4YHHO

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4yhhO00
2JRIA 1G1XB 2FKXA 2DOSA 5BY1A 1IBMO 4B3MO 4DV1O 4X65O 2UUCO 5H5NA 4DV0O 4DR5O 4LFAO 1IBKO 4JI8O 3J81N 1XEQA 1R1BA 1HNZO 3JAMN 4B3TO 1N36O 2UUBO 1FYJA 4DR2O 1A32A 2UU9O 4YHHO 4OPAA 4JI6O 2ZKOA 5BXZA 4DV6O 1KUQA 2AGAA 4DR3O 2DJVA 2VQFO 2E5LO 5IT9N 1AB3A 4JI7O 4LFBO 3RT3C 4LF5O 4B3SO 1N33O 2N74A 4JI1O 5BR8O 1HNXO 5LMUO 4X64O 1HNWO 1D2DA 1R6TA 1J5EO 4DV4O 1NS1A 4LF7O 3M8AA 4DV2O 2ZM6O 4DR7O 1XNQO 4GKJO 4JI5O 4DV3O 4DR1O 2UXBO 1X59A 3R66A 3F5TA 1F7YA 1HR0O 1XMQO 1XMOO 1DK1A 3J7AU 4OPHA 4GKKO 1N32O 2VQEO 1N34O 4OX9O 1YZBA 2Z0AA 4DUZO 3T1YO 4LF9O 2LW7A 1FKAO 4DR6O 4A5UB 5IWAO 1AILA 3T1HO 2UXDO 4DUYO 5FLXN 4JI2O 3J80N 4LF4O 4YY3O 2UXCO 4JV5O 5A2QN 4DR4O 5LMNO 2UUAO 4DV5O 4LF6O 4K0KO 4NXMO 1IBLO 1XNRO 4LF8O 4LFCO 2F4VO 5LL6Y 4DV7O 4JI4O 4NXNO 4X62O 4AQYO 1I94O 4JI0O 4JYAO 4B3RO 2HHHO 4KHPO 3OTOO 3O65A 1FJGO 4JI3O 4X66O 3SDLA
chains in the Genus database with same CATH superfamily
2JVDA 3TGUH 3M99B 4QJFB 2P5OA 5BY1A 2HFEC 4B3MO 5BZBA 5KHIA 1NI8A 4NXNB 3L73H 3T1YB 1IBKO 2H94A 2IH1C 2ADPA 1G6UA 1SERA 4UFZA 3LDCA 1LR1A 3UKMA 1YHQV 2PI5A 1YVWA 4FLUA 1JQ0A 1H2SB 4I4TB 1R6TA 1OCRC 4O4LB 3F7YC 2LP7A 2E76B 4JYAB 4MVMA 4UVAA 5IYZB 2FMLA 1KP2A 2X6AA 1FD9A 3PN1A 4R8CA 1NZ6A 4IT5A 4U7OA 2PYJA 1FXKB 3N2KA 1TA8A 2UXBO 4I7ZB 2IU3A 3W7WA 1HNWB 3G6BA 4NKGB 4K8ZA 4DUZO 1Q86W 3STLC 1K33A 4DR6O 4WFEA 2XAHA 2EIMB 2RNBA 1JJOA 1LNQA 3VQXA 4X1YA 3ZRWA 5FLXN 4BW5A 2Q7EA 4ZKIA 5J2TA 4DR1B 2BCCH 4DR3B 1K7DA 3WB1A 2ODMA 3FYEB 1EFRG 5KMGB 3BAAA 1TVKA 3S3XA 4MVRA 1R3IC 3H1JH 4GLXA 3E86A 3AG2B 3ZMSA 5IWAB 3OTOO 1R3JC 1TUBA 2VWKA 5FL7G 2YICA 2Q9LA 1ZX3A 2QEXV 2YC0A 1HDJA 5DECA 3ASOB 3P32A 1KU9A 4O2AA 1VQKV 1VQOV 3ETGA 5CBGA 2GBOA 1XEQA 1S77D 4UXNA 2VWJA 1A32A 3ZIAG 1OCOC 2ZE6A 1AROP 1H8HG 2ITCC 2P67A 4OPAA 3ZHQA 3TETA 2ZXWB 3QO8A 5CA3A 2B1IA 4GX0A 1QNMA 3OR7C 1D2DA 2E75B 2DE0X 1CXZB 3OAAG 2IJJA 4XDJA 5H6RA 5EYPB 2Y69B 1QR9A 1ENVA 1D5NA 4J7ZA 2D2CB 4D6TH 5B1AB 3K58A 2IJKA 4B3SB 4JI1B 4I4TA 2R72A 5EBWC 1M5IA 3Q4HB 3ICXA 4H44B 3G4SV 1Q82W 3OMNB 3CXHF 5H9CA 4YHHB 1JPXA 3FB8C 3OEHG 1FXKA 1JFFB 1KKCA 3CE2A 1YI2V 2G38A 3BA9A 2CGNA 1JCHA 4DXWA 5H2FZ 1L0LH 4K0KO 2P22C 2XOKG 1JVMA 1NR1A 4UVCA 4AQYO 5KX5B 2QDOA 4K3AA 3HKDB 5JJNB 2DMXA 1F4NA 4TQDA 4QGPA 4XDKA 4J11A 4X66O 1QHTA 3IJ4A 4UCRA 3BCCH 2DOSA 1I5YA 4NXMB 3E8HA 1AI4A 4F6RB 2F4VB 4DV0O 1N0NA 1VIBA 3B8NA 3LSUA 1XILA 1N36O 1S0VA 3ZBHA 4DR2O 2UXDB 1KP3A 4PI2A 3A8TA 1NKDA 5BXZA 5KA6A 1GK9A 3RFRA 3K06A 2ZQMA 4MVQA 5GONB 4LF5O 1RPOA 3N2GB 4FJCC 3ABKB 5EZYA 1IBLB 3DC5A 1G8MA 3CB2A 4IIJB 1J5EO 1NS1A 4DV2O 4ICGA 4TSFG 4B7KA 4GKJO 3KCXA 2KB1A 4X20B 1Q6UA 4PJ0Z 3CYOA 1UPGA 2BE3A 4UCTA 4FM0A 3F5TA 2Q7HA 2ZE8A 3SYOA 1N4CA 3E89A 3SYAA 3CCJV 1BCCH 5KUMA 4OX9O 4PDMA 4BIUA 5EYPA 1AI5A 3LSSA 3IC7A 5IDJA 3HKBB 4KP4A 1V54C 3J80N 1OCZB 3SJQC 4EFEA 3ZRXA 5LMNO 1S76D 1I7FA 2F66C 4QPJA 1GMGA 2JEUA 3Q4HA 1Q5OA 5KA5A 3JCUZ 3SPGA 4JI4O 5GTHZ 3ASNC 5L3DA 5AG2A 4J9YB 5IJ0B 1FJGO 3EXAA 1P7GA 2E74B 4DV3B 3SDLA 4DR4B 1MSDA 4WFBV 1XMQB 5JVDB 2WA3A 2Q68A 2VQEB 5KX5A 3K0DA 3HKDA 5LGTA 2KKWA 3JAMN 2UUBO 2JS3A 1Z5WA 2JGUA 2X6BA 1S5HC 3BVOA 1WP8A 3BPZA 1DF4A 2VQFO 4YY3B 4JI7O 4F6RA 4J10A 4WFFA 2N74A 3WB2A 1Z2GA 2QM4A 5BR8O 1S5LZ 3T4DA 5JQGB 1SA0B 1WLEA 2QKSA 5JWPA 2Y4UA 2QR4A 3G67A 1P7BA 5CN0A 3FD9A 1XDCA 4FFBB 1GM7A 2HJFC 5GONA 1AJPA 3N2GA 2EINC 3ABTA 2EILC 3J7AU 4OPHA 5D5QA 3ABUA 4IIJA 4GKKO 1WB8A 1NR7A 1ORQC 4LFAB 4TWKA 2WPDG 3K9SA 4KUMA 1MNGA 4X20A 2Q4PA 4EB6A 5HFMA 1K73W 2PYLA 1NTKH 1FPOA 1OZ0A 2CDYA 4LR3A 3VQVA 1UFIA 1HR0B 4LF6O 4FLYA 1N33B 1VQPV 1BT8A 1WN7A 4RWUA 3W7UA 4X62O 4DO2A 3MHSC 4I0XA 4IGGA 3RW0A 2NLJC 1EN6A 3JAWB 2UUAB 1VARA 1MZFA 1XL6A 4OGQB 1H2KA 3ZHTA 4DV1O 2Q73A 4ZHQB 4DV7B 2WLKA 4J7KA 2V1DA 4X88A 5IJ0A 1FYJA 2F23A 4MW8A 1FXHA 4IYIA 2DYRB 5LP6C 4DUYB 4WF9V 4JI2B 4PD4F 4UB8Z 1AB3A 2YXHA 2OYQA 2IBZH 1GKFA 1HNXO 5LMUO 3IGAC 4GX1A 2RMKB 2AZ0A 2YUAA 2EIMC 4DV4O 2HHHB 2EX3A 2GDSA 4TQFA 4UV8A 1K8AW 1WNSA 4YJ2B 4DYLA 3OMIB 3RWRD 4CZZA 2ZE7A 5HFLA 3CC4V 3G6EV 5JQGA 2XAGA 1BMFG 4DR5B 3AG2C 3CSXA 3T1YO 2R70A 2CE4A 3QG5A 1I08A 3B40A 3ASOC 5B1BC 1H2GA 1FXVA 3ETDA 3EHBB 3SJBC 1M56C 4JTAB 4O4IB 3CD6V 