4YHHE

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
157
structure length
157
Chain Sequence
b'DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4yhhE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4yhhE02
4YHHI 1N34E 1T4OA 4NXMI 1BKNA 5GMDA 2UXCE 4YHHE 4B3SI 4DV0E 2GS8A 1XNQI 4Z7CA 1H73A 4I3HA 3B78A 4LFBE 3QT7A 3J80Q 1IBKE 2DEJA 4OOGC 4FWHA 1MG7A 1FWLA 5IT9C 2BV3A 4DV4I 1K47A 4LF9E 2LUQA 3M6AA 1S4EA 1Z0BA 1YZ9A 3ZKDA 4DR6E 1X47A 1Z0VA 2Q2EB 2YT4A 4DUZI 2A2CA 1XNRI 4LF7I 1RQ0A 3D4JA 4JI1I 1HR0I 4X8WA 1YYOA 2DMYA 2HHHI 4OX9I 4WYQB 1FI4A 4EMDA 4PRVA 4DR5I 4UTGA 1WHQA 1YYWA 4XTJA 3F0NA 3T1YI 4DV3E 4USKA 1YYKA 2OI2A 2ZITA 1MX0A 2R3VA 2V2VA 3T1HI 3PYGA 2HK2A 1N0VC 1Z5AA 2V8PA 4DR7E 1J26A 1J5EI 4LFAE 1FKAE 4DU7A 5A2QQ 4K0KI 1HNWE 1Z0WA 3QT6A 2L3CA 4YY3I 2UUCE 3V2UC 2LUPB 1N0UA 4JI6E 1NZ0A 2HKJA 4DR3I 4DUYI 4YY3E 4DV1I 3WU5A 4URLA 3VYYA 2LJHA 1DI2A 2L2NA 4JI2E 4JI3I 1I94E 4DR4E 4X65E 3ADIA 4MYTA 2ZBKB 4B3RE 4WFTA 2RSMA 3WU6A 2NPFA 4DV6I 2JVAA 1NHHA 2HK3A 1IBMI 4DU8A 4B3ME 4FWGA 1XHKA 5IWAE 1N36I 2BM0A 3QT8A 3ZZ0A 3ZZUA 5LMNI 5BR8E 2B3TB 1H7UA 3LLHA 1FJGE 5CFFE 1FNMA 3H4LA 1N34I 3HULA 4WUBA 2B7VA 4WUDA 2UXCI 2AJ4A 1UEKA 4NXNE 2UUBE 4DV0I 2IHR1 3LNUA 4DXLA 4FW9A 4LFBI 4LF8E 3LPSA 1IBKI 1VISA 4HACA 4KHPI 5LMUE 4DV7E 2WW4A 4DR1E 4KHPE 1T4NA 4AQYE 1RREA 2LTSA 4LF9I 1H72C 2HFSA 4M2ZA 2L33A 1HNZE 2LJPA 3J7AG 3PYDA 4DPUA 4DR6I 4LF4E 3QT5A 4PRXA 4WUCA 3C4BA 1QU6A 5L3JA 4PU9A 3WU4A 1UILA 1A6FA 4JI5I 3PYFA 4JG4A 3B82A 3J81Q 1B62A 2RTXA 4JI5E 3JAMQ 2VQEE 2LRSA 2UXDE 4DV3I 1B63A 2HFUA 2X36A 4DR7I 4DPWA 1IBLI 4LFAI 1HNWI 1T4LB 2UUCI 1IBLE 2NUGA 1U2RA 4JI6I 2UU9E 2V2QA 4B3TE 2V2ZA 5FLXC 1N32E 4FN5A 1XMQE 4JI2I 1GQEA 4DPXA 3ADGA 4JI0E 1I94I 4DR4I 4JV5E 4X65I 1N33E 1X49A 4B3RI 2F4VE 1KTVA 3OTOE 2XEXA 1X48A 4X62I 4LFCE 4X66I 4LF6E 1EKZA 4LF5I 4X62E 4B3MI 4X66E 2UUAE 4HY1A 1ZXNA 5IWAI 3C4TA 4LF5E 3GONA 5BR8I 5A2QC 2V34A 1PIEA 1FJGI 2ZM6I 4KQVA 1OJ4A 2ZM6E 3B8HA 3VYXA 1ZXMA 3WU3A 4NXNI 2UUBI 4MYUA 3CWVA 3ADJA 1PVGA 5LL6R 4LF8I 4JI8E 4JI4E 4DPYA 5LMUI 4DV7I 2E5LE 4JI7E 5IT9Q 1Z0CA 4UT4A 4DR1I 4DV2E 2UXBE 4AQYI 2KHXA 1EA6A 2RS6A 2VQFE 3HTXA 1Z5BA 1Z0EA 1UHZA 1HNZI 4DR2E 4ED4A 4GKKI 1ZM3A 2MDRA 2DB2A 1MU5A 4LF4I 2N3GA 4HYMA 3ADLA 4NXME 4GKKE 4DPTA 2LBSB 4FWDA 4B3SE 1KKHA 2EZ6A 2NA2A 1XNQE 1EI1A 2HKEA 4M1KA 1Z5CA 4HXZA 3J7Yp 2B7TA 2VQEI 2NUFA 3V5RA 1XMOI 1H7SA 2J7KA 4HACB 3J80C 2UXDI 4DV4E 2L2KB 1XMOE 4X64I 2JY9A 4X64E 1KIJA 4DUZE 5FLXQ 1XNRE 1ZM9A 4LF7E 2N3HA 4JI1E 1O0WA 1HR0E 1WHNA 1QZRA 2UU9I 3Q1QA 4B3TI 2CZ9A 4RPFA 1N32I 1NHIA 1STUA 4Z7YA 1XMQI 3ZKBA 2HHHE 4OX9E 3J81C 4JI0I 2VF3A 4JV5I 1DARA 1PKPA 4DR5E 1N33I 3JAMC 1Z0GA 2RS7A 2F4VI 2R42A 3OTOI 4LFCI 3T1YE 4LF6I 3ZZTA 3T1HE 4GKJI 1Z59A 1RR9A 1NHJA 1ZM2A 2UUAI 2X7IA 2DIXA 1J5EE 2EFGA 4GKJE 4K0KE 4R1FA 1ZBTA 4DKKA 5GMEA 4DR3E 4DUYE 3K17A 4DV1E 2CPNA 2DEIA 3PYEA 4P52A 4JYAI 1WUUA 4P7AA 2A2DA 1ZM4A 2L2MA 1HNXI 1D6TA 4USMA 4M30A 4JYAE 4JI3E 3LTOA 2E1RA 1HNXE 3J7AM 1ELOA 1Z0TA 3ZM7A 3P1XA 1H74A 1FWKA 4JI8I 4JI4I 1S16A 2L3JA 4DV6E 2E5LI 4JI7I 1RC7A 1IBME 4DV2I 2UXBI 3K1JA 1KVKA 1N36E 2NUEA 5LMNE 2VQFI 4ZVIA 4DV5I 4DR2I 2BM1A 2LTRA 4DV5E
chains in the Genus database with same CATH superfamily
1TF6A 2EL5A 4O43A 1T4OA 1N34E 4YHHI 4NXMI 1BKNA 5AASA 5GMDA 2UXCE 4YHHE 4IS1C 4ISAA 4R2CA 4MU4A 4B3SI 4DV0E 5IV8B 2GS8A 4TUIA 1XNQI 3HPZA 4BC7A 1UDOA 4Z7CA 1H73A 2PNZA 1UDSA 2J65A 2EOJA 2EM2A 1YSAC 3B78A 4I3HA 2C38A 5JEAA 4LFBE 3QT7A 3KZYA 3J80Q 2EOZA 2EMAA 2RSIA 2ADRA 2LCEA 3JU0A 1IBKE 1YUIA 2DEJA 4FW3A 3RMPA 4OOGC 3U1KA 2PO0B 3IWDA 1T38A 2F1DA 4FWHA 1MG7A 2EMBA 4NBQA 1FWLA 5IT9C 2HC5A 2BV3A 2LO3A 4DV4I 1K47A 4Q35B 3C6KA 4LF9E 2LUQA 4MLVA 2WP8A 3PS3A 1SR9A 3M6AA 1EH6A 1S4EA 1Z0BA 2Z5CA 1YZ9A 4IFDD 3K6QA 1IQOA 3ZKDA 2LVHA 2GLIA 4DR6E 1X47A 2MC5A 5EL9A 2EWLA 4BBYA 2O1TA 1Z0VA 2Q2EB 2D9HA 2YT4A 4DUZI 4DR3I 3C6MA 1RMDA 1Z1BA 2A2CA 1XNRI 2WBTA 4IFDF 2YZTA 4LF7I 1RQ0A 3D4JA 4IFDA 4WPYA 2LT7A 4JI1I 2M4IA 1HR0I 2YRKA 3BBGA 2HGHA 4U3DA 2B9DA 2EOMA 4X8WA 4IZJD 2EE8A 1YYOA 3M85D 2DMYA 2PO1A 4MU3A 4FW4A 2EM7A 4O24A 2HHHI 4OX9I 4WYQB 1FI4A 2EOHA 4EMDA 4PRVA 4DR5I 2VF1A 4UTGA 1WHQA 1UDNA 2I9IA 1YYWA 2BA0G 3THNA 2GO3A 2VRDA 3JTZA 4XTJA 1UBDC 3F0NA 3M7NG 2M1SA 4OKGA 5K36A 3T1YI 4DV3E 4USKA 1YYKA 2JEAB 