4YHHT

Crystal structure of the 30s ribosomal subunit from thermus thermophilus in complex with tigecycline
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
99
structure length
99
Chain Sequence
b'RNLSALKRHRQSLKRRLRNKAKKSAIKTLSKKAIQLAQEGKAEEALKIMRKAESLIDKAAKGSTLHKNAAARRKSRLMRKVRQLLEAAGAPLIGGGLSA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 16S ribosomal RNA
publication title Structural characterization of an alternative mode of tigecycline binding to the bacterial ribosome.
pubmed doi rcsb
molecule tags Ribosome
total genus 31
structure length 99
sequence length 99
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.58.110 Mainly Alpha Up-down Bundle Methane Monooxygenase Hydroxylase; Chain G, domain 1 Ribosomal protein S20 4yhhT00
4LF9T 2ZM6T 4JI4T 2E5LT 4DV0T 4X62T 4DR7T 4JI7T 4JI6T 4DR4T 1XMQT 4B3RT 4LF6T 1IBKT 3T1HT 2UUAT 1J5ET 1HR0T 3T1YT 4LFCT 5LMUT 4DV4T 4YHHT 4JI5T 1IBMT 4JI1T 5BR8T 1N34T 4DV2T 4X66T 4JI3T 4B3ST 4B3MT 4DUZT 4AQYT 2F4VT 4OX9T 4DV1T 1N32T 1XNRT 4DR1T 2UXBT 4DV3T 1I94T 3OTOT 4DR6T 4JI8T 4GKKT 4LF7T 2VQFT 4DUYT 4LFBT 5IWAT 4JYAT 4B3TT 1IBLT 4LF5T 2UXDT 1HNWT 1HNXT 2HHHT 4YY3T 4X64T 4GKJT 2UUBT 2UXCT 5LMNT 4DR3T 4NXNT 1HNZT 4DR2T 4LF4T 4LF8T 4NXMT 4JV5T 4DV7T 4DV5T 2VQET 4K0KT 1XMOT 4DR5T 4X65T 1N36T 2UUCT 1FJGT 4JI0T 4KHPT 2UU9T 4DV6T 1XNQT 4LFAT 1N33T 4JI2T
chains in the Genus database with same CATH superfamily
4IDPA 4X62T 3KBUA 1XDOA 3GMIA 4B3RT 2YK0A 3L8RA 2BS3A 4H9OC 4HFCA 2V7JA 4DV4T 3HL6A 4ZEYA 1NAFA 1KNRA 5BR8T 3RYCE 4HN9A 4IIJE 4PJLA 4DBRA 3BK9A 4DV2T 3SOLA 2LM9A 1OWAA 1IAPA 5LOVE 2Q9QB 2KINB 1V9DA 2XQAA 1X9BA 2DNXA 4HFVA 2CXLA 4QH1A 4XZCA 2DHRA 3FZMB 3UU8A 2XTLA 2Q9QD 4HFDA 3QNUA 4UIGA 2CA5A 4U7YA 5H6RB 1BR1A 3LBXA 4HFEA 5IWAT 2IC6A 3EDUA 2X0HA 3MA9A 1WRDA 2QGSA 3LFMA 3M65A 2WS3A 4IDNA 4YLHA 4O2BE 3BQKA 2A9UA 4LF4T 1WFDA 2VWAA 5LGNB 1Z0PA 2DL1A 4ZHQE 5FVLA 4ILUA 1U4QA 3TKLB 2V6YB 1CUNA 2WM9A 2WBLA 5CB4E 1LVKA 3AXJA 1FJGT 3ZN1B 2LSIA 5JH7E 1T72A 4JI2T 3AB3B 2XY8B 5EK2A 3NVOA 3C4WA 2NW9A 5AQIB 2YDQA 1ZKEA 1IBKT 2ODUA 1XZYA 3ZJ2A 2CEAA 3UULA 5ABHA 4WW0A 2AXDS 2NOXA 2DI4A 3KV5A 3UQ7A 3OBVE 5DABA 2X0LB 4EYUA 1IJ5A 3F31A 2FJAA 4U2ZA 4QHOA 3LK2B 4ZI3D 4DR1T 3AVRA 1I94T 4L9IA 2V5DA 3VKGA 2LE8A 3HKDE 3Q5EA 5LP6E 2CBIA 3AE6A 3MXZA 3P4PA 3SRZA 3P8CD 2X9XA 4YSYA 4WZXA 5AFUL 3RIUA 5JDMA 2EHOB 2GK9A 3T8OA 3A5XA 5HXSA 1FEWA 2C5KT 4X20E 2LHRA 3FB2A 2EHOD 2CWYA 4IE4A 3N9QA 4O8SA 1LVFA 1WR6A 2XAQB 3W15B 1YW0A 2XSBA 4Q25A 2XQ8A 4ZS3A 4PK5A 2CXFA 2X0YA 2PJQA 3ONJA 2PTFA 5JRCA 2V7LA 2JQ9A 3I1AA 2XJ7A 4ADZA 4HFHA 2YDRA 3QK6A 4DO0A 5CFBA 3AA7B 2W61A 1E1HB 4HGAA 2R6GF 3GA8A 2VB6A 4LF6T 3KINB 1J5ET 2QRXA 5HXRA 4CN1A 4IT4A 2XQ6A 3QC9A 2CMRA 5ABEA 3TLWA 4UEMA 2G0UA 2XQ3A 4UVCB 4UF0A 3RYFE 1NEKA 5LG3A 1N32T 3NZPA 5FY7A 5L47A 2E5VA 2VL0A 1R8IA 3O1IA 2CHOA 5FL0A 2E9XC 4LMJA 