4YHHO

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4yhhO00
2JRIA 4DR6O 4LF7O 1N33O 3T1YO 1HNXO 3J7AU 2DOSA 4JI0O 4JI8O 4X64O 4KHPO 1XNRO 4JI7O 4DR7O 4DV2O 4DR1O 1XMOO 5BR8O 4JI3O 5FLXN 4OX9O 1N32O 2UXBO 1N34O 1NS1A 2Z0AA 4YY3O 1AILA 1HR0O 4A5UB 2AGAA 1XNQO 4DV5O 4DV0O 4NXMO 1DK1A 4LFAO 3SDLA 4DR4O 4AQYO 4LF4O 4JV5O 5IT9N 1XMQO 1FJGO 2UXDO 1AB3A 2LW7A 2N74A 4DV4O 1G1XB 4X66O 4OPAA 4DV7O 1IBKO 4DUYO 2VQFO 4JI5O 4JI6O 1HNWO 1FKAO 3O65A 2ZKOA 1J5EO 2UXCO 1F7YA 5H5NA 5BY1A 2UUBO 4LFBO 4LF8O 2E5LO 1XEQA 1IBLO 5BXZA 4DUZO 1D2DA 1HNZO 1KUQA 4OPHA 1N36O 5LMUO 3T1HO 3JAMN 4LF6O 1IBMO 4DV3O 1FYJA 4X65O 4DR5O 4B3RO 4X62O 3R66A 4JYAO 2HHHO 4NXNO 4K0KO 5A2QN 4LFCO 1R1BA 4GKKO 2VQEO 1A32A 4DR3O 1R6TA 4YHHO 2UUCO 3J80N 4LF9O 4B3TO 2F4VO 2DJVA 5IWAO 4B3SO 4JI1O 2UUAO 2UU9O 3OTOO 4GKJO 4JI2O 2FKXA 3M8AA 3J81N 4DR2O 2ZM6O 4DV6O 4JI4O 4LF5O 1I94O 3F5TA 1X59A 5LL6Y 4B3MO 5LMNO 3RT3C 4DV1O 1YZBA
chains in the Genus database with same CATH superfamily
1BZKA 1KYOF 4RUEA 3E8BA 3CMEV 2LO1A 4RO2A 2Q7HA 4X66B 3HKEA 5CMUA 3SJAC 1WA8A 3WFVA 3HKDB 1QVGU 4DUYB 2BE3A 1R73A 1I5XA 2ZCEA 1NI8A 1S76D 1AJNA 1J5EB 1N34O 3LSUA 3CC4V 5E1AC 2WLLA 2AZ0A 3SYQA 4YHHB 4DV5O 3LSQA 1P7BA 2LJ2A 3QO8A 5FPRA 3BVOA 4X66O 4I4TB 5GONA 4D6TH 4DUYO 4I5SA 5IJ0B 4RQFA 2H3OA 1J5EO 3ZCCA 1T5EA 4PHZA 1AJPA 2QTOA 1SZTA 3ZMTA 4MTXA 3EHBB 1AJQA 1NQTA 2QM4A 1TA8A 5ITZB 3MD0A 4Q20A 2RDCA 5H6QA 2EINB 3CB2A 4D7TA 5A2QN 1WPBA 4CS2A 1FFTB 1XILA 5LBQA 4NB5A 2ZXWB 3AK3A 3C3TA 2WAMA 1M56B 2YXLA 3JASB 1OCOC 1H2KA 3WU2Z 3CXHF 2WSSG 3T1YB 4UXNA 1NH2D 3M8AA 1O9GA 2ZE5A 2FMLA 1CP9A 3ZHQA 1NH2B 2Y0PA 3FD9A 4X1YB 5L3EA 4MVRA 4UCSA 3T1YO 3APQA 1HDJA 1IBKB 1B6QA 3CCVV 3K04A 2OTLV 2LQTA 4X20B 2HHHB 1VIBA 3TETA 4O4HA 2QGNA 4I7ZB 4J7ZA 5EZYB 2JEUA 3IFXA 4XDLA 1QLNA 1Q43A 2AGAA 4WFGA 1I08A 2F93B 4FLZA 3E86A 3P3NA 3K57A 1IBKO 3ZRSA 3FYEB 2QWOB 4MVZA 3RYIB 5KUMA 1JQ0A 4X62B 3KCXA 4B08A 2UUBO 1K33A 5JCOC 3ASNB 1ORQC 5IYBO 4OPHA 2KSDA 3JALA 4JASA 1N33B 2DE0X 5LOVB 4X65O 3E89A 5LHIA 3CCJV 4X62O 2ZNIA 1N32B 1FXKC 5IY5B 3OUFA 3AK2A 2LGWA 2XAJA 2B9ZA 1VF6C 2ZE8A 4UCRA 2FYUH 2YEVB 1Q3EA 3OTFA 4O4IB 4WFBV 1RSOB 1EFRG 3JYCA 4FM2A 3UT5A 1GKFA 4IIJA 2K9PA 4F6RA 4DV2B 2QE7G 1B06A 2B1IA 1FAFA 1QQCA 2R9RB 2F66C 1JVMA 1Q81W 3D36C 4R50A 2ZDIC 3CJHB 4MTFA 4JYBA 1PKXA 4JAVA 4P30A 1FJGB 4IGGA 4DV4B 2F43G 3J7AU 1SQQH 1ZL8B 4MVSA 4MVMA 1U97A 4DV2O 1AROP 4KP4A 2P6JA 1K34A 4PA7A 2A3QA 3U11A 1ZAUA 1M5IA 4GYCB 5CA3A 4FM1A 3RYHA 1NS1A 1YF2A 1IZ3A 4N23A 1SQGA 1GK9A 1Q90D 2DYRC 3L73H 2IU0A 3ZMSA 1FJGO 4DV4O 4F4LA 3BA8A 3RYFB 2KQXA 2UXXA 3H01A 3JARA 3CMAV 1K7DA 1XQ8A 1YEWA 2Q68A 4BW5A 2YIDA 4FFBB 4NXNB 4K0KB 2V1DA 1SC5B 5EC2C 2K1EA 1S72V 2XAGA 3ICXA 3E22A 1S77D 3FKSG 1W0KG 5CA1B 2CTQA 3FAVA 5KHKA 3CC2V 1OV9A 1PP9H 3CCMV 4DV6B 1GTOA 2L35A 1F23A 3LNMB 4J7KA 1I94B 4NXNO 4K0KO 1VQ5V 1VARA 3N2GB 3E35A 2P90A 4DV0B 3J80N 4LF4B 4TUYB 1SESA 2YICA 2DYSC 2CGNA 4IL6Z 2Q69A 4F6EA 3BRCA 2ZIMA 1FFXA 3UQ8A 3AK1A 4P9OA 4JAAA 1XNRB 4UCOA 3OT7A 2Z5UA 2YC0A 4DV6O 3K03A 4DRXA 4JI4O 1I94O 5EIBD 2P7TC 2JJ1G 4MW8A 1NTZH 2AZ2A 2XHBA 4X1IB 3RVYA 5IYZB 2YI9A 2PYLA 4LCUC 1XNRO 5IDJA 2JK5C 1H8HG 2HR3A 3RWRD 1BT8A 3U10A 1F51A 2FB5A 4W4LA 1VQ9V 4XBFA 2Z0AA 2QKAA 4X1KB 3F7YC 2H8PC 4E4EA 2AW9A 1DK1A 4JAUA 2E76B 1E79G 5LXTA 4MTOA 2LFRA 3CCRV 2WWWA 1G1XB 1AI4A 1N8RW 5J2UB 4H33A 3FB5C 1R3LC 5LP6A 1OHHG 4GT1A 3DTUB 4JZGA 4ZHQB 1HNZO 2FTKA 3E83A 3IAYA 4YJ2B 3OD4A 4WFEA 2R70A 5D5PA 4K35A 2RNBA 2XUMA 3DC5A 4K3AA 5KUKA 3IC7A 2PY5A 2Q9LA 2X0LA 1VQ7V 1M90W 5KLVH 3CRAA 3OAAG 4LF5B 2NN4A 3AG7A 1FXKB 4DYLA 2B1GA 2N04A 1M57C 1R1BA 2HVJC 5KMGA 2VWJA 4O4LB 2Y4UA 1XUQA 1H38A 4LBEC 2OWOA 1IX9A 4NYKA 2EX3A 5DN6G 2KG7A 4CH5A 3JAKA 1K4DC 3SYCA 5LHHA 4LC1A 3TK1A 4LF5O 4DXWA 2IBZH 3F5TA 2QDOA 4DK0A 2EINC 5JVDB 4J9YB 2PF4E 1V9PA 1YCIA 2E5LB 3LUTB 5EBLC 1PNLA 2X7RB 4I50B 4UVCA 1KQSU 4R6ZA 4B7KA 1S3JA 4J10A 1QNMA 5KX5A 1YJWV 3HKBB 3K58A 2QM8A 3SPIA 2VQEB 3OW2U 3ZMZA 1AILA 2M6YA 1PM9A 1U96A 3D3QA 4OXSA 3RYCA 5B5EZ 5LGUA 3WB1A 4GLXA 5H9CA 1Q8IA 5CA0B 4TWKA 1AB3A 2N74A 4JI1B 1UPGA 3T2MA 5LYJA 2A06H 3A8TA 1KP3A 2DWEC 3L74H 3A0BZ 4AI8A 1Y76A 1DF5A 1F7YA 3ABLC 2M7WA 5J2TA 1D2DA 4PELA 2F4VB 4G2KA 3OEHG 1IXMA 