4YHHE

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
157
structure length
157
Chain Sequence
DFEEKMILIRRTARMQAGGRRFRFGALVVVGDRQGRVGLGFGKAPEVPLAVQKAGYYARRNMVEVPLQNGTIPHEIEVEFGASKIVLKPAAPGTGVIAGAVPRAILELAGVTDILTKELGSRNPINIAYATMEALRQLRTKADVERLRKGEAHAQAQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 25
structure length 157
sequence length 157
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00333 Ribosomal_S5 Ribosomal protein S5, N-terminal domain
E PF03719 Ribosomal_S5_C Ribosomal protein S5, C-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.160.20 Alpha Beta 2-Layer Sandwich Double Stranded RNA Binding Domain Double Stranded RNA Binding Domain 4yhhE01
3.30.230.10 Alpha Beta 2-Layer Sandwich Ribosomal Protein S5; domain 2 Ribosomal Protein S5; domain 2 4yhhE02
4DR7E 3PYEA 4FWGA 1XHKA 4XTJA 4LF4I 4JV5I 1VISA 2ZITA 3LPSA 1IBLI 4M2ZA 2V34A 4DR7I 3QT5A 4HY1A 1FWLA 1I94E 2LJPA 1MX0A 5GMDA 2JY9A 1I94I 1HNWE 1U2RA 4R1FA 4ZVIA 1D6TA 4DV4E 1XMQE 4KHPE 1NZ0A 4FWDA 1FKAE 2EZ6A 1PIEA 2V8PA 1ZM4A 4DPYA 1RR9A 4DV4I 4KHPI 3V5RA 4DUZE 1Z0TA 1UEKA 4WUDA 2HFSA 4X66E 4DUZI 3LLHA 3ZZ0A 3JAMQ 4JI4E 3WU6A 1T4OA 5GMEA 4X66I 3JAMC 2ZM6E 3B78A 3CWVA 4DU7A 4JI4I 3J7Yp 3ZZUA 4X64E 2UUCE 1NHIA 2HFUA 4YHHE 1Z0GA 2ZM6I 3K1JA 1XNRI 4X64I 2DEJA 2UUCI 2E1RA 1RQ0A 1N0UA 2BM1A 5IT9Q 4YHHI 3T1YE 4PRXA 4DR5E 4JI0E 1KKHA 2E5LI 2NA2A 3LNUA 4DPWA 4FW9A 1Z0BA 3T1YI 1RC7A 4P7AA 4JI0I 3V2UC 4JI3E 4B3SE 3WU4A 2LTSA 4Z7YA 4DR1E 1FI4A 3H4LA 3QT6A 4HACA 4MYUA 4FN5A 2N3GA 3J7AM 2UUBE 5BR8E 4JI3I 4B3SI 1OJ4A 4MYTA 2CZ9A 4DR1I 1YYWA 4DR6E 2UUBI 2BM0A 5BR8I 2A2CA 1PKPA 1BKNA 1DI2A 4X62I 1T4NA 1H74A 1XMOE 4M30A 2VF3A 4DR6I 4GKKE 4LF6E 2L3CA 4DPXA 1XMOI 1ELOA 1RREA 4JG4A 2X7IA 3ZZTA 4JI8I 4GKKI 1QU6A 4X65E 1B62A 1ZXMA 3J80Q 4LF6I 2DIXA 2NPFA 1EKZA 2UXDE 3P1XA 2L2KB 4PU9A 1Z5CA 2UXBI 3B82A 4X65I 2L2MA 5FLXQ 3J80C 2L3JA 2UXDI 1FJGI 1O0WA 5FLXC 1N34E 2WW4A 2N3HA 1UHZA 1YYOA 4EMDA 2B7VA 1ZM2A 1N34I 4DV2E 1NHJA 3WU3A 3VYYA 4OX9I 1DARA 1YZ9A 4LF7E 4DV2I 4KQVA 4OOGC 3C4TA 1N0VC 2HKEA 4LF7I 1K47A 1HR0E 1KTVA 3ADJA 1N32E 4NXME 4DR2E 2RSMA 2LJHA 1B63A 1XNRE 1HR0I 1NHHA 5IWAE 4DPUA 1N32I 3M6AA 4NXMI 4DR2I 1STUA 2B3TB 4LFBE 2NUGA 1Z5AA 3ZKBA 2E5LE 5IWAI 4LF5E 1KIJA 2LBSB 4GKJE 4JYAE 1HNZI 3K17A 2V2QA 3OTOI 4LFBI 2LRSA 2DMYA 4JI2E 4AQYE 4LF5I 4LFCE 1J5EE 4GKJI 4JYAI 1Z0CA 5IT9C 1Z0EA 4Z7CA 2NUFA 4JI2I 3WU5A 4AQYI 4LFCI 1S16A 1J5EI 2LUPB 4JI7E 2DB2A 4DUYE 2UU9E 2J7KA 1WHQA 1IBKE 2V2ZA 4URLA 4X62E 4JI7I 4DUYI 5CFFE 2UU9I 3C4BA 2L33A 1IBKI 2LUQA 4WYQB 1EA6A 1X49A 2UUAE 2X36A 4K0KE 4JI8E 2DEIA 2VQEE 2AJ4A 1N33E 1ZM9A 2B7TA 1X47A 2UUAI 2OI2A 2CPNA 4DU8A 4K0KI 2HK2A 2UXBE 2VQEI 1N33I 2RTXA 1H73A 4DXLA 4ED4A 4HYMA 3PYDA 1H7SA 1FJGE 1T4LB 2L2NA 2NUEA 3D4JA 1Z59A 3ADGA 4YY3I 2A2DA 3QT7A 3J7AG 4FWHA 1XNQE 1IBME 5LL6R 5LMNE 4DV3E 2RS7A 4B3RE 4OX9E 1KVKA 1XNQI 2JVAA 1IBMI 4I3HA 2GS8A 3ADLA 4JI1E 5L3JA 4DV1E 1FWKA 5LMNI 2ZBKB 2MDRA 4DV3I 2R3VA 4B3RI 4JI5E 4LFAE 3PYFA 4JI1I 3LTOA 4DV1I 2IHR1 4WFTA 3HULA 4JI5I 4LFAI 4HACB 3F0NA 4LF9E 5A2QQ 4DR4E 1HNWI 1XMQI 2RS6A 4WUCA 1MG7A 4LF9I 2BV3A 4DR4I 5A2QC 3HTXA 4B3ME 4P52A 4DPTA 1HNZE 1ZBTA 3OTOE 3ADIA 2UXCE 2HK3A 4B3MI 1H72C 2Q2EB 2F4VE 1N36E 4RPFA 4DV6E 4HXZA 1X48A 3GONA 1WHNA 2LTRA 1MU5A 2UXCI 1ZM3A 1GQEA 1EI1A 2F4VI 1N36I 4DV7E 4X8WA 2KHXA 1YYKA 3B8HA 4DV6I 1HNXE 1Z5BA 1QZRA 4DKKA 3ZKDA 4DV5E 4UT4A 1A6FA 4DV7I 4USKA 1WUUA 4M1KA 1HNXI 2V2VA 2HHHE 3QT8A 1H7UA 4DV5I 3VYXA 2HHHI 2EFGA 1Z0WA 4JI6E 4DR5I 4WUBA 3T1HE 4DR3E 1J26A 3PYGA 4NXNE 1ZXNA 4JI6I 2VQFE 3ZM7A 3T1HI 4DR3I 4B3TE 4NXNI 2VQFI 1UILA 2YT4A 3J81Q 1Z0VA 4YY3E 4B3TI 2R42A 5LMUE 4LF8E 1PVGA 4DV0E 1FNMA 2XEXA 3J81C 1S4EA 4UTGA 5LMUI 4LF8I 2HKJA 4PRVA 4DV0I 4LF4E 4JV5E 4USMA 3Q1QA 1IBLE
chains in the Genus database with same CATH superfamily