3PUSA 2CLYC 5BMVE 4EB6E 3PURA 3HA4A 2UUBT 1BR0A 2VL8A 2KT9A 4U74A 4KUMB 3I9WA 3ZJ1A 1GQEA 5EZYE 1KNZA 3AE1A 4YHJA 3CPZA 4KI0F 3AE4A 2VQET 5J2TE 4TX5A 4JI0T 3EI0A 3EHZA 3MK7C 4YFSA 1UUSA 4GIWA 2E2AA 1XWMA 3RKGA 1N33T 4E7SA 2WP9A 2ZM6T 3UUBA 2ZMAA 4P0BA 4O4LE 1SA0E 3T1YT 4U7IA 3RKOA 4I43B 3ZT6A 3CX8B 4UR9A 1JNRA 2WU5A 1H7CA 4TNWA 5IUXA 4X66T 3TLTA 5DJQC 2WMNA 5AQHB 2XSAA 3J9X1 2ACZA 5AQLB 3PJAJ 3HKCE 2XM1A 2VK9A 5FXXA 4KHZF 4YTMA 4ASKA 5KMGP 2WZHA 4PFPA 2C5JA 3RRWA 3PUVF 4EV6A 2Q9QC 2UXDT 4P0AA 4DMVA 4X64T 2BG9C 2LJLA 2L9QA 5AQMB 4XBFB 3AAEB 4JEUB 2X9HA 2J4GA 2PFVA 5JDFA 1BR2A 3CX6B 4H63H 5JDQA 2JJ9A 1S94A 3LBXB 2UU9T 1XNQT 5L3GB 2P9BA 3PUYF 4GYRA 2XZEA 2NW7A 2H89A 4P1NA 3NKZA 5FXWA 3IA3A 1XMQT 3V5UA 4TUYE 3AEAA 3AEFA 4TWDA 3FZHB 2H7VC 4YHHT 1HG5A 2D0TA 1HTJF 3D0TA 2NR4A 5HWXA 2PBIA 2LSGA 3N9OA 2UXXB 1ZHCA 3RIFA 1FMWA 4B3MT 2VVNA 4DNDA 2ODVA 2WU2A 4QH5A 4GKKT 3JAEA 2Y8DA 4A97A 4ZI3C 4JYAT 5LXTE 3C4XA 3ABVA 3ZT7A 5C8YE 4EXTA 2XQYA 2I59A 3HKBE 2JRKA 4OHFA 1T7SA 1HFAA 4TWHA 4TNVA 5JQGE 3ZSTA 2X66A 3FZLB 3TLUA 3SFEA 3PU8A 3IEEA 2CM0A 4Z8XA 2EHOC 2V5CA 2KLQA 2W00A 4WBOA 4ZZCA 3ZMUB 3ZN0B 3RRCA 1Z8UA 1HR0T 1XDPA 2VKJA 3FZKB 1VCSA 4WNKA 2AE9A 3RI5A 3AAIA 4AKRB 1S35A 2BVMA 2NP9A 4A98A 4BA9A 1MIVA 2V1DB 5AQJB 1OXZA 3RQUA 5JRCB 3HR0A 5J0ZA 2W67A 5LJNA 3RQWA 1M7KA 4AQFC 4DUZT 4ILBA 4ERRA 2FJDA 4IHJE 3OTOT 5ADXL 1IZNB 2WDVA 4DR6T 5ETWA 5FY1A 2VQFT 3E22E 3PUAA 2LOSA 1HX1B 5E0OA 3NWIA 3RGLA 5LCYA 4IGUA 3O4XE 3JAFA 1D1BA 4NPPA 2YDSA 1X79A 2LKHA 2SPCA 5AQQB 5HAXA 4PJMA 1HNXT 3AEBA 1O3XA 4UF0B 2YU1A 4O2AE 4EEDA 3OPCA 3PU3A 4JEHB 3SFDA 4NXNT 5AQKB 4LF8T 3N2KE 4IREA 2X68A 2W62A 2KMFA 3FBZA 4X65T 3L3PA 3K8PC 1LKXA 5HEHA 4ZI7E 3X1DA 4K0UA 3AE9A 3VR8A 3AE3A 5CA1E 2BVLA 4A56A 1WYCA 4DV0T 2LEHA 1Y64B 5HXEA 4X1IE 2D9DA 2OA5A 3DJBA 4QXHB 5L3FB 5AQUB 2WWUA 2XAJB 3VR9A 2BS4A 3Q5XA 3QUJA 4PAGA 5JDLA 2WB5A 2VURA 3N9LA 2VKHA 5IYZE 2CCQA 4G63A 1SHZC 5HWYA 5AQTB 3K3OA 4OX9T 3TLSA 1KNPA 3KV9A 2OLTA 1OEDA 4PNIA 1MIYA 3IBPA 4PW8A 1QSDA 2M6IA 2ZLYA 3ZMZB 2KSRA 2RA1A 2V8SV 4B3TT 3AE5A 3ZMSB 4X1YE 2H88A 1YD8G 4QX7B 1MMGA 4BJNA 2J62A 1US7B 3ZC1A 2IW5B 3CX7B 3MACA 2XM2A 3L39A 4IE6A 2B1EA 1D0ZA 4L0RA 1D0XA 4QX8B 3AA6B 2K3WA 4LFAT 5HXCA 4CXWA 5LNKA 3MZKB 2VVSA 2LLYA 4MBQA 4EAHA 3ZEFB 4DR4T 3K1SA 5FMNA 4A5XA 4YJ3E 4ISTA 3U3IA 3JADA 1WYBA 3P4WA 4HFIA 4YT0A 1MNDA 2XAHB 4JI5T 5FP3A 3RX6A 1B7TA 4JI1T 2JIWA 1HX8A 4C90A 3HI2A 2A3DA 3O1JA 4U31A 2DCFA 2KNDA 3K3QC 4IDOA 2DWGA 3H37A 2ZM8A 2MAWA 3PUWF 4O4IE 1SUMB 2VKDA 1WCRA 5LBQB 3PUGA 2FUPA 3OVUA 3N2GE 2BZBA 3EVYA 3OYZA 2K48A 5FVKA 4LF5T 3AEGA 4H63V 5J2UE 3ZLIA 5JDGA 1UK5A 2BDEA 2WAUA 2IUBA 4I55E 2JQHA 3N5LA 3FBLA 3HKEE 3UFEA 2JQQA 4IDQA 4I4TE 5HYAA 5LHIB 1ZEEA 3E08A 5FXZA 2K9AA 4EEBA 4E7ZA 4HKAA 3JC6D 4CXYA 1HF8A 2J47A 3Q5WA 3Q5DA 4GYSA 3L09A 2W2UA 1SE7A 4AIUA 3CQXC 4EZHA 5JR9A 3ZYLA 1DU2A 