1L1FA 3HPLC 4B08A 3FFQA 2FTKA 4JYAO 3JD1A 4DR7B 4FZ1A 5LHGA 2DWDC 2WLLB 2ZXWC 2XAJA 3GWKC 1XI1A 3RVYA 1RP3B 2OIGA 2Q69A 4R6ZA 4FMTA 1M90W 3AG4C 4P9OA 2EULA 3E35A 3K9AA 3JATA 2GTAA 1N32B 2EINB 3KG2A 3OR6C 1H2MA 1XREA 2Y69C 3UCSC 1Y67A 3J81N 4CBCA 3RYIB 1YTFD 1DGSA 3JAWA 3T1HB 1SQFA 1VF5B 1VMGA 4DR3O 4CS2A 3T2MA 3CRMA 4ZHQA 4E4EA 1K5SA 5LGNA 3SYPA 2ITDC 2M7WA 3GB7C 1M1KW 1S5JA 4RUEA 2HR3A 2CGOA 1V55C 2XHBA 3CCUV 1KYOF 5LBQA 1B6QA 2OWOA 1DTOA 2BTQB 2DN9A 1Y76B 1ZLZA 4YIOA 3FYIB 4U3JB 2W6IG 3A0HZ 3N27A 3JSNA 4J9ZB 3DSQA 3K0GA 5TISZ 5EBMC 4YJ2A 2PI4A 3P30A 4DV6B 4IYHA 4D7SA 4R7CA 1W59A 5LP6B 1K4DC 1Y74A 5L3GA 3B77A 1GTOA 4JAAA 3CRCA 4I55B 2OIEA 3CPWU 4RAIA 1JA8A 5EC2C 5GTIZ 1BHAA 4DW1A 3OUFA 1FKAO 4WCEV 2NNUA 1G1XB 3ABKC 4O4IA 3K57A 1THZA 2X0LA 2ZT9B 4B3RB 5FPRA 1Q6IA 1YJNV 4FM2A 1RPRA 2WLLA 3BABA 4MTFA 5IYDO 4YHHO 1OHHG 2O57A 5CB4B 3SPJA 1MOFA 4JTDB 4ZIBA 1CPYA 5B1BB 2OCHA 5E1AC 5EIBD 4PA6A 4B3MB 4X64O 1XHXA 4FVMA 5IY5C 1M56B 3TCUA 3CCRV 1IBKB 3RYIA 1XOUA 4KXRA 1I94B 4FLZA 5A9GA 5LYJB 1SQPH 3CX5F 5JH7B 3AK2A 4BW9A 1OCZC 5L3FA 1H8EG 2ZR2A 4ZBMA 2M6YA 5KAFZ 4HBNA 3UT5B 2QM8A 1W0JG 3L9DA 4PI0A 1GN6A 2P90A 1XMOO 1SF9A 1EN4A 1OCCC 3AG4B 4QE9A 5LHHA 1K97A 3H1KH 4PHZA 2JDIG 4WFAV 4B3TB 2GHYA 2JK5C 3LSQA 2A79B 2UXDO 3TXSA 4JI6B 1K34A 4K35A 1SQGA 1Y76A 4UCUA 1FS0G 4G28B 5J2UB 4DV5O 3SYCA 4JTCB 4HYOA 1YDXA 2P7TC 3QF7A 1IBLO 5CA0B 4O4LA 4JZ2A 4DUZB 4CH6A 4IHJB 4U3JA 2D3OW 3B8MA 2AW9A 5B5EZ 2ARHA 1Q81W 5IYZA 4GX2A 2KSDA 3I55V 3DGEA 4JI3O 3E83A 5LP6A 1AILA 1V55B 3BEHA 2A9HA 4UCVA 1FAFA 1IDSA 4I55A 3ZMZA 4X65O 4UB6Z 2IH3C 5BMVB 2E3CA 4LWSB 3ZHVA 4LF9B 2ILMA 4H33A 3LNMB 1HNZO 3MDSA 1XBLA 2DWEC 1ZSPA 3OGCC 3WFVA 1KUQA 5KMGA 3JYCA 3PJSK 3OUSA 2WA4A 1PV0A 3CC7V 5B1OA 1QR8A 2P06A 4LF8B 3ZJZA 3P3PA 3OMAB 2PY5A 3VQWA 1G4YB 4ASUG 2YS8A 1GM8A 2CTQA 1WJZA 5J9PC 1XQ8A 3E8BA 5CB4A 2EZOA 5E79Z 2JGDB 4GZRB 2ZCEA 4DV3O 1RFYA 1Y4MA 1YITV 2Q6AA 2C2AA 2N05A 3CCMV 3MHHC 1XMQO 1DK1A 4P9PA 3G80A 2VQEO 3VQYA 3OW2U 1AI7A 5LYJA 1PNLA 3FKSG 3ZX6A 3I56V 1LUWA 4YXWG 2WLNA 3UT5A 5F2VO 1AR1B 4KL1A 2HP8A 1GH6A 2E5LB 3RYHB 4YY3O 1EN5A 5A2QN 2KG7B 4LFBB 1ZTEA 4NTYA 3X2QB 5C8YB 1BQ0A 1QQCA 2W0XA 3SYQA 3WG7C 2XNDG 1AVMA 2ZM6B 4MVUA 3STZC 1XNQB 2DYRC 3A0BZ 5IY5B 3D8CA 1VQNV 2GSMB 3H1IH 3EVKA 4MW3A 1URFA 3ABLB 3KKYA 2YI8A 5J2UA 2HJDA 2LO1A 2FKXA 3W7XA 2JS5A 5CA0A 4EKWA 3CC2V 5EC1C 4IHJA 1LUVA 2A7WA 3FB7C 4AQYB 3QTCA 4LFAO 1OCCB 3CXCU 1JJ2U 2W6JG 5KAIZ 1R6KA 2UXXA 1F23A 1PKXA 4ZI7B 2MW2B 1JFFA 2ZKOA 4OXSA 4Z1VA 3NXSA 1VEWA 2QWQB 4LF4B 2Q5ZA 4GYCB 4LCUC 1AJNA 3OM3B 3JCZA 1N33O 1FFXB 5BMVA 2DQ3A 3ZN1A 2QGNA 4LWSA 4DV0B 4TUYB 1XNRB 1VF7A 4RQFA 4LF7O 3JARB 4BIZA 1N36B 3ZEDA 3H1HH 1WP7A 1VQLV 3CMEV 5LXTB 1COWG 1SS3A 4O2BB 3FX7A 2HKOA 2YSUB 1QVFU 3GVMA 3JASB 4LF5B 2MK3A 1Q7YW 3JD0A 3BRCA 3OEEG 3H01A 5JCOA 2LW1A 4DV2B 3F7VC 2CTWA 4EFBA 5CBFA 1E1RG 2JGDA 4MVSA 2ADQB 3M7MX 3QVNA 5EIBC 4DUYO 4JI2O 5GW7A 3CMAV 4ABMA 3CP1A 4LNUB 3ZCCA 4MTOA 4JGSA 3RGBA 2KQXA 3CRAA 2OTJV 3OE7G 1JX9A 1YIJV 5H6QA 2Y4TA 4IL6Z 1OJHA 5LHIA 3SGIA 3E8GA 2QKCA 2HHHO 3MD0A 2A06H 4E2LA 1Y6XA 2EBOA 4PDVA 1XL4A 3RYHA 3ETQA 2KG7A 3SPHA 3D36C 1US6A 3DXRB 5C8YA 3JSLA 1P4RA 4X1KB 1Q6HA 4JI4B 2HLDG 4DR5O 1BGYH 2FYUH 4EEQA 2QM7A 2IJIA 1PNKA 2AXTZ 2WLMA 5CMUA 3A0RA 5K1PA 3HKBA 3G71V 1FJGB 5K1XA 2JIZG 2WLJA 4ZOLB 3B4SA 1XHZA 2L35A 1ZL8B 1NH2B 4W4LA 5LOVB 2H8PC 3EFFK 4FK5C 1YSCA 2EZPA 3M8AA 4JI0B 4DR7O 4ZI7A 3K59A 4WFHA 3WG7B 1VQMV 3ZHRA 2BSKB 4O4HB 4JI5O 4I50B 1GM9A 1GN4A 1MA1A 1FFXA 2F1MA 1F7YA 2LFSA 4FLXA 5JVDA 4TUYA 5BR8B 1IBMB 2ZIMA 1F51A 1N32O 2UUCB 1N34O 2RDCA 1QCEA 4MSWC 2OCCC 2RN9A 2LW7A 4JI8B 2CTRA 2Y0IA 1YEWA 1WA8B 4JF3A 5LXTA 2B5UA 4O2BA 3T1HO 3JASA 3CCLV 3ZHUA 1K4CC 4JV5O 1K3EA 4KFMA 2QA4V 4L8JA 2PF4E 4PELA 3L71H 1SA0A 4NXNO 3ZMTA 1DLBA 3S3WA 2NN4A 2XUMA 2K1EA 4MT8A 4UUJC 5KLVH 2HG5C 4QIWF 1NTMH 3LDDA 4FFBA 4FLWA 3K04A 4LNUA 2Z3YA 2Y48A 1V9PA 4LF6B 5KHJA 3CCSV 3SJCC 3L75H 4PDRA 4O4JB 3K08A 1FFTB 2EJ7A 5CA1B 5LA6B 1JOYA 2JJ2G 3AG3B 2WLHA 3DC6A 2RJZA 3KCYA 4Z2WA 1YF2A 2JEXA 5L3BA 4DV6O 2AGAA 4FIPC 2UXCB 5EBLC 1UJWB 4TV9B 4X1KA 1SETA 2F93B 2R9RB 2QE7G 4LH7A 4QPKA 1HNWO 1NU1H 2Q7GA 3HKEB 1QU7A 2QTSA 1R6NA 4TT3G 2LJ2A 1BSMA 1IZ3A 1TUBB 