4BP1A 2A1IA 1XEFA 4F12A 1USIA 1NM5A 1NU8A 3BVPA 3OAAD 3PEFA 2WVHA 2Y67A 3BX1A 3GU3A 5I5EA 5JCPA 2E55A 5DP1A 5LIPA 3I32A 1N8TA 1OREA 1P39A 1W52X 2XCLA 3N8GA 1UM8A 2VIIA 4KDRA 2PX5A 4KQEA 1NMZA 1SK8A 4X20A 1XRSB 5D85A 5C80A 5J2TB 1X1TA 3T4UA 1DAEA 4TMXA 4QBKA 3LQEA 1YOVB 1RXIA 4LXIA 3AB7A 1TLTA 2PD3A 3GDFA 3P19A 4PYKA 3WYBA 1PWHA 2DGDA 3TVTA 1N2JA 4GH5A 5IDQA 4XR9A 4MOWA 4RPJA 4XVCA 1RI5A 3VR3D 1EP2B 4DIDA 1ADJA 3I6MA 2FV8A 3IT3A 4HD8A 5HXBA 4X6UA 3CGWA 1WSDA 2NXWA 1KIAA 2FHSA 1J07A 2PUHA 1H69A 4IDFA 3HB4X 5FAXA 2R9VA 5DX8A 1XFAA 4CM1A 2J5KA 4YP6A 2DT5A 4JLNA 4ZHQB 3HYSA 4PIPA 4Q1FA 3ESCA 1FFYA 5L95A 4O08A 2W8BB 3WDLA 4YHBA 1NVXQ 4MGEA 2VYNA 2YZ2A 3EASA 4X8LA 4N82A 4FI3F 4DAOA 1EFAA 3AU9A 4FYJA 5KU1A 5M5BA 3WLEA 3B78A 3I2IA 1ZWKA 3TNYA 4YPOA 1L5HB 3T34A 4OKIA 1DLJA 2QUAA 3LX8A 2ATIA 3TW8B 2Z2KA 3IESA 5A7GA 3EWNA 3QEJA 3UAVA 4DM7A 5JQGB 2VPQA 3FIUA 1RPAA 5HKLA 3HBFA 4EUNA 3OOHA 4G2NA 4IIGA 1EFLA 3KXDA 3IE0A 4JVLA 3ET4A 1WZIA 1V2HE 3KJEA 4FXOA 4CGYA 3QPDA 1M7GA 1PF7E 4QYIB 3UK2A 5K9ZA 1QPZA 1KMMA 4KIGA 2B4TO 3IC5A 1WPQA 4S24A 1F51E 3Q88A 1I24A 3R3JA 4CL0A 3Q39A 2VH2A 2PS1A 4HHEA 3T7SA 4II2A 2KQUA 3ZCTA 4L7QA 2ORED 2PAAA 2QQEA 2UZAA 4CVNA 1NF2A 4ECEA 4V1CA 3BXPA 3WKBA 1JHVA 5L3SB 1WXEA 5FJIA 3EMKA 2FFJA 3EVEA 4F1JA 1NP6A 2ZK7A 3HCEA 4GVPA 1PJ4A 3DAYA 2J31A 1PGQA 1S8OA 3NVAA 2IOFA 3WJ7A 4K1LA 2QX6A 1U9ZA 1QTQA 1Z3IX 2HIGA 3IIEA 4EAQA 4L5CA 5FLEX 3UJHA 2YZMA 2GDZA 5CA0A 1I01A 3RTBA 3DCNA 5JYDA 1JBEA 1VBKA 1LJLA 2RONA 4WACA 5EP4A 3ZHZA 4NJMB 2BZ1A 1E2KA 5BMVF 3E5RA 3HCOA 4PV7A 5CRIA 4TTVA 2SKEA 3WDKA 3G2MA 3NIDB 4M8IA 4F5ZA 5DM70 2YWDA 5G40A 5KTYA 4JAVC 3ZHVA 2OQ2A 3LBYA 5A1TA 2XHEA 4OHRA 1B23P 2O05A 4IGEA 1O3YA 1FDVA 2HMYB 1QC5B 4X07A 5EC8A 1G3RA 3V4SA 5E4JA 3VH4A 1YB1A 1VQ9B 2IUTA 4QJ5A 1UBGA 1E63A 4R9UC 4ZO4A 2GM9A 5KAMA 3W3ZB 2HLDA 2YWEA 1RWNA 1W93A 1T2FA 3ONDA 3A3NA 2I65A 4YRRA 2B7LA 1TLLA 5LQAA 1Q92A 2REBA 4C3UA 4RHXA 1N75A 1NXSA 3DC2A 3KTFA 1KYXA 1XMPA 4GM1A 2GPBA 1UAAA 1SBQA 1AY0A 4PFJA 2QE7D 3K94A 5J63A 3RC9A 3SZGA 4HYYA 2C2MA 3LVFO 3M81A 4IUDS 3IDAA 5HBGA 1C7QA 4MWTA 2G1PA 1N5IA 3D31A 4I6GA 1RHUA 3KT8A 2WKPA 2YW9A 4HGZA 1DC3A 2G76A 3QOFA 2C5BA 1SC1A 2LR0A 1MC5A 2WW8A 2EWMA 3OZBA 5ALPA 3S7ZA 4F1KA 5F1YA 4FMCB 3I09A 3IPAA 1QHGA 1KFBB 3NTRA 4QBFA 3KQYA 4N7RA 4EVQA 4IJKA 1TYEB 1Y82A 5F2EA 2ZUFA 4JLSA 1X74A 1QRRA 3DL4A 3NAZA 5L3QB 1CJUC 4OQYA 4U6NA 4FOTA 3KLOA 4HTAA 3M1YA 5TQ0A 4V0RA 1UBLS 2CT8A 1E79D 4HUQB 2Q3FA 4YPVA 3W6NA 4UJ5A 1POWA 3I0ZA 1XVIA 2XADA 3JQDA 3VR5A 3IP7A 4HB0A 4XYEA 1Z82A 1XO1A 1QMPA 1O6GA 4I4TB 1Z7WA 2H06A 4NP6A 1EVKA 5E7IA 1HWYA 2AFHA 2CLMB 2I71A 4P7KA 2OENG 4DR1B 2VJJA 1CZLA 2FPOA 4RJ2A 1MJNA 2IIQA 4GBED 1YVEI 2QGNA 2I9KA 4NBSA 1ZKDA 4KQFA 3U3OA 5C3MA 2F4VB 2PN1A 2FXVA 2RGUA 2DPGA 5AOCA 3CVUA 2FMXA 2PWBA 5AUNB 3SQWA 2QN8A 1FSFA 4LDAA 1ENZA 5FI1B 5IVPA 4Y2HA 3V1NA 1RPNA 2NMVA 3FCEA 2PKQP 3ENVA 3HP4A 4IVQA 3LCCA 3SHFA 1TK9A 4BNGA 1I8DA 3A1NA 2QVLA 4JT9A 1U02A 4NS4A 2OMKA 4BMYA 3GT0A 2DECA 1QIDA 1YS9A 3F5FA 3L1JA 3L9XA 2L2QA 2QLJA 1PL6A 3IV7A 4GYJA 4IV8A 4MLZA 5JCOA 3ZGXA 1QV7A 4X1YB 4Y67A 3PD0A 2E49A 4TSRA 3ASRA 4AAYA 4D7AA 1P72A 1E58A 2GPNA 4KGXA 4E09A 1X7WB 4H1WA 1NNEA 1H4SA 1QU2A 4JMQA 2GEJA 1ZD5A 2QTTA 3MF4A 2CNWA 