2UUAB 5IJ9A 4WFAV 4DR2B 4UVAA 2P4VA 3SYOA 3T4DA 3TGUH 3ZBHA 2BTQB 2MK3A 1S5HC 1Y74A 4FK5C 5K1PA 1P84F 2PGGA 3CX5F 2F4VO 1H2MA 4DR6B 3N2KB 2ZE7A 3VQWA 2VWKA 3ZIAG 2UUAO 1VMGA 1FD9A 2P67A 2IJKA 4LP8A 4DR2O 2Q7EA 3LSSA 4ABMA 5BR8B 4JI3B 3W7WA 4TV8B 3ABMB 2KB1A 1PL0A 2ITDC 5IY5C 1EN5A 1Z5VA 4L87A 4YY3B 1SKVA 2L6LA 4WFFA 3LDDA 2ZNJA 3JSNA 4NXMB 4DR6O 4WBNA 3P32A 2EIKB 2F23A 5KHGA 1HNXO 5GW7A 3ABKC 4LH6A 1S5LZ 5BR8O 4JI3O 3E8HA 2BTOA 2Q67A 3CCEV 4X88A 5DEDA 3GVMA 4YY3O 1KKCA 4TSFG 3SPGA 3D36A 4NXMO 3ABUA 1XDCA 1XMQO 1NZ6A 4EB6A 4LNUB 2AHYA 4R7CA 3B77A 1QR9A 1BL8A 4O4JA 1I0HA 1V55C 4PA3A 3NXSA 1MZEA 3O65A 4HNAA 3L70H 1VQMV 1JFFA 3JCZA 4GUNA 5BMVA 4DW1A 4DR3B 3Q4HB 5GTHZ 3LDEA 4OGQB 1MSDA 4B3TB 5CBHA 4IYHA 2W6JG 3WG7C 1BMFG 3VQXA 2P5OA 1OZ0A 5L3BA 2GUZA 3K59A 2YSUB 1V54C 2JS5A 3B09A 1H2LA 4QPKA 3FB6C 4DK1A 1BHBA 3UM7A 4IHJA 2G38A 4ICGA 3SR2C 1M57B 3GWKC 1R3KC 4DR3O 2EJ7A 1Q5OA 4O2AB 4YHHO 5LA6B 1BHAA 4DV1B 2A79B 4B3TO 3P30A 2P22C 4PDMA 1L0LH 1RFYA 1VQ6V 3ZHTA 1DLBA 2Q7GA 1SRYA 5JH7B 1LUWA 2WLMA 1DTOA 3HB3B 3JATA 1JPXA 2YS8A 1HR0B 4DUZB 4DV1O 1YZBA 2WLIA 3K0GA 1TUBB 5D5QA 4PA6A 1MA1A 1SA0B 1G6UA 2OCCB 2NR5A 1SQFA 2PTMA 2DOSA 1YITV 3JAWA 2H94A 3T4ZA 4FZ1A 4JI5B 5FLXN 2UXCB 3ZRWB 1HR0O 5K1XA 2AHZA 4W4KA 4GX0A 5JQGB 2CTPA 1NT2B 4FPPA 1XL6A 2QWRB 2Q73A 1B3QA 4TOIA 4FLXA 5EIBC 3OMIB 1WB8A 3O9OA 3W7TA 1GN2A 1GM8A 3AG3C 4JI5O 4E2LA 1VEWA 2JS3A 3BFRA 2UXCO 3ABLB 4ZIBA 1KB9F 4MVQA 3JARB 1R3JC 1PV0A 1EZVH 1K92A 4ZKIA 3JAMN 2YIBD 1H8EG 3OTOB 2EZOA 1IXBA 4H13B 4BR6A 3RW0A 2HHHO 4DW0A 3HKDA 5CN0A 3S3WA 3OM3B 3SYPA 3QO7A 3APOA 4ASUG 1PD3A 1DF4A 4UV8A 1P7GA 3I5DA 3OTOO 3GWOA 4C7UA 4I4TA 1JOYA 4RQEA 2HFEC 1MABG 2UXBB 3WB2A 5IJ0A 3BPZA 3ZS8C 1SQBH 1QR8A 4DR4B 3K3WA 4GX5A 4XDKA 4DRXB 3S3XA 1N33O 5F2VO 4CC6A 3ABKB 4DV3B 1ZWIC 4DV7B 1ZTEA 4AILC 1XHXA 4TV9B 5ITZA 2W0FC 2XAFA 4LFCB 1N32O 2UXBO 1R3IC 3OR7C 5EYPB 3ASOC 4A5UB 2RN9A 1WB7A 4Q6GA 3RN4A 4LF9B 4DR4O 3JD4A 1SS3A 5JJEB 2ZR2A 3K5MA 4UUJC 4DV7O 1GRJA 3JASA 2WA4A 1V55B 4B3RB 4K8ZA 4JYAB 3T1CA 5BY1A 5LXTB 1JCHA 3SJCC 1MOFA 1WAZA 3RGBA 2ETNA 3PJSK 2Z3YA 1N4CA 3WG7B 1BSMA 4B3SB 2JVDA 2DMXA 1XOUA 2EIJB 1V54B 3DXRB 1QHTA 2QEXV 4GKJB 2ADQB 3TJTA 4X1YA 5C8YB 4O2BB 1VQOV 5CBGA 2B5UA 4PA9A 1SF9A 2YUAA 4B3RO 3CYOA 3R66A 4JYAO 1R6KA 1VQPV 2CTWA 3CRRA 3LNNA 5FPOA 4X20A 3ZHVA 5AG2A 3EVKA 4HBNA 4FMTA 2GDSA 5EZYA 2ZT9B 4KXRA 4B3SO 3TXSA 1QLEC 3QG5A 4GKJO 5KMGB 4R8CA 1SETA 4DR7B 4JI7B 1QU7A 5KHHA 1YXBA 1QCEA 2X6AA 3RYIA 3OEEG 1N0NA 1AI5A 2EULA 1IBLB 1G8MA 1BQ0A 2YDEA 1XNQB 1JA8A 5EBWC 3P3PA 1L0NH 4U3FH 2CDYA 1KU9A 4I55B 5B66Z 4FM0A 1AI7A 4EFBA 3BEHA 4KUMA 3MHSC 1WP7A 4X9QA 4TT3G 4JI7O 4DR7O 3UO3A 3F5WC 3AG1C 1OCRC 2PI4A 1Y66A 1ZLZA 1W0JG 5LOVA 1G4YB 1K5SA 4MVOA 3ABMC 1HP8A 1XNQO 4DV0O 2EILB 3K06A 1AR5A 4LF4O 1KMIZ 3X2QB 4CS3A 5BZBA 3A2FA 2EIKC 1NR7A 4JTCB 2YEVA 2CE4A 2JGDB 3AG3B 4O4IA 3CCSV 4DO2A 3FB8C 4YJ3B 5B1OA 3CCQV 1RSOA 3RYCB 1JX9A 2QJ1A 2WPDG 2FL4A 2A7WA 4MS2A 1VQKV 2Y69B 3FB7C 5FL7G 4ZI7B 3ETDA 3BCCH 2ODMA 5IWAB 3HKCB 3CJHA 4U3JB 2XNDG 5IYCO 2BSKB 3ETQA 5KAFZ 1AR1B 4YIPA 3R65A 3H9VA 3KKYA 2LW1A 2CH7B 2IH3C 5B1BB 2GV9A 3L75H 1SQPH 1NBMG 1K97A 2N05A 2ZQMA 1SERA 5LMNB 4LFAB 4BW9A 4JV5B 3QTCA 5GTIZ 5IWAO 1GM9A 3K9AA 1H2SB 3M99B 1YIJV 4CC5A 5CB4B 1WNSA 1HWYA 5LGNA 2DN9A 2IU3A 1PNKA 3FX7A 1SQXH 4GCZA 3L72H 1Q7YW 3ETGA 3OFNG 3ZRVA 4H44B 1MMMA 5LMNO 4FFBA 1FXHA 4RAIA 2QSAA 3AG2B 4KL1A 2ILMA 3W7XA 4J11A 3CSXA 1N0JA 3W7SA 4I0XA 5CA1A 2W6IG 3L9DA 1HNWB 3OGCC 1XREA 1M4UA 3ASOB 1X4TA 4PDVA 1TVKA 2ATKC 1K5QA 4LWSA 2R9AA 3N2GA 4J7JA 3VOUA 2LW7A 4NTXA 4FLUA 1K73W 2D3OW 2OCCC 4NR1A 4TUYA 1GM7A 1J95A 1EBOA 2A9HA 5FNVB 3OUSA 1HNWO 1M93A 1FXVA 3EFFK 4RUFA 1D5AA 1GH6A 2P06A 2E5LO 1WJZA 3HKEB 5HFMA 1WA8B 2DQ3A 1YDXA 4UV9A 2GTSA 1EN6A 2EBOA 3JD3A 4TQFA 4X1IA 2UU9B 2WLHA 3GB7C 5IYZA 2WLLB 4H37A 4PA4A 2VQEO 4UCUA 4CS4A 3IC9A 5GONB 4X1KA 4D7SA 4JI1O 1QLEB 4WFHA 2ZR3A 2UU9O 1L1FA 3CCUV 3B2EE 1VQLV 3MHHC 5J2UA 4FIPC 4Z1VA 3NR7A 2OIEA 3CS5A 3DSQA 3C90A 5JWPA 2JRIA 1N36B 2OT5A 5LGTA 2E75B 4ZHQA 3ML0A 5JCOA 2GHYA 4QNHB 4IYIA 2EIMC 1AR4A 2RJZA 2RMKB 2PZSA 1EZJA 2PI5A 4YJ2A 3AG1B 1OCRB 3SGIA 3HPLC 4EKWA 4BWAA 4N21A 2ARHA 4CH4A 1TUEB 4LFBB 2QM7A 5DECA 1SQVH 