4YHBA

Crystal structure of a siderophore utilization protein from t. fusca
Total Genus 64
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
64
sequence length
261
structure length
261
Chain Sequence
ERTVEMYPLKSRLLEVVNVRRITPRMVRVDLGGSDIAGLRSDNFADHVKLWFPNPETGEHVLPVVEDDRCLNFRAPGVIYRDYTVRRFDAKARLLTIDFVVHDNGPGGRWAATAQPGDRLGVLGPRGTVYYPEADHYVLLADETALPAAARRIEELPRDASVTAFFEVADAAEEQELDAPEGAEITWLHRNGAAPGTTDLLLRALEQTEFPKGRVFVWAGGEADALKPIRRLLKERGLVRGRDFEVDGYWRRGVSNLDHHA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure and Mechanism of the Siderophore-Interacting Protein from the Fuscachelin Gene Cluster of Thermobifida fusca.
pubmed doi rcsb
source organism Thermobifida fusca tm51
molecule tags Oxidoreductase
molecule keywords Iron-chelator utilization protein
total genus 64
structure length 261
sequence length 261
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04954 SIP Siderophore-interacting protein
A PF08021 FAD_binding_9 Siderophore-interacting FAD-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.30.10 Mainly Beta Beta Barrel Elongation Factor Tu (Ef-tu); domain 3 Translation factors 4yhbA01
3.40.50.80 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Nucleotide-binding domain of ferredoxin-NADP reductase (FNR) module 4yhbA02
3VO2A 1E62A 4ZV4A 1DG1G 3G4SB 2DETA 1TUIA 5GV8A 3W5VA 2QDXA 3OZVA 4TMVA 1CQXA 4RD0A 1Q7YD 1OGIA 1QVGB 3E20A 4FK8A 4M1KA 3E1YE 4TMZA 4YHBA 3OZWA 1BJKA 3U6KA 4BPRA 1YJWB 3WNBA 5DSZA 3A1FA 2QTZA 2OK8A 3JQPA 1ELOA 4H9GA 3FPKA 2E1RA 4M4SA 4ZCMA 5TY0A 1QVFB 1R5NA 2DERA 1JB9A 1W34A 4AF6A 1TLLA 2PMDA 2NPFA 1K9MD 2DCUA 3B8HA 4Y9RA 2X3UA 1BQEA 1D8TA 3CC7B 4PC7A 4AF7A 1GR1A 1Q86D 3CXCB 2R6HA 3ZBUA 2QA4B 3I55B 2RC5A 4LBVA 1VQ4B 1YI2B 2QMUA 4RD1A 3OJXA 4FN5A 3ZZTA 1QGAA 1EFCA 2YWEA 1QFJA 1EP3B 2BGIA 3CB4A 3QE2A 1KJZA 4LBZA 1EFUA 3P27A 1KC8D 1KQSB 1SM4A 1Q81D 1I7PA 4C43A 4PC6A 4RJLA 1KK0A 1GJRA 1EP2B 1YHQB 2FX3A 2AHOA 1VQ6B 3CPWB 4G5GA 2XNJA 3LVBA 5EMNA 1B23P 3MHPA 1A8PA 1U2RA 3WXMA 4TN1A 3CD6B 3CCMB 4PC3A 4PGOA 1VQ9B 3VNUA 5THXA 1XE1A 3WNCA 3CCUB 1D2EA 2D74A 1ZUNB 3I1FA 3OW2B 4M53A 2EIXA 1F60A 1QGYA 2BM1A 3ES9A 1GAWA 3WBKA 2OK7A 2HMAA 3G71B 1QUEA 3W5UA 1DDGA 1YITB 1Q82D 2QN6A 3QFCA 4B48A 3ZZUA 5TR9A 2VNKA 1SKQA 2QTLA 4N3GA 2BSAA 2CNDA 1VQKB 2PIAA 1KRHA 2BF4A 1ZM2A 2YWGA 1W2BB 4RD6A 1EP1B 2YWHA 1KK3A 1WDTA 3W2GA 1GAQA 1KK2A 3OJWA 3CCVB 3AVUA 5FA6A 3MMPA 2ZITA 4U9UA 4B3XA 2B7CA 1JA1A 1YJNB 3CCSB 1ZM4A 2BGJA 2C78A 5H5JA 3VO1A 3ZZ0A 4EH1A 2OTLB 4YALA 1K73D 1NJID 2EFGA 1M1KD 1QX4A 4HE6A 2DY1A 1QG0A 1E64A 1R5OA 4MYTA 4ACBA 3WBJA 4TMTA 3W2EA 3CCJB 3AVXA 5GV7A 4B47A 3QFRA 3CC4B 1G7TA 3AVYA 1N0VC 3LYUA 4G1VA 2BPOA 4AC9A 2BN4A 1W87A 3B82A 4Y7CA 2XNCA 3CCLB 3I56B 1QFZA 4IW3B 1VQ7B 4P6VF 5AN9A 1OB5A 3W2HA 1F20A 2OTJB 3ZC3A 1S0UA 3WY9A 2VYQA 1IB0A 2VNIA 1OB2A 3VNVA 4WQMA 3CRZA 1JNYA 2BVNA 4FWTA 3CCEB 3CMEB 4LBYA 2BMWA 3JQQA 1VQLB 4DQKA 1TTTA 3ZBTA 3AVWA 2HDNB 3OZUA 4MYUA 1G7CA 1FDRA 1DARA 1FRQA 1OGJA 2RC6A 4C0SA 1VQPB 3MCAA 1UMKA 1IJEA 4B43A 3CW2A 3AVVA 1JA0A 2BM0A 2YWFA 3CMAB 4RD2A 2HCJB 2J7KA 1DDIA 2BV3A 3WYAA 4YAOA 1FNCA 4ZGQB 4B4DA 1ZM3A 3JQRA 3U6BA 2CRVA 1H42A 3AVTA 1M90D 1IJFA 1NDHA 4RCZA 3WNDA 1B2RA 1CNEA 4NCNA 1K8AD 2C77A 4YAWA 4LBWA 4Y9UA 1VQMB 4RCYA 4R71A 1D1NA 1QFYA 3W2IA 4TMWA 2B7BA 1VQOB 4P3YA 1JJ2B 1YIJB 1EXMA 4HE5A 4RD3A 4YAFA 1G7RA 1N0UA 2VNHA 5JBQA 3AGQA 3CCRB 1H85A 4F7DA 1TVCA 4PC2A 1KD1D 4ACAA 2GQFA 2B5OA 5H59A 1G7SA 4UAJA 1E63A 4YAUA 3QFTA 1R5BA 1FNDA 4B44A 4PC1A 4QHYA 1KTVA 1EFTA 1XB2A 3SJZA 3LRXA 1AMOA 1VQ8B 4NBSA 2DEUA 1FNBA 1S72B 1FRNA 5HXBA 3PENA 3G6EB 4QFMA 3AGPA 5TV2A 3W5HA 4N3NA 2QEXB 1W35A 1YJ9B 3LO8A 5KSWB 3CC2B 4K1XA 1HA3A 4G1BA 1GVHA 1AIPA 3FJOA 4LC0A 3V76A 1EWYA 4ZCIA 3B78A 2GPJA 1KK1A 1VQ5B 2VZLA 1CNFA 1FNMA 3U2QA 4J0QA 4ZGNB 4TMXA 2XEXA 4ZCLA 4M2LA 1J9ZA 1BX0A 1VQNB 3J81k 4M0LA 1QUFA 4DQLA 3P26A 1QH0A 1QGZA 1ZM9A 2VNJA 1N8RD 1GO2A 3QSYA 3CCQB 3QFSA 1BX1A 4Q7JB 3VMFA 4RD4A 2PLFA 3W2FA
chains in the Genus database with same CATH superfamily
2VDPB 4HS9A 3OIWA 4MNTA 1XAJA 1XZIA 3WP0A 2O4UX 3PQ2A 1OROA 1ORWA 3PFFA 4MJ3A 2IS2A 1Q91A 1G20B 1NMEA 2R85A 3O8BA 5CR9A 3C6MA 4HVCA 1RFGE 1HDGO 2GD1O 4TKUA 1YBAA 2QAIA 1FP6A 2JVKA 3IAM6 4O63O 1PR5A 1Y7LA 4V03A 1GPLA 3D3NA 3ZWDA 4OOVA 4M1MA 5FO0A 1V8ZA 2XLBA 3KBBA 3PHGA 5IM4F 1JH9A 1E5DA 1X7YA 1I2ZA 4C29A 4D02A 4EX7A 2MDTA 1R64A 1JDJA 1JWLA 4X8IA 2RBGA 3A2LA 5U4QA 1YKSA 2ZANA 1UKZA 4PX5A 4DLVA 3BTOA 3AEKA 3H5NA 2QEQA 4KN8A 2IUUA 4LZAA 2YXBA 2I3GA 4X8LA 5FYQA 1V25A 2PL3A 1M1YA 3CF4G 2RJOA 4WK6A 5D8DA 4C4XA 4CQLA 2OCLA 3FYUA 4PPQA 1GUYA 4DA8A 2RGYA 5HIJA 4KGVA 3NV9A 4UTOA 2ODWA 4ZANA 4BJ1A 4Z9FA 1ZUD1 2GRAA 3O8QB 4QOSA 1JHPA 3QWBA 5DCUA 3WIOA 2O6HA 4L51A 3Q8LA 1LK0A 4WZKA 2H9IA 4FBGA 2RI6A 3CNBA 4CI0B 2HC9A 4ZJYA 1O0BA 4D8YA 3PCXA 4G67A 4YJ3F 2XUDA 4KI0A 3U3JA 4NE9A 4C0AC 2QX8A 1JMKC 3LPCA 3AM5A 1SU7A 5AM3A 4IRUB 1Y0RA 3R6GA 3C3MA 3AQIA 2BY4A 1I33A 2Y0CA 3NJ4A 2O2HA 4MKXA 3RK0A 2RE8A 3V6MA 3JQAD 4WVFA 5CLJA 3O8CA 4ARIA 5CDUA 3C41J 2KSQA 2PXCA 3DD5A 3RUHA 1TMYA 1HEUA 1MQAA 1AKUA 2FPGB 2QJOA 3PP8A 4LTMA 5KOJA 4XCXA 5KOYA 2VDOB 1G21E 