4YHBA

Crystal structure of a siderophore utilization protein from t. fusca
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
261
structure length
261
Chain Sequence
ERTVEMYPLKSRLLEVVNVRRITPRMVRVDLGGSDIAGLRSDNFADHVKLWFPNPETGEHVLPVVEDDRCLNFRAPGVIYRDYTVRRFDAKARLLTIDFVVHDNGPGGRWAATAQPGDRLGVLGPRGTVYYPEADHYVLLADETALPAAARRIEELPRDASVTAFFEVADAAEEQELDAPEGAEITWLHRNGAAPGTTDLLLRALEQTEFPKGRVFVWAGGEADALKPIRRLLKERGLVRGRDFEVDGYWRRGVSNLDHHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Iron-chelator utilization protein
publication title Structure and Mechanism of the Siderophore-Interacting Protein from the Fuscachelin Gene Cluster of Thermobifida fusca.
pubmed doi rcsb
source organism Thermobifida fusca tm51
molecule tags Oxidoreductase
total genus 64
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04954 SIP Siderophore-interacting protein
A PF08021 FAD_binding_9 Siderophore-interacting FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4yhbA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4yhbA02
3JQPA 1QFJA 2J7KA 1N0VC 4YAUA 1G7TA 1VQ8B 2GQFA 1N8RD 3G6EB 1KK0A 1G7CA 3E20A 5GV8A 4LBWA 1KK3A 3VMFA 1VQ7B 2BV3A 3OZUA 3W2IA 1YJWB 4M1KA 5FA6A 1QVFB 1FNCA 2B5OA 4M53A 4UAJA 4B47A 2BN4A 1TTTA 4LBYA 1I7PA 3W2FA 3I1FA 4TMWA 1KC8D 1EXMA 1QFZA 3QE2A 1UMKA 1GAQA 1TVCA 1G7RA 2PMDA 3CMAB 2VZLA 1GJRA 3ZZUA 3CC4B 2ZITA 3ZZTA 1W87A 4HE6A 3SJZA 2EIXA 4NCNA 2BGIA 2YWFA 2YWGA 3CCRB 3AGPA 1HA3A 2NPFA 2VNIA 3P27A 3U6KA 4YAOA 4DQLA 1S72B 2R6HA 1D8TA 2AHOA 1W2BB 3W2EA 1DDIA 3OJWA 1H42A 1KK1A 3WBKA 2GPJA 4ACAA 3CD6B 4ZGQB 2E1RA 4M2LA 1B23P 1CNEA 1GAWA 4QHYA 2PLFA 2VYQA 1B2RA 1IB0A 3CW2A 1EFTA 1ZM9A 2X3UA 4FN5A 1K9MD 3WNCA 1N0UA 1VQ6B 1OGIA 4MYUA 5TY0A 2DCUA 5GV7A 1K73D 4F7DA 4J0QA 4YALA 1VQ9B 3CCJB 1F60A 3FPKA 3B8HA 1YIJB 2QDXA 3VO2A 3QFTA 2QMUA 4YAWA 1R5NA 2BSAA 5H59A 3QFCA 2DETA 2BM1A 1EFCA 3CCEB 2DY1A 4HE5A 1R5BA 1DARA 2VNKA 1VQOB 4P3YA 4B4DA 2HCJB 3ZC3A 3CCLB 4C43A 3CPWB 2B7CA 4YHBA 2CRVA 4IW3B 3CCVB 1D2EA 3P26A 1YI2B 4G5GA 1D1NA 1EP2B 1JA1A 4LC0A 4Y9RA 4ZV4A 3LRXA 4PC1A 2EFGA 1ZM3A 1FNBA 3OW2B 4RJLA 2VNJA 3W5UA 3PENA 4NBSA 1BX1A 4PC3A 1U2RA 3OJXA 4G1VA 2B7BA 1JA0A 3VNUA 1M90D 1ELOA 4Y9UA 5THXA 4G1BA 2HDNB 1K8AD 1GR1A 1VQMB 1KRHA 1QGAA 3B82A 1IJFA 1FRNA 3LYUA 4RD4A 4N3NA 1KQSB 3CRZA 4N3GA 3U2QA 1FNDA 4AC9A 4RD1A 2BVNA 3AGQA 2QEXB 1EP3B 3G4SB 3E1YE 1TUIA 4LBVA 4YAFA 1NJID 3QSYA 1VQKB 4DQKA 2RC5A 3CMEB 1QH0A 3AVXA 1DG1G 2D74A 1A8PA 2OK8A 5TR9A 4RCZA 3G71B 4ZCIA 1AIPA 4WQMA 2C77A 4FWTA 4TMZA 5JBQA 1OB2A 1Q86D 3J81k 1G7SA 3I56B 1YJ9B 3CB4A 4U9UA 3CCMB 4ZCLA 1J9ZA 2BMWA 3CC7B 1QVGB 4C0SA 3CC2B 4BPRA 4TN1A 5DSZA 4M4SA 3WY9A 1OB5A 4AF6A 1W34A 3W2GA 1OGJA 1EP1B 1FNMA 1FDRA 1M1KD 3AVYA 4ACBA 3MMPA 3QFSA 1YITB 4Y7CA 1XB2A 1CQXA 1VQLB 1VQ5B 2QTZA 1QFYA 1QG0A 1EFUA 1YHQB 2BM0A 5TV2A 2QN6A 4K1XA 4PGOA 2OK7A 1CNFA 4H9GA 2BF4A 3W5HA 1AMOA 3A1FA 4RCYA 4TMXA 1DDGA 4ZGNB 3B78A 1VQ4B 2QTLA 2C78A 1WDTA 2OTLB 4B43A 2VNHA 1R5OA 2OTJB 1SM4A 2RC6A 2DEUA 4B48A 3I55B 3ZZ0A 3U6BA 4RD6A 1YJNB 1KTVA 3AVVA 3JQRA 4AF7A 3CXCB 4PC2A 1Q7YD 1H85A 1E64A 4B44A 3LVBA 1F20A 4TMTA 4RD0A 4RD3A 3WXMA 5AN9A 3WYAA 3AVWA 2PIAA 1W35A 4B3XA 2DERA 3W5VA 3V76A 1BJKA 5KSWB 1SKQA 2FX3A 3AVTA 1EWYA 1JNYA 2QA4B 3ES9A 4MYTA 1E62A 1QGZA 5H5JA 2XNJA 2BGJA 4Q7JB 1Q82D 5EMNA 2YWEA 4FK8A 2BPOA 2YWHA 3FJOA 2CNDA 1QGYA 1NDHA 4QFMA 1VQPB 4PC6A 1E63A 1VQNB 3WBJA 1BQEA 1BX0A 1QUEA 3W2HA 1Q81D 3CCSB 1GVHA 1XE1A 2XNCA 4EH1A 1KK2A 4R71A 3CCUB 4M0LA 4ZCMA 3ZBTA 1TLLA 4PC7A 5HXBA 3VNVA 3LO8A 1IJEA 3ZBUA 3CCQB 4P6VF 4TMVA 3OZWA 3OZVA 1ZM4A 1ZM2A 1QX4A 3WNBA 1KJZA 3MHPA 3MCAA 1JJ2B 3QFRA 1JB9A 2HMAA 1QUFA 3JQQA 3VO1A 4LBZA 3AVUA 1KD1D 1S0UA 2XEXA 1GO2A 4RD2A 1ZUNB 3WNDA 1FRQA
chains in the Genus database with same CATH superfamily
3TAUA 3EPKA 1H4QA 3DZ8A 2RB4A 2DJIA 5LVAA 1QFJA 2VAWA 1N0VC 3ML1A 2E18A 4IDOA 2UZAA 2BKUA 3NWOA 1O87A 4DNFA 1SRRA 4DW8A 3K92A 2BGMA 3GRCA 3BC9A 2H2HA 5JANA 5IRCD 1RC0A 3PNPA 3KE9A 3MYYA 4RA6A 3AFMA 1QHGA 3IEUA 2O5VA 2DYKA 4M1KA 1QDEA 5G2OA 1E3EA 4YMTA 3NWBA 1JYEA 1V96A 2F2TA 5F78A 1D6SA 3CM0A 4ZQBA 2PKQP 4UFPA 1AUOA 4OOSA 3TZLA 1CDEA 5HP4A 1HZEA 4X45A 4OB7A 3DBHB 2Q3LA 4KREA 4L85A 4Q1VA 2HRDA 4D0SA 4FHGA 4RK7A 5IFLA 2FPSA 2OQRA 4LQCA 4KO2S 5JY6A 3BCUA 3HDJA 1A9QA 3V55A 4ZA2A 2IPNA 5DMXA 1RYFA 4HV4A 3CNBA 3NEAA 4YMHA 1W36B 2O8EB 3C0KA 1BQ4A 1T8TA 4FGKA 1R10A 1TT5A 4YJ2B 2ORIA 1NSFA 1NW3A 3FMOB 3MCWA 4XWTA 1XVLA 2ZPAA 3A3YA 1HKUA 1C0IA 4G2TA 4GI1A 4MVWA 5KYVA 3V4PB 3RC8A 1QFXA 3VVCA 4E2XA 5L3SA 5JHHB 4ERNA 1TKCA 3OQ6A 4YQFA 1QO0D 1Z0FA 2EBHX 3N3BC 1RHRA 2DU8A 2HAEA 4Q02A 4Y1GA 2EIXA 3TZ6A 3WIVA 4DUPA 2WF5A 1RACA 1UMBB 4US2R 4L5AA 3AL0C 2QQGA 4JZYA 2GXSA 4M6WA 4YJDA 4QTZA 2N1BA 4RW0A 4YRZA 2QZZA 2CC2A 5FWDA 2ZU6A 2NP6A 4F9FA 3AGPA 3CR8A 1KAQA 2VQSA 3QWFA 4RFSB 3CNOA 3JD2A 3G9UA 3NGXA 1AZWA 1LSSA 4MW6A 2ADMA 3A8JA 2QX6A 4BNTA 4UVEA 2H51A 3X1ZA 4AZWA 5U9CA 1P3JA 5IHPA 4ETIA 2XDQA 4BKMA 2YZNA 1D4AA 3PP8A 1T26A 3GGJA 1A9OA 1LLFA 1Z4JA 4CIDA 1H42A 4GMDA 4I5EA 3EW9A 1IC6A 5DXJA 4D45A 4EMTA 4ZMBA 3STUA 2B61A 2I2DA 3K09A 1V45E 4G65A 3C6YA 5AICA 4UOEA 