4YHHT

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4yhhT00
4DR5T 4DV0T 4DUZT 1IBKT 3OTOT 4DR4T 1IBMT 4JI2T 1FJGT 5BR8T 1HNWT 4JI7T 4JI8T 1N32T 4AQYT 4B3RT 1J5ET 1XNRT 4DV5T 3T1YT 4JYAT 1HNXT 4DR2T 4LF4T 3T1HT 4B3TT 4YHHT 2ZM6T 4JI0T 1HR0T 1N33T 4LF7T 1IBLT 4YY3T 4LFAT 4JI3T 4X66T 4LF8T 5IWAT 4NXNT 1HNZT 2HHHT 4LF5T 4LFBT 2F4VT 4DR3T 2UXDT 2UU9T 4B3ST 4X64T 4LFCT 4DV2T 2VQET 4GKJT 4DV4T 4DV6T 4DR1T 5LMNT 4JI1T 4GKKT 4LF6T 4LF9T 5LMUT 4NXMT 2UUAT 4B3MT 4JV5T 2VQFT 4DV1T 2UUBT 4DUYT 1N36T 4K0KT 4DV7T 4DV3T 4JI4T 4X65T 4DR7T 2UXBT 1N34T 4X62T 2E5LT 2UUCT 2UXCT 1XMOT 4JI5T 1I94T 4OX9T 4JI6T 4DR6T 1XNQT 4KHPT 1XMQT
chains in the Genus database with same CATH superfamily
3CX7B 1M62A 1KEYA 2Y6XA 3Q5XA 5AQTB 1UK5A 3V5UA 5AQVB 3AE7A 3C4ZA 4H9QC 4EYYR 4PK5A 2KINB 1L0VA 2OA5A 5EK3A 3UQ7A 3FBLA 5DJQC 3E08A 3Q2MA 4UVAB 3WI3A 2E9XA 5HXEA 1V9DA 2XQ9A 3NZQA 3AECA 5L3DB 4PJMA 4O8SA 2HHHT 4QX7B 4UVBB 2J62A 4OHFA 2K48A 3IF8B 2JQKA 3IEEA 2W00A 2W62A 4KHZF 1QSDA 1UX4A 5L47A 4IE6A 3AEGA 3IA3A 2VKDA 2VKHA 2D0TA 4ILBA 4L5GA 5IUXA 1HX1B 3F31A 3AEFA 5JDHA 4A97A 2CHNA 2EHOD 2QYWA 3ZMSB 2XPKA 2J1DG 4JEHB 4U74A 3PJAJ 3QOFA 3C50A 5AQLB 3ONJA 5H6RB 1T7SA 3OBVE 1HX8A 4A56A 4U2YA 1IBKT 2XAJB 3VRAA 2IMLA 3F2EA 4G2AA 1IJ6A 4GOUA 2JQ9A 5EK2A 2WU2A 5JR9B 4YSYA 4HWHA 5JDQA 1KFYA 3P4WA 3QUJA 4MHCA 4LFAT 3CQGB 4QH5A 3KINB 5JQGE 1XWMA 3MA9A 5C3JA 4LFBT 2LSYA 4HFCA 3NRXA 1M7KA 4GIWA 1S94A 2CRBA 3ABVA 4YTNA 4GKJT 1LVFA 5AQOB 4DV6T 3CX6B 2CLYC 4YFSA 3NZPA 2LHRA 4HFDA 2A2FX 3P8CD 4IREA 1HTJF 2MAWA 3AB3B 5JREA 1LKXA 3OVUA 2UXBT 4EIWA 3CQCB 4KMCA 3RC3A 3AEDA 2HPLA 1NAFA 2YU2A 1MMAA 3RIFA 2L9QA 5IYZE 4BJNA 3GMIA 1IBMT 5BR8T 4QKNA 2D2SA 3SFDA 3QK6A 3PUGA 1XZYA 5JDGA 1U4QA 1VOMA 1T8BA 5LGNB 2FJEA 2XQ3A 2JQHA 1OXZA 2VASA 2BBHA 2BG9A 4TWFA 2B1EA 3VHLA 1MMDA 1IBLT 3PDYA 4JI3T 3HKCE 4V1Av 3BQIA 5LYJE 5LHIB 4H9OC 4HN9A 2C5KT 3NBXX 2D0UA 4ADZA 3JAEA 2YU1A 3OJAA 1HF8A 2AE9A 2J4GA 2BS2A 5LJNA 4GKKT 1BR2A 2D5UA 4ERRA 4LF6T 2WSSV 4LF9T 4A5XA 5HXHA 1J1JA 1QLBA 1GQEA 5A1LA 2UUBT 1E1HB 4IE0A 4IDQA 3DJBA 3C51A 4UVCB 5HCJA 4NUVA 2E9XB 3EHZA 4Q25A 4YSZA 5JDNA 4ISSA 4XBFB 3IHRA 2MPKA 5CB4E 4F8HA 3HL6A 3OTOT 3N9NA 4JI2T 2JRKA 4I0UA 5HXRA 4JI7T 4QH4A 4BAYB 4IDPA 3T1YT 4LMLA 4AKRB 3T1HT 4CQIA 2DNXA 4ZXLA 5AFUL 4QXCB 2I6HA 5ETWA 4O4LE 1YQ3A 4O4IE 4HFEA 5AQRB 3UU5A 4DVDA 2P9BA 4COFA 2XZEA 4C91A 4IT4A 2V7IA 2YEVC 1B7TA 5LXTE 2H7VC 5AQMB 3MK7C 4DR3T 3SWHA 1FMVA 1KNZA 3E22E 1MMNA 4TV8E 4X64T 3IBPA 3R6NA 3VU7H 3RC8A 2EHOC 5HEGA 2WB5A 2YDSA 4JI1T 5HXCA 3AAAB 3B13A 2Q9QD 2W0GA 4XZCA 4KBMB 4NXMT 3K3QC 4TWHA 3MKDA 4DV1T 4KUMB 1JNRA 3AEBA 5KDMC 4OYJA 3SFEA 4JBWF 3QNUA 4MFRA 3HA4A 3KVAA 1N34T 1QUUA 4U3CA 2CCQA 3AEAA 5FY1A 5L3BB 5JR9A 4A98A 3P4RA 1ZHCA 5J2TE 2X67A 2R6GF 2ZM2A 3I9WA 2IDOB 3QB5A 2BZBA 3RPUA 3RIUC 4O4JE 4QX8B 4ZI2D 1J5ET 3JCFA 3N9PA 3UQ4A 4UELA 4ZOLE 2WZHA 4LF4T 4PK6A 5F8PA 3AE5A 5AQPB 2WDQA 5AQIB 1HFAA 1OEDE 4PJLA 2BS3A 2WP9A 4WBOA 4HFVA 3P4SA 3TLWA 4CXYA 