1ZBQA 3UK3C 4DR7E 3PYEA 4FWGA 2FGGA 1EH6A 1XHKA 4XTJA 3GLLA 4LF4I 4JV5I 2V87A 1VISA 2ZITA 2EN4A 3DF6A 3LPSA 3Q6MA 2Z5BA 1G2FC 1BB8A 1IBLI 2LMZA 2RPCA 2R76A 4KWYA 4R2AA 4M2ZA 2V34A 3QT5A 4DR7I 5KL7A 4HY1A 1X6FA 2YU5A 4ZYEA 1I94E 1FWLA 2EMLA 2ENCA 5A69A 4M9VC 2LJPA 3NZKA 4BA1B 2LV2A 1MX0A 1RHYA 3EQ1A 3AV0A 5GMDA 2JY9A 1I94I 1HNWE 1U2RA 1X5WA 4R1FA 2WP8B 3PS3A 4ZVIA 2JEAA 1D6TA 4DV4E 2GPIA 1XMQE 1AAYA 5KL5A 1FKAE 4KHPE 1NZ0A 4FWDA 4LOMA 2EZ6A 3EPLA 1PIEA 4WXDA 2V8PA 1ZM4A 4J8ZA 1USVA 3B4TA 4DPYA 3EPHA 1RR9A 4DV4I 4KHPI 2LCEA 5IXMB 3V5RA 5AC5A 2KOUA 2DLQA 1JK1A 1A1GA 5DROA 4DUZE 4OO1D 1Z0TA 3PS2A 1UEKA 3ECRA 2NN6D 2EORA 4R2QA 4LU9A 2Z5CA 4WUDA 2EMKA 1ZAAC 2HFSA 4X66E 4DUZI 1OYPA 2EOFA 2EOZA 1R6LA 1HK7A 3LLHA 4Q28A 2EQ1A 3ZZ0A 3JAMQ 4JI4E 3WU6A 1T4OA 4R2RA 5GMEA 3HQ1A 1X6EA 3EPJA 2PO0A 3GMEA 4X66I 4NBQA 2ODRC 2YRMA 5K36E 3JAMC 2ZM6E 3B78A 3CWVA 4DU7A 4JI4I 3J7Yp 4BA2B 5AE3A 3ZZUA 4GZNC 2BR2A 4X64E 4IFDE 2UUCE 1NHIA 5K36B 1E3HA 2HFUA 1OYSA 4NHRA 4YHHE 3P3EA 4IFDB 1Z0GA 4N3OA 2R1FA 2ZM6I 3K1JA 1XNRI 3UHMA 1IQOA 4X64I 2DEJA 2UUCI 4P78A 2E1RA 2PO1A 1RQ0A 1N0UA 2BM1A 5IT9Q 2AE8A 5C0XA 4YHHI 2WNRB 4WXCA 3T1YE 2DRPA 1A1IA 4PRXA 4DR5E 4JI0E 1KKHA 2EPAA 2E5LI 2NA2A 3LNUA 4DPWA 4FW9A 1Z0BA 4R2SA 3T1YI 1RC7A 1YFHA 4J3DA 2KONA 4P7AA 4JI0I 4TUIA 1Y5YA 4L8NA 4TUGA 3V2UC 2EPZA 5DRPA 4JI3E 4B3SE 4IZJB 3PRYA 3HXLA 2CSHA 2EMWA 4ZYDA 2EM5A 2LTSA 3WU4A 4Z7YA 3TQMA 4DR1E 1GZ6A 1FI4A 2O1TA 3H4LA 3KZZA 3QT6A 2O1WA 4FN5A 4HACA 4MYUA 2N3GA 3J7AM 2UUBE 5BR8E 2EOIA 2WCC3 4JI3I 4B3SI 2A25A 2M1SA 3K85A 1OJ4A 4MYTA 2CZ9A 4DR1I 1YYWA 3HKMA 4DR6E 2EL6A 4GQUA 5DRQA 2UUBI 2M9AA 3JU0A 2BM0A 2DMIA 2A2CA 5BR8I 1PKPA 1MGTA 2EL4A 1DI2A 2M7QA 2YTJA 4BCAA 1BKNA 4X62I 1T4NA 1H74A 1XMOE 4M30A 2VF3A 3L00A 5LLQA 5A6KA 1EH7A 4DR6I 2EOMA 4GKKE 3F6GA 3HPZA 4MDTA 4LF6E 2Z5CB 5JEAC 2L3CA 4DPXA 1XMOI 1JK2A 1ELOA 2YTPA 1RREA 4JG4A 2X7IA 3ZZTA 4JI8I 2V89A 4BC9A 4GKKI 1AH5A 4WSPA 1QU6A 4X65E 2DGCA 1B62A 2EQ3A 1ZXMA 3J80Q 4LF6I 2E1MA 2C37B 4MU3A 5JEAA 2DIXA 4ZYGA 2NPFA 5K36C 1PJQA 1EKZA 1UDQA 1SR9A 2G7HA 2K7IA 3P1XA 2L2KB 2UXDE 1XXEA 1Z5CA 4R03A 3B82A 4PU9A 4IFDC 2UXBI 2BBGA 4X65I 2L2MA 5AC4A 2NN6E 5FLXQ 3H09A 3J80C 1L4SA 4R2DA 3C6MA 5C0XF 5T6JA 2YPNA 4OO1B 2YTNA 2EPRA 2EOSA 2MKNA 2EN2A 2I9IA 2L3JA 1FJGI 2EMCA 2NN6B 2UXDI 4L5NC 1O0WA 4BHCA 3U1KA 4MU0A 4FW5A 4ISAA 5FLXC 2EM2A 1N34E 4IZKA 2YWQA 2JE6B 1Y6ZA 5A6AA 2WW4A 2Z5EA 1KJKA 4MLVA 2EMAA 2N3HA 2MDGA 2GO3A 1UHZA 2C38A 1E3PA 2EM4A 1YYOA 2CGEA 4EMDA 2B7VA 1ZM2A 2YTDA 1N34I 4DV2E 3EPKA 1NHJA 2BA1D 3WU3A 3VYYA 1P47A 1A1JA 2GQ0A 4OX9I 4LPFA 3PS1A 1DARA 2YTQA 2C39A 1YZ9A 4ZYHA 4LF7E 4RH8A 2PRTA 2BA0G 1LLMC 4BHBA 5DNYA 3OMLA 4DV2I 2CTDA 4KQVA 2F8BA 4OOGC 2K4VA 2PNZB 3L7ZA 1YHCA 2O1UA 2FV4B 3C4TA 5ADZA 1N0VC 2HKEA 4LF7I 1YUIA 2EOEA 2YU8A 2FTXB 4AIDA 2YZTA 1K47A 1P42A 2EMZA 2GO4A 5C0XD 1HR0E 3H1CA 2O1VA 1KTVA 3ADJA 1A1FA 1N32E 4U3BA 4NXME 2F1DA 4DR2E 4BS9A 1USUA 2RSMA 2LJHA 3DJWA 2JPAA 2V88A 1B63A 1XNRE 1HR0I 1NHHA 5IWAE 4DPUA 2EM3A 1N32I 2WBSA 4R2EA 3M6AA 5JEAF 4NXMI 2YRHA 1R6MA 4DR2I 3C6KA 2LO3A 1IQSA 1STUA 2B3TB 4LFBE 2YTIA 2NUGA 1Z5AA 2CVEA 2PO2A 3ZKBA 3VK6A 4F6MA 2I13A 2EJ4A 4IJDA 2E5LE 5IWAI 4LF5E 2EPXA 2YSOA 4O43A 2EMIA 2LBSB 4GKJE 4JYAE 1KIJA 1VI7A 1HNZI 3K17A 2JEBA 5K36F 5DNXA 4IS1C 2V2QA 2EN6A 3OTOI 2LRSA 4LFBI 1A1LA 4R2PA 4R2CA 4IFDF 2DLKA 2GHFA 4OO1C 2DMYA 3M85G 3U1YA 2JOBA 4JI2E 2BB8A 1A1HA 2L6MA 4AQYE 4LFCE 2NN6C 4LF5I 1J5EE 4U3DA 4GKJI 4FW6A 4JYAI 4F9CB 1Z0CA 2Z5BB 3HPSA 4WX9A 5IT9C 1YUJA 1Y4UA 2EPNA 1Z0EA 5KL2A 5DNLA 4Z7CA 2EPKX 2NUFA 4JI2I 3WU5A 4AQYI 4LFCI 1S16A 1J5EI 4RHBB 2EPCA 3MHHC 1PJSA 4BA1A 1BBGA 2LUPB 3K6QA 4JI7E 2DB2A 4DUYE 5FWKA 2UU9E 3P06A 2IOQA 2JEAB 1X3CA 2J7KA 1WHQA 1IBKE 2EOXA 3MHSC 4FK5C 4X9JA 2V2ZA 3P3CA 4URLA 4BMJA 4X62E 4JI7I 4LCFA 3F6HA 5JEAD 5CFFE 4DUYI 4M0VA 2L92A 2RSIA 1G2DC 2UU9I 2V85A 1T38A 2HC5A 1QNTA 3C4BA 1YSAC 2YTGA 4FW3A 4O24A 2C39B 2L33A 1IBKI 2LUQA 4WYQB 1EA6A 1X49A 3THOB 2IESA 2EPUA 2L8TA 2UUAE 5KL4A 2Q8UA 4LCHA 3RMPA 2X36A 4K0KE 4JI8E 2DEIA 2VQEE 2JWOA 1N33E 1ZM9A 2AJ4A 4LCGA 2B7TA 3KRNA 1X47A 4QNJA 2JYAA 2EN1A 1GTKA 2NABA 1IMUA 2UUAI 2OI2A 2CPNA 2VRDA 1A1KA 4DU8A 5KL6A 3KWRA 2D9HA 2EMXA 4GEQB 4HEIA 2HK2A 4K0KI 2UXBE 2IOPA 2JP9A 5KL3A 3CDJA 2VQEI 1N33I 4OKGA 2EPLX 4I8OA 2RTXA 5A6JA 4Q35B 1H73A 2PO0B 4DXLA 1MEYC 4ED4A 2IERA 4HYMA 2PNMA 4KZSA 1Y4SA 3PYDA 1H7SA 2WZOA 1FJGE 1T4LB 2L2NA 2NUEA 4BA2A 3D4JA 3BGHA 1OYRA 1Z59A 2BR2B 4MU4A 2EMBA 3ADGA 5K36A 4YY3I 3THNA 2EQ0A 2A2DA 4NZVA 3QT7A 3J7AG 4IFDA 4FWHA 1XNQE 5C0XE 1IBME 5LL6R 5A6BA 1NEIA 1X6HA 1UN6B 1DGCA 2EMHA 2MKDA 4MQYA 5LMNE 2PO1B 4OO1F 3IWDA 4WSGA 1YH8A 1WRJA 4DV3E 5ELWA 2RS7A 5C0XB 4B3RE 2WNRA 2NN6F 3M85D 4OX9E 1KVKA 1XNQI 2JVAA 1IBMI 1ZR9A 4DMIA 4I3HA 2GS8A 3ADLA 4JI1E 5L3JA 4DV1E 1FWKA 5LMNI 2ZBKB 2EE8A 2B9DA 2MDRA 4WPYA 3CDIA 4DV3I 2R3VA 4B3RI 4JI5E 3P76A 2YRKA 4LFAE 2ENAA 