4BFYA 3N2EA 1IK6A 1OTYA 2FPIB 4MWOA 2GVNA 4V0KA 2IV3A 5BV0A 3OCUA 2B30A 2WTAA 2AIRA 1MAUA 3I9FA 3EEIA 2EX4A 4CKWA 4M2LA 4BASA 4F92B 2YHUA 4BZXA 1EAYA 1RXWA 4QHYA 3H7IA 1ECLA 3K9BA 1CRPA 4C01A 5K1ZA 3HQ4O 1FF9A 5M2QA 4MHSA 2OV2A 3VR4D 2AJBA 1QHFA 3HUTA 4OBEA 1RAFA 3NDPA 5ARCA 4KPGA 3K72B 1O94C 4R6XA 1K9MD 2BKXA 3GG9A 5DYYA 5C46F 5IVHA 2AN9A 4CG1A 4I9UA 1W4BA 3VTKA 1L8LA 3S81A 1GARA 1OAOA 4LJAA 3CR7A 3HJCA 1G3UA 2C31A 3F3SA 3REGA 1S8OA 2BFPA 1LTKA 2H92A 3OY7A 3K0AA 4Q4HB 3NAZA 1QLJA 4BVAA 3DKIA 3GVXA 1QZUA 4K9KA 4C14A 5HX7A 1ZIDA 3H8SA 4MH0R 4MSUA 4N40A 5BNWA 5IXJA 4FP9A 3MBOA 4PGGA 4DADA 2HSWA 3Q40A 4B4OA 1JGTA 1OREA 2WJIA 3TSCA 4QYSA 3T3GA 1C7EA 3M5CA 4QRHA 2HO4A 4AZTA 4WCFB 1FZQA 1I0ZA 3DLTA 2H0QA 2X7HA 2Z3WA 1E2KA 4FHDA 4JASB 4KFRA 4YJFA 2ZWMA 4DIDA 1YL7A 3EF1A 3JWJA 2GREA 2LDXA 1RZRD 4JIMA 3DPIA 4J76A 3CF6R 4YLGA 1YR7A 4HUJA 5H59A 1OZ0A 5CH8A 3U3JA 1VA4A 4OB6A 5BYBA 3G0DA 1H6CA 3O8CA 5IT9A 4JLPA 3NX4A 1WPQA 1ANKA 2HA2A 4N47A 4LVNA 2AUTA 3ONEA 4IIJA 1RJWA 3A6KA 1DKUA 5CT5A 5HTOA 2FN7A 3FVWA 3TQFA 4OP3A 3KJHA 2OBLA 4MLCA 3T15A 4EYGA 2J0SA 1E2HA 3WWZA 3ZUGA 4JH0A 3WKAA 3I8XA 2G17A 3QPVA 3CH5A 1L7NA 3PJEA 4IUCS 4EECA 2PGXA 5DU2A 1W6UA 3DGEC 5A7FA 1L5SA 5CDSA 2WUWE 4FYYA 3BX1A 4NZNA 4Y2VA 2XCRB 1CUHA 1A77A 4JOBA 1YA4A 4XDHA 1D1NA 2Q3CA 1ZD5A 3RU3A 4DIBA 1UKVY 2PJZA 4HQKA 3GL9A 2P2LA 4LGVA 1J2UA 4IX9A 1TCVA 1IUPA 4ARVA 3IVAA 1RI2A 1O03A 1QK3A 3EA4A 2DTDA 4L8WB 5L8VA 2N0SA 4KQIA 4YI3A 2Z8YM 4RZXA 4AF8A 1U8UA 2BFFB 2DZDA 4FONA 4Y6SA 2C2BA 2BONA 1N2XA 3LQYA 2VNJA 2O2GA 3GRZA 3QEKA 1IPHA 4AVYA 3TR5A 1SBYA 4CF3A 1P7VA 1EFLA 2IXGA 3Q39A 1CR1A 2FFHA 3K8QA 2FWAA 4QUDA 4ZEXA 2FSIA 5GZ6A 4E2FA 2A4MA 3NP7A 2ZTLA 4HDSA 2R7KA 4O02B 2BGUA 3BMXA 2AE2A 2Y0BA 4LY3A 5THXA 3P9RA 5IF9A 1RJEA 1JFLA 3BFVA 3DAFA 4MI6A 4UBJA 3TBKA 2WU8A 4G7XA 2XXJA 6REQB 1K8AD 2G9RA 2JIZA 4QGSA 5CBPA 1KJWA 3RT1A 3KT6A 1JIVA 3EG9A 4FB4A 1A7JA 1F8XA 4X90A 5GIOE 3B82A 4II7A 2IU6A 1E5TA 3LA8A 4BNXA 3EHDA 1I14A 2GBLA 4R51A 4WINA 2H7XA 1YAHA 5CT4A 5BSRA 3TSZA 3QE3A 3V1NA 2BJVA 1NFRA 3IILA 3I64A 1ZPDA 5FEMA 1R00A 3ZE8A 3W6OA 1ST3A 2BC9A 2GF0A 1M2HA 2Z8XA 1GRCA 4WXRA 5ALUA 3S2EA 1IOLA 4UEWA 1UC8A 3FY4A 3A6EA 1U0EA 2IZ1A 3N8NA 4IIYA 4MHOA 4FEAA 4Z0PA 1XTZA 4BL5A 2CK3A 3DPUA 5LMZA 1QG4A 1R6UA 1V16B 2QY6A 3H94A 3DM5A 1SAYA 3IAUA 2V03A 4ITUA 3MIZA 4F3RA 4DNQA 5GOTA 4RH3A 1PR0A 4TYMA 3WQQA 2Z2JA 3CNLA 2O2EA 3O1IC 2P7IA 4N3AA 1T3HA 4ZO9A 5IKMA 4YAFA 1JHMA 3DDOA 2J0UB 3DEHA 1VL1A 4HXFB 1E92A 1SZPA 4WSOA 3ETHA 5ALDA 4DIEA 3G13A 1LF5A 2FUCA 2OHIA 3N0RA 3CMCO 2DGDA 4FE7A 1QIFA 1P9LA 4FFBA 2J07A 3JQCA 4ZAZA 4YMLA 3TUZC 2J4CA 1DAPA 4M7OA 4BQEA 1SXQA 4UDYX 3HU5A 1Y4SA 3A3GA 3QF7A 4JL6A 2WU1A 2CF5A 4AS1A 2C59A 2ZETA 5IWAB 3W77A 3ZHOA 3HBMA 5A7HA 2NUTB 2BIFA 4GI7A 2HYIC 1BE8A 2IIVA 1KETA 1TF2A 1ODCA 2FHPA 1WOPA 4I1RA 2WWGA 3IXMA 5JTUA 3EPPA 3RC9A 5KX5F 1FUEA 3BT7A 2R1TA 3MWGA 1N1DA 3IODA 3SKYA 2JGJA 2OPHA 5LJIA 4PRLA 1V7ZA 2FPGA 1N1GA 1SJ9A 1UBTS 2XVAA 3ZQ4A 3KWJA 1U3VA 3C7TA 4R83A 4YUYA 1T5DX 5ALFA 4F3CA 1CDOA 1HRDA 2JEYA 1J97A 4F2GA 1YF3A 3WI7A 3NKFA 2X9VA 4TTRA 2CB9A 2AQIA 2QN1A 4DMKA 1NFFA 2UUBB 1C3OB 1Z2AA 4UBNA 1PBNA 1Z2OX 3AR8A 3FSGA 4FI3C 1LPSA 4WFQA 5C18A 1D1QA 4OATA 5GZ1A 5HZKA 1JQDA 5IDQA 2QKYA 2YDXA 1RJGA 3GJTA 2ORWA 2V4UA 5JNVA 2HPAA 1THTA 2ZTGA 4MS1A 4LJ9A 3M4ZA 4UUAA 2QG4A 1L5FA 1Y6RA 2D2FA 2NPIA 1YZFA 1AG9A 2BZ1A 3IHTA 3LFHA 3QBEA 4UXIA 3RYCA 5IYQA 3L46A 3CT6A 1XEWX 3BBLA 2FQ1A 3A1PA 1Y8QA 4LYEA 4NAVA 1P9WA 4D46A 1Z8FA 5BN1A 1UKYA 1T0UA 5KYKA 5GONB 3PEYA 4CEHA 4LTDA 3G1TA 1Y1PA 1SCUA 3HCWA 5EIOA 2GB4A 3DH0A 3MB5A 3QVXA 2QTZA 2IU0A 4X92A 1JIJA 2X1LA 1PDWA 1REQA 5CK4A 4XB6B 4DILA 3BVPA 3KTOA 4FMDF 1USWA 2ZJ4A 4MV7A 4G0QA 4O4JF 3BMCB 1GCOA 3CLUC 4JUCA 4C7BA 1IXSB 2ZRJA 1CQJB 3TFOA 1SC9A 3IHLA 4KQ9A 4ZAXA 5BSMA 2P3LA 4N7BA 2XCIA 2C4NA 3C3AA 4LRXA 4DZZA 3GVIA 3ZIUA 1RI4A 1K5GA 2HL6A 3PLNA 4KACA 1B14A 3F2VA 1KWGA 1UBEA 4JL8A 2QJTA 4ITRC 4HDAA 1HI9A 4LSWA 3HBNA 4MKGA 3QOXA 4XE5A 4FGUA 4K5QA 1BD3A 1HTTA 4CE6A 4XORA 3LV8A 2GTHA 1HDXA 1JWLA 4G84A 3CZPA 1X7XA 3IIMA 4XQEA 1WX1A 3DWEX 1GL9B 1U0JA 3KTAA 4FMCF 3GP8A 3SYLA 1SZDA 1NN3A 1XTKA 5BSKA 2W70A 1R5OA 4N5NA 1M8JA 2JC3A 2HADA 1L7RA 3CX6A 1L4UA 1P17A 3R3WA 3T5BA 5BVHB 2I87A 1PQYA 4GBGA 2A58A 2QU8A 4FNGA 4IGIA 3ZD6A 2O06A 3H75A 1SFRA 4IFEA 3QYFA 4PZCA 1AQJA 1KI3A 2O5RA 2UVPB 4EATA 4Q9HA 3AVVA 1UZNA 5JQGA 4FYIA 3AU9A 3NYIA 2FW8A 4MUIA 1TZCA 2SECE 5D7BA 5A06A 2HREA 2MINB 1NVKA 4UNNA 5FT9A 3LK6A 3C7CB 4BN4A 1ADJA 3BC1A 4QRIA 1UDCA 4BKUA 4NBRA 1IY8A 2B9EA 1SWWA 2ZFUA 3C6ZA 4UDOA 2Q5IA 3T7DA 1I3CA 5AVXA 4CLXA 5JS1A 2QZPA 1YJBA 4RD0A 1U8FO 1C3LA 1YI8A 2R4QA 2W2LD 2ZB2A 4IO1A 3B1XA 3FM9A 3GJ6A 2PMFA 3DW3X 3B6KA 3D0RA 4LHXA 4YRCA 4TSFD 4CM4A 1GQRA 3V6LA 5IKPA 2XQVA 3EVGA 5KQRA 3OLYA 3VAAA 3R4VA 5CNIA 3RS8A 3FBWA 4G8BA 3U17A 4BBPA 2E1PA 5HJ5A 3ZE0B 4KPEC 3PGXA 4MW1A 4B7ZA 1JFVA 2QTVA 3PUHA 5LPNA 5JEEA 3HU2A 4BLSA 4PX3A 3MT8A 1NQOA 1Z82A 1SGWA 3GXOA 3DZDA 4CCYB 3DHYA 2CVQA 2XYVA 1P4AA 5CFNA 2IUFA 5A4KA 2MU1A 3BWXA 4NJEA 4QDTA 5IDWA 3BTUA 1OFVA 1N2CB 1XCGB 4JHLA 3RKUA 2RGBA 3WLRA 3CNHA 3QP9A 2WAOA 4D9CA 