3KFWX 2D2SA 3RIUC 1WR0A 4AKHA 4IE5A 2V7IA 3AEDA 3PJAA 1XNRT 5L4HA 4DV3T 2V7MA 3UUMA 4QWNB 5L3EB 4AI6A 5HXHA 1KEYA 5FYMA 2D0UA 4LF7T 3FHNA 3AE2A 4YTPA 2BKOA 5JDNA 3NZQA 3NRYA 4ZXLA 3CMLA 1ZP0A 3ZKRA 1UX5A 5LB7B 5HCJA 2W0GA 2YINA 3C51A 2WWVA 4F6RC 3PUXF 3GN5A 4AKLA 2MOZA 5AQOB 4HE8A 4H9SE 3RHWA 5AQGB 3UUNA 3A7MA 1N36T 2XASB 4Z91A 4KMCA 3F2EA 3ESLA 4AISA 3B5MA 1VCTA 4ZI2D 4BAYB 3LG7A 1VRBA 2NTXA 4EYYR 4I50E 3ZT5A 2HPLA 4NUUA 2A2FX 1W09A 4IE7A 1JNZA 5LA6E 3LDQB 3FXDB 4KX6A 1E7PA 3ZPOA 4JLEA 1HS7A 3I0QA 1MMDA 4M1PA 2WZIA 1ZOYA 2CBJA 5JTGA 3C64A 3B13A 4AQGA 4F8HA 3VRBA 1J5WA 2QYWA 2VASA 4WYVA 2CHNA 3CK6A 4AQFA 3P4RA 2WMOA 2VKOA 4LMKA 3IF8B 3LJCA 3VU7H 1NWMX 4ZS2A 4CI2B 1MNEA 4AKGA 5GONE 3KVBA 5CA0E 5LJMA 4YY3T 4L5GA 2X9YA 3ANWA 5LG4A 4P09A 5LMNT 4YSXA 4MALA 3AAAB 2LOPA 1OEDB 2LSJA 4CXXA 3ZCJA 5HEGA 4DV5T 3VRAA 5LHHB 4TZ4C 2L8KA 2D5UA 5KXJA 3GWHA 1M62A 2YU2A 5EK3A 4B6XA 3E0ZA 2K5BB 4Z90A 4EGWA 3H3AA 5L2LA 1HG2A 3SS1A 4HWCA 3P7IA 3LK3B 5TAOA 5C2TA 4COFA 2IAKA 2IDOB 4OK0A 1D0YA 1KF6A 1QUUA 4WBNE 4N78D 2WQYA 3AVSA 2HPJA 4PK6A 2OV9A 3JCFA 4CI1B 2L3LA 5J1GA 4CI3B 4AXPA 5DQWA 2YOEA 3H3MA 4HEAA 3QB5A 1CHUA 1MMNA 2XQ7A 2X51A 3KV6A 2F4VT 4YSZA 4UV9B 1KK7A 3ZMVB 4HWDA 5HEOA 5DQVA 4PK4A 2BKNA 4TWFA 5A1LA 4EOZB 5HEJA 2ACXA 5AQSB 3C98B 5HCMA 3F57A 1BR4A 2ZM2A 3ZSSA 5L4EA 3WAJA 5AQRB 2WY2A 2HHHT 4ZOLE 3UFGA 4IE0A 1HNZT 4DR2T 1FIOA 2WDQA 4QXBB 4MLKA 4JV5T 4H9QC 4K0KT 1XMOT 2DWKA 3CKDA 4O4JE 1MMAA 2JMHA 2MYSA 2LM2A 5KX5E 2M6BA 5AQNB 3A8YC 4ZZBA 5EK4A 3TLVA 1YQ3A 2N2NA 4HWIB 2MTQA 3T1HT 3J7Yq 5FL1A 3CVRA 2NW8A 3JC6C 2BG9B 3AE8A 1YXRA 3RIAA 2QVAA 2C5IT 3CWZB 2CPTA 2JMKA 1N34T 4B3ST 3V5SA 3RPUA 2LHNA 2XAFB 3ZYKA 2FJBA 4AQYT 2JQKA 4PJNA 4GK0E 1YQ4A 3RLFF 4DV1T 3I9YA 1MIWA 1E2AA 1J1JA 3P4QA 4HFBA 1W0BA 2DLRA 4UVBB 3AA0B 4U3CA 5JR9B 2CE7A 4JBWF 3AA1B 5ABFA 3LK42 3DP7A 3UU3A 3B57A 1UX4A 4NUVA 1UURA 3ONLC 4V1Av 4H9NC 3ZC0A 4TV8E 3RYHE 3S4UA 3RYIE 3PUZF 3ZYMA 1EZ3A 4BJMA 2LSKA 3KBTA 2XUEA 4ILAA 2UUCT 4DV6T 2JPFA 4YTNA 4GOUA 4IDZA 2E9XA 4DBQA 4U2YA 3I0OA 3M3ZB 3RF1A 5FY0A 3OKQA 2IHR1 3GN5B 4GK5E 3R84B 3EUHA 3ZMTB 2MBGA 4YXDA 4ZI2C 3ZCIA 4UXNB 5HEUA 4JI3T 4FJOA 2E8IA 3UU4A 2NTYA 2XHEB 5H6QB 3WI3A 3R6NA 4QXCB 4UVAB 3KDSE 1OEDE 4DVDA 4H9RC 4O4HE 3Q9DA 2C0SA 3DTOA 5FXVA 2X9WA 5F5WA 4MHCA 2H3RA 4HTEA 2KZ7B 1HNWT 4CN4A 2UXNB 2V26A 2NWBA 4DR3T 3N2OA 4NXMT 4LMLA 3ONXA 5JVDE 3CQGB 4KHPT 4U33A 3U78A 1G8XA 2KWIB 2IC9A 2M67A 1KFYA 1UGOA 4OYKA 1NENA 4LF9T 3UTKA 3IHRA 4ILCA 4OYJA 4JI4T 2Q9QA 3PTRB 1QLBA 3ANWB 1I6ZA 2I6HA 1OEDC 2BG9A 5FNVE 2UUAT 3NRXA 3MKDA 5LMUT 4PFOA 1IBMT 1LRZA 1WLXA 1U5PA 2CXDA 2RPAA 5LBMA 3NBXX 3EAMA 5CJ5A 3C4ZA 4H9PC 3LSVA 4UELA 3FZFB 3EDVA 3VHLA 5AQFB 5L3DB 5LGTB 2IMLA 2V6YA 1FMVA 2XQ5A 2YEVC 1G73A 5CGMA 3KVAA 4CQIA 3K3NA 4JUYA 4XAXB 2PG8A 3O1HA 2N1GA 4X1KE 2CWOA 3PV0F 3UU6A 3FXEB 3Q2MA 2Z6EA 2WDRA 2Y6XA 2LRKA 2I0MA 