4YHHO

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
88
structure length
88
Chain Sequence
b'PITKEEKQKVIQEFARFPGDTGSTEVQVALLTLRINRLSEHLKVHKKDHHSHRGLLMMVGQRRRLLRYLQREDPERYRALIEKLGIRG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 28
structure length 88
sequence length 88
ec nomenclature
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
O PF00312 Ribosomal_S15 Ribosomal protein S15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.10 Mainly Alpha Orthogonal Bundle Helix Hairpins S15/NS1, RNA-binding 4yhhO00
1AB3A 4JI6O 2F4VO 2LW7A 1HR0O 4GKJO 3J7AU 4DR4O 4LF5O 3JAMN 4DV6O 4LF6O 1FYJA 4YHHO 3R66A 4DV4O 1I94O 4B3TO 1AILA 4X66O 4JI3O 2UU9O 1YZBA 1FKAO 4NXNO 4OX9O 2JRIA 1A32A 2UXDO 4DR1O 1N36O 1IBKO 2E5LO 4DV3O 4B3MO 1R6TA 1DK1A 4DV5O 5BXZA 1FJGO 4LFAO 4DV7O 4X62O 3OTOO 4YY3O 4DUZO 2FKXA 3O65A 4OPAA 2UXBO 4GKKO 4AQYO 4DR6O 1F7YA 4OPHA 4JI7O 1R1BA 2ZKOA 1D2DA 4JI4O 4DV1O 4B3RO 1KUQA 4B3SO 1XEQA 4DR7O 2UXCO 4LF7O 4DUYO 4LFCO 3J81N 4LF9O 5LMUO 2UUCO 1XNRO 1G1XB 4DR2O 4JI0O 1IBLO 1X59A 4JYAO 4A5UB 3T1YO 4DV2O 2HHHO 4JI1O 2N74A 4LF4O 4NXMO 5IT9N 5IWAO 1HNZO 4DV0O 4JI5O 3RT3C 5FLXN 1XNQO 4K0KO 3M8AA 1N34O 2DOSA 2DJVA 5H5NA 5A2QN 4DR3O 1IBMO 2ZM6O 3SDLA 1NS1A 4JV5O 4X64O 5BY1A 1XMQO 5LL6Y 3T1HO 1N33O 4LF8O 2UUAO 4LFBO 2Z0AA 2AGAA 1J5EO 2UUBO 5BR8O 4X65O 2VQEO 2VQFO 4JI8O 4JI2O 4KHPO 1HNWO 4DR5O 3J80N 1XMOO 5LMNO 1HNXO 3F5TA 1N32O
chains in the Genus database with same CATH superfamily
4UCSA 3STZC 2Y69C 4IT5A 3L70H 1DLBA 2HVJC 2N05A 1PPJH 5EIBC 2P67A 1TUBA 1KD1W 2EIKB 3W7UA 2PZSA 1G6UA 2ZR3A 4NXNO 3D36C 5CA0A 5LMUB 3ML0A 1QNMA 1Q43A 1YF2A 4IIJA 3WB0A 4B3MO 1BQZA 2R70A 1Q8IA 3JD2A 3WB2A 4UV8A 4YY3O 1P4RA 1KP2A 1HDJA 2XAFA 2YEVA 1JPXA 4FLUA 3N27A 5LOVA 4UVBA 4LBEC 5B3SB 2EX3A 4B3SO 1WB7A 2Q69A 3G67A 2UUCO 2B1IA 3E8FA 5LMNB 2JGDA 2AXTZ 4DO2A 1Y66A 3TETA 1FPOA 2BSKB 4DK0A 1P49A 4I0XA 4UCVA 3UO3A 4PA3A 1I5XA 3CSXA 4NXMO 5C8YB 4AHCA 4PA6A 4X1KB 2OCCC 3K58A 2VQFB 3K0GA 4R7CA 4U3JB 1KP3A 3Q4HA 3NR7A 3FB5C 1NTMH 4WCEV 2IJIA 2YS8A 4UCRA 1M93A 3ABKB 3SDLA 1XL4A 3JD0A 1AP5A 4X62B 1VQPV 1YIJV 3ETQA 2KG7B 2UUBO 4WFAV 4DW0A 3K0DA 4DV1B 1HP8A 4JZ2A 1E79G 3OW2U 2BTOA 2EILB 4YXWG 5D5PA 3HR0A 4J42A 1NH2B 1NZ6A 4JTDB 1NKDA 2IBZH 1WA8B 2QJ1A 1KKCA 5JCOA 1MOFA 5CA3A 4UCOA 5IYZB 1AI6A 1K7DA 1I08A 1AILA 2RJZA 3KG2A 2IH1C 2QWPB 3CHXA 2ZXWC 4HZ3A 1IBKO 2XASA 1RSOA 4J80A 1ZSPA 3OE7G 1SERA 1SRYA 5L3BA 1L1FA 1N33B 4LR3A 4LNUA 1I0HA 3A0BZ 1U96A 1MA1A 1SA0A 1N34B 1VQ9V 2CGNA 3CMEV 3HKEB 3CX5F 4TUYB 1Q3EA 1I5YA 1O9HA 1SQBH 4PD4F 5JVDB 5IYBO 4RUFA 4U3FH 5E1AC 4BIOA 1K8AW 5E79Z 5EBWC 2QE7G 2JEUA 4J7KA 1AJPA 2L35A 3N2GA 2ZE6A 2OTLV 2DOSA 1KBHA 1QLEB 5A2QN 5KX5B 4LH7A 4B3MB 1RFYA 3A8TA 3FFQA 5IDJA 4ZOLA 4YY3B 1Q5OA 4O4JB 2PI4A 2N04A 1QU7A 1J5EO 1V55B 5CA0B 2RMKB 3U11A 1DTOA 3RW0A 2UUCB 4H33A 5DN6G 1NI8A 5GONA 2A79B 3D36A 4X9QA 1Q6UA 5LOVB 2WA4A 4DR4O 5LYJA 2IJKA 3HB3B 3AG4C 1FYJA 3ZRVA 4YHHO 1Y74A 4PA7A 1I94O 1PNKA 3SYOA 4NTWA 3ABMB 2Z5UA 1M90W 4LF9B 3BA8A 5KAIZ 1ZL8A 4DV3O 1JFFA 3APQA 4E2LA 1SC5B 5EYPA 1JX9A 4FLWA 3X2QB 2WLJA 2EINC 4ZI7A 4AQYO 4O2AA 2UUBB 4I9WA 1UJWB 4OXSA 1G8MA 2W0FC 4PDVA 3B8MA 4TOIA 2LQTA 4CS4A 2ZM6B 1S5HC 1P7BA 3H1KH 5IY5C 3EHBB 2QKCA 2N74A 5B5EZ 1BHBA 3JASB 4O4HB 4JI5O 3WU2Z 3BVOA 1IBKB 3ETGA 4F6EA 5CB4B 4H37A 2Y0PA 1ZX3A 2QTOA 3AK2A 4IYHA 5A9GA 3KCYA 2Q7EA 3H1IH 3SJAC 1GN6A 1MSDA 5EZYA 3SPCA 1RM1C 4MVMA 4TV8A 2P4VA 3OUFA 3DXRA 2H94A 3MHHC 5KLVH 3W7SA 2X6CA 2DQ3A 2HVKC 1FXKC 1NR1A 1HR0O 3CJHB 3OMIB 4FZ0A 3B40A 2Q73A 3JD4A 1YTFB 2ZDIC 4X66O 4JI3O 5JJJB 4W4LA 2UXDO 5GW7A 4WFBV 1Y67A 1KQSU 1NU1H 3RYFB 5JQGA 3OTOO 2ZNIA 1F4MA 1NH2D 3RBZA 3FAVB 4BR6A 3ZCCA 5F2VO 2CTWA 2R72A 1AR4A 1J5EB 1AROP 1NR7A 1S5LZ 4D7TA 4K8XA 4DR7O 1GMGA 4DXWA 4DUYO 2Q7GA 3ZHTA 1CPYA 2BCCH 1K73W 4FLYA 1BGYH 3C90A 4EKWA 4W4KA 3RYIA 2EIMC 2FB5A 3ABUA 1Z5VA 2Q8VA 1GH6A 1L0LH 2Y69B 1GTOA 4DR4B 2B1GA 3DC5A 4O2BA 3SPHA 3FYEB 3ZBHA 2ZIMA 5IYDO 3HKCA 4YHHB 1I94B 4K0KO 3CCJV 3K04A 4LCUC 1EBOA 2IJJA 3JATA 4DR3O 1PNLA 2M7WA 4DV3B 3ZMUA 2IU3A 1XREA 5CBGA 3SYCA 3HKBB 3RVZA 2PTMA 2HLDG 1FS0G 4EEQA 5GTHZ 5J2UA 1B04A 4WF9V 2RDCA 5BR8O 1Y4MA 4X65O 2G38A 2Q7HA 1J95A 2HJDA 3JAKA 1SS3A 3J80N 4WFFA 1JR9A 2EIJC 5K1PA 2R9AA 3IFXA 3TXQA 4JAUA 5ITZA 3JARA 