4IS3A 3COSA 2A9RA 2V31A 1PYGA 3DWGA 3MTIA 3TVTA 3VH3A 1JEOA 5A6SB 3BL6A 3S1LA 1IYZA 2CLMB 2EW8A 3STVA 4BO7A 3O2QB 2FN9A 1GFIA 4OHBA 3DM9B 5IYZF 1RVV1 3RC7A 1CS0B 1OIVA 3H1TA 4LZJA 2XBMA 3O93A 4WERA 2CXPA 3UJDA 2IYQA 1U0SY 1JB1A 2QTGA 2VC2B 5IC5A 4AO6A 3ENWA 1LEHA 3KKOA 4FGZA 4HCJA 3BQJA 3MS7A 4N0QA 1WG8A 3WWDA 1ZJZA 1MQSA 3I4LA 2O2SA 1YZTA 3PX2A 2VP2A 1G16A 3THRA 3TLGB 3ZV4A 1PAUA 2I3BA 4NMLA 4MYDA 2BM8A 4HP8A 3TVYA 4D8WA 3U4QB 1DHTA 3U7FB 2XT6A 1XZHA 3FDJA 3FPSA 1EVZA 2CSUA 4Q9NA 1P6QA 3P9NA 2ZREA 3DYBA 2ZJ8A 2PZLA 2QT0A 2LV8A 1W47A 2FYTA 2WUEA 3W4IA 3WGNA 2J3JA 3C7AA 4B7XA 3ITEA 4PZEA 1QIDA 2OXIA 3QX7A 2LTAA 4OFWA 1ADCA 2NIPA 1WPGA 3DHNA 4RULA 1IVSA 5CFOA 1XN1A 3VKUA 1KOGA 5K4AA 1ISGA 1P75A 3PKIA 1EBFA 3UOWA 2C00A 1OLXA 2XUQA 5F7XA 4TMVA 2FE4A 2REXB 3P1JA 3QBTA 5EHNA 1D4ZA 2HT1A 1QX4A 5F51A 4A27A 2XUHA 1V1RA 4HNTA 1U7HA 4IQ0A 3VR6D 4YRRA 3U40A 1QF7A 1XZFA 9GPBA 3MCAA 1DRKA 2OSBA 4QOSA 5E9WA 3A9RA 3K70D 4GI2A 1DVRA 1E99A 2IHUA 1BKYA 2JGDB 1GGKA 2VJPA 2X5NA 3AYZB 3GRKA 2B8WA 4P3PA 3KJQA 1RRPA 1JJ2B 1DRUA 3AR2A 2XMRA 3JD4A 4NG5A 4RETA 3UGTA 4AKIA 1JIIA 3E7FA 4OOVA 2ZVQX 3TOCA 5A02A 2I7XA 4LXGA 4QGFA 4L76A 4TWZA 5CVJA 4C3ZA 1KH2A 3S1AA 1N6IA 1G8YA 1OXTA 3JYLA 1OOEA 1C8LA 2PJDA 4CT0A 2UU9B 1KD1D 1PJ8A 4RV5A 5DNAA 5FULA 3VJMA 3KPYA 1TYZA 1E98A 3LQ4A 4Q00A 3F9IA 2KX7A 4QOIA 2NVUB 2VJOA 4E2ZA 3O90A 1ZVQA 3MOIA 1Y8AA 4A10A 1EUZA 1P0FA 1ETUA 1QTIA 1E18A 1QQ7A 3RQIA 1M6HA 3TOVA 3I62A 3PFGA 4OXNA 5CLJA 1MV8A 1NPDA 2HQ1A 3CWZA 4IHAA 2F9FA 1Q3KA 5ARBA 2JFXA 1YOVB 1WW2A 1W1UA 2H1FA 3JY6A 4UASA 2YJNA 4LBWA 3VMFA 1NIPA 1LBIA 3NYQA 5BNTA 5LD2C 2ODPA 4URFA 1T5HX 2V97A 1SBTA 4E21A 1D04A 2A0WA 3ANNA 3GFFA 4HVCA 4D0GA 1EFPB 1M1NA 4M53A 3NV7A 2BN4A 1TYAE 3PJGA 4HPJB 4RQUA 5DW3A 3VZDA 1C0EA 1VJCA 2DFTA 5MHTA 3I2JA 2Z2KA 2R6ZA 1UD4A 2Y68A 1JL3A 3KT3A 4E6PA 1Z75A 3IUJA 2HRCA 3F73A 1E5VA 4NOLA 1ISJA 4GOLD 5DI9A 5H70A 4C78A 1UFQA 1EXMA 4EP1A 4ESOA 3F8WA 1XQYA 4CLRB 5K8TA 3HGQA 3TNYA 4D9HA 3H2BA 3CTMA 2CVOA 2XQGA 5B6IA 3DMYA 3EE6A 2PMDA 3C16C 3DD5A 3FNBA 1Z83A 4B6EA 1KYQA 3ZWNA 1F8FA 4CETA 1GJRA 1XQ1A 1YTLA 1NONA 3F8SA 4JSYA 2I4NA 4QX6A 4BNJA 3GG2A 4KIUA 3DOEA 1HL7A 4RZ3A 2EX0A 6GPBA 3LWDA 3W8FA 3IJRA 1RNLA 1SHUX 4JJAA 1JQEA 3CYFA 4RXUA 2IBMA 4DLTA 4AJLA 5TLSA 1SUDA 4JVOA 4E12A 1N2ZA 1UKCA 1QE0A 3V8PA 4WASA 4MR7A 4EG4A 3OWOA 4MA0A 3HJRA 4P2NA 1G5PA 3MSXA 3PTLA 1Z2PX 4KFUA 3PA8A 5A4IS 2EBUA 1TM7E 1XNHA 2PLAA 4BLQA 2ZIFA 2PQ0A 3W5BA 2G70A 2HHJA 4KIGA 4C7VA 2JAXA 3WLJA 4XLTA 5C3UA 3HJFA 4E07A 3PHGA 3ROXA 4Q4AB 2IYLD 1RYZA 4FOLA 3EGDA 1T1EA 4NKRA 4X66B 1CFJA 2OCYC 4OF4A 2AHOA 1JTFA 2LCQA 2OXTA 1E69A 2ZU0C 4CKCA 3PC7A 2OEPA 4PF1A 4ZEMA 2YN4A 4ZYYA 4BPBA 3LCRA 5B7PA 3WBKA 1XFAA 2WHYA 3UFBA 1QANA 2F1OA 2A33A 4N5DA 4UTVA 3DEYX 5E3IA 5EC8A 1ZHOA 3K9CA 5CP8A 3WYFA 3UQZA 1VF7A 3AERA 5BN5A 1Q50A 2HC9A 1LLCA 1TJ4A 4HH3C 5KYNA 1ULHA 3H9QA 3QKUA 3CMMA 4PSCA 2D4HA 2IUYA 2FDXA 1NV9A 1Q12A 2WWXA 3G9XA 4IUDS 1MBZA 4ND1A 1E6LA 5DGDA 1NASA 1PQUA 2P6RA 1O5OA 3UXMA 1UANA 2X7XA 3E22B 1FFXB 1R4AA 1CUJA 3GJQA 3GROA 5EWJA 1CIVA 1M2WA 2ZYHA 4Z4SA 2EJTA 2AWNA 4KE9A 3PQDA 2M98A 4UEKA 3DR3A 1TA9A 3GOQA 5FHRA 1D03A 1M2FA 4U4AA 1RCFA 1TM4E 2HLPA 3I6MA 3WGLA 4HVTA 4LRWA 1H2EA 3HN7A 3TW6A 4RZSA 3WLEA 1GPDG 2X41A 2QE7D 4KR6A 2A4KA 3OCXA 4RPDA 1K7XB 3ODPA 4WH0A 1SUPA 4R7ZA 4DNXA 4DCCA 4YALA 2DECA 1JDUA 1P72A 4FB5A 2NNWB 3NWPA 1SHZA 3UYLA 3ZGYA 4AXXA 3ANLA 3H6KA 1XTPA 4JMPA 1IU9A 3ADDA 5EJ5A 1JVSA 1E66A 1GQSA 2ES4A 1XMQB 3E8MA 1MHTA 2BR4A 3H9JA 1V5VA 4QAJA 3ZJVA 5KBYA 2QDXA 1HL3A 1ZI8A 4XCXA 4BQOA 1JSLA 1LW6E 1RBZA 4MKZA 3FYCA 1ESNA 1PX0A 1X9HA 1L1RA 2QUBA 3DQPA 3LPNA 3UMGA 3I5AA 1EFAA 3AEYA 3EZ2A 5CGZA 1II0A 3K20A 4WK4B 3WWEA 1E1RA 4FN4A 5J5AA 5C8YF 4Y2SA 3FPBA 2G1JA 1TUBB 1LNQA 3S2YA 1U63A 4DKXA 4OHPA 3UOGA 1RQ2A 3E1KA 1I3MA 4UXHA 1BOFA 1XSEA 3BF8A 3FUVA 3KJXA 3EXHB 3RSOA 4H7FA 4P86A 3UXHA 3OCCA 4TWJA 1HZZC 2E4YA 3D2BA 1K5HA 4Q6BA 3EFOA 3H87A 3ZI4A 1MF7A 1SU4A 1E0SA 4F2DA 4D57A 4IW3B 4AJ1A 1D2EA 3E7WA 3Q3JB 2PX4A 3JQ9A 1W4RA 2VA9A 1YI2B 3L8HA 5B7QA 4BYGA 3EZ7A 4WMLA 3ZVKA 3K1AA 4DMHA 3R9XA 3RHSA 3TH5A 3LT0A 4I5FA 8LDHA 3GGOA 1W73A 2CLIB 1Z07A 4N9WA 4P33A 4QNRA 4CKEB 1MG0A 1KVRA 2X53S 1NW7A 1WXXA 1ZIPA 1DLIA 3PWTA 3SFTA 2KBEA 4D2IA 5JLJA 2UUOA 1D09A 1O0CA 1QWOA 2PS3A 4O2BF 2G0NA 2PWBA 3A2MA 2HF7A 4M46A 4XM0A 2FZVA 4RVCA 4TUYB 3V7FA 1XEWY 2DP4E 4Z4RA 4Y2YA 4DV2B 4KYTA 1E3TA 3PQ2A 5BWLA 1RRGA 2ZSUA 4KKVA 1OU4A 4RHXA 1U3TA 4RGVA 3T7AA 3TO5A 1RPZA 1PV1A 3D2CA 3W9SA 4C6RA 3FZGA 3C97A 3JSXA 3O8OB 4UNQA 2Y66A 3CCFA 1PR6A 4I4TB 2P9FA 2ERXA 4LI3X 5BYJA 1SD1A 3H0KA 1AKQA 5FR1A 4K0KB 5GQSA 5IAEA 3H4IA 4XIGS 5H81A 3Q2OA 1KJQA 3H3XA 1CB7A 3LJKA 1GU1A 4ZJUA 3PUJA 4G81A 1W9HA 2X5KO 5EHQA 5TC4A 4ZTZB 2O8DA 1T8YA 1TOAA 2QAIA 3IURA 2PZEA 1KRHA 3A35A 4FX2A 3AHEA 4YRLA 1OBOA 1QYRA 2B8TA 2OOSA 3LP6A 3ISJA 1EX9A 4P7FA 2Q3MA 2HLDA 1XCOA 2BGRA 4KQGA 4PG4A 4W5RA 2E87A 1DC7A 1EM6A 4CV1A 4YJ2A 3LD9A 2YQ4A 4MR9A 2CKDA 1HE4A 3SVLA 2VDLB 2QZ4A 3Q3HA 3AIOA 3E5NA 4DGSA 2Z9BA 3IQDB 3PHBE 4WKBA 1PEKE 3P52A 2BFCB 4FFMA 1WTHD 1KDOA 4I6JA 4WVFA 1QMGA 2YWXA 4QU5A 4Y6GB 1WM1A 4NZYA 