3N9NA 1D1AA 4IL4A 4DIDB 3KV4A 2BG9E 4DR5T 3N9MA 2WSSV 2IIUA 2XQ9A 2FJEA 2A72A 4EZ4A 5AQVB 4HWFA 1T8BA 3VKHA 1IJ6A 2LRLA 4DR7T 3G06A 2K24A 1ZV4X 3UT5E 4LFCT 2ES0A 1VOMA 2V6XA 2CRBA 2RP4A 3ETUA 4AKIA 2LT3A 3P4SA 1YKHB 4ISSA 4PJJA 3CQCB 2EHOA 3EABA 3PE0A 4X5TA 1AJ3A 2J1DG 4KP3C 3ETVA 4ANJA 5KDMC 5C3JA 4DUYT 4LFBT 2FBWA 1HCIA 5JREA 2HH7A 3RH3A 2QA7A 3QOFA 2LKGA 1IBLT 3WAKA 2N9DA 3UUXB 4G2AA 4GKJT 2BKPA 5F3JA 5IHYA 4QH4A 3PUQA 5FKYA 4KBMB 5JR9C 4I0UA 2W63A 3QB5K 2X67A 2W66A 3AEEA 2XAGB 4DMWA 1Y01A 2V7KA 2BS2A 2KWHA 2H7OA 3AXJB 4IL9A 5ABFB 1L0VA 3OJAA 4HWHA 2XQ4A 2E5LT 3N9PA 4FI5A 1YKEB 4JI7T 4JI6T 4C91A 2WCAA 3AECA 2HN2A 4CN6A 3P50A 5LGUB 3BQLA 2KXPB 1UCUA 3MJXA 5LYJE 4U72A 2B76A 2E9XB 4UV8B 2CLYB 3SWHA 2Y48B 4YJ2E 5M4YA 2UXBT 1T98A 2E9XD 4TV9E 4OFZA 4JI8T 3UQ4A 1D1CA 4J2CA 4QKNA 3UU5A 5L3CB 3OYXA 4NIQA 1W0AA 2BBHA 3PDYA 4EIWA 2W4XA 5JDHA 2UXCT 2YN6A 3BQIA 3O9XA 2BBJA 5ABGA 3C50A 4CZZB 3AE7A 4MFRA 4TN7B 2ZM0A 4DV7T 5F8PA 3RC3A 2YKSA 5LHGB 1W9RA 3RC8A 2XPKA 5L3BB 2HN1A 3CIRA 2LSYA 2MPKA 5AQPB
chains in the Genus database with same CATH topology
4LF9T 2ZM6T 4JI4T 2E5LT 4DV0T 4X62T 4DR7T 4JI7T 4JI6T 4DR4T 1XMQT 4B3RT 4LF6T 1IBKT 3T1HT 2UUAT 1J5ET 1HR0T 3T1YT 4LFCT 5LMUT 4DV4T 4YHHT 4JI5T 1IBMT 4JI1T 5BR8T 1N34T 4DV2T 4X66T 4JI3T 4B3ST 4B3MT 4DUZT 4AQYT 2F4VT 4OX9T 4DV1T 1N32T 1XNRT 4DR1T 2UXBT 4DV3T 1I94T 3OTOT 4DR6T 4JI8T 4GKKT 4LF7T 2VQFT 4DUYT 4LFBT 5IWAT 4JYAT 4B3TT 1IBLT 4LF5T 2UXDT 1HNWT 1HNXT 2HHHT 4YY3T 4X64T 4GKJT 2UUBT 2UXCT 5LMNT 4DR3T 4NXNT 1HNZT 4DR2T 4LF4T 4LF8T 4NXMT 4JV5T 4DV7T 4DV5T 2VQET 4K0KT 1XMOT 4DR5T 4X65T 1N36T 2UUCT 1FJGT 4JI0T 4KHPT 2UU9T 4DV6T 1XNQT 4LFAT 1N33T 4JI2T
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LF9 T;  2ZM6 T;  4JI4 T;  2E5L T;  4DV0 T;  4X62 T;  4DR7 T;  4JI7 T;  4JI6 T;  4DR4 T;  1XMQ T;  4B3R T;  4LF6 T;  1IBK T;  3T1H T;  2UUA T;  1J5E T;  1HR0 T;  3T1Y T;  4LFC T;  5LMU T;  4DV4 T;  4YHH T;  4JI5 T;  1IBM T;  4JI1 T;  5BR8 T;  1N34 T;  4DV2 T;  4X66 T;  4JI3 T;  4B3S T;  4B3M T;  4DUZ T;  4AQY T;  2F4V T;  4OX9 T;  4DV1 T;  1N32 T;  1XNR T;  4DR1 T;  2UXB T;  4DV3 T;  1I94 T;  3OTO T;  4DR6 T;  4JI8 T;  4GKK T;  4LF7 T;  2VQF T;  4DUY T;  4LFB T;  5IWA T;  4JYA T;  4B3T T;  1IBL T;  4LF5 T;  2UXD T;  1HNW T;  1HNX T;  2HHH T;  4YY3 T;  4X64 T;  4GKJ T;  2UUB T;  2UXC T;  5LMN T;  4DR3 T;  4NXN T;  1HNZ T;  4DR2 T;  4LF4 T;  4LF8 T;  4NXM T;  4JV5 T;  4DV7 T;  4DV5 T;  2VQE T;  4K0K T;  1XMO T;  4DR5 T;  4X65 T;  1N36 T;  2UUC T;  1FJG T;  4JI0 T;  4KHP T;  2UU9 T;  4DV6 T;  1XNQ T;  4LFA T;  1N33 T;  4JI2 T; 
#chains in the Genus database with same CATH topology