3PYFA 4OO1E 4O5GA 4JI1I 3LTOA 4DV1I 2IHR1 4WFTA 1TF3A 2ELYA 3IWCA 4IZJA 4OZEA 2ODRD 2V8QB 3HULA 4JI5I 2E72A 4LFAI 4HACB 3F0NA 5EL9A 1PDAA 3M7NG 3QG5C 1PJTA 4IS9A 4R8OA 3JTZA 4F9BB 4LF9E 5A2QQ 4DR4E 4HTGA 1HNWI 4F2JC 1UBDC 2EMYA 1XMQI 2RS6A 4WUCA 2LE2A 1MG7A 1N3GA 3BBGA 4LF9I 2BV3A 1UDOA 3ZOQB 5A2QC 2J65A 2H36X 4BC7A 4DR4I 2EM0A 5F3WA 3HTXA 4B3ME 2HGHA 1ZU1A 2PNLA 3BIDA 1UDNA 4P52A 4DPTA 2CT1A 2VE7C 1HNZE 2EOYA 4MLQA 2JR1A 1YPNA 2EN8A 1ZBTA 1EH8A 3OTOE 3ADIA 2YSPA 2UXCE 5JEAE 2HK3A 4B3MI 1H72C 2Q2EB 2F4VE 4P7DA 2LVHA 1N36E 4RPFA 4DV6E 3VHTB 2CG9A 3P3GA 2EM8A 4HXZA 5JEAB 1Z1BA 1X48A 2C37A 2EMFA 4F54A 3GONA 4QNKA 1WHNA 1RMDA 2LTRA 3BF2A 4LTYA 1MU5A 1UDSA 1ZM3A 2UXCI 1GQEA 1EI1A 2F4VI 2EM7A 2EWLA 2JXPA 4DV7E 1N36I 4N4RB 4X8WA 2KHXA 1WJPA 1YYKA 3B8HA 4DV6I 1HNXE 1Z5BA 1Y60A 1QZRA 2MC5A 4OO1A 4DKKA 2YTEA 3ZKDA 4DV5E 4UT4A 2V83A 3KZYA 1A6FA 5C0XC 2NN6A 4DV7I 2V86A 4USKA 1WUUA 4M1KA 4AM3A 1HNXI 1KYQA 2V2VA 2HHHE 4IZKB 2ENHA 2JE6A 3FIGA 4O4KA 3QT8A 1H7UA 3HJCA 1F2IG 4DV5I 3AUZA 5AE1A 2WP8A 2WBTA 2EL5A 2C38B 2JT2A 2EPPA 3VYXA 2EN7A 3IWBA 2HHHI 4F9AB 2EN3A 4FW4A 2EOJA 1TN9A 2EOQA 4BBYA 2BA1G 2EFGA 1Z0WA 4FW7A 2GLIA 2LJUA 2EPOA 5EKWA 4JI6E 2BA0D 4DR5I 4WUBA 5AASA 2VESA 3GCMA 3T1HE 2J7JA 4DR3E 2M4IA 2N8XA 2PNZA 3L7ZB 2EMGA 2MC6A 5AE2A 1J26A 5K36D 3M99B 3PYGA 2EPMX 2HJJA 3MSWA 4NXNE 1ZXNA 4JI6I 2VQFE 4IFDD 5IV8B 2O3ZA 3ZM7A 5A6BD 3M7ND 3T1HI 2VF1A 2EOHA 4DR3I 4MU1A 2WBUA 4B3TE 4NXNI 2EM9A 2VQFI 5DRRA 1UILA 2YT4A 2LT7A 2ADRA 2YTFA 2EM6A 2EP3A 5TSEA 3J81Q 1Z0VA 3LMLA 4YY3E 4B3TI 2R42A 5LMUE 4LF8E 3Q6NA 1B69A 1PVGA 4DV0E 1SFEA 1FNMA 2XEXA 4F6NA 3J81C 4AIMA 1BBOA 4IZJD 2EOOA 3DD6A 2PO2B 1S4EA 2JOXA 4UTGA 1DQ3A 5LMUI 4LF8I 2DSYA 2YTOA 1T39A 2HKJA 4PRVA 4DV0I 1TF6A 1WXRA 4LF4E 4JV5E 2JEBB 4USMA 3Q1QA 1IBLE 2RQLA 2ELZA 1NCSA
chains in the Genus database with same CATH topology
1ZBQA 4DR7E 3PYEA 4FWGA 2FGGA 1XHKA 4XTJA 4LF4I 4JV5I 2V87A 1VISA 2ZITA 3DF6A 3LPSA 2Z5BA 1IBLI 2LMZA 4M2ZA 2V34A 4DR7I 3QT5A 4HY1A 1FWLA 1I94E 2LJPA 1MX0A 3AV0A 5GMDA 2JY9A 1I94I 1HNWE 1U2RA 4R1FA 4ZVIA 1D6TA 4DV4E 1XMQE 4KHPE 1NZ0A 1FKAE 4FWDA 2EZ6A 1PIEA 2V8PA 1ZM4A 4J8ZA 1USVA 4DPYA 1RR9A 4DV4I 4KHPI 3V5RA 2KOUA 4DUZE 1Z0TA 1UEKA 4LU9A 2Z5CA 4WUDA 2HFSA 4X66E 4DUZI 1HK7A 3LLHA 4Q28A 3ZZ0A 3JAMQ 4JI4E 3WU6A 1T4OA 5GMEA 3HQ1A 4X66I 2ODRC 3JAMC 2ZM6E 3B78A 3CWVA 4DU7A 4JI4I 3J7Yp 5AE3A 3ZZUA 4X64E 2UUCE 1NHIA 2HFUA 4YHHE 1Z0GA 4N3OA 2ZM6I 3K1JA 1XNRI 4X64I 2DEJA 2UUCI 4P78A 2E1RA 1RQ0A 1N0UA 2BM1A 5IT9Q 4YHHI 3T1YE 4PRXA 4DR5E 4JI0E 1KKHA 2E5LI 2NA2A 3LNUA 4DPWA 4FW9A 1Z0BA 3T1YI 1RC7A 2KONA 4P7AA 4JI0I 4TUIA 4L8NA 4TUGA 3V2UC 4JI3E 4B3SE 4IZJB 3PRYA 3HXLA 3WU4A 2LTSA 4Z7YA 4DR1E 1GZ6A 1FI4A 2O1TA 3H4LA 3QT6A 4HACA 2O1WA 4FN5A 4MYUA 2N3GA 3J7AM 2UUBE 5BR8E 4JI3I 4B3SI 2M1SA 3K85A 1OJ4A 4MYTA 2CZ9A 4DR1I 1YYWA 4DR6E 2UUBI 3JU0A 2BM0A 5BR8I 2A2CA 1PKPA 1BKNA 1DI2A 2M7QA 4BCAA 4X62I 1T4NA 1H74A 1XMOE 4M30A 2VF3A 4DR6I 4GKKE 3F6GA 3HPZA 4LF6E 2Z5CB 2L3CA 4DPXA 1XMOI 1ELOA 1RREA 4JG4A 2X7IA 3ZZTA 4JI8I 2V89A 4BC9A 4GKKI 4WSPA 1QU6A 4X65E 1B62A 1ZXMA 3J80Q 4LF6I 2E1MA 2DIXA 2NPFA 1EKZA 1SR9A 2G7HA 2UXDE 3P1XA 2L2KB 4PU9A 1Z5CA 2UXBI 4R03A 3B82A 4X65I 2L2MA 5FLXQ 3H09A 3J80C 5T6JA 2L3JA 2UXDI 1FJGI 4L5NC 1O0WA 5FLXC 1N34E 4IZKA 1Y6ZA 2WW4A 2Z5EA 2N3HA 1UHZA 2CGEA 1YYOA 4EMDA 2B7VA 1ZM2A 1N34I 4DV2E 1NHJA 3WU3A 3VYYA 2GQ0A 4OX9I 1DARA 1YZ9A 4LF7E 5DNYA 4DV2I 3OMLA 4KQVA 2F8BA 4OOGC 2K4VA 2O1UA 2FV4B 3C4TA 5ADZA 1N0VC 2HKEA 4LF7I 2FTXB 2YZTA 1K47A 1HR0E 2O1VA 1KTVA 3ADJA 1N32E 4NXME 4DR2E 4BS9A 1USUA 2RSMA 2LJHA 3DJWA 1B63A 2V88A 1XNRE 1HR0I 1NHHA 5IWAE 4DPUA 1N32I 3M6AA 4NXMI 4DR2I 1STUA 2B3TB 4LFBE 2NUGA 1Z5AA 3ZKBA 3VK6A 2E5LE 5IWAI 4LF5E 1KIJA 3Q6MA 2LBSB 4GKJE 4JYAE 1HNZI 3K17A 2V2QA 3OTOI 4LFBI 2LRSA 2DMYA 2JOBA 4JI2E 2L6MA 4AQYE 4LFCE 4LF5I 1J5EE 4GKJI 4JYAI 4F9CB 1Z0CA 2Z5BB 3HPSA 5IT9C 1Y4UA 1Z0EA 4Z7CA 2NUFA 4JI2I 3WU5A 4AQYI 4LFCI 1S16A 1J5EI 2LUPB 3K6QA 4JI7E 2DB2A 4DUYE 5FWKA 2UU9E 3P06A 2IOQA 2J7KA 1WHQA 1IBKE 2V2ZA 4URLA 4BMJA 4X62E 4JI7I 3F6HA 4DUYI 5CFFE 4M0VA 2L92A 2UU9I 2V85A 3C4BA 2L33A 1IBKI 2LUQA 4WYQB 1EA6A 1X49A 2L8TA 2UUAE 3RMPA 2X36A 4K0KE 4JI8E 2DEIA 2VQEE 2JWOA 1N33E 1ZM9A 2AJ4A 2B7TA 1X47A 2UUAI 2OI2A 2CPNA 4DU8A 3KWRA 4GEQB 2HK2A 4K0KI 2UXBE 2IOPA 2VQEI 1N33I 4I8OA 2RTXA 1H73A 4DXLA 4ED4A 4HYMA 2PNMA 