2I6UA 5I8ZA 2FSSA 4UARA 4UZEA 1ABEA 1ZJYA 2XMSA 3EVZA 4JJZA 1IBSA 4WESA 4BLVA 5C2JB 4LRQA 1JJIA 3CKKA 1U1CA 2B4YA 4JLKA 4O5AA 5LSAA 1LWOA 1WEKA 1XDGA 1T5LA 1A50B 2O3JA 4P3NA 2ZZNA 5IANA 4GR4A 3M6IA 3MJFA 3OZSA 5K3BA 3Q5GA 4MMYB 4CM7A 4LKOA 5EKTA 4PZCA 5DGTA 2VTBA 1O6FA 5IU6A 3MMXA 4MI9A 1L5MA 1ST3A 2CHUA 2X2PA 3ZDZB 1Z16A 4A2QA 3L49A 2V9PA 5JSZA 1QO0A 2HJVA 2Y4OA 2FY8A 2C95A 2IY9A 4NZOA 4CV0A 1U94A 4B74A 4PLFA 2O8VA 2GDJA 3E7DA 5E38A 5AHRA 1M73E 4RSHA 1Y5RA 1EZ1A 4H0FA 4XFJA 5B1SA 2MSLA 2XRFA 3WGMA 4C7XA 1RC0A 2GCOB 1Q19A 1WD7A 2X0DA 4CQMD 2WUWE 1DNPA 2O2ZA 5TF4A 3TRHA 4JI0B 3C8HA 4A92A 2AKEA 2HFKA 1UBUS 2O19A 1T0PA 1XZHA 3NUZA 1A76A 4X61A 4HJXA 2HADA 1RBYA 1KK0A 3CC2B 3GCDA 3JYPA 4ARIA 2IZ0A 2BGKA 3RFTA 3W5VA 3GVXA 5CR9A 4QELA 4YRDA 2NZJA 1SJ9A 3FWPA 3WQHA 4CV3A 1K8ZB 1QWOA 5EIBD 4KYUA 2R5WA 2PBLA 5JARA 4G41A 4CKYA 4GWGA 3LG2A 2G8LA 2AGVA 1V16B 4URHA 1O96A 4Y30A 2UV8A 3JVUA 1X1QA 1L7BA 3PEYA 1T4BA 3NVMB 4GOOD 4JGBA 3EG9B 1JDBC 4RF5A 4BKMA 3DE0X 5JDCA 4FDAA 1XCPA 2Q0SA 1PR5A 4UUPA 1A9TA 2CLHB 2CVZA 4Z0PA 2P0EA 3TLBA 1G16A 2VDPB 2BMFA 4JKOA 1VL5A 1D2RA 2IEZA 4FGWA 3VM6A 1BYUA 4HIZA 2ZTHA 4BNVA 1E4OA 5C53B 5LDGA 4Q93A 1JLMA 1D2CA 1M2WA 3OOCA 4YUVA 1IE3A 4KN9S 4P9SA 1RM4A 1L5LA 2H4FA 3UH1A 5JAHA 2IHNA 4YNBA 3BGOS 1KJNA 5IJXA 1GU7A 4L2IA 1RTKA 3ZWVA 4LBWA 3UJDA 4DA0A 2IUUA 4EY3A 1RHMA 4G26A 1W6RA 4TLDA 3JTMA 4FHDA 3WWZA 2GZAA 4BO1A 4HDNB 2GM3A 2OD2A 1IRXA 2J3QA 4JXKA 2ODBA 4RMIA 4V3CA 4LI3X 1EGMB 2ADOA 3HCAA 4FHZA 3LQ1A 5A3SA 3G5UA 1T26A 3L01A 4MR9A 2IGTA 2B8NA 3MRSA 4LTMA 1R0RE 1TAUA 4OPSA 1HT1E 1IHDA 3OMWA 4L50A 1U8XX 1NJGA 2GJ8A 3UT5A 5K4GA 3KUKA 5GP1A 1V4VA 2CF5A 3BRSA 1AUVA 2JATA 5G1PA 1U0BB 4D3SA 3SQNA 2UZ1B 3M2TA 2AB0A 2QPLA 3BWYA 5KJEA 4N9WA 1HK7A 5LQKA 3RV3A 5DYIA 1ZR2A 4MYCA 2IZ5A 3ROZA 1II8A 2RGYA 3C6ZA 3C3EA 4QWWA 5D3KA 2ZCUA 3ML1A 4MIKA 1ORHA 4Z4VA 4GPIB 4M49A 5IT0A 3GA5A 1E94E 5FWXB 1N3IA 1ODIA 3PXEA 5FOWA 4LFAB 1AHIA 4B09A 1E32A 1JXOA 2JJMA 2TS1A 1AB5A 2ZXEA 4FE7A 1PHPA 2NTVA 5FBVB 3GPBA 1WZ2A 1EVZA 3Q7TA 3Q98A 5L53A 2ZBUA 2H2DA 1OGIA 1E8DA 2W71A 4PNHA 3ZQJA 4HNAB 4C6SA 1DC7A 1JHPA 1EWTA 2WLSA 3KR9A 3QA9A 4Z2YA 3T0IA 1VL2A 1YL6A 5EE3A 4JBHA 1AKNA 1IXKA 5IKPA 2E5LB 5FOUA 1B73A 1Q21A 5EIFA 3WA7A 2YJ3A 3GJ7A 4KYTA 2GJRA 1D1NA 1XRRA 4JHLA 1NLUA 3K1AA 4J75A 2NPOA 4MR7A 2Y05A 4PVDA 4YAKA 1GNVA 2ZL6A 2IL1A 3AM4A 1OPRA 2J7PD 3LCVB 4KL8S 4X60A 1IN7A 2IYRA 4AKTA 8MHTA 3RASA 1SQGA 3QIVA 2HNAA 4UQOA 1ZM9A 1O77A 1QGUA 1A95A 3G5AA 3HKCB 2XE7A 4MQ6A 4YPFA 1N6RA 5BURA 2O07A 1VE1A 3PD7A 1I18A 2FUEA 2DHRA 3T3PB 1SZPA 3LXUX 5FNZA 3FI9A 2QGFA 2Y9PB 1P60A 1NOKA 1QH0A 2WTEA 1KTVA 3P97A 4F8YA 1M6HA 4PVCA 3WYAA 4LJAA 4S12A 5SV2A 4I08A 5ESWA 1E9VA 1FMLA 3ZHOA 2HNKA 5B30A 2UU9B 4KU4A 3A4VA 3P0IA 3JYNA 3R6LA 4ZT7A 2RMKA 4WXPA 5EJGA 3CJRA 4YJ3A 4CEHB 5EJ4A 3VYVA 3A1PA 1A7JA 2V7GA 4RVOA 3F78A 5K8IA 1XL0A 5HIAA 4JOSA 1QFJA 4O1HA 1JLRA 5IYZB 4MUMA 1JYFA 1KGSA 4M0LA 3I56B 2C4HA 4B9AA 1CUVA 1ESZA 2A57A 1CEYA 1B8VA 1L1EA 2OO5C 1ZZEA 2WHQA 2WUDA 5JXHA 4PPYA 1TK3A 2R6HA 3I2KA 5BQPA 1XYGA 1BOOA 3R75A 5IJ9B 2PD6A 2CV2A 4H7JA 1NVVR 1YRAA 5BSYA 2DFDA 2A9RA 1XLUA 3CHYA 3NKLA 1SUFA 3U7JA 4F4JA 4Z7OB 1AT1A 5BN4A 4YIHA 2XOKD 1XNRB 1O94A 2J08A 3GJXC 4K26A 4V2IA 1ZESA 