5EYPB 5D5QA 4X1YB 5J2TB 1R3LC 3N2KB 1VQ5V 2GDSA 3HPLC 4UV9A 2LW7A 5LP6A 2QM4A 5FNVB 1GN4A 4QE7A 2A7WA 2QWNB 3LDDA 1H2LA 2ZT9B 2D3OW 1GK9A 3I56V 2RN9A 4JI5B 1TVKA 2OCCB 3GVMA 1A32A 1HWYA 1N36O 4FPPA 1SQQH 3VQWA 2NR5A 5KAFZ 1W59A 1FJGO 4FM1A 5DEDA 2FKXA 1F7YA 3RVYA 4CH5A 2ZNJA 5IWAB 3D8CA 5CN0A 4WFEA 2V4DA 2UXCO 5DECA 4LF7O 4P9OA 1XNQB 3E8BA 4LWSB 2UXNA 3AG7A 1FFXA 3U0ZA 3BFRA 5FPOA 3CRAA 1IBMB 2CUGA 5FPRA 1XI1A 1HR0B 1WPXA 5JCOC 3T4DA 2LFRA 3VQVA 2RNBA 2EJRA 2WLIB 2Q6AA 3M8AA 1XUQA 3AEIA 4JI3B 2UXDB 4X89A 2PUSA 3U10A 1GM7A 5LHGA 4YJ2A 1YEWA 3GWKC 3W7XA 1BE3H 2ZQMA 3K79A 3SJQC 3OMNB 5AG2A 1IDSA 2UUAO 5FL7G 1YI2V 4LH6A 1FXKA 2XAJA 3ASOC 4UCTA 3E35A 4L87A 4JI8O 3UT5B 4FFBA 4DR7B 1VARA 1YITV 4OGQB 4AI8A 2HFEC 2ZDIA 2ADQB 2AHYA 4ZKIA 1EN5A 3F5TA 3CRQA 4J41A 1LUVA 2X6BA 1EZJA 2E74B 4LF5O 2WA3A 4JTCB 5JH7B 1VQOV 4QPKA 2LFSA 3JCZA 5H2FZ 1VF5B 2F23A 2QWRB 2YUAA 4DV4O 3CRRA 2YDEA 2GUZB 4K0KB 5H9CA 2VRZA 1OCCC 4DR3B 5L3EA 1K33A 4EFBA 2AW9A 3E8HA 4PDRA 5BXZA 3CXCU 1VQ8V 4MVUA 1WLEA 3FYIB 2JS3A 1IURA 1JOYA 2H8PC 2JVDA 1GRJA 1JCHA 4F6RA 2ODMA 2ZE5A 1VMGA 5BR8B 2WLLB 1XEQA 4X65B 4GLXA 3E8GA 2Q0AA 3TJTA 2NLJC 1YTFD 4L8JA 3ZRSA 3SYAA 4GYCB 2JGUA 3SR2C 3ABTA 4JI0O 4CH4A 5LGUA 1S76D 3CEIA 3OGCC 1SZXA 2DYRB 4PA9A 4QE9A 3ZN1A 3ASNC 2WLMA 3HKDA 4CH6A 4EFEA 1Y76A 1AP6A 1GN3A 3AG4B 1PNMA 3T2MA 3KKYA 4CS2A 1F4NA 5TISZ 4N23A 5LGTA 2PGGA 2JDIG 1XMOB 1N36B 3OD4A 1M4UA 4PHZA 3WB1A 1FJGB 3I55V 3ZRWB 4MT8A 1VIBA 2EINB 3ZMSA 5CMUA 4X1IB 4TQFA 4O4IA 3STLC 1S0VA 4UVAA 2F95B 3IGAC 4NVPA 5EIBD 4JI2O 2UXCB 4LF7B 2BTQB 3OTFA 3JSLA 2JK5C 3IJ4A 2H3OA 5KHIA 3WFVA 3CC2V 1EN6A 4BIZA 2XUMA 1GM8A 1BL8A 2EULA 4RO2A 1L8DA 4LF6O 1AJNA 4UCUA 3R66A 3AG1C 4XDLA 3L9DA 3JALA 1GAXA 5KUKA 5IJ9A 2CH7B 3QNEA 4UB6Z 3BEHA 1MMMA 2XTAA 4IHJB 2R9RB 4HNAA 4CBCA 2ITCC 1BHAA 4DUZO 1BT8A 4CC5A 1WPBA 5EBMC 3O65A 3A0HZ 1WP8A 4GKKO 3LDEA 4ZBMA 3CRMA 4MVRA 2UUAB 3K57A 3CPWU 4JI8B 4LFCO 4H13B 3ZS8C 1BMFG 1H2SB 4G27B 1YSCA 4R8CA 1XBLA 2X7RB 3CCQV 1MG1A 3LNMB 4FMTA 4LC1A 1OCRB 1H2KA 4JI1O 4LF5B 1FFTB 2JJ1G 1YJWV 2C2AA 1OV9A 5B1AC 4DV0O 3H1JH 4DV4B 3RT3C 3TGUH 2ADPA 1S5JA 1HNWB 3SPIA 1OZ0A 1K4CC 3BPZA 1TGOA 2NNUA 3GB7C 3RYHB 2WSSG 4JASA 3NXSA 1DF4A 3QTCA 4X64O 3T1HO 2FYUH 3RYCA 4NTYA 3PJSK 1R6KA 1M57C 1DGSA 2YXLA 4NXNB 3SJBC 3AG3C 2XNDG 2JEXA 3ZHSA 4JI0B 4R50A 3AK1A 4WBNA 2OYQA 3W7TA 3LSQA 3JAMN 1TUBB 1Q6HA 4GZRB 1BCCH 2CAZC 1LR1A 4G28B 1V54C 4TT3G 4B3SB 4JYCA 4ZHQA 4OX9O 4IIJB 1QBZA 2ZCEA 5CA1A 2B9ZA 4J11A 2A9HA 4LFAO 4DV7O 5IYCO 4FLZA 2YEVB 2GTAA 3ZHQA 4OPHA 1W2BU 3F7YC 4NXMB 3GWOA 2ZIOA 4JI2B 1F51A 1SQFA 3WG7B 2JGDB 2HEPA 3M99B 4KUMA 4Z1MG 5L3DA 4P9PA 2QTSA 4FVMA 2IU0A 5LP6C 1FXHA 4I0XB 1IBLO 3CCRV 3FB8C 4PJ0Z 2VWKA 1URFA 4LF6B 4BW5A 3G71V 1R3KC 5B3SC 3B09A 5LGNA 2YIBD 3Q4HB 5B1BB 2O57A 1RPOA 1D5AA 5BMVA 3ZEDA 2ZR2A 3P32A 4XDJA 2DYSB 2MK3A 1HW7A 4GX1A 2CTQA 4QPJA 4JV5O 1Y6XA 5LHHA 2F1MA 4DUZB 1H8EG 4I55A 2XAHA 3JALB 2P22C 1G4YB 1KECA 1ZUQA 4KP4A 1TAEA 1E1RG 1JJOA 4P2ZA 1WAZA 2EJ7A 3UM7A 1XHZA 4JI6O 2F4VO 1K34A 3BRCA 1OCOB 1QR8A 3APOA 2L6LA 3ZHRA 3CB2A 4I50A 1N4CA 5CBHA 4DV0B 1V9PA 2UU9O 1FKAO 5KMGA 2EILC 1THZA 3CRCA 4JPRA 1RSOB 2YIAA 4K3AA 3MDSA 3P3PA 3ZHUA 1VQMV 2WPDG 2BOCC 4Q20A 2CE4A 3OAAG 3SPGA 4X64B 4LNUB 2Q0OC 3T1HB 3VBBA 3K59A 1GN2A 4JI7O 4JI4O 1ROPA 1SA0B 4X20A 1PP9H 3H1LH 5BZBA 2KKWA 1H8HG 1FXVA 1NTZH 4J7ZA 3CC7V 1S3JA 4HBNA 4NTXA 2R9IA 4JF3A 5HFMA 3E22A 1NBMG 4I4TA 1VF7A 3BABA 3N2GB 4MTFA 4MTXA 1VP7A 2OTJV 1GO3F 3CCLV 1H2NA 1LNQA 5H5NA 4OX9B 5JJEB 3T4ZA 4NR1A 1OCCB 1VQLV 4ZOLB 3ZMVA 4MW3A 1KKDA 4LFAB 3ZX6A 4DV7B 4GUNA 4FLTA 4CS3A 4C7UA 2HP8A 5B66Z 5IE9A 1IVSA 4LF8O 4LFBO 1XL6A 2Z0AA 1PL4A 3DSQA 5LXTA 5GONB 1N0JA 1UFIA 1M56C 4FLXA 1HNXO 4QIWF 4U7OA 1IBLB 2W6JG 4Q6GA 5LYJB 3JAWA 2ETNA 3UCSC 1I7FA 3ASNB 4DYLA 3C3TA 1Y74B 4MTOA 4AQYB 1V55C 3ZHVA 3M7MX 3SJCC 4MVOA 2DQ0A 4B3TO 3P30A 1ZL8B 2JRIA 1JFFB 3ABLC 3F5WC 1AR5A 3MHSC 4DRXA 1Q81W 2YSUB 1K9MW 4QGPA 2FL4A 4EB6A 4JYBA 1R6TA 1K5QA 4PI0A 4ZI7B 4O2AB 5L3GA 4JV5B 2EZOA 3FKSG 3PN1A 4UXNA 1K5SA 5KUMA 1O9GA 5LMUO 2LO1A 3DGEA 4DR2O 4F4LA 5IJ0A 4GX2A 1Q6IA 2OWOA 2QKAA 2F4VB 2IJHA 1ZWIC 1Q82W 4HYOA 3CP1A 2BSKA 4LF4O 1SETA 3VQYA 3CE2A 3A2FA 1CXZB 3CMAV 5C8YA 3MAQA 3LUTB 2UU9B 2XT9A 5EBLC 4X1KA 3F7VC 4WFHA 1KC8W 3K5OA 4U3JA 