2OI2A 1MX0A 2V2VA 2R3VA 2EL6A 5DNYA 2ZITA 2EPPA 3T1HI 4HTGA 3PYGA 2YU8A 2ODRC 1N0VC 1Z5AA 2HK2A 2V8PA 1T39A 4DR7E 1J26A 2CG9A 2VE7C 1J5EI 4LFAE 2YRHA 3P3CA 3M99B 1FKAE 4DU7A 5A2QQ 4K0KI 1HNWE 2ELYA 2JEBA 1Z0WA 3QT6A 2EM9A 2L3CA 5FWKA 2UUCE 4YY3I 2EN2A 3V2UC 3EPJA 2LUPB 1N0UA 5C0XA 4JI6E 1NZ0A 2A25A 2HKJA 2O1UA 1A1JA 1PJQA 4YY3E 2M7QA 2BR2A 5DNXA 4DUYI 2M9AA 3IWCA 4DV1I 2L92A 3WU5A 2YWQA 1A1KA 2Z5EA 2GHFA 4URLA 3VYYA 2AE8A 1DQ3A 2LJHA 5KL6A 1DI2A 2L2NA 1Y4UA 2MC6A 5KL5A 2EOEA 4JI2E 2MKNA 4AIDA 4JI3I 1I94E 1HK7A 1BB8A 4DR4E 4X65E 3ADIA 2PO2B 4IZJB 2EMXA 4NHRA 2YTOA 4BMJA 2BA0D 4MYTA 5JEAC 2ZBKB 1R6LA 4B3RE 5JEAE 3M7ND 4IS9A 1YPNA 3BGHA 4WFTA 2RSMA 2JT2A 4BHBA 1A1HA 2WNRA 3NZKA 3WU6A 2WBSA 2NPFA 1GZ6A 1Y6ZA 4DV6I 2ENHA 2BA1G 1JK1A 2EMIA 2JVAA 1NHHA 2EPXA 2HK3A 1IBMI 4WSGA 4DU8A 5KL7A 4B3ME 4WX9A 4FWGA 1XHKA 5IWAE 2C39A 2BM0A 1N36I 3QT8A 2V8QB 1A1LA 3ZZ0A 1G2FC 3ZZUA 2YTIA 4KZSA 5LMNI 4OO1E 3EPHA 5BR8E 4MU0A 1N3GA 2B3TB 1H7UA 2DLKA 3AV0A 4M0VA 4R2QA 3LLHA 1FJGE 4R2SA 1P42A 1X3CA 1XXEA 5CFFE 5AE2A 1FNMA 2EORA 3H4LA 1N34I 3PRYA 2K7IA 1Y4SA 3HULA 4ZYGA 2DLQA 4WUBA 2BB8A 2B7VA 2EL4A 4IFDC 5EKWA 4WUDA 5DNLA 1ZR9A 2UXCI 2AJ4A 1UEKA 2EPMX 3OMLA 4NXNE 2UUBE 3EPLA 5DRPA 4DV0I 2DRPA 2EMZA 2E72A 5DRRA 5TSEA 2IHR1 5JEAD 3LNUA 4BHCA 4DXLA 4FW9A 1P47A 4LFBI 1ZU1A 4RHBB 4LF8E 4AM3A 2DSYA 4R2EA 3CDIA 4N3OA 2EOIA 5JEAF 3LPSA 2JXPA 5LLQA 1IBKI 2BA1D 3M85G 1VISA 4NZVA 4HACA 4KHPI 1LLMC 1BBGA 2LE2A 5LMUE 4DV7E 2WW4A 3K85A 4DR1E 4KHPE 1T4NA 2Z5BA 2LV2A 4AQYE 3UK3C 1EH8A 1RREA 2PNLA 5K36C 2LTSA 3GLLA 4OO1D 3L00A 5K36E 4LF9I 1H72C 2GPIA 1ZAAC 2HFSA 3ZOQB 4M2ZA 4U3BA 1Y5YA 2L33A 1HNZE 2LJPA 2YSPA 3J7AG 1IQSA 3PYDA 2DGCA 4OO1F 4DPUA 4DR6I 4WSPA 4OO1A 4F6MA 4LF4E 3QT5A 1USUA 2EMCA 4PRXA 4WUCA 1IMUA 3C4BA 2EPKX 5C0XC 2KONA 4BS9A 5C0XE 4F54A 1QU6A 3DD6A 5L3JA 4PU9A 3WU4A 2EPZA 1UILA 3BIDA 3P76A 1A6FA 4JI5I 2EMKA 2V87A 3PYFA 3B82A 2IESA 4JG4A 1B62A 3J81Q 2RTXA 3MHSC 2YU5A 4ZYHA 2PNZB 2YTPA 2V85A 4JI5E 3JAMQ 2C38B 5JEAB 2ELZA 4BA1A 4F9CB 2VQEE 1WRJA 2JWOA 2LRSA 3H1CA 2CT1A 3KRNA 5K36D 2UXDE 3PS1A 2EM4A 2IOQA 2EMLA 2V83A 1NCSA 3CDJA 4IZKA 4DV3I 3PS2A 1B63A 2JE6A 2CVEA 5K36F 2EN3A 4GEQB 2ENCA 2HFUA 4QNKA 2JOBA 2WP8B 1A1GA 2X36A 4DR7I 2NN6A 2RPCA 4DPWA 1IBLI 3FIGA 4LFAI 2EPAA 2Z5CB 3L7ZA 4IJDA 1HNWI 1PJTA 1T4LB 4LOMA 3MSWA 2EM0A 5C0XD 2UUCI 1IBLE 4F2JC 2NUGA 2EN1A 5A6BA 1U2RA 4JI6I 2EPRA 2UU9E 2V2QA 5DRQA 2EQ1A 2C37A 1WXRA 4B3TE 2V2ZA 4IFDB 5C0XF 5FLXC 4GQUA 1N32E 4FN5A 2KOUA 2IOPA 1XMQE 3HXLA 2L8TA 3QG5C 4JI2I 1GQEA 2PO1B 4DPXA 4BA2A 3ADGA 4JI0E 1I94I 4DR4I 4JV5E 4X65I 1YUJA 3LMLA 2YTEA 5AC5A 1N33E 1USVA 2EJ4A 3P06A 1X49A 4MU1A 4B3RI 2F4VE 1KTVA 2JYAA 3OTOE 2XEXA 4DMIA 1X48A 3HPSA 3P3GA 4LFCE 2EMYA 4X62I 2YTNA 4X66I 4LF6E 1EKZA 4LF5I 2YTQA 4X62E 5K36B 2IERA 2ENAA 1UN6B 4ZYEA 4B3MI 2YTJA 4X66E 2UUAE 4HY1A 1YHCA 2JR1A 1ZXNA 3C4TA 2CGEA 4LF5E 5IWAI 3KWRA 1E3PA 3MHHC 1E3HA 2F8BA 4LCHA 3GONA 2EOXA 5BR8I 5KL3A 3VHTB 1ZBQA 5A2QC 1PJSA 4R8OA 2V34A 3F6HA 1PIEA 2ZM6I 4OO1C 1MGTA 3TQMA 4R03A 5DROA 1FJGI 2JEBB 2V89A 4P7DA 2EPUA 4KQVA 2GQ0A 1OJ4A 4WXCA 5A6KA 2ZM6E 5C0XB 2J7JA 3B8HA 3VYXA 1QNTA 2EM8A 3HQ1A 1ZXMA 2BR2B 4LPFA 3WU3A 4IFDE 4NXNI 2UUBI 4MYUA 5A6JA 2LMZA 2EOQA 3GCMA 2EMFA 3CWVA 3ADJA 5AE1A 1PVGA 3EQ1A 2EN4A 5LL6R 2PO0A 4LF8I 4JI8E 4JI4E 4KWYA 4DPYA 3H09A 2WBUA 2O3ZA 5LMUI 1TF3A 2E5LE 4DV7I 4JI7E 5IT9Q 2PRTA 1Z0CA 4LTYA 2YTDA 2WNRB 4UT4A 4DR1I 4DV2E 2UXBE 3THOB 4AQYI 2KHXA 1EA6A 3VK6A 2YRMA 2EQ0A 4L5NC 2EOSA 2RS6A 2VQFE 3HTXA 2E1MA 1AAYA 1Z5BA 3EPKA 1UHZA 1Z0EA 1HNZI 2EM6A 3IWBA 4DR2E 2G7HA 4M9VC 2L6MA 2C39B 4ED4A 2NN6C 4GKKI 1ZM3A 2NN6E 2GO4A 2MDRA 2DB2A 1SFEA 1MU5A 2O1VA 4MDTA 4LF4I 2N3GA 4HYMA 3ADLA 1X6FA 1A1FA 4NXME 3Q6MA 4GKKE 4DPTA 2LBSB 2EN8A 2RQLA 4FWDA 1NEIA 2EMWA 4B3SE 1KKHA 2EZ6A 2NA2A 1XNQE 3B4TA 1EI1A 2DMIA 2HJJA 4OZEA 2HKEA 4MLQA 4M1KA 3BF2A 1RHYA 1Z5CA 4I8OA 4HXZA 2YSOA 3J7Yp 2B7TA 4BC9A 2PNMA 2YPNA 1EH7A 3KZZA 3DJWA 5T6JA 4F9BB 4LCFA 1G2DC 2NUFA 2VQEI 2LJUA 3V5RA 1XMOI 2WCC3 2FV4B 5F3WA 1H7SA 1OYSA 2JEAA 1WJPA 2V88A 2J7KA 3J80C 5AC4A 4HACB 2UXDI 3HKMA 4DV4E 1PDAA 2L2KB 1XMOE 4X64I 4GZNC 2JY9A 2Z5BB 2NN6D 2K4VA 4X64E 4FW5A 1A1IA 1KIJA 2R76A 1KJKA 2Q8UA 2MDGA 2EPOA 2EOOA 4DUZE 2EPLX 2NN6F 4AIMA 4P78A 1XNRE 5FLXQ 5A6BD 1ZM9A 4LF7E 