4D41A 5FI0B 1M2NA 2PD6A 3CG0A 3O3MB 4G86A 4AN0A 1QQTA 2UVQA 3ZVRA 2GI4A 3AU8A 5TS3A 1VSQA 1T1JA 3VC7A 2L19A 4YJ3F 3DVAB 2FDRA 3CQ9A 2OKCA 4UPDA 2WWIA 3PKZA 5CA1F 1NBMA 1EE9A 1E5QA 1S2LA 2AOTA 1F5SA 2P68A 2XYHA 3EGVA 1TK2A 2WD7B 2X6RA 3I6QA 4X44A 4RVNA 5MN4A 1UD6A 3MJEA 3E9YA 4MCHA 2D1YA 2RK6A 5I7UA 2FSHA 5E2IA 1RXCA 1C29B 1W0JD 2JAQA 1YS2X 5JSKA 4EHKA 3EAQA 3D4LA 2RC5A 1YS6A 4JODA 2UUAB 1ZRHA 1SWVA 2WG1A 4I4LA 2IZ5A 1XRPA 3ZZ1A 1TGVA 2PGLA 1KKLA 4WDQA 4QYMA 1V39A 3MWDA 1B4DA 4XWAA 1QPGA 5IH7A 2QRUA 4TZKA 5IYWA 2NZYA 3OU6A 4RNCA 1UK8A 4KB5A 1JUDA 4QWMA 3U62A 1WUYA 5J4KA 5KO2A 1AIPA 3I45A 3IIJA 1EK0A 4LQDA 1F4PA 2QMQA 3NXKA 4YBZA 4B46A 4H31A 1Y8CA 3E0QA 2PUWA 3IUPA 1WUHS 3PL5A 5IAGA 3Q7TA 3SQXA 4U9UA 2J6BA 2VT2A 2NU9A 3G2MA 3K5WA 5HEKA 2GYWA 2QMEA 3B38A 4TRNA 5EIXA 5KDDA 1YVUA 2AI3A 2LVBA 1SR8A 1ZIXA 2GBPA 2YXNA 3NDJA 3PNKA 3V4ZA 4EHNA 2OCBA 4MW9A 4H3HB 5B1YA 4TV8F 3CG4A 2GOYA 4A0SA 1MPTA 2VG8A 1HDZA 5BSTA 2FR8C 4CF4A 1Y8RB 4ZDJA 3TPCA 1AO0A 1H4TA 1Z8HA 3EDYA 5CNJA 2PWYA 3KDAA 1J09A 3WY9A 2H2GA 3DXXA 2ZAMA 3TD2A 4V1CI 2XB9A 3DV0A 1SVMA 1P4GA 4MWCA 5ER9A 1A50B 3U61B 2IEGA 2ZWVA 5HSGA 1EVJA 1KYYA 5LZ7A 2AKYA 5K4GA 1QHHA 4O25A 4BNKA 5JR3A 3UFXA 3MMPA 2OLKA 2AG5A 3EF3A 3D81A 4PHGA 1YASA 4WL0A 3X1JA 4JLJA 1N8TA 2XMGA 1A88A 2TRSB 3HCAA 3HKCB 2PUBA 1VXOA 4B3CA 4P81A 1VBMA 3U0BA 5ULLA 2RJOA 3H6HA 2YOFA 1G4AE 2ZUVA 3T0GA 1FSGA 3VU0A 1QV6A 3WYGA 2PVPA 2V6FA 3KXKA 1B6TA 1KEEB 2VZEA 4P4SB 5FBWB 4XFDA 1I01A 4AULA 3C8DA 4EFLA 2V6JA 3IKJA 1Y3BE 4B4UA 4ZT2A 4C4XA 4OSPA 2C9MA 3DV2A 5DX1A 1CNFA 1HFEL 1CF9A 1UXHA 2Y1CA 4A5OA 1FUYB 1L5RA 4ZT3A 1LTHR 3LUKA 2XD4A 3NNSA 4L6CA 4Z54A 3IEXA 4OFZA 4Z4VA 1ZC4A 1KVUA 1PR2A 2GUGA 3KWFA 1UJNA 2V5UA 3E53A 5HQ3A 4RU1A 3R3JA 5FV7A 1KAGA 1CWUA 1T5SA 2ZJ1A 3R41A 2O8FB 3G6KA 1E6MA 2C78A 3E9ZA 3EDOA 3KU4A 5JSYA 4FMPA 1JHPA 1N5IA 3OJ0A 2FN4A 2QRJA 1HE8B 3PSAA 4EZEA 4IF6A 4ZHQA 1F9EA 2WTNA 4C89A 3NOXA 3FYUC 3D8HA 3LX6A 2DEUA 4ZOEA 5A9SB 4QUGA 5PGMA 4JC8A 3GJ7A 4BXOB 4GRDA 2FSPA 1SBCA 3JQGA 2WFMA 3EH2A 4CLEA 1XNJA 1KYTA 2GBIA 4OYHA 2JS7A 1EJ2A 1QAOA 4M0DA 2I6QA 5CT9A 4QJBA 4CMEA 2GETA 1JEYB 1TZKA 5HCNA 2C0QA 1YR8A 3FLAA 4OMUA 1GD1O 1VSUA 4UEQA 5HOEA 4DOMA 4K9MA 4IO0A 1AUXA 1VMEA 4AQ7A 2Z6UA 1GZ5A 1NB9A 1OFUA 1U28C 2FETA 4MKRA 1GSAA 2DPGA 3VDQA 1PR1A 2WRZA 4B0OA 2FUG6 4XOUA 3ZD8A 5CCXA 4GDFA 1V26A 2JCXA 3VAYA 2J9RA 4PO1A 5BR7A 1JAHA 1CJTC 1PGOA 3T38A 1IAVA 4HVAA 2DXIA 4HBZA 2GX6A 1T0HB 4KNWA 4MUYA 1FMCA 3VMMA 4RSGA 1ZM7A 4P54A 3R6WA 4O29A 4YAJA 5IDVA 2H31A 5LYJF 1DOZA 4LYYA 3VPHA 3Q3CA 3FMVA 4TV8B 3BQ9A 3RM3A 1YXMA 1F4LA 1ZL0A 1VLVA 2ACEA 5EVJA 4JC0A 3GUYA 4CTMA 5E1DA 4G1CA 3CF2A 3BSWA 4YR7A 7AT1A 1S02A 2OGWA 5IZCC 1S2NA 3C3JA 1K3FA 5ITWA 3ES9A 4FINA 5G3YA 4LOAA 4GWLA 1T1GA 1COWA 2HEIA 3T9AA 2X6XA 2PN1A 2R6DA 3HHPA 1KL7A 4U0KA 3D4NA 4I0WB 2Y6VA 4TQUS 1V16A 1N7HA 4J1TC 2ZLBA 2VR1A 5AJVB 5B1DA 3RK0A 4X0EA 3UBMA 3L41A 1X1EA 2PS9A 5C5DA 1M34B 4KP7A 3ZY3A 4IJQA 1XYVA 1LPOA 3M5DA 4QECA 1HSOA 4TLDA 5DK4A 4B80A 2GWRA 2HNKA 2CUTA 4C30A 1YMQA 3AJ8A 2BMEA 4JUBA 3TGWA 5HF8A 3W06A 1LNZA 2AN3A 3ZLTA 1A04A 2DH6A 3A1WA 3KOXA 3LHSA 3H99A 4OFBA 2GQ0A 3L9XA 1W7AA 2Y0DA 3HA2A 4OGKA 3ZX4A 1FSPA 4F1JA 1ZNWA 3DDUA 4MYSA 3F3MA 2QY9A 3HAGA 5K3AA 1TRHA 1X9GA 3B6JA 2YW2A 3HMKA 4O4LA 4PAQA 4OAPA 2CHEA 4UPVA 4ZYXA 3Q3AA 1WDMA 2RH9B 4A2CA 3DEAA 1AY0A 3EQ9A 2IXBA 3B1YA 1NI5A 4K28A 3ZY4A 1SBQA 4XXHA 3ZBTA 5AW2A 5KYYB 4ID9A 4MB2A 1T36B 3MT7A 5EJGA 3TM5A 6PFKA 2PEZA 1YRHA 1ZNQO 4J7UA 4OKIA 4X7BA 5EZSA 4FKZA 3QKSA 1A9YA 1GYPA 3KCQA 5EE0A 3H3JA 1VHOA 1PN3A 3E5RA 5AP9A 3I04A 3JD3A 1XZNA 1JG7A 5JCPA 4NDZA 2AC7A 3BMOB 3F9RA 1NQVA 3MHPA 4LZAA 1C1DB 4Q37A 3E82A 3GPDG 3M3PA 1SCBA 4YAGA 4MYRA 5MGBA 4CCWA 3A9WA 3ONDA 4FPXA 2A78A 1PVOA 1DTWA 3UAZA 1Q3TA 3NBYC 1Y5MA 4FYMA 1EQUA 3DF9A 1XTSA 1THGA 1BO6A 1Q22A 2HMYB 1A4UA 2HMAA 1LFDB 1NVFA 1NKSA 5JBIA 4I8DA 1PG0A 2C9BA 5DMHA 4OFXA 4BDSA 4HR7A 3FHCB 4MRMB 5B55A 1QP4A 2CD7A 3HO1A 5F12A 3OZXA 5BW8A 2B1RA 3TKYA 1SXHA 4RH1A 1QK4A 5GONA 2XEXA 1EFVB 1XEXB 2HBYA 1MP0A 4Y6PA 4XJVA 5KSOA 4Q3OA 5SZHB 2QTRA 3X1DA 4J7CA 4DNPA 2OCIA 3G2PA 1QRRA 1CY1A 5JVDF 2FSVA 3DT9A 1DKLA 1OPRA 1XF1A 1Y82A 3IKMB 4QULA 1GZ7A 4IDPA 4WHMA 2DHEA 4YROA 3ISXA 1W8DA 3I8OA 3EDCA 3S2UA 4BCDA 1HH4A 4DR3B 4POAA 3G6EB 2OXRA 1C81A 2TMGA 3QYAA 1ISPA 3AOEC 2FTKE 5TMDA 4WLOA 4HPXB 4MROA 3PXBA 1JYSA 4E94A 5L3QB 1EESA 2G28A 5AOVA 2BKEA 4N01A 4P5EA 4DV5B 2XWJI 4GR4A 2B5OA 1JN0A 3DCJA 5K2OA 3HM2A 2O9JA 3QX8A 2QLBA 4OV6B 1LDGA 2J3LA 3BF7A 2I76A 3DVSX 4WY5A 4N0EA 4E5PA 1TT7A 5DX0A 2A3RA 3DZJA 1UWLA 1ILWA 4ZJZA 2O1WA 4F45A 5DBGA 1YFKA 5AK3A 2GA8A 2Z58A 1JXMA 1SNYA 1VSVA 1MT0A 1PCXA 3HA3A 4H17A 3TLCA 2ACWA 3VSEA 5KSZA 4LF7B 1DV1A 3C6XA 2QJFA 2QR5A 4HWSA 1GGMA 1NXOA 4QASA 1SIUA 5BVHA 4YMWA 5IN5A 3T1OA 1PK9A 3CC4B 3EXAA 3PX7A 1RYDA 3TIXB 4CFSA 3QTTA 2P65A 4QFDA 3G0BA 3K9QO 3EWAA 1B26A 1T9KA 1W87A 4ISBA 4V2UA 3VR4H 3MG9A 1V47A 2MINA 2R79A 4EPWA 2FOIA 3A7DA 1EVLA 3IGFA 4IX1A 1M6VA 1DXYA 1QH1A 3BTSA 3PFWO 3PEUA 4BO5A 4NYMR 4WOJA 2PL3A 1KVQA 2P0AA 3GD5A 4IOMA 4XPIB 4EYSA 5B36A 2EFHB 2X8LA 4LJ4A 3VA7A 3F0TA 1DTSA 1RFLA 4N5HX 4PYNA 