1FXKA 4FLWA 2WLNA 3SDLA 1GMGA 1VF6A 2X6BA 4FFKA 2LFSA 4OPAA 1NTKH 4PD4F 3CRCA 3H1HH 3CD6V 1YHQV 2Q6AA 3FYIB 4GKKB 4LFBO 3ZRXA 4P9PA 5JVDA 3ZHSA 1Q6IA 2HEPA 2F95B 2XTAA 3M7MX 4UFZA 5L3FA 4G27B 2ZDIA 2WA3A 1FYJA 4I50A 4O4HB 3OE7G 3SJQC 3MAQA 3K9SA 1Y6XA 1N34B 3H1JH 4GKKO 3VQYA 1GN6A 1I5YA 2EJRA 3HKBA 1W2BU 1YJNV 4X89A 3JSLA 4WF9V 4DV5B 4J80A 1XBLA 2R9IA 4JGSA 2DJVA 4JTAB 5LP6C 3THOA 2EIJC 1Y67A 4MT8A 1NU1H 1Z2GA 2NNUA 5CA0A 3BAAA 4FLVA 4P2ZA 1P4RA 4H0LB 5DM6V 1KECA 4OX9B 2ZIOA 3JALB 3UKMA 1VF5B 3H1LH 1VQ8V 2KKWA 3RFRA 2MW2B 4QGPA 4JYYA 3K5LA 1XI1A 1YI2V 1SZXA 3K79A 3ZMUA 2OTJV 4Z2WA 4OX9O 3BHPA 1UFIA 3TCUA 1QBZA 2HG5C 2UXNA 1CEZA 2OIGA 3UT5B 2BTQA 4IIJB 3QF7A 3CE2A 4F6RB 3T1HB 4GX2A 4IT5A 2IH1C 4X8AA 4PV1B 4JYCA 1K9MW 3N2KA 4HAMA 2BOCC 3ZN0A 2Q4PA 4WCEV 2PYJA 1Y4MA 5KAIZ 1IURA 4DUZO 4TV8A 4U7NA 1KUQA 4LH7A 4EEQA 4NKGB 3SJBC 3ZMVA 2EILC 4PJ0Z 1I7FA 3T1HO 3A0HZ 3X2QC 3SPHA 1EN4A 4Z1MG 3G67A 3RYHB 2GTAA 3CEIA 5C93A 5JJJB 4MSWC 1JJ2U 1A32A 2VS0A 2Y69C 4ZOLA 4JI2B 3LDCA 1GO3F 1PNMA 5L3GA 4ZBMA 2BCCH 4JI8B 3CP1A 2Q0AA 2QTSA 5IE9A 4I9QA 4LNUA 1XMOB 4TQDA 3ZN1A 1GN3A 1X59A 3E22B 1VQNV 2YI8A 1MZFA 5B1AC 2UUBB 5LL6Y 3FAVB 5B1BC 3E8GA 1KP2A 5B3SC 4JI2O 1NKDA 4BAYA 1YTFD 1TAEA 2EIMB 2QWNB 3Q4HA 1BE3H 4X65B 4JI8O 1OCCB 4BIOA 1XMOO 4QIWF 4YIOA 1OCZB 3W7UA 2EZPA 1YTFB 1FS0G 5L3CA 3ZHUA 1FFXB 1ZX3A 3AG2C 3CRQA 5LMUB 1NVPD 1ENVA 4O2AA 5LA6A 3EXAA 2GBOA 1AP6A 2NLJC 1IBMB 1VQ4V 3B4SA 2D2CB 4DR5B 4PI2A 5A9GA 2IJJA 3H1IH 4UCTA 2ZKOA 4L8JA 1NVPB 2P4KA 5H5NA 1P49A 2HJFC 5B1NA 4UB8Z 1RM1C 1W59A 5KA6A 1XEQA 1AP5A 3CC7V 1H2NA 1YSCA 5BXZA 3SPJA 4J41A 3D3IA 4UVBA 5JH7A 5LMUO 1THZA 1VP7A 3K5OA 1FPOA 2CTRA 3KZIZ 3CCLV 1IBMO 5KHIA 4DV3O 1E1RG 4FVMA 4DR5O 3E2EA 1TUBA 5IYDO 1SA0A 5H2FZ 4LFCO 1BGYH 2BOBC 4I9WA 1ZUQA 1URFA 2WLKA 3VQVA 2QR4A 3STLC 1VF7A 2JGUA 1M1KW 2X6CA 3JCUZ 5EC1C 4LF9O 3ZRWA 1L8DA 2CUGA 3OR6C 5LP6B 4LF7B 3K5NA 2LP7A 5JQGA 4X64B 3J81N 1E1QG 5L3DA 3U0ZA 3WB0A 3L71H 4HYOA 2JIZG 5HFLA 3K0DA 2IJHA 2QWQB 2RQ6A 3CRMA 1XL4A 1RPRA 1Q6HA 2RCVA 3F7VC 3B8NA 1RPOA 2CK3G 1XHZA 1O9HA 4QE7A 3G80A 3B40A 2W0XA 4LF7O 2GSMB 4NTWA 1LUVA 2R72A 4X64O 4CH6A 4XDJA 3ABTA 5TISZ 1DGSA 2Y4TA 1Q82W 1Q86W 3BABA 3QNEA 4FJCC 2OYQA 2KG7B 3JAKB 1WLEA 3BA9A 2IJIA 4I0XB 2YIBA 4PI0A 1MSWD 1TGOA 1TVKB 2V7QG 1COWG 3K08A 3RVZA 4LWSB 4JI4B 4UCVA 1GN4A 2HP8A 2OCHA 1IBLO 1M9NA 1BCCH 1OCOB 3I55V 5KX5B 2HLDG 1ZSPA 4JTDB 1LNQA 4K8XA 3C3SA 3FFQA 3ZJZA 4CZZA 1GAXA 1IVSA 2PUSA 2HVKC 2ZD9A 2Q0OC 4J9ZB 4YXWG 2JEXA 3TXQA 3MDSA 4TV9A 3ZX6A 4AHCA 5CBFA 1US6A 5LYJB 1WPXA 2AXTZ 5EYPA 2LGQA 1Y76B 3CWBH 4NVPA 3ZEDA 4KHPB 2HJDA 3B8MA 5J2TB 1EM1A 1JMKC 1ZL8A 3AG4C 5E79Z 5B1AB 1LR1A 4EFEA 3UO2A 5B3SB 2E74B 2ZE6A 3RT3C 1HNZB 3D8CA 3CHXA 1Q6UA 5IJ9B 3ZHRA 4B7EA 1CXZB 3PN1A 2UXDB 1AI6A 2DWDC 2Y0IA 5KA5A 4KHPO 3QO5A 1Y74B 4JI6B 3RYFA 3DXRA 2Q8VA 1PPJH 5C8YA 1CPYA 4O2BA 1PL4A 2DQ0A 4G28B 1R6NA 3CXCU 4LFAO 4JV5O 5IT9N 2XAQA 4GX1A 2UXDO 1YVWA 2O57A 1HW7A 4JZ2A 4FZ0A 2VRZA 4JI6O 1YJ9V 1S0VA 3G4SV 4WBNB 1RM1B 3HR0A 4MTGA 3OMNB 3JD2A 1OJHA 2YIAA 3STZC 5LHGA 2XASA 3H1KH 3A0RA 2IW5A 4BIUA 3CPWU 2HKOA 2XAHA 4I55A 3OGIB 1JR9A 3N27A 3IJ4A 1BQZA 4EB6B 1K8AW 2ZXWC 2E3CA 1M56C 4RWUA 1F4NA 4MVUA 4O4JB 1JJOA 2JJ2G 3IGAC 2FKXA 4HNAB 4JI0B 2DW4A 2Y48A 1JFFB 5BMVB 4DR1B 3E8FA 2JGDA 4YJ3A 1NR1A 3JD0A 2DYRB 4HZ3A 2GUZB 4AQYB 1F4MA 1KC8W 2ITCC 2YXYA 4IHJB 4JI0O 4ZI7A 2QA4V 4DR1O 3HKCA 3SPCA 1UJWB 2VQFB 4U3JA 2BSKA 2JDIG 2C2AA 1K4CC 4KFMA 3OMAB 1BS3A 1RP3B 4LF8B 3QVNA 4QJFB 4QPJA 2CH7A 4AQYO 4JF3A 2YXHA 3DC6A 4LF6B 2CGOA 3UCSC 4JPRA 3JATB 1AVMA 5JJNB 2VQFO 1OCCC 2ADPA 4J42A 1NTMH 1KKDA 4NTYA 1FKAO 5KHJA 5CB4A 1OCZC 2WLIB 3VBBA 4LF8O 3SYAA 1QVFU 4LR3A 4PDLA 4GZRB 3ASNC 2V4DA 2UUCB 1WP8A 3JAWB 1N36O 2DYSB 4MW3A 4QE9A 4O4LA 1K3EA 1HNXB 3G6BA 4LF6O 3AEIA 1KBHA 1Z5WA 1NJIW 4BIZA 2WLJA 4FLYA 2ZM6B 3KCYA 5EBMC 1WN7A 1KD1W 2Q5ZA 1B04A 1ROPA 2XOKG 4U7OA 1R6TA 2QKSA 2ZINA 4B3MB 1MNGA 5EK0A 2UUCO 4CBCA 4PDRA 1XMQB 2QWPB 1MG1A 4UB6Z 1S5JA 1H2GA 3KG2A 3RBZA 4FLTA 4CH3A 2ZM6O 3G6EV 5H6RA 3AG4B 4ZOLB 2XT9A 3I56V 1IDSA 3BY6A 2A0LA 3JD1A 3G71V 3DGEA 2F1MA 2QKCA 5J9PC 5FNVA 4B3MO 2IM9A 1D5NA 2CAZC 3ETEA
chains in the Genus database with same CATH topology