1J95A 2JJ1G 3OGIB 1WPBA 1JMKC 4GT1A 5KUKA 1PP9H 4DR1O 2VS0A 1ZL8A 1MG1A 5LOVA 1HW7A 3LUTB 1AR4A 4O2AB 2ZR3A 5LMUB 3UQ8A 3CCVV 1WPXA 1NH2D 2Q67A 3VOUA 4DV4B 4J42A 2ZD9A 1GN2A 1BE3H 1SQQH 5IWAO 4H0LB 2UU9B 2BSKA 4O4HA 4I50A 4CS4A 1NJIW 1QLEB 5CBHA 1Y66A 4PDLA 1RM1B 1PL0A 3AG1B 3CRRA 1AP5A 4BIOA 5LL6Y 1VQ9V 1SESA 1WA8A 1I94O 3LDEA 3ZRSA 2A3QA 4LC1A 3D3QA 3W7TA 4AILC 2AHYA 4GCZA 3U11A 3K5LA 1S72V 1TGOA 2DYSC 2W0FC 1D5AA 1BS3A 1K92A 3CHXA 1NTZH 5JCOC 5FNVB 2CH7B 1HP8A 4FZ0A 4B3TO 2OCCB 4LH6A 3C3SA 2B9ZA 1M57B 4JI6O 1WB7A 1EM1A 3IC9A 4NTWA 1XUQA 1ZUQA 4BR6A 4P30A 4B3SO 4JI1O 4U7NA 3HKCB 2RCVA 2PZSA 4O4JA 4LFCB 5CA1A 5LA6A 2Q0OC 1E1QG 2EIKB 3WU2Z 3IAYA 4KHPB 1EZVH 3ETEA 1HWYA 4CC5A 4K8XA 1W0KG 1O9GA 3CCQV 3B09A 1F4MA 3X2QC 4TV9A 1X59A 4X8AA 3RYFB 1GN3A 2XAFA 2V4DA 3HKEA 2X6CA 2ZNJA 4GUNA 1GAXA 4LF9O 2HEPA 2QSAA 3FAVB 1M4UA 1KMIZ 4FFKA 4MTGA 3ABLC 3O9OA 3L70H 4G2KA 4PA7A 3JD2A 1N8RW 4DW0A 2YIDA 3D36A 4NXMO 1SC5B 3CRQA 1KQSU 4LF8O 5EZYB 2F4VO 1TAEA 2P4VA 3ZHSA 1E79G 4DRXB 4JPRA 4X1IB 1VF6C 2QWRB 2UXBB 4BAYA 2BTQA 2GUZB 2R9IA 4JYYA 1KBHA 4G27B 2ZDIC 2ZNIA 4FLTA 2QWOB 3SJAC 4DR6B 4U3FH 4MTXA 4NR1A 2IM9A 4H13B 1Q3EA 4CC6A 1AR5A 2AZ2A 2QWPB 2E5LO 4WBNB 4LFBO 1GRJA 2YXYA 3C3TA 5FNVA 4JASA 2WSSG 2CH7A 1VQ4V 3LNNA 2BOBC 4XBFA 1R73A 2ZM6O 1YJ9V 4CS3A 1XNQO 2UXNA 1L8DA 3R65A 3OTOB 1SQVH 1YCIA 4J80A 2QJ1A 4PA4A 2GV9A 4MVZA 3E8FA 4JAUA 3HKCA 2DYSB 4X64B 2Z5UA 1Z5VA 4GX5A 4YJ3B 1OCRB 2HVJC 5DM6V 4LBEC 4RQEA 3CS5A 5B1NA 4LF4O 2CTPA 2FB5A 3RYFA 4DR4O 5KHKA 4UCSA 1XMOB 2BTOA 1CEZA 1XNRO 1PNMA 3FAVA 1NQTA 1AP6A 2YEVB 5JH7A 2IU0A 4JZGA 1NBMG 3JALB 5IJ9B 3OTFA 2WLIB 4YIPA 3AEIA 1EZJA 2IW5A 3CJHB 4DV5B 1Q43A 1B3QA 1WAZA 4QE7A 5IYBO 2X7RB 3H9VA 2YIAA 1H38A 3RBZA 1IXMA 3RVZA 3JAKB 4DRXA 5IE9A 4RO2A 2YDEA 4X1IA 4W4KA 4JI3B 4EB6B 2PUSA 1YJWV 1IVSA 2EJRA 2GUZA 4HAMA 5IT9N 1PPJH 4K0KB 4X65B 2GTSA 3APQA 3DTUB 4JAVA 4F6EA 4PV1B 3UO3A 2XAQA 1HNZB 4I0XB 1I5XA 2F43G 3MAQA 1H2NA 4P2ZA 4NB5A 2B1GA 2FL4A 4WBNA 1OCOB 3ABMC 4X66B 2Q8VA 3R66A 3D3IA 3RYCB 1HR0O 2P4KA 2YI9A 2WAMA 1KECA 4Z1MG 3AK3A 4I5SA 3CEIA 5D5PA 2LGQA 3W7SA 4CH3A 2CK3G 3K3WA 4HNAB 1BZKA 1QBZA 4DR2B 1IURA 1NT2B 1P49A 2N04A 4TOIA 3L72H 5B3SC 1H2LA 5L3CA 2A0LA 4I9QA 1R3LC 5DEDA 3U0ZA 2UUAO 1AI6A 4AHCA 4F4LA 4AI8A 2ZINA 3I5DA 1NVPB 3VBBA 3GWOA 3ML0A 3K5MA 4PA9A 3CWBH 4N21A 3AG7A 4YJ3A 4DV7O 1J5EB 2ZE5A 3AG3C 4QNHB 3E2EA 4JI0O 2CAZC 4CH4A 3NR7A 2RQ6A 4GKJB 1W2BU 2ZIOA 3KZIZ 4JYCA 2ATKC 3F5WC 1CP9A 2IJHA 4J41A 4CH5A 1IX9A 1IBMO 1N0JA 2LQTA 1RSOB 2UUCO 4OX9B 2DW4A 3WB0A 2YEVA 3JD3A 4JI8O 1R1BA 3T1CA 3ZMUA 1OV9A 3JALA 4R50A 3SR2C 3TXQA 5IJ9A 4LP8A 2WLIA 2VRZA 1VQ6V 1B04A 4NTXA 4FLVA 3CJHA 2QTOA 3T4ZA 5LMNB 4UV9A 4NVPA 2XT9A 3RT3C 1U97A 4X9QA 1M93A 4PA3A 5L3EA 4X89A 1ZAUA 2V7QG 1SQBH 3JAKA 3QO5A 4DK1A 5ITZB 1QLEC 2EIJC 1S3JA 1RM1C 1MZEA 1L0NH 1M9NA 3AG1C 1YXBA 4Q6GA 4L87A 3K03A 1TUEB 2BOCC 3CCEV 3JATB 2Z0AA 1YTFB 1AJQA 4TV8B 3L74H 3P3NA 1KC8W 4LF7B 2OT5A 4A5UB 2DQ0A 2UUBB 1U96A 1MABG 2QWNB 4FM1A 3E22B 2VQFB 1Q8IA 1VF6A 3RYCA 3BFRA 2UXCO 4JI7B 1BL8A 5B66Z 5LGUA 3B2EE 5EK0A 4N23A 2Q0AA 1K9MW 4BWAA 3ZN0A 3RN4A 3JARA 2LFRA 2ZDIA 3BA8A 1K5QA 1QVGU 4HNAA 1M57C 5IYCO 1QLNA 1VQ8V 4FPPA 2XTAA 3O65A 1FXKC 2YXLA 4J7JA 3HB3B 4C7UA 1SZXA 3FB6C 4MVOA 1GO3F 3OD4A 2JRIA 4JYBA 1V54B 3HR0A 1VQ5V 2CUGA 4DK0A 3ABMB 2EIKC 2AHZA 2NR5A 4GKKB 5H5NA 1NVPD 2PGGA 1PL4A 3OT7A 3ZS8C 3QNEA 1X4TA 2OTLV 1PD3A 3JD4A 2PTMA 3FB5C 4H37A 1SRYA 3ASNB 2UU9O 1BHBA 3THOA 5DN6G 5JJJB 2DJVA 3UM7A 5KHGA 3ZRVA 1EBOA 2P6JA 4WFGA 5B3SB 3N2KB 1RSOA 3K5OA 1T5EA 2HVKC 4XDLA 1Y74B 1I0HA 3AK1A 3BY6A 4Q20A 4X62B 1DF5A 1MMMA 1R3KC 4UVBA 1KB9F 1PM9A 4B7EA 2YIBA 5FPOA 1VQ7V 4RUFA 4X1YB 3ZRWB 1BQZA 1JR9A 2YIBD 2F95B 5J2TB 3DXRA 1KKDA 4D7TA 1B06A 3H1LH 1P84F 1TVKB 4DV1B 1YZBA 3BHPA 1KD1W 1ZWIC 3K79A 1SZTA 2QKAA 5ITZA 1VP7A 2Y0PA 3UO2A 2L6LA 1ROPA 3K5NA 1O9HA 5KHHA 4JI5B 2R9AA 4NYKA 5C93A 4ZOLA 3SPCA 2ETNA 3C90A 2K9PA 3U10A 3ZMVA 3TK1A 1IXBA 3A2FA 1Q90D 1HNXB 3OFNG 1N34B 4UCOA 4TV8A 4LFCO 2H3OA 2EILB 4HZ3A 4I9WA 3TJTA 1SKVA 2LGWA 3IFXA 3SPIA 4B3RO 4KHPO 3APOA 1MSWD 2XASA 1SQXH 5B1AC 3E22A 4MS2A 5JJEB 2WWWA 3QO7A 2EIJB 4JV5B
chains in the Genus database with same CATH topology