5AXCA 3M6UA 3R40A 4B75A 4C6TA 2CL7X 1WSRA 1E9AA 1RPNA 1SB8A 1Y9DA 1Z9BA 2EBWA 3F1KA 4B7UA 1J8FA 3OPYA 3TG8A 3LO5A 4NAUA 5L4SA 1QJ4A 2HQRA 4JL5A 4BQFA 2GN8A 3TMYA 3PFFA 2GPTA 1WMDA 2FV8A 2W6ZA 1GUBA 1Y5LA 4B2IA 1P19A 5BSVA 1A9XA 2HM7A 1WF6A 3DYVA 3V8QA 1QE3A 3HKBA 4UHBA 5LXTF 1YK0A 1A5AB 1XRLA 1NXPA 5LU9A 3GQBB 4IV5A 1VPVA 1J7KA 2PG3A 4K8RB 4HZUB 4QUIA 4WOKA 3PDCA 3NJ4A 1I2ZA 1ICIA 3P2YA 1HLGA 3F49S 2OHGA 2WDZA 3FI0A 4B40A 1GAWA 4D92A 1CRZA 2YN0A 5HCUA 5LSAA 3RUDA 4J2OA 5BWOA 2YV2A 3CC8A 2VCYA 3BD9A 3G2QA 4L8YA 4CM7A 1BSVA 4U63A 4QRDA 3VV3A 4DWJA 5FO1A 3K15A 4YT4A 3NBFA 3T9BA 5EHIA 4Z5XA 2M6LA 2WWYA 1G41A 2ODTX 1GPJA 2IP4A 2HJVA 2JFOA 2P4EA 3HA5A 1ULUA 4CLHA 6YASA 1QRDA 2QXUA 1I4EB 3N5KA 1G63A 3ETDA 4O6VA 4WNYA 3E70C 1KO5A 1G9SA 1VMIA 3DTVA 2EF1A 2WSIA 2CDAA 2WMYA 3I34X 1T9HA 3KR1A 4LC1A 4Q21A 3SIRA 4KCGA 3ZKAA 2G88A 4MQEB 2ZRIA 1SUSA 2YHIB 4HGYA 5DGXA 3V9AA 2GJKA 2QZJA 2YHAA 3D9QX 3BXFA 1TAQA 1NLFA 1NI3A 1X80B 2I7TA 5B1EA 1SXJA 2XSZA 3KFLA 4NOMA 1YIJB 4LDJA 3Q72A 1KVTA 1T4GA 5FLEX 2ZXUA 1H4VB 3GLUA 3KB6A 4O4HB 1QYCA 1SA0B 3IQHX 4AWBA 3VR0A 5K0ZA 1U5BB 5KPDA 1PTKA 3W7BA 5E3HA 1TIKA 2IS1A 2AWOA 1R0LA 2ZIWB 3D3WB 1ODKA 2XNDD 3N75A 1MVOA 3X2FA 2NT3A 3CTAA 4OX9B 2D7CA 3RD5A 1I4TD 1PG2A 2DETA 1SZCA 3G5UA 1NBME 3B9RA 2P11A 4X91A 2XXAA 5GPBA 1GXSA 1GGFA 1N57A 1BOOA 1X1CA 4ILKA 1K97A 2VCEA 1JRLA 4JUFA 4RK5A 2KVOA 1Z3IX 2ODBA 2RAPA 3OECA 2A5FA 1CZUA 3ANXA 1NQUA 3LTEA 4MAMA 5ALIA 1N3LA 4DG8A 4YCJA 1C80A 2YUTA 4YO8A 2CRVA 2PS0A 2IQ5A 1SVLA 3G0CA 4YRJA 4YA6A 1USIA 1PO7A 1JPVA 2B83A 2C3MA 2IX9A 3QMMA 5IKOA 1OJ7A 1BTOA 3RVSA 1UXIA 2ZQYA 2W7TA 2ZT8A 2M5SA 4M1EA 4TTAA 5EINA 4HAUA 1T0PA 3ZHBA 1J5PA 1D3AA 5IAKA 3RVQA 2GM3A 1UBCA 2R7MA 1IMJA 2ST1A 2VTDA 4LE2A 4DV1B 2BTEA 4ZV4A 1HC7A 3BWEA 3PSHA 4JIGA 2VBVA 1FLNA 4QG3A 2JLVA 1MT3A 5DHSA 4H7KA 2Q0QA 4RK4A 1FK8A 5AVTA 1CY0A 1ZM3A 3OW2B 1AXRA 1M1YE 5E1BA 1M1UA 5DYNA 1UR5A 4IXWA 4JX9A 4OGFA 5F77A 3W5UA 1GNPA 1YNOA 4NBSA 1VHJA 1CUIA 2K2QB 4R8LA 1RAIA 3LCVB 3D5EA 4JITA 4QQKA 1GU7A 1TE2A 5NULA 3EGEA 1QVVA 2QIOA 3URMA 3WHLA 1EFPA 3ANTA 4LZLA 4RBNA 1TCUA 4CMHA 3LCJA 4MW5A 2FCAA 4DR1B 3SS9X 3ZWOA 2C2WA 2DFPA 2Q2QA 4Y30A 1I9CA 4HH4A 3OUZA 4BB9A 4W1PA 2R6GA 4EAQA 1GT6A 1UT8A 1VQMB 2ONYA 1KYVA 4KQ6A 4LXHA 5K6AC 1ZICA 1Q1GA 3NTQA 2IV7A 1A7AA 3E27A 4X8MA 3SQWA 4OK3A 4BO0A 4OP7A 1WEHA 4TQGA 2OXFA 3B9QA 4F5DA 3W6NA 3KJZA 4OIMA 3OQ1A 4X6LA 4EFNA 2Q4RA 3IJEB 4G1FA 3B1WA 5EP4A 5AW9A 2DTXA 4AQYB 3CX7A 1UZMA 3NBAA 3U4MA 4A2WA 3TZHA 1DBIA 2OV6A 3FRHA 1UP7A 3GP5A 3NATA 4HRVA 2WF7A 1EK6A 2JB9A 3S27A 3TOXA 1W76A 3E2MA 4PGFA 1S01A 2UYHA 2QRVB 2FG6C 4IIVA 3QG1A 2EHDA 4HX9A 1QCYA 4RV9A 5IN4A 1JLLB 1U2GA 1YACA 2A5GA 3M83A 3GU3A 4OJYA 1DUIA 1OLUB 2VSNA 4Z4ZA 2GBCA 4XWGA 4AZSA 1Y3CE 2FW6A 3PIRA 5HIIA 4F97A 4CGZA 3TGPA 3E1YE 1U02A 5IJ0A 1J20A 4R8VA 4GOND 4ECAA 5C3MA 1UJ4A 5KNDH 1NJID 5LU8A 1BHO1 2JFHA 5EQJB 1VQKB 4RL6A 2CD9A 5FF9A 1UJCA 3A26A 1TO6A 2PRIA 2VDQB 1NURA 2ZG6A 3SNHA 4CQMA 2WUVA 3VHRA 1L7EA 4ZK6A 4UVIA 5AK4A 1GL6A 5DOZA 5LD2B 4MR8A 2OK8A 2QTAA 3A27A 3L8YA 2H07A 4DC0A 3B48A 4TSRA 1C30A 3IQXA 2R11A 1KBZA 1ISFA 4WAUA 4Y9DA 4GOXA 4PICA 1J25A 1KGDA 3ASYA 3EODA 2EGHA 3I05A 4KQXA 3RIMA 3QVMA 2PUCA 3BERA 4HN2A 4XJTA 1MG5A 2ZJ2A 4I6EA 3MILA 4KGDA 4PLCA 1TD1A 1J8QA 1YJ9B 4W8OA 3ROEA 1KS2A 3KFVA 4C7OB 4OQEA 5ALNA 1QTRA 2OQIA 2QRZA 3V2IA 1Q6YA 3ZWWA 4AWXA 2C8VA 3U5ZB 3ASSA 2WF6A 4CI0B 4LTMA 3AL2A 1A8HA 5FWNA 5U4QA 4FZ3A 4DN6A 4XLHA 1VP3A 1XVTA 1WSVA 5D87A 4RIEA 4V2IA 4MW0A 3D7NA 4BAUA 5HZHA 2FPMA 3P2OA 3TCKA 2OORA 3MUOA 5HMLA 4XVUA 1FXWF 4DSOA 3TLZA 1I2MA 1MXHA 2O2HA 2Q6VA 1WHTA 1JVNA 2YJZA 2FX2A 4IEEA 4UHCA 3SEZA 5TGZA 1GADO 3PCRB 4YFVA 2NU7B 3KEOA 3UKOA 4ZARA 3TQIA 1EP1B 4U6QA 1OI2A 4MCIA 4OU4A 4RL4A 1DT5A 1G4HA 3LKBA 4L4YA 2D1RA 3AEUB 3IP7A 5M29A 2NT4A 5DNYB 5CB0A 3RBAA 2H7YA 2O3QA 2ET6A 2WKSA 3BSFA 1JG6A 3GT7A 1QYDA 2DRIA 2OCGA 5KSPA 1S3SA 4EB3A 2PCLA 3MK31 4I2NA 4ZKEA 2F90A 2GYUA 3P9IA 1IULA 1SCIA 1TTPB 1BRTA 4ZEOA 2IOHA 1E1CA 3H8JA 4WUVA 1X7ZA 2B34A 3FWZA 3UH0A 2VJCA 2OK7A 3EVZA 4J90A 4WESB 3DFUA 1R9JA 3O2JA 4H9GA 2B5WA 1H6BA 4QVIA 2GR9A 4KH1A 1AS2A 1GNRA 2XA9A 5BWNA 3RYHB 4RCYA 2P7HA 2M1XA 4E03A 4ARIA 1KBQA 4HDOB 3QZUA 4LHYA 1DJNA 3UT5A 2EHJA 2H9YA 1YIOA 1H8HD 3LQFA 4HSGA 4J1QA 3TYXA 3ZY2A 5JI3E 5K0BA 2ZB7A 4RZHA 2M9MA 4J9UE 2B2XA 1KQOA 1QO7A 1F0NA 2ZIEA 2A94A 3WGGA 4I55B 4D99A 4DA4A 3KJEA 2P4QA 3LUAA 1SURA 2YZKA 5E2AA 2D0OB 3FNIA 4OPSA 5T57A 2LBPA 3JATA 2WAAA 5AVOA 3VPDA 4IAOA 2VHEA 4QOFA 1Y98A 3IERA 3K1TA 3HTXA 4N9QA 4YP0A 3UGQA 4EJSC 2OFXA 4P3OA 4XW2A 3U3DA 1BVUA 5EMJA 4YCNA 4GAEA 1SC6A 3IP9A 3WA7A 3CRVA 1Z8DA 1XTTA 4O2AB 4AY5A 4YT8A 4CQJA 4KFTA 4KN8A 2IIQA 3SQLA 1CE8A 3FD8A 2Y92A 3IFSA 2D5IA 2V59A 2VPTA 1SKUA 3JZIA 3QYPA 2IXEA 2H8GA 2J3IA 3E58A 5BO5A 4DLPA 3VZPA 1KYWA 1FDSA 3S0JA 3VTAA 3GUHA 2RGDA 2N9UA 4I4TA 1FIUA 2Q3EA 1F8YA 1H8ED 1XCPA 3RNLA 2DBYA 4ER7A 3KSBC 3FMFA 4FYVA 3LVBA 4S2UA 3MSCA 3SY8A 1HYQA 1FDOA 3CIFA 4TMTA 3IKVA 4RPBA 1Z2CA 2VF2A 2GM9A 5JXIA 1NJSA 3PPYA 3WXMA 2PLWA 4LF6B 1R74A 3BE8A 4C7JA 2RMKA 1Y5RA 4JGGA 3SE0A 5KMGA 3V4LA 2C3PA 1HFWA 2FEKA 3PFKA 4K6FA 5JNLA 