3QVNA 4X88A 2JS5A 2CTRA 5C93A 3VOUA 4I50B 1NVPD 2OIGA 2LW1A 2QWQB 2DWDC 3E89A 5LL6Y 3K06A 1JA8A 5EZYB 4JI7B 2KQXA 2KG7A 4TV8B 2VQFO 1EM1A 1WB8A 3DXRB 3KZIZ 4X66B 4I7ZB 1VEWA 1Q90D 3H01A 1X4TA 4RQFA 2Z3YA 3K03A 1DF5A 2ZXWB 3L75H 1N32O 3T1CA 3OTOB 4UFZA 5H6RA 2IH3C 1KYOF 1WA8A 3P3NA 3B2EE 5IYZA 4DUYB 4MW8A 2YXHA 3SYQA 4DR1O 2QA4V 4RUEA 5JQGB 2E5LO 4K8ZA 4J10A 4GT1A 3SGIA 4DV5O 4D7SA 3E22B 1AR1B 1EZVH 3CCUV 1IX9A 3CCSV 2DMXA 4RWUA 3UQ8A 4LF8B 5JJNB 4UB8Z 1M57B 1JMKC 2QDOA 4MVQA 1ZTEA 2FMLA 3RYIB 4MS2A 2XAGA 1HNXB 4NKGB 3C3SA 3ZRXA 1X59A 3HKEA 4TUYA 3T1YO 4O2BB 1QR9A 4J9YB 5CBFA 4DV2O 4D6TH 3LDCA 2K1EA 3HKCB 4JYYA 5JVDA 2WLKA 5B1NA 3QO5A 4JTAB 1W0JG 1MABG 1V54B 2K9PA 3E86A 1PKXA 3FX7A 4B3TB 3JATB 1YHQV 1N34O 2WAMA 1R6NA 2DJVA 1SQPH 1BQ0A 3OT7A 1N8RW 5KX5A 2ILMA 3LSUA 4P30A 2KB1A 5J2UB 5BY1A 4NB5A 5JWPA 2WWWA 2Q5ZA 2OT5A 2WLHA 4O4JA 3JAKB 2W6IG 4DRXB 2ZD9A 1XQ8A 4EB6B 5ITZB 3AG2C 3JARB 1WP7A 4B08A 1Q86W 2CK3G 4DR2B 2WLNA 5LP6B 4K35A 1AB3A 3OEEG 1AI7A 4GKJO 1FAFA 4LF4B 3CCMV 1TVKB 2V1DA 1OCZC 3QG5A 3EFFK 5IJ0B 1OJHA 4IYIA 1E1QG 1YDXA 5KHJA 3CC4V 3ZMTA 3OM3B 4ICGA 3BAAA 2AHZA 4XBFA 2GSMB 1VQ6V 5IY5B 2UXBO 1QHTA 1W0KG 3IAYA 1M5IA 1PL0A 1R1BA 4H0LB 3B4SA 5KHHA 2Q67A 1P7GA 3SPJA 1MZFA 2ZE8A 1PD3A 4LF9O 4QJFB 4J9ZB 1FFXB 1XNRO 1QVFU 2EBOA 3BA9A 4JYAO 1N32B 4FZ1A 1JJ2U 3K08A 2HHHO 1CEZA 4PDLA 1PV0A 1B06A 3CYOA 1B3QA 1RM1B 3JASA 4O4HA 3CCVV 1GM9A 4YJ2B 4DR1B 2YI8A 4YIPA 2E5LB 3JSNA 2QSAA 2ZM6O 4DV5B 4Z1VA 1YXBA 1NQTA 2XOKG 4MTGA 5CB4A 3FB6C 1XMQO 1FXKB 2A3QA 3TK1A 1MSWD 2F66C 3EXAA 3RN4A 1UPGA 4YJ3A 1SZTA 3IC9A 4FFBB 1Q7YW 3S3XA 3G6BA 3BY6A 2DWEC 1XOUA 2E76B 1LUWA 5EC2C 4GCZA 3OFNG 1NT2B 2NN4A 5KHKA 2P06A 3UO2A 4NYKA 3ETEA 3T1YB 3L71H 4DV2B 2DW4A 4KXRA 3ZN0A 5DM6V 3CJHA 5B1OA 2Y48A 4O4LA 4BWAA 2P90A 2HJFC 2YI9A 3UKMA 3FD9A 2QGNA 3ZJZA 3THOA 3K5NA 1TA8A 3ETDA 2BE3A 1TUEB 4F6RB 2EIMB 2CDYA 3RYFA 4TSFG 1AI4A 1H2GA 2QM8A 3FAVA 1D2DA 1SKVA 3RGBA 1WN7A 3QO8A 1M56B 4U7NA 3G80A 2LGQA 2QKSA 1ENVA 2LGWA 3HKDB 1Y76B 5EK0A 2P4KA 2ZE7A 4GKJB 3B8NA 1HNZO 4TQDA 2GTSA 3QF7A 2XHBA 3OEHG 1P84F 2EIKC 4PI2A 3OR6C 5KA6A 3ABLB 2VWJA 2EIJB 2YICA 1WNSA 5KHGA 1SF9A 2DYRC 1VQKV 1NVPB 3S3WA 4MVSA 1GKFA 4ZIBA 4O4IB 2UXBB 1XHXA 3HKBA 3TCUA 4KL1A 2AGAA 4YIOA 5KA5A 2XAQA 2Y4UA 2PF4E 4LP8A 3CCEV 2F93B 4FFKA 4KFMA 2Q9LA 1XNRB 4RQEA 2JIZG 3LSSA 4UVCA 4JYAB 2DN9A 4BIUA 4X1YA 5J2TA 1RP3B 3N2KA 2ZINA 2HHHB 4DW1A 4DV6O 4GKKB 5FNVA 3I5DA 2HG5C 3QO7A 5IJ9B 3W7WA 4LFCB 3CXHF 3DC6A 1FD9A 4TV9A 3AK3A 4HNAB 1CP9A 4H44B 3ABKC 2ARHA 4Z2WA 1DK1A 2RCVA 1NJIW 1YJNV 4IL6Z 1XMQB 1Z2GA 1Z5WA 3H9VA 4JI1B 4I5SA 4DR6O 1ZAUA 1BZKA 5HFLA 4B3RO 1S77D 4GX0A 4I9QA 3K9SA 1BS3A 2BOBC 3IC7A 1WJZA 2LP7A 2A0LA 4LWSA 4RAIA 2CGOA 1VQ4V 4MVZA 4YJ3B 1R3IC 4CC6A 1U97A 4JAVA 1YJ9V 1R73A 4G2KA 3D3IA 3RFRA 5IT9N 5IWAO 1VF6C 3ASOB 5K1XA 2QM7A 5FLXN 2V7QG 1XNQO 4CH3A 1T5EA 2WLIA 3BCCH 4BAYA 3TXSA 1JVMA 2GHYA 1S72V 3SYPA 1US6A 2IW5A 1AJQA 4PELA 1IBMO 1K97A 3MD0A 3L74H 1F23A 5LA6A 2FTKA 1NS1A 3JD1A 1OCRC 2M6YA 3RYCB 2ITDC 3OUSA 4PV1B 2YXYA 3D3QA 1SQGA 2HKOA 4O4LB 3ZMZA 2W0XA 1SESA 1M1KW 4JZGA 1KB9F 4PA4A 1N0NA 2GBOA 2VQEO 1QCEA 3K3WA 4B7KA 4KHPO 3A0RA 2VS0A 1EN4A 4DR5O 3OGIB 1EFRG 3UT5A 4HAMA 1ORQC 1MNGA 1L0NH 2X0LA 2E75B 4WBNB 1K3EA 1OHHG 3J7AU 1VQ7V 2MW2B 3K5LA 1YCIA 5GTIZ 2PY5A 2PYJA 1JQ0A 5JH7A 4FJCC 1HNZB 4ZHQB 1YVWA 1YZBA 4ABMA 5CA1B 4ASUG 1QLEC 3E2EA 3CD6V 2GUZA 3ZIAG 2QWOB 3G4SV 3ICXA 1RPRA 1H2MA 1IXBA 2CTPA 3FB7C 2YC0A 1ZLZA 4BW9A 3OMAB 2ZKOA 1QVGU 2E3CA 4QNHB 2YIBA 1QQCA 3E83A 2WLLA 3AG2B 5L3FA 4FM0A 3EVKA 4CZZA 3H1HH 1XILA 4FLVA 2ATKC 3R65A 1IXMA 2LJ2A 4PDMA 1SQXH 4DV6B 4B7EA 4MSWC 3JYCA 1COWG 1OCZB 3ABMC 3WG7C 3LNNA 5BMVB 1MZEA 2A06H 3JD3A 3O9OA 5LHIA 2D2CB 4R6ZA 1SQVH 4I55B 2P6JA 2Y0IA 4JI6B 3X2QC 1QLNA 4J7JA 3DTUB 3ZRWA 3CWBH 4JGSA 4DR6B 3L73H 2IM9A 2GV9A 5H6QA 3KCXA 5J9PC 5L3CA 5LBQA 1AI5A 4TV9B 4B3RB 4X1IA 5B1BC 3AG1B 3L72H 1XMOO 4FIPC 5LMNO 2DYSC 4WFGA 2BTQA 3VQXA 4FK5C 2YIDA 1B6QA 2Q4PA 4N21A 2Q68A 5KMGB 4FM2A 4JI4B 2QEXV 1R3JC 2DE0X 2B5UA 4TWKA 3CS5A 2CH7A 3OR7C 3BHPA 4X62O 1OCOC 4IHJA 4OPAA 1M9NA 2AZ2A 4X20B 4DV1O 2Y4TA 1KUQA 5B1AB 2VQEB 5EC1C 4UUJC 2HR3A 4KHPB 3J81N 4DR5B 1VF6A 5LA6B 1K4DC 1G1XB 4E4EA 2F43G 4IGGA 1H38A 4A5UB 1AVMA 2QR4A 4I4TB 4DK1A 1PM9A 1BSMA 2P7TC 4GX5A 2PYLA 4LFBB 1KU9A 2PI5A 3K5MA 2UXXA 4JAAA 2X6AA 3RWRD 4AILC 1D5NA 2OCHA 1KMIZ 3AG3B 1K92A 2AZ0A 4XDKA 1IZ3A 3RYHA 1NTKH 2P5OA 5LXTB 1N33O 3G6EV 2OIEA 2JJ2G 2EZPA 2RQ6A 1XDCA 3B77A 3JCUZ 3K9AA 4X8AA 1HNWO 2KSDA 1VQNV 3JAWB