2JRIA 1G1XB 2FKXA 2DOSA 5BY1A 1IBMO 4B3MO 4DV1O 4X65O 2UUCO 5H5NA 4DV0O 4DR5O 4LFAO 1IBKO 4JI8O 3J81N 1XEQA 1R1BA 1HNZO 3JAMN 4B3TO 1N36O 2UUBO 1FYJA 4DR2O 1A32A 2UU9O 4YHHO 4OPAA 4JI6O 2ZKOA 5BXZA 4DV6O 1KUQA 2AGAA 4DR3O 2DJVA 2VQFO 2E5LO 5IT9N 1AB3A 4JI7O 4LFBO 3RT3C 4LF5O 4B3SO 1N33O 2N74A 4JI1O 5BR8O 1HNXO 5LMUO 4X64O 1HNWO 1D2DA 1R6TA 1J5EO 4DV4O 1NS1A 4LF7O 3M8AA 4DV2O 2ZM6O 4DR7O 1XNQO 4GKJO 4JI5O 4DV3O 4DR1O 2UXBO 1X59A 3R66A 3F5TA 1F7YA 1HR0O 1XMQO 1XMOO 1DK1A 3J7AU 4OPHA 4GKKO 1N32O 2VQEO 1N34O 4OX9O 1YZBA 2Z0AA 4DUZO 3T1YO 4LF9O 2LW7A 1FKAO 4DR6O 4A5UB 5IWAO 1AILA 3T1HO 2UXDO 4DUYO 5FLXN 4JI2O 3J80N 4LF4O 4YY3O 2UXCO 4JV5O 5A2QN 4DR4O 5LMNO 2UUAO 4DV5O 4LF6O 4K0KO 4NXMO 1IBLO 1XNRO 4LF8O 4LFCO 2F4VO 5LL6Y 4DV7O 4JI4O 4NXNO 4X62O 4AQYO 1I94O 4JI0O 4JYAO 4B3RO 2HHHO 4KHPO 3OTOO 3O65A 1FJGO 4JI3O 4X66O 3SDLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI A;  1G1X B;  2FKX A;  2DOS A;  5BY1 A;  1IBM O;  4B3M O;  4DV1 O;  4X65 O;  2UUC O;  5H5N A;  4DV0 O;  4DR5 O;  4LFA O;  1IBK O;  4JI8 O;  3J81 N;  1XEQ A;  1R1B A;  1HNZ O;  3JAM N;  4B3T O;  1N36 O;  2UUB O;  1FYJ A;  4DR2 O;  1A32 A;  2UU9 O;  4YHH O;  4OPA A;  4JI6 O;  2ZKO A;  5BXZ A;  4DV6 O;  1KUQ A;  2AGA A;  4DR3 O;  2DJV A;  2VQF O;  2E5L O;  5IT9 N;  1AB3 A;  4JI7 O;  4LFB O;  3RT3 C;  4LF5 O;  4B3S O;  1N33 O;  2N74 A;  4JI1 O;  5BR8 O;  1HNX O;  5LMU O;  4X64 O;  1HNW O;  1D2D A;  1R6T A;  1J5E O;  4DV4 O;  1NS1 A;  4LF7 O;  3M8A A;  4DV2 O;  2ZM6 O;  4DR7 O;  1XNQ O;  4GKJ O;  4JI5 O;  4DV3 O;  4DR1 O;  2UXB O;  1X59 A;  3R66 A;  3F5T A;  1F7Y A;  1HR0 O;  1XMQ O;  1XMO O;  1DK1 A;  3J7A U;  4OPH A;  4GKK O;  1N32 O;  2VQE O;  1N34 O;  4OX9 O;  1YZB A;  2Z0A A;  4DUZ O;  3T1Y O;  4LF9 O;  2LW7 A;  1FKA O;  4DR6 O;  4A5U B;  5IWA O;  1AIL A;  3T1H O;  2UXD O;  4DUY O;  5FLX N;  4JI2 O;  3J80 N;  4LF4 O;  4YY3 O;  2UXC O;  4JV5 O;  5A2Q N;  4DR4 O;  5LMN O;  2UUA O;  4DV5 O;  4LF6 O;  4K0K O;  4NXM O;  1IBL O;  1XNR O;  4LF8 O;  4LFC O;  2F4V O;  5LL6 Y;  4DV7 O;  4JI4 O;  4NXN O;  4X62 O;  4AQY O;  1I94 O;  4JI0 O;  4JYA O;  4B3R O;  2HHH O;  4KHP O;  3OTO O;  3O65 A;  1FJG O;  4JI3 O;  4X66 O;  3SDL A; 
#chains in the Genus database with same CATH topology
 2JVD A;  3TGU H;  3M99 B;  4QJF B;  2P5O A;  5BY1 A;  2HFE C;  4B3M O;  5BZB A;  5KHI A;  1NI8 A;  4NXN B;  3L73 H;  3T1Y B;  1IBK O;  2H94 A;  2IH1 C;  2ADP A;  1G6U A;  1SER A;  4UFZ A;  3LDC A;  1LR1 A;  3UKM A;  1YHQ V;  2PI5 A;  1YVW A;  4FLU A;  1JQ0 A;  1H2S B;  4I4T B;  1R6T A;  1OCR C;  4O4L B;  3F7Y C;  2LP7 A;  2E76 B;  4JYA B;  4MVM A;  4UVA A;  5IYZ B;  2FML A;  1KP2 A;  2X6A A;  1FD9 A;  3PN1 A;  4R8C A;  1NZ6 A;  4IT5 A;  4U7O A;  2PYJ A;  1FXK B;  3N2K A;  1TA8 A;  2UXB O;  4I7Z B;  2IU3 A;  3W7W A;  1HNW B;  3G6B A;  4NKG B;  4K8Z A;  4DUZ O;  1Q86 W;  3STL C;  1K33 A;  4DR6 O;  4WFE A;  2XAH A;  2EIM B;  2RNB A;  1JJO A;  1LNQ A;  3VQX A;  4X1Y A;  3ZRW A;  5FLX N;  4BW5 A;  2Q7E A;  4ZKI A;  5J2T A;  4DR1 B;  2BCC H;  4DR3 B;  1K7D A;  3WB1 A;  2ODM A;  3FYE B;  1EFR G;  5KMG B;  3BAA A;  1TVK A;  3S3X A;  4MVR A;  1R3I C;  3H1J H;  4GLX A;  3E86 A;  3AG2 B;  3ZMS A;  5IWA B;  3OTO O;  1R3J C;  1TUB A;  2VWK A;  5FL7 G;  2YIC A;  2Q9L A;  1ZX3 A;  2QEX V;  2YC0 A;  1HDJ A;  5DEC A;  3ASO B;  3P32 A;  1KU9 A;  4O2A A;  1VQK V;  1VQO V;  3ETG A;  5CBG A;  2GBO A;  1XEQ A;  1S77 D;  4UXN A;  2VWJ A;  1A32 A;  3ZIA G;  1OCO C;  2ZE6 A;  1ARO P;  1H8H G;  2ITC C;  2P67 A;  4OPA A;  3ZHQ A;  3TET A;  2ZXW B;  3QO8 A;  5CA3 A;  2B1I A;  4GX0 A;  1QNM A;  3OR7 C;  1D2D A;  2E75 B;  2DE0 X;  1CXZ B;  3OAA G;  2IJJ A;  4XDJ A;  5H6R A;  5EYP B;  2Y69 B;  1QR9 A;  1ENV A;  1D5N A;  4J7Z A;  2D2C B;  4D6T H;  5B1A B;  3K58 A;  2IJK A;  4B3S B;  4JI1 B;  4I4T A;  2R72 A;  5EBW C;  1M5I A;  3Q4H B;  3ICX A;  4H44 B;  3G4S V;  1Q82 W;  3OMN B;  3CXH F;  5H9C A;  4YHH B;  1JPX A;  3FB8 C;  3OEH G;  1FXK A;  1JFF B;  1KKC A;  3CE2 A;  1YI2 V;  2G38 A;  3BA9 A;  2CGN A;  1JCH A;  4DXW A;  5H2F Z;  1L0L H;  4K0K O;  2P22 C;  2XOK G;  1JVM A;  1NR1 A;  4UVC A;  4AQY O;  5KX5 B;  2QDO A;  4K3A A;  3HKD B;  5JJN