4KZSA 1Y4SA 3PYDA 1H7SA 2WZOA 1FJGE 1T4LB 2L2NA 2NUEA 3D4JA 1Z59A 3ADGA 4YY3I 2A2DA 3QT7A 3J7AG 4FWHA 1XNQE 1IBME 5LL6R 5LMNE 3IWDA 4DV3E 2RS7A 4B3RE 4OX9E 1KVKA 1XNQI 2JVAA 1IBMI 4DMIA 4I3HA 2GS8A 3ADLA 4JI1E 5L3JA 4DV1E 1FWKA 5LMNI 2ZBKB 2B9DA 2MDRA 4WPYA 4DV3I 2R3VA 4B3RI 4JI5E 4LFAE 3PYFA 4JI1I 3LTOA 4DV1I 2IHR1 4WFTA 3IWCA 4IZJA 2ODRD 2V8QB 3HULA 4JI5I 4LFAI 4HACB 3F0NA 4R8OA 3JTZA 4F9BB 4LF9E 5A2QQ 4DR4E 1HNWI 1XMQI 2RS6A 4WUCA 2LE2A 1MG7A 4LF9I 2BV3A 3ZOQB 5A2QC 4DR4I 2H36X 4BC7A 5F3WA 3HTXA 4B3ME 4P52A 2PNLA 4DPTA 2VE7C 1HNZE 2JR1A 1ZBTA 3OTOE 3ADIA 2UXCE 2HK3A 4B3MI 1H72C 2Q2EB 2F4VE 4P7DA 1N36E 4RPFA 4DV6E 2CG9A 4HXZA 1X48A 3GONA 4F54A 1WHNA 2LTRA 4LTYA 1MU5A 2UXCI 1ZM3A 1GQEA 1EI1A 2F4VI 2EWLA 1N36I 4DV7E 4X8WA 2KHXA 1YYKA 3B8HA 4DV6I 1HNXE 1Z5BA 1QZRA 2MC5A 4DKKA 3ZKDA 4DV5E 4UT4A 2V83A 1A6FA 4DV7I 2V86A 4USKA 1WUUA 4M1KA 1HNXI 2V2VA 2HHHE 4IZKB 3FIGA 3QT8A 1H7UA 3HJCA 4DV5I 3AUZA 5AE1A 3VYXA 3IWBA 2HHHI 4F9AB 2EFGA 4BBYA 1Z0WA 4JI6E 4DR5I 4WUBA 5AASA 3T1HE 4DR3E 2M4IA 2MC6A 5AE2A 1J26A 3PYGA 3MSWA 4NXNE 1ZXNA 4JI6I 2VQFE 3ZM7A 3T1HI 2VF1A 4DR3I 4B3TE 4NXNI 2VQFI 1UILA 2YT4A 3J81Q 1Z0VA 3LMLA 4YY3E 4B3TI 2R42A 5LMUE 4LF8E 3Q6NA 1PVGA 4DV0E 1FNMA 2XEXA 3J81C 4IZJD 1S4EA 2JOXA 4UTGA 1DQ3A 5LMUI 4LF8I 2DSYA 2HKJA 4PRVA 4DV0I 1WXRA 4LF4E 4JV5E 4USMA 3Q1QA 1IBLE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR7 E;  3PYE A;  4FWG A;  1XHK A;  4XTJ A;  4LF4 I;  4JV5 I;  1VIS A;  2ZIT A;  3LPS A;  1IBL I;  4M2Z A;  2V34 A;  4DR7 I;  3QT5 A;  4HY1 A;  1FWL A;  1I94 E;  2LJP A;  1MX0 A;  5GMD A;  2JY9 A;  1I94 I;  1HNW E;  1U2R A;  4R1F A;  4ZVI A;  1D6T A;  4DV4 E;  1XMQ E;  4KHP E;  1NZ0 A;  4FWD A;  1FKA E;  2EZ6 A;  1PIE A;  2V8P A;  1ZM4 A;  4DPY A;  1RR9 A;  4DV4 I;  4KHP I;  3V5R A;  4DUZ E;  1Z0T A;  1UEK A;  4WUD A;  2HFS A;  4X66 E;  4DUZ I;  3LLH A;  3ZZ0 A;  3JAM Q;  4JI4 E;  3WU6 A;  1T4O A;  5GME A;  4X66 I;  3JAM C;  2ZM6 E;  3B78 A;  3CWV A;  4DU7 A;  4JI4 I;  3J7Y p;  3ZZU A;  4X64 E;  2UUC E;  1NHI A;  2HFU A;  4YHH E;  1Z0G A;  2ZM6 I;  3K1J A;  1XNR I;  4X64 I;  2DEJ A;  2UUC I;  2E1R A;  1RQ0 A;  1N0U A;  2BM1 A;  5IT9 Q;  4YHH I;  3T1Y E;  4PRX A;  4DR5 E;  4JI0 E;  1KKH A;  2E5L I;  2NA2 A;  3LNU A;  4DPW A;  4FW9 A;  1Z0B A;  3T1Y I;  1RC7 A;  4P7A A;  4JI0 I;  3V2U C;  4JI3 E;  4B3S E;  3WU4 A;  2LTS A;  4Z7Y A;  4DR1 E;  1FI4 A;  3H4L A;  3QT6 A;  4HAC A;  4MYU A;  4FN5 A;  2N3G A;  3J7A M;  2UUB E;  5BR8 E;  4JI3 I;  4B3S I;  1OJ4 A;  4MYT A;  2CZ9 A;  4DR1 I;  1YYW A;  4DR6 E;  2UUB I;  2BM0 A;  5BR8 I;  2A2C A;  1PKP A;  1BKN A;  1DI2 A;  4X62 I;  1T4N A;  1H74 A;  1XMO E;  4M30 A;  2VF3 A;  4DR6 I;  4GKK E;  4LF6 E;  2L3C A;  4DPX A;  1XMO I;  1ELO A;  1RRE A;  4JG4 A;  2X7I A;  3ZZT A;  4JI8 I;  4GKK I;  1QU6 A;  4X65 E;  1B62 A;  1ZXM A;  3J80 Q;  4LF6 I;  2DIX A;  2NPF A;  1EKZ A;  2UXD E;  3P1X A;  2L2K B;  4PU9 A;  1Z5C A;  2UXB I;  3B82 A;  4X65 I;  2L2M A;  5FLX Q;  3J80 C;  2L3J A;  2UXD I;  1FJG I;  1O0W A;  5FLX C;  1N34 E;  2WW4 A;  2N3H A;  1UHZ A;  1YYO A;  4EMD A;  2B7V A;  1ZM2 A;  1N34 I;  4DV2 E;  1NHJ A;  3WU3 A;  3VYY A;  4OX9 I;  1DAR A;  1YZ9 A;  4LF7 E;  4DV2 I;  4KQV A;  4OOG C;  3C4T A;  1N0V C;  2HKE A;  4LF7 I;  1K47 A;  1HR0 E;  1KTV A;  3ADJ A;  1N32 E;  4NXM E;  4DR2 E;  2RSM A;  2LJH A;  1B63 A;  1XNR E;  1HR0 I;  1NHH A;  5IWA E;  4DPU A;  1N32 I;  3M6A A;  4NXM I;  4DR2 I;  1STU A;  2B3T B;  4LFB E;  2NUG A;  1Z5A A;  3ZKB A;  2E5L E;  5IWA I;  4LF5 E;  1KIJ A;  2LBS B;  4GKJ E;  4JYA E;  1HNZ I;  3K17 A;  2V2Q A;  3OTO I;  4LFB I;  2LRS A;  2DMY A;  4JI2 E;  4AQY E;  4LF5 I;  4LFC E;  1J5E E;  4GKJ I;  4JYA I;  1Z0C A;  5IT9 C;  1Z0E A;  4Z7C A;  2NUF A;  4JI2 I;  3WU5 A;  4AQY I;  4LFC I;  1S16 A;  1J5E I;  2LUP B;  4JI7 E;  2DB2 A;  4DUY E;  2UU9 E;  2J7K A;  1WHQ A;  1IBK E;  2V2Z A;  4URL A;  4X62 E;  4JI7 I;  4DUY I;  5CFF E;  2UU9 I;  3C4B A;  2L33 A;  1IBK I;  2LUQ A;  4WYQ B;  1EA6 A;  1X49 A;  2UUA E;  2X36 A;  4K0K E;  4JI8 E;  2DEI A;  2VQE E;  2AJ4 A;  1N33 E;  1ZM9 A;  2B7T A;  1X47 A;  2UUA I;  2OI2 A;  2CPN A;  4DU8 A;  4K0K I;  2HK2 A;  2UXB E;  2VQE I;  1N33 I;  2RTX A;  1H73 A;  4DXL A;  4ED4 A;  4HYM A;  3PYD A;  1H7S A;  1FJG E;  1T4L B;  2L2N A;  2NUE A;  3D4J A;  1Z59 A;  3ADG A;  4YY3 