chains in the Genus database with same CATH topology
1AB3A 4JI6O 2F4VO 2LW7A 1HR0O 4GKJO 3J7AU 4DR4O 4LF5O 3JAMN 4DV6O 4LF6O 1FYJA 4YHHO 3R66A 4DV4O 1I94O 4B3TO 1AILA 4X66O 4JI3O 2UU9O 1YZBA 1FKAO 4NXNO 4OX9O 2JRIA 1A32A 2UXDO 4DR1O 1N36O 1IBKO 2E5LO 4DV3O 4B3MO 1R6TA 1DK1A 4DV5O 5BXZA 1FJGO 4LFAO 4DV7O 4X62O 3OTOO 4YY3O 4DUZO 2FKXA 3O65A 4OPAA 2UXBO 4GKKO 4AQYO 4DR6O 1F7YA 4OPHA 4JI7O 1R1BA 2ZKOA 1D2DA 4JI4O 4DV1O 4B3RO 1KUQA 4B3SO 1XEQA 4DR7O 2UXCO 4LF7O 4DUYO 4LFCO 3J81N 4LF9O 5LMUO 2UUCO 1XNRO 1G1XB 4DR2O 4JI0O 1IBLO 1X59A 4JYAO 4A5UB 3T1YO 4DV2O 2HHHO 4JI1O 2N74A 4LF4O 4NXMO 5IT9N 5IWAO 1HNZO 4DV0O 4JI5O 3RT3C 5FLXN 1XNQO 4K0KO 3M8AA 1N34O 2DOSA 2DJVA 5H5NA 5A2QN 4DR3O 1IBMO 2ZM6O 3SDLA 1NS1A 4JV5O 4X64O 5BY1A 1XMQO 5LL6Y 3T1HO 1N33O 4LF8O 2UUAO 4LFBO 2Z0AA 2AGAA 1J5EO 2UUBO 5BR8O 4X65O 2VQEO 2VQFO 4JI8O 4JI2O 4KHPO 1HNWO 4DR5O 3J80N 1XMOO 5LMNO 1HNXO 3F5TA 1N32O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1AB3 A;  4JI6 O;  2F4V O;  2LW7 A;  1HR0 O;  4GKJ O;  3J7A U;  4DR4 O;  4LF5 O;  3JAM N;  4DV6 O;  4LF6 O;  1FYJ A;  4YHH O;  3R66 A;  4DV4 O;  1I94 O;  4B3T O;  1AIL A;  4X66 O;  4JI3 O;  2UU9 O;  1YZB A;  1FKA O;  4NXN O;  4OX9 O;  2JRI A;  1A32 A;  2UXD O;  4DR1 O;  1N36 O;  1IBK O;  2E5L O;  4DV3 O;  4B3M O;  1R6T A;  1DK1 A;  4DV5 O;  5BXZ A;  1FJG O;  4LFA O;  4DV7 O;  4X62 O;  3OTO O;  4YY3 O;  4DUZ O;  2FKX A;  3O65 A;  4OPA A;  2UXB O;  4GKK O;  4AQY O;  4DR6 O;  1F7Y A;  4OPH A;  4JI7 O;  1R1B A;  2ZKO A;  1D2D A;  4JI4 O;  4DV1 O;  4B3R O;  1KUQ A;  4B3S O;  1XEQ A;  4DR7 O;  2UXC O;  4LF7 O;  4DUY O;  4LFC O;  3J81 N;  4LF9 O;  5LMU O;  2UUC O;  1XNR O;  1G1X B;  4DR2 O;  4JI0 O;  1IBL O;  1X59 A;  4JYA O;  4A5U B;  3T1Y O;  4DV2 O;  2HHH O;  4JI1 O;  2N74 A;  4LF4 O;  4NXM O;  5IT9 N;  5IWA O;  1HNZ O;  4DV0 O;  4JI5 O;  3RT3 C;  5FLX N;  1XNQ O;  4K0K O;  3M8A A;  1N34 O;  2DOS A;  2DJV A;  5H5N A;  5A2Q N;  4DR3 O;  1IBM O;  2ZM6 O;  3SDL A;  1NS1 A;  4JV5 O;  4X64 O;  5BY1 A;  1XMQ O;  5LL6 Y;  3T1H O;  1N33 O;  4LF8 O;  2UUA O;  4LFB O;  2Z0A A;  2AGA A;  1J5E O;  2UUB O;  5BR8 O;  4X65 O;  2VQE O;  2VQF O;  4JI8 O;  4JI2 O;  4KHP O;  1HNW O;  4DR5 O;  3J80 N;  1XMO O;  5LMN O;  1HNX O;  3F5T A;  1N32 O; 
#chains in the Genus database with same CATH topology
 4UCS A;  3STZ C;  2Y69 C;  4IT5 A;  3L70 H;  1DLB A;  2HVJ C;  2N05 A;  1PPJ H;  5EIB C;  2P67 A;  1TUB A;  1KD1 W;  2EIK B;  3W7U A;  2PZS A;  1G6U A;  2ZR3 A;  4NXN O;  3D36 C;  5CA0 A;  5LMU B;  3ML0 A;  1QNM A;  1Q43 A;  1YF2 A;  4IIJ A;  3WB0 A;  4B3M O;  1BQZ A;  2R70 A;  1Q8I A;  3JD2 A;  3WB2 A;  4UV8 A;  4YY3 O;  1P4R A;  1KP2 A;  1HDJ A;  2XAF A;  2YEV A;  1JPX A;  4FLU A;  3N27 A;  5LOV A;  4UVB A;  4LBE C;  5B3S B;  2EX3 A;  4B3S O;  1WB7 A;  2Q69 A;  3G67 A;  2UUC O;  2B1I A;  3E8F A;  5LMN B;  2JGD A;  2AXT Z;  4DO2 A;  1Y66 A;  3TET A;  1FPO A;  2BSK B;  4DK0 A;  1P49 A;  4I0X A;  4UCV A;  3UO3 A;  4PA3 A;  1I5X A;  3CSX A;  4NXM O;  5C8Y B;  4AHC A;  4PA6 A;  4X1K B;  2OCC C;  3K58 A;  2VQF B;  3K0G A;  4R7C A;  4U3J B;  1KP3 A;  3Q4H A;  3NR7 A;  3FB5 C;  1NTM H;  4WCE V;  2IJI A;  2YS8 A;  4UCR A;  1M93 A;  3ABK B;  3SDL A;  1XL4 A;  3JD0 A;  1AP5 A;  4X62 B;  1VQP V;  1YIJ V;  3ETQ A;  2KG7 B;  2UUB O;  4WFA V;  4DW0 A;  3K0D A;  4DV1 B;  1HP8 A;  4JZ2 A;  1E79 G;  3OW2 U;  2BTO A;  2EIL B;  4YXW G;  5D5P A;  3HR0 A;  4J42 A;  1NH2 B;  1NZ6 A;  4JTD B;  1NKD A;  2IBZ H;  1WA8 B;  2QJ1 A;  1KKC A;  5JCO A;  1MOF A;  5CA3 A;  4UCO A;  5IYZ B;  1AI6 A;  1K7D A;  1I08 A;  1AIL A;  2RJZ A;  3KG2 A;  2IH1 C;  2QWP B;  3CHX A;  2ZXW C;  4HZ3 A;  1IBK O;  2XAS A;  1RSO A;  4J80 A;  1ZSP A;  3OE7 G;  1SER A;  1SRY A;  5L3B A;  1L1F A;  1N33 B;  4LR3 A;  4LNU A;  1I0H A;  3A0B Z;  1U96 A;  1MA1 A;  1SA0 A;  1N34 B;  1VQ9 V;  2CGN A;  3CME V;  3HKE B;  3CX5 F;  4TUY B;  1Q3E A;  1I5Y A;  1O9H A;  1SQB H;  4PD4 F;  5JVD B;  5IYB O;  4RUF A;  4U3F H;  5E1A C;  4BIO A;  1K8A