4DYHA 1K5PA 2YS7A 1FVOA 1TKRA 4BV8A 1V48A 2QPAA 1I5RA 3SCZA 5FR2A 2E18A 3BH4A 1VCOA 1N92A 4IMRA 4L9SA 2VP4A 1QTRA 3HO8A 2VHXA 2CYBA 4KI7A 1UKBA 4O1HA 3AZQA 3CXCB 1TRHA 1ULTA 4BNLA 4HH0A 3BK2A 3GGOA 1NP7A 3L02A 3GP5A 4ZTUB 1ADJA 2WABA 1RIFA 5G0SA 4UTNA 2ZUFA 3I04A 4CLEA 1DKNA 3I30X 1NKSA 3JAKB 3BSYA 1X3SA 2OAQ1 4WLEA 3RK4A 1REQA 2A1UB 4IHQA 3M9LA 5DOVA 2WIGA 2X8AA 4ZZ1A 4GT1A 2PZEA 3BK7A 4NS4A 3V1TC 2C9DA 2OD9A 3MTJA 4G1EB 2I5PO 2YWEA 4XFJA 5CM9C 2WYWA 2ZJ0A 4OX9B 2Z2XA 4H4CA 5F12A 1L1RA 1RE0A 3VNQA 3FJYA 2NYAA 4FMDF 4OLHA 3QVXA 4B4VA 3FOZA 3QBDA 1BWPA 5I6DA 4DLNA 1T5OA 3VR2A 1G59A 5LZ4A 1T6YA 1BOOA 3ZD9A 5D86A 5HXAA 1QKIA 3KAJA 3E7FA 1MO2A 2GF2A 1M0SA 3B7GA 4JLDA 4P58A 1H69A 3PNVA 4UEOA 3ESCA 3HN7A 1M73E 2ZFUA 4GQBA 3TLAA 1RRMA 4H17A 2REXB 4JP8A 2Y1WA 2P5SA 1WHSA 1HYEA 1ZMRA 3KSUA 4MDHA 1ODKA 2P9ZA 4OXYA 4BL5A 1KO4A 3GFSA 3V7UA 1ZUHA 5CJPA 2IV7A 3R4VA 5FWNA 3SHWA 4YRCA 1KETA 2GWHA 4P3OA 4LY0A 2ZRLA 4PCAA 3L4BC 5DHTA 5EIWA 4YRZA 4N47A 1M34B 1ICEA 1WCWA 2G5PA 1EWKA 1VE3A 4RMIA 5LA6B 1ID1A 5TJ9A 2JASA 3TO5A 4E5SA 2RD2A 5EMNA 3NDIA 2JI9A 2PD3A 2DF8A 2IDZA 1A8PA 1I8TA 3LO5A 4J0IA 5DP1A 1JQ3A 1TA9A 3HG7A 1V2GA 1J2YA 1G66A 1MLDA 1W0CA 2J3IA 3KUDA 4LE2A 4EG7A 4RY8A 2RK4A 4R2HA 4EMUA 1OXSC 4HDSB 4RULA 1D04A 3N9IA 2WWGA 4H4DA 4OXQA 2CBZA 1KXZA 3P2OA 4UU8A 2MCFA 4BTVA 1Y5RA 3B3FA 1PT5A 2G7ZA 3OLZA 3QXSA 3CTAA 3KE9A 4X71A 2IF0A 3ZHCA 1XSEA 3FVVA 1ZI9A 2WTUA 2G08A 3CHYA 4MJ7A 3WR5A 2HI0A 1I2AA 1GUFA 2PKQO 2QX7A 3AKEA 5B4UA 5EQFA 3KIPA 2B8NA 4TT8A 4DSZA 2FRVA 2AUTA 3ZOZA 1ODCA 3FTQA 4RPCA 5DIFA 5D84A 3H4TA 2CL5A 2EEZA 3LECA 1V9SA 3KJIA 1B00A 1LSUA 2JATA 2P9GA 3C7CB 3KAKA 4X92A 1YB2A 2QPLA 5ALHA 3I2IA 3I6BA 3T1QA 2JLZA 1QR6A 4ZT6A 3DE7X 5MN6A 5JASA 4FFBA 3W5UA 2FUCA 4BFSA 4IHJA 2ZL7A 2QR2A 5HDQA 1ENOA 4QYMA 1NWHA 5CH5A 1W59A 2K7FA 1UP6A 3UNXA 4MR8B 1R4AA 4JP2A 1M10A 3FYSA 2QQEA 3G2IA 2O1EA 3QE3A 3C74A 4KWEA 3GGDA 2O2ZA 5EWJB 1KRWA 5TR9A 4S24A 4TZKA 1YBHA 4EUNA 1CU1A 3WMRA 1GUAA 3G0BA 1RS0A 3AMVA 1CNMA 3AM3A 3PKZA 4E51A 4LECA 3D0QA 4NYJR 1RWPA 4QRIA 4OHYA 2QU8A 1NXSA 1EEXB 3I34X 4M37A 1Y4SA 1NN1A 1PT8A 4A5OA 2JFVA 3ELUA 4KAFA 4CM5A 3ADPA 6NULA 4MGYR 4BFVA 2KS6A 4WINA 1EUDA 2H00A 4ZD6A 3O2SB 1O9BA 2YFQA 1CS0B 1GUBA 4IFIA 1M76A 1ZC4A 4KAAA 4MVJH 1M0WA 1FDVA 1Z83A 1N4AA 3SEFA 1E2QA 2H5LA 2X9LA 3GEMA 2I67A 1N1DA 3FWNA 4JL6A 3SWWA 3LRTA 4JLKA 1GN8A 4IS2A 5K03A 3H11B 1PCXA 4QO8A 2X5OA 2ECFA 4JGBA 1LK7A 1S7GA 1I5EA 2OYRA 4HGQA 4TLMB 4YHHB 3L7YA 4KIGA 5FNVB 2OV3A 2YIDA 2FMXA 1C41A 4UZSA 2JGKA 4H1WA 1P2FA 4EECA 1CT9A 4K81B 1V96A 2YVUA 2XADA 4WKBA 3RVNA 5C9ZA 3LZDA 3T38A 5L4LA 1XRQA 4YXWA 1T91A 3OE4A 4CIYA 4KVAA 1N5DA 5EIEA 3R24A 1N8TA 3AVQA 4QREA 1U2SA 3GN2A 5KWJA 1RHJA 3L0OA 3GRUA 4O4IB 1LWOA 1SUCA 3B6IA 4XYEA 5G1NA 5JFTA 1T35A 1L7MA 3M1LA 5LYYA 3ZGLA 4US1R 1MTZA 3M1IA 3NM6B 2WP8J 3O26A 2FTKE 2OESA 3Q12A 4QC2A 3ESAA 3GGSA 1WP6A 1NHGA 3WBJA 1N8SA 1REQB 2A1UA 3H9GA 3JRXA 4HAXA 3W2EA 2WSSA 2VPPA 3CCJB 4IFEA 3S0JA 2GFHA 1N5IA 1WS6A 4LXIA 5HBRA 1JSZA 5K0FA 4Z7NB 3IURA 5E95A 3PGVA 2Q0SA 2WVAA 3AR5A 1U8ZA 2HTEA 2Q3CA 2XMSA 2L2QA 1IY0A 3HV2A 4LW8A 3B3AA 1PGQA 2KWIA 4HWPA 1N0HA 3MCUA 4JJZA 3DDYA 1M0EA 3W5AA 4LY3A 3OPOA 3JY6A 2C4UA 1RKBA 4TWJA 4TUYF 4WK2B 4C9BA 3QKIA 4TKVA 2R4TA 1C30A 2DRIA 3WLJA 1U4SA 4E12A 3GG9A 3I6MA 4HL6A 4LSWA 5C1DA 3EXHB 3W2HA 3NEPX 4HUQB 2VP9A 5IYWA 5B1DA 5C51B 4I4TA 3BY2A 4K8RB 4TXJA 3LBNA 4AT1A 2EQBA 3PNLA 3TTWA 3VU0A 4CM1A 2O2EA 5T8KC 1KE1A 2WJ4A 1WCV1 5FBVB 3VNVA 1FVHA 4GPBA 1KYTA 1OC4A 2NTVA 3DR3A 5K8IA 3K9BA 3VI3B 4U7JA 1QLWA 4DNTB 4TV8B 1H3FA 4B4WA 4QTUB 1YFZA 1ZJ4A 3I04M 4KH1A 3PDIA 4LBYA 1JJFA 1UDAA 3LGSA 2AZXA 3BUSA 1YLOA 3TW4A 1T5DX 3NPMA 3A1TA 1T25A 3QMPA 4CM3A 1U1GA 1ZMBA 2PIDA 4CV3A 3OQ6A 5AUOB 3QSGA 3ZBTA 1JU3A 3LK7A 4JB2A 3X1MA 1Q0ZA 2ASVA 2JDIA 1MVOA 3PQ6A 4J03A 4MYDA 1ZJZA 3J7TA 4HFNA 4QQFA 4XVQA 3SR0A 3BMXA 4TN5A 4MWOA 3SM9A 1KOGA 4DFDA 1J42A 5ADVA 1EVIA 2A0WA 2BSXA 2EG9A 4CQMD 1MIHA 2P4EA 5BURA 2R7KA 4C03A 4IDPA 3O31A 1KDVA 4JVLA 3X1WA 1D0IA 2ZETA 2RAVA 2VHYA 3SYLA 3TZEA 1Z06A 2HK6A 2RGXA 3X0DA 1JG2A 5FOWA 1SHKA 4UBNA 4UC0A 4HGOA 4CMBA 3GLHB 2QMQA 1ZK2A 4RPIA 1M5TA 1IAVA 4NDAA 5FCDA 5HF9A 1IZ9A 4EKDA 3CW2A 1NSFA 2F1JA 2ID8A 2QAGC 4PCLA 1RXSA 2FRDC 5K0CA 1G3MA 2P3MA 1DBIA 2WF6A 2FLKA 4II3A 1PFQA 4MI3A 4RKRA 1I6MA 2BV3A 3M4NA 4PQYA 2RKWA 5EZYF 3FNHA 2C2XA 1Q17A 4D46A 5CFOA 5JH7F 1JIVA 2FMFA 4FLMA 3B1VA 3WMFA 2DFKB 5GADl 4BBAA 4BWFB 3HCFA 4JUIA 5FYDA 5AK3A 1O03A 1FFWA 5DN6D 4HNQA 4LZWA 1K3FA 5HFAA 5IJXA 5HQ3A 3J7AC 5IYPA 2CLLB 1Y7TA 2CLCX 3HFSA 2DFLA 5C31A 5JCJA 3LBIA 1VL8A 1B6TA 1ZX1A 2OP0A 2XWBF 1MW9X 1L9KA 3H04A 2A9OA 3BREA 3HH8A 3JASB 5KYWA 3EPJA 4J8PA 1NDHA 1ZKMA 4JR2A 1O96B 3C7TA 5DM60 5HJ5A 2V9ZA 2Z9DA 3LCVB 4Y9DA 5CVEA 3V1MA 2XYPA 3BMNB 3EXEB 4Q1CA 3K1AA 1SBQA 5EJ9A 2Z8YM 4BB6A 4KLZA 5ERYA 1OZHA 3LUKA 5IFKA 3JPYA 1YJ8A 1OFVA 4N9QA 5J2TF 5AIAA 2C2WA 2C9CA 3PXXA 2HRDA 1SIWA 3WS7A 4XA8A 2JFNA 3DFMA 3A4LA 1ZH0A 3HZZA 3R7SA 1JR6A 3DTVB 1XKTA 1LA2A 4PVDA 3SPXA 3TINA 3DQPA 5AIBA 3GJ5A 5LQAA 1P7ZA 2ZIAA 1NAIA 3ADBA 5BW6B 1JFSA 4Z4IA 3BICA 4RSMA 3GEGA 1V7ZA 1E1QD 1ODSA 2VRCA 3L1HA 1R0LA 4M3NA 5HCUA 4QFDA 3T9DA 