2JRIA 4DR6O 4LF7O 1N33O 3T1YO 1HNXO 3J7AU 2DOSA 4JI0O 4JI8O 4X64O 4KHPO 1XNRO 4JI7O 4DR7O 4DV2O 4DR1O 1XMOO 5BR8O 4JI3O 5FLXN 4OX9O 1N32O 2UXBO 1N34O 1NS1A 2Z0AA 4YY3O 1AILA 1HR0O 4A5UB 2AGAA 1XNQO 4DV5O 4DV0O 4NXMO 1DK1A 4LFAO 3SDLA 4DR4O 4AQYO 4LF4O 4JV5O 5IT9N 1XMQO 1FJGO 2UXDO 1AB3A 2LW7A 2N74A 4DV4O 1G1XB 4X66O 4OPAA 4DV7O 1IBKO 4DUYO 2VQFO 4JI5O 4JI6O 1HNWO 1FKAO 3O65A 2ZKOA 1J5EO 2UXCO 1F7YA 5H5NA 5BY1A 2UUBO 4LFBO 4LF8O 2E5LO 1XEQA 1IBLO 5BXZA 4DUZO 1D2DA 1HNZO 1KUQA 4OPHA 1N36O 5LMUO 3T1HO 3JAMN 4LF6O 1IBMO 4DV3O 1FYJA 4X65O 4DR5O 4B3RO 4X62O 3R66A 4JYAO 2HHHO 4NXNO 4K0KO 5A2QN 4LFCO 1R1BA 4GKKO 2VQEO 1A32A 4DR3O 1R6TA 4YHHO 2UUCO 3J80N 4LF9O 4B3TO 2F4VO 2DJVA 5IWAO 4B3SO 4JI1O 2UUAO 2UU9O 3OTOO 4GKJO 4JI2O 2FKXA 3M8AA 3J81N 4DR2O 2ZM6O 4DV6O 4JI4O 4LF5O 1I94O 3F5TA 1X59A 5LL6Y 4B3MO 5LMNO 3RT3C 4DV1O 1YZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JRI A;  4DR6 O;  4LF7 O;  1N33 O;  3T1Y O;  1HNX O;  3J7A U;  2DOS A;  4JI0 O;  4JI8 O;  4X64 O;  4KHP O;  1XNR O;  4JI7 O;  4DR7 O;  4DV2 O;  4DR1 O;  1XMO O;  5BR8 O;  4JI3 O;  5FLX N;  4OX9 O;  1N32 O;  2UXB O;  1N34 O;  1NS1 A;  2Z0A A;  4YY3 O;  1AIL A;  1HR0 O;  4A5U B;  2AGA A;  1XNQ O;  4DV5 O;  4DV0 O;  4NXM O;  1DK1 A;  4LFA O;  3SDL A;  4DR4 O;  4AQY O;  4LF4 O;  4JV5 O;  5IT9 N;  1XMQ O;  1FJG O;  2UXD O;  1AB3 A;  2LW7 A;  2N74 A;  4DV4 O;  1G1X B;  4X66 O;  4OPA A;  4DV7 O;  1IBK O;  4DUY O;  2VQF O;  4JI5 O;  4JI6 O;  1HNW O;  1FKA O;  3O65 A;  2ZKO A;  1J5E O;  2UXC O;  1F7Y A;  5H5N A;  5BY1 A;  2UUB O;  4LFB O;  4LF8 O;  2E5L O;  1XEQ A;  1IBL O;  5BXZ A;  4DUZ O;  1D2D A;  1HNZ O;  1KUQ A;  4OPH A;  1N36 O;  5LMU O;  3T1H O;  3JAM N;  4LF6 O;  1IBM O;  4DV3 O;  1FYJ A;  4X65 O;  4DR5 O;  4B3R O;  4X62 O;  3R66 A;  4JYA O;  2HHH O;  4NXN O;  4K0K O;  5A2Q N;  4LFC O;  1R1B A;  4GKK O;  2VQE O;  1A32 A;  4DR3 O;  1R6T A;  4YHH O;  2UUC O;  3J80 N;  4LF9 O;  4B3T O;  2F4V O;  2DJV A;  5IWA O;  4B3S O;  4JI1 O;  2UUA O;  2UU9 O;  3OTO O;  4GKJ O;  4JI2 O;  2FKX A;  3M8A A;  3J81 N;  4DR2 O;  2ZM6 O;  4DV6 O;  4JI4 O;  4LF5 O;  1I94 O;  3F5T A;  1X59 A;  5LL6 Y;  4B3M O;  5LMN O;  3RT3 C;  4DV1 O;  1YZB A; 
#chains in the Genus database with same CATH topology
 1BZK A;  1KYO F;  4RUE A;  3E8B A;  3CME V;  2LO1 A;  4RO2 A;  2Q7H A;  4X66 B;  3HKE A;  5CMU A;  3SJA C;  1WA8 A;  3WFV A;  3HKD B;  1QVG U;  4DUY B;  2BE3 A;  1R73 A;  1I5X A;  2ZCE A;  1NI8 A;  1S76 D;  1AJN A;  1J5E B;  1N34 O;  3LSU A;  3CC4 V;  5E1A C;  2WLL A;  2AZ0 A;  3SYQ A;  4YHH B;  4DV5 O;  3LSQ A;  1P7B A;  2LJ2 A;  3QO8 A;  5FPR A;  3BVO A;  4X66 O;  4I4T B;  5GON A;  4D6T H;  4DUY O;  4I5S A;  5IJ0 B;  4RQF A;  2H3O A;  1J5E O;  3ZCC A;  1T5E A;  4PHZ A;  1AJP A;  2QTO A;  1SZT A;  3ZMT A;  4MTX A;  3EHB B;  1AJQ A;  1NQT A;  2QM4 A;  1TA8 A;  5ITZ B;  3MD0 A;  4Q20 A;  2RDC A;  5H6Q A;  2EIN B;  3CB2 A;  4D7T A;  5A2Q N;  1WPB A;  4CS2 A;  1FFT B;  1XIL A;  5LBQ A;  4NB5 A;  2ZXW B;  3AK3 A;  3C3T A;  2WAM A;  1M56 B;  2YXL A;  3JAS B;  1OCO C;  1H2K A;  3WU2 Z;  3CXH F;  2WSS G;  3T1Y B;  4UXN A;  1NH2 D;  3M8A A;  1O9G A;  2ZE5 A;  2FML A;  1CP9 A;  3ZHQ A;  1NH2 B;  2Y0P A;  3FD9 A;  4X1Y B;  5L3E A;  4MVR A;  4UCS A;  3T1Y O;  3APQ A;  1HDJ A;  1IBK B;  1B6Q A;  3CCV V;  3K04 A;  2OTL V;  2LQT A;  4X20 B;  2HHH B;  1VIB A;  3TET A;  4O4H A;  2QGN A;  4I7Z B;  4J7Z A;  5EZY B;  2JEU A;  3IFX A;  4XDL A;  1QLN A;  1Q43 A;  2AGA A;  4WFG A;  1I08 A;  2F93 B;  4FLZ A;  3E86 A;  3P3N A;  3K57 A;  1IBK O;  3ZRS A;  3FYE B;  2QWO B;  4MVZ A;  3RYI B;  5KUM A;  1JQ0 A;  4X62 B;  3KCX A;  4B08 A;  2UUB O;  1K33 A;  5JCO C;  3ASN B;  1ORQ C;  5IYB O;  4OPH A;  2KSD A;  3JAL A;  4JAS A;  1N33 B;  2DE0 X;  5LOV B;  4X65 O;  3E89 A;  5LHI A;  3CCJ V;  4X62 O;  2ZNI A;  1N32 B;  1FXK C;  5IY5 B;  3OUF A;  3AK2 A;  2LGW A;  2XAJ A;  2B9Z A;  1VF6 C;  2ZE8 A;  4UCR A;  2FYU H;  2YEV B;  1Q3E A;  3OTF A;  4O4I B;  4WFB V;  1RSO B;  1EFR G;  3JYC A;  4FM2 A;  3UT5 A;  1GKF A;  4IIJ A;  2K9P A;  4F6R A;  4DV2 B;  2QE7 G;  1B06 A;  2B1I A;  1FAF A;  1QQC A;  2R9R B;  2F66 C;  1JVM A;  1Q81 W;  3D36 C;  4R50 