W;  5E79 Z;  5EBW C;  2QE7 G;  2JEU A;  4J7K A;  1AJP A;  2L35 A;  3N2G A;  2ZE6 A;  2OTL V;  2DOS A;  1KBH A;  1QLE B;  5A2Q N;  5KX5 B;  4LH7 A;  4B3M B;  1RFY A;  3A8T A;  3FFQ A;  5IDJ A;  4ZOL A;  4YY3 B;  1Q5O A;  4O4J B;  2PI4 A;  2N04 A;  1QU7 A;  1J5E O;  1V55 B;  5CA0 B;  2RMK B;  3U11 A;  1DTO A;  3RW0 A;  2UUC B;  4H33 A;  5DN6 G;  1NI8 A;  5GON A;  2A79 B;  3D36 A;  4X9Q A;  1Q6U A;  5LOV B;  2WA4 A;  4DR4 O;  5LYJ A;  2IJK A;  3HB3 B;  3AG4 C;  1FYJ A;  3ZRV A;  4YHH O;  1Y74 A;  4PA7 A;  1I94 O;  1PNK A;  3SYO A;  4NTW A;  3ABM B;  2Z5U A;  1M90 W;  4LF9 B;  3BA8 A;  5KAI Z;  1ZL8 A;  4DV3 O;  1JFF A;  3APQ A;  4E2L A;  1SC5 B;  5EYP A;  1JX9 A;  4FLW A;  3X2Q B;  2WLJ A;  2EIN C;  4ZI7 A;  4AQY O;  4O2A A;  2UUB B;  4I9W A;  1UJW B;  4OXS A;  1G8M A;  2W0F C;  4PDV A;  3B8M A;  4TOI A;  2LQT A;  4CS4 A;  2ZM6 B;  1S5H C;  1P7B A;  3H1K H;  5IY5 C;  3EHB B;  2QKC A;  2N74 A;  5B5E Z;  1BHB A;  3JAS B;  4O4H B;  4JI5 O;  3WU2 Z;  3BVO A;  1IBK B;  3ETG A;  4F6E A;  5CB4 B;  4H37 A;  2Y0P A;  1ZX3 A;  2QTO A;  3AK2 A;  4IYH A;  5A9G A;  3KCY A;  2Q7E A;  3H1I H;  3SJA C;  1GN6 A;  1MSD A;  5EZY A;  3SPC A;  1RM1 C;  4MVM A;  4TV8 A;  2P4V A;  3OUF A;  3DXR A;  2H94 A;  3MHH C;  5KLV H;  3W7S A;  2X6C A;  2DQ3 A;  2HVK C;  1FXK C;  1NR1 A;  1HR0 O;  3CJH B;  3OMI B;  4FZ0 A;  3B40 A;  2Q73 A;  3JD4 A;  1YTF B;  2ZDI C;  4X66 O;  4JI3 O;  5JJJ B;  4W4L A;  2UXD O;  5GW7 A;  4WFB V;  1Y67 A;  1KQS U;  1NU1 H;  3RYF B;  5JQG A;  3OTO O;  2ZNI A;  1F4M A;  1NH2 D;  3RBZ A;  3FAV B;  4BR6 A;  3ZCC A;  5F2V O;  2CTW A;  2R72 A;  1AR4 A;  1J5E B;  1ARO P;  1NR7 A;  1S5L Z;  4D7T A;  4K8X A;  4DR7 O;  1GMG A;  4DXW A;  4DUY O;  2Q7G A;  3ZHT A;  1CPY A;  2BCC H;  1K73 W;  4FLY A;  1BGY H;  3C90 A;  4EKW A;  4W4K A;  3RYI A;  2EIM C;  2FB5 A;  3ABU A;  1Z5V A;  2Q8V A;  1GH6 A;  1L0L H;  2Y69 B;  1GTO A;  4DR4 B;  2B1G A;  3DC5 A;  4O2B A;  3SPH A;  3FYE B;  3ZBH A;  2ZIM A;  5IYD O;  3HKC A;  4YHH B;  1I94 B;  4K0K O;  3CCJ V;  3K04 A;  4LCU C;  1EBO A;  2IJJ A;  3JAT A;  4DR3 O;  1PNL A;  2M7W A;  4DV3 B;  3ZMU A;  2IU3 A;  1XRE A;  5CBG A;  3SYC A;  3HKB B;  3RVZ A;  2PTM A;  2HLD G;  1FS0 G;  4EEQ A;  5GTH Z;  5J2U A;  1B04 A;  4WF9 V;  2RDC A;  5BR8 O;  1Y4M A;  4X65 O;  2G38 A;  2Q7H A;  1J95 A;  2HJD A;  3JAK A;  1SS3 A;  3J80 N;  4WFF A;  1JR9 A;  2EIJ C;  5K1P A;  2R9A A;  3IFX A;  3TXQ A;  4JAU A;  5ITZ A;  3JAR A;  5EYP B;  5D5Q A;  4X1Y B;  5J2T B;  1R3L C;  3N2K B;  1VQ5 V;  2GDS A;  3HPL C;  4UV9 A;  2LW7 A;  5LP6 A;  2QM4 A;  5FNV B;  1GN4 A;  4QE7 A;  2A7W A;  2QWN B;  3LDD A;  1H2L A;  2ZT9 B;  2D3O W;  1GK9 A;  3I56 V;  2RN9 A;  4JI5 B;  1TVK A;  2OCC B;  3GVM A;  1A32 A;  1HWY A;  1N36 O;  4FPP A;  1SQQ H;  3VQW A;  2NR5 A;  5KAF Z;  1W59 A;  1FJG O;  4FM1 A;  5DED A;  2FKX A;  1F7Y A;  3RVY A;  4CH5 A;  2ZNJ A;  5IWA B;  3D8C A;  5CN0 A;  4WFE A;  2V4D A;  2UXC O;  5DEC A;  4LF7 O;  4P9O A;  1XNQ B;  3E8B A;  4LWS B;  2UXN A;  3AG7 A;  1FFX A;  3U0Z A;  3BFR A;  5FPO A;  3CRA A;  1IBM B;  2CUG A;  5FPR A;  1XI1 A;  1HR0 B;  1WPX A;  5JCO C;  3T4D A;  2LFR A;  3VQV A;  2RNB A;  2EJR A;  2WLI B;  2Q6A A;  3M8A A;  1XUQ A;  3AEI A;  4JI3 B;  2UXD B;  4X89 A;  2PUS A;  3U10 A;  1GM7 A;  5LHG A;  4YJ2 A;  1YEW A;  3GWK C;  3W7X A;  1BE3 H;  2ZQM A;  3K79 A;  3SJQ C;  3OMN B;  5AG2 A;  1IDS A;  2UUA O;  5FL7 G;  1YI2 V;  4LH6 A;  1FXK A;  2XAJ A;  3ASO C;  4UCT A;  3E35 A;  4L87 A;  4JI8 O;  3UT5 B;  4FFB A;  4DR7 B;  1VAR A;  1YIT V;  4OGQ B;  4AI8 A;  2HFE C;  2ZDI A;  2ADQ B;  2AHY A;  4ZKI A;  1EN5 A;  3F5T A;  3CRQ A;  4J41 A;  1LUV A;  2X6B A;  1EZJ A;  2E74 B;  4LF5 O;  2WA3 A;  4JTC B;  5JH7 B;  1VQO V;  4QPK A;  2LFS A;  3JCZ A;  5H2F Z;  1VF5 B;  2F23 A;  2QWR B;  2YUA A;  4DV4 O;  3CRR A;  2YDE A;  2GUZ B;  4K0K B;  5H9C A;  2VRZ A;  1OCC C;  4DR3 B;  5L3E A;  1K33 A;  4EFB A;  2AW9 A;  3E8H A;  4PDR A;  5BXZ A;  3CXC U;  1VQ8 V;  4MVU A;  1WLE A;  3FYI B;  2JS3 A;  1IUR A;  1JOY A;  2H8P C;  2JVD A;  1GRJ A;  1JCH A;  4F6R A;  2ODM A;  2ZE5 A;  1VMG A;  5BR8 B;  2WLL B;  1XEQ A;  4X65 B;  4GLX A;  3E8G A;  2Q0A A;  3TJT A;  2NLJ C;  1YTF D;  4L8J A;  3ZRS A;  3SYA A;  