1U98A 5FORA 4NYMR 1H9BA 3IXMA 1XZPA 1O1YA 2WOJA 5I47A 4BUZA 3FPBA 1POWA 1G7RA 1O94D 3I3SR 3G8YA 3FSJX 2CJYA 3AJ8A 3OKPA 1GPYA 4KVZA 1OT3A 3FVRA 1MQSA 4I5IA 2O3JA 3K73O 3MT0A 3QUSA 4JDPA 4GMFA 4JUDX 4NX2A 4DARA 5MHTA 1X87A 1AUXA 1CDEA 5JQGA 1Q22A 4RS4A 3R3XA 2ZBVA 2EG5A 4BMCA 5CCEA 2X15A 4UVGA 1EAMA 3ND6A 4R40A 5HE9A 1JDUA 3RSZA 2NN3C 3HBLA 1UM9B 5EI5A 1GNLA 3V6LA 1T2DA 1M2OA 1DO8A 3T7JA 4YAUA 1M34E 1N9ZA 1XALA 2X40A 4B7AA 4E14A 3HCOA 4QGSA 5GJVC 1E0KA 3A36A 4QXRA 5BRNA 5LLTA 2RGAA 3A1WA 1EFTA 3A9UA 3RLIA 3DDNA 3Q3JB 4R16A 2XQIA 4LK2A 4NEGA 2PBFA 4XN3A 1MV5A 3RNLA 4DQXA 2PDAA 1ECPA 3D6UA 2I1WA 4QJ4A 1WOYA 3V48A 4IQ0A 4DPMA 2QRNA 4MRAA 3MGBA 3ZI4A 1HT3A 1BAPA 2WIAA 5CIWA 3AXTA 2RJNA 1VE6A 2AFIB 3I1YA 2NSDA 4F8EA 2M9MA 4G26A 2WT4A 3ZD6A 3LQ4A 1GLGA 2XGGA 1PJRA 3D3QA 5F7OA 5F7XA 2B4YA 3EASA 3OMXA 3G6KA 2BKEA 3IVGA 2ECOA 2N1MA 3WMGA 1QHHA 4ZT3A 5IRCD 3CC2B 2B2XA 2ZYHA 4PFJA 1W9XA 3DLAA 3K0AB 2A9JA 2C1XA 2OWEA 1AIPA 1G4UR 3CRQA 1O96A 1W6UA 1M8GA 1V35A 4KQ9A 5IVIA 3ETGA 5JSZB 3MJSA 2HLDA 3DMYA 3WRYA 4CKCB 1G2IA 3OWXA 3UWPA 5A8AA 1L7DA 3ZH2A 1XQBA 2NO5A 3WZMA 3DZDA 3KSDO 3C8MA 4CG0A 4B7XA 3ZYZA 3QOFA 2W2XA 5JMTA 4RFSA 3GNLA 1W76A 3OKFA 4KO1S 1UQTA 1YRYE 1C3OB 2Q7OE 2D8MA 2A9VA 4ZGNB 1NR7A 5FRDA 1V5IA 4RTRA 3QEAZ 5BSYA 4LRQA 2MINB 3D1LA 4GFDA 3RWBA 2HMWA 1UBCA 4ZCLA 4TWZA 5C2JB 1XPOA 1BX0A 1KZYC 3L8MA 3AP1A 3G2OA 4M88A 4Q01A 5H3CA 3FRJA 3SN6A 1JYFA 3OF3A 3IT1A 4R41A 5F2OA 4CYMA 1QH0A 1AGNA 1AO3A 2O3QA 2Z30A 3EXFB 3G82C 1LJ8A 4RFSB 4K9LA 5KHOC 2QN1A 3PD0A 1GFSA 1K28D 3QSYA 2GCPA 2GGSA 2GXQA 3D0KA 1ZXBA 2BEWB 4Q00A 1QK4A 3TAXA 4BQRA 2DOGA 1TJPB 1L2TA 1K06A 2P9FA 5FTJA 4TS9A 5KYXA 1CJMA 1GGFA 3CVOA 1IHMA 2FLWA 1L1FA 3SYNA 5K0JA 5EMJA 2YWCA 3BL6A 3MEQA 4FXUA 2GLXA 4NRDA 1EG7A 3QE9Y 3EIXA 3K9LA 3KVNA 3W2FA 2OCXA 3PEFA 5GOTA 3S1SA 2ATXA 2IYYA 3OFSA 2FNAA 3DT6A 3PL1A 4HNGA 4YAGA 3CZQA 3ZE2B 4CMEC 2F1IA 3CQ9A 2MSCB 5AW3A 5DISB 2EERA 4MWCA 5AXBA 5CPFA 2FW1A 4I2NA 1PWHA 1KFBB 2C5LA 3OZVA 4JI4B 1OWPA 4N41A 5HZAA 1CQXA 2WAYA 2L18A 4TS4A 3Q40A 3GZJA 2FWJA 4DA9A 3CH7A 4G0ZA 4RGYA 2VHWA 5FNVA 4HLNA 2XMCA 4TV9F 1O8BA 1UAGA 1C1HA 2W2KA 4N8EA 2C5SA 4RIFA 4NG4A 5HE8A 5JNUA 1VE5A 4L2IB 4DIUA 4WECA 3RVRA 3VDMA 1N9KA 8ATCA 4IH1A 1Q0PA 4BPRA 1DKQA 1HE5A 3PCRB 2BGUA 2P30A 1N34B 2JIQA 3CZPA 2VG8A 4XKWA 1HSOA 3I1IA 1EVZA 2OHVA 2E89A 2QW1A 4INAA 4TLDA 3WSVA 1CS0A 3OEEA 1Q5PA 1S9DA 1Y1TA 2XI4A 1PDWA 3AH8A 4BNZA 1FXWA 2GX6A 3CB2A 3KOZA 1PJ2A 3QVOA 1ZGGA 2H92A 3WIDA 1NP3A 4M0MA 2W2VA 4QNMA 3DEFA 4WFJA 3U61B 3DTVA 3NP7A 1OYWA 1RC8A 4Y98A 3MGCA 3E5HA 3PHIA 1PQ4A 1QG4A 1X1BA 3DBHB 3KD3A 4AF6A 3KLPX 1YJAA 4MS4B 4B4UA 5B5SA 1W0JD 5F35A 3U7GA 4JBYA 4B85A 1H0RA 3DBRA 4YO8A 4C7BA 4XLFA 4FONA 5KDLA 2NPFA 1T5LA 5K6AA 1JE0A 1YDHA 5HIAA 1Y9DA 5BQ3A 1NRXA 4G2TA 4XLLA 1Q95A 4B6OA 5LQDA 3AR4A 4ZV7A 1UMDA 2Q1YA 2WYRA 3DJFA 2M1XA 2HIMA 3JTMA 2P79A 3HABA 3L7KA 3PFHA 3TQQA 2BFDB 1Q86D 1OXXK 1W88A 1ZISA 1E2UA 3C3KA 2DUJA 5BV2P 5IN4A 1G38A 4DMRA 1RCFA 1J0CA 3ZWYA 4P54A 4KK3A 2QUJA 1NNLA 5BWLA 5F2NA 3U60B 2H2HA 4Z4WA 1K98A 4W9NC 1BCSA 3HB5X 4DV2B 5GONF 4H59A 5DBIA 1J8VA 2QGFA 1HEIA 3V4SA 3QIVA 3FA2A 2BUCA 3TAUA 3G5LA 3OJXA 4IF6A 4FN5A 5AP9A 1WU8A 2OBLA 3RQIA 1XRJA 1YO6A 5BSKA 1A7KA 3HRHA 3INTA 5IM5A 3QF4B 4BLUA 4DLAA 2L82A 4EHFA 4R0MA 4IX9A 1U2DA 2OCGA 4HRYA 4KBFA 4A0HA 2B0CA 2JFBA 2EKQA 4MWBA 5DX8A 1G41A 4YMHA 3W34A 2I4RA 1QDUA 4GAEA 5HZBA 1KS2A 3R9XA 1SCIA 3GQBA 4J90A 4Q1EA 4KKUA 1YACA 1SBCA 2PYZA 5EGNA 3T7RA 4BN5A 4DGSA 1HO3A 4KB5A 3W1EA 1F06A 1G19A 2C96A 4UU1A 1K5HA 5SY4A 4US0R 3DZIA 3LUCA 3L7NA 4PYRA 5AO9A 4HGZA 1GGEA 3U7IA 1ZN2A 4N3CA 5GJWC 3DFIA 2Q5HA 1ACMA 5ESDA 2HPVA 1I4EB 2AF4C 1VECA 4ZP1A 2VS1A 4ZZ3A 1GJRA 4X41A 4MV5A 1TQDA 2UZ4A 2PKCA 4EPYA 1T1GA 1KVTA 4FTWA 1RLOA 5JY1A 2NOAA 1W94A 3C3YA 3DOFA 1HG0A 2QD4A 5A71A 3Q0EA 4FZJA 1Z45A 3H11A 3G9XA 4HRVA 4Q39A 3COYA 3B5IA 2XNJA 3IILA 4WN3A 4D4IA 5YASA 1DJQA 4K2HA 1Z4QA 3IULA 1R5JA 3ZHVA 1L7QA 2F3UA 4IQFA 4J0GA 3ZW9A 1L4HA 3IP3A 1IZ0A 1SCUB 3H18A 1A7AA 2H2AA 3JR7A 3NFYA 4LCJA 4MGHA 4YJHB 5KYUA 1OFIA 3ONWA 1JZSA 1E3TA 3PNYA 5FHQA 4AMBA 3T1HB 2F1RA 1TB4A 1DAKA 3F78A 3O93A 3NDJA 3GI1A 4I2VA 4URZR 2WD9A 3A9TA 2WK1A 1W2HA 4C30A 2IC5A 3A6GA 4HADA 3SX4A 1LNQA 1T36B 2D74A 2G70A 2YMMA 1NVVR 3DE0X 4GRDA 3UFXB 5ALTA 1BEUB 1GEGA 2E87A 1AB5A 3QV2A 4I6GA 5I7HA 3RKRA 1EXVA 2O59A 4MUMA 4B75A 1B3BA 2HMUA 4U5XA 1UAAA 4NNJA 3UOGA 5KO2A 5E38A 1ESNA 2ZYDA 3MJ4A 2ZSEA 1JIXA 2WDPA 3PF8A 4LI3X 4GYJA 1U8FO 1F60A 2DWPA 2YVLA 2GZHA 3E9RA 1LY1A 2ZRDA 3ZHXA 2GCNA 4FFVA 1SC9A 1NULA 1TF7A 4OXNA 2FWAA 2O3SA 5F4BA 3W7BA 4URXR 3F3SA 1J1UA 1NBMA 2H65A 2X4IA 3GLVA 2GSDA 4NU6A 3WZLA 2FA9A 1M2WA 4FS3A 1JQDA 2GPBA 2G82A 2N46A 4RLQA 5EIAA 3IIJA 4GXTA 1DC7A 1NJ1A 3FTEA 4KV7A 1A72A 3TFOA 3M3PA 3ZWMA 4P26A 1GQOA 3QNUA 4PG6A 4B6FA 2IXFA 2D13A 3QGMA 4Y7DA 1TW2A 5IXYA 2Q7DA 3E7XA 3OZAA 2BFBA 2XTJA 4J49A 4Z9YA 5G02A 1TVKB 1VQKB 2CN1A 2QQGA 3G7SA 4PXYA 4LYHA 1DVRA 1DJNA 2C2BA 5A5VA 3WLMA 3DTNA 2PIAA 4FDAA 3OHPA 1I0LA 3IP8A 1YE5A 1ZNWA 1LLCA 1SWWA 5ECWA 3GNTA 1GAXA 4OYHA 1NM5A 4G23A 1UT5A 2DKOA 3T9CA 4R5HA 4DWWA 4DV6B 4YRIA 1F4PA 2Z4TA 4WH0A 3P5BA 3P4YA 1B1CA 1RVDA 