3PJEA 3UPDA 2XOXA 2GM4A 1NXQA 3H5AA 2PSEA 3KT3A 4I55F 4KQXA 2E1PA 3MWFA 2CNBA 2YWRA 4L8YA 5HUQA 4L8LA 4MRMA 2BI8A 3OJXA 4GSLA 4PFKA 5CX1B 2Q2NA 4M9ZA 1IG0A 1V1RA 2GRAA 3QFCA 3LPDA 5F98A 1B8UA 4MAMA 3KQMA 2WG2A 3DS8A 1I4WA 3K35A 3JQRA 3EWSA 1T3ZA 3AM5A 4XWKA 4L78A 3GLFB 5HF6A 3HXOA 5AI6A 3NDBB 1RJWA 1UOEA 1C9EA 2AI2A 2P9HA 4Q37A 3ORRA 2OQRA 3HSSA 1RI2A 4C76A 5ES4B 1JIJA 2FHPA 3AG6A 3EMVA 5KWEA 2J4DA 3FLEA 2OC9A 2P5UA 4MVXA 5F2NA 3SXJA 1PLJA 3O73A 2D1TA 1P2GA 1ULUA 1Y1RA 2J9GA 4MARA 5EFOA 5L3RA 4BV3A 1JEQB 3AHIA 2W0MA 3I5UA 2OV2A 3KAJA 1GR1A 4FZJA 2EAUA 2REOA 2ZXIA 5GINE 1JQ3A 3K2QA 1X9HA 1HLDA 3B6IA 4WLUA 2XUIA 2JFVA 2QAGB 1JPVA 4DOMA 1N0VC 2C3PA 2JI8A 3HJGA 5G41A 5EJ8A 2EDCA 5IF3A 1Q0UA 1TL7C 2BZSA 1Y4ZA 3UJCA 3D4IA 1VLOA 4RAQA 2NZYA 4D8UA 5AVVA 2YHSA 5HS4A 1UODA 2BM9A 1G64A 3QP9A 4QYSA 3SIXA 1FMCA 3HJCA 1YIAA 3HWRA 4RH0A 1AQUA 2PVCA 4KO4S 5LP6F 4B3FX 1H4TA 3OT5A 4G0VA 4YP7A 2WTBA 2EJUA 2VDUE 2Z57A 5HF8A 2GD2A 2PPVA 3AF1A 1JALA 1GKYA 3QXJA 2B8TA 1IVSA 3ZPNA 2BKVA 1PLKA 1CUEA 5ECWA 5J1SB 1CEEA 3OCJA 4LSWA 4A7PA 5CLFA 1NASA 4A2PA 3SQXA 2DFPA 2J4FA 3UWDA 1ML4A 4OYYA 2GKOA 4RD3A 3AZOA 3DBRB 4TKVB 3NHAA 3S44A 4RK4A 3JQQA 2FNAA 1Q7TA 4F6RB 2LXNA 2D2IA 1BKDR 1XWWA 2LDBA 5AI5A 5I4BA 2IU4A 4QHSA 1LPBB 3IMKA 4LE2A 4LZNA 5K3AA 2HHAA 2AOWA 1QIGA 1M1NB 2PBFA 1PJ3A 3DD1A 3G0CA 3IULA 5FFFA 4RC9A 5BSTA 5CEFA 1MRNA 4BQQA 3FPLA 4CR7A 4QTTB 1IB0A 2P9GA 3M89A 1E9BA 1IQ0A 1L3CA 4AD8A 1Y9AA 2WSBA 1ULHA 1YACA 1ZSNA 4E4YA 1WE2A 4FBMA 4JXZA 3NC1C 4BJ5A 4JT2A 3N0RA 1FZQA 1NL3A 2PZKA 2NV6A 1VIAA 2HRQA 3JVIA 1X77A 3KV1A 4HNQA 3UG7A 3RYCA 2DR3A 4LC1A 3DOIA 2HV8A 1WPRA 2PMDA 2BGMA 3IT2A 3LUJA 1I1NA 2IWHA 4PN7A 3LGAA 3QVGA 1QFMA 5IKEA 1P0PA 1YR3A 1AZTA 1R0BA 1V3VA 1KYYA 1CWUA 1DDOA 4P53A 3A35A 4BEWA 4JITA 2R8RA 3HPQA 4LJ4A 3FF1A 4IQFA 1Q95A 4L1KA 3I01M 3W5UA 4EG3A 2XOEA 1WKCA 4JUIA 5IN5A 1Y63A 1H8ED 3SC6A 2JEZA 2ZG6A 3OU6A 4EZBA 2QJWA 2C2YA 3LLUA 5IXYA 3BJEA 3NRBA 3M1IA 4KUGA 1A2QA 4ZREA 1GFSA 4YV7A 3EZ2A 4QQ8A 4Z4ZA 4B3DA 5IFKA 1WSAA 2QD4A 4L16A 4ZV7A 3EODA 4K0KB 2E5FA 3LC1O 1CP3A 5I7WA 1OH8A 3E03A 3OH8A 5IC6A 2PD4A 3KX2A 4FWIB 3TLEA 1JSXA 4DK1A 1MV8A 2FZKA 2O8NA 2RDMA 4MQUA 1A8QA 2WSIA 3W8DA 5CFMA 3LL7A 1J09A 1ZL0A 1L4UA 3ONNA 3PQFA 4BRWA 3JWIA 3LLVA 3R7WA 3AVQA 1RZUA 2BRUA 3FTQA 4MEJA 4KKSA 1L7RA 1WXDA 1G60A 4Y2UA 2FPRA 1GGFA 2WP8J 1YB6A 4NBRA 2ASEA 1NLFA 2DTXA 2V31A 1GN8A 3SJPA 1ZCAA 2NAFA 1OUMA 3EW7A 3EZXA 3HJUA 2WIJA 3HU2A 4UAJA 3DPSA 3IIIA 4G5QA 1C0EA 3HJRA 1I33A 3KPYA 1P91A 5CPFA 1K8RA 2HCBA 3T7EA 2YRXA 3L0SA 3W8FA 3GCXA 1IHMA 5ITVA 1F9EA 3BMQB 3RYFA 3Q72A 5MFZA 3J80A 4QVKA 3LBFA 5DP2A 5DWQA 1OWNA 3PFFA 4QFDA 3I30X 3SR0A 3WY9A 3LPCA 3IAUA 3WYDA 1AV7A 1C1XB 1T5HX 4LISA 1UDBA 1VLVA 3TGLA 4ZGQB 4A91A 5CHEA 1O97D 5JT1A 1GUAA 1Y48E 5FTNA 1UQUA 4KO3S 1ZVVA 2EARA 3CLUC 1H1LB 4MKRA 2ZAYA 3ABIA 1L8QA 3N5KA 2RJOA 1GGJA 1NUUA 1OWPA 2B78A 4FEYA 4JUCA 4EGCB 4P0PB 5BPHA 2AFHE 3QVJA 4NHEA 5HE9A 4P3YA 4EA9A 1S96A 1MO2A 1FFXB 3RS3A 4JKYA 3RU3A 5BVGB 1QIIA 4KP7A 3TFQA 2PKWA 4E5VA 3SC3A 1R9MA 1VBMA 4E70A 5I9IA 4EA7A 2WU1A 1LK5A 5FOTA 4AWXA 3L02A 5K3DA 2QD3A 1G291 5C3UA 4YUXA 3FMVA 4ZVLA 4KK4A 5E3JA 1I5OA 2G9VA 2CHEA 2OAGA 4CW7A 4JI4B 2ZI3A 3WOVA 1RXYA 2IOHA 3A1CA 2FQ1A 3LC0A 