A;  2ZDI C;  3CJH B;  4MTF A;  4JYB A;  1PKX A;  4JAV A;  4P30 A;  1FJG B;  4IGG A;  4DV4 B;  2F43 G;  3J7A U;  1SQQ H;  1ZL8 B;  4MVS A;  4MVM A;  1U97 A;  4DV2 O;  1ARO P;  4KP4 A;  2P6J A;  1K34 A;  4PA7 A;  2A3Q A;  3U11 A;  1ZAU A;  1M5I A;  4GYC B;  5CA3 A;  4FM1 A;  3RYH A;  1NS1 A;  1YF2 A;  1IZ3 A;  4N23 A;  1SQG A;  1GK9 A;  1Q90 D;  2DYR C;  3L73 H;  2IU0 A;  3ZMS A;  1FJG O;  4DV4 O;  4F4L A;  3BA8 A;  3RYF B;  2KQX A;  2UXX A;  3H01 A;  3JAR A;  3CMA V;  1K7D A;  1XQ8 A;  1YEW A;  2Q68 A;  4BW5 A;  2YID A;  4FFB B;  4NXN B;  4K0K B;  2V1D A;  1SC5 B;  5EC2 C;  2K1E A;  1S72 V;  2XAG A;  3ICX A;  3E22 A;  1S77 D;  3FKS G;  1W0K G;  5CA1 B;  2CTQ A;  3FAV A;  5KHK A;  3CC2 V;  1OV9 A;  1PP9 H;  3CCM V;  4DV6 B;  1GTO A;  2L35 A;  1F23 A;  3LNM B;  4J7K A;  1I94 B;  4NXN O;  4K0K O;  1VQ5 V;  1VAR A;  3N2G B;  3E35 A;  2P90 A;  4DV0 B;  3J80 N;  4LF4 B;  4TUY B;  1SES A;  2YIC A;  2DYS C;  2CGN A;  4IL6 Z;  2Q69 A;  4F6E A;  3BRC A;  2ZIM A;  1FFX A;  3UQ8 A;  3AK1 A;  4P9O A;  4JAA A;  1XNR B;  4UCO A;  3OT7 A;  2Z5U A;  2YC0 A;  4DV6 O;  3K03 A;  4DRX A;  4JI4 O;  1I94 O;  5EIB D;  2P7T C;  2JJ1 G;  4MW8 A;  1NTZ H;  2AZ2 A;  2XHB A;  4X1I B;  3RVY A;  5IYZ B;  2YI9 A;  2PYL A;  4LCU C;  1XNR O;  5IDJ A;  2JK5 C;  1H8H G;  2HR3 A;  3RWR D;  1BT8 A;  3U10 A;  1F51 A;  2FB5 A;  4W4L A;  1VQ9 V;  4XBF A;  2Z0A A;  2QKA A;  4X1K B;  3F7Y C;  2H8P C;  4E4E A;  2AW9 A;  1DK1 A;  4JAU A;  2E76 B;  1E79 G;  5LXT A;  4MTO A;  2LFR A;  3CCR V;  2WWW A;  1G1X B;  1AI4 A;  1N8R W;  5J2U B;  4H33 A;  3FB5 C;  1R3L C;  5LP6 A;  1OHH G;  4GT1 A;  3DTU B;  4JZG A;  4ZHQ B;  1HNZ O;  2FTK A;  3E83 A;  3IAY A;  4YJ2 B;  3OD4 A;  4WFE A;  2R70 A;  5D5P A;  4K35 A;  2RNB A;  2XUM A;  3DC5 A;  4K3A A;  5KUK A;  3IC7 A;  2PY5 A;  2Q9L A;  2X0L A;  1VQ7 V;  1M90 W;  5KLV H;  3CRA A;  3OAA G;  4LF5 B;  2NN4 A;  3AG7 A;  1FXK B;  4DYL A;  2B1G A;  2N04 A;  1M57 C;  1R1B A;  2HVJ C;  5KMG A;  2VWJ A;  4O4L B;  2Y4U A;  1XUQ A;  1H38 A;  4LBE C;  2OWO A;  1IX9 A;  4NYK A;  2EX3 A;  5DN6 G;  2KG7 A;  4CH5 A;  3JAK A;  1K4D C;  3SYC A;  5LHH A;  4LC1 A;  3TK1 A;  4LF5 O;  4DXW A;  2IBZ H;  3F5T A;  2QDO A;  4DK0 A;  2EIN C;  5JVD B;  4J9Y B;  2PF4 E;  1V9P A;  1YCI A;  2E5L B;  3LUT B;  5EBL C;  1PNL A;  2X7R B;  4I50 B;  4UVC A;  1KQS U;  4R6Z A;  4B7K A;  1S3J A;  4J10 A;  1QNM A;  5KX5 A;  1YJW V;  3HKB B;  3K58 A;  2QM8 A;  3SPI A;  2VQE B;  3OW2 U;  3ZMZ A;  1AIL A;  2M6Y A;  1PM9 A;  1U96 A;  3D3Q A;  4OXS A;  3RYC A;  5B5E Z;  5LGU A;  3WB1 A;  4GLX A;  5H9C A;  1Q8I A;  5CA0 B;  4TWK A;  1AB3 A;  2N74 A;  4JI1 B;  1UPG A;  3T2M A;  5LYJ A;  2A06 H;  3A8T A;  1KP3 A;  2DWE C;  3L74 H;  3A0B Z;  4AI8 A;  1Y76 A;  1DF5 A;  1F7Y A;  3ABL C;  2M7W A;  5J2T A;  1D2D A;  4PEL A;  2F4V B;  4G2K A;  3OEH G;  1IXM A;  2UUA B;  5IJ9 A;  4WFA V;  4DR2 B;  4UVA A;  2P4V A;  3SYO A;  3T4D A;  3TGU H;  3ZBH A;  2BTQ B;  2MK3 A;  1S5H C;  1Y74 A;  4FK5 C;  5K1P A;  1P84 F;  2PGG A;  3CX5 F;  2F4V O;  1H2M A;  4DR6 B;  3N2K B;  2ZE7 A;  3VQW A;  2VWK A;  3ZIA G;  2UUA O;  1VMG A;  1FD9 A;  2P67 A;  2IJK A;  4LP8 A;  4DR2 O;  2Q7E A;  3LSS A;  4ABM A;  5BR8 B;  4JI3 B;  3W7W A;  4TV8 B;  3ABM B;  2KB1 A;  1PL0 A;  2ITD C;  5IY5 C;  1EN5 A;  1Z5V A;  4L87 A;  4YY3 B;  1SKV A;  2L6L A;  4WFF A;  3LDD A;  2ZNJ A;  3JSN A;  4NXM B;  4DR6 O;  4WBN A;  3P32 A;  2EIK B;  2F23 A;  5KHG A;  1HNX O;  5GW7 A;  3ABK C;  4LH6 A;  1S5L Z;  5BR8 O;  4JI3 O;  3E8H A;  2BTO A;  2Q67 A;  3CCE V;  4X88 A;  5DED A;  3GVM A;  4YY3 O;  1KKC A;  4TSF G;  3SPG A;  3D36 A;  4NXM O;  3ABU A;  1XDC A;  1XMQ O;  1NZ6 A;  4EB6 A;  4LNU B;  2AHY A;  4R7C A;  3B77 A;  1QR9 A;  1BL8 A;  4O4J A;  1I0H A;  1V55 C;  4PA3 A;  3NXS A;  1MZE A;  3O65 A;  4HNA A;  3L70 H;  1VQM V;  1JFF A;  3JCZ A;  4GUN A;  5BMV A;  4DW1 A;  4DR3 B;  3Q4H B;  5GTH Z;  3LDE A;  4OGQ B;  1MSD A;  4B3T B;  5CBH A;  4IYH A;  2W6J G;  3WG7 C;  1BMF G;  3VQX A;  2P5O A;  1OZ0 A;  5L3B A;  2GUZ A;  3K59 A;  2YSU B;  1V54 C;  2JS5 A;  3B09 A;  1H2L A;  4QPK A;  3FB6 C;  4DK1 A;  1BHB A;  3UM7 A;  4IHJ A;  2G38 A;  4ICG A;  3SR2 