2Q5LA 4RWEA 1T3SA 1K6IA 1ZINA 3RABA 3S29A 2XF8A 1RXUA 1Q21A 2CVFA 4WZAE 3QFFA 3WJ7A 1L4UA 1IXYA 3QPDA 1M34A 3TLMA 3ZQKA 1EX1A 4A0GA 1DV2A 4BP1A 4ZDKA 4CKBA 3AUSA 1E2KA 2Q0XA 2W70A 1UJMA 3HVKA 4FHZA 3H8SA 4LJ4A 2YW2A 5LXTA 2AHRA 3WQZA 2HJGA 1J97A 3HXLA 4EO7A 1E7WA 5BUQA 1KVRA 1ZD9A 2C5EA 3RKSA 4IEFB 4QM7A 2X9GA 2HBQA 2QPOA 3GAAA 4ZT4A 3ZTTA 4EGJA 3HKBA 4LMBA 2RONA 3WRXA 1PN3A 1IN4A 3F7TA 3WTCA 3X2SA 4IMIB 1W36C 1JTFA 4B74A 5JDIA 3H8WA 3OAAA 1UBFA 1GTSA 4GYWA 2JNWA 2A9RA 2ANBA 4A6DA 2VPYA 4JQZA 2DJIA 1VA5A 3D6AA 4PRKA 2YWXA 4UTRA 4JI0B 3P2MA 4JJAA 1WKBA 3NCTA 4DJEC 2W6OA 1NWCA 1U3CA 4R1PA 4B47A 1VKRA 4BO3A 2G6TA 5B3KA 2C7RA 2ZE7A 3CR8A 3HCWA 1XO1A 2JEZA 5DYGA 1HZJA 4NOKA 2QR5A 3OZEA 2OYSA 3JQCA 2IS4A 3E9NA 2RCNA 1NVAA 5EJ2A 2JS7A 4HH1A 3ZV4A 2BN4A 1RPJA 4IHJB 1UD6A 1P2SA 3B82A 3KV1A 3H9EO 4QLOA 5EHZA 2V6IA 2D0OB 4FFBB 3RRMA 4D0NA 1Q16A 5DWVA 5I8ZA 2PMWB 1YVRA 1V3QE 3NBUA 1G9TA 3KZKA 1BVRA 1Y0BA 2X19A 4EYOA 2R97A 4A0SA 2F3PA 5HYVA 1I0ZA 3CRVA 1U7HA 2J3HA 4G0XA 4Y6GB 1P29A 4YUWA 2IHVA 3O8LA 5IW8A 4JI2B 2OTJB 4X84A 2IHZA 2B9EA 4LDJA 1VKOA 4L9AA 2QZPA 3IDZA 4DLPA 1IB0A 4HQNA 3TAHA 2JHGA 1TZCA 4PHGA 2QTVB 3AY7A 2ZUWA 5KKAA 3OD1A 1O95C 3RFCA 3PXGA 2P3LA 4KSCA 4I3HA 4WXHA 1Z6PA 3BGSA 1QIEA 1N2SA 4TRNA 3T5TA 1AHNA 2R6FA 1V1RA 4JVOA 2X8JA 5HUJA 3RJTA 5LQJA 4M1SA 1E4VA 1B3RA 1FSPA 3K9FC 2H11A 1H8HA 1FYEA 3KZNA 2O7SA 2DUUA 4TT3D 4Z3DA 4W7HA 4KGXA 4MR9A 4JC0A 1EX9A 1X8LA 2WZQA 3SIPA 4D8TA 1VJGA 2EAUA 2DH5A 2IYEA 3ZWPA 1T8WA 3AWIA 2PGLA 4NFHA 1QRTA 4RZXA 3U0BA 1V26A 2FDRA 2XCUA 4GRAA 1XCBA 1CZOA 3FFTA 3KHSA 4DCSA 4WIAA 4BNNA 4QEZA 2QL9A 1C3LA 4ZQIA 4NEHB 1QYXA 3BWYA 1OGJA 4IBOA 1Q44A 4L5BA 1I32A 4QXQA 1XDBA 5EQDA 3DP7A 4G1MB 1MFZA 5K8TA 4XR6A 3GVJA 1UMKA 3KKQA 3M70A 4P3NA 4YRRA 5FL7D 3TL6A 4GYYA 3CVJA 3DXXA 3AM1A 2WV7A 1IHOA 3BSFA 1OLSB 4I55F 3S2FA 4DV7B 3AJ9A 4G25A 1I6LA 3R7NA 2YIJA 1RAIA 1VIAA 2B8JA 3GRCA 3MBKA 4L4RA 2HCJB 1JFRA 1D6NA 2Y0EA 1PQUA 2I22A 4PBRA 2BFEB 4RIIA 4TYQA 3DLBA 3NPAA 3FX2A 2ZB2A 1AKMA 2BAGA 4JD5A 3L7IA 2BMAA 2C4NA 2UVDA 5L95A 3DW1X 1XD8A 5JPCA 1QBKC 1VB3A 4LHWA 5I7UA 1SVSA 1L5HB 3F8SA 5FL3A 1XNJA 1UZMA 2WWHA 3UXYA 4EF6A 5JDCC 3AVTA 4F2WA 2VNSA 1GPKA 5EL0A 4HP8A 3T7IA 2I34A 1RXVA 4BV2A 5E7JA 4PSAA 3UJ7A 4RCZA 5J47A 5CCXA 1VJDA 3O38A 3LZ6A 4L8JA 1MAWA 5JXWA 4NCNA 3L77A 4X1YA 2LBPA 3EQ6A 3EULA 3GPBA 2ONJA 1ZOSA 2ODEA 4YAWA 3CY6A 3N8IA 3USES 5ALVA 2GJ9A 3CP8A 2YY6A 3VAZA 1IXZA 1UBKS 5HQTA 4Q34A 4NAUA 4R9VA 2FF7A 5CBKA 2ZYGA 3FMGA 3KVOA 1P2DA 2B5VA 1LBEA 5TMEA 4Q12A 4DV1B 4O2RA 1JDVA 4BZQA 2VUIB 1SHUX 3L6CA 4OKIA 3ZVKA 5EKXA 1DBWA 3EWNA 3KL2A 4XW2A 5HG0A 3Q39A 4UNPA 1COWD 1MR3F 1PJAA 4DBZA 2FSGA 3EE6A 3I72A 5ELMA 4ONEA 5CTJA 3VZQA 4CM8A 3FMVA 3IUPA 2ONYA 3FCXA 5ERGB 4ZIRA 5DB4A 2Q0QA 5CDYA 1VLOA 4RA6A 5JBQA 2XMZA 3DKIA 3ICCA 4LIPD 3ZV6A 5KYKA 1XKQA 3EGEA 5AI8A 4I5GA 1C4KA 1P18A 4AWAA 1KFKB 1BTOA 4MYRA 3GT4A 2ZZMA 4IDFA 4OQQA 2H4ZA 1KZ4A 1M1XB 5DNCA 4FDMA 5KZMB 5KS2A 3TW0A 4M7OA 1TLFA 1AKNA 1OOEA 2PSFA 3NDRA 4RJKA 2ZM5A 1OBCA 1GSOA 3WGMA 4EUKA 2V6JA 4YJ3B 1U99A 3MJEA 4KMOA 4G8CA 3HXKA 3QHAA 1KP2A 4QHYA 1SD5A 4P2GA 2VSQA 2V9CA 4LSZA 2PTHA 1JAZA 3LRXA 5CVUA 2DQ4A 5KSPA 3K0CA 2G17A 5HTOA 1VQ8B 4YJHA 3AZOA 4MVJG 1OV4A 1KQNA 1NXWA 2B98A 3SY8A 5BN5A 3DAYA 2W43A 3BERA 5F9HA 4RDLA 2AT1A 3O8OA 2VF4X 1BQ3A 1OU0A 1JDSA 2B3TA 4MKHA 4F6RA 1T1IA 4X93A 5PNTA 1DI0A 3SDZA 3QYFA 1ZD8A 3P19A 2ZYTX 2BMEA 1CUFA 1SOVA 4RESA 4EY3A 3TDNA 2GA9A 2ZJFA 3I3OA 2GZMA 2BH2A 2CXNA 5TV2A 2OHIA 3CNOA 3NT4A 4IXNA 3TIXB 2G5TA 4DJ5X 3VM6A 2V6BA 4YFYA 4ENWA 5L7TA 1TJYA 3W5SA 4WWHA 4DLWA 1BQ4A 1CWUA 3L2OB 1QP8A 4P5EA 5E9QA 3FYTA 3I05A 1P4HA 1T1EA 5KTYA 4EYKA 4YLYA 1KO5A 3H5TA 4ND5A 3FMOB 3NNNA 4CKXA 1PFUA 4C05A 4LJAA 1V5FA 4Y67A 1TX4B 3FZEA 5D01A 4DC0A 3FPHA 3OJLA 2WLSA 4E5UA 4AY2A 2REBA 1ZL2A 5B6IA 3QZUA 1PAUA 2IZZA 4L4YA 4TL7A 2EJUA 1DINA 1DIHA 4HAYA 4PLCA 4DJDC 3QA9A 4R3WA 1ZUIA 2QUIA 4M60A 3MTQA 1LGYA 1Z07A 3FH0A 4CIDA 1H66A 2WHPA 3AI1A 1Z5OA 4NZZA 1GSAA 2OBSA 1GYRA 2AKYA 4HWSA 5JH7B 1X6VA 4ENRA 3RVOA 3FLAA 3U4CA 1DAGA 1M7HA 2P2GA 3U4IA 4DPLA 3H3JA 4DQLA 3FDZA 2JFGA 4S1TA 4Z4RA 2FQWA 4IVQA 2Q46A 3MZ0A 4O2BA 4R1UA 4XQ9A 2JAOA 4LYAA 3MJDA 1NHWA 1UDRA 5IXSA 5JXHA 1RWVA 1QANA 2DTEA 2IU3A 4MPDA 3FKQA 2MSDB 1OAOA 4D0RA 621PA 4U2GA 1RAFA 4X6LA 3BC9A 1GQRA 3F4KA 1FLDA 3TZLA 3WLLA 2X6YA 2Q6OA 2DULA 4PIPA 4OP1A 3LY8A 4BC0A 4B6RA 4GF5A 4RD4A 2PLFA 1SZDA 2IXEA 1Y82A 2PZAA 2EWVA 1MOZA 4XLEA 1M1UA 2G9VA 3GLHA 4NPHA 4YLGA 4JMQA 4C08A 2CFRA 2GVNA 1BS9A 3TK1A 3ZXXA 1L4LA 1GKUB 1IG0A 1HLFA 2F67A 2QIOA 3D6FA 4DEXA 3IPCA 4JCOA 1DAOA 4R2LA 2K4MA 5CH3A 3BAZA 3TECE 3DWEX 2A4KA 1W9HA 1ZHOA 2VHUA 2ZB3A 3ONNA 4G0QA 5K3FA 1B8UA 2IHUA 3CZRA 1QNFA 1PWXA 3BXOA 4J3FA 1ZYUA 1A2OA 1NOIA 1GTZA 1X7WB 2F62A 3L7MA 5JS2A 4Q7LA 4CBVA 1C9JA 4KRXA 4WDQA 4E70A 1J8MF 2QRZA 3N07A 5KW9A 2O7RA 1CUBA 3OC6A 3E1SA 4LZLA 4RPLA 1NJGA 4GMHA 5DYTA 1G9XA 3B85A 4RQUA 5EMKA 4QQNA 1AJEA 3CURA 2CK3D 4HX5A 3VR5H 1JHUA 4NESA 3TF5A 1LBQA 5FBQB 4PLZA 4OXIA 4TLLB 4TQAA 1TNDA 1E0JA 1E2HA 1QQ5A 1QVRA 4YPVA 1K75A 2HSDA 3SZLA 3RF7A 4HR7A 4GBED 2ESRA 3BFVA 5G0WA 2RGCA 2QF7A 5DT2A 3X1XA 2OP1A 4RV9A 3D8BA 4A6XA 