4NR0A 5J4YA 4NPAA 3H8SA 1PRYA 3VKVA 2K5UA 5U4XA 4LJRA 3CCBA 4Y0NA 4HGRA 1A27A 1W581 1H6BA 1ODCA 2BE9A 5DT9A 4KQMA 3ISJA 4O2BA 3EN0A 4NJEA 2GARA 3MWJA 1J2YA 1L0BA 3D6FA 3I34X 5F4OA 4DLAA 2WWWA 3AF3A 3PDUA 3IQFA 4I19A 2BSAA 3ADCA 3BZBA 4ID3A 2J33A 5B1YA 4YCLA 3N2GA 2OPHA 1WP9A 3E23A 1IOZA 4FGKA 2AX4A 1A7UA 2QVYX 1U2DC 2NVUA 2QRGA 5A4AA 4KSBA 1OKKA 3BBPA 4QUKA 4F9GA 5KS2A 1J9ZA 1ZD4A 5AW0A 2VHZA 3M6XA 4EUFA 2RBEA 3SLDA 2PO5A 1WCWA 4GXNA 4MI3A 4YCAA 1KE2A 1XLVA 1TAHA 1EGAA 4ARUA 2FPIB 1CUDA 2C3UA 2Z1DA 4LNAA 4S1WA 4BFWA 4ZQBA 2O2DA 2X58A 4J43A 4NCIA 1V95A 5LNK6 3GDOA 1C3OA 4M54A 2ZRAA 2WJAA 1DJMA 2BELA 5KQMA 3L6UA 3WV5A 1ZYUA 1DBWA 2BISA 1U9CA 4DK0A 5H59A 2LW7A 4CUJA 4ZEWA 1BEUB 3A9VA 1V3UA 3PGA1 1BDJA 3BFXA 1CEQA 1Q7CA 1Z4LA 3KKOA 3O38A 1P17A 1KVSA 3TTTA 1ZD8A 2XV1A 3E18A 4BBZA 3TH5A 4UNQA 1QVVA 1U7HA 4OB6A 1K5DA 2JKYA 1SVNA 1UANA 1I3KA 3F7NA 1OXMA 3OURA 2GYYA 2EKBA 2XQFA 3EDCA 4JA2A 5LUBA 4ZKEA 4S1NA 3U4QB 1LCIA 2GK4A 3RKUA 5K0CA 1EE1A 2Z3WA 4GX5A 4AZ0B 4ZEMA 1W85A 3QVWA 1KXZA 2DC1A 4PLGA 2Q9BA 3GZ4A 1GYPA 1WMDA 4HY3A 4MGZR 4AJ1A 5B2ZA 4K6FA 2ZI5A 2QM7A 3A2LA 3SF8B 2Y6UA 5FTWA 1NAIA 2JIZD 3RNOA 5KTTA 1VOTA 5AOAA 1JDTA 1N5MA 3BXOA 1DUIA 4U00A 2P9CA 4EJ6A 2E85A 4ZOQI 3B53X 1UZNA 1Q14A 4N65A 3SHVA 3FUVA 4F5YA 5B1EA 4Z3OA 3GB9A 2NUAB 4B6SA 1P5ZB 2DSTA 2CKDA 3L5KA 3CCFA 3O0TA 3WAKA 3JASB 2XRYA 5F7ZA 4D3DA 4W5RA 3ICQB 4NU6A 3PUJA 4V38A 2HXSA 2ADMA 2BF7A 4J49A 3F74A 5K2OA 4XDZA 3WICA 1YQXA 2G80A 2C59A 1Y5MA 1QYDA 4PC6A 1SBTA 3ZV7A 4GDFA 2M32A 2OO7A 4ER7A 4J0CA 4L08A 4MDFA 2GPTA 3Q9NA 1MPXA 4MLDA 1L5NA 5EHZA 1G0OA 1M6VA 1SU4A 2BF4A 2J8ZA 2TMDA 3I64A 4P8RA 4RIGA 4BNTA 2ZRMA 1FNMA 3UOGA 2JA2A 3CIOA 2JBWA 1P4HA 2H7XA 2ORVA 3IDSA 3JVVA 3Q6IA 4OLFA 4J0FA 4ZAXA 1M6EX 3BERA 3R20A 3TSAA 4KRFA 4BJHB 3LLSA 3L1UA 3OE1A 2YYYA 1SEVA 5FX2A 1YT5A 3CCRB 3VUFA 1BJTA 2CJWA 5IBPA 1NVGA 1EBFA 3CF4A 3GHHA 5ALGA 3GL9A 1HPLA 3DCIA 3ZI4A 4EPYA 2MYPA 3R3UA 3H9BA 5CXSA 2PH7A 1NOIA 2OCYC 1ISHA 1J2JA 5DEOA 2W6ID 3IAM6 1HM5A 1CJTC 4FJ1A 3H83A 1AQJA 3MD9A 5JSYA 1QB8A 4L95C 1Z2PX 3QWAA 5A3RA 2YS6A 5BVHA 1Z5OA 3GFQA 4DGQA 3KV3O 4R9RA 2BYTA 3KB1A 1E7RA 3NM4A 4IJWA 3N74A 5HTKA 4Z8YA 4IRXA 2O2GA 1MO5A 1A9PA 3E48A 3I12A 3QHPA 4GOMD 4X6LA 1IM5A 2QJRA 4BQRA 3NGLA 3A9TA 2WJPA 4UATA 4TQ9A 4DMUB 5EA2A 1W46A 2P9FA 3L0YA 4EH1A 4GQAA 3D8RA 4RPKA 4UE3S 4DLNA 2C4TA 1SM4A 1VF7A 1KHHA 1J8DA 1YRBA 2ABWA 2YVKA 4KQ2A 5F2KA 1KVUA 3E05A 4NMMA 3NRCA 5JHGB 5EXXA 4JSRA 621PA 4XLAA 1Z39A 4ZOLF 3UF0A 4KXUA 1PYOA 5TGTA 1NW5A 1N3LA 3DAHA 4FFMA 1KZ1A 2GOYA 3VR4H 5BY2A 2LVBA 3DAGA 1VLLA 3O5AA 1XK7A 1XCBA 5DXAA 3SBDA 4ETWA 1Z7GA 1PJBA 4LQCA 4EF5A 3TIFA 5KYTA 4ZRDA 4JT4A 1E2QA 3ESAA 2QG4A 3BD9A 3L6DA 3QEOA 4I50B 3ADPA 4P5EA 4E32A 4DLZA 1SHUX 4UM9B 1JXQA 2RGAA 4JEUA 4FMBB 5K8TA 1GIAA 4RHUA 4IO1A 4Z4TA 4EHBA 1AGYA 1HORA 1SHJA 1ZM2A 3PT9A 3INYA 3MQ2A 2JFOA 3IVXA 4WPGA 1XQVA 2C2ZA 1QIEA 3LHSA 4ZWNA 2WYUA 3GF4A 2Z6UA 2IYVA 1F6WA 1Z7BA 3FPCA 2FCAA 3R5SA 4PAQA 2DXIA 4D41A 3F4KA 3G2LA 1VIYA 3A4TA 4FJ0A 1BXZA 1Q1BA 2QMYA 3E5NA 5DASA 4LXQA 2B5VA 3VNRA 2B35A 3OTHA 3CNHA 2XODA 4EY8A 4NU8X 1I7PA 2UZ3A 5B6JA 5AW6A 3WDSA 1LNZA 3VKWA 4FNAA 3WRXA 4JY7A 2I8LA 1XEXA 2BM1A 2D59A 1X8LA 5EJIA 3KK0A 3UGQA 4DSNA 4YT2A 2G4LA 1PS9A 