 4IDP A;  4X62 T;  3KBU A;  1XDO A;  3GMI A;  4B3R T;  2YK0 A;  3L8R A;  2BS3 A;  4H9O C;  4HFC A;  2V7J A;  4DV4 T;  3HL6 A;  4ZEY A;  1NAF A;  1KNR A;  5BR8 T;  3RYC E;  4HN9 A;  4IIJ E;  4PJL A;  4DBR A;  3BK9 A;  4DV2 T;  3SOL A;  2LM9 A;  1OWA A;  1IAP A;  5LOV E;  2Q9Q B;  2KIN B;  1V9D A;  2XQA A;  1X9B A;  2DNX A;  4HFV A;  2CXL A;  4QH1 A;  4XZC A;  2DHR A;  3FZM B;  3UU8 A;  2XTL A;  2Q9Q D;  4HFD A;  3QNU A;  4UIG A;  2CA5 A;  4U7Y A;  5H6R B;  1BR1 A;  3LBX A;  4HFE A;  5IWA T;  2IC6 A;  3EDU A;  2X0H A;  3MA9 A;  1WRD A;  2QGS A;  3LFM A;  3M65 A;  2WS3 A;  4IDN A;  4YLH A;  4O2B E;  3BQK A;  2A9U A;  4LF4 T;  1WFD A;  2VWA A;  5LGN B;  1Z0P A;  2DL1 A;  4ZHQ E;  5FVL A;  4ILU A;  1U4Q A;  3TKL B;  2V6Y B;  1CUN A;  2WM9 A;  2WBL A;  5CB4 E;  1LVK A;  3AXJ A;  1FJG T;  3ZN1 B;  2LSI A;  5JH7 E;  1T72 A;  4JI2 T;  3AB3 B;  2XY8 B;  5EK2 A;  3NVO A;  3C4W A;  2NW9 A;  5AQI B;  2YDQ A;  1ZKE A;  1IBK T;  2ODU A;  1XZY A;  3ZJ2 A;  2CEA A;  3UUL A;  5ABH A;  4WW0 A;  2AXD S;  2NOX A;  2DI4 A;  3KV5 A;  3UQ7 A;  3OBV E;  5DAB A;  2X0L B;  4EYU A;  1IJ5 A;  3F31 A;  2FJA A;  4U2Z A;  4QHO A;  3LK2 B;  4ZI3 D;  4DR1 T;  3AVR A;  1I94 T;  4L9I A;  2V5D A;  3VKG A;  2LE8 A;  3HKD E;  3Q5E A;  5LP6 E;  2CBI A;  3AE6 A;  3MXZ A;  3P4P A;  3SRZ A;  3P8C D;  2X9X A;  4YSY A;  4WZX A;  5AFU L;  3RIU A;  5JDM A;  2EHO B;  2GK9 A;  3T8O A;  3A5X A;  5HXS A;  1FEW A;  2C5K T;  4X20 E;  2LHR A;  3FB2 A;  2EHO D;  2CWY A;  4IE4 A;  3N9Q A;  4O8S A;  1LVF A;  1WR6 A;  2XAQ B;  3W15 B;  1YW0 A;  2XSB A;  4Q25 A;  2XQ8 A;  4ZS3 A;  4PK5 A;  2CXF A;  2X0Y A;  2PJQ A;  3ONJ A;  2PTF A;  5JRC A;  2V7L A;  2JQ9 A;  3I1A A;  2XJ7 A;  4ADZ A;  4HFH A;  2YDR A;  3QK6 A;  4DO0 A;  5CFB A;  3AA7 B;  2W61 A;  1E1H B;  4HGA A;  2R6G F;  3GA8 A;  2VB6 A;  4LF6 T;  3KIN B;  1J5E T;  2QRX A;  5HXR A;  4CN1 A;  4IT4 A;  2XQ6 A;  3QC9 A;  2CMR A;  5ABE A;  3TLW A;  4UEM A;  2G0U A;  2XQ3 A;  4UVC B;  4UF0 A;  3RYF E;  1NEK A;  5LG3 A;  1N32 T;  3NZP A;  5FY7 A;  5L47 A;  2E5V A;  2VL0 A;  1R8I A;  3O1I A;  2CHO A;  5FL0 A;  2E9X C;  4LMJ A;  3PUS A;  2CLY C;  5BMV E;  4EB6 E;  3PUR A;  3HA4 A;  2UUB T;  1BR0 A;  2VL8 A;  2KT9 A;  4U74 A;  4KUM B;  3I9W A;  3ZJ1 A;  1GQE A;  5EZY E;  1KNZ A;  3AE1 A;  4YHJ A;  3CPZ A;  4KI0 F;  3AE4 A;  2VQE T;  5J2T E;  4TX5 A;  4JI0 T;  3EI0 A;  3EHZ A;  3MK7 C;  4YFS A;  1UUS A;  4GIW A;  2E2A A;  1XWM A;  3RKG A;  1N33 T;  4E7S A;  2WP9 A;  2ZM6 T;  3UUB A;  2ZMA A;  4P0B A;  4O4L E;  1SA0 E;  3T1Y T;  4U7I A;  3RKO A;  4I43 B;  3ZT6 A;  3CX8 B;  4UR9 A;  1JNR A;  2WU5 A;  1H7C A;  4TNW A;  5IUX A;  4X66 T;  3TLT A;  5DJQ C;  2WMN A;  5AQH B;  2XSA A;  3J9X 1;  2ACZ A;  5AQL B;  3PJA J;  3HKC E;  2XM1 A;  2VK9 A;  5FXX A;  4KHZ F;  4YTM A;  4ASK A;  5KMG P;  2WZH A;  4PFP A;  2C5J A;  3RRW A;  3PUV F;  4EV6 A;  2Q9Q C;  2UXD T;  4P0A A;  4DMV A;  4X64 T;  2BG9 C;  2LJL A;  2L9Q A;  5AQM B;  4XBF B;  3AAE B;  4JEU B;  2X9H A;  2J4G A;  2PFV A;  5JDF A;  