4GYC B;  2JGU A;  3SR2 C;  3ABT A;  4JI0 O;  4CH4 A;  5LGU A;  1S76 D;  3CEI A;  3OGC C;  1SZX A;  2DYR B;  4PA9 A;  4QE9 A;  3ZN1 A;  3ASN C;  2WLM A;  3HKD A;  4CH6 A;  4EFE A;  1Y76 A;  1AP6 A;  1GN3 A;  3AG4 B;  1PNM A;  3T2M A;  3KKY A;  4CS2 A;  1F4N A;  5TIS Z;  4N23 A;  5LGT A;  2PGG A;  2JDI G;  1XMO B;  1N36 B;  3OD4 A;  1M4U A;  4PHZ A;  3WB1 A;  1FJG B;  3I55 V;  3ZRW B;  4MT8 A;  1VIB A;  2EIN B;  3ZMS A;  5CMU A;  4X1I B;  4TQF A;  4O4I A;  3STL C;  1S0V A;  4UVA A;  2F95 B;  3IGA C;  4NVP A;  5EIB D;  4JI2 O;  2UXC B;  4LF7 B;  2BTQ B;  3OTF A;  3JSL A;  2JK5 C;  3IJ4 A;  2H3O A;  5KHI A;  3WFV A;  3CC2 V;  1EN6 A;  4BIZ A;  2XUM A;  1GM8 A;  1BL8 A;  2EUL A;  4RO2 A;  1L8D A;  4LF6 O;  1AJN A;  4UCU A;  3R66 A;  3AG1 C;  4XDL A;  3L9D A;  3JAL A;  1GAX A;  5KUK A;  5IJ9 A;  2CH7 B;  3QNE A;  4UB6 Z;  3BEH A;  1MMM A;  2XTA A;  4IHJ B;  2R9R B;  4HNA A;  4CBC A;  2ITC C;  1BHA A;  4DUZ O;  1BT8 A;  4CC5 A;  1WPB A;  5EBM C;  3O65 A;  3A0H Z;  1WP8 A;  4GKK O;  3LDE A;  4ZBM A;  3CRM A;  4MVR A;  2UUA B;  3K57 A;  3CPW U;  4JI8 B;  4LFC O;  4H13 B;  3ZS8 C;  1BMF G;  1H2S B;  4G27 B;  1YSC A;  4R8C A;  1XBL A;  2X7R B;  3CCQ V;  1MG1 A;  3LNM B;  4FMT A;  4LC1 A;  1OCR B;  1H2K A;  4JI1 O;  4LF5 B;  1FFT B;  2JJ1 G;  1YJW V;  2C2A A;  1OV9 A;  5B1A C;  4DV0 O;  3H1J H;  4DV4 B;  3RT3 C;  3TGU H;  2ADP A;  1S5J A;  1HNW B;  3SPI A;  1OZ0 A;  1K4C C;  3BPZ A;  1TGO A;  2NNU A;  3GB7 C;  3RYH B;  2WSS G;  4JAS A;  3NXS A;  1DF4 A;  3QTC A;  4X64 O;  3T1H O;  2FYU H;  3RYC A;  4NTY A;  3PJS K;  1R6K A;  1M57 C;  1DGS A;  2YXL A;  4NXN B;  3SJB C;  3AG3 C;  2XND G;  2JEX A;  3ZHS A;  4JI0 B;  4R50 A;  3AK1 A;  4WBN A;  2OYQ A;  3W7T A;  3LSQ A;  3JAM N;  1TUB B;  1Q6H A;  4GZR B;  1BCC H;  2CAZ C;  1LR1 A;  4G28 B;  1V54 C;  4TT3 G;  4B3S B;  4JYC A;  4ZHQ A;  4OX9 O;  4IIJ B;  1QBZ A;  2ZCE A;  5CA1 A;  2B9Z A;  4J11 A;  2A9H A;  4LFA O;  4DV7 O;  5IYC O;  4FLZ A;  2YEV B;  2GTA A;  3ZHQ A;  4OPH A;  1W2B U;  3F7Y C;  4NXM B;  3GWO A;  2ZIO A;  4JI2 B;  1F51 A;  1SQF A;  3WG7 B;  2JGD B;  2HEP A;  3M99 B;  4KUM A;  4Z1M G;  5L3D A;  4P9P A;  2QTS A;  4FVM A;  2IU0 A;  5LP6 C;  1FXH A;  4I0X B;  1IBL O;  3CCR V;  3FB8 C;  4PJ0 Z;  2VWK A;  1URF A;  4LF6 B;  4BW5 A;  3G71 V;  1R3K C;  5B3S C;  3B09 A;  5LGN A;  2YIB D;  3Q4H B;  5B1B B;  2O57 A;  1RPO A;  1D5A A;  5BMV A;  3ZED A;  2ZR2 A;  3P32 A;  4XDJ A;  2DYS B;  2MK3 A;  1HW7 A;  4GX1 A;  2CTQ A;  4QPJ A;  4JV5 O;  1Y6X A;  5LHH A;  2F1M A;  4DUZ B;  1H8E G;  4I55 A;  2XAH A;  3JAL B;  2P22 C;  1G4Y B;  1KEC A;  1ZUQ A;  4KP4 A;  1TAE A;  1E1R G;  1JJO A;  4P2Z A;  1WAZ A;  2EJ7 A;  3UM7 A;  1XHZ A;  4JI6 O;  2F4V O;  1K34 A;  3BRC A;  1OCO B;  1QR8 A;  3APO A;  2L6L A;  3ZHR A;  3CB2 A;  4I50 A;  1N4C A;  5CBH A;  4DV0 B;  1V9P A;  2UU9 O;  1FKA O;  5KMG A;  2EIL C;  1THZ A;  3CRC A;  4JPR A;  1RSO B;  2YIA A;  4K3A A;  3MDS A;  3P3P A;  3ZHU A;  1VQM V;  2WPD G;  2BOC C;  4Q20 A;  2CE4 A;  3OAA G;  3SPG A;  4X64 B;  4LNU B;  2Q0O C;  3T1H B;  3VBB A;  3K59 A;  1GN2 A;  4JI7 O;  4JI4 O;  1ROP A;  1SA0 B;  4X20 A;  1PP9 H;  3H1L H;  5BZB A;  2KKW A;  1H8H G;  1FXV A;  1NTZ H;  4J7Z A;  3CC7 V;  1S3J A;  4HBN A;  4NTX A;  2R9I A;  4JF3 A;  5HFM A;  3E22 A;  1NBM G;  4I4T A;  1VF7 A;  3BAB A;  3N2G B;  4MTF A;  4MTX A;  1VP7 A;  2OTJ V;  1GO3 F;  3CCL V;  1H2N A;  1LNQ A;  5H5N A;  4OX9 B;  5JJE B;  3T4Z A;  4NR1 A;  1OCC B;  1VQL V;  4ZOL B;  3ZMV A;  4MW3 A;  1KKD A;  4LFA B;  3ZX6 A;  4DV7 B;  4GUN A;  4FLT A;  4CS3 A;  4C7U A;  2HP8 A;  5B66 Z;  5IE9 A;  1IVS A;  4LF8 O;  4LFB O;  1XL6 A;  2Z0A A;  1PL4 A;  3DSQ A;  5LXT A;  5GON B;  1N0J A;  1UFI A;  1M56 C;  4FLX A;  1HNX O;  4QIW F;  4U7O A;  1IBL B;  2W6J G;  4Q6G A;  5LYJ B;  3JAW A;  2ETN A;  3UCS C;  1I7F A;  3ASN B;  4DYL A;  3C3T A;  1Y74 B;  4MTO A;  4AQY B;  1V55 C;  3ZHV A;  3M7M X;  3SJC C;  4MVO A;  2DQ0 A;  4B3T O;  3P30 A;  1ZL8 B;  2JRI A;  1JFF B;  3ABL C;  3F5W C;  1AR5 A;  3MHS C;  4DRX A;  1Q81 W;  2YSU B;  1K9M W;  4QGP A;  2FL4 A;  4EB6 A;  4JYB A;  1R6T A;  1K5Q A;  4PI0 A;  4ZI7 B;  4O2A B;  5L3G A;  4JV5 B;  2EZO A;  3FKS G;  3PN1 A;  4UXN A;  1K5S A;  5KUM