3K3OA 2YK0A 2KMFA 4EOZB 1KNPA 1X9BA 2IC9A 2YKSA 4IE4A 4H9NC 4HGAA 4P09A 4JEUB 1XDPA 4GYSA 4MALA 2NOXA 2CBIA 4ISTA 1HG2A 2V8SV 4GYRA 4X5TA 1HCIA 2BVMA 3N2GE 1FMWA 4DR7T 4EB6E 5M4YA 3HKEE 3TKLB 3CVRA 4DBRA 3UUBA 2UXCT 4EGWA 4IDZA 5LOVE 3SS1A 2ACZA 1ZP0A 1S35A 2G0UA 2K24A 2X0YA 4CN1A 5LG4A 2BS4A 5FMNA 3EVYA 1WR6A 2K5BB 4UF0B 3AA1B 3MACA 4IL4A 4MLKA 2CLYB 3M65A 3PJAA 4B3TT 5F3JA 5L3FB 2ZM6T 4QWNB 4Z90A 2XQ7A 3UU6A 4LF8T 2FJDA 3ZT5A 5J1GA 3ZSSA 3ZMZB 3AE3A 5CFBA 2WS3A 2QGSA 2NP9A 2XM1A 2DL1A 4I55E 4O2AE 3Q9DA 4BJMA 2IIUA 2XSBA 3PV0F 4IE7A 4WZXA 2NR4A 3CPZA 4QXHB 3FZKB 2BKPA 3ZJ2A 4QXBB 1H7CA 1UCUA 4EEBA 3O4XE 2IUBA 3OYXA 2BKOA 3RI5A 2KSRA 2KT9A 2I59A 1U5PA 4CI3B 3U3IA 3HI2A 1WYCA 4F6RC 2SPCA 3BQLA 3E0ZA 2XAFB 2V26A 4TZ4C 4HFBA 4NUUA 1OEDC 3KVBA 2YINA 2XY8B 4AQFA 4TNVA 4X20E 3UFGA 2C0SA 3GA8A 4Z91A 2VKJA 5FYMA 3H3AA 1UX5A 4B3RT 5HWYA 4DV5T 4DMWA 3AE8A 5ABGA 4UV9B 4YHHT 1KK7A 2NW8A 4IIJE 3ZMTB 5HCMA 1W0AA 4E7ZA 1XDOA 4LMJA 4AKGA 3BK9A 3VR8A 3P7IA 4X66T 3I0OA 5C8YE 3RIAA 1ZV4X 2FUPA 4J2CA 5LP6E 1HS7A 2Q9QC 4L9IA 5L2LA 1D1CA 4ILCA 2UU9T 2IAKA 3RQWA 3UUMA 4ASKA 4LFCT 2XASB 3P50A 2C5JA 5LMNT 2CEAA 3ZN1B 1WFDA 1AJ3A 4B3MT 3N9LA 4DIDB 4U31A 3ZCJA 5H6QB 3A5XA 2HPJA 3PUWF 3AE9A 4HWCA 2JMHA 3RX6A 2V1DB 4E7SA 3AEEA 4CI1B 5FXZA 2W2UA 4ZI2C 4EZ4A 4Z8XA 2LE8A 3CWZB 4U72A 2NW9A 2PFVA 3ZEFB 3PUZF 2ZMAA 4M1PA 2CHOA 4YHJA 5HYAA 5LA6E 1N32T 4TUYE 4CN6A 1XNRT 2VKOA 2PJQA 4AIUA 1SUMB 4JYAT 4ZI3C 1YKEB 3JADA 3RGLA 2EHOB 3KV6A 4FJOA 2IC6A 3AXJA 2LHNA 5AQJB 4JI0T 2MYSA 4WBNE 3PUAA 3UT5E 4AI6A 1IJ5A 3CK6A 4PK4A 4YT0A 1HNZT 3N2OA 3JAFA 1D0XA 4IDOA 1DU2A 2WCAA 3H3MA 2XQ6A 1YQ4A 2M67A 1Y64B 2XQAA 4WNKA 1WRDA 1UGOA 3AE2A 2DWKA 4PFPA 4WYVA 3KV9A 5FNVE 3ZT7A 3FB2A 2QA7A 2YN6A 4UF0A 3FBZA 4H9PC 1MIWA 4YJ3E 2CBJA 1XMOT 2BDEA 4OX9T 3ETVA 5E0OA 2OLTA 4UEMA 2LM2A 4YTPA 3UFEA 5LCYA 3VKHA 5HXSA 4EYUA 4KX6A 3K3NA 5CGMA 1YD8G 2QVAA 4O2BE 1HNWT 2FJBA 3L3PA 4K0UA 2W66A 3QC9A 3PE0A 2V7MA 2M6IA 3EABA 5JTGA 3RH3A 2J47A 4QH1A 3NKZA 3LBXB 3ZCIA 4ANJA 3ZT6A 5KX5E 1SA0E 3K8PC 2XHEB 3TLUA 1NWMX 2NTXA 5HEUA 3Q5EA 2LOSA 4LMKA 2B76A 1ZKEA 3ZN0B 3I0QA 1E7PA 5LHGB 2UUAT 2A3DA 2NTYA 3I1AA 4JV5T 2HH7A 5FL1A 3ZYKA 3C4WA 5JRCA 4H63V 4DUYT 4YJ2E 4X65T 4X1KE 4P0AA 1Z8UA 2X9XA 3UTKA 3RHWA 2E5LT 4DNDA 5LNKA 4CI2B 5JH7E 2WWUA 3OYZA 2Y8DA 2DLRA 3SOLA 3P4PA 5DQVA 2JPFA 4CXXA 4HWIB 4WW0A 3RKGA 2MBGA 2RPAA 3FHNA 1FJGT 3FZMB 4O4HE 5AQNB 4ZZBA 1WR0A 3UU4A 3UU8A 3BQKA 3RLFF 1KF6A 3O1JA 2LSGA 2VVSA 1R8IA 2XTLA 2A72A 3CX8B 1EZ3A 4U7IA 2VVNA 2Y48B 2NWBA 4XAXB 2H88A 3U78A 1YW0A 4L0RA 1FIOA 3RF1A 2XJ7A 1LVKA 3HKBE 3FXEB 1OEDB 2VQET 5LBQB 2UXNB 2V6XA 5AQSB 4ZI3D 4ZS3A 5L3CB 3N2KE 4CN4A 4U7YA 3RYFE 3EUHA 2C5IT 1MIVA 5J0ZA 3FZLB 5L4HA 2W63A 4BA9A 4KP3C 5ABHA 3AXJB 2EHOA 4PJNA 2VWAA 4U33A 5LHHB 5JVDE 2ODUA 4OK0A 3CMLA 2JQQA 4HFIA 1XMQT 2N2NA 3LJCA 4DR5T 4EAHA 3S4UA 2Q9QB 5L4EA 2WQYA 2MTQA 2CMRA 3UUNA 4PFOA 4HKAA 5FXVA 1W09A 3FZFB 5L3GB 2XQ8A 1VCSA 5FP3A 3ZMVB 1UURA 2IHR1 2WY2A 3ANWB 