4LCGA 4O4KA 5IXMB 4R2PA 1X5WA 3AUZA 1OYRA 2N3HA 4OO1B 1JK2A 1O0WA 1HR0E 4JI1E 1WHNA 2EM5A 2EOFA 1QZRA 1VI7A 5A6AA 1BBOA 2UU9I 3Q1QA 4B3TI 2CZ9A 4RPFA 4RH8A 1N32I 4X9JA 1NHIA 1STUA 1AH5A 1X6HA 4IZJA 4Z7YA 5ADZA 2PO2A 2R1FA 4BCAA 1XMQI 3ZKBA 2CSHA 2N8XA 2HHHE 4OX9E 3J81C 4JI0I 2VF3A 1OYPA 4JV5I 2EM3A 1DARA 1PKPA 4DR5E 2NABA 1N33I 3JAMC 2WZOA 3F6GA 1Z0GA 3HJCA 2RS7A 2BBGA 2F4VI 2O1WA 1X6EA 2R42A 3OTOI 4BA1B 5KL4A 1GTKA 1B69A 4N4RB 2EOYA 3T1YE 2I13A 4LFCI 4O5GA 2YTGA 4LF6I 4QNJA 1UDQA 3ZZTA 3T1HE 2FGGA 2V86A 4GKJI 1Z59A 1RR9A 3UHMA 4IZKB 5ELWA 1NHJA 1ZM2A 2UUAI 2X7IA 2JE6B 2DIXA 1J5EE 2EFGA 4R2AA 4HEIA 1F2IG 4L8NA 2JPAA 1YH8A 4GKJE 4K0KE 4J3DA 4R1FA 1ZBTA 4DKKA 4MQYA 5GMEA 2NN6B 2EP3A 2EN7A 1R6MA 2YTFA 2EPNA 4F9AB 2MKDA 4R2DA 4FW7A 3L7ZB 3DF6A 4DR3E 4DUYE 3K17A 4DV1E 2CPNA 4ZYDA 2DEIA 3PYEA 4FW6A 4P52A 4JYAI 1WUUA 4P7AA 1L4SA 2A2DA 1ZM4A 2L2MA 1YFHA 4R2RA 2C37B 1MEYC 1HNXI 1D6TA 4USMA 4M30A 4JYAE 2EMGA 4JI3E 3U1YA 3LTOA 2E1RA 1HNXE 3J7AM 4WXDA 1ELOA 1Z0TA 3P3EA 3ZM7A 4BA2B 3P1XA 2JP9A 4J8ZA 2H36X 4TUGA 1FWKA 2EN6A 1H74A 1S16A 4JI8I 2ODRD 4JI4I 2L3JA 4DV6E 2E5LI 5KL2A 3GMEA 4JI7I 1DGCA 2JOXA 1RC7A 1IBME 2CTDA 5A69A 4DV2I 3K1JA 2UXBI 3ECRA 4F6NA 1KVKA 3Q6NA 4LU9A 1N36E 2NUEA 2EQ3A 5LMNE 2FTXB 4Q28A 4ZVIA 2VQFI 4DV5I 4FK5C 5AE3A 4DR2I 1Y60A 2VESA 2EMHA 2BM1A 2EPCA 2LTRA 4DV5E 1KYQA 1TN9A
chains in the Genus database with same CATH topology
4YHHI 1N34E 1T4OA 4NXMI 1BKNA 5AASA 5GMDA 2UXCE 4YHHE 4B3SI 4DV0E 2GS8A 1XNQI 4TUIA 3HPZA 4BC7A 4Z7CA 1H73A 4I3HA 3B78A 4LFBE 3QT7A 3J80Q 3JU0A 1IBKE 2DEJA 3RMPA 4OOGC 3IWDA 4FWHA 1MG7A 1FWLA 5IT9C 2BV3A 4DV4I 1K47A 4LF9E 2LUQA 1SR9A 3M6AA 1S4EA 1Z0BA 2Z5CA 1YZ9A 3K6QA 3ZKDA 4DR6E 1X47A 2MC5A 2EWLA 4BBYA 2O1TA 1Z0VA 2Q2EB 2YT4A 4DUZI 2A2CA 1XNRI 2YZTA 4LF7I 1RQ0A 3D4JA 4WPYA 4JI1I 2M4IA 1HR0I 2B9DA 4X8WA 4IZJD 1YYOA 2DMYA 2HHHI 4OX9I 4WYQB 1FI4A 4EMDA 4PRVA 4DR5I 2VF1A 4UTGA 1WHQA 1YYWA 4XTJA 3JTZA 3F0NA 2M1SA 3T1YI 4DV3E 4USKA 1YYKA 2OI2A 1MX0A 2V2VA 2R3VA 2ZITA 5DNYA 3T1HI 3PYGA 2ODRC 1N0VC 1Z5AA 2HK2A 2V8PA 4DR7E 1J26A 2CG9A 2VE7C 1J5EI 4LFAE 1FKAE 4DU7A 5A2QQ 4K0KI 1HNWE 1Z0WA 3QT6A 2L3CA 4YY3I 5FWKA 2UUCE 3V2UC 2LUPB 1N0UA 4JI6E 1NZ0A 2HKJA 2O1UA 4DUYI 4DR3I 4YY3E 2M7QA 4DV1I 3IWCA 2L92A 3WU5A 2Z5EA 4URLA 3VYYA 1DQ3A 2LJHA 1DI2A 2L2NA 1Y4UA 2MC6A 4JI2E 4JI3I 1I94E 1HK7A 4IZJB 4DR4E 4X65E 3ADIA 4BMJA 4MYTA 2ZBKB 4B3RE 4WFTA 2RSMA 3WU6A 2NPFA 1GZ6A 1Y6ZA 4DV6I 2JVAA 1NHHA 2HK3A 1IBMI 4DU8A 4B3ME 4FWGA 1XHKA 5IWAE 1N36I 2BM0A 3QT8A 2V8QB 3ZZ0A 3ZZUA 4KZSA 5LMNI 5BR8E 2B3TB 1H7UA 3AV0A 4M0VA 3LLHA 1FJGE 5CFFE 5AE2A 1FNMA 3H4LA 1N34I 3PRYA 1Y4SA 3HULA 4WUBA 2B7VA 4WUDA 2UXCI 2AJ4A 1UEKA 3OMLA 4NXNE 2UUBE 4DV0I 2IHR1 3LNUA 4DXLA 4FW9A 4LFBI 4LF8E 2DSYA 4N3OA 3LPSA 1IBKI 1VISA 4HACA 4KHPI 2LE2A 5LMUE 4DV7E 2WW4A 3K85A 4DR1E 4KHPE 1T4NA 2Z5BA 4AQYE 1RREA 2PNLA 2LTSA 4LF9I 1H72C 2HFSA 3ZOQB 4M2ZA 2L33A 1HNZE 2LJPA 3J7AG 3PYDA 4DPUA 4DR6I 4WSPA 4LF4E 3QT5A 1USUA 4PRXA 4WUCA 3C4BA 2KONA 4BS9A 4F54A 1QU6A 5L3JA 4PU9A 3WU4A 1UILA 1A6FA 4JI5I 2V87A 3PYFA 3B82A 4JG4A 3J81Q 1B62A 2RTXA 2V85A 4JI5E 3JAMQ 4F9CB 2VQEE 2JWOA 2LRSA 2UXDE 2IOQA 2V83A 4DV3I 4IZKA 1B63A 4GEQB 2HFUA 2JOBA 2X36A 4DR7I 4DPWA 1IBLI 3FIGA 4LFAI 2Z5CB 1HNWI 1T4LB 3MSWA 2UUCI 1IBLE 2NUGA 1U2RA 4JI6I 2UU9E 2V2QA 1WXRA 4B3TE 2V2ZA 5FLXC 1N32E 4FN5A 2KOUA 2IOPA 1XMQE 3HXLA 2L8TA 4JI2I 1GQEA 4DPXA 3ADGA 4JI0E 1I94I 4DR4I 4JV5E 4X65I 3LMLA 1USVA 1N33E 3P06A 1X49A 4B3RI 2F4VE 1KTVA 3OTOE 2XEXA 4DMIA 1X48A 3HPSA 4X62I 4LFCE 4X66I 4LF6E 1EKZA 4LF5I 4X62E 4B3MI 4X66E 2UUAE 4HY1A 2JR1A 1ZXNA 3C4TA 2CGEA 4LF5E 5IWAI 3KWRA 2F8BA 3GONA 5BR8I 1ZBQA 5A2QC 4R8OA 2V34A 3F6HA 1PIEA 2ZM6I 1FJGI 4R03A 2V89A 4P7DA 4KQVA 2GQ0A 1OJ4A 2ZM6E 3B8HA 3VYXA 3HQ1A 1ZXMA 3WU3A 4NXNI 2UUBI 4MYUA 2LMZA 3CWVA 3ADJA 5AE1A 1PVGA 5LL6R 4LF8I 4JI8E 4JI4E 4DPYA 3H09A 5LMUI 4DV7I 2E5LE 4JI7E 5IT9Q 1Z0CA 4LTYA 4UT4A 4DR1I 4DV2E 2UXBE 4AQYI 2KHXA 1EA6A 3VK6A 4L5NC 2RS6A 2VQFE 3HTXA 2E1MA 1Z5BA 1Z0EA 1UHZA 1HNZI 3IWBA 4DR2E 2G7HA 2L6MA 4ED4A 4GKKI 1ZM3A 2MDRA 2DB2A 1MU5A 4LF4I 2O1VA 2N3GA 4HYMA 3ADLA 4NXME 3Q6MA 4GKKE 4DPTA 2LBSB 4FWDA 4B3SE 1KKHA 2EZ6A 2NA2A 1XNQE 1EI1A 2HKEA 4M1KA 1Z5CA 4I8OA 4HXZA 3J7Yp 2B7TA 4BC9A 2PNMA 3DJWA 5T6JA 4F9BB 2VQEI 2NUFA 3V5RA 