3JQBC 2ZW9A 2NO5A 4R41A 4RJTA 1NHGA 4Z4YA 1Q84A 2YMMA 1M66A 3G0DA 4PG8A 5J9FA 3EVTA 1V7QA 3GP3A 3HDGA 2PAFA 2CRVA 3FFXA 4GL2A 3PC8C 2M98A 3I6QA 4XL9A 2ZGVA 3O8BA 2YJ4A 5JSKA 5DEIA 3HBNA 3UPTA 1EFRD 4LV8B 4UNSA 4WVFA 3CLTD 3OPYA 1F2TA 1KMQA 4HEJA 1EX1A 4KIWA 5LA6B 3SQMA 1ORTA 1T8RA 2WUEA 4CM3A 3HNRA 4QE3A 3D2CA 3DH0A 3JZAA 2X40A 3NEYA 1P6XA 3ZWQA 1XVLA 1RI3A 4NZZA 4W9NC 2GBCA 1JV2B 2EQ5A 3NS7A 4QD3A 2RH9B 4XUEA 5LDDC 4RD6A 2JIDA 5EVJA 4G1UC 1LTHR 2WT8A 1A88A 4JWTA 1M1KD 1W9HA 2IRWA 3ABOB 4JU9A 3M6LA 3PEUA 4BKPA 5B6IA 4E6EA 2YMQA 3PP8A 1JJBA 1IEWA 4RJLA 4Q18A 4V02A 4B3SB 4N8DA 1NE7A 2PQMA 5FOSA 3KJHA 2YTZA 3FPFA 2ZXFA 5IP5A 3SKXA 3QHAA 5DTMA 4NX2A 4BHTA 5FV4A 1PO7A 3MCZA 2I91A 4ZTZB 2N46A 4H35A 2R47A 1UOQA 3V55A 2IYYA 2YS7A 1PR4A 3VDRA 4KWIA 2ZJ0A 3HL4A 1VHDA 3AVVA 1NBME 4LOAA 3KL9A 2P8SA 3E7FA 2IBTA 2J9RA 1KC3A 3EFOA 5JV5A 3D9QX 1VB3A 5LXTA 5CAEA 4IIJB 2VYQA 1QOZA 2VNSA 1NBWB 5HMMA 1D3AA 2ONZA 2P9ZA 5BYAA 4YQZA 3CVYA 1JKJB 3ZXSA 2Q5OA 2XDQA 1L5KA 4BPBA 3PL1A 1BRTA 3ILYA 1FSPA 4LHZA 2IP2A 2OILA 1OBFO 3EGOA 3LZ6A 4PQFA 3S2EA 4XUCA 5AKLA 3EVNA 1JLSA 4YJFA 1NVUQ 3LUAA 4M7PA 3WA6A 4B3RB 5HRAA 4G0ZA 2HSJA 1TUBA 1OILA 1PUXA 2DCMA 1VHEA 3KWLA 5HOQA 2II6A 2QVBA 3B1XA 5KOJB 1QK4A 2FF7A 4LDNA 2AKAB 2IPXA 5BN3A 1UAYA 1URPA 4N8EA 3RRXA 4CF6A 3ZBQA 2Z8XA 3RK4A 4AFNA 1EX6A 2VXBA 4DLSA 4LDQA 2HK7A 2OBFA 3OVMA 3PYXA 2QOEA 4OPOA 3ZY6A 3TO5A 1KAQA 4YAIA 2KVOA 3HNOA 5JVDB 4RZHA 3WKCA 4EB8A 4CEIB 1ADBA 1QE0A 4QQFA 5DBEX 3QPAA 3GQBB 3UJ8A 5FO1A 2FN7A 2H1IA 1XF9A 2NZ2A 1GGNA 5IVKA 3INNA 4XM3A 2WWTA 1QKKA 3SQOA 1GL6A 3BCFA 3PUIA 3GRPA 4BQPA 4QUDA 4BO8A 4QJIA 1U7UA 1XZLA 4LMRA 3SR3A 1B74A 1DX9A 1JWAB 1LFDB 1KZ7B 2BUBA 1A5BB 2QZ4A 2ZUSA 3C16C 2IU3A 2JKVA 4KCGA 1GPWB 3C4QA 5TE9A 5L46A 4MUFA 4TMWA 3SYTA 4CEJA 3U4AA 3PFHA 3FMIA 2RHWA 3OKFA 4KXLA 3ZDRA 2AOUA 5DBOA 1DE0A 2ID4A 3I55B 3Q9SA 4ITRC 4XIGS 4X62B 3C39A 1KEWA 3B38A 2CHGA 3MTAA 4PSUA 2GYVA 2D0OB 3U37A 2O2XA 4ENRA 2ZYIA 3Q6MA 1IWBB 4IRUB 4WGGA 2NO4A 3PI6A 3GUUA 4PPGA 4Q9DA 3R8XA 3ZZ0A 3PJGA 5KSWB 3DAPA 3GH1A 1BROA 1JQEA 4RS4A 4MVJA 2FFRA 4EMUA 1LS6A 2FW6A 4AS1A 1IXRC 4DILA 3PNVA 4OKNA 1ONNA 3ZX5A 4YT4A 3UUEA 1NLYA 1ZU5A 4HQFA 5CG2A 2P35A 1JBQA 1NFFA 1Z6QA 5HDQA 4LF6B 1NVDA 4EF4A 3KALA 3LXRA 1EFCA 5G1OA 1SWVA 4REQA 5EP2A 1RQLA 4X5OA 1XDWA 4RPDA 4MW9A 3NJRA 3R3VA 5FULA 3IIJA 3WGYA 1DAFA 3FETA 1PNVA 1X0VA 1ZRSA 3KBOA 2VZ9A 4RMHA 2I6FA 1G6OA 1XUOA 4FPXA 1TJ5A 1NI4A 3MWEA 2NU9B 1WS6A 3H5OA 1WUKS 3E9NA 3PNBA 5FPYA 3A4YA 3HEAA 2PS3A 3I23A 1YBAA 5HKKA 3OE7D 3DZDA 3OPQA 3KQLA 3D7LA 2EIXA 1S7CA 1VG1A 4D9MA 2E48A 2HSWA 3KHSA 4HH0A 4IO0A 5DCWA 2OGUA 3IFSA 4JB0A 3NTQA 5DI9A 1CF2O 4FYMA 1PG2A 5IVDA 4BQOA 3QVKA 2VSNA 3IBFA 5MN4A 1B6GA 2BDTA 4UM8B 1XD2B 4Z4EA 4PIVA 4EKEA 5DTRA 2H2WA 3EOAI 5D1NA 3RRFA 1P80A 1PQUA 1KO8A 2JAHA 3T8YA 1JLLB 4AG3A 1E9AA 4AJOA 4BLRA 4BE4A 4QGSA 3N0TA 3B85A 3ENWA 4ONEA 1W59A 2DHDA 1QLWA 2H4JA 1GVHA 1RYFA 2EF1A 3BE6A 4B45A 3K1YA 1OWMA 1EEHA 2CY0A 3EEBA 5F3WB 4KDEA 3KWMA 1S4MA 5BUCA 1WCIB 3KT0A 4BZXA 2QQGA 4B44A 4F91B 1MTOA 3OQMA 2ECFA 3KKEA 2DH5A 4PS1A 4B35A 1H8HD 1NWCA 1DQZA 1ODTC 4O2AB 1RYHA 3GT7A 1AO0A 3CNOA 4RY2A 1GTRA 4R16A 3RJMA 1BDHA 4EHNA 4KJZA 3CCVB 3R6DA 4KACA 5BN1A 1BD4A 2ZL7A 1ATZA 2HTFA 1KJQA 