A;  1O9G A;  5LMU O;  2LO1 A;  3DGE A;  4DR2 O;  4F4L A;  5IJ0 A;  4GX2 A;  1Q6I A;  2OWO A;  2QKA A;  2F4V B;  2IJH A;  1ZWI C;  1Q82 W;  4HYO A;  3CP1 A;  2BSK A;  4LF4 O;  1SET A;  3VQY A;  3CE2 A;  3A2F A;  1CXZ B;  3CMA V;  5C8Y A;  3MAQ A;  3LUT B;  2UU9 B;  2XT9 A;  5EBL C;  4X1K A;  3F7V C;  4WFH A;  1KC8 W;  3K5O A;  4U3J A;  3QVN A;  4X88 A;  2JS5 A;  2CTR A;  5C93 A;  3VOU A;  4I50 B;  1NVP D;  2OIG A;  2LW1 A;  2QWQ B;  2DWD C;  3E89 A;  5LL6 Y;  3K06 A;  1JA8 A;  5EZY B;  4JI7 B;  2KQX A;  2KG7 A;  4TV8 B;  2VQF O;  1EM1 A;  1WB8 A;  3DXR B;  3KZI Z;  4X66 B;  4I7Z B;  1VEW A;  1Q90 D;  3H01 A;  1X4T A;  4RQF A;  2Z3Y A;  3K03 A;  1DF5 A;  2ZXW B;  3L75 H;  1N32 O;  3T1C A;  3OTO B;  4UFZ A;  5H6R A;  2IH3 C;  1KYO F;  1WA8 A;  3P3N A;  3B2E E;  5IYZ A;  4DUY B;  4MW8 A;  2YXH A;  3SYQ A;  4DR1 O;  2QA4 V;  4RUE A;  5JQG B;  2E5L O;  4K8Z A;  4J10 A;  4GT1 A;  3SGI A;  4DV5 O;  4D7S A;  3E22 B;  1AR1 B;  1EZV H;  3CCU V;  1IX9 A;  3CCS V;  2DMX A;  4RWU A;  3UQ8 A;  4LF8 B;  5JJN B;  4UB8 Z;  1M57 B;  1JMK C;  2QDO A;  4MVQ A;  1ZTE A;  2FML A;  3RYI B;  4MS2 A;  2XAG A;  1HNX B;  4NKG B;  3C3S A;  3ZRX A;  1X59 A;  3HKE A;  4TUY A;  3T1Y O;  4O2B B;  1QR9 A;  4J9Y B;  5CBF A;  4DV2 O;  4D6T H;  3LDC A;  2K1E A;  3HKC B;  4JYY A;  5JVD A;  2WLK A;  5B1N A;  3QO5 A;  4JTA B;  1W0J G;  1MAB G;  1V54 B;  2K9P A;  3E86 A;  1PKX A;  3FX7 A;  4B3T B;  3JAT B;  1YHQ V;  1N34 O;  2WAM A;  1R6N A;  2DJV A;  1SQP H;  1BQ0 A;  3OT7 A;  1N8R W;  5KX5 A;  2ILM A;  3LSU A;  4P30 A;  2KB1 A;  5J2U B;  5BY1 A;  4NB5 A;  5JWP A;  2WWW A;  2Q5Z A;  2OT5 A;  2WLH A;  4O4J A;  3JAK B;  2W6I G;  4DRX B;  2ZD9 A;  1XQ8 A;  4EB6 B;  5ITZ B;  3AG2 C;  3JAR B;  1WP7 A;  4B08 A;  1Q86 W;  2CK3 G;  4DR2 B;  2WLN A;  5LP6 B;  4K35 A;  1AB3 A;  3OEE G;  1AI7 A;  4GKJ O;  1FAF A;  4LF4 B;  3CCM V;  1TVK B;  2V1D A;  1OCZ C;  3QG5 A;  3EFF K;  5IJ0 B;  1OJH A;  4IYI A;  1E1Q G;  1YDX A;  5KHJ A;  3CC4 V;  3ZMT A;  3OM3 B;  4ICG A;  3BAA A;  2AHZ A;  4XBF A;  2GSM B;  1VQ6 V;  5IY5 B;  2UXB O;  1QHT A;  1W0K G;  3IAY A;  1M5I A;  1PL0 A;  1R1B A;  4H0L B;  3B4S A;  5KHH A;  2Q67 A;  1P7G A;  3SPJ A;  1MZF A;  2ZE8 A;  1PD3 A;  4LF9 O;  4QJF B;  4J9Z B;  1FFX B;  1XNR O;  1QVF U;  2EBO A;  3BA9 A;  4JYA O;  1N32 B;  4FZ1 A;  1JJ2 U;  3K08 A;  2HHH O;  1CEZ A;  4PDL A;  1PV0 A;  1B06 A;  3CYO A;  1B3Q A;  1RM1 B;  3JAS A;  4O4H A;  3CCV V;  1GM9 A;  4YJ2 B;  4DR1 B;  2YI8 A;  4YIP A;  2E5L B;  3JSN A;  2QSA A;  2ZM6 O;  4DV5 B;  4Z1V A;  1YXB A;  1NQT A;  2XOK G;  4MTG A;  5CB4 A;  3FB6 C;  1XMQ O;  1FXK B;  2A3Q A;  3TK1 A;  1MSW D;  2F66 C;  3EXA A;  3RN4 A;  1UPG A;  4YJ3 A;  1SZT A;  3IC9 A;  4FFB B;  1Q7Y W;  3S3X A;  3G6B A;  3BY6 A;  2DWE C;  1XOU A;  2E76 B;  1LUW A;  5EC2 C;  4GCZ A;  3OFN G;  1NT2 B;  2NN4 A;  5KHK A;  2P06 A;  3UO2 A;  4NYK A;  3ETE A;  3T1Y B;  3L71 H;  4DV2 B;  2DW4 A;  4KXR A;  3ZN0 A;  5DM6 V;  3CJH A;  5B1O A;  2Y48 A;  4O4L A;  4BWA A;  2P90 A;  2HJF C;  2YI9 A;  3UKM A;  3FD9 A;  2QGN A;  3ZJZ A;  3THO A;  3K5N A;  1TA8 A;  3ETD A;  2BE3 A;  1TUE B;  4F6R B;  2EIM B;  2CDY A;  3RYF A;  4TSF G;  1AI4 A;  1H2G A;  2QM8 A;  3FAV A;  1D2D A;  1SKV A;  3RGB A;  1WN7 A;  3QO8 A;  1M56 B;  4U7N A;  3G80 A;  2LGQ A;  2QKS A;  1ENV A;  2LGW A;  3HKD B;  1Y76 B;  5EK0 A;  2P4K A;  2ZE7 A;  4GKJ B;  3B8N A;  1HNZ O;  4TQD A;  2GTS A;  3QF7 A;  2XHB A;  3OEH G;  1P84 F;  2EIK C;  4PI2 A;  3OR6 C;  5KA6 A;  3ABL B;  2VWJ A;  2EIJ B;  2YIC A;  1WNS A;  5KHG A;  1SF9 A;  2DYR C;  1VQK V;  1NVP B;  3S3W A;  4MVS A;  1GKF A;  4ZIB A;  4O4I B;  2UXB B;  1XHX A;  3HKB A;  3TCU A;  4KL1 A;  2AGA A;  4YIO A;  5KA5 A;  2XAQ A;  2Y4U A;  2PF4 E;  4LP8 A;  3CCE V;  2F93 B;  4FFK A;  4KFM A;  2Q9L A;  1XNR B;  4RQE A;  2JIZ G;  3LSS A;  4UVC A;  4JYA B;  2DN9 A;  4BIU A;  4X1Y A;  5J2T A;  1RP3 B;  3N2K A;  2ZIN A;  2HHH B;  4DW1 A;  4DV6 O;  4GKK B;  5FNV A;  3I5D A;  2HG5 C;  3QO7 A;  5IJ9 B;  3W7W A;  4LFC B;  3CXH F;  3DC6 A;  1FD9 A;  4TV9 A;  3AK3 A;  4HNA B;  1CP9 A;  4H44 B;  3ABK C;  2ARH A;  4Z2W A;  1DK1 A;  2RCV A;  1NJI W;  1YJN V;  4IL6 Z;  1XMQ B;  1Z2G A;  1Z5W A;  3H9V A;  4JI1 B;  4I5S