1SVUA 3WA7A 3KHKA 2QLLA 2F1MA 5F4JA 1U8XX 1XVIA 4P7BA 3V2UA 1W75A 3ZCUA 4WZBA 4E13A 1A4UA 2E7ZA 1XLTC 7ADHA 5IJ0A 2DPMA 1QHHB 5BUSA 3P2KA 2C8JA 4HS4A 5C8DA 4LFAB 3NBKA 2O5RA 3EOBI 3UJNA 4UZFA 1DL5A 4BHTA 2MSLA 4TOIA 2R8YA 3JW8A 3PHLA 5EXPA 3TSAA 4G5XA 4BLQA 5BR8B 1Z2PX 1Z0AA 3DKPA 3RODA 2Z2YA 1Z7WA 3MJCA 3RSCA 4QYWA 3PG5A 4QDKA 3S2SA 2X85A 1LDGA 2AW5A 2Q29A 1BQEA 1EUCA 1KIAA 2QTAA 2VWPA 3KYDB 3PWKA 1L5FA 4FOLA 2BCGY 1SQ0A 3Q0TA 1LJUA 4YJKA 5IVDA 4BMSA 4CMKA 2VXYA 2YZNA 2Z95A 4EHAA 5CFMA 1U6IA 4DNRB 5KTSA 4PWZA 3C0KA 3CG0A 3DJYA 1NQOA 3QWIA 1AK9A 5TPWA 4F8JA 3T94A 5J2UF 3ZDFA 3DH0A 3WL5A 3I55B 2CLDX 2R65A 5BWNA 4KFCA 1WPCA 4XTCS 5BSMA 3GJYA 4R0NA 1EA7A 1PX0A 4WJZA 4DMHA 4ZTBA 5KINB 1L4KA 4IXDA 2E2WA 2ZRKA 1CR1A 2IHKA 2GK4A 5AM2A 1X9HA 1NF8A 1ISSA 2OG1A 2P35A 3DMDA 3STVA 3ADCA 2PWAA 4M8LA 4NC9A 2IP4A 4X00A 3FTFA 3KR1A 4Q7QA 2VAMA 2Q5FA 1GRQA 1IRXA 4XYBA 2GCGA 4OAPA 3IB6A 1U9JA 4CT4B 4HDAA 3KQKA 3GJ8A 1YRQA 1B0AA 2CJWA 4KWHA 5CNJA 1FU4A 1Y9EA 2DPHA 2KBFA 4FFPA 1OX6A 3A05A 3LQ1A 4D6XA 2D3NA 4KFRA 2WUVA 2H1LA 4Q02A 1RXIA 2ZYIA 1OR8A 4JMPA 2VA9A 4MP3A 4RVFA 5TJHA 3GDHA 3IUMA 5FFMA 4F97A 2X2OA 4HJXA 4YN3A 2OOSA 1U0TA 3BEOA 1KZ1A 4GM1A 2EL7A 1M74A 3PXAA 3RC7A 1T8UA 1E5QA 2FJPA 1NN3A 3GVCA 3H9QA 3IDFA 1YRHA 4RH3A 3S28A 4LF8B 3LDUA 4J7CA 4FT2A 4N7MA 3P9SA 3FKSA 1Y6QA 4Q7KA 5JECA 3DCIA 1H4TA 1JSCA 4PYKA 2V4DA 2R7AA 2AUNA 3BXXA 4TM8A 4NV3A 3GPCA 1RWQA 3A6KA 2PT5A 2YQ5A 3KV3O 3LCRA 3EUEA 3TGLA 4RKFA 3ONVA 3CLVA 3RSFA 4DCCA 2V9PA 2VJAA 3BGVA 3L8HA 4PSUA 5EVCA 3CV3A 3CCMB 3IPYA 4AZWA 3VBEA 3OM9A 3PT5A 1IIRA 4YJ2B 1L7EA 2ZT7A 3N5CA 4KODA 4PFQA 3DBLB 1CQJB 3GR6A 3AESA 1KZ9A 1PTJA 1JIIA 4KO4S 1QP7A 2MHCA 5CCDA 3RSOA 1XTBA 1ZHHA 3ANXA 5HSGA 4I8IA 3UH1A 4DSTA 2DWUA 5FNVF 1MH1A 1ZOLA 2ZAOA 4Z6KA 1Y33E 1W4RA 3T3PB 4TSFA 3AERA 1NRWA 1K6EA 1KO1A 1RWOA 2BM1A 4HLCA 4BZPA 1YF3A 3LP8A 1PR3A 1P6QA 3OPQA 4Z4YA 2HLDD 3ORRA 4CL8A 4U39A 2NG1A 3NIBA 2B9VA 1ARZA 2ENUA 1HMPA 4NTZA 3D6MA 3I5UA 5TPWB 4J2OA 2R6R1 4XX0B 4BS9A 2YXNA 1MJ5A 4DZTA 4R69A 1U5BB 3HCBA 5IYQA 3WISA 1ABEA 4IOLA 5L8VA 3NZEA 2D59A 1O57A 2JIPA 2F59A 1QV9A 2CHEA 2QAGA 3A3PA 4IUDS 3LM8A 4X1OA 2KHZA 4UBKA 3ONUA 1H1DA 2NM0A 2QSJA 4QYTA 4HDRA 1FTYA 4BP3A 3WA6A 1TZ2A 1XTIA 4ZGWA 3F71A 3GK3A 1HNZB 3UMCA 1Z7EA 4IIXA 4JS0A 5F5XA 3A6FA 4PO8A 4F45A 4JIGA 4QJIA 3E9CA 1UIMA 5LC1A 2FN7A 3O91A 3SSNA 3GH1A 3T9EA 4I14A 4ITRC 2P6NA 3D1JA 4CETA 1XMOB 3P9NA 1GQFA 2IYOA 3OURA 5AYVA 2FMTA 2JVJA 3E18A 3KSZO 3QUAA 5DK6A 4WEOA 3C3PA 3AB3A 5DLYA 10MHA 1GPWB 1L4MA 4GECA 3OCJA 2ZWOA 3ZW8A 3AXSA 3A3OA 4R81A 5EUCA 1RI2A 3QVWA 5I5EA 3N05A 3IHTA 4EL5A 1YK0A 5GONA 5CD9A 4OUDA 3K16A 3MMPA 4YRTA 4JVMA 4BUJA 1L6IA 4G4IA 1KU0A 2X0JA 2ZIXA 5TVKA 3W3AD 1O94A 1AD2A 4GZMA 3VV2A 5COQA 4Z4FA 3KWJA 2DZDA 2OV1A 4I6EA 2EKPA 1F2TA 1O7JA 1E1QA 4EH1A 3KVVA 4PIMA 1XCLA 3GRKA 1AZLA 3L4EA 3V8RA 5KCZA 4NOLA 3NC4A 3DM5A 1M1KD 5FOQA 3EX7C 3I09A 2VJQA 4N0PA 3D3JA 3NDPA 1YZNA 3EB9A 4C3UA 1VGRA 1XV5A 4TTPA 1NMQA 1Q83A 1R6VA 2WSIA 1JEYA 4O2LA 1BCRB 1VG9B 3MXTA 1Z0ZA 1K2WA 2EKLA 4MWEA 5ITZB 1QP0A 1W2GA 4QUBA 1SOAA 4TMTA 1XD2A 4KPGA 4X0CA 4LJKA 4P3PA 3A32A 4D74A 2K87A 2IUEA 4N3BA 5HHTA 3HB7A 2R6JA 3O90A 4J3NA 2CNWA 2P2ZA 4XLTA 1Z5WA 2H7CA 4AN1A 2RGUA 2YFYA 3L1KA 1RYHA 4HNAB 4OSEA 1UBMS 2IZ1A 5H82A 5BQOA 2IZOA 3WLFA 4BDTA 5L53A 3C1AA 1BIFA 1RYMA 1VBKA 4YCCA 2DKNA 2IZ6A 3RBVA 3OM1A 4DLYA 1A50B 2FFJA 2NXEA 3HE3A 3MCVA 3O4IA 4JT2A 1R0ZA 1KA9H 5COBA 2YRFA 4FB5A 2GJ8A 3WB2A 2XMBA 4N5MA 4ZOEA 1Q77A 4IW3B 3BD9A 4XR4A 4JODA 1XJQA 2Q1SA 1WB6A 1NV8A 4LYGA 2VAPA 2HJWA 2IPMA 3FFXA 1A2QA 4DA7A 1SUPA 3M5WA 4IVRA 5J35A 5I7RA 2P11A 2CDBA 3NOXA 4O4IF 3T61A 4MK4A 2D5BA 2VBFA 4QAJA 4UBLA 5EE1A 4UATA 2VPWA 2Q9UA 3E4CA 1PEKE 2QW0X 4WQMA 5ALWA 3L9XA 5EWLA 1THTA 2B34A 3UMBA 4RABA 1WAMA 2IH5A 4Y2GA 5ARBA 2BLNA 4MQBA 2FMKA 1TT7A 4CQMA 4BNXA 2PGAA 1CC1S 2X3FA 3D81A 2VDKB 2CEKA 4XM2A 4HQLA 2R86A 4OHBA 5HK8A 3RVMA 1MORA 1UJBA 4DTIA 1HFJA 2AQ8A 4P1ZA 4RV4A 4RELA 3GFRA 1OPRA 5TPZD 2C99A 3ZH9B 2O8BB 3LVQE 3N0RA 2ZXHA 4GPZA 2QRHA 3MAAC 4JI1B 1I1HA 1AXRA 4EARA 2HDNB 3EXIA 3NAMA 4MYUA 1J09A 2VBGA 4JQYA 1JR3D 3EAQA 5FLEX 4E4YA 1D09A 3OQBA 1UOPA 1HF3A 4O1MA 3I9MA 3RR2A 1WNFA 5FTNA 1J1IA 1R74A 3GLUA 1A95A 1L6RA 4LE0A 2D3TA 1IL0A 1IUPA 4OQLA 5TQ0A 2A5DA 2YOHA 3RSLA 4PHHA 3B6MA 2PR7A 5E6UB 1L8AA 3PFNA 3H99A 2BGTA 2R48A 2WTBA 4IO1A 1O95D 3HKBB 4KYIB 2CXUA 3PF9A 1Q1GA 5HBGA 2EWMA 5AM5A 1MMFB 5HTKA 4DA0A 5JARA 5MGBA 2D5CA 3A1CA 4ZO7A 2Z6QA 3BH7A 1LH0A 1DMRA 1XWFA 4P2BA 3O4FA 2ODNA 3KKMA 1XQXA 4LMAA 3E9DA 2WSLA 3N2EA 5CX4A 3U6BA 5LBIA 2XA9A 1V1MA 1JR4A 1EUYA 5IMSA 3CISA 4KX3A 5B3JA 1NE7A 1UXIA 3QU7A 4KQEA 3FWYA 3U3XA 1PL0A 1C14A 1XZEA 4IDHA 2Q2VA 2GM4A 4XKVA 1R1DA 1TA4A 2WM2A 1NVDA 3BRSA 3OTIA 4MB6A 4AUKA 5FX2A 3H4MA 4FS8A 2JBAA 4I08A 4BFYA 6GPBA 1D2HA 3UKDA 4X66B 1XPJA 4OI4A 3GLHE 4A03A 5DM2A 2OZLA 1RWKA 4Y0NA 5DGXA 2SICE 3HJCA 3ECCA 4XPZA 1RXWA 4RADA 2FEMA 4AYTA 4DHWA 4UOEA 1XMPA 2IL1A 1R0XA 5CH8A 1MVNA 2JRLA 3IERA 1U0GA 2HHCA 1W5SA 3CBGA 3F1LA 3ZQ4A 3J81A 4KXWA 2V4ZA 4JLJA 1K3UB 3HSKA 1AUPA 3E23A 3Q7IA 4ID3A 4TRRA 1CRPA 4W1RA 3IKMB 3DZJA 4LWZA 1WEKA 1CSEE 1Z33A 2EX4A 3ZV3A 4D57A 