1G1MA 3H8JA 2A9OA 4GGMX 4X93A 5LMUB 3AUAA 3PVDA 5KYXA 2V5VA 1R6UA 4LQLA 3Q6RA 2A59A 3EULA 1D4OA 3MJTA 4NEHB 4JKIA 3RS0A 3STVA 3VZSA 3AESA 1CZRA 2D3WA 2JGDB 2VRCD 3ED5A 1U0HC 4N0EA 1XE1A 1L7DA 3JYQA 3OETA 4I5IA 4S2UA 3F1KA 2ZIWB 4LAFA 5HNKA 1KP9A 1A9YA 2VNAA 4RK1A 1P4RA 3PF9A 5FWNA 2F8SA 3N07A 4ZVMA 4F3NA 4Q3LA 1NG1A 2QLLA 2X6WA 2RAFA 1ZIPA 3EVFA 3EIXA 1MGPA 3HVKA 2BMEA 4X95A 3H9CA 5CT4A 5AJZA 3M82A 3U4CA 2QL6A 1DZIA 2EG9A 4QVAA 3U81A 3BSWA 3LPNA 3TRDA 3HU5A 1TO2E 5B36A 4LYAA 1R4MB 4DCMA 4J7CA 4KLCA 4I9UA 1X7YA 3IP1A 3ZWAA 5AIBA 3T5AA 2HW8A 4TTIA 4LK2A 4JYBA 3ZU6A 1X14A 3NWPA 5CEEA 3CEAA 4FR2A 4KVFA 3PC7A 4QXMA 4R98A 4Y7CA 1SRQA 4RVHA 5CNJA 5KTSA 4EVRA 1QHHB 3F4BA 3U39A 1I1QB 1E69A 3U26A 1CQPA 3PNQA 2HCFA 4GM4A 3USCS 1EVQA 1D2MA 4MKIA 3BWDD 3L4SO 3UT6A 3WLLA 2D2XA 2L19A 3UW1A 5H4GA 10MHA 3TDKA 1TJNA 5FEUA 4YS6A 3LYUA 4PC3A 1JLHA 5KNCH 2C5EA 1KJJA 4KR6A 1O1YA 1IWOA 3H6HA 4FU0A 4HRVA 1FFCA 4BNDB 1F7UA 4B79A 1TVEA 1WTAA 3BD8A 2O14A 2Y71A 1B6TA 3O83A 5AVYA 1VL6A 4A0SA 5DBIA 3BXEA 4P3IA 2A0XA 2F1LA 5G0VA 4H59A 4Q4LA 5G0WA 1Z0AA 4ZQHA 1GGVA 2F1HA 3CUKA 1YKFA 3NCHA 4ZOCA 2VJMB 3DMYA 1WBDA 2R7MA 3PXUA 1F48A 3QLTA 3PDIA 2DFNA 3E1YE 1MRZA 3R09A 4W1QA 2V59A 4XGQA 3HR8A 2JGKA 1Q7BA 4RLQA 1E2LA 1Y4DE 4H60A 4G2TA 5MGBA 2OC4A 1UWLA 1CZKA 1EEXB 2PU7A 3C3AA 4UREA 1LY1A 3U17A 5AKEA 5AVQA 1TFUA 3DBIA 3TSCA 4BWFB 1XTPA 4D9KA 3N2KB 5J40A 2EDAA 1EP1B 1AKTA 3ONWA 1NRKA 1O9BA 2H1VA 3C5WP 5CNKA 4ZHSA 5ECYA 5FBRB 3ROPA 5HRUA 1SQFA 5D86A 5CDHA 2NYVA 1I30A 3KVOA 4AUNA 5KX5A 2I7CA 1YS1X 1ZXLA 3SDZA 4EEXA 4OV6B 2V6BA 3ANSA 3CS3A 2IZ6A 3EXEA 4INOA 4QU8A 1G8MA 2HR1A 5DH9A 4AY4A 4IIDA 5AXBA 2IU0A 2D1QA 1G20B 3NC0C 5JPIA 4YJGA 1Y9ZA 1TIPA 1PJSA 2WKWA 1LFAA 3KQOA 4J94A 4NMWA 4FWTA 4TTAA 4PAOA 5ALTA 1YE5A 1ADGA 4L0QA 4Q9NA 5L3VA 3MUNA 5KYKA 4IV5A 2F64A 4K8RB 4Z99A 2ZVJA 3IB6A 1GN9A 3ETDA 2OGZA 4G5RA 1CETA 4BN0A 2L17A 1E7QA 1H5NA 1WEHA 4GGPA 2A8YA 5FLYA 2P1RA 5DSTA 4EGSA 2OWEA 3K0HA 2PKYX 3IXLA 5JD6A 3FGPA 4KXNA 4N5LA 5B55A 1VDZA 3MXTA 2QWXA 5EZ5A 4WZBE 5ITZB 3UAYA 2OFXA 1DC5A 2FMIA 5DULA 3V8EA 4ALIA 2GN0A 1GRNA 1E3QA 5LC1A 4WBSA 1NT4A 5ALRA 3BE5A 4URUR 3AHDA 1YDEA 1RMYA 1PTJA 2GREA 3A1VA 1RXEA 2BHTA 5H68A 1E7YA 1D5WA 1V8BA 1J8VA 2J9XB 1W73A 3NFRA 3AINA 3PGXA 3PKZA 2JI4A 5ICMA 4O2BF 1U2PA 1FBTA 2XF2A 3I1FA 3QWFA 1C41A 4I4NA 2AMFA 3WAGA 4EW3A 4GX1A 3K5HA 3OUUA 3KU4A 1N1GA 1NUTA 3QU4A 1MUUA 3KZVA 3VNQA 4C30A 1OT3A 3S2YA 3EEQA 1Q5PA 3WIOA 3FCAA 1DINA 2VHXA 4EG0A 1X7HA 1E64A 8ADHA 1YL7A 1EK5A 1ZK4A 2D1SA 1EG2A 4GBMA 4HNTA 1A69A 5E6UA 5HIIA 4KSYA 1XJ0A 3ETGA 4HZGA 4OPVA 4L72A 3RUEA 1QGZA 2I1WA 3SDBA 4B17A 2AUMA 3W90A 4NZ9A 4JXXA 3RVLA 4TKUA 4D6PA 1BXGA 3TXYA 3ICCA 2IHBA 3IT1A 3ZJYA 5KREA 2H1LA 1KZYC 3DVAA 2IE8A 4MUJA 1G3UA 3QG1A 3SBXA 3UMGA 4UPDA 4DLYA 2XE4A 3QX7A 3AIOA 2YWCA 3ZS9A 2CCKA 3HUUA 1DEOA 4NCNA 4C0JA 4RL6A 4RA9A 3B13B 3JATA 1CDZA 4EYEA 1HNZB 4XCXA 1QR6A 5EG5A 3TQSA 1QF6A 2N9UA 4ZEOA 3DKIA 1CY0A 2GFQA 3NWJA 2V7QA 2HHLA 3WLJA 1A4IA 4W5NA 1ZSVA 4OX9Y 4GKKB 3IVAA 1ZN7A 4G97A 1YMVA 3ZQ4A 4JC5A 4TRRA 1YKGA 1ZM4A 4QC2A 3PCTA 1GTZA 4J2OA 4LGMA 4Q82A 3HO6A 1FUYB 1OLXB 3R6WA 3RS5A 1UADA 2Z1NA 1JBKA 5EINA 2AC2A 3RADC 3ZYCA 1CC1S 3RUIA 5H9WA 2GZSA 2ZAMA 2HO5A 2CMKA 2PZEA 2PT7A 