2KNDA 2ZM8A 4OYKA 5CA1E 3B5MA 3RIUA 3VRBA 2BG9E 4NXNT 3LK42 3RRCA 3GN5B 1D0ZA 4C90A 2XAQB 3PUQA 5HEOA 3FXDB 2BKNA 1MIYA 2KWIB 3LK3B 2LM9A 4YTMA 2PG8A 2XUEA 1JNZA 2CXFA 3F57A 2WWVA 5FY0A 3DP7A 4CXWA 2DWGA 4TN7B 4ZZCA 2VQFT 2GK9A 2X9WA 2WMNA 5JDLA 4H63H 5LGTB 2XSAA 4DV7T 2N9DA 2DCFA 4AQGA 5LG3A 2LT3A 4DBQA 2X68A 1IZNB 1I94T 3LBXA 2JMKA 4JLEA 2CXLA 5AQQB 5EK4A 5ABFB 2CPTA 2YDQA 5FXXA 2H89A 1BR1A 3A8YC 2WAUA 2X9HA 4JI8T 5ABEA 1WLXA 2WM9A 2A9UA 1Y01A 2LOPA 4DR2T 3N9MA 1G73A 3ONXA 4QHOA 5KMGP 4TV9E 4YXDA 3ONLC 2JJ9A 2X9YA 4YY3T 1LRZA 4AISA 5JRCB 3O9XA 4IE5A 2V5DA 3AA7B 4PNIA 2V7LA 5JDFA 2FJAA 3QB5K 3C64A 1YKHB 5LBMA 4AKHA 2F4VT 4YSXA 3MXZA 1VCTA 2Z6EA 5AQUB 2H7OA 2VL0A 2VK9A 3ZYMA 4IDNA 1Z0PA 5FY7A 1OWAA 3WAKA 2V6YB 3RQUA 4DO0A 3KBUA 3UULA 2X51A 5LMUT 3J9X1 3CQXC 5C2TA 4AKLA 3DTOA 3L8RA 1N36T 4K0KT 3EI0A 3HKDE 4PAGA 1CUNA 4JI4T 2CXDA 1X79A 3PUYF 4OFZA 4P1NA 1MNDA 4EEDA 2KWHA 5HEHA 2WDRA 2BG9C 3PTRB 3T8OA 1WYBA 5HEJA 1WCRA 4HTEA 4IHJE 4ZEYA 1E2AA 3AA0B 2IW5B 2AXDS 2LJLA 3G06A 2W67A 4G63A 4P0BA 3N5LA 1ZOYA 2VL8A 4UXNB 4ILAA 3CKDA 4N78D 1OEDA 1HR0T 1G8XA 1SE7A 5ADXL 4ZS2A 1NEKA 3R84B 3AAEB 1UUSA 4B6XA 2W4XA 2FBWA 2JIWA 2ZLYA 3J7Yq 4LF5T 1MNEA 2XAGB 3HR0A 2E9XD 4B3ST 3ZPOA 2LSIA 5LB7B 2XQ5A 2CWYA 1CHUA 4DV4T 3JC6C 4H9RC 5GONE 3N9QA 1KNRA 3KFWX 2E8IA 2XQYA 5AQGB 1T72A 2H3RA 2KZ7B 2UXXB 4UIGA 5DABA 1VRBA 2Q9QA 2N1GA 3LK2B 1D0YA 3NWIA 3PUVF 4EV6A 2ODVA 3OPCA 4X62T 5TAOA 2HN2A 4ZHQE 5FVLA 3MJXA 2YOEA 2LSJA 2PTFA 2E5VA 3ANWA 3PUSA 5BMVE 2ZM0A 3ZLIA 2KLQA 2LKGA 2LEHA 3GN5A 4PW8A 4CZZB 4AQYT 5HAXA 4IL9A 4YLHA 5LGUB 4HWFA 3M3ZB 4KI0F 4ZI7E 3UU3A 3TLTA 3RRWA 2WBLA 3MZKB 4LF7T 5IWAT 4X1YE 2QRXA 4HFHA 2X0HA 2VB6A 5EZYE 2RP4A 3LG7A 2W61A 1W9RA 4PJJA 4GK0E 4IGUA 5JR9C 2D9DA 3AVRA 3PU3A 5ABFA 4I50E 2L8KA 1J5WA 5CJ5A 2VURA 3Q5DA 3AE4A 2WMOA 4DV3T 3ETUA 2CWOA 2UUCT 3VKGA 3H37A 5HWXA 1D1AA 4JI6T 4UV8B 3EAMA 1T98A 4I4TE 4GK5E 4DR6T 1W0BA 3AE1A 3P4QA 3ZYLA 1SHZC 3AAIA 2V5CA 2X66A 3D0TA 4DR4T 2DHRA 5LJMA 3CIRA 4DMVA 5IHYA 4I43B 1HNXT 4ILUA 3ZSTA 3K1SA 2LSKA 2X0LB 2LLYA 4NPPA 5FVKA 3OKQA 1N33T 3AVSA 2V6YA 3X1DA 3Q5WA 3ZMUB 3V5SA 3ZC0A 2PBIA 3PUXF 3KV5A 2V7KA 3C4XA 2LRLA 2BVLA 1NENA 1FEWA 2CM0A 3L39A 2LRKA 4DV2T 3RYHE 3TLVA 3PURA 1O3XA 4U2ZA 4DR1T 2OV9A 3ESLA 5DQWA 3NVOA 4TX5A 3KBTA 5L3EB 2WZIA 1ZEEA 3N9OA 4HE8A 3I9YA 3KDSE 3O1IA 2WU5A 2E2AA 3C98B 5FL0A 2L3LA 5FXWA 5KXJA 4DV0T 4DUZT 3AA6B 4TNWA 5CA0E 3RYCE 3JC6D 3EDVA 4TWDA 1HG5A 4JUYA 3A7MA 3W15B 3L09A 2HN1A 5AQHB 2CA5A 2DI4A 3PU8A 2MOZA 3EDUA 5FKYA 2RA1A 2E9XC 3LFMA 3VR9A 5J2UE 2KXPB 3NRYA 3B57A 1BR4A 2M6BA 4UR9A 3RKOA 4HWDA 5F5WA 3RYIE 2ES0A 2I0MA 1D1BA 4NIQA 3AE6A 4AXPA 1MMGA 3LSVA 2UXDT 1BR0A 1YXRA 4X1IE 1I6ZA 3O1HA 2NW7A 2WDVA 3GWHA 2XM2A 2YDRA 3ZKRA 4FI5A 2BG9B 5JDMA 3ZC1A 2K9AA 4EZHA 5AQKB 4HEAA 1US7B 1IAPA 3WAJA 3ZJ1A 4AQFC 2V7JA 2XQ4A 4AKIA 2XAHB 3TLSA 2BBJA 4MBQA 2K3WA 3FZHB 2LKHA 4JI5T 3KV4A 3SRZA 2CE7A 5AQFB 3UUXB 4H9SE 3LDQB 1XNQT 2ACXA 4KHPT 4EXTA