1C80A 1FB5A 2ZIGA 2VJCA 1GXSB 2GXSA 3CUUA 4DCGA 2XB6A 2IV2X 1X8XA 1Y80A 2VNHA 2BWJA 2OAP1 1F2UB 1QF7A 4PLPA 5SYAA 1MB2A 5DO9A 1JFFA 1H85A 2JLSA 4G0NA 2VWQA 3U4QB 2LRHA 2C94A 4P9SA 4PRLA 1I6WA 1PDOA 2WICA 2GZ2A 4PAQA 5B6JA 4RY2A 1KD1D 1X7XB 2CKDA 3A1SA 3NHFA 2PSJA 4K6OA 4DL9A 4OX9Y 3V80A 3NRJA 2AV6A 4G5SA 3CO0S 1FE8A 3OCXA 5HA5A 1KWKA 3L82B 1TVEA 2YDYA 5B3JC 3BGDA 5FWXB 5IM4A 4GPIB 4X7RA 4A3SA 2GO7A 3D8TA 3ITNA 4CDRA 4L6CA 1PJ8A 1U81A 2F55A 2GYWA 3AO0B 3KWMA 5D87A 5TRTA 1DCTA 5A4MS 4WKOA 4HDSA 2CCKA 2XOXA 5TNXA 1ZD2P 3S2YA 2ZSKA 3N2KA 3BJIC 4UM8B 1UJ6A 5F1PA 4TQGA 4FZ5A 2ZUDA 3PRJA 4I1YA 3A4TA 3V4VB 1WR8A 3K71B 1NSYA 3AFIA 3V33A 4MV9A 4ETMA 3TQTA 3UV7A 2WUFA 2FR1A 3Q88A 2XGSA 4R7TA 3S7ZA 3SEQA 3FRHA 4EY4A 2QNRA 3ANMA 3IT2A 1E7QA 3EISA 4BMVA 1RHUA 4A8JB 1Z5UA 4ABTA 4G5HA 3LDGA 5LVAA 3ZV5A 2AN9A 3SHFA 3U0VA 4Y6LA 3IYLW 4MHSA 2RK6A 4GSLA 4QEDA 2EBWA 2KQUA 3FUXA 1E79D 2GBFA 4L8FA 4UEQA 3DE4X 3V1LA 4K1XA 3PE6A 3ZYCA 4WESB 1SG9A 2ZJYA 3EPPA 3U7JA 2F8TA 1HDIA 3DT8A 3FYHA 3H19A 1ORRA 5KHLB 1G2QA 3RAJA 3IBCA 1CUDA 4CNBA 4EYEA 5HMMA 4RDIA 3TLXA 1ZIPA 3TSOA 1KK1A 1DX6A 2ZJ2A 2OFWA 1FFEA 1CNFA 2CFTA 4MP8A 2JFUA 2DSTA 2NUTB 3Q87B 1MXHA 1V71A 4EO4A 3IQEA 1HM5A 3U2QA 2D1TA 2VDRB 2AKEA 1V3UA 3AKDA 4HWGA 3WIVA 2WUEA 5EJGA 1E6LA 1W30A 2BKUA 1YFKA 5J5CA 3VAYA 3E9YA 2VCEA 3VPCA 4D3XA 1YHYA 3MTGA 1W88B 3NUQA 2GCOA 3OIGA 4GX0A 4O59O 2WHRA 4E7PA 3ZDRA 4RTKA 4G0WA 2EJVA 2WTEA 3CEJA 2JFWA 3MWYW 1O5TA 4Q93A 2IYTA 4XUGB 3BWVA 4AWXA 3CW9A 4PZ9A 3PX3A 3EIFA 4F06A 4MVXA 4M8NE 2P3OA 3QQPA 1SQGA 2V7WA 2JIOA 2VOJA 3R3JA 3UUWA 1XMIA 2N75A 4AM8A 5ALGA 4CKYA 4WZBE 4IWXA 3O3NB 5K05A 1UK8A 1YE8A 3OPYA 2E4AA 3QKWA 4BFUA 5DHRA 2YR0A 5KX5A 3DD1A 1XPUA 4EPVA 3EPRA 3KUCA 2XCTB 2HA3A 1DXHA 1K8XB 2B1RA 3RD5A 5GP1A 4QDJA 3AFNA 2JJYA 2QE6A 4B31A 3FD8A 5AI4A 5AQEA 4KQCA 4N5IX 4WERA 1T2UA 1EYZA 2IJGX 2IGBA 4MS1B 2F6RA 3N87A 4BKPA 5HPYB 1N7HA 5B2EA 5ITSA 5I7AA 1C1YA 2DQSA 5J2UA 1GCAA 3I6ZA 2UVQA 2IOHA 2FX5A 4TMVA 2GDJA 3FBWA 2SCUA 3MRTA 7REQB 3IO3A 1ZMXA 4ZU1X 1E4EB 3KB8A 2J5QA 3HDVA 3HKCB 1ATZA 3WO1A 1JNXX 3ORQA 3K7EA 4P86A 4BB5A 3PXDA 1Z22A 3VR2D 2BBOA 3E03A 1E92A 5AI5A 4AX4A 3G0IA 2BM8A 4V38A 3IUQA 1WV0A 3PQEA 2QP9X 1UFVA 3VR4H 1VBMA 1P4MA 1VPLA 4HZUB 2BW0A 3AF6A 5DM70 2BGLA 4PZEA 4A6PA 5AVVA 4NK5A 4B33A 2G76A 1XLVA 3NH6A 5K20A 4Z0HO 1JG7A 5JBIA 3V4ZA 4P7JA 1YV9A 3W8FA 4WZZA 2Y9PB 2IHBA 3IVAA 5BSGA 5TY0A 3EGXA 4OAOA 5D3MA 3QVVA 4EATA 3I23A 3PQ4A 4FHDA 2W6NA 3CZ9A 3NKLA 3QX9A 4QICA 3M5CA 2ENWA 4RQTA 1TIPA 3BHNA 1JFVA 1EFDN 1NTOA 3CF6R 3NTQA 4YQFA 2OO7A 2C0PA 1CCWA 3PXBA 2V7PA 4C0JA 3I37X 1SQ6A 4CM9D 1KS9A 4DNPA 4NULA 1WHTB 4FBLA 1YUMA 3PITA 1GSHA 1YDWA 3EF0A 2HSGA 1X19A 1PWYE 3MINA 2IY9A 1YCFA 5EP2A 4GG1A 3ZD8A 4NZNA 1HGXA 1LDBA 4H1VA 4LUCA 5K09A 2V7VA 4PC7A 1FXUA 1JPVA 4OQFA 3C5EA 3FUUA 4KDEA 4YFVA 5PGMA 4CTNA 1VCIA 4PABA 1XHLA 3KUKA 4G9BA 3W9UA 3JQAA 1XZMA 2X5JO 3Q38A 2WM9B 3Q7PA 3K0SA 2JK0A 4GIBA 2REQA 3HRKA 4BXOA 3S2EA 3GXOA 1SBIA 2P8JA 2Q5IA 4ZZ0A 1QGUA 3TM5A 4ZOLB 5E9WA 1JF8A 1XDUA 1ZK1A 1NQWA 3DL7A 3OZRA 1YT5A 1FTQA 4RD1A 2WW8A 2G8LA 2XB4A 3BMCA 4BNFA 3DFFA 3BD6A 4QLAA 1QYCA 3N7UA 4R05A 5JEEA 1T6BY 1PR1A 2EARA 3OQIA 5CT6A 3RAEC 4H27A 1NVFA 1PIWA 2VN8A 2YYSA 1IB6A 1G8SA 3LUHA 1R8SA 4D9JA 3FWHA 5J58A 3IE1A 2NPOA 3KT3A 3QXJA 4Q19A 2XD4A 4G97A 2CNBA 3NONA 2QT9A 4IUBS 4EGFA 2VL7A 4GX1A 4JJ8A 4D26A 2HF7A 4S2UA 4BJ6A 4XGIA 4E88A 2LIVA 5DU2A 2WD7A 3T5PA 1GL3A 1N5JA 1FVFA 2YCLA 5D7BA 5DGCA 3P27A 2WYOA 1KC8D 3LX6A 5JAQA 5TEWA 4E5YA 3VO8A 2ZRCA 4D81A 4WLUA 4WZEA 2R2AA 3DOHA 4X8OA 2WJ3A 4C43A 4NDNE 2J3KA 5JRJA 2NYRA 3WV5A 1U7DA 2VSOA 1O6BA 2A5YB 4HEHA 3COWA 5A3JA 3ESBA 1B43A 1TDJA 3O84A 1EHYA 1BGVA 4OOSA 1CZUA 5K3CA 1RM4A 3NW9A 4M9QA 5FH9A 1R3UA 4EUEA 4H77A 4B8WA 1JB1A 2VBCA 3WWOA 1Y81A 5C0OE 4B79A 2FPPA 1NMXA 1RQRA 2HEIA 2HJVA 3EVNA 1B0PA 4HAVA 4WSOA 4GLOA 5CB8A 1MW8X 3NHKA 1KJYA 2OMKA 3EIQA 3ELYA 1SZCA 2Q99A 4D9HA 5JCZA 3OBIA 4NY1A 4DXDA 2C20A 2EEPA 3P0IA 1U7OA 5IG2A 3GGCA 3A6DA 1KAHA 5EESA 2OV2A 4YJGB 1J39A 4Q4JA 4BX9A 3L1JA 5A1TA 3AJEA 1WA5A 4M53A 1RJEA 1WABA 3WRXC 4ENQA 1OCEA 1X1DA 1KRXA 3GQVA 1JH8A 2GEUA 3B6EA 3ZXIA 3IAEA 2ODAA 1ILEA 5G3YA 2ZW9A 1WU7A 3KAPA 3Q8KA 3ES9A 3GLFE 5KNCD 4B3BA 3RM3A 3KP1A 1Q0UA 4TTTS 3UGQA 4F3YA 2PMFA 1XP8A 2FI1A 3FZYA 2OCIA 5EYPB 4LC1A 3CR3C 3UPDA 4D80A 5H4HA 3G71B 4KR6A 3HYNA 1E79A 1O58A 1QHEA 2YJ3A 4BMDA 5J43A 3CXUA 3LHIA 3VVMA 4LEIA 1XAHA 3IUYA 1VYVA 4RO0A 4WUVA 3K94A 3A3BA 1NVGA 2QZJA 3QWAA 2BTQA 1OXTA 1E60A 4WW0A 4LYYA 1DC3A 3BMCB 4N0QA 1HDXA 1HZEA 3IMCA 5LZ2A 3TSWA 5P8WA 5HZKA 1TM3E 5JS7A 3QK7A 5JTTA 2XVYA 3CINA 1MX3A 4PGAA 3TIIA 1A4IA 1AZSC 1QIKA 3KX2A 1B6GA 1CEXA 4LDZA 1OA0A 4UD2A 3OBBA 4W9NA 4GS5A 1S2DA 2P2SA 2MMGA 5A02A 3T3NA 1A88A 1JX6A 2WE7A 3VFDA 1R27A 3ZPXA 4EUFA 4F7WA 2XZLA 4BY9E 3HCAA 2OC4A 3OIDA 2QVXX 5JSQA 1F6WA 1M8JA 1O4VA 2V6GA 3PFIA 4L5CA 4P33A 4Z4TA 2GK6A 4U6SA 3DV0A 3GJTA 1NY6A 2I6TA 4BKRA 2P65A 3IAM1 4AZ0B 1J00A 3DWIA 3OA0A 4G86A 4YH1A 1HI9A 3FPLA 5LFAA 1E59A 1CZLA 1OLUB 3I8OA 1E32A 2W6PA 3M6XA 2H08A 4MQLA 5HIMA 1IEXA 1AA9A 5K2OA 3LLUA 4S3MA 2A58A 3ZWAA 3O9VA 5JW6A 2Q1UA 3S1AB 3WLOA 1H93A 1YS7A 4I9NA 4G41A 