3PFBA 1S7GA 3DGEC 3FDZA 4MMXB 5EUQB 4B46A 1QIHA 4BO0A 3ETLA 4N39A 4AMGA 4CIDA 3R7LA 2O3SA 3FF4A 1QVGB 1PV1A 4BC0A 3NHSA 4IPTA 4L9WA 1N7GA 2ACWA 5HZGA 3BNWA 2O6LA 1V0EA 3PCRB 3CZRA 3OQVA 3OLVA 4IZIA 3NC4A 3OFJA 3MWYW 2UDPA 5CNMA 4FNOA 3MRVA 2X6YA 3KEQA 4NKRA 4WINA 3VR5H 4ENTA 1FTNA 5GONA 4ZPXA 5KOHA 3HSYA 4JOCA 1IHYA 4JZKA 3VNUA 5TY0A 2KS6A 3HY4A 3OJCA 2WFZA 3O92A 2WTXA 2ZJ2A 4UW9A 3BIFA 4PSDA 5CH5A 1F3OA 1QYIA 3QELB 1MN6A 5LZ7A 4CIAA 4FFBB 1P0CA 2PZ8A 2XMZA 3IUEA 1HXHA 2WF8A 3NUGA 3ZDFA 3GA7A 5BT9A 1SBYA 2Y9MB 2FVXA 4BVLA 4MYDA 5DE3A 1BE6A 1PJAA 4ZI5A 4C9BA 3LSYA 3NPAA 3KD2A 3TAHA 1DJNA 4BNNA 5HBRA 4G9GA 5HIKA 4GG1A 1H2RS 2CL5A 3QVOA 1AKWA 2O20A 1YK0A 2AE2A 3PDCA 4I1SA 4O1MA 5F33A 2FG5A 3JAWA 3OQ1A 1D04A 2PUDA 3G6EB 1N08A 3I4LA 1NXVA 1KSGA 5I6DA 3TFOA 3FD8A 4G84A 4INAA 2ZBQA 5JRZA 5M3BA 3PZRA 1JEJA 5REQA 3IAFA 3S81A 2CVFA 3FYCA 3LUBA 2QEQA 2O5EA 3DXFA 4RZ2A 1LI4A 1PFQA 2YOFA 4HNSA 4PFQA 2G9UA 1XB2A 4TSKA 1E4EB 3P2KA 3R9XA 1P7YA 4QUJA 3KSAC 1NI3A 4NBUA 4S3MA 2H07A 1CLUA 2MIIA 2H17A 4YJKA 1K2WA 2SBTA 3D5TA 3ME5A 1X19A 3CEHA 4KLZA 4MS4B 3KUUA 1ESEA 1L7QA 3C7TA 4ESEA 1I4DD 4L57A 1YULA 1Q1AA 1VSTA 4MCAA 1DPFA 2CMHA 4JUAA 2QMZA 3WRWA 5DU2A 3OLWA 1CVRA 4K9SA 4BXOA 1IY2A 1IK6A 4RF3A 1MVOA 5BSRA 1Y8CA 2I66A 4NYJQ 4UQPA 1ES9A 3WL4A 2CW5A 1PD0A 2W6OA 4XWGA 2AG0A 3Q8KA 3ER9A 4R6XA 1WZEA 2EU8A 4OHMA 4Z9YA 3FVWA 1Y3HA 2Q1SA 3P4YA 3GPLA 3W5AA 1BQ4A 1EVLA 2RFLA 4A16A 4TT3D 2I54A 1P1BA 1U9JA 3C7AA 2P0AA 3T1NA 1JPJA 4RADA 1WDTA 3PNOA 4PS0A 1EB8A 2B37A 4PTYA 2ZTVA 4ND8B 1IU9A 3O4IA 1SU6A 3B52X 2PJZA 3HZHA 4YP0A 2AVDA 3U1TA 3TQQA 3UJBA 3BJIC 4GZ3A 2BEUB 1OXUA 2O06A 3GC6A 4GP9A 2JANA 3JWGA 1R9JA 3SXUA 1R6VA 1RE0A 3ZXYA 2BGTA 4YCDA 3BXHA 5EZQA 2NO7A 1KI8A 3RRBA 1H5UA 2LE0A 3JW8A 1VJCA 4D97A 5EWLA 4MRRA 3JQFC 3SS7X 4BS9A 4DPMA 2IUFA 5TQJA 2HRCA 4KH1A 2NSYA 3D7KA 4HDOB 3CZCA 3HWWA 4B87A 4QTYA 1TF5A 3LDHA 4XVRA 2QW0X 4MVJE 5IZCA 4QPJC 1P45A 2QY6A 4L4YA 3G2IA 3KR2A 2DIEA 5IK2A 3QENA 3QU9A 4HZUB 4HVLA 4RHCA 2GTHA 4R0MA 2VNHA 1GG5A 1M8FA 1X9GA 1SBZA 4J29A 4RHTA 1BDBA 5DX0A 3W6UA 2Y0PA 1OIWA 4MJ3A 4WKBA 2D6FA 4RPLA 3IQEA 1PVOA 4WKOA 1I2BA 3ILSA 5H9VA 3VU3A 1H05A 1KS9A 3JQBA 5HQ3B 4NSNA 2DUNA 2IXFA 4YCNA 1II0A 4MO2A 3B6JA 1CUWA 1MB9A 3UFBA 3MT0A 2AL7A 4N01A 1NW4A 2C5GA 4Y1RA 1ZMOA 1KYQA 3DF7A 5BUSA 2JB9A 1R5BA 4TLEA 5FUMA 1T2EA 2H4YA 4GBGA 3VPAA 4PN3A 1U81A 1NZFA 4C0HA 1YUBA 3QJGA 4BL5A 1XIVA 4PPQA 4JJKA 4OP3A 4XGNA 2INGX 1FPQA 3E82A 2ZRJA 2HCJB 1MCZA 1E9CA 5HMLA 4B4WA 3W4KA 2A1UB 3FGNA 1XAIA 4F9TA 2HOQA 3JQAB 2BFFB 3WTCA 1QTNA 1DFGA 1PQWA 2VR1A 4B3CA 4GPBA 1U98A 1UPUA 4FE3A 2GX6A 4OGGA 4UHCA 5JCJD 1P33A 1JG4A 3AY6A 2PKCA 2W58A 1CY1A 1A4RA 3OQHA 3CMAB 5AW1A 1N5DA 4TVBA 4IM7A 5FFMA 1NONA 3ABQB 4IWNA 3PC6A 3HXKA 4J76A 2BW0A 4G0QA 2NQ8A 4YCJA 2WI8A 3USES 2Y0EA 1U2EA 4XVHA 1GA1A 4GO1A 3QVUA 3IOYA 5HE8A 5L3ZA 3CMCO 2XYQA 2GBGA 3CG4A 4U7TB 3O3MB 3COVA 3RT9A 4BUCA 1E9SA 3ITDA 1GA6A 1OU0A 1YNSA 2Z98A 3I8OA 4HADA 4DCVA 2NZ8A 4Y6GB 4OOVA 5MDHA 4LWPA 4L02A 1WOOA 3FRJA 2V58A 1W35A 2NSHA 3NKFA 4X9XA 2FX3A 1KNXA 1C8LA 2Q6VA 3NHPA 5FTMA 4EY7A 3BEOA 5BPFA 3ENNA 4A82A 1NZJA 5LXTF 3VAZA 4RIHA 1X8JA 3A2MA 4DLBA 1YD7A 1GV0A 4MXDA 5JFOA 5CBPA 1XV5A 3C85A 1E0AA 1J90A 3DONA 3C6KA 3O93A 