chains in the Genus database with same CATH topology
4DR5T 4DV0T 4DUZT 1IBKT 3OTOT 4DR4T 1IBMT 4JI2T 1FJGT 5BR8T 1HNWT 4JI7T 4JI8T 1N32T 4AQYT 4B3RT 1J5ET 1XNRT 4DV5T 3T1YT 4JYAT 1HNXT 4DR2T 4LF4T 3T1HT 4B3TT 4YHHT 2ZM6T 4JI0T 1HR0T 1N33T 4LF7T 1IBLT 4YY3T 4LFAT 4JI3T 4X66T 4LF8T 5IWAT 4NXNT 1HNZT 2HHHT 4LF5T 4LFBT 2F4VT 4DR3T 2UXDT 2UU9T 4B3ST 4X64T 4LFCT 4DV2T 2VQET 4GKJT 4DV4T 4DV6T 4DR1T 5LMNT 4JI1T 4GKKT 4LF6T 4LF9T 5LMUT 4NXMT 2UUAT 4B3MT 4JV5T 2VQFT 4DV1T 2UUBT 4DUYT 1N36T 4K0KT 4DV7T 4DV3T 4JI4T 4X65T 4DR7T 2UXBT 1N34T 4X62T 2E5LT 2UUCT 2UXCT 1XMOT 4JI5T 1I94T 4OX9T 4JI6T 4DR6T 1XNQT 4KHPT 1XMQT
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4DR5 T;  4DV0 T;  4DUZ T;  1IBK T;  3OTO T;  4DR4 T;  1IBM T;  4JI2 T;  1FJG T;  5BR8 T;  1HNW T;  4JI7 T;  4JI8 T;  1N32 T;  4AQY T;  4B3R T;  1J5E T;  1XNR T;  4DV5 T;  3T1Y T;  4JYA T;  1HNX T;  4DR2 T;  4LF4 T;  3T1H T;  4B3T T;  4YHH T;  2ZM6 T;  4JI0 T;  1HR0 T;  1N33 T;  4LF7 T;  1IBL T;  4YY3 T;  4LFA T;  4JI3 T;  4X66 T;  4LF8 T;  5IWA T;  4NXN T;  1HNZ T;  2HHH T;  4LF5 T;  4LFB T;  2F4V T;  4DR3 T;  2UXD T;  2UU9 T;  4B3S T;  4X64 T;  4LFC T;  4DV2 T;  2VQE T;  4GKJ T;  4DV4 T;  4DV6 T;  4DR1 T;  5LMN T;  4JI1 T;  4GKK T;  4LF6 T;  4LF9 T;  5LMU T;  4NXM T;  2UUA T;  4B3M T;  4JV5 T;  2VQF T;  4DV1 T;  2UUB T;  4DUY T;  1N36 T;  4K0K T;  4DV7 T;  4DV3 T;  4JI4 T;  4X65 T;  4DR7 T;  2UXB T;  1N34 T;  4X62 T;  2E5L T;  2UUC T;  2UXC T;  1XMO T;  4JI5 T;  1I94 T;  4OX9 T;  4JI6 T;  4DR6 T;  1XNQ T;  4KHP T;  1XMQ T; 
#chains in the Genus database with same CATH topology
 3CX7 B;  1M62 A;  1KEY A;  2Y6X A;  3Q5X A;  5AQT B;  1UK5 A;  3V5U A;  5AQV B;  3AE7 A;  3C4Z A;  4H9Q C;  4EYY R;  4PK5 A;  2KIN B;  1L0V A;  2OA5 A;  5EK3 A;  3UQ7 A;  3FBL A;  5DJQ C;  3E08 A;  3Q2M A;  4UVA B;  3WI3 A;  2E9X A;  5HXE A;  1V9D A;  2XQ9 A;  3NZQ A;  3AEC A;  5L3D B;  4PJM A;  4O8S A;  2HHH T;  4QX7 B;  4UVB B;  2J62 A;  4OHF A;  2K48 A;  3IF8 B;  2JQK A;  3IEE A;  2W00 A;  2W62 A;  4KHZ F;  1QSD A;  1UX4 A;  5L47 A;  4IE6 A;  3AEG A;  3IA3 A;  2VKD A;  2VKH A;  2D0T A;  4ILB A;  4L5G A;  5IUX A;  1HX1 B;  3F31 A;  3AEF A;  5JDH A;  4A97 A;  2CHN A;  2EHO D;  2QYW A;  3ZMS B;  2XPK A;  2J1D G;  4JEH B;  4U74 A;  3PJA J;  3QOF A;  3C50 A;  5AQL B;  3ONJ A;  5H6R B;  1T7S A;  3OBV E;  1HX8 A;  4A56 A;  4U2Y A;  1IBK T;  2XAJ B;  3VRA A;  2IML A;  3F2E A;  4G2A A;  1IJ6 A;  4GOU A;  2JQ9 A;  5EK2 A;  2WU2 A;  5JR9 B;  4YSY A;  4HWH A;  5JDQ A;  1KFY A;  3P4W A;  3QUJ A;  4MHC A;  4LFA T;  3CQG B;  4QH5 A;  3KIN B;  5JQG E;  1XWM A;  3MA9 A;  5C3J A;  4LFB T;  2LSY A;  4HFC A;  3NRX A;  1M7K A;  4GIW A;  1S94 A;  2CRB A;  3ABV A;  4YTN A;  4GKJ T;  1LVF A;  5AQO B;  4DV6 T;  3CX6 B;  2CLY C;  4YFS A;  3NZP A;  2LHR A;  4HFD A;  2A2F X;  3P8C D;  4IRE A;  1HTJ F;  2MAW A;  3AB3 B;  5JRE A;  1LKX A;  3OVU A;  2UXB T;  4EIW A;  3CQC B;  4KMC A;  3RC3 A;  3AED A;  2HPL A;  1NAF A;  