1NNUA 3SXUA 1Y0YA 2OXEA 1KEWA 1UIMA 5GJVC 3QXSA 1JEEA 4MMXB 4OQNA 2DR2A 3A4MA 1E61A 4W7HA 3RBXA 2VBUA 2KLHA 2VPIA 3EYAA 4BUZA 4DQDA 4ZI7A 4L22A 4LJ7A 4O0MA 4UDXX 3W1EA 2ZBUA 1P9RA 3KZVA 1MGOA 1JNYA 1N34B 1O7JA 3RCBA 5TNXA 3L6BA 3DKRA 4P7GA 1L1QA 4J8PA 5KYUA 4I1UA 2BI7A 4EB6B 1PJAA 4KAAA 3PRHA 2BTQB 4HXGA 4U3JB 1XLUA 2ENWA 1MJHA 2WF9A 2O7QA 2XUFA 3AYXB 3GVCA 1N32B 3DVAA 4DLWA 3LQ1A 3NAMA 1MO2A 3U7JA 1PFVA 1I6KA 1CJKC 4YXWD 3G23A 4V1CA 3CKLA 5KINB 1Q9SA 3C87A 2YWEA 2JIRA 1TYEB 4L78A 3KXLA 1SXIA 2ALJA 5E4JA 2YWHA 2PR7A 2QTFA 1BPLA 1KYIA 4FM9A 1NDHA 1BC5A 1CS4C 1LZLA 1AB6A 4UAUA 2OXCA 5HKBA 1X7YB 2Y1OA 1IM2A 3N8KA 2VHYA 1SBZA 3H11B 2ORED 3O73A 5BOVA 2OZKA 4BNLA 4YECA 3R7SA 1KPGA 4WTOA 4DJTA 4M0MA 4EH1A 2WABA 5TMBA 1J56A 3BWBA 1I6MA 5AXBA 3FMGA 2I65A 5FWAA 3VOSA 1GTSA 4P34A 2ZZEA 4ZCMA 3E48A 2I6XA 3B9PA 4EPTA 5L95A 2PX3A 4WK2B 1DC8A 4JFAA 3MMSA 4EA9A 3W8EA 3E1SA 1RQRA 3LC7O 2O7VA 4HY3A 2GHQA 1UPAA 1ZCFA 3LO8A 3WMWA 1KFCB 2AMYA 3OCYA 3T4UA 4LWPA 2EJWA 2CNWA 3LM8A 2PPLA 2G80A 4DTCA 1QB7A 4JYMA 5FPSA 1BYIA 1B7GO 5TRDA 1XDZA 1VBNA 1QIHA 3WTCA 3GK3A 5IK2A 3LLCA 4XX0A 5IFKA 2ZRDA 3ZPXA 1Y8RA 2R6CA 1CQZA 5A1TA 2ZZMA 3A3PA 4HAWA 3AUXA 1FJHA 2PCJA 2VPYA 2YCLA 1XNRB 2BZGA 2B0CA 1WE2A 5EJ6A 3AX6A 1G5TA 2V8OA 1M0SA 5CVUA 2MSDB 4X8OA 5JYBA 2CE7A 5DM1A 4BP3A 3ZVMA 3OE7A 1CR6A 3KE8A 3HV0A 5D3ZA 4LJSA 1R4MB 1AUVA 3BGSA 3IV6A 4G6ZA 3SIXA 3KXPA 1Z2EA 3I92A 4NMMA 3QMPA 2Y9MB 1QLHA 3M6VA 4G5FA 4UZEA 4ZOBA 1OBCA 1BG6A 4TTPA 1K7EB 1DBSA 3KYIB 5KNDA 4B4WA 3MTQA 3OPMA 4FZJA 3B1ZA 2MSWA 3GPIA 1XMVA 3NYWA 1YHNA 1EWVA 2A9FA 1T4MA 2AN5A 2OTCA 3EWSA 3OOWA 3LKVA 4LMPA 3T52A 4ZDIA 1AMUA 4R2LA 4CG0A 4JC5A 4DRXB 3PPWA 1EUYA 3MAGA 2GQFA 3ABIA 1EMDA 3PXXA 4PNHA 1T5BA 3BFKA 1TTQB 4H59A 4H77A 1C3VA 1G5FA 4JLMA 2LDBA 1AN0A 4HNHA 2YJ3A 1XZMA 2JHFA 2ZGVA 1E1LA 1OT3A 1TYCA 1T8WA 3OFVA 3QUTA 4WXMA 2PGOA 3SOPA 4WKPA 3LNCA 3UA4A 1GPWB 5J43A 3ZU5A 3DLHA 1SOAA 3ZE9A 2X76A 2H2IA 4AYTA 4EHLA 1VB3A 4MI9A 1I7PA 4Z3OA 2FCRA 4PRYA 2VAVA 3MTDA 4FQ7A 5LWQA 3NDBB 2W0MA 1KH3A 1MO4A 3ECSA 3T1VA 1WIWA 2CXTA 1ZEJA 3O92A 1KJNA 2W4IA 1G6KA 5E9QA 3WK6A 2X0FA 4E09A 4MA5A 1QPBA 4WJZA 1TVCA 2GESA 1A4XA 3ROMA 5HE9A 4M38A 5EESA 1T6XA 2XUDA 1LJLA 3KVOA 4P3IA 3K0CC 1EZ1A 3GFRA 2I6TA 3R2JA 2EBFX 3RVDA 1G6Q1 2GEVA 3WK7A 5DT9A 2E55A 2H4WA 2FEPA 1HOTA 1XMOB 4JYBA 4AYXA 1IZ8A 4E0BA 1K7SN 3ON5A 4I36A 1GDDA 1P7CA 4NHEA 1KS9A 1JDSA 8GPBA 1BXGB 3EK2A 4KWEA 1ZSYA 3WV5A 3X2EA 2DF8A 1CVLA 2CLEB 4G1EB 4DJJA 1KARA 2YICA 3O7MA 3OPXA 4G2NA 4P8RA 1DIHA 3C5VA 4ZDWA 2YFHA 2A35A 4IF4A 3HDYA 1FP4A 1VDZA 5LQUA 3ZOZA 4KXMA 3ZG6A 1GTVA 5HFJA 3E9RA 5J9FA 4YLEA 4JOCA 3SX4A 1ZL2A 2HMSA 1S72B 4B2YA 4E5UA 2GZ1A 3OO1A 1EU1A 1XMIA 5CA0F 1ZA1A 16PKA 1D8TA 1W2BB 2ZBFA 1J2YA 4QARA 2GYVA 3C3DA 5ALEA 1N4DA 4ASUA 3C3XA 3WWOA 3EPJA 3CESA 2VJLA 2QM3A 4K0RA 4M9UA 3H2HA 3RIYA 2QSZA 1TQ6A 4R5MA 1E2DA 3DZBA 5K3FB 5AI0A 3BQNB 4FFVA 1GILA 1A4RA 1BDJA 2F1MA 4I1PA 2GXAA 1FFEA 3JVVA 3UAXA 5L7WA 1ZONA 4NEGA 2VO1A 4PFSA 1L7MA 2VRCA 5JYCA 4US0R 1N5LA 3QX3A 2PR2A 3M3DA 3F9CA 1E7SA 4JLNA 2NZUG 4GPZA 4F4UA 3EGXB 1M0WA 2FF7A 1QP8A 1E8NA 2KJQA 2VYQA 2GRUA 4DDUA 3RSGA 3P9QA 1WF3A 3N1UA 4CV3A 4TQ9A 1JPNA 3OPQA 4YRSA 2CJWB 2VYVA 3NFYA 3ZQKA 1EFTA 1D4FA 1NTOA 1BVYF 1DAEA 1G18A 2JIOA 2GYYA 3P71T 4OD0A 5EIBD 2IUUA 3P19A 4A6PA 3ZGNA 1CVIA 3T0IA 1U6KA 4X9XA 1G21A 2Q6IA 2VTBA 1Z7WA 1ND5A 1YZHA 1Z4LA 3FYUB 4XDGA 4ZOLF 3O4JA 1JPJA 3UW1A 4LXXA 3W9UA 2YZ2A 1EI9A 3KHSA 2DIEA 1I4OA 3OMXA 1RLJA 2FSSA 3KZXA 3SC3A 2XMDA 3M34A 1SOMA 4COKA 4RJJA 2GZRA 1NR1A 2UZ1A 4MS3B 5J4YA 2VZ9A 4PFJA 2XYPA 3F96A 1C1HA 4N5IX 4ND5A 4RUKA 1YCFA 3W3AD 1CY6A 1J8DA 5KTOA 4MW4A 5M5BA 1Q7EA 5DEIA 3QW4B 1H1LA 4BE7B 1YMVA 1WZEA 4RX1A 3CURA 2XADA 1GKUB 4OYYA 4UHEA 5G0TA 2NAPA 1H1DA 1JX6A 4KPUB 3F3KA 4KXLA 2PK3A 2CZCA 2YC2C 2WJJA 4LA4A 3FHJA 3G49A 4J0KA 3QE9Y 1SC1A 2R8XA 3PVZA 4JI8B 5A0VA 1I36A 1KAEA 3MGAA 3ECAA 3BDAA 1HXHA 3ZCXA 1EXDA 2FR1A 1PRYA 2C5EA 1E3WA 2BEWA 2PD4A 4MRVA 4BEJA 3FBGA 2C82A 4DMFA 1WUIS 3OQMA 5IBCA 4O0LA 1MTZA 3GEBA 3R44A 2AI1A 3ORFA 2NZVG 3CCEB 4G0YA 3QLUA 1GY8A 1GG5A 3E3MA 3GP3A 1W8IA 4OGGA 4R1UA 3RRJA 3L93A 4JKYA 3ZDZB 2WM3A 3LY9A 1UXKA 3H17A 2O2XA 4C7XA 1C9MA 4RENA 4MGEA 4OKNA 1KSJA 3QBJA 5HZBA 1VKZA 5ISMA 1BU5A 5LM3A 4JBGA 4PINA 3VNSA 3RSLA 3R6DA 4Y1RB 1HT1E 4H7IA 2PUGA 4DNTB 3A4LA 1R0WA 5DISB 5JO0A 5GTDA 4B76A 1VPEA 2G67A 3LK7A 4MINA 3S3TA 2EFYA 1INLA 1XEXA 1HOXA 2Z5GA 3MB8A 1MD9A 4Y3UA 5AWFC 3RAJA 4JKIA 4ARBA 4EBFA 3PXEA 3T54A 3K1ZA 3L7CA 4LYFA 2QAGC 1V11A 1RWMA 2WE8A 3M2PA 4UU1A 1AGRA 1W5SA 2PKQO 3O3OB 4YQEA 3WMEA 4YRPA 1IBRA 1UZUA 2RFLA 4B09A 2O0HA 3IKTA 1EVIA 3OJEA 1Y9ZA 4YCSA 4IILA 4TT3A 2A9QA 3NGMA 3SKXA 3GLFA 5ESWA 4J0IA 1RRVA 4EFMA 2IC5A 5J2TA 3CO5A 5I4IA 4IKEA 2AMJA 2VYFA 1NSYA 3QFHA 2IS6A 3IUEA 2YMQA 2NSJA 4X1OA 3Q2IA 4XQGA 2FN3A 4E5NA 5CXQA 5THKA 3R7NA 3C5CA 1V9LA 2VTEA 3I58A 3RJZA 2RI6A 5FNVB 2C4WA 4Z4EA 1RWXA 2YVQA 2AR9A 4NCHA 1TTHA 1H2BA 1K9SA 1P8AA 1I3KA 1D2CA 4L2IA 1NLZA 3DTTA 3GLKA 3GNQA 3R0ZA 4MV3A 4KUEA 4RV4A 1MZPA 5E95A 3R0IA 4UBOA 3R4CA 1H9AA 1QVRA 3MD0A 4OM7A 2FEOA 4X97A 4AX4A 4PHHA 3R3YA 1VJSA 3ESBA 3ED1A 