3B7WA 2ZB7A 2OZPA 4H31A 4ISBA 2ZAIA 3GEHA 1Q74A 1SBCA 1ZH8A 4KOAA 4B5LA 2FWBA 1F0YA 5GMOA 1PQ4A 2P68A 2NXCA 4MA4A 3LF2A 3UBTA 4GEKA 2H0RA 2X0RA 1Z4JA 3FAZA 4MUEA 1XYYA 2I2FA 1YC2A 4EHLA 2GCIA 4K3VA 4QFMA 2JAXA 1IHXA 3WV4A 2PIDA 4MJLA 1HH4A 1NMXA 1N2CE 4ABTA 3D81A 4M4SA 2H5EA 3OKAA 4W1RA 3HGMA 3L77A 4FSXA 5JG7A 3RWMB 2QF7A 3I6BA 2IYSA 3DD5A 2ZIXA 2W2TA 3BMNB 2HK9A 3I6YA 4GE0A 1F7VA 3GRAA 4F4FA 5HFNA 1EWRA 3AF0A 3EYAA 3NLLA 4H7KA 2B98A 4TLBA 1K7YA 1M0SA 1V41E 2XSZA 4DC1A 1LRKA 1QS0B 4PC2A 5KWIA 3EQZA 1JQBA 1RKXA 1KP3A 1AHNA 2I3ZA 1M6NA 3OE4A 4RZXA 4Y6PA 5DLYA 1DRVA 1A2KC 3QE2A 3IEUA 3PRKE 1OHHD 4GS5A 4BU0A 821PA 1Z2AA 2HJ9A 3KG2A 3TIXB 3KXIA 2PLRA 1G9XA 1HKUA 2VLIA 1IJKA 3VNSA 5FNVB 2QUHA 1X70A 3A6GA 3H19A 4J4TA 16PKA 4G25A 4UJ3A 2H92A 2WKSA 1IN1A 1CT9A 3AV3A 1MJGA 1ZUNA 1QQAA 3ZU3A 2HC9A 3BRWA 3C14C 2C0QA 2P2GA 3MINA 2DAPA 1MORA 3AU8A 4HAXA 1VECA 2LIVA 4MVYA 5CXUA 2P6OA 4UHKA 4MVJF 3LDAA 4ZIRA 2G17A 3O31A 1W49A 2Q6KA 4AU1A 3HHPA 1Z12A 1PUJA 2FW8A 1WCYA 3D8UA 5EPEA 2WYHA 3DL2A 4NRDA 5CJ2A 3VZDA 4A5OA 4DPLA 4EY6A 4XTCS 1YHNA 1BZYA 3AUYA 2ZIVB 2G4CA 1OAOC 2PL1A 3OT4A 1H5QA 1TKRA 1U0EA 3EUFA 3K9WA 3KYCA 4XIJA 1M2EA 1RR6A 5THQA 1W0JD 1Z6XA 1DCFA 1JT2A 4N5NA 2OGSA 1TM5E 3WE7A 4Q3CA 3PC3A 4XE5A 3SDSA 1Z4QA 2C78A 1O6CA 2H63A 3HEMA 4O4HA 2I55A 1UP6A 2FLKA 2QVZX 4WEQA 3ULKA 1Z9BA 5DBHX 4QLAA 1SUWA 1YRLA 4AURA 5CBKA 4LF9B 4B5KA 4R51A 1YB7A 1NXOA 2WOOA 4TX1A 4LPKA 4Q1DA 3PA2A 3OTIA 3TUJC 4DT1A 2Z8YM 1WVMA 3G8AA 4E13A 1U0NA 1QCYA 1N9ZA 2G1JA 4P81A 3B9BA 4ON9A 1T25A 1ECBA 3ECSA 4YV2A 1P18A 3JQ7B 3UICA 3HH8A 4OHVA 5HIJA 2VBFA 4NDNE 1UIMA 1VHTA 3TD6A 4EB3A 3LI2A 4JI3B 4MRAA 1WSBA 4H6XA 3LUKA 4L8VA 1ISPA 4O29A 4HJRA 2GETA 3D64A 1FXUA 3T3GA 5JAUA 1GG8A 1TGYA 5ILQA 4PC7A 3FUUA 2F1KA 5GV8A 1L5YA 4MIOA 2RARA 5E8JA 3L06A 1BQ3A 2W6QA 2ZRBA 2BBSA 5IHXA 3DZJA 1PT9A 4H77A 4UULA 3OTGA 5GY7A 2C4KA 1V6AA 4IKOA 4IMPA 5BORA 1WSWA 2PSFA 1OLSB 2IYWA 3IYLW 3MGKA 1BXKA 3D26A 2QN6A 2LIPA 1LX7A 2C7VA 4UTXA 3V8PA 4EZIA 5JZMA 3VGJA 4PCVA 5A9RA 4D25A 2E4WA 1MXHA 3KZNA 3LNCA 3G2OA 2Q5CA 2BP7B 2RHCA 3Q1KA 4ZAVA 3O84A 4EO4A 5CA1F 5IM4A 1ETUA 1FNNA 3N86A 5DI3B 5KSYA 1DHTA 4FYXA 3A14A 3KM0A 4MJ7A 2GILA 3MGCA 4E5PA 2L0XA 3FPPA 3D6MA 3GD5A 1YJ9B 1MOPA 4UNIA 4ZQIA 1JFVA 3LYAA 1WZUA 1W4BA 3I39X 1E18A 2YYZA 2A0KA 2ZE7A 3EDRA 3UH0A 2IDMA 4BZWA 2JCXA 1HNNA 1C80A 1NI5A 2EF0A 3NDIA 4R05A 5A5GA 5IJZA 3BCHA 4IUYA 1B0PA 1Y6FA 4WX2B 4AYTA 5K3OA 1FDTA 2VNJA 1Q0QA 1OGYA 2OD9A 3OQPA 1MKYA 4GMHA 5CDFA 3O26A 2O8CA 5I9MA 1NX9A 2FVYA 2XYPA 1GQSA 3EFEA 3HI6A 3JAKA 4WIAA 3ZQ6A 1A8PA 3HKDB 3NBQA 1JH8A 4CXMA 1YR7A 4EG4A 5TNXA 2WJGA 3F3MA 4IUBS 3LECA 3FDIA 5B5SA 1JG1A 1YOBA 2HA2A 3QV1A 5B1HA 2XCUA 3FWYA 2WF6A 3TLZA 1GRQA 3X3HA 1SG9A 4KR2A 4H6WA 4EG1A 4TOIA 3HTXA 2ARKA 3TZKA 4QFCA 1T2UA 4B40A 2AHOA 3GLGB 4H3SA 4PXAA 2VTDA 3SOZA 3K8YA 5FUQA 1SKBA 5DN9A 4LPSA 2HWWA 5ENDA 4FDLA 4A36A 5ESRA 4ZHQA 3CXRA 3ZV4A 2CLSA 3TIGA 1OJLA 1R0SA 1DKPA 1W36B 1WVGA 1B0UA 3CNNA 3HCRA 1CDEA 3SMQA 3ZCSA 4LY0A 5A7FA 4OOEA 2QRHA 1ZK1A 3V4LA 4JBNA 2OCPA 4D92A 4TWRA 3AX6A 3M7IA 2DOKA 4ZMBA 4EJMA 5JS8A 5C35A 3SD7A 4YY3B 4B3GA 3O4RA 1C0PA 3ER8A 3DE5X 3TW8A 1MGOA 2I34A 2XUFA 4NBNA 5F1PA 3SFTA 3CLRC 5DZSA 5JQGA 3ACDA 3DKVA 4UE6A 2OBTA