1BR2 A;  3CX6 B;  4H63 H;  5JDQ A;  2JJ9 A;  1S94 A;  3LBX B;  2UU9 T;  1XNQ T;  5L3G B;  2P9B A;  3PUY F;  4GYR A;  2XZE A;  2NW7 A;  2H89 A;  4P1N A;  3NKZ A;  5FXW A;  3IA3 A;  1XMQ T;  3V5U A;  4TUY E;  3AEA A;  3AEF A;  4TWD A;  3FZH B;  2H7V C;  4YHH T;  1HG5 A;  2D0T A;  1HTJ F;  3D0T A;  2NR4 A;  5HWX A;  2PBI A;  2LSG A;  3N9O A;  2UXX B;  1ZHC A;  3RIF A;  1FMW A;  4B3M T;  2VVN A;  4DND A;  2ODV A;  2WU2 A;  4QH5 A;  4GKK T;  3JAE A;  2Y8D A;  4A97 A;  4ZI3 C;  4JYA T;  5LXT E;  3C4X A;  3ABV A;  3ZT7 A;  5C8Y E;  4EXT A;  2XQY A;  2I59 A;  3HKB E;  2JRK A;  4OHF A;  1T7S A;  1HFA A;  4TWH A;  4TNV A;  5JQG E;  3ZST A;  2X66 A;  3FZL B;  3TLU A;  3SFE A;  3PU8 A;  3IEE A;  2CM0 A;  4Z8X A;  2EHO C;  2V5C A;  2KLQ A;  2W00 A;  4WBO A;  4ZZC A;  3ZMU B;  3ZN0 B;  3RRC A;  1Z8U A;  1HR0 T;  1XDP A;  2VKJ A;  3FZK B;  1VCS A;  4WNK A;  2AE9 A;  3RI5 A;  3AAI A;  4AKR B;  1S35 A;  2BVM A;  2NP9 A;  4A98 A;  4BA9 A;  1MIV A;  2V1D B;  5AQJ B;  1OXZ A;  3RQU A;  5JRC B;  3HR0 A;  5J0Z A;  2W67 A;  5LJN A;  3RQW A;  1M7K A;  4AQF C;  4DUZ T;  4ILB A;  4ERR A;  2FJD A;  4IHJ E;  3OTO T;  5ADX L;  1IZN B;  2WDV A;  4DR6 T;  5ETW A;  5FY1 A;  2VQF T;  3E22 E;  3PUA A;  2LOS A;  1HX1 B;  5E0O A;  3NWI A;  3RGL A;  5LCY A;  4IGU A;  3O4X E;  3JAF A;  1D1B A;  4NPP A;  2YDS A;  1X79 A;  2LKH A;  2SPC A;  5AQQ B;  5HAX A;  4PJM A;  1HNX T;  3AEB A;  1O3X A;  4UF0 B;  2YU1 A;  4O2A E;  4EED A;  3OPC A;  3PU3 A;  4JEH B;  3SFD A;  4NXN T;  5AQK B;  4LF8 T;  3N2K E;  4IRE A;  2X68 A;  2W62 A;  2KMF A;  3FBZ A;  4X65 T;  3L3P A;  3K8P C;  1LKX A;  5HEH A;  4ZI7 E;  3X1D A;  4K0U A;  3AE9 A;  3VR8 A;  3AE3 A;  5CA1 E;  2BVL A;  4A56 A;  1WYC A;  4DV0 T;  2LEH A;  1Y64 B;  5HXE A;  4X1I E;  2D9D A;  2OA5 A;  3DJB A;  4QXH B;  5L3F B;  5AQU B;  2WWU A;  2XAJ B;  3VR9 A;  2BS4 A;  3Q5X A;  3QUJ A;  4PAG A;  5JDL A;  2WB5 A;  2VUR A;  3N9L A;  2VKH A;  5IYZ E;  2CCQ A;  4G63 A;  1SHZ C;  5HWY A;  5AQT B;  3K3O A;  4OX9 T;  3TLS A;  1KNP A;  3KV9 A;  2OLT A;  1OED A;  4PNI A;  1MIY A;  3IBP A;  4PW8 A;  1QSD A;  2M6I A;  2ZLY A;  3ZMZ B;  2KSR A;  2RA1 A;  2V8S V;  4B3T T;  3AE5 A;  3ZMS B;  4X1Y E;  2H88 A;  1YD8 G;  4QX7 B;  1MMG A;  4BJN A;  2J62 A;  1US7 B;  3ZC1 A;  2IW5 B;  3CX7 B;  3MAC A;  2XM2 A;  3L39 A;  4IE6 A;  2B1E A;  1D0Z A;  4L0R A;  1D0X A;  4QX8 B;  3AA6 B;  2K3W A;  4LFA T;  5HXC A;  4CXW A;  5LNK A;  3MZK B;  2VVS A;  2LLY A;  4MBQ A;  4EAH A;  3ZEF B;  4DR4 T;  3K1S A;  5FMN A;  4A5X A;  4YJ3 E;  4IST A;  3U3I A;  3JAD A;  1WYB A;  3P4W A;  4HFI A;  4YT0 A;  1MND A;  2XAH B;  4JI5 T;  5FP3 A;  3RX6 A;  1B7T A;  4JI1 T;  2JIW A;  1HX8 A;  4C90 A;  3HI2 A;  2A3D A;  3O1J A;  4U31 A;  2DCF A;  2KND A;  3K3Q C;  4IDO A;  2DWG A;  3H37 A;  2ZM8 A;  2MAW A;  3PUW F;  4O4I E;  1SUM B;  2VKD A;  1WCR A;  5LBQ B;  3PUG A;  2FUP A;  3OVU A;  3N2G E;  2BZB A;  3EVY A;  3OYZ A;  2K48 A;  5FVK A;  4LF5 T;  3AEG A;  4H63 V;  5J2U E;  3ZLI A;  5JDG A;  1UK5 A;  2BDE A;  2WAU A;  2IUB A;  4I55 E;  2JQH A;  3N5L A;  3FBL A;  3HKE E;  3UFE A;  2JQQ A;  4IDQ A;  4I4T E;  5HYA A;  5LHI B;  1ZEE A;  3E08 A;  5FXZ A;  2K9A A;  4EEB A;  4E7Z A;  4HKA A;  3JC6 D;  4CXY A;  1HF8 A;  2J47 A;  3Q5W A;  3Q5D A;  4GYS A;  3L09 A;  2W2U A;  1SE7 A;  4AIU A;  3CQX C;  4EZH A;  5JR9 A;  3ZYL A;  1DU2 A;  3KFW X;  2D2S A;  3RIU C;  1WR0 A;  4AKH A;  4IE5 A;  2V7I A;  3AED A;  3PJA A;  1XNR T;  5L4H A;  4DV3 T;  2V7M A;  3UUM A;  4QWN B;  5L3E B;  4AI6 A;  5HXH A;  1KEY A;  5FYM A;  2D0U A;  4LF7 T;  3FHN A;  3AE2 A;  4YTP A;  2BKO A;  5JDN A;  3NZQ A;  3NRY A;  4ZXL A;  3CML A;  1ZP0 A;  3ZKR A;  1UX5 A;  5LB7 B;  5HCJ A;  2W0G A;  2YIN A;  3C51 A;  2WWV A;  4F6R C;  3PUX F;  3GN5 A;  4AKL A;  2MOZ A;  5AQO B;  4HE8 A;  4H9S E;  3RHW A;  5AQG B;  3UUN A;  3A7M A;  1N36 T;  2XAS B;  4Z91 A;  4KMC A;  3F2E A;  3ESL A;  4AIS A;  3B5M A;  1VCT A;  4ZI2 D;  4BAY B;  3LG7 A;  1VRB A;  2NTX A;  4EYY R;  4I50 E;  3ZT5 A;  2HPL A;  4NUU A;  2A2F X;  1W09 A;  4IE7 A;  1JNZ A;  5LA6 E;  3LDQ B;  3FXD B;  4KX6 A;  1E7P A;  3ZPO A;  4JLE A;  1HS7 A;  3I0Q A;  1MMD A;  4M1P A;  2WZI A;  1ZOY A;  2CBJ A;  5JTG A;  3C64 A;  3B13 A;  4AQG A;  4F8H A;  3VRB A;  1J5W A;  2QYW A;  2VAS A;  4WYV A;  2CHN A;  3CK6 A;  4AQF A;  3P4R A;  2WMO A;  2VKO A;  4LMK A;  3IF8 B;  3LJC A;  3VU7 H;  1NWM X;  4ZS2 A;  4CI2 B;  1MNE A;  4AKG A;  5GON E;  3KVB A;  5CA0 E;  5LJM A;  4YY3 T;  4L5G A;  2X9Y A;  3ANW A;  5LG4 A;  4P09 A;  5LMN T;  4YSX A;  4MAL A;  3AAA B;  2LOP A;  1OED B;  2LSJ A;  4CXX A;  3ZCJ A;  5HEG A;  4DV5 T;  3VRA A;  5LHH B;  4TZ4 C;  2L8K A;  2D5U A;  5KXJ A;  3GWH A;  1M62 A;  2YU2 A;  5EK3 A;  4B6X A;  3E0Z A;  2K5B B;  4Z90 A;  4EGW A;  3H3A A;  5L2L A;  1HG2 A;  3SS1 A;  4HWC A;  3P7I A;  3LK3 B;  5TAO A;  5C2T A;  4COF A;  2IAK A;  2IDO B;  4OK0 A;  1D0Y A;  1KF6 A;  1QUU A;  4WBN E;  4N78 D;  2WQY A;  3AVS A;  2HPJ A;  4PK6 A;  2OV9 A;  3JCF A;  4CI1 B;  2L3L A;  5J1G A;  4CI3 B;  4AXP A;  5DQW A;  2YOE A;  3H3M A;  4HEA A;  3QB5 A;  1CHU A;  1MMN A;  2XQ7 A;  2X51 A;  3KV6 A;  2F4V T;  4YSZ A;  4UV9 B;  1KK7 A;  3ZMV B;  4HWD A;  5HEO A;  5DQV A;  4PK4 A;  2BKN A;  4TWF A;  5A1L A;  4EOZ B;  5HEJ A;  2ACX A;  5AQS B;  3C98 B;  5HCM A;  3F57 A;  1BR4 A;  2ZM2 A;  3ZSS A;  5L4E A;  3WAJ A;  5AQR B;  2WY2 A;  2HHH T;  4ZOL E;  3UFG A;  4IE0 A;  1HNZ T;  4DR2 T;  1FIO A;  2WDQ A;  4QXB B;  4MLK A;  4JV5 T;  4H9Q C;  4K0K T;  1XMO T;  2DWK A;  3CKD A;  4O4J E;  1MMA A;  2JMH A;  2MYS A;  2LM2 A;  5KX5 E;  2M6B A;  5AQN B;  3A8Y C;  4ZZB A;  5EK4 A;  3TLV A;  1YQ3 A;  2N2N A;  4HWI B;  2MTQ A;  3T1H T;  3J7Y