1VM6A 2MSNA 1M7GA 1NUSA 4GVXA 4A7PA 2QGGA 3HZHA 1VLYA 2FPIB 3LPAA 2NACA 4XB6B 1BWRA 1F0KA 2ZSIA 1MDFA 2ZRFA 3QWHA 4POAA 4QOJA 5MGNA 1ZM4A 3C7DB 1OXMA 1Q7BA 1P0CA 2Y9MB 1LQTA 2QENA 2XYGA 3BJEA 3OQOA 5MN4A 2ACVA 1XNQB 5IUJC 1GG2A 3G0DA 1ZUWA 2EZ8A 1T9GR 2JGDA 1S4QA 1BPLA 2XV1A 3SC2A 2NU8B 1FU7A 4EJ2A 1W49A 3C1TA 1QX4A 1UDBA 1JEEA 2JBWA 3TE7A 1ZW1A 1DRJA 2DY1A 2AXPA 3EY4A 3I64A 1UPBA 3MTIA 3NTVA 1ZCZA 2IUTA 3NWBA 3PNBA 4OQMA 1YMQA 3S3TA 2QI9C 1FMCA 3OMLA 4MRRA 1PO7A 1SG0A 1GTMA 4J76A 1IUNA 1JL3A 3G2KA 4BEJA 3OVMA 4L08A 1QE0A 2P1RA 3H7IA 1D7OA 4HDQB 4OL9A 1UR5A 2RG1A 5EIOA 2ZJ4A 1I2CA 3A4YA 3QFRA 1G0OA 5AKHA 5T64A 1T43A 3V4RA 3Q1KA 3H1TA 1YUBA 4YELA 1NYTA 1YVUA 1G2OA 3NC0C 3OM0A 5HCIA 3SIRA 3UT6A 3N8NA 2JCBA 2J6HA 2ORIA 4RC9A 1M6EX 2VTKA 1WD5A 1NMSA 1Y8RA 4B2LA 1QHFA 3DM9B 3ACCA 3G9QA 4TZ0A 1W1WA 3RBXA 1FDOA 4H1TA 1VHQA 1WY7A 2IXAA 3ECSA 3ONFA 4F96A 5B12A 3JCZA 4BB0A 4NG5A 1Q7TA 4WMLA 4N0MA 1F1BA 1SUEA 2AQKA 1WO8A 3W5DA 3I42A 3NNDA 4F2HA 5BV7A 2Z58A 3L1UA 1Z4LA 1RJDA 1QZTA 4NJMB 1NM5C 3ZC3A 4Q3BA 1U0RA 3H2YA 2VYQA 2H06A 2REOA 4FGJA 1RVV1 5P21A 1BGWA 1N06A 3GF4A 1BE8A 3UW1A 3WMWA 1JFFB 1QOZA 4LXQA 4D92A 2XUQA 1VL2A 2B4QA 3MWJA 4FWTA 1N6HA 1PYDA 4ZXPA 8LDHA 2H3HA 3P9KA 4BEVA 1U3WA 1E77A 2J0QA 2E4VA 2OM2A 4I66A 3CMEB 2A5GA 5I8WA 2OZKA 4DLKA 5B6PA 2WB2A 1DAEA 2J9ZB 1P0MA 1F6DA 1U8EA 3L8EA 3RYCB 2CV2A 2V54A 3BH0A 5KOHA 4M7RA 1G98A 4R2XA 4ZRMA 1R6UA 3AIMA 4OQZA 4F3KA 3DZKA 1KPIA 5JC1A 2ZWIA 1XZBA 2CMGA 3ETLA 3ND5A 3OZUA 2IOQA 4HO1X 3IEIA 4OA8A 3SF0A 3HGQA 3NANA 2VHQA 4MMXB 4D45A 5LU8A 1CY7A 1GA4A 3GYGA 5G1PA 3N0XA 4BX8A 1NAHA 1SBTA 1LW6E 5DBHX 4EKNB 221PA 2FOIA 2XZOA 1FRQA 1UC4B 2LKDA 3GJRA 4WACA 3LF1A 2RKBA 3HL0A 4NDZA 1TYZA 4P53A 3NTLA 5J4YA 4TYNA 3L40A 5HZHA 3MWDB 2PS9A 3D4PA 3NHRA 2D0IA 1P4GA 1E3EA 4ZYLA 3OEWA 3HWRA 4WGGA 2F7SA 4L9RA 3CMAB 2ZRQA 3P71T 4AJ4A 4CCWA 4HGNA 4D6YA 1Q2UA 3UA3A 1Z2EA 4LHEA 4AZVA 4BC1A 3RTBA 3WYAA 4L3OA 3G49A 1XU7A 2WINI 2DH6A 2W58A 2X14A 4HBZA 4KQWA 1Z15A 1WXEA 4YT2A 2AYZA 3K9QO 3IE0A 1U2PA 2PN1A 4PAGA 2CRVA 3AQ4A 3UB3A 1JEOA 1ECFA 2C9ZA 2AB0A 4DSNA 1PJLA 3F96A 1XRNA 3DDCA 5EWJA 2NVWA 3COJA 2Y0DA 1QZ3A 5A9SB 5I7FA 2O2JA 4OB7A 1N2CB 1C9KA 1U6KA 1N3BA 3D2AA 1P8AA 1WSAA 3DO6A 3SHQA 3HU3A 3GLFA 3ETHA 1Z68A 3EG5A 1GZ4A 2GVZC 1KH1A 4NU0A 3ZDAA 1C7QA 1FP1D 3FDFA 3V1NA 4ENTA 1F2UA 1XT6A 1KEVA 2ZG6A 3CZ5A 3LQKA 5A5FA 1EFAA 4V1CI 5HF6A 1H3NA 3EDOA 3HGMA 2G9ZA 2Y1DA 1W6RA 1T5HX 5KNCA 1Y8AA 2ORVA 3MXOA 5AVWA 4N54A 3NFRA 1ZNYA 1ZOIA 3UZUA 5EIBD 4WOJA 3QU2A 4I4TB 2YS6A 3HLTA 1GNVA 3N0TA 4MZDA 1BSVA 3H9CA 5G0UA 2H1HA 2CVZA 4X9XA 3KEWA 5BW5A 4I0WB 3QX3A 2FHSA 4B3JA 4KQIA 5L3QA 3I5YA 4HE5A 2V3CC 4UNIA 5DBFA 1KBOA 2V45A 2EZ4A 2JIDA 2XRFA 1UFQA 4B2PA 1H6BA 3SR4A 2IU6A 5IABA 1YL7A 2GN1A 3A1PA 1DUVG 5ALEA 4PC2A 2VEOA 1U8YA 1XCOA 2ZSUA 3K05A 1WF6A 2YZMA 3G1WA 1RQ7A 2W22A 5FB3A 3ASVA 5WRFA 4MW4A 2O5EA 2D9RA 3EDCA 4F4UA 2Z98A 3NETA 3O7MA 4V0ME 2EYQA 1EZ4A 1L7BA 1OMOA 2VDUE 4C0QC 1E63A 3NH9A 5CVJA 2JL1A 3MMNA 4PYNA 1WX1A 5EXXA 4PR0A 4H35A 3PA6A 4LNUA 2IT1A 4QTZA 2GESA 2I54A 5B57C 1CP2A 5JXIA 2AOTB 3TZCA 1V45E 4EYGA 1IY9A 2O5VA 4RKQA 1OXUA 5INTA 2BEKA 1U1EA 1KI7A 3OTOB 3UGJA 1JLLB 4IJ5A 4M76B 4O5AA 4UFNA 4CMIB 3BFJA 5BV8A 1EQAA 1PR0A 4QIHA 1LC0A 1ZUNA 3TJRA 5K8CA 4G5RA 1OZGA 3QG5A 2BFMA 3JAWA 3PPXA 4C2BA 2C97A 5DNUA 5JAZA 2ZJ3A 1IOLA 2ISQA 3E8MA 1ZQ9A 5HCNA 1KAOA 1YJ9B 4H2DA 4IZOA 1M83A 5E1BA 4DLZA 3TLZA 5LJIA 3AUTA 1XZCA 3UG6A 3K4HA 3BMQB 2I6SA 3T1VA 5F98A 1FX1A 2I78A 3PKJA 2A7QA 3KZXA 3PUJA 1FSGA 3KB6A 5CK5A 3ELDA 3KXIA 3FCCA 2XA1A 3TVDA 4NCAA 1Z47A 4FFOA 3GFFA 3WGYA 2RH9B 1G60A 2BEVA 2GTIA 3HS3A 4M38A 5LZ7A 4ZDIA 4YCBA 1SD1A 4J0QA 1RLTA 1T8RA 2W5UA 3KPUA 1RR6A 5BN4B 2AC4A 1M6VA 3K09A 4UUPA 3ST7A 3DA8A 3JWIA 4D56A 1G8MA 1ZCBA 1VKNA 1GTG1 2EGHA 1H5UA 1KJ9A 2ECQA 1H65A 1MGPA 2QV7A 3SEAA 5D2CA 3RVDA 1KQGA 3REGA 2IYSA 3QNWA 1T4MA 2XE8A 4JJ4A 1XRRA 3L6EA 1J0EA 3L0PA 4HVAA 4UHJA 1VSVA 2JD1A 5E9AA 3WRYC 3MTAA 1ZMOA 1NUPA 2IEGA 3GBVA 3HA7A 2OFPA 5IK2D 1Q7GA 3K9HA 2P41A 2VTVA 5FP0A 2BHRA 2WJ6A 4ZMSA 1E9AA 3TTXA 1FUUA 3CCQB 3AG5A 5A6VA 4KQFA 2IBTA 1YC5A 3ED1A 5DRYA 2XTAA 3ZLBA 3WRWA 3HCDA 1FTWA 1E7SA 2BFOA 3CNQS 1QR2A 2VJPA 2FYTA 3W3AH 1PTJC 4LQDA 2WPNA 4Y1RB 1HYBA 2PY6A 2W2PA 2H2FA 1TQ2A 1EBFA 2OD2A 3R5KA 5U9CA 1KDRA 5DWQA 2QLBA 3Q2KA 2V31A 3LQ2A 3W5VA 3OM8A 2R7NA 3WB0A 4OH1A 5BSWA 4NCHA 1RPAA 4H7HA 3QRWA 2JI8A 5FI5A 4X06A 1XZAA 3MJFA 4WFQA 3KC2A 2FPXA 3CLRD 4UU0A 3MA0A 4OVKA 5TQJA 2FPLA 1VZ3A 3STHA 1KEZA 1OBFO 2ZSBA 3L1VA 2JKYA 3UM9A 1ONPA 1D3AA 1DTWA 2ZIEA 2OHHA 2PT9A 4MZXA 2G67A 4P32A 5H02A 2ZK7A 1UXHA 4LJLA 3TQFA 2PJRA 5F9FA 1RRKA 3K09C 2Q2QA 3QKUA 4MW5A 2I4NA 3LOPA 3EWAA 4WOCA 5TS2A 3VC7A 1ADYA 3WOHA 4KXNA 4RPDA 1X1TA 1OFUX 1A9YA 4IJ6A 4LXUA 2WMNB 3A25A 4NEQA 3PQ5A 1ELOA 4H9GA 1V11B 1XLTA 2Q8QA 5ANRB 2RH5A 3TMKA 1EAYA 2Z6VA 4ZVOA 4YNBA 1DEXA 3ZXSA 2AF3C 2RB4A 3C3DA 4JBHA 121PA 3I9NA 2B4KA 2WAOA 2QP3A 3G23A 5BQXA 3DT9A 2Z2KA 3RV4A 3I32A 2EBFX 3TKAA 2E5LB 4MLDA 1P2BA 3A3GA 2DR3A 2AEJA 3HLKA 3N53A 3HA5A 2WFZA 4NFSA 2UXDB 2ZBPA 5E2IA 4IVNA 3TSYA 4JA0A 2PPVA 1RYYA 2D1FA 3KLOA 1QVAA 3IOBA 1TMGE 4PXSA 3RVQA 2ZTGA 1YSCA 2XXJA 4WCFB 