The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.
Total Genus |
64
|
sequence length |
261
|
structure length |
261
|
Chain Sequence |
ERTVEMYPLKSRLLEVVNVRRITPRMVRVDLGGSDIAGLRSDNFADHVKLWFPNPETGEHVLPVVEDDRCLNFRAPGVIYRDYTVRRFDAKARLLTIDFVVHDNGPGGRWAATAQPGDRLGVLGPRGTVYYPEADHYVLLADETALPAAARRIEELPRDASVTAFFEVADAAEEQELDAPEGAEITWLHRNGAAPGTTDLLLRALEQTEFPKGRVFVWAGGEADALKPIRRLLKERGLVRGRDFEVDGYWRRGVSNLDHHA
|
The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.
After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.
publication title |
Structure and Mechanism of the Siderophore-Interacting Protein from the Fuscachelin Gene Cluster of Thermobifida fusca.
pubmed doi rcsb |
molecule tags |
Oxidoreductase
|
source organism |
Thermobifida fusca tm51
|
molecule keywords |
Iron-chelator utilization protein
|
total genus |
64
|
structure length |
261
|
sequence length |
261
|
chains with identical sequence |
B
|
ec nomenclature | |
pdb deposition date | 2015-02-27 |
chain | Pfam Accession Code | Pfam Family Identifier | Pfam Description |
---|---|---|---|
A | PF04954 | SIP | Siderophore-interacting protein |
A | PF08021 | FAD_binding_9 | Siderophore-interacting FAD-binding domain |
cath code
| Class | Architecture | Topology | Homology | Domain |
---|---|---|---|---|---|
Mainly Beta | Beta Barrel | Elongation Factor Tu (Ef-tu); domain 3 | Translation factors | ||
Alpha Beta | 3-Layer(aba) Sandwich | Rossmann fold | Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module |