1XMOI 2FV4B 5F3WA 1H7SA 2J7KA 2V88A 3J80C 4HACB 2UXDI 4DV4E 2L2KB 1XMOE 4X64I 2JY9A 2Z5BB 2K4VA 4X64E 1KIJA 4DUZE 5FLXQ 4P78A 1XNRE 1ZM9A 4LF7E 3AUZA 2N3HA 4JI1E 1O0WA 1HR0E 1WHNA 1QZRA 2UU9I 3Q1QA 4B3TI 2CZ9A 4RPFA 1N32I 1NHIA 1STUA 4IZJA 4Z7YA 5ADZA 1XMQI 4BCAA 3ZKBA 2HHHE 4OX9E 3J81C 4JI0I 2VF3A 4JV5I 1DARA 1PKPA 4DR5E 1N33I 3JAMC 2WZOA 3F6GA 1Z0GA 3HJCA 2RS7A 2F4VI 2O1WA 2R42A 3OTOI 4LFCI 3T1YE 4LF6I 3ZZTA 3T1HE 2FGGA 2V86A 4GKJI 1Z59A 1RR9A 4IZKB 1NHJA 1ZM2A 2UUAI 2X7IA 2DIXA 1J5EE 2EFGA 4L8NA 4GKJE 4K0KE 4R1FA 1ZBTA 4DKKA 5GMEA 4F9AB 3DF6A 4DR3E 4DUYE 3K17A 4DV1E 2CPNA 2DEIA 3PYEA 4P52A 4JYAI 1WUUA 4P7AA 2A2DA 1ZM4A 2L2MA 1HNXI 1D6TA 4USMA 4M30A 4JYAE 4JI3E 3LTOA 2E1RA 1HNXE 3J7AM 1ELOA 1Z0TA 3ZM7A 3P1XA 4J8ZA 2H36X 1H74A 4TUGA 1FWKA 4JI8I 1S16A 4JI4I 2ODRD 2L3JA 4DV6E 2E5LI 4JI7I 2JOXA 1RC7A 1IBME 4DV2I 2UXBI 3K1JA 1KVKA 3Q6NA 4LU9A 1N36E 2NUEA 5LMNE 2FTXB 4Q28A 4ZVIA 2VQFI 4DV5I 5AE3A 4DR2I 2BM1A 2LTRA 4DV5E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YHH I;  1N34 E;  1T4O A;  4NXM I;  1BKN A;  5GMD A;  2UXC E;  4YHH E;  4B3S I;  4DV0 E;  2GS8 A;  1XNQ I;  4Z7C A;  1H73 A;  4I3H A;  3B78 A;  4LFB E;  3QT7 A;  3J80 Q;  1IBK E;  2DEJ A;  4OOG C;  4FWH A;  1MG7 A;  1FWL A;  5IT9 C;  2BV3 A;  4DV4 I;  1K47 A;  4LF9 E;  2LUQ A;  3M6A A;  1S4E A;  1Z0B A;  1YZ9 A;  3ZKD A;  4DR6 E;  1X47 A;  1Z0V A;  2Q2E B;  2YT4 A;  4DUZ I;  2A2C A;  1XNR I;  4LF7 I;  1RQ0 A;  3D4J A;  4JI1 I;  1HR0 I;  4X8W A;  1YYO A;  2DMY A;  2HHH I;  4OX9 I;  4WYQ B;  1FI4 A;  4EMD A;  4PRV A;  4DR5 I;  4UTG A;  1WHQ A;  1YYW A;  4XTJ A;  3F0N A;  3T1Y I;  4DV3 E;  4USK A;  1YYK A;  2OI2 A;  2ZIT A;  1MX0 A;  2R3V A;  2V2V A;  3T1H I;  3PYG A;  2HK2 A;  1N0V C;  1Z5A A;  2V8P A;  4DR7 E;  1J26 A;  1J5E I;  4LFA E;  1FKA E;  4DU7 A;  5A2Q Q;  4K0K I;  1HNW E;  1Z0W A;  3QT6 A;  2L3C A;  4YY3 I;  2UUC E;  3V2U C;  2LUP B;  1N0U A;  4JI6 E;  1NZ0 A;  2HKJ A;  4DR3 I;  4DUY I;  4YY3 E;  4DV1 I;  3WU5 A;  4URL A;  3VYY A;  2LJH A;  1DI2 A;  2L2N A;  4JI2 E;  4JI3 I;  1I94 E;  4DR4 E;  4X65 E;  3ADI A;  4MYT A;  2ZBK B;  4B3R E;  4WFT A;  2RSM A;  3WU6 A;  2NPF A;  4DV6 I;  2JVA A;  1NHH A;  2HK3 A;  1IBM I;  4DU8 A;  4B3M E;  4FWG A;  1XHK A;  5IWA E;  1N36 I;  2BM0 A;  3QT8 A;  3ZZ0 A;  3ZZU A;  5LMN I;  5BR8 E;  2B3T B;  1H7U A;  3LLH A;  1FJG E;  5CFF E;  1FNM A;  3H4L A;  1N34 I;  3HUL A;  4WUB A;  2B7V A;  4WUD A;  2UXC I;  2AJ4 A;  1UEK A;  4NXN E;  2UUB E;  4DV0 I;  2IHR 1;  3LNU A;  4DXL A;  4FW9 A;  4LFB I;  4LF8 E;  3LPS A;  1IBK I;  1VIS A;  4HAC A;  4KHP I;  5LMU E;  4DV7 E;  2WW4 A;  4DR1 E;  4KHP E;  1T4N A;  4AQY E;  1RRE A;  2LTS A;  4LF9 I;  1H72 C;  2HFS A;  4M2Z A;  2L33 A;  1HNZ E;  2LJP A;  3J7A G;  3PYD A;  4DPU A;  4DR6 I;  4LF4 E;  3QT5 A;  4PRX A;  4WUC A;  3C4B A;  1QU6 A;  5L3J A;  4PU9 A;  3WU4 A;  1UIL A;  1A6F A;  4JI5 I;  3PYF A;  4JG4 A;  3B82 A;  3J81 Q;  1B62 A;  2RTX A;  4JI5 E;  3JAM Q;  2VQE E;  2LRS A;  2UXD E;  4DV3 I;  1B63 A;  2HFU A;  2X36 A;  4DR7 I;  4DPW A;  1IBL I;  4LFA I;  1HNW I;  1T4L B;  2UUC I;  1IBL E;  2NUG A;  1U2R A;  4JI6 I;  2UU9 E;  2V2Q A;  4B3T E;  2V2Z A;  5FLX C;  1N32 E;  4FN5 A;  1XMQ E;  4JI2 I;  1GQE A;  4DPX A;  3ADG A;  4JI0 E;  1I94 I;  4DR4 I;  4JV5 E;  4X65 I;  1N33 E;  1X49 A;  4B3R I;  2F4V E;  1KTV A;  3OTO E;  2XEX A;  1X48 A;  4X62 I;  4LFC E;  4X66 I;  4LF6 E;  1EKZ A;  4LF5 I;  4X62 E;  4B3M I;  4X66 E;  2UUA E;  4HY1 A;  1ZXN A;  5IWA I;  3C4T A;  4LF5 E;  3GON A;  5BR8 I;  5A2Q C;  2V34 A;  1PIE A;  1FJG I;  2ZM6 I;  4KQV A;  1OJ4 A;  2ZM6 E;  3B8H A;  3VYX A;  1ZXM A;  3WU3 A;  4NXN I;  2UUB I;  4MYU A;  3CWV A;  3ADJ A;  1PVG A;  5LL6 R;  4LF8 I;  4JI8 E;  4JI4 E;  4DPY A;  5LMU I;  4DV7 I;  2E5L E;  4JI7 E;  5IT9 Q;  1Z0C A;  4UT4 A;  4DR1 I;  4DV2 E;  2UXB E;  4AQY I;  2KHX A;  1EA6 A;  2RS6 A;  2VQF E;  3HTX A;  1Z5B A;  1Z0E A;  1UHZ A;  1HNZ I;  4DR2 E;  4ED4 A;  4GKK I;  1ZM3 A;  2MDR A;  2DB2 A;  1MU5 A;  4LF4 I;  2N3G A;  4HYM A;  3ADL A;  4NXM E;  4GKK E;  4DPT A;  2LBS B;  4FWD A;  4B3S E;  1KKH A;  2EZ6 A;  2NA2 A;  1XNQ E;  1EI1 A;  2HKE A;  4M1K A;  1Z5C A;  4HXZ A;  3J7Y p;  2B7T A;  2VQE I;  2NUF A;  3V5R A;  1XMO I;  1H7S A;  2J7K