4QJ5A 2QR3A 3VR6A 3UATA 4YP6A 1NYLA 3VHXB 2XD9A 4H7KA 2GRUA 4C76A 1ZHFA 5D00A 3OPYI 1XN4A 4ZI7B 4EJMA 3PQ8A 3C4VA 2XDQA 3JARA 4ZC1A 4YQYA 5DV9A 4R68A 4Z8XA 3ZHQA 2QA4B 1DT5A 1Y4ZA 4UBIA 1VPWA 3CH6A 4Q3KA 4R8KA 3OW7A 2WJZB 4ZQCB 1YE3A 2C83A 4FSXA 2IVFA 3LBYA 1M8FA 5AOBA 3W9SA 4K6HA 5CIYA 1JPNA 4W82A 1TA0A 3PFBA 3HUDA 1MC4A 1GU7A 1QC5A 2P7HA 3EGDB 3KAQA 1JHRA 3WK5A 1V39A 4G37A 4XNFA 3DDSA 3DZFA 1CHDA 3KK0A 1R88A 3GFPA 3NWEA 1QWOA 2GSWA 2QKYA 2EWWA 4GZ3A 1EFCA 1FYVA 1XCJA 4MITA 5A5DA 2XE7A 5BRJA 1P7YA 1JILA 4ALMA 1IYZA 2Q4OA 1KZ6A 1NT4A 2AKAB 4BUCA 1RCUA 3D4BA 2QSUA 4FIDA 2AOTA 2GAAA 1HFWA 3SFVA 1PJ7A 1CE8B 1K7FB 4S35A 1Z2AA 3G9TA 4HPWA 1Y37A 3S55A 1N33B 1NVTA 2I62A 3DULA 2HNBA 1V8PA 3M2TA 4ATNA 1MOSA 3EGWA 3PA1A 1P1IA 2H2IA 2NWQA 5KAPA 1S2LA 1CUSA 3WIBA 1NI4B 1XDGA 3GPDG 2JLCA 3BILA 1THGA 4HD8A 3SBOA 1FQJA 4D42A 2VSNA 1KQSB 3DDWA 5LUAA 5CX1B 4C4RA 1WZIA 1I7PA 1ZK0A 2VT7A 2AXQA 2GBIA 5HDBB 3O75A 3QXXA 4MB2A 1QRDA 4AJ1A 2GZ3A 4RHEA 4P4GA 2B6HA 4UTXA 4UBOA 4ND8A 3GUCA 4HTAA 3KEOA 1EP2B 2SKEA 3P94A 1DBPA 3IRUA 4N7BA 3N2NA 4Q1DA 4Y6PA 1C1XB 1TVMA 2XF2A 1COZA 5H4GA 2IHNA 1KP3A 1VLZA 2B20A 3EOZA 4A26A 3BWEA 4MULA 3HKEA 3CPWB 3NWJA 3HUEA 3Q6IA 4PPNA 5GZ3A 2JHFA 2AX4A 2ZRIA 4OQEA 1LPAB 4IDNA 4PHFA 3F6EX 4C14A 1XI2A 2FZGA 4YRSA 5B3AA 1XQ9A 4P12A 4OREX 3LYAA 4R2KA 4DR5B 1L5MA 1KTIA 1WOPA 2NPIA 5CD1A 5DX1A 4XWAA 4GI3A 2OXFA 3B70A 4EG0A 1ST2A 2A57A 2HY7A 2NO1A 3EZNA 5AVOA 3RC1A 5IYRA 1NUAA 3U4GA 3PVZA 3ND7A 3P9PA 3QVGA 3GD5A 2FVXA 1U31A 4LGVA 4JFRA 1E9CA 2FQQA 5FHRA 1PVOA 1PSZA 3AUUA 4HDNB 2HMYB 4HNRA 5F64A 1D2EA 4FMDB 3K0HA 4P82A 1Z39A 3NTUA 4QPCA 3VKWA 4QA9A 1SKBA 4RLFA 5DPMA 2FUKA 4LKRA 4MUGA 1E2GA 4JBXA 1ZSVA 3ETDA 4JIMA 4M46A 4MDFA 1WKVA 2FN3A 4S1NA 3C3WA 2ZU6A 1X39A 5CA1A 3BG5A 1PHRA 1NW5A 521PA 1JKJA 3ME5A 2C8VA 2QRLA 3OCWA 4GPAA 3F7MA 3TQHA 1YMVA 1QQBA 1BU5A 1JHAA 1P3DA 1FP7A 1SZPA 4MRVA 1QP4A 4BNHA 4C7OA 4WCVA 1IVYA 2QTCA 3BA6A 4YACA 2GERA 4KQHA 4HDMA 5EUMA 4KUHA 5GJCA 1TTQB 4JMLA 1TU4A 4HGPA 5IAOA 4CTJA 3O2JA 2AJBA 4Q6WA 2PO7A 4J91A 4B9AA 2Q5CA 2HA5A 5LKAA 1EFRA 1YZKA 4K9OA 5AICA 4UTVA 3GRVA 3TEFA 1HNNA 3PD1A 3RW9A 2F4VB 2CNDA 4UJ3A 4YDHB 4M1OA 1ZD3A 2AZDA 1CF9A 1T9DA 1OREA 2MTBA 3VC2A 1QIMA 4DILA 1GRNA 3SJUA 1I0IA 1TIKA 1KRHA 4D99A 2BF4A 1P9OA 1ZP6A 3K92A 1PJ5A 4K8OA 5JVDB 1NLYA 3AY6A 5MN5A 2J59A 1VCNA 4TSRA 3KPWA 3CE6A 2Y77A 3INYA 1JSRA 3DPSA 3LQFA 1NX9A 2E6KA 1TMKA 2G1AA 3NHJA 3OTHA 4GP6A 4AJHA 1KDZA 3P1JA 4AJ9A 2JGDB 3R7BA 2DPLA 3CTMA 4YQZA 9LDTA 4RYLA 4UUMA 1ZWLA 3TI9A 4XQEA 3IGFA 1KK3A 4PPYA 1Y1KE 3D5TA 1RKUA 3NRBA 2V03A 3OUUA 2YV4A 4KFSA 5CM8B 2RHWA 1GAQA 3WYEA 3PUZA 1P7VA 1N6LA 2FG6C 1FMFA 2V3VA 2WU3A 2D4AA 3OX1A 2B7CA 3C97A 3JQ9C 4ED9A 1DLJA 4DR3B 3EEIA 1E7MA 3L1IA 3MIZA 1EXWA 3N0VA 4GLLA 4FD2A 5SZHB 3ZGVA 4P80A 4LVNA 2B61A 5ALKA 1U2GC 2GETA 3O92A 4IDOA 1COWA 1ETHA 1H2FA 3LSTA 2B8WA 3SD7A 3T1OA 3EUFA 4FI3C 4A2CA 5CLIA 3DLIA 2CXRA 4Y3UA 3TKYA 1BFKA 5EPOA 5ENVA 3TR6A 3IIMA 3EA5A 3OTWA 2ZVDA 4JFAA 4D9IA 1WEHA 2QQFA 2HIAA 3JATA 5JXJA 5A0FA 1DHTA 1MU0A 3VR5A 1JHZA 1Y8RB 4OQYA 2IEZA 3DL0A 5ENDA 2QTTA 3HR8A 1LBHA 2C5FA 5FBWB 1K5DA 2RHBA 1FFSA 2ZUCA 4FYJA 4TTJA 4JI5B 2HT6A 5K3AA 2AR7A 5CA1B 1PGOA 4UNRA 2ZROA 5G0TA 4C5CA 2Z2IA 3OOYA 1P75A 1UIRA 3H2KA 4TMFA 4DVGA 5BMVF 3S8YA 4K3VA 3NORA 2I3AA 3ZLJA 3ZJVA 1SK8A 4XIIA 4JU9A 2OLKA 4X7DA 1T13A 3IAS1 1W87A 1GPH1 1CY4A 1M8KA 2NUAA 1G2PA 3WL4A 1E1RD 4QT4A 4BFLA 2RAUA 3KKZA 1NXVA 2I2WA 3IUBA 1JQAA 5C8VA 3W5BA 1OQAA 4K3UA 4NYJQ 2OSVA 1J49A 3GH3A 4OJMX 5FAKA 2AK2A 2CMHA 2BRUA 4P6VF 2CNWD 1QFSA 3F4LA 5GZ1A 4K9SA 2E55A 2G72A 5JIBA 4J0FA 2W90A 3LP6A 5GOZA 4RIGA 5EJMA 2BP7A 2W37A 1U0HC 4PHTA 3DMTA 1NUQA 1PDVA 5FI3A 3DP9A 3ESDA 1L7OA 2LIPA 3ENVA 3LLCA 3R3UA 5CTAA 4DF3A 3K6SB 4FXPA 5ESRA 2CMKA 4AAYA 2XQVA 1M1NA 4DR7B 2NZJA 1NB0A 2P5YA 1D2NA 4MKZA 2DBYA 4KIWA 1F8GA 5AOAA 4XX1A 2WSMA 4NCXA 5JZBA 2BEJA 2VQSA 3JRNA 1UM9A 3NHUA 4YRKA 4UM9D 4JOCA 3JD1A 1VQLB 4KKTA 5BWCA 1JAIA 1T0UA 3K6RA 3PFGA 1PD0A 4HAWA 5T67A 2ZYSA 5JQGB 3FCEA 3SF8B 4L28A 4WDRA 4I4IA 1A97A 1GLNA 1NBAA 2FSPA 2R6CA 3GJZA 4HDMB 4ETIA 1ML4A 4GWGA 2GAOA 1BDHA 4MRNA 3UJ9A 4IKEA 4PCVA 3ZCPA 4ALNA 5T7BA 1XDDA 1S5PA 5B53A 1C4OA 1NJ2A 4D7AA 2ODPA 3W7VA 2RC6A 1XZHA 2IEAA 5JISA 3A9CA 4XAQA 1C1DA 1W36B 4RUKA 5J4LA 1OGYA 1KJNA 1NVWQ 4TWAA 1N2EA 1Z0IA 3WSTA 5A2GA 3M1AA 3TJMA 1MOPA 1JG3A 2ATEA 2YJNA 3SBEA 4YMLA 1S3SA 2X6TA 2ISSD 4B4KA 4D8WA 2HF8A 1GUZA 3PD7A 4RD2A 3G68A 4BMXA 3TCNA 2NZUG 4HLQB 4ILEA 1UK7A 2J7KA 4H1HA 3FHTA 3D4LA 1KYXA 5KNDD 4RM0A 5BUCA 2PRIA 4DR4B 2GARA 4QGHA 1MAHA 3II6X 3FSRA 2X6WA 1NLMA 2QRQA 4UEJA 3K1AB 3OC0A 3W77A 1ZKDA 2Y76A 4I1IA 3PIIA 3VYVA 4AP9A 1MRNA 4F38A 4QYIA 4ZI7A 5AVUA 2R8XA 4A1FA 4DMCA 3RVPA 5DTMA 2DWOA 3QJGA 4MV1A 1U7XA 1CRZA 1SXPA 4IGFA 4OQPA 1G5RA 4D4GA 1CF4A 2H63A 3LXRA 3MELA 3P0HA 4HYQA 1M2JA 4OMFG 4EB6A 4PG8A 4UQLA 1DG9A 1CEEA 1K8AD 1JLMA 1PZNA 1VG1A 1OTHA 2ZIWB 2IY8A 3T95A 3SZRA 1F2DA 3AI3A 4F71A 2EBHX 2H17A 3OF5A 1QU2A 1N2CE 4FGKA 4W99A 4X7EA 3LVRE 5K3OA 1ZRHA 3A7EA 1VQMB 3AHFA 2IWRA 3OQPA 2R9VA 4CG3A 4XIGS 2XKBA 4M87A 4NZYA 3V34A 3OZGA 1HLPA 1Q0SA 2QT0A 1ACLA 3FNGA 4N6NA 2ONKA 3TNJA 4ZO9A 2A8YA