B;  2DMX A;  1F4N A;  4TQD A;  4QGP A;  4XDK A;  4J11 A;  4X66 O;  1QHT A;  3IJ4 A;  4UCR A;  3BCC H;  2DOS A;  1I5Y A;  4NXM B;  3E8H A;  1AI4 A;  4F6R B;  2F4V B;  4DV0 O;  1N0N A;  1VIB A;  3B8N A;  3LSU A;  1XIL A;  1N36 O;  1S0V A;  3ZBH A;  4DR2 O;  2UXD B;  1KP3 A;  4PI2 A;  3A8T A;  1NKD A;  5BXZ A;  5KA6 A;  1GK9 A;  3RFR A;  3K06 A;  2ZQM A;  4MVQ A;  5GON B;  4LF5 O;  1RPO A;  3N2G B;  4FJC C;  3ABK B;  5EZY A;  1IBL B;  3DC5 A;  1G8M A;  3CB2 A;  4IIJ B;  1J5E O;  1NS1 A;  4DV2 O;  4ICG A;  4TSF G;  4B7K A;  4GKJ O;  3KCX A;  2KB1 A;  4X20 B;  1Q6U A;  4PJ0 Z;  3CYO A;  1UPG A;  2BE3 A;  4UCT A;  4FM0 A;  3F5T A;  2Q7H A;  2ZE8 A;  3SYO A;  1N4C A;  3E89 A;  3SYA A;  3CCJ V;  1BCC H;  5KUM A;  4OX9 O;  4PDM A;  4BIU A;  5EYP A;  1AI5 A;  3LSS A;  3IC7 A;  5IDJ A;  3HKB B;  4KP4 A;  1V54 C;  3J80 N;  1OCZ B;  3SJQ C;  4EFE A;  3ZRX A;  5LMN O;  1S76 D;  1I7F A;  2F66 C;  4QPJ A;  1GMG A;  2JEU A;  3Q4H A;  1Q5O A;  5KA5 A;  3JCU Z;  3SPG A;  4JI4 O;  5GTH Z;  3ASN C;  5L3D A;  5AG2 A;  4J9Y B;  5IJ0 B;  1FJG O;  3EXA A;  1P7G A;  2E74 B;  4DV3 B;  3SDL A;  4DR4 B;  1MSD A;  4WFB V;  1XMQ B;  5JVD B;  2WA3 A;  2Q68 A;  2VQE B;  5KX5 A;  3K0D A;  3HKD A;  5LGT A;  2KKW A;  3JAM N;  2UUB O;  2JS3 A;  1Z5W A;  2JGU A;  2X6B A;  1S5H C;  3BVO A;  1WP8 A;  3BPZ A;  1DF4 A;  2VQF O;  4YY3 B;  4JI7 O;  4F6R A;  4J10 A;  4WFF A;  2N74 A;  3WB2 A;  1Z2G A;  2QM4 A;  5BR8 O;  1S5L Z;  3T4D A;  5JQG B;  1SA0 B;  1WLE A;  2QKS A;  5JWP A;  2Y4U A;  2QR4 A;  3G67 A;  1P7B A;  5CN0 A;  3FD9 A;  1XDC A;  4FFB B;  1GM7 A;  2HJF C;  5GON A;  1AJP A;  3N2G A;  2EIN C;  3ABT A;  2EIL C;  3J7A U;  4OPH A;  5D5Q A;  3ABU A;  4IIJ A;  4GKK O;  1WB8 A;  1NR7 A;  1ORQ C;  4LFA B;  4TWK A;  2WPD G;  3K9S A;  4KUM A;  1MNG A;  4X20 A;  2Q4P A;  4EB6 A;  5HFM A;  1K73 W;  2PYL A;  1NTK H;  1FPO A;  1OZ0 A;  2CDY A;  4LR3 A;  3VQV A;  1UFI A;  1HR0 B;  4LF6 O;  4FLY A;  1N33 B;  1VQP V;  1BT8 A;  1WN7 A;  4RWU A;  3W7U A;  4X62 O;  4DO2 A;  3MHS C;  4I0X A;  4IGG A;  3RW0 A;  2NLJ C;  1EN6 A;  3JAW B;  2UUA B;  1VAR A;  1MZF A;  1XL6 A;  4OGQ B;  1H2K A;  3ZHT A;  4DV1 O;  2Q73 A;  4ZHQ B;  4DV7 B;  2WLK A;  4J7K A;  2V1D A;  4X88 A;  5IJ0 A;  1FYJ A;  2F23 A;  4MW8 A;  1FXH A;  4IYI A;  2DYR B;  5LP6 C;  4DUY B;  4WF9 V;  4JI2 B;  4PD4 F;  4UB8 Z;  1AB3 A;  2YXH A;  2OYQ A;  2IBZ H;  1GKF A;  1HNX O;  5LMU O;  3IGA C;  4GX1 A;  2RMK B;  2AZ0 A;  2YUA A;  2EIM C;  4DV4 O;  2HHH B;  2EX3 A;  2GDS A;  4TQF A;  4UV8 A;  1K8A W;  1WNS A;  4YJ2 B;  4DYL A;  3OMI B;  3RWR D;  4CZZ A;  2ZE7 A;  5HFL A;  3CC4 V;  3G6E V;  5JQG A;  2XAG A;  1BMF G;  4DR5 B;  3AG2 C;  3CSX A;  3T1Y O;  2R70 A;  2CE4 A;  3QG5 A;  1I08 A;  3B40 A;  3ASO C;  5B1B C;  1H2G A;  1FXV A;  3ETD A;  3EHB B;  3SJB C;  1M56 C;  4JTA B;  4O4I B;  3CD6 V;  1L1F A;  3HPL C;  4B08 A;  3FFQ A;  2FTK A;  4JYA O;  3JD1 A;  4DR7 B;  4FZ1 A;  5LHG A;  2DWD C;  2WLL B;  2ZXW C;  2XAJ A;  3GWK C;  1XI1 A;  3RVY A;  1RP3 B;  2OIG A;  2Q69 A;  4R6Z A;  4FMT A;  1M90 W;  3AG4 C;  4P9O A;  2EUL A;  3E35 A;  3K9A A;  3JAT A;  2GTA A;  1N32 B;  2EIN B;  3KG2 A;  3OR6 C;  1H2M A;  1XRE A;  2Y69 C;  3UCS C;  1Y67 A;  3J81 N;  4CBC A;  3RYI B;  1YTF D;  1DGS A;  3JAW A;  3T1H B;  1SQF A;  1VF5 B;  1VMG A;  4DR3 O;  4CS2 A;  3T2M A;  3CRM A;  4ZHQ A;  4E4E A;  1K5S A;  5LGN A;  3SYP A;  2ITD C;  2M7W A;  3GB7 C;  1M1K W;  1S5J A;  4RUE A;  2HR3 A;  2CGO A;  1V55 C;  2XHB A;  3CCU V;  1KYO F;  5LBQ A;  1B6Q A;  2OWO A;  1DTO A;  2BTQ B;  2DN9 A;  1Y76 B;  1ZLZ A;  4YIO A;  3FYI B;  4U3J B;  2W6I G;  3A0H Z;  3N27 A;  3JSN A;  4J9Z B;  3DSQ A;  3K0G A;  5TIS Z;  5EBM C;  4YJ2 A;  2PI4 A;  3P30 A;  4DV6 B;  4IYH A;  4D7S A;  4R7C A;  1W59 A;  5LP6 B;  1K4D C;  1Y74 A;  5L3G A;  3B77 A;  1GTO A;  4JAA A;  3CRC A;  4I55 B;  2OIE A;  3CPW U;  4RAI A;  1JA8 A;  5EC2 C;  5GTI Z;  1BHA A;  4DW1 A;  3OUF A;  1FKA O;  4WCE V;  2NNU A;  1G1X B;  3ABK C;  4O4I A;  3K57 A;  1THZ A;  2X0L A;  2ZT9 B;  4B3R B;  5FPR A;  1Q6I A;  1YJN V;  4FM2 A;  1RPR A;  2WLL A;  3BAB A;  4MTF A;  5IYD O;  4YHH O;  1OHH G;  2O57 A;  5CB4 B;  3SPJ A;  1MOF A;  4JTD B;  4ZIB A;  1CPY A;  5B1B B;  2OCH A;  5E1A C;  5EIB D;  4PA6 A;  4B3M B;  4X64 O;  1XHX A;  4FVM A;  5IY5 C;  1M56 B;  3TCU A;  3CCR V;  1IBK B;  3RYI A;  1XOU A;  4KXR A;  1I94 B;  4FLZ A;  5A9G A;  5LYJ B;  1SQP H;  3CX5 F;  5JH7 B;  3AK2 A;  4BW9 A;  1OCZ C;  5L3F A;  1H8E G;  2ZR2 A;  4ZBM A;  2M6Y A;  5KAF Z;  4HBN A;  3UT5 B;  2QM8 A;  1W0J G;  3L9D A;  4PI0 A;  1GN6 A;  2P90 A;  1XMO O;  1SF9 A;  1EN4 A;  1OCC C;  3AG4 B;  4QE9 A;  5LHH A;  1K97 A;  3H1K H;  4PHZ A;  2JDI G;  4WFA V;  4B3T B;  2GHY A;  2JK5 C;  3LSQ A;  2A79 B;  2UXD O;  3TXS A;  4JI6 B;  1K34 A;  4K35 A;  1SQG A;  1Y76 A;  4UCU A;  1FS0 G;  4G28 B;  5J2U B;  4DV5 O;  3SYC A;  4JTC B;  4HYO A;  1YDX A;  2P7T C;  3QF7 A;  1IBL O;  5CA0 B;  4O4L A;  4JZ2 A;  4DUZ B;  4CH6 A;  4IHJ B;  4U3J A;  2D3O W;  3B8M A;  2AW9 A;  5B5E Z;  2ARH A;  1Q81 W;  5IYZ A;  4GX2 A;  2KSD A;  3I55 V;  3DGE A;  4JI3 O;  3E83 A;  5LP6 A;  1AIL A;  1V55 B;  3BEH A;  2A9H A;  4UCV A;  1FAF A;  1IDS A;  4I55 A;  3ZMZ A;  4X65 O;  4UB6 Z;  2IH3 C;  5BMV B;  2E3C A;  4LWS B;  3ZHV A;  4LF9 B;  2ILM A;  4H33 A;  3LNM B;  1HNZ O;  3MDS A;  1XBL A;  2DWE C;  1ZSP A;  3OGC C;  3WFV A;  1KUQ A;  5KMG A;  3JYC A;  3PJS K;  3OUS A;  2WA4 A;  1PV0 A;  3CC7 V;  5B1O A;  1QR8 A;  2P06 A;  4LF8 B;  3ZJZ A;  3P3P A;  3OMA B;  2PY5 A;  3VQW A;  1G4Y B;  4ASU G;  2YS8 A;  1GM8 A;  2CTQ A;  1WJZ A;  5J9P C;  1XQ8 A;  3E8B A;  5CB4 A;  2EZO A;  5E79 Z;  2JGD B;  4GZR B;  2ZCE A;  4DV3 O;  1RFY A;  1Y4M A;  1YIT V;  2Q6A A;  2C2A A;  2N05 A;  3CCM V;  3MHH C;  1XMQ O;  1DK1 A;  4P9P A;  3G80 A;  2VQE O;  3VQY A;  3OW2 U;  1AI7 A;  5LYJ A;  1PNL A;  3FKS G;  3ZX6 A;  3I56 V;  1LUW A;  4YXW G;  2WLN A;  3UT5 A;  5F2V O;  1AR1 B;  4KL1 A;  2HP8 A;  1GH6 A;  2E5L B;  3RYH B;  4YY3 O;  1EN5 A;  5A2Q N;  2KG7 B;  4LFB B;  1ZTE A;  4NTY A;  3X2Q B;  5C8Y B;  1BQ0 A;  1QQC A;  2W0X A;  3SYQ A;  3WG7 C;  2XND G;  1AVM A;  2ZM6 B;  4MVU A;  3STZ C;  1XNQ B;  2DYR C;  3A0B Z;  5IY5 B;  3D8C A;  1VQN V;  2GSM B;  3H1I H;  3EVK A;  4MW3 A;  1URF A;  3ABL B;  3KKY A;  2YI8 A;  5J2U A;  2HJD A;  2LO1 A;  2FKX A;  3W7X A;  2JS5 A;  5CA0 A;  4EKW A;  3CC2 V;  5EC1 C;  4IHJ A;  1LUV A;  2A7W A;  3FB7 C;  4AQY B;  3QTC A;  4LFA O;  1OCC B;  3CXC U;  1JJ2 U;  2W6J G;  5KAI Z;  1R6K A;  2UXX A;  1F23 A;  1PKX A;  4ZI7 B;  2MW2 B;  1JFF A;  2ZKO A;  4OXS A;  4Z1V A;  3NXS A;  1VEW A;  2QWQ B;  4LF4 B;  2Q5Z A;  4GYC B;  4LCU C;  1AJN A;  3OM3 B;  3JCZ A;  1N33 O;  1FFX B;  5BMV A;  2DQ3 A;  3ZN1 A;  2QGN A;  4LWS A;  4DV0 B;  4TUY B;  1XNR B;  1VF7 A;  4RQF A;  4LF7 O;  3JAR B;  4BIZ A;  1N36 B;  3ZED A;  3H1H H;  1WP7 A;  1VQL V;  3CME V;  5LXT B;  1COW G;  1SS3 A;  4O2B B;  3FX7 A;  2HKO A;  2YSU B;  1QVF U;  3GVM A;  3JAS B;  4LF5 B;  2MK3 A;  1Q7Y W;  3JD0 A;  3BRC A;  3OEE G;  3H01 A;  5JCO A;  2LW1 A;  4DV2 B;  3F7V C;  2CTW A;  4EFB A;  5CBF A;  1E1R G;  2JGD A;  4MVS A;  2ADQ B;  3M7M X;  3QVN A;  5EIB C;  4DUY O;  4JI2 O;  5GW7 A;  3CMA V;  4ABM A;  3CP1 A;  4LNU B;  3ZCC A;  4MTO A;  4JGS A;  3RGB A;  2KQX A;  3CRA A;  2OTJ V;  3OE7 G;  1JX9 A;  1YIJ V;  5H6Q A;  2Y4T A;  4IL6 Z;  1OJH A;  5LHI A;  3SGI A;  3E8G A;  2QKC A;  2HHH O;  3MD0 A;  2A06 H;  4E2L A;  1Y6X A;  2EBO A;  4PDV A;  1XL4 A;  3RYH A;  3ETQ A;  2KG7 A;  3SPH A;  3D36 C;  1US6 A;  3DXR B;  5C8Y A;  3JSL A;  1P4R A;  4X1K B;  1Q6H A;  4JI4 B;  2HLD G;  4DR5 O;  1BGY H;  2FYU H;  4EEQ A;  2QM7 A;  2IJI A;  1PNK A;  2AXT Z;  2WLM A;  5CMU A;  3A0R A;  5K1P A;  3HKB A;  3G71 V;  1FJG B;  5K1X A;  2JIZ G;  2WLJ A;  4ZOL B;  3B4S A;  1XHZ A;  2L35 A;  1ZL8 B;  1NH2 B;  4W4L A;  5LOV B;  2H8P C;  3EFF K;  4FK5 C;  1YSC A;  2EZP A;  3M8A A;  4JI0 B;  4DR7 O;  4ZI7 A;  3K59 A;  4WFH A;  3WG7 B;  1VQM V;  3ZHR A;  2BSK B;  4O4H B;  4JI5 O;  4I50 B;  1GM9 A;  1GN4 A;  1MA1 A;  1FFX A;  2F1M A;  1F7Y A;  2LFS A;  4FLX A;  5JVD A;  4TUY A;  5BR8 B;  1IBM B;  2ZIM A;  1F51 A;  1N32 O;  2UUC B;  1N34 O;  2RDC A;  1QCE A;  4MSW C;  2OCC C;  2RN9 A;  2LW7 A;  4JI8 B;  2CTR A;  2Y0I A;  1YEW A;  1WA8 B;  4JF3 A;  5LXT A;  2B5U A;  4O2B A;  3T1H O;  