A;  4HAC B;  3J80 C;  2UXD I;  4DV4 E;  2L2K B;  1XMO E;  4X64 I;  2JY9 A;  4X64 E;  1KIJ A;  4DUZ E;  5FLX Q;  1XNR E;  1ZM9 A;  4LF7 E;  2N3H A;  4JI1 E;  1O0W A;  1HR0 E;  1WHN A;  1QZR A;  2UU9 I;  3Q1Q A;  4B3T I;  2CZ9 A;  4RPF A;  1N32 I;  1NHI A;  1STU A;  4Z7Y A;  1XMQ I;  3ZKB A;  2HHH E;  4OX9 E;  3J81 C;  4JI0 I;  2VF3 A;  4JV5 I;  1DAR A;  1PKP A;  4DR5 E;  1N33 I;  3JAM C;  1Z0G A;  2RS7 A;  2F4V I;  2R42 A;  3OTO I;  4LFC I;  3T1Y E;  4LF6 I;  3ZZT A;  3T1H E;  4GKJ I;  1Z59 A;  1RR9 A;  1NHJ A;  1ZM2 A;  2UUA I;  2X7I A;  2DIX A;  1J5E E;  2EFG A;  4GKJ E;  4K0K E;  4R1F A;  1ZBT A;  4DKK A;  5GME A;  4DR3 E;  4DUY E;  3K17 A;  4DV1 E;  2CPN A;  2DEI A;  3PYE A;  4P52 A;  4JYA I;  1WUU A;  4P7A A;  2A2D A;  1ZM4 A;  2L2M A;  1HNX I;  1D6T A;  4USM A;  4M30 A;  4JYA E;  4JI3 E;  3LTO A;  2E1R A;  1HNX E;  3J7A M;  1ELO A;  1Z0T A;  3ZM7 A;  3P1X A;  1H74 A;  1FWK A;  4JI8 I;  4JI4 I;  1S16 A;  2L3J A;  4DV6 E;  2E5L I;  4JI7 I;  1RC7 A;  1IBM E;  4DV2 I;  2UXB I;  3K1J A;  1KVK A;  1N36 E;  2NUE A;  5LMN E;  2VQF I;  4ZVI A;  4DV5 I;  4DR2 I;  2BM1 A;  2LTR A;  4DV5 E; 
#chains in the Genus database with same CATH topology
 1TF6 A;  2EL5 A;  4O43 A;  1T4O A;  1N34 E;  4YHH I;  4NXM I;  1BKN A;  5AAS A;  5GMD A;  2UXC E;  4YHH E;  4IS1 C;  4ISA A;  4R2C A;  4MU4 A;  4B3S I;  4DV0 E;  5IV8 B;  2GS8 A;  4TUI A;  1XNQ I;  3HPZ A;  4BC7 A;  1UDO A;  4Z7C A;  1H73 A;  2PNZ A;  1UDS A;  2J65 A;  2EOJ A;  2EM2 A;  1YSA C;  3B78 A;  4I3H A;  2C38 A;  5JEA A;  4LFB E;  3QT7 A;  3KZY A;  3J80 Q;  2EOZ A;  2EMA A;  2RSI A;  2ADR A;  2LCE A;  3JU0 A;  1IBK E;  1YUI A;  2DEJ A;  4FW3 A;  3RMP A;  4OOG C;  3U1K A;  2PO0 B;  3IWD A;  1T38 A;  2F1D A;  4FWH A;  1MG7 A;  2EMB A;  4NBQ A;  1FWL A;  5IT9 C;  2HC5 A;  2BV3 A;  2LO3 A;  4DV4 I;  1K47 A;  4Q35 B;  3C6K A;  4LF9 E;  2LUQ A;  4MLV A;  2WP8 A;  3PS3 A;  1SR9 A;  3M6A A;  1EH6 A;  1S4E A;  1Z0B A;  2Z5C A;  1YZ9 A;  4IFD D;  3K6Q A;  1IQO A;  3ZKD A;  2LVH A;  2GLI A;  4DR6 E;  1X47 A;  2MC5 A;  5EL9 A;  2EWL A;  4BBY A;  2O1T A;  1Z0V A;  2Q2E B;  2D9H A;  2YT4 A;  4DUZ I;  4DR3 I;  3C6M A;  1RMD A;  1Z1B A;  2A2C A;  1XNR I;  2WBT A;  4IFD F;  2YZT A;  4LF7 I;  1RQ0 A;  3D4J A;  4IFD A;  4WPY A;  2LT7 A;  4JI1 I;  2M4I A;  1HR0 I;  2YRK A;  3BBG A;  2HGH A;  4U3D A;  2B9D A;  2EOM A;  4X8W A;  4IZJ D;  2EE8 A;  1YYO A;  3M85 D;  2DMY A;  2PO1 A;  4MU3 A;  4FW4 A;  2EM7 A;  4O24 A;  2HHH I;  4OX9 I;  4WYQ B;  1FI4 A;  2EOH A;  4EMD A;  4PRV A;  4DR5 I;  2VF1 A;  4UTG A;  1WHQ A;  1UDN A;  2I9I A;  1YYW A;  2BA0 G;  3THN A;  2GO3 A;  2VRD A;  3JTZ A;  4XTJ A;  1UBD C;  3F0N A;  3M7N G;  2M1S A;  4OKG A;  5K36 A;  3T1Y I;  4DV3 E;  4USK A;  1YYK A;  2JEA B;  2OI2 A;  1MX0 A;  2V2V A;  2R3V A;  2EL6 A;  5DNY A;  2ZIT A;  2EPP A;  3T1H I;  4HTG A;  3PYG A;  2YU8 A;  2ODR C;  1N0V C;  1Z5A A;  2HK2 A;  2V8P A;  1T39 A;  4DR7 E;  1J26 A;  2CG9 A;  2VE7 C;  1J5E I;  4LFA E;  2YRH A;  3P3C A;  3M99 B;  1FKA E;  4DU7 A;  5A2Q Q;  4K0K I;  1HNW E;  2ELY A;  2JEB A;  1Z0W A;  3QT6 A;  2EM9 A;  2L3C A;  5FWK A;  2UUC E;  4YY3 I;  2EN2 A;  3V2U C;  3EPJ A;  2LUP B;  1N0U A;  5C0X A;  4JI6 E;  1NZ0 A;  2A25 A;  2HKJ A;  2O1U A;  1A1J A;  1PJQ A;  4YY3 E;  2M7Q A;  2BR2 A;  5DNX A;  4DUY I;  2M9A A;  3IWC A;  4DV1 I;  2L92 A;  3WU5 A;  2YWQ A;  1A1K A;  2Z5E A;  2GHF A;  4URL A;  3VYY A;  2AE8 A;  1DQ3 A;  2LJH A;  5KL6 A;  1DI2 A;  2L2N A;  1Y4U A;  2MC6 A;  5KL5 A;  2EOE A;  4JI2 E;  2MKN A;  4AID A;  4JI3 I;  1I94 E;  1HK7 A;  1BB8 A;  4DR4 E;  4X65 E;  3ADI A;  2PO2 B;  4IZJ B;  2EMX A;  4NHR A;  2YTO A;  4BMJ A;  2BA0 D;  4MYT A;  5JEA C;  2ZBK B;  1R6L A;  4B3R E;  5JEA E;  3M7N D;  4IS9 A;  1YPN A;  3BGH A;  4WFT A;  2RSM A;  2JT2 A;  4BHB A;  1A1H A;  2WNR A;  3NZK A;  3WU6 A;  2WBS A;  2NPF A;  1GZ6 A;  1Y6Z A;  4DV6 I;  2ENH A;  2BA1 G;  1JK1 A;  2EMI A;  2JVA A;  1NHH A;  2EPX A;  2HK3 A;  1IBM I;  4WSG A;  4DU8 A;  5KL7 A;  4B3M E;  4WX9 A;  4FWG A;  1XHK A;  5IWA E;  2C39 A;  2BM0 A;  1N36 I;  3QT8 A;  2V8Q B;  1A1L A;  3ZZ0 A;  1G2F C;  3ZZU A;  2YTI A;  4KZS A;  5LMN I;  4OO1 E;  3EPH A;  5BR8 E;  4MU0 A;  1N3G A;  2B3T B;  1H7U A;  2DLK A;  3AV0 