A;  4DR6 O;  1ZAU A;  1BZK A;  5HFL A;  4B3R O;  1S77 D;  4GX0 A;  4I9Q A;  3K9S A;  1BS3 A;  2BOB C;  3IC7 A;  1WJZ A;  2LP7 A;  2A0L A;  4LWS A;  4RAI A;  2CGO A;  1VQ4 V;  4MVZ A;  4YJ3 B;  1R3I C;  4CC6 A;  1U97 A;  4JAV A;  1YJ9 V;  1R73 A;  4G2K A;  3D3I A;  3RFR A;  5IT9 N;  5IWA O;  1VF6 C;  3ASO B;  5K1X A;  2QM7 A;  5FLX N;  2V7Q G;  1XNQ O;  4CH3 A;  1T5E A;  2WLI A;  3BCC H;  4BAY A;  3TXS A;  1JVM A;  2GHY A;  1S72 V;  3SYP A;  1US6 A;  2IW5 A;  1AJQ A;  4PEL A;  1IBM O;  1K97 A;  3MD0 A;  3L74 H;  1F23 A;  5LA6 A;  2FTK A;  1NS1 A;  3JD1 A;  1OCR C;  2M6Y A;  3RYC B;  2ITD C;  3OUS A;  4PV1 B;  2YXY A;  3D3Q A;  1SQG A;  2HKO A;  4O4L B;  3ZMZ A;  2W0X A;  1SES A;  1M1K W;  4JZG A;  1KB9 F;  4PA4 A;  1N0N A;  2GBO A;  2VQE O;  1QCE A;  3K3W A;  4B7K A;  4KHP O;  3A0R A;  2VS0 A;  1EN4 A;  4DR5 O;  3OGI B;  1EFR G;  3UT5 A;  4HAM A;  1ORQ C;  1MNG A;  1L0N H;  2X0L A;  2E75 B;  4WBN B;  1K3E A;  1OHH G;  3J7A U;  1VQ7 V;  2MW2 B;  3K5L A;  1YCI A;  5GTI Z;  2PY5 A;  2PYJ A;  1JQ0 A;  5JH7 A;  4FJC C;  1HNZ B;  4ZHQ B;  1YVW A;  1YZB A;  4ABM A;  5CA1 B;  4ASU G;  1QLE C;  3E2E A;  3CD6 V;  2GUZ A;  3ZIA G;  2QWO B;  3G4S V;  3ICX A;  1RPR A;  1H2M A;  1IXB A;  2CTP A;  3FB7 C;  2YC0 A;  1ZLZ A;  4BW9 A;  3OMA B;  2ZKO A;  1QVG U;  2E3C A;  4QNH B;  2YIB A;  1QQC A;  3E83 A;  2WLL A;  3AG2 B;  5L3F A;  4FM0 A;  3EVK A;  4CZZ A;  3H1H H;  1XIL A;  4FLV A;  2ATK C;  3R65 A;  1IXM A;  2LJ2 A;  4PDM A;  1SQX H;  4DV6 B;  4B7E A;  4MSW C;  3JYC A;  1COW G;  1OCZ B;  3ABM C;  3WG7 C;  3LNN A;  5BMV B;  1MZE A;  2A06 H;  3JD3 A;  3O9O A;  5LHI A;  2D2C B;  4R6Z A;  1SQV H;  4I55 B;  2P6J A;  2Y0I A;  4JI6 B;  3X2Q C;  1QLN A;  4J7J A;  3DTU B;  3ZRW A;  3CWB H;  4JGS A;  4DR6 B;  3L73 H;  2IM9 A;  2GV9 A;  5H6Q A;  3KCX A;  5J9P C;  5L3C A;  5LBQ A;  1AI5 A;  4TV9 B;  4B3R B;  4X1I A;  5B1B C;  3AG1 B;  3L72 H;  1XMO O;  4FIP C;  5LMN O;  2DYS C;  4WFG A;  2BTQ A;  3VQX A;  4FK5 C;  2YID A;  1B6Q A;  2Q4P A;  4N21 A;  2Q68 A;  5KMG B;  4FM2 A;  4JI4 B;  2QEX V;  1R3J C;  2DE0 X;  2B5U A;  4TWK A;  3CS5 A;  2CH7 A;  3OR7 C;  3BHP A;  4X62 O;  1OCO C;  4IHJ A;  4OPA A;  1M9N A;  2AZ2 A;  4X20 B;  4DV1 O;  2Y4T A;  1KUQ A;  5B1A B;  2VQE B;  5EC1 C;  4UUJ C;  2HR3 A;  4KHP B;  3J81 N;  4DR5 B;  1VF6 A;  5LA6 B;  1K4D C;  1G1X B;  4E4E A;  2F43 G;  4IGG A;  1H38 A;  4A5U B;  1AVM A;  2QR4 A;  4I4T B;  4DK1 A;  1PM9 A;  1BSM A;  2P7T C;  4GX5 A;  2PYL A;  4LFB B;  1KU9 A;  2PI5 A;  3K5M A;  2UXX A;  4JAA A;  2X6A A;  3RWR D;  4AIL C;  1D5N A;  2OCH A;  1KMI Z;  3AG3 B;  1K92 A;  2AZ0 A;  4XDK A;  1IZ3 A;  3RYH A;  1NTK H;  2P5O A;  5LXT B;  1N33 O;  3G6E V;  2OIE A;  2JJ2 G;  2EZP A;  2RQ6 A;  1XDC A;  3B77 A;  3JCU Z;  3K9A A;  4X8A A;  1HNW O;  2KSD A;  1VQN V;  3JAW B; 
#chains in the Genus database with same CATH homology
 1AB3 A;  4JI6 O;  2F4V O;  2LW7 A;  1HR0 O;  4GKJ O;  3J7A U;  4DR4 O;  4LF5 O;  3JAM N;  4DV6 O;  4LF6 O;  1FYJ A;  4YHH O;  3R66 A;  4DV4 O;  1I94 O;  4B3T O;  1AIL A;  4X66 O;  4JI3 O;  2UU9 O;  1YZB A;  1FKA O;  4NXN O;  4OX9 O;  2JRI A;  1A32 A;  2UXD O;  4DR1 O;  1N36 O;  1IBK O;  2E5L O;  4DV3 O;  4B3M O;  1R6T A;  1DK1 A;  4DV5 O;  5BXZ A;  1FJG O;  4LFA O;  4DV7 O;  4X62 O;  3OTO O;  4YY3 O;  4DUZ O;  2FKX A;  3O65 A;  4OPA A;  2UXB O;  4GKK O;  4AQY O;  4DR6 O;  1F7Y A;  4OPH A;  4JI7 O;  1R1B A;  2ZKO A;  1D2D A;  4JI4 O;  4DV1 O;  4B3R O;  1KUQ A;  4B3S O;  1XEQ A;  4DR7 O;  2UXC O;  4LF7 O;  4DUY O;  4LFC O;  3J81 N;  4LF9 O;  5LMU O;  2UUC O;  1XNR O;  1G1X B;  4DR2 O;  4JI0 O;  1IBL O;  1X59 A;  4JYA O;  4A5U B;  3T1Y O;  4DV2 O;  2HHH O;  4JI1 O;  2N74 A;  4LF4 O;  4NXM O;  5IT9 N;  5IWA O;  1HNZ O;  4DV0 O;  4JI5 O;  3RT3 C;  5FLX N;  1XNQ O;  4K0K O;  3M8A A;  1N34 O;  2DOS A;  2DJV A;  5H5N A;  5A2Q N;  4DR3 O;  1IBM O;  2ZM6 O;  3SDL A;  1NS1 A;  4JV5 O;  4X64 O;  5BY1 A;  1XMQ O;  5LL6 Y;  3T1H O;  1N33 O;  4LF8 O;  2UUA O;  4LFB O;  2Z0A A;  2AGA A;  1J5E O;  2UUB O;  5BR8 O;  4X65 O;  2VQE O;  2VQF O;  4JI8 O;  4JI2 O;  4KHP O;  1HNW O;  4DR5 O;  3J80 N;  1XMO O;  5LMN O;  1HNX O;  3F5T A;  1N32 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...