2YU2 A;  1MMA A;  3RIF A;  2L9Q A;  5IYZ E;  4BJN A;  3GMI A;  1IBM T;  5BR8 T;  4QKN A;  2D2S A;  3SFD A;  3QK6 A;  3PUG A;  1XZY A;  5JDG A;  1U4Q A;  1VOM A;  1T8B A;  5LGN B;  2FJE A;  2XQ3 A;  2JQH A;  1OXZ A;  2VAS A;  2BBH A;  2BG9 A;  4TWF A;  2B1E A;  3VHL A;  1MMD A;  1IBL T;  3PDY A;  4JI3 T;  3HKC E;  4V1A v;  3BQI A;  5LYJ E;  5LHI B;  4H9O C;  4HN9 A;  2C5K T;  3NBX X;  2D0U A;  4ADZ A;  3JAE A;  2YU1 A;  3OJA A;  1HF8 A;  2AE9 A;  2J4G A;  2BS2 A;  5LJN A;  4GKK T;  1BR2 A;  2D5U A;  4ERR A;  4LF6 T;  2WSS V;  4LF9 T;  4A5X A;  5HXH A;  1J1J A;  1QLB A;  1GQE A;  5A1L A;  2UUB T;  1E1H B;  4IE0 A;  4IDQ A;  3DJB A;  3C51 A;  4UVC B;  5HCJ A;  4NUV A;  2E9X B;  3EHZ A;  4Q25 A;  4YSZ A;  5JDN A;  4ISS A;  4XBF B;  3IHR A;  2MPK A;  5CB4 E;  4F8H A;  3HL6 A;  3OTO T;  3N9N A;  4JI2 T;  2JRK A;  4I0U A;  5HXR A;  4JI7 T;  4QH4 A;  4BAY B;  4IDP A;  3T1Y T;  4LML A;  4AKR B;  3T1H T;  4CQI A;  2DNX A;  4ZXL A;  5AFU L;  4QXC B;  2I6H A;  5ETW A;  4O4L E;  1YQ3 A;  4O4I E;  4HFE A;  5AQR B;  3UU5 A;  4DVD A;  2P9B A;  4COF A;  2XZE A;  4C91 A;  4IT4 A;  2V7I A;  2YEV C;  1B7T A;  5LXT E;  2H7V C;  5AQM B;  3MK7 C;  4DR3 T;  3SWH A;  1FMV A;  1KNZ A;  3E22 E;  1MMN A;  4TV8 E;  4X64 T;  3IBP A;  3R6N A;  3VU7 H;  3RC8 A;  2EHO C;  5HEG A;  2WB5 A;  2YDS A;  4JI1 T;  5HXC A;  3AAA B;  3B13 A;  2Q9Q D;  2W0G A;  4XZC A;  4KBM B;  4NXM T;  3K3Q C;  4TWH A;  3MKD A;  4DV1 T;  4KUM B;  1JNR A;  3AEB A;  5KDM C;  4OYJ A;  3SFE A;  4JBW F;  3QNU A;  4MFR A;  3HA4 A;  3KVA A;  1N34 T;  1QUU A;  4U3C A;  2CCQ A;  3AEA A;  5FY1 A;  5L3B B;  5JR9 A;  4A98 A;  3P4R A;  1ZHC A;  5J2T E;  2X67 A;  2R6G F;  2ZM2 A;  3I9W A;  2IDO B;  3QB5 A;  2BZB A;  3RPU A;  3RIU C;  4O4J E;  4QX8 B;  4ZI2 D;  1J5E T;  3JCF A;  3N9P A;  3UQ4 A;  4UEL A;  4ZOL E;  2WZH A;  4LF4 T;  4PK6 A;  5F8P A;  3AE5 A;  5AQP B;  2WDQ A;  5AQI B;  1HFA A;  1OED E;  4PJL A;  2BS3 A;  2WP9 A;  4WBO A;  4HFV A;  3P4S A;  3TLW A;  4CXY A;  3K3O A;  2YK0 A;  2KMF A;  4EOZ B;  1KNP A;  1X9B A;  2IC9 A;  2YKS A;  4IE4 A;  4H9N C;  4HGA A;  4P09 A;  4JEU B;  1XDP A;  4GYS A;  4MAL A;  2NOX A;  2CBI A;  4IST A;  1HG2 A;  2V8S V;  4GYR A;  4X5T A;  1HCI A;  2BVM A;  3N2G E;  1FMW A;  4DR7 T;  4EB6 E;  5M4Y A;  3HKE E;  3TKL B;  3CVR A;  4DBR A;  3UUB A;  2UXC T;  4EGW A;  4IDZ A;  5LOV E;  3SS1 A;  2ACZ A;  1ZP0 A;  1S35 A;  2G0U A;  2K24 A;  2X0Y A;  4CN1 A;  5LG4 A;  2BS4 A;  5FMN A;  3EVY A;  1WR6 A;  2K5B B;  4UF0 B;  3AA1 B;  3MAC A;  4IL4 A;  4MLK A;  2CLY B;  3M65 A;  3PJA A;  4B3T T;  5F3J A;  5L3F B;  2ZM6 T;  4QWN B;  4Z90 A;  2XQ7 A;  3UU6 A;  4LF8 T;  2FJD A;  3ZT5 A;  5J1G A;  3ZSS A;  3ZMZ B;  3AE3 A;  5CFB A;  2WS3 A;  2QGS A;  2NP9 A;  2XM1 A;  2DL1 A;  4I55 E;  4O2A E;  3Q9D A;  4BJM A;  2IIU A;  2XSB A;  3PV0 F;  4IE7 A;  4WZX A;  2NR4 A;  3CPZ A;  4QXH B;  3FZK B;  2BKP A;  3ZJ2 A;  4QXB B;  1H7C A;  1UCU A;  4EEB A;  3O4X E;  