A;  4M0V A;  4R2Q A;  3LLH A;  1FJG E;  4R2S A;  1P42 A;  1X3C A;  1XXE A;  5CFF E;  5AE2 A;  1FNM A;  2EOR A;  3H4L A;  1N34 I;  3PRY A;  2K7I A;  1Y4S A;  3HUL A;  4ZYG A;  2DLQ A;  4WUB A;  2BB8 A;  2B7V A;  2EL4 A;  4IFD C;  5EKW A;  4WUD A;  5DNL A;  1ZR9 A;  2UXC I;  2AJ4 A;  1UEK A;  2EPM X;  3OML A;  4NXN E;  2UUB E;  3EPL A;  5DRP A;  4DV0 I;  2DRP A;  2EMZ A;  2E72 A;  5DRR A;  5TSE A;  2IHR 1;  5JEA D;  3LNU A;  4BHC A;  4DXL A;  4FW9 A;  1P47 A;  4LFB I;  1ZU1 A;  4RHB B;  4LF8 E;  4AM3 A;  2DSY A;  4R2E A;  3CDI A;  4N3O A;  2EOI A;  5JEA F;  3LPS A;  2JXP A;  5LLQ A;  1IBK I;  2BA1 D;  3M85 G;  1VIS A;  4NZV A;  4HAC A;  4KHP I;  1LLM C;  1BBG A;  2LE2 A;  5LMU E;  4DV7 E;  2WW4 A;  3K85 A;  4DR1 E;  4KHP E;  1T4N A;  2Z5B A;  2LV2 A;  4AQY E;  3UK3 C;  1EH8 A;  1RRE A;  2PNL A;  5K36 C;  2LTS A;  3GLL A;  4OO1 D;  3L00 A;  5K36 E;  4LF9 I;  1H72 C;  2GPI A;  1ZAA C;  2HFS A;  3ZOQ B;  4M2Z A;  4U3B A;  1Y5Y A;  2L33 A;  1HNZ E;  2LJP A;  2YSP A;  3J7A G;  1IQS A;  3PYD A;  2DGC A;  4OO1 F;  4DPU A;  4DR6 I;  4WSP A;  4OO1 A;  4F6M A;  4LF4 E;  3QT5 A;  1USU A;  2EMC A;  4PRX A;  4WUC A;  1IMU A;  3C4B A;  2EPK X;  5C0X C;  2KON A;  4BS9 A;  5C0X E;  4F54 A;  1QU6 A;  3DD6 A;  5L3J A;  4PU9 A;  3WU4 A;  2EPZ A;  1UIL A;  3BID A;  3P76 A;  1A6F A;  4JI5 I;  2EMK A;  2V87 A;  3PYF A;  3B82 A;  2IES A;  4JG4 A;  1B62 A;  3J81 Q;  2RTX A;  3MHS C;  2YU5 A;  4ZYH A;  2PNZ B;  2YTP A;  2V85 A;  4JI5 E;  3JAM Q;  2C38 B;  5JEA B;  2ELZ A;  4BA1 A;  4F9C B;  2VQE E;  1WRJ A;  2JWO A;  2LRS A;  3H1C A;  2CT1 A;  3KRN A;  5K36 D;  2UXD E;  3PS1 A;  2EM4 A;  2IOQ A;  2EML A;  2V83 A;  1NCS A;  3CDJ A;  4IZK A;  4DV3 I;  3PS2 A;  1B63 A;  2JE6 A;  2CVE A;  5K36 F;  2EN3 A;  4GEQ B;  2ENC A;  2HFU A;  4QNK A;  2JOB A;  2WP8 B;  1A1G A;  2X36 A;  4DR7 I;  2NN6 A;  2RPC A;  4DPW A;  1IBL I;  3FIG A;  4LFA I;  2EPA A;  2Z5C B;  3L7Z A;  4IJD A;  1HNW I;  1PJT A;  1T4L B;  4LOM A;  3MSW A;  2EM0 A;  5C0X D;  2UUC I;  1IBL E;  4F2J C;  2NUG A;  2EN1 A;  5A6B A;  1U2R A;  4JI6 I;  2EPR A;  2UU9 E;  2V2Q A;  5DRQ A;  2EQ1 A;  2C37 A;  1WXR A;  4B3T E;  2V2Z A;  4IFD B;  5C0X F;  5FLX C;  4GQU A;  1N32 E;  4FN5 A;  2KOU A;  2IOP A;  1XMQ E;  3HXL A;  2L8T A;  3QG5 C;  4JI2 I;  1GQE A;  2PO1 B;  4DPX A;  4BA2 A;  3ADG A;  4JI0 E;  1I94 I;  4DR4 I;  4JV5 E;  4X65 I;  1YUJ A;  3LML A;  2YTE A;  5AC5 A;  1N33 E;  1USV A;  2EJ4 A;  3P06 A;  1X49 A;  4MU1 A;  4B3R I;  2F4V E;  1KTV A;  2JYA A;  3OTO E;  2XEX A;  4DMI A;  1X48 A;  3HPS A;  3P3G A;  4LFC E;  2EMY A;  4X62 I;  2YTN A;  4X66 I;  4LF6 E;  1EKZ A;  4LF5 I;  2YTQ A;  4X62 E;  5K36 B;  2IER A;  2ENA A;  1UN6 B;  4ZYE A;  4B3M I;  2YTJ A;  4X66 E;  2UUA E;  4HY1 A;  1YHC A;  2JR1 A;  1ZXN A;  3C4T A;  2CGE A;  4LF5 E;  5IWA I;  3KWR A;  1E3P A;  3MHH C;  1E3H A;  2F8B A;  4LCH A;  3GON A;  2EOX A;  5BR8 I;  5KL3 A;  3VHT B;  1ZBQ A;  5A2Q C;  1PJS A;  4R8O A;  2V34 A;  3F6H A;  1PIE A;  2ZM6 I;  4OO1 C;  1MGT A;  3TQM A;  4R03 A;  5DRO A;  1FJG I;  2JEB B;  2V89 A;  4P7D A;  2EPU A;  4KQV A;  2GQ0 A;  1OJ4 A;  4WXC A;  5A6K A;  2ZM6 E;  5C0X B;  2J7J A;  3B8H A;  3VYX A;  1QNT A;  2EM8 A;  3HQ1 A;  1ZXM A;  2BR2 B;  4LPF A;  3WU3 A;  4IFD E;  4NXN I;  2UUB I;  4MYU A;  5A6J A;  2LMZ A;  2EOQ A;  3GCM A;  2EMF A;  3CWV A;  3ADJ A;  5AE1 A;  1PVG A;  3EQ1 A;  2EN4 A;  5LL6 R;  2PO0 A;  4LF8 I;  4JI8 E;  4JI4 E;  4KWY A;  4DPY A;  3H09 A;  2WBU A;  2O3Z A;  5LMU I;  1TF3 A;  2E5L E;  4DV7 I;  4JI7 E;  5IT9 Q;  2PRT A;  1Z0C A;  4LTY A;  2YTD A;  2WNR B;  4UT4 A;  4DR1 I;  4DV2 E;  2UXB E;  3THO B;  4AQY I;  2KHX A;  1EA6 A;  3VK6 A;  2YRM A;  2EQ0 A;  4L5N C;  2EOS A;  2RS6 A;  2VQF E;  3HTX A;  2E1M A;  1AAY A;  1Z5B A;  3EPK A;  1UHZ A;  1Z0E A;  1HNZ I;  2EM6 A;  3IWB A;  4DR2 E;  2G7H A;  4M9V C;  2L6M A;  2C39 B;  4ED4 A;  2NN6 C;  4GKK I;  1ZM3 A;  2NN6 E;  2GO4 A;  2MDR A;  2DB2 A;  1SFE A;  1MU5 A;  2O1V A;  4MDT A;  4LF4 I;  2N3G A;  4HYM A;  3ADL A;  1X6F A;  1A1F A;  4NXM E;  3Q6M A;  4GKK E;  4DPT A;  2LBS B;  2EN8 A;  2RQL A;  4FWD A;  1NEI A;  2EMW A;  4B3S E;  1KKH A;  2EZ6 A;  2NA2 A;  1XNQ E;  3B4T A;  1EI1 A;  2DMI A;  2HJJ A;  4OZE A;  2HKE A;  