3JAS A;  3CCL V;  3ZHU A;  1K4C C;  4JV5 O;  1K3E A;  4KFM A;  2QA4 V;  4L8J A;  2PF4 E;  4PEL A;  3L71 H;  1SA0 A;  4NXN O;  3ZMT A;  1DLB A;  3S3W A;  2NN4 A;  2XUM A;  2K1E A;  4MT8 A;  4UUJ C;  5KLV H;  2HG5 C;  4QIW F;  1NTM H;  3LDD A;  4FFB A;  4FLW A;  3K04 A;  4LNU A;  2Z3Y A;  2Y48 A;  1V9P A;  4LF6 B;  5KHJ A;  3CCS V;  3SJC C;  3L75 H;  4PDR A;  4O4J B;  3K08 A;  1FFT B;  2EJ7 A;  5CA1 B;  5LA6 B;  1JOY A;  2JJ2 G;  3AG3 B;  2WLH A;  3DC6 A;  2RJZ A;  3KCY A;  4Z2W A;  1YF2 A;  2JEX A;  5L3B A;  4DV6 O;  2AGA A;  4FIP C;  2UXC B;  5EBL C;  1UJW B;  4TV9 B;  4X1K A;  1SET A;  2F93 B;  2R9R B;  2QE7 G;  4LH7 A;  4QPK A;  1HNW O;  1NU1 H;  2Q7G A;  3HKE B;  1QU7 A;  2QTS A;  1R6N A;  4TT3 G;  2LJ2 A;  1BSM A;  1IZ3 A;  1TUB B;  1J95 A;  2JJ1 G;  3OGI B;  1WPB A;  1JMK C;  4GT1 A;  5KUK A;  1PP9 H;  4DR1 O;  2VS0 A;  1ZL8 A;  1MG1 A;  5LOV A;  1HW7 A;  3LUT B;  1AR4 A;  4O2A B;  2ZR3 A;  5LMU B;  3UQ8 A;  3CCV V;  1WPX A;  1NH2 D;  2Q67 A;  3VOU A;  4DV4 B;  4J42 A;  2ZD9 A;  1GN2 A;  1BE3 H;  1SQQ H;  5IWA O;  4H0L B;  2UU9 B;  2BSK A;  4O4H A;  4I50 A;  4CS4 A;  1NJI W;  1QLE B;  5CBH A;  1Y66 A;  4PDL A;  1RM1 B;  1PL0 A;  3AG1 B;  3CRR A;  1AP5 A;  4BIO A;  5LL6 Y;  1VQ9 V;  1SES A;  1WA8 A;  1I94 O;  3LDE A;  3ZRS A;  2A3Q A;  4LC1 A;  3D3Q A;  3W7T A;  4AIL C;  2AHY A;  4GCZ A;  3U11 A;  3K5L A;  1S72 V;  1TGO A;  2DYS C;  2W0F C;  1D5A A;  1BS3 A;  1K92 A;  3CHX A;  1NTZ H;  5JCO C;  5FNV B;  2CH7 B;  1HP8 A;  4FZ0 A;  4B3T O;  2OCC B;  4LH6 A;  3C3S A;  2B9Z A;  1M57 B;  4JI6 O;  1WB7 A;  1EM1 A;  3IC9 A;  4NTW A;  1XUQ A;  1ZUQ A;  4BR6 A;  4P30 A;  4B3S O;  4JI1 O;  4U7N A;  3HKC B;  2RCV A;  2PZS A;  4O4J A;  4LFC B;  5CA1 A;  5LA6 A;  2Q0O C;  1E1Q G;  2EIK B;  3WU2 Z;  3IAY A;  4KHP B;  1EZV H;  3ETE A;  1HWY A;  4CC5 A;  4K8X A;  1W0K G;  1O9G A;  3CCQ V;  3B09 A;  1F4M A;  3X2Q C;  4TV9 A;  1X59 A;  4X8A A;  3RYF B;  1GN3 A;  2XAF A;  2V4D A;  3HKE A;  2X6C A;  2ZNJ A;  4GUN A;  1GAX A;  4LF9 O;  2HEP A;  2QSA A;  3FAV B;  1M4U A;  1KMI Z;  4FFK A;  4MTG A;  3ABL C;  3O9O A;  3L70 H;  4G2K A;  4PA7 A;  3JD2 A;  1N8R W;  4DW0 A;  2YID A;  3D36 A;  4NXM O;  1SC5 B;  3CRQ A;  1KQS U;  4LF8 O;  5EZY B;  2F4V O;  1TAE A;  2P4V A;  3ZHS A;  1E79 G;  4DRX B;  4JPR A;  4X1I B;  1VF6 C;  2QWR B;  2UXB B;  4BAY A;  2BTQ A;  2GUZ B;  2R9I A;  4JYY A;  1KBH A;  4G27 B;  2ZDI C;  2ZNI A;  4FLT A;  2QWO B;  3SJA C;  4DR6 B;  4U3F H;  4MTX A;  4NR1 A;  2IM9 A;  4H13 B;  1Q3E A;  4CC6 A;  1AR5 A;  2AZ2 A;  2QWP B;  2E5L O;  4WBN B;  4LFB O;  1GRJ A;  2YXY A;  3C3T A;  5FNV A;  4JAS A;  2WSS G;  2CH7 A;  1VQ4 V;  3LNN A;  2BOB C;  4XBF A;  1R73 A;  2ZM6 O;  1YJ9 V;  4CS3 A;  1XNQ O;  2UXN A;  1L8D A;  3R65 A;  3OTO B;  1SQV H;  1YCI A;  4J80 A;  2QJ1 A;  4PA4 A;  2GV9 A;  4MVZ A;  3E8F A;  4JAU A;  3HKC A;  2DYS B;  4X64 B;  2Z5U A;  1Z5V A;  4GX5 A;  4YJ3 B;  1OCR B;  2HVJ C;  5DM6 V;  4LBE C;  4RQE A;  3CS5 A;  5B1N A;  4LF4 O;  2CTP A;  2FB5 A;  3RYF A;  4DR4 O;  5KHK A;  4UCS A;  1XMO B;  2BTO A;  1CEZ A;  1XNR O;  1PNM A;  3FAV A;  1NQT A;  1AP6 A;  2YEV B;  5JH7 A;  2IU0 A;  4JZG A;  1NBM G;  3JAL B;  5IJ9 B;  3OTF A;  2WLI B;  4YIP A;  3AEI A;  1EZJ A;  2IW5 A;  3CJH B;  4DV5 B;  1Q43 A;  1B3Q A;  1WAZ A;  4QE7 A;  5IYB O;  2X7R B;  3H9V A;  2YIA A;  1H38 A;  3RBZ A;  1IXM A;  3RVZ A;  3JAK B;  4DRX A;  5IE9 A;  4RO2 A;  2YDE A;  4X1I A;  4W4K A;  4JI3 B;  4EB6 B;  2PUS A;  1YJW V;  1IVS A;  2EJR A;  2GUZ A;  4HAM A;  5IT9 N;  1PPJ H;  4K0K B;  4X65 B;  2GTS A;  3APQ A;  3DTU B;  4JAV A;  4F6E A;  4PV1 B;  3UO3 A;  2XAQ A;  1HNZ B;  4I0X B;  1I5X A;  2F43 G;  3MAQ A;  1H2N A;  4P2Z A;  4NB5 A;  2B1G A;  2FL4 A;  4WBN A;  1OCO B;  3ABM C;  4X66 B;  2Q8V A;  3R66 A;  3D3I A;  3RYC B;  1HR0 O;  2P4K A;  2YI9 A;  2WAM A;  1KEC A;  4Z1M G;  3AK3 A;  4I5S A;  3CEI A;  5D5P A;  2LGQ A;  3W7S A;  4CH3 A;  2CK3 G;  3K3W A;  4HNA B;  1BZK A;  1QBZ A;  4DR2 B;  1IUR A;  1NT2 B;  1P49 A;  2N04 A;  4TOI A;  3L72 H;  5B3S C;  1H2L A;  5L3C A;  2A0L A;  4I9Q A;  1R3L C;  5DED A;  3U0Z A;  2UUA O;  1AI6 A;  4AHC A;  4F4L A;  4AI8 A;  2ZIN A;  