C;  1M57 B;  3GWK C;  1R3K C;  4DR3 O;  2EJ7 A;  1Q5O A;  4O2A B;  4YHH O;  5LA6 B;  1BHA A;  4DV1 B;  2A79 B;  4B3T O;  3P30 A;  2P22 C;  4PDM A;  1L0L H;  1RFY A;  1VQ6 V;  3ZHT A;  1DLB A;  2Q7G A;  1SRY A;  5JH7 B;  1LUW A;  2WLM A;  1DTO A;  3HB3 B;  3JAT A;  1JPX A;  2YS8 A;  1HR0 B;  4DUZ B;  4DV1 O;  1YZB A;  2WLI A;  3K0G A;  1TUB B;  5D5Q A;  4PA6 A;  1MA1 A;  1SA0 B;  1G6U A;  2OCC B;  2NR5 A;  1SQF A;  2PTM A;  2DOS A;  1YIT V;  3JAW A;  2H94 A;  3T4Z A;  4FZ1 A;  4JI5 B;  5FLX N;  2UXC B;  3ZRW B;  1HR0 O;  5K1X A;  2AHZ A;  4W4K A;  4GX0 A;  5JQG B;  2CTP A;  1NT2 B;  4FPP A;  1XL6 A;  2QWR B;  2Q73 A;  1B3Q A;  4TOI A;  4FLX A;  5EIB C;  3OMI B;  1WB8 A;  3O9O A;  3W7T A;  1GN2 A;  1GM8 A;  3AG3 C;  4JI5 O;  4E2L A;  1VEW A;  2JS3 A;  3BFR A;  2UXC O;  3ABL B;  4ZIB A;  1KB9 F;  4MVQ A;  3JAR B;  1R3J C;  1PV0 A;  1EZV H;  1K92 A;  4ZKI A;  3JAM N;  2YIB D;  1H8E G;  3OTO B;  2EZO A;  1IXB A;  4H13 B;  4BR6 A;  3RW0 A;  2HHH O;  4DW0 A;  3HKD A;  5CN0 A;  3S3W A;  3OM3 B;  3SYP A;  3QO7 A;  3APO A;  4ASU G;  1PD3 A;  1DF4 A;  4UV8 A;  1P7G A;  3I5D A;  3OTO O;  3GWO A;  4C7U A;  4I4T A;  1JOY A;  4RQE A;  2HFE C;  1MAB G;  2UXB B;  3WB2 A;  5IJ0 A;  3BPZ A;  3ZS8 C;  1SQB H;  1QR8 A;  4DR4 B;  3K3W A;  4GX5 A;  4XDK A;  4DRX B;  3S3X A;  1N33 O;  5F2V O;  4CC6 A;  3ABK B;  4DV3 B;  1ZWI C;  4DV7 B;  1ZTE A;  4AIL C;  1XHX A;  4TV9 B;  5ITZ A;  2W0F C;  2XAF A;  4LFC B;  1N32 O;  2UXB O;  1R3I C;  3OR7 C;  5EYP B;  3ASO C;  4A5U B;  2RN9 A;  1WB7 A;  4Q6G A;  3RN4 A;  4LF9 B;  4DR4 O;  3JD4 A;  1SS3 A;  5JJE B;  2ZR2 A;  3K5M A;  4UUJ C;  4DV7 O;  1GRJ A;  3JAS A;  2WA4 A;  1V55 B;  4B3R B;  4K8Z A;  4JYA B;  3T1C A;  5BY1 A;  5LXT B;  1JCH A;  3SJC C;  1MOF A;  1WAZ A;  3RGB A;  2ETN A;  3PJS K;  2Z3Y A;  1N4C A;  3WG7 B;  1BSM A;  4B3S B;  2JVD A;  2DMX A;  1XOU A;  2EIJ B;  1V54 B;  3DXR B;  1QHT A;  2QEX V;  4GKJ B;  2ADQ B;  3TJT A;  4X1Y A;  5C8Y B;  4O2B B;  1VQO V;  5CBG A;  2B5U A;  4PA9 A;  1SF9 A;  2YUA A;  4B3R O;  3CYO A;  3R66 A;  4JYA O;  1R6K A;  1VQP V;  2CTW A;  3CRR A;  3LNN A;  5FPO A;  4X20 A;  3ZHV A;  5AG2 A;  3EVK A;  4HBN A;  4FMT A;  2GDS A;  5EZY A;  2ZT9 B;  4KXR A;  4B3S O;  3TXS A;  1QLE C;  3QG5 A;  4GKJ O;  5KMG B;  4R8C A;  1SET A;  4DR7 B;  4JI7 B;  1QU7 A;  5KHH A;  1YXB A;  1QCE A;  2X6A A;  3RYI A;  3OEE G;  1N0N A;  1AI5 A;  2EUL A;  1IBL B;  1G8M A;  1BQ0 A;  2YDE A;  1XNQ B;  1JA8 A;  5EBW C;  3P3P A;  1L0N H;  4U3F H;  2CDY A;  1KU9 A;  4I55 B;  5B66 Z;  4FM0 A;  1AI7 A;  4EFB A;  3BEH A;  4KUM A;  3MHS C;  1WP7 A;  4X9Q A;  4TT3 G;  4JI7 O;  4DR7 O;  3UO3 A;  3F5W C;  3AG1 C;  1OCR C;  2PI4 A;  1Y66 A;  1ZLZ A;  1W0J G;  5LOV A;  1G4Y B;  1K5S A;  4MVO A;  3ABM C;  1HP8 A;  1XNQ O;  4DV0 O;  2EIL B;  3K06 A;  1AR5 A;  4LF4 O;  1KMI Z;  3X2Q B;  4CS3 A;  5BZB A;  3A2F A;  2EIK C;  1NR7 A;  4JTC B;  2YEV A;  2CE4 A;  2JGD B;  3AG3 B;  4O4I A;  3CCS V;  4DO2 A;  3FB8 C;  4YJ3 B;  5B1O A;  3CCQ V;  1RSO A;  3RYC B;  1JX9 A;  2QJ1 A;  2WPD G;  2FL4 A;  2A7W A;  4MS2 A;  1VQK V;  2Y69 B;  3FB7 C;  5FL7 G;  4ZI7 B;  3ETD A;  3BCC H;  2ODM A;  5IWA B;  3HKC B;  3CJH A;  4U3J B;  2XND G;  5IYC O;  2BSK B;  3ETQ A;  5KAF Z;  1AR1 B;  4YIP A;  3R65 A;  3H9V A;  3KKY A;  2LW1 A;  2CH7 B;  2IH3 C;  5B1B B;  2GV9 A;  3L75 H;  1SQP H;  1NBM G;  1K97 A;  2N05 A;  2ZQM A;  1SER A;  5LMN B;  4LFA B;  4BW9 A;  4JV5 B;  3QTC A;  5GTI Z;  5IWA O;  1GM9 A;  3K9A A;  1H2S B;  3M99 B;  1YIJ V;  4CC5 A;  5CB4 B;  1WNS A;  1HWY A;  5LGN A;  2DN9 A;  2IU3 A;  1PNK A;  3FX7 A;  1SQX H;  4GCZ A;  3L72 H;  1Q7Y W;  3ETG A;  3OFN G;  3ZRV A;  4H44 B;  1MMM A;  5LMN O;  4FFB A;  1FXH A;  4RAI A;  2QSA A;  3AG2 B;  4KL1 A;  2ILM A;  3W7X A;  4J11 A;  3CSX A;  1N0J A;  3W7S A;  4I0X A;  5CA1 A;  2W6I G;  3L9D A;  1HNW B;  3OGC C;  1XRE A;  1M4U A;  3ASO B;  1X4T A;  4PDV A;  1TVK A;  2ATK C;  1K5Q A;  4LWS A;  2R9A A;  3N2G A;  4J7J A;  3VOU A;  2LW7 A;  4NTX A;  4FLU A;  1K73 W;  2D3O W;  2OCC C;  4NR1 A;  4TUY A;  1GM7 A;  1J95 A;  1EBO A;  2A9H A;  5FNV B;  3OUS A;  1HNW O;  1M93 A;  1FXV A;  3EFF K;  4RUF A;  