4HQLA 4E11A 1G3IA 2ATVA 4IJ5A 4BMSA 1QGOA 4QU0A 3TQCA 5FTJA 1AK2A 1QVAA 1EQ2A 1XWFA 1Z7EA 2ZTUA 3Q7IA 4HHEA 2YJ4A 5EIHA 2J1LA 1IJFA 1FRNA 1DBQA 1X7DA 2FW0A 5E0KB 1K6MA 2LZ0A 2XTAA 3ZV7A 4B3IA 2V7WA 5C8XA 3H5IA 3BCDA 1BJTA 3SKVA 1CT9A 1ULZA 3IH5A 5ADVA 4K03A 9ATCA 2Y3IA 2H0AA 5JYDA 5FLXA 4ISCA 4HDKB 4ARZB 1L4FA 1X2EA 1FJGB 1QAMA 4Z9BA 4DV6B 3CRZA 4PXYA 2EDCA 4N3GA 1HUQA 3PV0A 4AC9A 3ER6A 1T4CA 4PSVA 5EZ6B 3LCMA 3T3HA 4LF4B 121PA 2FXIA 3PHIA 2BVNA 2IRWA 3NDIA 1MC5A 4E5MA 1P0IA 2CV2A 4IZHA 4ICIA 4KIWA 1XZJA 1EP3B 1QYXA 2H4HA 4BV9A 2W71A 2F4VB 2O7RA 3NKVA 4GVLA 4D8UA 2IOFK 1NN5A 2ZUTA 4XCQA 4Y18A 1BD4A 4TLEA 3FSJX 1YK1A 4TTIA 3CF4G 2OGSA 5LQDA 1G8GA 1L6IA 3IP8A 4AJOA 1QH9A 3T1QA 2VKQA 3I83A 3OKFA 4GBMA 1SUFA 2IW3A 5D3MA 3FDXA 2HV8A 5JATA 1G38A 1QH0A 2J6HA 4OOEA 4Y8VA 2ZI6A 5CUQA 1MC4A 1NQTA 1UM9B 2AR7A 4KVAA 3WGHA 3RO7A 4N41A 2VQDA 1W2GA 3WRVA 1T0BA 1GA1A 2QTBA 2YVKA 3FKQA 4C2BA 2FEWB 5T3UA 2CWDA 2DKOA 3QYJA 3AG6A 2HFJA 1WRBA 2JFQA 1QRAA 4YIHA 4EM6A 2WKWA 4E4TA 1JIQA 5JRDS 4BX3A 3HZRA 1G7SA 4HLUC 4PYJA 4L27A 1LVUA 3SX2A 1Z35A 2F1HA 3TCNA 4J0FA 2D1FA 2C57A 2LWIA 4H1HA 1FRFS 3UB3A 5JJIA 2NZJA 1UF9A 1W46A 1HT0A 2W6QA 4C0SA 1L5HB 4ZQEA 1MABA 2W8BB 3R1IA 1LDMA 2BTOA 2DSNA 2V9PA 4XIFA 1VM6A 3VR2A 1EINA 1XQ9A 3WDKA 5EHXA 3GIRA 3UHPA 3QBDA 3N7TA 1IEVA 3QUCA 4MYHA 1ESDA 2BGNA 1XGKA 4YCBA 4CL2A 3CV3A 1CY8A 2RHGB 1OSNA 1DBRA 1UJ2A 3HACA 3M4YA 3JRNA 2ZL5A 3WBBA 5K4HA 3QVGB 2CVHA 2YHIA 2IX3A 5DN6A 2C5BA 2OP1A 2ZULA 4BC0A 3TLBA 1FNMA 2PUHA 1GP2A 1E2UA 1HG1A 1M8KA 1NVVQ 1YVDA 3KPUA 3NIGB 4QXRA 2IPAB 3ENNA 2G5CA 4HAXA 4HZIA 2F3PA 4UE2A 2PZKA 3A7EA 4X0CA 2QRHA 3O9ZA 1RQPA 3O21A 4WVLA 5L9AA 4MX8A 1RBQA 1S4MA 4XYBA 1A97A 1I13A 4BFXA 3SEQA 4MUFA 1N6NA 3IOBA 4O4HA 2OWDA 4HFRA 3BUSA 1Z13A 2OR3A 1MQ9A 5GGYA 2FEXA 1SA0A 1O95C 3MWKA 1RI5A 4Y7DA 4BNFA 4YHHB 1NQAO 4LZNA 3GUVA 3LYAA 5AJWA 1T15A 1UADA 4O4IA 4EW2A 5BWBA 1Z0SA 5FH9A 4GP7A 2R8BA 3TG2A 4HWPA 2HWWA 4PR3A 2CUNA 4DAOA 3U1VA 3P0FA 5LOVA 4K1XA 5AMXA 1P5JA 5BWMA 3PVDA 1BU8A 1QC5B 5IT4A 2JLZA 3X44A 1E3JA 2E0IA 1I4LD 3D0OA 4QDOA 2EFCB 4BGUA 4L28A 4DV0B 1YA6A 3COZA 4G41A 2VT3A 3M9WA 1BN7A 4P83A 3WK5A 4B33A 4YTEA 5IAJA 4Q05A 5JAUA 2BHNA 1VQ4B 3OF3A 3UKJA 3DEIA 2QTLA 4PN7A 1XAJA 1I1QB 4EENA 4G0UA 3M0EA 1F5NA 1ODFA 4J1NA 1TZMA 3K9LA 5JS8A 4S1VA 4S04A 3IUBA 1L4KA 4CTNA 4RDIA 4G5YA 4AP5A 4V02A 3B6ZA 1ZK2A 1ZJ6A 3PE4A 4YRAA 1Q14A 1WCWA 2E7ZA 4EGAA 3N8HA 4V3CA 3PYXA 2DUNA 4NENA 5C51B 1L2TA 2FQYA 2VRNA 3CLTD 4MHTA 1P91A 3NT5A 3D6JA 5FUBA 2Q0XA 2X5OA 3PEFA 1FA9A 1Y7TA 1HDIA 3UM9A 2VQ3A 3RIGA 3VVLA 1TRKA 3GDHA 2HA5A 4KNVA 4RD6A 1UPFA 2EJUA 2H63A 3FOEC 4G1UC 1QU2A 2QYOA 1A9SA 2NYAA 5J3OA 3ZIAD 2C2HA 2BYTA 1G8KA 3BULA 4AJJA 4NSNA 5KDLA 5GIPE 3ZHSA 3V1UA 3VO8A 3LVRE 4I50A 2B0JA 1PZNA 2GHTA 3KOOA 1OILA 4JELA 4O08A 2J4FA 4DLNA 5IKEA 3AHGA 3GVLA 4MTCA 3W9YA 3FLBA 1MV5A 4JB2A 1V8DA 4KG7A 5COBA 3JASB 4C7MA 3DE3X 2CL0X 3OFKA 3QLEA 1YA8A 4M0UA 2WIDA 3VPXA 1NW9B 2I7CA 2P2ZA 1NMQA 5M7EA 5G0SA 4RPJA 3WB1A 3SX0A 2ZXFA 4L5CA 1X7WA 5EKSA 5K8JB 4ZAWA 4EKGA 1O5TA 2YFYA 2WSSD 3IS3A 3E9DA 4H7DA 4BZZA 3G05A 4B3XA 2JNWA 1NU6A 4FU0A 4J91A 4NBLA 4TVBA 4FFNA 4UCQA 4WK6A 2EKLA 3EY9A 5ALSA 3WR5A 1DKOA 3Q6NA 5CIQA 5B4UA 3TNFA 2AMFA 1N75A 1Y9AA 2C4TA 1YR3A 1XQVA 4MJ7A 1XFOA 3V76A 1J21A 1G6OA 4BN0A 1KQNA 1EP9A 1SKQA 2PSHA 1MOSA 3D4IA 1EUCB 3BJIC 5FUQA 1XZQA 1E0AA 3T7TA 3K4HA 1YJAA 2FSGA 2XUZA 5KPJA 2CVZA 1NVEA 4CW7A 1MB9A 3KOYA 3RBZA 1JLLA 1B00A 2C04A 5BNIA 4UOZA 3G8AA 1HDYA 5LUAA 1VCIA 4BRWA 3C4QA 2JLYA 3VH4A 2G4VA 4XYMA 2G7ZA 1ZJJA 4LOHA 3WZMA 2XZOA 3SIPA 1ILEA 4D3ZA 4HDQB 2YWCA 2WT4A 1JJBA 2GF9A 2Q2NA 2ZBGA 1KO8A 4AQDA 4WLVA 1Q7RA 4YP5A 3ISVA 5AKXA 5EXEA 1RW4A 2O50A 3EOAI 2OY0A 5ESDA 2WZNA 3UJ7A 2X0IA 4D26A 3FFBA 4RM0A 1BX0A 2CLOB 2H57A 1QORA 1QO9A 1U7TA 1XQWA 3FDZB 2CNLA 1UKZA 1WP6A 4K9OA 4WEQA 2XNCA 1IUKA 1YB4A 3QIAA 3RK1A 4PYOA 1AGYA 5G3ZA 4M0LA 3AF0A 3WV4A 2VBFA 5AM5A 2PMCA 2NO6A 4GMXA 3GLVA 4AZ0A 4BO8A 4H3SA 3GLSA 2G9ZA 5FFNA 1YFJA 1FC0A 1XZPA 3H2GA 4C7OA 4IH1A 3T5DA 5CNKA 1MU0A 4EUHA 4K46A 1DX4A 1PR9A 1U8TA 4CKXA 1SOUA 1UBGA 1AKVA 2P2SA 1E43A 3WKEA 2PFGA 3EGWA 1CZRA 4V0QA 1H94A 2WQ7A 5KVVA 1KZLA 1XRNA 4C0HA 4K87A 1M66A 3CS3A 1KJZA 1Z36A 4IYJA 2YN2A 4LYJA 2ATXA 1RWKA 4ZODA 1KZGB 2Q46A 2ZUDA 1Z06A 2XZDA 4JCCA 3T1YB 4PQYA 2JCGA 3KKLA 3SLDA 1Y81A 2H17A 2O2CA 2C88A 3Q41A 2MSEB 4IPTA 2R8PA 4MQUA 1QH8B 5HE8A 5JH7B 5KWJA 5ILQA 4GZ3A 1Z28A 4GM0A 4I66A 1ZJ4A 1CUYA 3Q0TA 5CCEA 5AW5A 3EEFA 4RM2A 1YZ3A 1AT1A 4H1WA 3P2EA 3UJBA 1IY0A 3JQQA 4DRYA 3LU1A 4BS9A 3CJRA 3AVOA 4J4TA 3NVDA 2BFDB 3IAXA 3TJRA 4B6JA 4BWGA 1GO2A 1ZUNB 3R6TA 4L4XA 2A59A 2O14A 3TD6A 4WRRA 5CVDA 3WSTA 1FRQA 1PJQA 3LUDA 1K8ZB 1VRVA 1H2HA 2P30A 2QD1A 5AHWA 1MMFB 1KMNA 2B8EA 2GSDA 3BDIA 5F3DA 4Z49A 3RFCA 5LLDA 2LZJA 1R4NB 3PC6A 3IOYA 4CIXA 2ON6A 1HNZB 3DPSA 1G5IA 4DDVA 3B53X 3KLBA 1U7UA 2I4LA 1P31A 4IH4A 2C95A 1UP6A 4QGHA 2X19A 4FDAA 4WESA 3I01A 4PQEA 4RS4A 3AR9A 5J1TB 3L4EA 5LBTA 3W2IA 3F6SA 1V48A 2DFLA 4OH1A 3RYHA 3VFDA 4Q01A 2C9DA 2Z6QA 1G21E 4D4JA 1C50A 4O5AA 1D6JA 2F8TA 3PQEA 5AVSA 3RSFA 1PV4A 2XMZA 4KFSA 3OOJA 3LDHA 1X8XA 4KE8A 5BMVA 