4MLQ A;  4M1K A;  3BF2 A;  1RHY A;  1Z5C A;  4I8O A;  4HXZ A;  2YSO A;  3J7Y p;  2B7T A;  4BC9 A;  2PNM A;  2YPN A;  1EH7 A;  3KZZ A;  3DJW A;  5T6J A;  4F9B B;  4LCF A;  1G2D C;  2NUF A;  2VQE I;  2LJU A;  3V5R A;  1XMO I;  2WCC 3;  2FV4 B;  5F3W A;  1H7S A;  1OYS A;  2JEA A;  1WJP A;  2V88 A;  2J7K A;  3J80 C;  5AC4 A;  4HAC B;  2UXD I;  3HKM A;  4DV4 E;  1PDA A;  2L2K B;  1XMO E;  4X64 I;  4GZN C;  2JY9 A;  2Z5B B;  2NN6 D;  2K4V A;  4X64 E;  4FW5 A;  1A1I A;  1KIJ A;  2R76 A;  1KJK A;  2Q8U A;  2MDG A;  2EPO A;  2EOO A;  4DUZ E;  2EPL X;  2NN6 F;  4AIM A;  4P78 A;  1XNR E;  5FLX Q;  5A6B D;  1ZM9 A;  4LF7 E;  4LCG A;  4O4K A;  5IXM B;  4R2P A;  1X5W A;  3AUZ A;  1OYR A;  2N3H A;  4OO1 B;  1JK2 A;  1O0W A;  1HR0 E;  4JI1 E;  1WHN A;  2EM5 A;  2EOF A;  1QZR A;  1VI7 A;  5A6A A;  1BBO A;  2UU9 I;  3Q1Q A;  4B3T I;  2CZ9 A;  4RPF A;  4RH8 A;  1N32 I;  4X9J A;  1NHI A;  1STU A;  1AH5 A;  1X6H A;  4IZJ A;  4Z7Y A;  5ADZ A;  2PO2 A;  2R1F A;  4BCA A;  1XMQ I;  3ZKB A;  2CSH A;  2N8X A;  2HHH E;  4OX9 E;  3J81 C;  4JI0 I;  2VF3 A;  1OYP A;  4JV5 I;  2EM3 A;  1DAR A;  1PKP A;  4DR5 E;  2NAB A;  1N33 I;  3JAM C;  2WZO A;  3F6G A;  1Z0G A;  3HJC A;  2RS7 A;  2BBG A;  2F4V I;  2O1W A;  1X6E A;  2R42 A;  3OTO I;  4BA1 B;  5KL4 A;  1GTK A;  1B69 A;  4N4R B;  2EOY A;  3T1Y E;  2I13 A;  4LFC I;  4O5G A;  2YTG A;  4LF6 I;  4QNJ A;  1UDQ A;  3ZZT A;  3T1H E;  2FGG A;  2V86 A;  4GKJ I;  1Z59 A;  1RR9 A;  3UHM A;  4IZK B;  5ELW A;  1NHJ A;  1ZM2 A;  2UUA I;  2X7I A;  2JE6 B;  2DIX A;  1J5E E;  2EFG A;  4R2A A;  4HEI A;  1F2I G;  4L8N A;  2JPA A;  1YH8 A;  4GKJ E;  4K0K E;  4J3D A;  4R1F A;  1ZBT A;  4DKK A;  4MQY A;  5GME A;  2NN6 B;  2EP3 A;  2EN7 A;  1R6M A;  2YTF A;  2EPN A;  4F9A B;  2MKD A;  4R2D A;  4FW7 A;  3L7Z B;  3DF6 A;  4DR3 E;  4DUY E;  3K17 A;  4DV1 E;  2CPN A;  4ZYD A;  2DEI A;  3PYE A;  4FW6 A;  4P52 A;  4JYA I;  1WUU A;  4P7A A;  1L4S A;  2A2D A;  1ZM4 A;  2L2M A;  1YFH A;  4R2R A;  2C37 B;  1MEY C;  1HNX I;  1D6T A;  4USM A;  4M30 A;  4JYA E;  2EMG A;  4JI3 E;  3U1Y A;  3LTO A;  2E1R A;  1HNX E;  3J7A M;  4WXD A;  1ELO A;  1Z0T A;  3P3E A;  3ZM7 A;  4BA2 B;  3P1X A;  2JP9 A;  4J8Z A;  2H36 X;  4TUG A;  1FWK A;  2EN6 A;  1H74 A;  1S16 A;  4JI8 I;  2ODR D;  4JI4 I;  2L3J A;  4DV6 E;  2E5L I;  5KL2 A;  3GME A;  4JI7 I;  1DGC A;  2JOX A;  1RC7 A;  1IBM E;  2CTD A;  5A69 A;  4DV2 I;  3K1J A;  2UXB I;  3ECR A;  4F6N A;  1KVK A;  3Q6N A;  4LU9 A;  1N36 E;  2NUE A;  2EQ3 A;  5LMN E;  2FTX B;  4Q28 A;  4ZVI A;  2VQF I;  4DV5 I;  4FK5 C;  5AE3 A;  4DR2 I;  1Y60 A;  2VES A;  2EMH A;  2BM1 A;  2EPC A;  2LTR A;  4DV5 E;  1KYQ A;  1TN9 A; 
#chains in the Genus database with same CATH homology
 4YHH I;  1N34 E;  1T4O A;  4NXM I;  1BKN A;  5AAS A;  5GMD A;  2UXC E;  4YHH E;  4B3S I;  4DV0 E;  2GS8 A;  1XNQ I;  4TUI A;  3HPZ A;  4BC7 A;  4Z7C A;  1H73 A;  4I3H A;  3B78 A;  4LFB E;  3QT7 A;  3J80 Q;  3JU0 A;  1IBK E;  2DEJ A;  3RMP A;  4OOG C;  3IWD A;  4FWH A;  1MG7 A;  1FWL A;  5IT9 C;  2BV3 A;  4DV4 I;  1K47 A;  4LF9 E;  2LUQ A;  1SR9 A;  3M6A A;  1S4E A;  1Z0B A;  2Z5C A;  1YZ9 A;  3K6Q A;  3ZKD A;  4DR6 E;  1X47 A;  2MC5 A;  2EWL A;  4BBY A;  2O1T A;  1Z0V A;  2Q2E B;  2YT4 A;  4DUZ I;  2A2C A;  1XNR I;  2YZT A;  4LF7 I;  1RQ0 A;  3D4J A;  4WPY A;  4JI1 I;  2M4I A;  1HR0 I;  2B9D A;  4X8W A;  4IZJ D;  1YYO A;  2DMY A;  2HHH I;  4OX9 I;  4WYQ B;  1FI4 A;  4EMD A;  4PRV A;  4DR5 I;  2VF1 A;  4UTG A;  1WHQ A;  1YYW A;  4XTJ A;  3JTZ A;  3F0N A;  2M1S A;  3T1Y I;  4DV3 E;  4USK A;  1YYK A;  2OI2 A;  1MX0 A;  2V2V A;  2R3V A;  2ZIT A;  5DNY A;  3T1H I;  3PYG A;  2ODR C;  1N0V C;  1Z5A A;  2HK2 A;  2V8P A;  4DR7 E;  1J26 A;  2CG9 A;  2VE7 C;  1J5E I;  4LFA E;  1FKA E;  4DU7 A;  5A2Q Q;  4K0K I;  1HNW E;  1Z0W A;  3QT6 A;  2L3C A;  4YY3 I;  5FWK A;  2UUC E;  3V2U C;  2LUP B;  1N0U A;  4JI6 E;  1NZ0 A;  2HKJ A;  2O1U A;  4DUY I;  4DR3 I;  4YY3 E;  2M7Q A;  4DV1 I;  3IWC A;  2L92 A;  3WU5 A;  2Z5E A;  4URL A;  3VYY A;  1DQ3 A;  2LJH A;  1DI2 A;  2L2N A;  1Y4U A;  2MC6 A;  4JI2 E;  4JI3 I;  1I94 E;  1HK7 A;  4IZJ B;  4DR4 E;  4X65 E;  3ADI A;  4BMJ A;  4MYT A;  2ZBK B;  4B3R E;  4WFT A;  2RSM A;  3WU6 A;  2NPF A;  1GZ6 A;  1Y6Z