3I5D A;  1NVP B;  3VBB A;  3GWO A;  3ML0 A;  3K5M A;  4PA9 A;  3CWB H;  4N21 A;  3AG7 A;  4YJ3 A;  4DV7 O;  1J5E B;  2ZE5 A;  3AG3 C;  4QNH B;  3E2E A;  4JI0 O;  2CAZ C;  4CH4 A;  3NR7 A;  2RQ6 A;  4GKJ B;  1W2B U;  2ZIO A;  3KZI Z;  4JYC A;  2ATK C;  3F5W C;  1CP9 A;  2IJH A;  4J41 A;  4CH5 A;  1IX9 A;  1IBM O;  1N0J A;  2LQT A;  1RSO B;  2UUC O;  4OX9 B;  2DW4 A;  3WB0 A;  2YEV A;  3JD3 A;  4JI8 O;  1R1B A;  3T1C A;  3ZMU A;  1OV9 A;  3JAL A;  4R50 A;  3SR2 C;  3TXQ A;  5IJ9 A;  4LP8 A;  2WLI A;  2VRZ A;  1VQ6 V;  1B04 A;  4NTX A;  4FLV A;  3CJH A;  2QTO A;  3T4Z A;  5LMN B;  4UV9 A;  4NVP A;  2XT9 A;  3RT3 C;  1U97 A;  4X9Q A;  1M93 A;  4PA3 A;  5L3E A;  4X89 A;  1ZAU A;  2V7Q G;  1SQB H;  3JAK A;  3QO5 A;  4DK1 A;  5ITZ B;  1QLE C;  2EIJ C;  1S3J A;  1RM1 C;  1MZE A;  1L0N H;  1M9N A;  3AG1 C;  1YXB A;  4Q6G A;  4L87 A;  3K03 A;  1TUE B;  2BOC C;  3CCE V;  3JAT B;  2Z0A A;  1YTF B;  1AJQ A;  4TV8 B;  3L74 H;  3P3N A;  1KC8 W;  4LF7 B;  2OT5 A;  4A5U B;  2DQ0 A;  2UUB B;  1U96 A;  1MAB G;  2QWN B;  4FM1 A;  3E22 B;  2VQF B;  1Q8I A;  1VF6 A;  3RYC A;  3BFR A;  2UXC O;  4JI7 B;  1BL8 A;  5B66 Z;  5LGU A;  3B2E E;  5EK0 A;  4N23 A;  2Q0A A;  1K9M W;  4BWA A;  3ZN0 A;  3RN4 A;  3JAR A;  2LFR A;  2ZDI A;  3BA8 A;  1K5Q A;  1QVG U;  4HNA A;  1M57 C;  5IYC O;  1QLN A;  1VQ8 V;  4FPP A;  2XTA A;  3O65 A;  1FXK C;  2YXL A;  4J7J A;  3HB3 B;  4C7U A;  1SZX A;  3FB6 C;  4MVO A;  1GO3 F;  3OD4 A;  2JRI A;  4JYB A;  1V54 B;  3HR0 A;  1VQ5 V;  2CUG A;  4DK0 A;  3ABM B;  2EIK C;  2AHZ A;  2NR5 A;  4GKK B;  5H5N A;  1NVP D;  2PGG A;  1PL4 A;  3OT7 A;  3ZS8 C;  3QNE A;  1X4T A;  2OTL V;  1PD3 A;  3JD4 A;  2PTM A;  3FB5 C;  4H37 A;  1SRY A;  3ASN B;  2UU9 O;  1BHB A;  3THO A;  5DN6 G;  5JJJ B;  2DJV A;  3UM7 A;  5KHG A;  3ZRV A;  1EBO A;  2P6J A;  4WFG A;  5B3S B;  3N2K B;  1RSO A;  3K5O A;  1T5E A;  2HVK C;  4XDL A;  1Y74 B;  1I0H A;  3AK1 A;  3BY6 A;  4Q20 A;  4X62 B;  1DF5 A;  1MMM A;  1R3K C;  4UVB A;  1KB9 F;  1PM9 A;  4B7E A;  2YIB A;  5FPO A;  1VQ7 V;  4RUF A;  4X1Y B;  3ZRW B;  1BQZ A;  1JR9 A;  2YIB D;  2F95 B;  5J2T B;  3DXR A;  1KKD A;  4D7T A;  1B06 A;  3H1L H;  1P84 F;  1TVK B;  4DV1 B;  1YZB A;  3BHP A;  1KD1 W;  1ZWI C;  3K79 A;  1SZT A;  2QKA A;  5ITZ A;  1VP7 A;  2Y0P A;  3UO2 A;  2L6L A;  1ROP A;  3K5N A;  1O9H A;  5KHH A;  4JI5 B;  2R9A A;  4NYK A;  5C93 A;  4ZOL A;  3SPC A;  2ETN A;  3C90 A;  2K9P A;  3U10 A;  3ZMV A;  3TK1 A;  1IXB A;  3A2F A;  1Q90 D;  1HNX B;  3OFN G;  1N34 B;  4UCO A;  4TV8 A;  4LFC O;  2H3O A;  2EIL B;  4HZ3 A;  4I9W A;  3TJT A;  1SKV A;  2LGW A;  3IFX A;  3SPI A;  4B3R O;  4KHP O;  3APO A;  1MSW D;  2XAS A;  1SQX H;  5B1A C;  3E22 A;  4MS2 A;  5JJE B;  2WWW A;  3QO7 A;  2EIJ B;  4JV5 B; 
#chains in the Genus database with same CATH homology
 2JRI A;  1G1X B;  2FKX A;  2DOS A;  5BY1 A;  1IBM O;  4B3M O;  4DV1 O;  4X65 O;  2UUC O;  5H5N A;  4DV0 O;  4DR5 O;  4LFA O;  1IBK O;  4JI8 O;  3J81 N;  1XEQ A;  1R1B A;  1HNZ O;  3JAM N;  4B3T O;  1N36 O;  2UUB O;  1FYJ A;  4DR2 O;  1A32 A;  2UU9 O;  4YHH O;  4OPA A;  4JI6 O;  2ZKO A;  5BXZ A;  4DV6 O;  1KUQ A;  2AGA A;  4DR3 O;  2DJV A;  2VQF O;  2E5L O;  5IT9 N;  1AB3 A;  4JI7 O;  4LFB O;  3RT3 C;  4LF5 O;  4B3S O;  1N33 O;  2N74 A;  4JI1 O;  5BR8 O;  1HNX O;  5LMU O;  4X64 O;  1HNW O;  1D2D A;  1R6T A;  1J5E O;  4DV4 O;  1NS1 A;  4LF7 O;  3M8A A;  4DV2 O;  2ZM6 O;  4DR7 O;  1XNQ O;  4GKJ O;  4JI5 O;  4DV3 O;  4DR1 O;  2UXB O;  1X59 A;  3R66 A;  3F5T A;  1F7Y A;  1HR0 O;  1XMQ O;  1XMO O;  1DK1 A;  3J7A U;  4OPH A;  4GKK O;  1N32 O;  2VQE O;  1N34 O;  4OX9 O;  1YZB A;  2Z0A A;  4DUZ O;  3T1Y O;  4LF9 O;  2LW7 A;  1FKA O;  4DR6 O;  4A5U B;  5IWA O;  1AIL A;  3T1H O;  2UXD O;  4DUY O;  5FLX N;  4JI2 O;  3J80 N;  4LF4 O;  4YY3 O;  2UXC O;  4JV5 O;  5A2Q N;  4DR4 O;  5LMN O;  2UUA O;  4DV5 O;  4LF6 O;  4K0K O;  4NXM O;  1IBL O;  1XNR O;  4LF8 O;  4LFC O;  2F4V O;  5LL6 Y;  4DV7 O;  4JI4 O;  4NXN O;  4X62 O;  4AQY O;  1I94 O;  4JI0 O;  4JYA O;  4B3R O;  2HHH O;  4KHP O;  3OTO O;  3O65 A;  1FJG O;  4JI3 O;  4X66 O;  3SDL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...