2IUB A;  3OYX A;  2BKO A;  3RI5 A;  2KSR A;  2KT9 A;  2I59 A;  1U5P A;  4CI3 B;  3U3I A;  3HI2 A;  1WYC A;  4F6R C;  2SPC A;  3BQL A;  3E0Z A;  2XAF B;  2V26 A;  4TZ4 C;  4HFB A;  4NUU A;  1OED C;  3KVB A;  2YIN A;  2XY8 B;  4AQF A;  4TNV A;  4X20 E;  3UFG A;  2C0S A;  3GA8 A;  4Z91 A;  2VKJ A;  5FYM A;  3H3A A;  1UX5 A;  4B3R T;  5HWY A;  4DV5 T;  4DMW A;  3AE8 A;  5ABG A;  4UV9 B;  4YHH T;  1KK7 A;  2NW8 A;  4IIJ E;  3ZMT B;  5HCM A;  1W0A A;  4E7Z A;  1XDO A;  4LMJ A;  4AKG A;  3BK9 A;  3VR8 A;  3P7I A;  4X66 T;  3I0O A;  5C8Y E;  3RIA A;  1ZV4 X;  2FUP A;  4J2C A;  5LP6 E;  1HS7 A;  2Q9Q C;  4L9I A;  5L2L A;  1D1C A;  4ILC A;  2UU9 T;  2IAK A;  3RQW A;  3UUM A;  4ASK A;  4LFC T;  2XAS B;  3P50 A;  2C5J A;  5LMN T;  2CEA A;  3ZN1 B;  1WFD A;  1AJ3 A;  4B3M T;  3N9L A;  4DID B;  4U31 A;  3ZCJ A;  5H6Q B;  3A5X A;  2HPJ A;  3PUW F;  3AE9 A;  4HWC A;  2JMH A;  3RX6 A;  2V1D B;  4E7S A;  3AEE A;  4CI1 B;  5FXZ A;  2W2U A;  4ZI2 C;  4EZ4 A;  4Z8X A;  2LE8 A;  3CWZ B;  4U72 A;  2NW9 A;  2PFV A;  3ZEF B;  3PUZ F;  2ZMA A;  4M1P A;  2CHO A;  4YHJ A;  5HYA A;  5LA6 E;  1N32 T;  4TUY E;  4CN6 A;  1XNR T;  2VKO A;  2PJQ A;  4AIU A;  1SUM B;  4JYA T;  4ZI3 C;  1YKE B;  3JAD A;  3RGL A;  2EHO B;  3KV6 A;  4FJO A;  2IC6 A;  3AXJ A;  2LHN A;  5AQJ B;  4JI0 T;  2MYS A;  4WBN E;  3PUA A;  3UT5 E;  4AI6 A;  1IJ5 A;  3CK6 A;  4PK4 A;  4YT0 A;  1HNZ T;  3N2O A;  3JAF A;  1D0X A;  4IDO A;  1DU2 A;  2WCA A;  3H3M A;  2XQ6 A;  1YQ4 A;  2M67 A;  1Y64 B;  2XQA A;  4WNK A;  1WRD A;  1UGO A;  3AE2 A;  2DWK A;  4PFP A;  4WYV A;  3KV9 A;  5FNV E;  3ZT7 A;  3FB2 A;  2QA7 A;  2YN6 A;  4UF0 A;  3FBZ A;  4H9P C;  1MIW A;  4YJ3 E;  2CBJ A;  1XMO T;  2BDE A;  4OX9 T;  3ETV A;  5E0O A;  2OLT A;  4UEM A;  2LM2 A;  4YTP A;  3UFE A;  5LCY A;  3VKH A;  5HXS A;  4EYU A;  4KX6 A;  3K3N A;  5CGM A;  1YD8 G;  2QVA A;  4O2B E;  1HNW T;  2FJB A;  3L3P A;  4K0U A;  2W66 A;  3QC9 A;  3PE0 A;  2V7M A;  2M6I A;  3EAB A;  5JTG A;  3RH3 A;  2J47 A;  4QH1 A;  3NKZ A;  3LBX B;  3ZCI A;  4ANJ A;  3ZT6 A;  5KX5 E;  1SA0 E;  3K8P C;  2XHE B;  3TLU A;  1NWM X;  2NTX A;  5HEU A;  3Q5E A;  2LOS A;  4LMK A;  2B76 A;  1ZKE A;  3ZN0 B;  3I0Q A;  1E7P A;  5LHG B;  2UUA T;  2A3D A;  2NTY A;  3I1A A;  4JV5 T;  2HH7 A;  5FL1 A;  3ZYK A;  3C4W A;  5JRC A;  4H63 V;  4DUY T;  4YJ2 E;  4X65 T;  4X1K E;  4P0A A;  1Z8U A;  2X9X A;  3UTK A;  3RHW A;  2E5L T;  4DND A;  5LNK A;  4CI2 B;  5JH7 E;  2WWU A;  3OYZ A;  2Y8D A;  2DLR A;  3SOL A;  3P4P A;  5DQV A;  2JPF A;  4CXX A;  4HWI B;  4WW0 A;  3RKG A;  2MBG A;  2RPA A;  3FHN A;  1FJG T;  3FZM B;  4O4H E;  5AQN B;  4ZZB A;  1WR0 A;  3UU4 A;  3UU8 A;  3BQK A;  3RLF F;  1KF6 A;  3O1J A;  2LSG A;  2VVS A;  1R8I A;  2XTL A;  2A72 A;  3CX8 B;  1EZ3 A;  4U7I A;  2VVN A;  2Y48 B;  2NWB A;  4XAX B;  2H88 A;  3U78 A;  1YW0 A;  4L0R A;  1FIO A;  3RF1 A;  2XJ7 A;  1LVK A;  3HKB E;  3FXE B;  1OED B;  2VQE T;  5LBQ B;  2UXN B;  2V6X