I;  2A2D A;  3QT7 A;  3J7A G;  4FWH A;  1XNQ E;  1IBM E;  5LL6 R;  5LMN E;  4DV3 E;  2RS7 A;  4B3R E;  4OX9 E;  1KVK A;  1XNQ I;  2JVA A;  1IBM I;  4I3H A;  2GS8 A;  3ADL A;  4JI1 E;  5L3J A;  4DV1 E;  1FWK A;  5LMN I;  2ZBK B;  2MDR A;  4DV3 I;  2R3V A;  4B3R I;  4JI5 E;  4LFA E;  3PYF A;  4JI1 I;  3LTO A;  4DV1 I;  2IHR 1;  4WFT A;  3HUL A;  4JI5 I;  4LFA I;  4HAC B;  3F0N A;  4LF9 E;  5A2Q Q;  4DR4 E;  1HNW I;  1XMQ I;  2RS6 A;  4WUC A;  1MG7 A;  4LF9 I;  2BV3 A;  4DR4 I;  5A2Q C;  3HTX A;  4B3M E;  4P52 A;  4DPT A;  1HNZ E;  1ZBT A;  3OTO E;  3ADI A;  2UXC E;  2HK3 A;  4B3M I;  1H72 C;  2Q2E B;  2F4V E;  1N36 E;  4RPF A;  4DV6 E;  4HXZ A;  1X48 A;  3GON A;  1WHN A;  2LTR A;  1MU5 A;  2UXC I;  1ZM3 A;  1GQE A;  1EI1 A;  2F4V I;  1N36 I;  4DV7 E;  4X8W A;  2KHX A;  1YYK A;  3B8H A;  4DV6 I;  1HNX E;  1Z5B A;  1QZR A;  4DKK A;  3ZKD A;  4DV5 E;  4UT4 A;  1A6F A;  4DV7 I;  4USK A;  1WUU A;  4M1K A;  1HNX I;  2V2V A;  2HHH E;  3QT8 A;  1H7U A;  4DV5 I;  3VYX A;  2HHH I;  2EFG A;  1Z0W A;  4JI6 E;  4DR5 I;  4WUB A;  3T1H E;  4DR3 E;  1J26 A;  3PYG A;  4NXN E;  1ZXN A;  4JI6 I;  2VQF E;  3ZM7 A;  3T1H I;  4DR3 I;  4B3T E;  4NXN I;  2VQF I;  1UIL A;  2YT4 A;  3J81 Q;  1Z0V A;  4YY3 E;  4B3T I;  2R42 A;  5LMU E;  4LF8 E;  1PVG A;  4DV0 E;  1FNM A;  2XEX A;  3J81 C;  1S4E A;  4UTG A;  5LMU I;  4LF8 I;  2HKJ A;  4PRV A;  4DV0 I;  4LF4 E;  4JV5 E;  4USM A;  3Q1Q A;  1IBL E; 
#chains in the Genus database with same CATH topology
 1ZBQ A;  3UK3 C;  4DR7 E;  3PYE A;  4FWG A;  2FGG A;  1EH6 A;  1XHK A;  4XTJ A;  3GLL A;  4LF4 I;  4JV5 I;  2V87 A;  1VIS A;  2ZIT A;  2EN4 A;  3DF6 A;  3LPS A;  3Q6M A;  2Z5B A;  1G2F C;  1BB8 A;  1IBL I;  2LMZ A;  2RPC A;  2R76 A;  4KWY A;  4R2A A;  4M2Z A;  2V34 A;  3QT5 A;  4DR7 I;  5KL7 A;  4HY1 A;  1X6F A;  2YU5 A;  4ZYE A;  1I94 E;  1FWL A;  2EML A;  2ENC A;  5A69 A;  4M9V C;  2LJP A;  3NZK A;  4BA1 B;  2LV2 A;  1MX0 A;  1RHY A;  3EQ1 A;  3AV0 A;  5GMD A;  2JY9 A;  1I94 I;  1HNW E;  1U2R A;  1X5W A;  4R1F A;  2WP8 B;  3PS3 A;  4ZVI A;  2JEA A;  1D6T A;  4DV4 E;  2GPI A;  1XMQ E;  1AAY A;  5KL5 A;  1FKA E;  4KHP E;  1NZ0 A;  4FWD A;  4LOM A;  2EZ6 A;  3EPL A;  1PIE A;  4WXD A;  2V8P A;  1ZM4 A;  4J8Z A;  1USV A;  3B4T A;  4DPY A;  3EPH A;  1RR9 A;  4DV4 I;  4KHP I;  2LCE A;  5IXM B;  3V5R A;  5AC5 A;  2KOU A;  2DLQ A;  1JK1 A;  1A1G A;  5DRO A;  4DUZ E;  4OO1 D;  1Z0T A;  3PS2 A;  1UEK A;  3ECR A;  2NN6 D;  2EOR A;  4R2Q A;  4LU9 A;  2Z5C A;  4WUD A;  2EMK A;  1ZAA C;  2HFS A;  4X66 E;  4DUZ I;  1OYP A;  2EOF A;  2EOZ A;  1R6L A;  1HK7 A;  3LLH A;  4Q28 A;  2EQ1 A;  3ZZ0 A;  3JAM Q;  4JI4 E;  3WU6 A;  1T4O A;  4R2R A;  5GME A;  3HQ1 A;  1X6E A;  3EPJ A;  2PO0 A;  3GME A;  4X66 I;  4NBQ A;  2ODR C;  2YRM A;  5K36 E;  3JAM C;  2ZM6 E;  3B78 A;  3CWV A;  4DU7 A;  4JI4 I;  3J7Y p;  4BA2 B;  5AE3 A;  3ZZU A;  4GZN C;  2BR2 A;  4X64 E;  4IFD E;  2UUC E;  1NHI A;  5K36 B;  1E3H A;  2HFU A;  1OYS A;  4NHR A;  4YHH E;  3P3E A;  4IFD B;  1Z0G A;  4N3O A;  2R1F A;  2ZM6 I;  3K1J A;  1XNR I;  3UHM A;  1IQO A;  4X64 I;  2DEJ A;  2UUC I;  4P78 A;  2E1R A;  2PO1 A;  1RQ0 A;  1N0U A;  2BM1 A;  5IT9 Q;  2AE8 A;  5C0X A;  4YHH I;  2WNR B;  4WXC A;  3T1Y E;  2DRP A;  1A1I A;  4PRX A;  4DR5 E;  4JI0 E;  1KKH A;  2EPA A;  2E5L I;  2NA2 A;  3LNU A;  4DPW A;  4FW9 A;  1Z0B A;  4R2S A;  3T1Y I;  1RC7 A;  1YFH A;  4J3D A;  2KON A;  4P7A A;  4JI0 I;  4TUI A;  1Y5Y A;  4L8N A;  4TUG A;  3V2U C;  2EPZ A;  5DRP A;  4JI3 E;  4B3S E;  4IZJ B;  3PRY A;  3HXL A;  2CSH A;  2EMW A;  4ZYD A;  2EM5 A;  2LTS A;  3WU4 A;  4Z7Y A;  3TQM A;  4DR1 E;  1GZ6 A;  1FI4 A;  2O1T A;  3H4L A;  3KZZ A;  3QT6 A;  2O1W A;  4FN5 A;  4HAC A;  4MYU A;  2N3G A;  3J7A M;  2UUB E;  5BR8 E;  2EOI A;  2WCC 3;  4JI3 I;  4B3S I;  2A25 A;  2M1S A;  3K85 A;  1OJ4 A;  4MYT A;  2CZ9 A;  4DR1 I;  1YYW A;  3HKM A;  4DR6 E;  2EL6 A;  4GQU A;  5DRQ A;  2UUB I;  2M9A A;  3JU0 A;  2BM0 A;  2DMI A;  2A2C A;  5BR8 I;  1PKP A;  1MGT A;  2EL4 A;  1DI2 A;  2M7Q A;  2YTJ A;  4BCA A;  1BKN A;  4X62 I;  1T4N A;  1H74 A;  1XMO E;  4M30 A;  2VF3 A;  3L00 A;  5LLQ A;  5A6K A;  1EH7 A;  4DR6 I;  2EOM A;  4GKK E;  3F6G A;  3HPZ A;  4MDT A;  4LF6 E;  2Z5C B;  5JEA C;  2L3C A;  4DPX A;  1XMO I;  1JK2 A;  1ELO A;  2YTP A;  1RRE A;  4JG4 A;  