1D5A A;  1GH6 A;  2P06 A;  2E5L O;  1WJZ A;  3HKE B;  5HFM A;  1WA8 B;  2DQ3 A;  1YDX A;  4UV9 A;  2GTS A;  1EN6 A;  2EBO A;  3JD3 A;  4TQF A;  4X1I A;  2UU9 B;  2WLH A;  3GB7 C;  5IYZ A;  2WLL B;  4H37 A;  4PA4 A;  2VQE O;  4UCU A;  4CS4 A;  3IC9 A;  5GON B;  4X1K A;  4D7S A;  4JI1 O;  1QLE B;  4WFH A;  2ZR3 A;  2UU9 O;  1L1F A;  3CCU V;  3B2E E;  1VQL V;  3MHH C;  5J2U A;  4FIP C;  4Z1V A;  3NR7 A;  2OIE A;  3CS5 A;  3DSQ A;  3C90 A;  5JWP A;  2JRI A;  1N36 B;  2OT5 A;  5LGT A;  2E75 B;  4ZHQ A;  3ML0 A;  5JCO A;  2GHY A;  4QNH B;  4IYI A;  2EIM C;  1AR4 A;  2RJZ A;  2RMK B;  2PZS A;  1EZJ A;  2PI5 A;  4YJ2 A;  3AG1 B;  1OCR B;  3SGI A;  3HPL C;  4EKW A;  4BWA A;  4N21 A;  2ARH A;  4CH4 A;  1TUE B;  4LFB B;  2QM7 A;  5DEC A;  1SQV H;  1FXK A;  4FLW A;  2WLN A;  3SDL A;  1GMG A;  1VF6 A;  2X6B A;  4FFK A;  2LFS A;  4OPA A;  1NTK H;  4PD4 F;  3CRC A;  3H1H H;  3CD6 V;  1YHQ V;  2Q6A A;  3FYI B;  4GKK B;  4LFB O;  3ZRX A;  4P9P A;  5JVD A;  3ZHS A;  1Q6I A;  2HEP A;  2F95 B;  2XTA A;  3M7M X;  4UFZ A;  5L3F A;  4G27 B;  2ZDI A;  2WA3 A;  1FYJ A;  4I50 A;  4O4H B;  3OE7 G;  3SJQ C;  3MAQ A;  3K9S A;  1Y6X A;  1N34 B;  3H1J H;  4GKK O;  3VQY A;  1GN6 A;  1I5Y A;  2EJR A;  3HKB A;  1W2B U;  1YJN V;  4X89 A;  3JSL A;  4WF9 V;  4DV5 B;  4J80 A;  1XBL A;  2R9I A;  4JGS A;  2DJV A;  4JTA B;  5LP6 C;  3THO A;  2EIJ C;  1Y67 A;  4MT8 A;  1NU1 H;  1Z2G A;  2NNU A;  5CA0 A;  3BAA A;  4FLV A;  4P2Z A;  1P4R A;  4H0L B;  5DM6 V;  1KEC A;  4OX9 B;  2ZIO A;  3JAL B;  3UKM A;  1VF5 B;  3H1L H;  1VQ8 V;  2KKW A;  3RFR A;  2MW2 B;  4QGP A;  4JYY A;  3K5L A;  1XI1 A;  1YI2 V;  1SZX A;  3K79 A;  3ZMU A;  2OTJ V;  4Z2W A;  4OX9 O;  3BHP A;  1UFI A;  3TCU A;  1QBZ A;  2HG5 C;  2UXN A;  1CEZ A;  2OIG A;  3UT5 B;  2BTQ A;  4IIJ B;  3QF7 A;  3CE2 A;  4F6R B;  3T1H B;  4GX2 A;  4IT5 A;  2IH1 C;  4X8A A;  4PV1 B;  4JYC A;  1K9M W;  3N2K A;  4HAM A;  2BOC C;  3ZN0 A;  2Q4P A;  4WCE V;  2PYJ A;  1Y4M A;  5KAI Z;  1IUR A;  4DUZ O;  4TV8 A;  4U7N A;  1KUQ A;  4LH7 A;  4EEQ A;  4NKG B;  3SJB C;  3ZMV A;  2EIL C;  4PJ0 Z;  1I7F A;  3T1H O;  3A0H Z;  3X2Q C;  3SPH A;  1EN4 A;  4Z1M G;  3G67 A;  3RYH B;  2GTA A;  3CEI A;  5C93 A;  5JJJ B;  4MSW C;  1JJ2 U;  1A32 A;  2VS0 A;  2Y69 C;  4ZOL A;  4JI2 B;  3LDC A;  1GO3 F;  1PNM A;  5L3G A;  4ZBM A;  2BCC H;  4JI8 B;  3CP1 A;  2Q0A A;  2QTS A;  5IE9 A;  4I9Q A;  4LNU A;  1XMO B;  4TQD A;  3ZN1 A;  1GN3 A;  1X59 A;  3E22 B;  1VQN V;  2YI8 A;  1MZF A;  5B1A C;  2UUB B;  5LL6 Y;  3FAV B;  5B1B C;  3E8G A;  1KP2 A;  5B3S C;  4JI2 O;  1NKD A;  4BAY A;  1YTF D;  1TAE A;  2EIM B;  2QWN B;  3Q4H A;  1BE3 H;  4X65 B;  4JI8 O;  1OCC B;  4BIO A;  1XMO O;  4QIW F;  4YIO A;  1OCZ B;  3W7U A;  2EZP A;  1YTF B;  1FS0 G;  5L3C A;  3ZHU A;  1FFX B;  1ZX3 A;  3AG2 C;  3CRQ A;  5LMU B;  1NVP D;  1ENV A;  4O2A A;  5LA6 A;  3EXA A;  2GBO A;  1AP6 A;  2NLJ C;  1IBM B;  1VQ4 V;  3B4S A;  2D2C B;  4DR5 B;  4PI2 A;  5A9G A;  2IJJ A;  3H1I H;  4UCT A;  2ZKO A;  4L8J A;  1NVP B;  2P4K A;  5H5N A;  1P49 A;  2HJF C;  5B1N A;  4UB8 Z;  1RM1 C;  1W59 A;  5KA6 A;  1XEQ A;  1AP5 A;  3CC7 V;  1H2N A;  1YSC A;  5BXZ A;  3SPJ A;  4J41 A;  3D3I A;  4UVB A;  5JH7 A;  5LMU O;  1THZ A;  1VP7 A;  3K5O A;  1FPO A;  2CTR A;  3KZI Z;  3CCL V;  1IBM O;  5KHI A;  4DV3 O;  1E1R G;  4FVM A;  4DR5 O;  3E2E A;  1TUB A;  5IYD O;  1SA0 A;  5H2F Z;  4LFC O;  1BGY H;  2BOB C;  4I9W A;  1ZUQ A;  1URF A;  2WLK A;  3VQV A;  2QR4 A;  3STL C;  1VF7 A;  2JGU A;  1M1K W;  2X6C A;  3JCU Z;  5EC1 C;  4LF9 O;  3ZRW A;  1L8D A;  2CUG A;  3OR6 C;  5LP6 B;  4LF7 B;  3K5N A;  2LP7 A;  5JQG A;  4X64 B;  3J81 N;  1E1Q G;  5L3D A;  3U0Z A;  3WB0 A;  3L71 H;  4HYO A;  2JIZ G;  5HFL A;  3K0D A;  2IJH A;  2QWQ B;  2RQ6 A;  3CRM A;  1XL4 A;  1RPR A;  1Q6H A;  2RCV A;  3F7V C;  3B8N A;  1RPO A;  2CK3 G;  1XHZ A;  1O9H A;  4QE7 A;  3G80 A;  3B40 A;  2W0X A;  4LF7 O;  2GSM B;  4NTW A;  1LUV A;  2R72 A;  4X64 O;  4CH6 A;  4XDJ A;  3ABT A;  5TIS Z;  1DGS A;  2Y4T A;  1Q82 W;  1Q86 W;  3BAB A;  3QNE A;  4FJC C;  2OYQ A;  2KG7 B;  3JAK B;  1WLE A;  3BA9 A;  2IJI A;  4I0X B;  2YIB A;  4PI0 A;  1MSW D;  1TGO A;  