A;  4DV6 I;  2JVA A;  1NHH A;  2HK3 A;  1IBM I;  4DU8 A;  4B3M E;  4FWG A;  1XHK A;  5IWA E;  1N36 I;  2BM0 A;  3QT8 A;  2V8Q B;  3ZZ0 A;  3ZZU A;  4KZS A;  5LMN I;  5BR8 E;  2B3T B;  1H7U A;  3AV0 A;  4M0V A;  3LLH A;  1FJG E;  5CFF E;  5AE2 A;  1FNM A;  3H4L A;  1N34 I;  3PRY A;  1Y4S A;  3HUL A;  4WUB A;  2B7V A;  4WUD A;  2UXC I;  2AJ4 A;  1UEK A;  3OML A;  4NXN E;  2UUB E;  4DV0 I;  2IHR 1;  3LNU A;  4DXL A;  4FW9 A;  4LFB I;  4LF8 E;  2DSY A;  4N3O A;  3LPS A;  1IBK I;  1VIS A;  4HAC A;  4KHP I;  2LE2 A;  5LMU E;  4DV7 E;  2WW4 A;  3K85 A;  4DR1 E;  4KHP E;  1T4N A;  2Z5B A;  4AQY E;  1RRE A;  2PNL A;  2LTS A;  4LF9 I;  1H72 C;  2HFS A;  3ZOQ B;  4M2Z A;  2L33 A;  1HNZ E;  2LJP A;  3J7A G;  3PYD A;  4DPU A;  4DR6 I;  4WSP A;  4LF4 E;  3QT5 A;  1USU A;  4PRX A;  4WUC A;  3C4B A;  2KON A;  4BS9 A;  4F54 A;  1QU6 A;  5L3J A;  4PU9 A;  3WU4 A;  1UIL A;  1A6F A;  4JI5 I;  2V87 A;  3PYF A;  3B82 A;  4JG4 A;  3J81 Q;  1B62 A;  2RTX A;  2V85 A;  4JI5 E;  3JAM Q;  4F9C B;  2VQE E;  2JWO A;  2LRS A;  2UXD E;  2IOQ A;  2V83 A;  4DV3 I;  4IZK A;  1B63 A;  4GEQ B;  2HFU A;  2JOB A;  2X36 A;  4DR7 I;  4DPW A;  1IBL I;  3FIG A;  4LFA I;  2Z5C B;  1HNW I;  1T4L B;  3MSW A;  2UUC I;  1IBL E;  2NUG A;  1U2R A;  4JI6 I;  2UU9 E;  2V2Q A;  1WXR A;  4B3T E;  2V2Z A;  5FLX C;  1N32 E;  4FN5 A;  2KOU A;  2IOP A;  1XMQ E;  3HXL A;  2L8T A;  4JI2 I;  1GQE A;  4DPX A;  3ADG A;  4JI0 E;  1I94 I;  4DR4 I;  4JV5 E;  4X65 I;  3LML A;  1USV A;  1N33 E;  3P06 A;  1X49 A;  4B3R I;  2F4V E;  1KTV A;  3OTO E;  2XEX A;  4DMI A;  1X48 A;  3HPS A;  4X62 I;  4LFC E;  4X66 I;  4LF6 E;  1EKZ A;  4LF5 I;  4X62 E;  4B3M I;  4X66 E;  2UUA E;  4HY1 A;  2JR1 A;  1ZXN A;  3C4T A;  2CGE A;  4LF5 E;  5IWA I;  3KWR A;  2F8B A;  3GON A;  5BR8 I;  1ZBQ A;  5A2Q C;  4R8O A;  2V34 A;  3F6H A;  1PIE A;  2ZM6 I;  1FJG I;  4R03 A;  2V89 A;  4P7D A;  4KQV A;  2GQ0 A;  1OJ4 A;  2ZM6 E;  3B8H A;  3VYX A;  3HQ1 A;  1ZXM A;  3WU3 A;  4NXN I;  2UUB I;  4MYU A;  2LMZ A;  3CWV A;  3ADJ A;  5AE1 A;  1PVG A;  5LL6 R;  4LF8 I;  4JI8 E;  4JI4 E;  4DPY A;  3H09 A;  5LMU I;  4DV7 I;  2E5L E;  4JI7 E;  5IT9 Q;  1Z0C A;  4LTY A;  4UT4 A;  4DR1 I;  4DV2 E;  2UXB E;  4AQY I;  2KHX A;  1EA6 A;  3VK6 A;  4L5N C;  2RS6 A;  2VQF E;  3HTX A;  2E1M A;  1Z5B A;  1Z0E A;  1UHZ A;  1HNZ I;  3IWB A;  4DR2 E;  2G7H A;  2L6M A;  4ED4 A;  4GKK I;  1ZM3 A;  2MDR A;  2DB2 A;  1MU5 A;  4LF4 I;  2O1V A;  2N3G A;  4HYM A;  3ADL A;  4NXM E;  3Q6M A;  4GKK E;  4DPT A;  2LBS B;  4FWD A;  4B3S E;  1KKH A;  2EZ6 A;  2NA2 A;  1XNQ E;  1EI1 A;  2HKE A;  4M1K A;  1Z5C A;  4I8O A;  4HXZ A;  3J7Y p;  2B7T A;  4BC9 A;  2PNM A;  3DJW A;  5T6J A;  4F9B B;  2VQE I;  2NUF A;  3V5R A;  1XMO I;  2FV4 B;  5F3W A;  1H7S A;  2J7K A;  2V88 A;  3J80 C;  4HAC B;  2UXD I;  4DV4 E;  2L2K B;  1XMO E;  4X64 I;  2JY9 A;  2Z5B B;  2K4V A;  4X64 E;  1KIJ A;  4DUZ E;  5FLX Q;  4P78 A;  1XNR E;  1ZM9 A;  4LF7 E;  3AUZ A;  2N3H A;  4JI1 E;  1O0W A;  1HR0 E;  1WHN A;  1QZR A;  2UU9 I;  3Q1Q A;  4B3T I;  2CZ9 A;  4RPF A;  1N32 I;  1NHI A;  1STU A;  4IZJ A;  4Z7Y A;  5ADZ A;  1XMQ I;  4BCA A;  3ZKB A;  2HHH E;  4OX9 E;  3J81 C;  4JI0 I;  2VF3 A;  4JV5 I;  1DAR A;  1PKP A;  4DR5 E;  1N33 I;  3JAM C;  2WZO A;  3F6G A;  1Z0G A;  3HJC A;  2RS7 A;  2F4V I;  2O1W A;  2R42 A;  3OTO I;  4LFC I;  3T1Y E;  4LF6 I;  3ZZT A;  3T1H E;  2FGG A;  2V86 A;  4GKJ I;  1Z59 A;  1RR9 A;  4IZK B;  1NHJ A;  1ZM2 A;  2UUA I;  2X7I A;  2DIX A;  1J5E E;  2EFG A;  4L8N A;  4GKJ E;  4K0K E;  4R1F A;  1ZBT A;  4DKK A;  5GME A;  4F9A B;  3DF6 A;  4DR3 E;  4DUY E;  3K17 A;  4DV1 E;  2CPN A;  2DEI A;  3PYE A;  4P52 A;  4JYA I;  1WUU A;  4P7A A;  2A2D A;  1ZM4 A;  2L2M A;  1HNX I;  1D6T A;  4USM A;  4M30 A;  4JYA E;  4JI3 E;  3LTO A;  2E1R A;  1HNX E;  3J7A M;  1ELO A;  1Z0T A;  3ZM7 A;  3P1X A;  4J8Z A;  2H36 X;  1H74 A;  4TUG A;  1FWK A;  4JI8 I;  1S16 A;  4JI4 I;  2ODR D;  2L3J A;  4DV6 E;  2E5L I;  4JI7 I;  2JOX A;  1RC7 A;  1IBM E;  4DV2 I;  2UXB I;  3K1J A;  1KVK A;  3Q6N A;  4LU9 A;  1N36 E;  2NUE A;  5LMN E;  2FTX B;  4Q28 A;  4ZVI A;  2VQF I;  4DV5 I;  5AE3 A;  4DR2 I;  2BM1 A;  2LTR A;  4DV5 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...