2X7I A;  3ZZT A;  4JI8 I;  2V89 A;  4BC9 A;  4GKK I;  1AH5 A;  4WSP A;  1QU6 A;  4X65 E;  2DGC A;  1B62 A;  2EQ3 A;  1ZXM A;  3J80 Q;  4LF6 I;  2E1M A;  2C37 B;  4MU3 A;  5JEA A;  2DIX A;  4ZYG A;  2NPF A;  5K36 C;  1PJQ A;  1EKZ A;  1UDQ A;  1SR9 A;  2G7H A;  2K7I A;  3P1X A;  2L2K B;  2UXD E;  1XXE A;  1Z5C A;  4R03 A;  3B82 A;  4PU9 A;  4IFD C;  2UXB I;  2BBG A;  4X65 I;  2L2M A;  5AC4 A;  2NN6 E;  5FLX Q;  3H09 A;  3J80 C;  1L4S A;  4R2D A;  3C6M A;  5C0X F;  5T6J A;  2YPN A;  4OO1 B;  2YTN A;  2EPR A;  2EOS A;  2MKN A;  2EN2 A;  2I9I A;  2L3J A;  1FJG I;  2EMC A;  2NN6 B;  2UXD I;  4L5N C;  1O0W A;  4BHC A;  3U1K A;  4MU0 A;  4FW5 A;  4ISA A;  5FLX C;  2EM2 A;  1N34 E;  4IZK A;  2YWQ A;  2JE6 B;  1Y6Z A;  5A6A A;  2WW4 A;  2Z5E A;  1KJK A;  4MLV A;  2EMA A;  2N3H A;  2MDG A;  2GO3 A;  1UHZ A;  2C38 A;  1E3P A;  2EM4 A;  1YYO A;  2CGE A;  4EMD A;  2B7V A;  1ZM2 A;  2YTD A;  1N34 I;  4DV2 E;  3EPK A;  1NHJ A;  2BA1 D;  3WU3 A;  3VYY A;  1P47 A;  1A1J A;  2GQ0 A;  4OX9 I;  4LPF A;  3PS1 A;  1DAR A;  2YTQ A;  2C39 A;  1YZ9 A;  4ZYH A;  4LF7 E;  4RH8 A;  2PRT A;  2BA0 G;  1LLM C;  4BHB A;  5DNY A;  3OML A;  4DV2 I;  2CTD A;  4KQV A;  2F8B A;  4OOG C;  2K4V A;  2PNZ B;  3L7Z A;  1YHC A;  2O1U A;  2FV4 B;  3C4T A;  5ADZ A;  1N0V C;  2HKE A;  4LF7 I;  1YUI A;  2EOE A;  2YU8 A;  2FTX B;  4AID A;  2YZT A;  1K47 A;  1P42 A;  2EMZ A;  2GO4 A;  5C0X D;  1HR0 E;  3H1C A;  2O1V A;  1KTV A;  3ADJ A;  1A1F A;  1N32 E;  4U3B A;  4NXM E;  2F1D A;  4DR2 E;  4BS9 A;  1USU A;  2RSM A;  2LJH A;  3DJW A;  2JPA A;  2V88 A;  1B63 A;  1XNR E;  1HR0 I;  1NHH A;  5IWA E;  4DPU A;  2EM3 A;  1N32 I;  2WBS A;  4R2E A;  3M6A A;  5JEA F;  4NXM I;  2YRH A;  1R6M A;  4DR2 I;  3C6K A;  2LO3 A;  1IQS A;  1STU A;  2B3T B;  4LFB E;  2YTI A;  2NUG A;  1Z5A A;  2CVE A;  2PO2 A;  3ZKB A;  3VK6 A;  4F6M A;  2I13 A;  2EJ4 A;  4IJD A;  2E5L E;  5IWA I;  4LF5 E;  2EPX A;  2YSO A;  4O43 A;  2EMI A;  2LBS B;  4GKJ E;  4JYA E;  1KIJ A;  1VI7 A;  1HNZ I;  3K17 A;  2JEB A;  5K36 F;  5DNX A;  4IS1 C;  2V2Q A;  2EN6 A;  3OTO I;  2LRS A;  4LFB I;  1A1L A;  4R2P A;  4R2C A;  4IFD F;  2DLK A;  2GHF A;  4OO1 C;  2DMY A;  3M85 G;  3U1Y A;  2JOB A;  4JI2 E;  2BB8 A;  1A1H A;  2L6M A;  4AQY E;  4LFC E;  2NN6 C;  4LF5 I;  1J5E E;  4U3D A;  4GKJ I;  4FW6 A;  4JYA I;  4F9C B;  1Z0C A;  2Z5B B;  3HPS A;  4WX9 A;  5IT9 C;  1YUJ A;  1Y4U A;  2EPN A;  1Z0E A;  5KL2 A;  5DNL A;  4Z7C A;  2EPK X;  2NUF A;  4JI2 I;  3WU5 A;  4AQY I;  4LFC I;  1S16 A;  1J5E I;  4RHB B;  2EPC A;  3MHH C;  1PJS A;  4BA1 A;  1BBG A;  2LUP B;  3K6Q A;  4JI7 E;  2DB2 A;  4DUY E;  5FWK A;  2UU9 E;  3P06 A;  2IOQ A;  2JEA B;  1X3C A;  2J7K A;  1WHQ A;  1IBK E;  2EOX A;  3MHS C;  4FK5 C;  4X9J A;  2V2Z A;  3P3C A;  4URL A;  4BMJ A;  4X62 E;  4JI7 I;  4LCF A;  3F6H A;  5JEA D;  5CFF E;  4DUY I;  4M0V A;  2L92 A;  2RSI A;  1G2D C;  2UU9 I;  2V85 A;  1T38 A;  2HC5 A;  1QNT A;  3C4B A;  1YSA C;  2YTG A;  4FW3 A;  4O24 A;  2C39 B;  2L33 A;  1IBK I;  2LUQ A;  4WYQ B;  1EA6 A;  1X49 A;  3THO B;  2IES A;  2EPU A;  2L8T A;  2UUA E;  5KL4 A;  2Q8U A;  4LCH A;  3RMP A;  2X36 A;  4K0K E;  4JI8 E;  2DEI A;  2VQE E;  2JWO A;  1N33 E;  1ZM9 A;  2AJ4 A;  4LCG A;  2B7T A;  3KRN A;  1X47 A;  4QNJ A;  2JYA A;  2EN1 A;  1GTK A;  2NAB A;  1IMU A;  2UUA I;  2OI2 A;  2CPN A;  2VRD A;  1A1K A;  4DU8 A;  5KL6 A;  3KWR A;  2D9H A;  2EMX A;  4GEQ B;  4HEI A;  2HK2 A;  4K0K I;  2UXB E;  2IOP A;  2JP9 A;  5KL3 A;  3CDJ A;  2VQE I;  1N33 I;  4OKG A;  2EPL X;  4I8O A;  2RTX A;  5A6J A;  4Q35 B;  1H73 A;  2PO0 B;  4DXL A;  1MEY C;  4ED4 A;  2IER A;  4HYM A;  2PNM A;  4KZS A;  1Y4S A;  3PYD A;  1H7S A;  2WZO A;  1FJG E;  1T4L B;  2L2N A;  2NUE A;  4BA2 A;  3D4J A;  3BGH A;  1OYR A;  1Z59 A;  2BR2 B;  4MU4 A;  2EMB A;  3ADG A;  5K36 A;  4YY3 I;  3THN A;  2EQ0 A;  2A2D A;  4NZV A;  3QT7 A;  3J7A G;  4IFD A;  4FWH A;  1XNQ E;  5C0X E;  1IBM E;  5LL6 R;  5A6B A;  1NEI A;  1X6H A;  1UN6 B;  1DGC A;  2EMH A;  2MKD A;  4MQY A;  5LMN E;  2PO1 B;  4OO1 F;  3IWD A;  4WSG A;  1YH8 A;  1WRJ A;  4DV3 E;  5ELW A;  2RS7 A;  5C0X B;  4B3R E;  2WNR A;  2NN6 F;  3M85 D;  4OX9 E;  1KVK A;  1XNQ I;  2JVA A;  1IBM I;  1ZR9 A;  4DMI A;  4I3H A;  2GS8 A;  3ADL A;  4JI1 E;  5L3J A;  4DV1 E;  1FWK A;  5LMN I;  2ZBK B;  2EE8 