4MQFA 4H2DA 3B6IA 3H0CA 3D8RA 3WLSA 1KIFA 5HK9A 3AEQB 4JOQA 4RGYA 5AXAA 1S2DA 4P12A 4B17A 3L7BA 1IBLB 3U26A 1DC6A 2BFEA 3I9V6 4M88A 4ZANA 3CMAB 3W6PA 3D3QA 4D8XA 3VBCA 1NBWB 3L4JA 1JG3A 3L7YA 1PLLA 2H1OA 3HB7A 1XF9A 4LHSA 1L5LA 1UWCA 2J3MA 3RTBA 1Z62A 4MQBA 2XVZA 1SCDA 2VXYA 2QTCA 4F46A 2ANBA 1PHRA 2FVXA 3LY7A 2OBSA 1MAWA 3KKKA 3H97A 1MDFA 2Q5JA 4ATNA 2QMHA 4AS2A 3RAEC 1J2RA 2C2OA 2ZWPA 1E6WA 1JDBC 3I9KA 4DT1B 1QTQA 1UH5A 1Z0KA 3UK6A 1R1DA 3VYRB 4EKYA 4G8CA 4HWGA 3UUEA 3H2IA 3CCRB 4ZVSA 3IXQA 2YIMA 3RR2A 4JEUA 3Q87B 3CN7A 1IPEA 1GQFA 4IG9A 3U3ZA 4ND7A 4HK4A 1SVSA 1M6EX 1XD9A 3BY1A 3SMVA 3HJGA 3P8ZA 4RDLA 5CXSA 1E9CA 4JYZA 1TMOA 3T3IA 2R6HA 5HXAA 2XUGA 3HB1A 1G2OA 4CLOB 3Q2KA 4B8YA 3ME5A 3B3FA 5EERA 3P0EA 4POOA 4UU8A 1VL0A 1AUQA 2VBSA 3MIIA 3VNAA 2H29A 4PONA 1TW2A 3OIWA 1N8SA 4MKFA 5TQ0A 1N2SA 2W6ID 4PG6A 3WLTA 5C7OO 4IZIA 2WU4A 4KAJA 3UMCA 3GRUA 5FEUA 3BIFA 2YW9A 1HG0A 2AT1A 3GY0A 1R6TA 4ALKA 3T3NA 4B3FX 1YKFA 4IGEA 1UJMA 1VGQA 3S6JA 1CETA 1MOQA 4D6PA 3OZIA 3ZJ5A 1BWPA 4GQNA 5F9HA 1H2XA 2RHBA 5ELLA 1CY2A 4EB6A 4BC1A 3J81A 3HL4A 2YIDA 3A6ZA 4QU9A 4U3JA 3GLFE 4JI1B 2X86A 1BS9A 5BW6B 4OHRA 2C2ZA 1E1KA 5HPYB 2ZR9A 4J43A 5FUXA 2X3UA 2C92A 1DOAA 4EJSB 3MA0A 5TEVA 5U4XA 1M67A 2ZBPA 3AR7A 3VOAA 3NXSA 4PAMA 4DK0A 2J0QA 3H1PA 4GKVA 5TXGA 3DT8A 1I1HA 3D3EA 3WKBA 1HE3A 2HSEA 3AEKB 3HZHA 4RIFA 4MVJI 3ZWCA 5I5EA 5G1PA 5JWOA 1J6UA 5IYNA 2ID9A 2PEYA 2XF8A 3H11A 3KQYA 4G7WA 3ZCRA 2YVAA 1TAHA 1MAAA 5DX8A 4BRZA 3STXA 4HWKA 4TMFA 3H1EA 2IP2A 1EVYA 3D1VA 3G3EA 2YX1A 3AG5A 1NZFA 4KLNA 3GJZA 3KKZA 1TF5A 2QN7A 4GRIA 5DBIA 5SYNA 3RODA 4YV7A 1UBJS 1ZVVA 3VO2A 3OAAA 3DCNA 3HO6A 2XITA 3NASA 4J2TA 3ELWA 1ONPA 2QMUA 1J24A 3T9CA 4Z0NA 4XWKA 2BSAA 3H5TA 1V41E 2WPNA 4A5SA 4ME6A 3K0FA 1NLYA 1YVRA 4FJ2A 5KKAA 4I3GA 4JCOA 1O89A 3GX1A 4B3TB 2IPMA 3I2YX 3B60A 1D5WA 5F5NA 3MWFA 1DXHA 1Y34E 3D5TA 3OQOA 5F1OA 1XTJA 4OHVA 4CMJA 4DCUA 2HIHA 4JVLA 4WZZA 2EJVA 2Z95A 4CF5A 1RKBA 1PWXA 1D7OA 1MPXA 5EZYA 4RA9B 5EJIA 3ZU2A 1MLDA 4REOA 1CERA 1N2OA 3CPWB 1MKYA 2XOXA 4WK0B 4U2GA 5JS2A 1F12A 3BCRA 4TLBA 3IQWA 3WBFA 2B4AA 4P4UA 4LGYA 4TGLA 3SS7X 3UAVA 1QR2A 4PLGA 2XD9A 1RLTA 2VF5X 4Y9RA 4F9TA 2TECE 2NQTA 3EG5A 4H7JA 3IAM1 4LAFA 1Q1ZA 1KJ8A 1ZW1A 3IALA 1DBPA 3LRXA 1U3FA 3SU8A 3IRVA 2WB4A 1CUDA 2IW1A 1CY4A 4DRXA 2PZ8A 4OBBA 3U5TA 2ZJBA 4BMVA 1GPLA 3CNEA 2GD0A 2GKOA 2PSDA 1IUOA 1XEAA 3QNWA 4ZVMA 3TR6A 5FUVA 2ODWA 3T35A 3WA6A 2WLTA 1XTVA 2AE1A 3UJ9A 1U31A 2D8AA 5TVKA 1YDFA 1TCAA 4EPVA 4EUEA 2B7BA 3FCAA 1VPLA 3TAHA 3SSMA 1DQRA 4ZJPA 2PSSA 4FC6A 3V8NA 2FKNA 1AZTA 2HW8A 5JJKA 4V0LA 3ZHZA 2W00A 5AM1A 4Y9UA 3KKEA 3INTA 2C1EA 2RKBA 2UYGA 5CTAA 5LLTA 1S2GA 4Y1FA 1OYVA 2ZSJA 4M83A 4XEHA 5HKOA 3MERA 1UK9A 4OXXA 2M6KA 3TK1A 4RF5A 2D5BA 2I6SA 2XQIA 3EWIA 2VDWB 2PYZA 5DXFA 1V6AA 4BNHA 1KYZA 1TUEA 5IJ9B 2JIBA 3KQSA 3R3UA 1ZLYA 3ZHUA 4YJHA 5KKCA 3U3OA 4TVKA 1I2DA 1PFYA 2HUNA 4KI7A 4MWEA 5DI3B 1FX1A 2MYUA 2AX4A 1THZA 1ZHHA 7GPBA 1CUBA 2IYZA 5EPUA 1NX6A 1YS4A 2SNIE 3GLQA 3KUCA 3ORRA 3WE7A 5LWHA 4J07A 3ESYA 3DOJA 5DP2A 1S1CA 4OYLA 1E2PA 2BEVB 3KOZA 1USUA 2F6RA 1DAHA 3OEHA 1ECJA 1L5GB 3TNLA 2QRKA 2AFVA 4URUR 1R6BX 4M54A 3ZWXA 3U19A 3U37A 4UNRA 1U0LA 1TAUA 2ZBVA 3RFVA 2XB6A 2JN9A 5CLIA 2X0DA 3TDKA 2YASA 4MQ4A 4B83A 4FCVA 1YCHA 3P96A 3U44A 3P2JA 4ZAGA 1X6VA 4RQAA 3Q10A 3DZIA 4P58A 4DV4B 3IKLA 1NUSA 1P4RA 1XJ0A 1OXUA 1VLHA 3F4LA 4IR7A 1OX5A 3UJHA 3AVXA 5T64A 3IP3A 2CFTA 1AQ6A 3M3HA 4OHKA 2YBEA 3WDSA 2IBTA 1IN4A 4M3NA 5K3FA 4C6SA 4OQFA 1K27A 3OKAA 4RCZA 1TAGA 1MB4A 2EWVA 3HSKA 1Y7LA 3KETA 1EYZA 1NHWA 1Y3AA 1QV7A 4HDNB 4O1IA 3RLIA 4TVSA 1T4DA 1V35A 2H8KA 2BEUB 2Y27A 3D4PA 3QIVA 4RAQA 2NUAA 1MDBA 3HDTA 6ADHA 2WU3A 3ACDA 4HX5A 3FBTA 3BXHA 3TE6A 3U3KA 2GN9A 3OX4A 3CB4A 2Q4BA 3DZGA 4U8HA 4W9MC 3L84A 2WYRA 1BVHA 1C1XB 3AONB 3E7DA 2WJVA 1J9ZA 2VJYA 2X77A 2YIJA 3AUSA 2CJXA 2QMOA 3ELYA 3NEPX 5TRTA 4FHZA 1RM3A 5I8WA 4AKSA 3GAFA 7ADHA 4A7PA 2WILA 5JMOA 3DMNA 3K96A 3DFFA 2FFJA 1NQXA 5LL6P 1OXVA 3IPAA 1XDWA 3KHTA 1ENOA 5FADA 1ZK4A 3OZRA 4FUTA 3BJRA 1DFGA 5C8VA 1CUGA 4LDZA 4I81A 5EIFA 1NM5C 4CV0A 3FSEA 3CVXA 1V1MA 3ASUA 3L6RA 4LNUB 4LIPD 4J0DA 4Z4QA 4IDAA 1FDRA 3PWKA 3KV3O 4KHPB 1E4OA 5KYXB 1XP5A 3WAJA 3ZIDA 1KXJA 4TVOA 3MWYW 4P7JA 3EZNA 2QM8A 5ADHA 5FCDA 1OBVA 2NU6A 2RGNC 1MXFA 3QOFA 1YB2A 3H5OA 2P9BA 3VU9B 4A8JA 4BJ3A 1VL2A 2GJ8A 1QS0B 1VI5A 4EHDA 4JOSA 4RHYA 4L8VA 1YSCA 2HF8A 4CMIA 3ULKA 4B3JA 4DDWA 5HM8A 1MO5A 2IZ7A 1HF3A 1V37A 2P41A 1Y4UA 3EZGA 2R85A 3RQSA 1K0FA 2OESA 4QUKA 2XQJA 2DPMA 2R5NA 1L5YA 3OMLA 5AVVA 3OQNA 2Z3ZA 5FYDA 3ZVNA 4XLAA 3NRJA 1S7CA 1UQRA 3PFIA 5JCJA 3EPLA 2XNDA 2IH2A 3HB5X 3IDFA 1GKIA 4YGYA 2GZSA 2VUIB 3EDRA 5FI5A 3QX9A 4UUQA 1KFKB 4HFMA 2HSJA 2JH3A 4NJOA 5CW1A 1WW3A 3LXRA 2O3TA 4HB4A 5HG0A 3V34A 1XX6A 3O84A 4J1TA 2G1UA 4JYPA 4C0JA 3RARA 3PEVA 3USCS 5JCZA 2I2XB 1NI4A 2H1RA 2LR0A 2W2PA 3KUDA 2YNMC 4GHWA 4PZDA 2JIZD 3ZGVA 2QP3A 4U7FA 5BNFA 2JLCA 3KOWA 3JWHA 3OZAA 2CFIA 4LJ8A 3WOVA 5BR8B 1VJ0A 1TJNA 2R4TA 3W2TA 3PC8C 3QWHA 1AOXA 1KQPA 1VJ5A 1WD7A 1DMSA 3VAZA 5JROA 2Q1SA 3GJSA 4B34A 1WETA 3GMDA 1UMDB 2B8NA 3LA6A 4KDRA 4TYYA 5T6BA 4JXXA 1G4UR 4PYQA 5CM8B <