A;  5AQS B;  4ZI3 D;  4ZS3 A;  5L3C B;  3N2K E;  4CN4 A;  4U7Y A;  3RYF E;  3EUH A;  2C5I T;  1MIV A;  5J0Z A;  3FZL B;  5L4H A;  2W63 A;  4BA9 A;  4KP3 C;  5ABH A;  3AXJ B;  2EHO A;  4PJN A;  2VWA A;  4U33 A;  5LHH B;  5JVD E;  2ODU A;  4OK0 A;  3CML A;  2JQQ A;  4HFI A;  1XMQ T;  2N2N A;  3LJC A;  4DR5 T;  4EAH A;  3S4U A;  2Q9Q B;  5L4E A;  2WQY A;  2MTQ A;  2CMR A;  3UUN A;  4PFO A;  4HKA A;  5FXV A;  1W09 A;  3FZF B;  5L3G B;  2XQ8 A;  1VCS A;  5FP3 A;  3ZMV B;  1UUR A;  2IHR 1;  2WY2 A;  3ANW B;  2KND A;  2ZM8 A;  4OYK A;  5CA1 E;  3B5M A;  3RIU A;  3VRB A;  2BG9 E;  4NXN T;  3LK4 2;  3RRC A;  3GN5 B;  1D0Z A;  4C90 A;  2XAQ B;  3PUQ A;  5HEO A;  3FXD B;  2BKN A;  1MIY A;  2KWI B;  3LK3 B;  2LM9 A;  4YTM A;  2PG8 A;  2XUE A;  1JNZ A;  2CXF A;  3F57 A;  2WWV A;  5FY0 A;  3DP7 A;  4CXW A;  2DWG A;  4TN7 B;  4ZZC A;  2VQF T;  2GK9 A;  2X9W A;  2WMN A;  5JDL A;  4H63 H;  5LGT B;  2XSA A;  4DV7 T;  2N9D A;  2DCF A;  4AQG A;  5LG3 A;  2LT3 A;  4DBQ A;  2X68 A;  1IZN B;  1I94 T;  3LBX A;  2JMK A;  4JLE A;  2CXL A;  5AQQ B;  5EK4 A;  5ABF B;  2CPT A;  2YDQ A;  5FXX A;  2H89 A;  1BR1 A;  3A8Y C;  2WAU A;  2X9H A;  4JI8 T;  5ABE A;  1WLX A;  2WM9 A;  2A9U A;  1Y01 A;  2LOP A;  4DR2 T;  3N9M A;  1G73 A;  3ONX A;  4QHO A;  5KMG P;  4TV9 E;  4YXD A;  3ONL C;  2JJ9 A;  2X9Y A;  4YY3 T;  1LRZ A;  4AIS A;  5JRC B;  3O9X A;  4IE5 A;  2V5D A;  3AA7 B;  4PNI A;  2V7L A;  5JDF A;  2FJA A;  3QB5 K;  3C64 A;  1YKH B;  5LBM A;  4AKH A;  2F4V T;  4YSX A;  3MXZ A;  1VCT A;  2Z6E A;  5AQU B;  2H7O A;  2VL0 A;  2VK9 A;  3ZYM A;  4IDN A;  1Z0P A;  5FY7 A;  1OWA A;  3WAK A;  2V6Y B;  3RQU A;  4DO0 A;  3KBU A;  3UUL A;  2X51 A;  5LMU T;  3J9X 1;  3CQX C;  5C2T A;  4AKL A;  3DTO A;  3L8R A;  1N36 T;  4K0K T;  3EI0 A;  3HKD E;  4PAG A;  1CUN A;  4JI4 T;  2CXD A;  1X79 A;  3PUY F;  4OFZ A;  4P1N A;  1MND A;  4EED A;  2KWH A;  5HEH A;  2WDR A;  2BG9 C;  3PTR B;  3T8O A;  1WYB A;  5HEJ A;  1WCR A;  4HTE A;  4IHJ E;  4ZEY A;  1E2A A;  3AA0 B;  2IW5 B;  2AXD S;  2LJL A;  3G06 A;  2W67 A;  4G63 A;  4P0B A;  3N5L A;  1ZOY A;  2VL8 A;  4UXN B;  4ILA A;  3CKD A;  4N78 D;  1OED A;  1HR0 T;  1G8X A;  1SE7 A;  5ADX L;  4ZS2 A;  1NEK A;  3R84 B;  3AAE B;  1UUS A;  4B6X A;  2W4X A;  2FBW A;  2JIW A;  2ZLY A;  3J7Y q;  4LF5 T;  1MNE A;  2XAG B;  3HR0 A;  2E9X D;  4B3S T;  3ZPO A;  2LSI A;  5LB7 B;  2XQ5 A;  2CWY A;  1CHU A;  4DV4 T;  3JC6 C;  4H9R C;  5GON E;  3N9Q A;  1KNR A;  3KFW X;  2E8I A;  2XQY A;  5AQG B;  1T72 A;  2H3R A;  2KZ7 B;  2UXX B;  4UIG A;  5DAB A;  1VRB A;  2Q9Q A;  2N1G A;  3LK2 B;  1D0Y A;  3NWI A;  3PUV F;  4EV6 A;  2ODV A;  3OPC A;  4X62 T;  5TAO A;  2HN2 A;  4ZHQ E;  5FVL A;  3MJX A;  2YOE A;  2LSJ A;  2PTF A;  2E5V A;  3ANW A;  3PUS A;  5BMV E;  2ZM0 A;  3ZLI A;  2KLQ A;  2LKG A;  2LEH A;  3GN5 A;  4PW8 A;  4CZZ B;  4AQY T;  5HAX A;  4IL9 A;  4YLH A;  5LGU B;  4HWF A;  3M3Z B;  4KI0 F;  4ZI7 E;  3UU3 A;  3TLT A;  3RRW