A;  2B9D A;  2MDR A;  4WPY A;  3CDI A;  4DV3 I;  2R3V A;  4B3R I;  4JI5 E;  3P76 A;  2YRK A;  4LFA E;  2ENA A;  3PYF A;  4OO1 E;  4O5G A;  4JI1 I;  3LTO A;  4DV1 I;  2IHR 1;  4WFT A;  1TF3 A;  2ELY A;  3IWC A;  4IZJ A;  4OZE A;  2ODR D;  2V8Q B;  3HUL A;  4JI5 I;  2E72 A;  4LFA I;  4HAC B;  3F0N A;  5EL9 A;  1PDA A;  3M7N G;  3QG5 C;  1PJT A;  4IS9 A;  4R8O A;  3JTZ A;  4F9B B;  4LF9 E;  5A2Q Q;  4DR4 E;  4HTG A;  1HNW I;  4F2J C;  1UBD C;  2EMY A;  1XMQ I;  2RS6 A;  4WUC A;  2LE2 A;  1MG7 A;  1N3G A;  3BBG A;  4LF9 I;  2BV3 A;  1UDO A;  3ZOQ B;  5A2Q C;  2J65 A;  2H36 X;  4BC7 A;  4DR4 I;  2EM0 A;  5F3W A;  3HTX A;  4B3M E;  2HGH A;  1ZU1 A;  2PNL A;  3BID A;  1UDN A;  4P52 A;  4DPT A;  2CT1 A;  2VE7 C;  1HNZ E;  2EOY A;  4MLQ A;  2JR1 A;  1YPN A;  2EN8 A;  1ZBT A;  1EH8 A;  3OTO E;  3ADI A;  2YSP A;  2UXC E;  5JEA E;  2HK3 A;  4B3M I;  1H72 C;  2Q2E B;  2F4V E;  4P7D A;  2LVH A;  1N36 E;  4RPF A;  4DV6 E;  3VHT B;  2CG9 A;  3P3G A;  2EM8 A;  4HXZ A;  5JEA B;  1Z1B A;  1X48 A;  2C37 A;  2EMF A;  4F54 A;  3GON A;  4QNK A;  1WHN A;  1RMD A;  2LTR A;  3BF2 A;  4LTY A;  1MU5 A;  1UDS A;  1ZM3 A;  2UXC I;  1GQE A;  1EI1 A;  2F4V I;  2EM7 A;  2EWL A;  2JXP A;  4DV7 E;  1N36 I;  4N4R B;  4X8W A;  2KHX A;  1WJP A;  1YYK A;  3B8H A;  4DV6 I;  1HNX E;  1Z5B A;  1Y60 A;  1QZR A;  2MC5 A;  4OO1 A;  4DKK A;  2YTE A;  3ZKD A;  4DV5 E;  4UT4 A;  2V83 A;  3KZY A;  1A6F A;  5C0X C;  2NN6 A;  4DV7 I;  2V86 A;  4USK A;  1WUU A;  4M1K A;  4AM3 A;  1HNX I;  1KYQ A;  2V2V A;  2HHH E;  4IZK B;  2ENH A;  2JE6 A;  3FIG A;  4O4K A;  3QT8 A;  1H7U A;  3HJC A;  1F2I G;  4DV5 I;  3AUZ A;  5AE1 A;  2WP8 A;  2WBT A;  2EL5 A;  2C38 B;  2JT2 A;  2EPP A;  3VYX A;  2EN7 A;  3IWB A;  2HHH I;  4F9A B;  2EN3 A;  4FW4 A;  2EOJ A;  1TN9 A;  2EOQ A;  4BBY A;  2BA1 G;  2EFG A;  1Z0W A;  4FW7 A;  2GLI A;  2LJU A;  2EPO A;  5EKW A;  4JI6 E;  2BA0 D;  4DR5 I;  4WUB A;  5AAS A;  2VES A;  3GCM A;  3T1H E;  2J7J A;  4DR3 E;  2M4I A;  2N8X A;  2PNZ A;  3L7Z B;  2EMG A;  2MC6 A;  5AE2 A;  1J26 A;  5K36 D;  3M99 B;  3PYG A;  2EPM X;  2HJJ A;  3MSW A;  4NXN E;  1ZXN A;  4JI6 I;  2VQF E;  4IFD D;  5IV8 B;  2O3Z A;  3ZM7 A;  5A6B D;  3M7N D;  3T1H I;  2VF1 A;  2EOH A;  4DR3 I;  4MU1 A;  2WBU A;  4B3T E;  4NXN I;  2EM9 A;  2VQF I;  5DRR A;  1UIL A;  2YT4 A;  2LT7 A;  2ADR A;  2YTF A;  2EM6 A;  2EP3 A;  5TSE A;  3J81 Q;  1Z0V A;  3LML A;  4YY3 E;  4B3T I;  2R42 A;  5LMU E;  4LF8 E;  3Q6N A;  1B69 A;  1PVG A;  4DV0 E;  1SFE A;  1FNM A;  2XEX A;  4F6N A;  3J81 C;  4AIM A;  1BBO A;  4IZJ D;  2EOO A;  3DD6 A;  2PO2 B;  1S4E A;  2JOX A;  4UTG A;  1DQ3 A;  5LMU I;  4LF8 I;  2DSY A;  2YTO A;  1T39 A;  2HKJ A;  4PRV A;  4DV0 I;  1TF6 A;  1WXR A;  4LF4 E;  4JV5 E;  2JEB B;  4USM A;  3Q1Q A;  1IBL E;  2RQL A;  2ELZ A;  1NCS A; 
#chains in the Genus database with same CATH homology
 1ZBQ A;  4DR7 E;  3PYE A;  4FWG A;  2FGG A;  1XHK A;  4XTJ A;  4LF4 I;  4JV5 I;  2V87 A;  1VIS A;  2ZIT A;  3DF6 A;  3LPS A;  2Z5B A;  1IBL I;  2LMZ A;  4M2Z A;  2V34 A;  4DR7 I;  3QT5 A;  4HY1 A;  1FWL A;  1I94 E;  2LJP A;  1MX0 A;  3AV0 A;  5GMD A;  2JY9 A;  1I94 I;  1HNW E;  1U2R A;  4R1F A;  4ZVI A;  1D6T A;  4DV4 E;  1XMQ E;  4KHP E;  1NZ0 A;  1FKA E;  4FWD A;  2EZ6 A;  1PIE A;  2V8P A;  1ZM4 A;  4J8Z A;  1USV A;  4DPY A;  1RR9 A;  4DV4 I;  4KHP I;  3V5R A;  2KOU A;  4DUZ E;  1Z0T A;  1UEK A;  4LU9 A;  2Z5C A;  4WUD A;  2HFS A;  4X66 E;  4DUZ I;  1HK7 A;  3LLH A;  4Q28 A;  3ZZ0 A;  3JAM Q;  4JI4 E;  3WU6 A;  1T4O A;  5GME A;  3HQ1 A;  4X66 I;  2ODR C;  3JAM C;  2ZM6 E;  3B78 A;  3CWV A;  4DU7 A;  4JI4 I;  3J7Y p;  5AE3 A;  3ZZU A;  4X64 E;  2UUC E;  1NHI A;  2HFU A;  4YHH E;  1Z0G A;  4N3O A;  2ZM6 I;  3K1J A;  1XNR I;  4X64 I;  2DEJ A;  2UUC I;  4P78 A;  2E1R A;  1RQ0 A;  1N0U A;  2BM1 A;  5IT9 Q;  4YHH I;  3T1Y E;  4PRX A;  4DR5 E;  4JI0 E;  1KKH A;  2E5L I;  2NA2 A;  3LNU A;  4DPW A;  4FW9 A;  1Z0B A;  3T1Y I;  1RC7 A;  2KON A;  4P7A A;  4JI0 I;  4TUI A;  4L8N A;  4TUG A;  3V2U C;  4JI3 E;  4B3S E;  4IZJ B;  3PRY A;  3HXL A;  3WU4 A;  2LTS A;  4Z7Y A;  4DR1 E;  1GZ6 A;  1FI4 A;  2O1T A;  3H4L A;  3QT6 A;  4HAC A;  2O1W A;  4FN5 A;  4MYU A;  2N3G A;  3J7A M;  2UUB E;  5BR8 E;  4JI3 I;  4B3S I;  2M1S A;  3K85 A;  1OJ4 A;  4MYT A;  2CZ9 A;  4DR1 I;  1YYW