1TVK B;  2V7Q G;  1COW G;  3K08 A;  3RVZ A;  4LWS B;  4JI4 B;  4UCV A;  1GN4 A;  2HP8 A;  2OCH A;  1IBL O;  1M9N A;  1BCC H;  1OCO B;  3I55 V;  5KX5 B;  2HLD G;  1ZSP A;  4JTD B;  1LNQ A;  4K8X A;  3C3S A;  3FFQ A;  3ZJZ A;  4CZZ A;  1GAX A;  1IVS A;  2PUS A;  2HVK C;  2ZD9 A;  2Q0O C;  4J9Z B;  4YXW G;  2JEX A;  3TXQ A;  3MDS A;  4TV9 A;  3ZX6 A;  4AHC A;  5CBF A;  1US6 A;  5LYJ B;  1WPX A;  2AXT Z;  5EYP A;  2LGQ A;  1Y76 B;  3CWB H;  4NVP A;  3ZED A;  4KHP B;  2HJD A;  3B8M A;  5J2T B;  1EM1 A;  1JMK C;  1ZL8 A;  3AG4 C;  5E79 Z;  5B1A B;  1LR1 A;  4EFE A;  3UO2 A;  5B3S B;  2E74 B;  2ZE6 A;  3RT3 C;  1HNZ B;  3D8C A;  3CHX A;  1Q6U A;  5IJ9 B;  3ZHR A;  4B7E A;  1CXZ B;  3PN1 A;  2UXD B;  1AI6 A;  2DWD C;  2Y0I A;  5KA5 A;  4KHP O;  3QO5 A;  1Y74 B;  4JI6 B;  3RYF A;  3DXR A;  2Q8V A;  1PPJ H;  5C8Y A;  1CPY A;  4O2B A;  1PL4 A;  2DQ0 A;  4G28 B;  1R6N A;  3CXC U;  4LFA O;  4JV5 O;  5IT9 N;  2XAQ A;  4GX1 A;  2UXD O;  1YVW A;  2O57 A;  1HW7 A;  4JZ2 A;  4FZ0 A;  2VRZ A;  4JI6 O;  1YJ9 V;  1S0V A;  3G4S V;  4WBN B;  1RM1 B;  3HR0 A;  4MTG A;  3OMN B;  3JD2 A;  1OJH A;  2YIA A;  3STZ C;  5LHG A;  2XAS A;  3H1K H;  3A0R A;  2IW5 A;  4BIU A;  3CPW U;  2HKO A;  2XAH A;  4I55 A;  3OGI B;  1JR9 A;  3N27 A;  3IJ4 A;  1BQZ A;  4EB6 B;  1K8A W;  2ZXW C;  2E3C A;  1M56 C;  4RWU A;  1F4N A;  4MVU A;  4O4J B;  1JJO A;  2JJ2 G;  3IGA C;  2FKX A;  4HNA B;  4JI0 B;  2DW4 A;  2Y48 A;  1JFF B;  5BMV B;  4DR1 B;  3E8F A;  2JGD A;  4YJ3 A;  1NR1 A;  3JD0 A;  2DYR B;  4HZ3 A;  2GUZ B;  4AQY B;  1F4M A;  1KC8 W;  2ITC C;  2YXY A;  4IHJ B;  4JI0 O;  4ZI7 A;  2QA4 V;  4DR1 O;  3HKC A;  3SPC A;  1UJW B;  2VQF B;  4U3J A;  2BSK A;  2JDI G;  2C2A A;  1K4C C;  4KFM A;  3OMA B;  1BS3 A;  1RP3 B;  4LF8 B;  3QVN A;  4QJF B;  4QPJ A;  2CH7 A;  4AQY O;  4JF3 A;  2YXH A;  3DC6 A;  4LF6 B;  2CGO A;  3UCS C;  4JPR A;  3JAT B;  1AVM A;  5JJN B;  2VQF O;  1OCC C;  2ADP A;  4J42 A;  1NTM H;  1KKD A;  4NTY A;  1FKA O;  5KHJ A;  5CB4 A;  1OCZ C;  2WLI B;  3VBB A;  4LF8 O;  3SYA A;  1QVF U;  4LR3 A;  4PDL A;  4GZR B;  3ASN C;  2V4D A;  2UUC B;  1WP8 A;  3JAW B;  1N36 O;  2DYS B;  4MW3 A;  4QE9 A;  4O4L A;  1K3E A;  1HNX B;  3G6B A;  4LF6 O;  3AEI A;  1KBH A;  1Z5W A;  1NJI W;  4BIZ A;  2WLJ A;  4FLY A;  2ZM6 B;  3KCY A;  5EBM C;  1WN7 A;  1KD1 W;  2Q5Z A;  1B04 A;  1ROP A;  2XOK G;  4U7O A;  1R6T A;  2QKS A;  2ZIN A;  4B3M B;  1MNG A;  5EK0 A;  2UUC O;  4CBC A;  4PDR A;  1XMQ B;  2QWP B;  1MG1 A;  4UB6 Z;  1S5J A;  1H2G A;  3KG2 A;  3RBZ A;  4FLT A;  4CH3 A;  2ZM6 O;  3G6E V;  5H6R A;  3AG4 B;  4ZOL B;  2XT9 A;  3I56 V;  1IDS A;  3BY6 A;  2A0L A;  3JD1 A;  3G71 V;  3DGE A;  2F1M A;  2QKC A;  5J9P C;  5FNV A;  4B3M O;  2IM9 A;  1D5N A;  2CAZ C;  3ETE A; 
#chains in the Genus database with same CATH homology
 2JRI A;  4DR6 O;  4LF7 O;  1N33 O;  3T1Y O;  1HNX O;  3J7A U;  2DOS A;  4JI0 O;  4JI8 O;  4X64 O;  4KHP O;  1XNR O;  4JI7 O;  4DR7 O;  4DV2 O;  4DR1 O;  1XMO O;  5BR8 O;  4JI3 O;  5FLX N;  4OX9 O;  1N32 O;  2UXB O;  1N34 O;  1NS1 A;  2Z0A A;  4YY3 O;  1AIL A;  1HR0 O;  4A5U B;  2AGA A;  1XNQ O;  4DV5 O;  4DV0 O;  4NXM O;  1DK1 A;  4LFA O;  3SDL A;  4DR4 O;  4AQY O;  4LF4 O;  4JV5 O;  5IT9 N;  1XMQ O;  1FJG O;  2UXD O;  1AB3 A;  2LW7 A;  2N74 A;  4DV4 O;  1G1X B;  4X66 O;  4OPA A;  4DV7 O;  1IBK O;  4DUY O;  2VQF O;  4JI5 O;  4JI6 O;  1HNW O;  1FKA O;  3O65 A;  2ZKO A;  1J5E O;  2UXC O;  1F7Y A;  5H5N A;  5BY1 A;  2UUB O;  4LFB O;  4LF8 O;  2E5L O;  1XEQ A;  1IBL O;  5BXZ A;  4DUZ O;  1D2D A;  1HNZ O;  1KUQ A;  4OPH A;  1N36 O;  5LMU O;  3T1H O;  3JAM N;  4LF6 O;  1IBM O;  4DV3 O;  1FYJ A;  4X65 O;  4DR5 O;  4B3R O;  4X62 O;  3R66 A;  4JYA O;  2HHH O;  4NXN O;  4K0K O;  5A2Q N;  4LFC O;  1R1B A;  4GKK O;  2VQE O;  1A32 A;  4DR3 O;  1R6T A;  4YHH O;  2UUC O;  3J80 N;  4LF9 O;  4B3T O;  2F4V O;  2DJV A;  5IWA O;  4B3S O;  4JI1 O;  2UUA O;  2UU9 O;  3OTO O;  4GKJ O;  4JI2 O;  2FKX A;  3M8A A;  3J81 N;  4DR2 O;  2ZM6 O;  4DV6 O;  4JI4 O;  4LF5 O;  1I94 O;  3F5T A;  1X59 A;  5LL6 Y;  4B3M O;  5LMN O;  3RT3 C;  4DV1 O;  1YZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...