A;  2WBL A;  3MZK B;  4LF7 T;  5IWA T;  4X1Y E;  2QRX A;  4HFH A;  2X0H A;  2VB6 A;  5EZY E;  2RP4 A;  3LG7 A;  2W61 A;  1W9R A;  4PJJ A;  4GK0 E;  4IGU A;  5JR9 C;  2D9D A;  3AVR A;  3PU3 A;  5ABF A;  4I50 E;  2L8K A;  1J5W A;  5CJ5 A;  2VUR A;  3Q5D A;  3AE4 A;  2WMO A;  4DV3 T;  3ETU A;  2CWO A;  2UUC T;  3VKG A;  3H37 A;  5HWX A;  1D1A A;  4JI6 T;  4UV8 B;  3EAM A;  1T98 A;  4I4T E;  4GK5 E;  4DR6 T;  1W0B A;  3AE1 A;  3P4Q A;  3ZYL A;  1SHZ C;  3AAI A;  2V5C A;  2X66 A;  3D0T A;  4DR4 T;  2DHR A;  5LJM A;  3CIR A;  4DMV A;  5IHY A;  4I43 B;  1HNX T;  4ILU A;  3ZST A;  3K1S A;  2LSK A;  2X0L B;  2LLY A;  4NPP A;  5FVK A;  3OKQ A;  1N33 T;  3AVS A;  2V6Y A;  3X1D A;  3Q5W A;  3ZMU B;  3V5S A;  3ZC0 A;  2PBI A;  3PUX F;  3KV5 A;  2V7K A;  3C4X A;  2LRL A;  2BVL A;  1NEN A;  1FEW A;  2CM0 A;  3L39 A;  2LRK A;  4DV2 T;  3RYH E;  3TLV A;  3PUR A;  1O3X A;  4U2Z A;  4DR1 T;  2OV9 A;  3ESL A;  5DQW A;  3NVO A;  4TX5 A;  3KBT A;  5L3E B;  2WZI A;  1ZEE A;  3N9O A;  4HE8 A;  3I9Y A;  3KDS E;  3O1I A;  2WU5 A;  2E2A A;  3C98 B;  5FL0 A;  2L3L A;  5FXW A;  5KXJ A;  4DV0 T;  4DUZ T;  3AA6 B;  4TNW A;  5CA0 E;  3RYC E;  3JC6 D;  3EDV A;  4TWD A;  1HG5 A;  4JUY A;  3A7M A;  3W15 B;  3L09 A;  2HN1 A;  5AQH B;  2CA5 A;  2DI4 A;  3PU8 A;  2MOZ A;  3EDU A;  5FKY A;  2RA1 A;  2E9X C;  3LFM A;  3VR9 A;  5J2U E;  2KXP B;  3NRY A;  3B57 A;  1BR4 A;  2M6B A;  4UR9 A;  3RKO A;  4HWD A;  5F5W A;  3RYI E;  2ES0 A;  2I0M A;  1D1B A;  4NIQ A;  3AE6 A;  4AXP A;  1MMG A;  3LSV A;  2UXD T;  1BR0 A;  1YXR A;  4X1I E;  1I6Z A;  3O1H A;  2NW7 A;  2WDV A;  3GWH A;  2XM2 A;  2YDR A;  3ZKR A;  4FI5 A;  2BG9 B;  5JDM A;  3ZC1 A;  2K9A A;  4EZH A;  5AQK B;  4HEA A;  1US7 B;  1IAP A;  3WAJ A;  3ZJ1 A;  4AQF C;  2V7J A;  2XQ4 A;  4AKI A;  2XAH B;  3TLS A;  2BBJ A;  4MBQ A;  2K3W A;  3FZH B;  2LKH A;  4JI5 T;  3KV4 A;  3SRZ A;  2CE7 A;  5AQF B;  3UUX B;  4H9S E;  3LDQ B;  1XNQ T;  2ACX A;  4KHP T;  4EXT A; 
#chains in the Genus database with same CATH homology
 4DR5 T;  4DV0 T;  4DUZ T;  1IBK T;  3OTO T;  4DR4 T;  1IBM T;  4JI2 T;  1FJG T;  5BR8 T;  1HNW T;  4JI7 T;  4JI8 T;  1N32 T;  4AQY T;  4B3R T;  1J5E T;  1XNR T;  4DV5 T;  3T1Y T;  4JYA T;  1HNX T;  4DR2 T;  4LF4 T;  3T1H T;  4B3T T;  4YHH T;  2ZM6 T;  4JI0 T;  1HR0 T;  1N33 T;  4LF7 T;  1IBL T;  4YY3 T;  4LFA T;  4JI3 T;  4X66 T;  4LF8 T;  5IWA T;  4NXN T;  1HNZ T;  2HHH T;  4LF5 T;  4LFB T;  2F4V T;  4DR3 T;  2UXD T;  2UU9 T;  4B3S T;  4X64 T;  4LFC T;  4DV2 T;  2VQE T;  4GKJ T;  4DV4 T;  4DV6 T;  4DR1 T;  5LMN T;  4JI1 T;  4GKK T;  4LF6 T;  4LF9 T;  5LMU T;  4NXM T;  2UUA T;  4B3M T;  4JV5 T;  2VQF T;  4DV1 T;  2UUB T;  4DUY T;  1N36 T;  4K0K T;  4DV7 T;  4DV3 T;  4JI4 T;  4X65 T;  4DR7 T;  2UXB T;  1N34 T;  4X62 T;  2E5L T;  2UUC T;  2UXC T;  1XMO T;  4JI5 T;  1I94 T;  4OX9 T;  4JI6 T;  4DR6 T;  1XNQ T;  4KHP T;  1XMQ T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...