A;  4DR6 E;  2UUB I;  3JU0 A;  2BM0 A;  5BR8 I;  2A2C A;  1PKP A;  1BKN A;  1DI2 A;  2M7Q A;  4BCA A;  4X62 I;  1T4N A;  1H74 A;  1XMO E;  4M30 A;  2VF3 A;  4DR6 I;  4GKK E;  3F6G A;  3HPZ A;  4LF6 E;  2Z5C B;  2L3C A;  4DPX A;  1XMO I;  1ELO A;  1RRE A;  4JG4 A;  2X7I A;  3ZZT A;  4JI8 I;  2V89 A;  4BC9 A;  4GKK I;  4WSP A;  1QU6 A;  4X65 E;  1B62 A;  1ZXM A;  3J80 Q;  4LF6 I;  2E1M A;  2DIX A;  2NPF A;  1EKZ A;  1SR9 A;  2G7H A;  2UXD E;  3P1X A;  2L2K B;  4PU9 A;  1Z5C A;  2UXB I;  4R03 A;  3B82 A;  4X65 I;  2L2M A;  5FLX Q;  3H09 A;  3J80 C;  5T6J A;  2L3J A;  2UXD I;  1FJG I;  4L5N C;  1O0W A;  5FLX C;  1N34 E;  4IZK A;  1Y6Z A;  2WW4 A;  2Z5E A;  2N3H A;  1UHZ A;  2CGE A;  1YYO A;  4EMD A;  2B7V A;  1ZM2 A;  1N34 I;  4DV2 E;  1NHJ A;  3WU3 A;  3VYY A;  2GQ0 A;  4OX9 I;  1DAR A;  1YZ9 A;  4LF7 E;  5DNY A;  4DV2 I;  3OML A;  4KQV A;  2F8B A;  4OOG C;  2K4V A;  2O1U A;  2FV4 B;  3C4T A;  5ADZ A;  1N0V C;  2HKE A;  4LF7 I;  2FTX B;  2YZT A;  1K47 A;  1HR0 E;  2O1V A;  1KTV A;  3ADJ A;  1N32 E;  4NXM E;  4DR2 E;  4BS9 A;  1USU A;  2RSM A;  2LJH A;  3DJW A;  1B63 A;  2V88 A;  1XNR E;  1HR0 I;  1NHH A;  5IWA E;  4DPU A;  1N32 I;  3M6A A;  4NXM I;  4DR2 I;  1STU A;  2B3T B;  4LFB E;  2NUG A;  1Z5A A;  3ZKB A;  3VK6 A;  2E5L E;  5IWA I;  4LF5 E;  1KIJ A;  3Q6M A;  2LBS B;  4GKJ E;  4JYA E;  1HNZ I;  3K17 A;  2V2Q A;  3OTO I;  4LFB I;  2LRS A;  2DMY A;  2JOB A;  4JI2 E;  2L6M A;  4AQY E;  4LFC E;  4LF5 I;  1J5E E;  4GKJ I;  4JYA I;  4F9C B;  1Z0C A;  2Z5B B;  3HPS A;  5IT9 C;  1Y4U A;  1Z0E A;  4Z7C A;  2NUF A;  4JI2 I;  3WU5 A;  4AQY I;  4LFC I;  1S16 A;  1J5E I;  2LUP B;  3K6Q A;  4JI7 E;  2DB2 A;  4DUY E;  5FWK A;  2UU9 E;  3P06 A;  2IOQ A;  2J7K A;  1WHQ A;  1IBK E;  2V2Z A;  4URL A;  4BMJ A;  4X62 E;  4JI7 I;  3F6H A;  4DUY I;  5CFF E;  4M0V A;  2L92 A;  2UU9 I;  2V85 A;  3C4B A;  2L33 A;  1IBK I;  2LUQ A;  4WYQ B;  1EA6 A;  1X49 A;  2L8T A;  2UUA E;  3RMP A;  2X36 A;  4K0K E;  4JI8 E;  2DEI A;  2VQE E;  2JWO A;  1N33 E;  1ZM9 A;  2AJ4 A;  2B7T A;  1X47 A;  2UUA I;  2OI2 A;  2CPN A;  4DU8 A;  3KWR A;  4GEQ B;  2HK2 A;  4K0K I;  2UXB E;  2IOP A;  2VQE I;  1N33 I;  4I8O A;  2RTX A;  1H73 A;  4DXL A;  4ED4 A;  4HYM A;  2PNM A;  4KZS A;  1Y4S A;  3PYD A;  1H7S A;  2WZO A;  1FJG E;  1T4L B;  2L2N A;  2NUE A;  3D4J A;  1Z59 A;  3ADG A;  4YY3 I;  2A2D A;  3QT7 A;  3J7A G;  4FWH A;  1XNQ E;  1IBM E;  5LL6 R;  5LMN E;  3IWD A;  4DV3 E;  2RS7 A;  4B3R E;  4OX9 E;  1KVK A;  1XNQ I;  2JVA A;  1IBM I;  4DMI A;  4I3H A;  2GS8 A;  3ADL A;  4JI1 E;  5L3J A;  4DV1 E;  1FWK A;  5LMN I;  2ZBK B;  2B9D A;  2MDR A;  4WPY A;  4DV3 I;  2R3V A;  4B3R I;  4JI5 E;  4LFA E;  3PYF A;  4JI1 I;  3LTO A;  4DV1 I;  2IHR 1;  4WFT A;  3IWC A;  4IZJ A;  2ODR D;  2V8Q B;  3HUL A;  4JI5 I;  4LFA I;  4HAC B;  3F0N A;  4R8O A;  3JTZ A;  4F9B B;  4LF9 E;  5A2Q Q;  4DR4 E;  1HNW I;  1XMQ I;  2RS6 A;  4WUC A;  2LE2 A;  1MG7 A;  4LF9 I;  2BV3 A;  3ZOQ B;  5A2Q C;  4DR4 I;  2H36 X;  4BC7 A;  5F3W A;  3HTX A;  4B3M E;  4P52 A;  2PNL A;  4DPT A;  2VE7 C;  1HNZ E;  2JR1 A;  1ZBT A;  3OTO E;  3ADI A;  2UXC E;  2HK3 A;  4B3M I;  1H72 C;  2Q2E B;  2F4V E;  4P7D A;  1N36 E;  4RPF A;  4DV6 E;  2CG9 A;  4HXZ A;  1X48 A;  3GON A;  4F54 A;  1WHN A;  2LTR A;  4LTY A;  1MU5 A;  2UXC I;  1ZM3 A;  1GQE A;  1EI1 A;  2F4V I;  2EWL A;  1N36 I;  4DV7 E;  4X8W A;  2KHX A;  1YYK A;  3B8H A;  4DV6 I;  1HNX E;  1Z5B A;  1QZR A;  2MC5 A;  4DKK A;  3ZKD A;  4DV5 E;  4UT4 A;  2V83 A;  1A6F A;  4DV7 I;  2V86 A;  4USK A;  1WUU A;  4M1K A;  1HNX I;  2V2V A;  2HHH E;  4IZK B;  3FIG A;  3QT8 A;  1H7U A;  3HJC A;  4DV5 I;  3AUZ A;  5AE1 A;  3VYX A;  3IWB A;  2HHH I;  4F9A B;  2EFG A;  4BBY A;  1Z0W A;  4JI6 E;  4DR5 I;  4WUB A;  5AAS A;  3T1H E;  4DR3 E;  2M4I A;  2MC6 A;  5AE2 A;  1J26 A;  3PYG A;  3MSW A;  4NXN E;  1ZXN A;  4JI6 I;  2VQF E;  3ZM7 A;  3T1H I;  2VF1 A;  4DR3 I;  4B3T E;  4NXN I;  2VQF I;  1UIL A;  2YT4 A;  3J81 Q;  1Z0V A;  3LML A;  4YY3 E;  4B3T I;  2R42 A;  5LMU E;  4LF8 E;  3Q6N A;  1PVG A;  4DV0 E;  1FNM A;  2XEX A;  3J81 C;  4IZJ D;  1S4E A;  2JOX A;  4UTG A;  1DQ3 A;  5LMU I;  4LF8 I;  2DSY A;  2HKJ A;  4PRV A;  4DV0 I;  1WXR A;  4LF4 E;  4JV5 E;  4USM A;  3Q1Q A;  1IBL E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...