q;  5FL1 A;  3CVR A;  2NW8 A;  3JC6 C;  2BG9 B;  3AE8 A;  1YXR A;  3RIA A;  2QVA A;  2C5I T;  3CWZ B;  2CPT A;  2JMK A;  1N34 T;  4B3S T;  3V5S A;  3RPU A;  2LHN A;  2XAF B;  3ZYK A;  2FJB A;  4AQY T;  2JQK A;  4PJN A;  4GK0 E;  1YQ4 A;  3RLF F;  4DV1 T;  3I9Y A;  1MIW A;  1E2A A;  1J1J A;  3P4Q A;  4HFB A;  1W0B A;  2DLR A;  4UVB B;  3AA0 B;  4U3C A;  5JR9 B;  2CE7 A;  4JBW F;  3AA1 B;  5ABF A;  3LK4 2;  3DP7 A;  3UU3 A;  3B57 A;  1UX4 A;  4NUV A;  1UUR A;  3ONL C;  4V1A v;  4H9N C;  3ZC0 A;  4TV8 E;  3RYH E;  3S4U A;  3RYI E;  3PUZ F;  3ZYM A;  1EZ3 A;  4BJM A;  2LSK A;  3KBT A;  2XUE A;  4ILA A;  2UUC T;  4DV6 T;  2JPF A;  4YTN A;  4GOU A;  4IDZ A;  2E9X A;  4DBQ A;  4U2Y A;  3I0O A;  3M3Z B;  3RF1 A;  5FY0 A;  3OKQ A;  2IHR 1;  3GN5 B;  4GK5 E;  3R84 B;  3EUH A;  3ZMT B;  2MBG A;  4YXD A;  4ZI2 C;  3ZCI A;  4UXN B;  5HEU A;  4JI3 T;  4FJO A;  2E8I A;  3UU4 A;  2NTY A;  2XHE B;  5H6Q B;  3WI3 A;  3R6N A;  4QXC B;  4UVA B;  3KDS E;  1OED E;  4DVD A;  4H9R C;  4O4H E;  3Q9D A;  2C0S A;  3DTO A;  5FXV A;  2X9W A;  5F5W A;  4MHC A;  2H3R A;  4HTE A;  2KZ7 B;  1HNW T;  4CN4 A;  2UXN B;  2V26 A;  2NWB A;  4DR3 T;  3N2O A;  4NXM T;  4LML A;  3ONX A;  5JVD E;  3CQG B;  4KHP T;  4U33 A;  3U78 A;  1G8X A;  2KWI B;  2IC9 A;  2M67 A;  1KFY A;  1UGO A;  4OYK A;  1NEN A;  4LF9 T;  3UTK A;  3IHR A;  4ILC A;  4OYJ A;  4JI4 T;  2Q9Q A;  3PTR B;  1QLB A;  3ANW B;  1I6Z A;  2I6H A;  1OED C;  2BG9 A;  5FNV E;  2UUA T;  3NRX A;  3MKD A;  5LMU T;  4PFO A;  1IBM T;  1LRZ A;  1WLX A;  1U5P A;  2CXD A;  2RPA A;  5LBM A;  3NBX X;  3EAM A;  5CJ5 A;  3C4Z A;  4H9P C;  3LSV A;  4UEL A;  3FZF B;  3EDV A;  3VHL A;  5AQF B;  5L3D B;  5LGT B;  2IML A;  2V6Y A;  1FMV A;  2XQ5 A;  2YEV C;  1G73 A;  5CGM A;  3KVA A;  4CQI A;  3K3N A;  4JUY A;  4XAX B;  2PG8 A;  3O1H A;  2N1G A;  4X1K E;  2CWO A;  3PV0 F;  3UU6 A;  3FXE B;  3Q2M A;  2Z6E A;  2WDR A;  2Y6X A;  2LRK A;  2I0M A;  3N9N A;  1D1A A;  4IL4 A;  4DID B;  3KV4 A;  2BG9 E;  4DR5 T;  3N9M A;  2WSS V;  2IIU A;  2XQ9 A;  2FJE A;  2A72 A;  4EZ4 A;  5AQV B;  4HWF A;  1T8B A;  3VKH A;  1IJ6 A;  2LRL A;  4DR7 T;  3G06 A;  2K24 A;  1ZV4 X;  3UT5 E;  4LFC T;  2ES0 A;  1VOM A;  2V6X A;  2CRB A;  2RP4 A;  3ETU A;  4AKI A;  2LT3 A;  3P4S A;  1YKH B;  4ISS A;  4PJJ A;  3CQC B;  2EHO A;  3EAB A;  3PE0 A;  4X5T A;  1AJ3 A;  2J1D G;  4KP3 C;  3ETV A;  4ANJ A;  5KDM C;  5C3J A;  4DUY T;  4LFB T;  2FBW A;  1HCI A;  5JRE A;  2HH7 A;  3RH3 A;  2QA7 A;  3QOF A;  2LKG A;  1IBL T;  3WAK A;  2N9D A;  3UUX B;  4G2A A;  4GKJ T;  2BKP A;  5F3J A;  5IHY A;  4QH4 A;  3PUQ A;  5FKY A;  4KBM B;  5JR9 C;  4I0U A;  2W63 A;  3QB5 K;  2X67 A;  2W66 A;  3AEE A;  2XAG B;  4DMW A;  1Y01 A;  2V7K A;  2BS2 A;  2KWH A;  2H7O A;  3AXJ B;  4IL9 A;  5ABF B;  1L0V A;  3OJA A;  4HWH A;  2XQ4 A;  2E5L T;  3N9P A;  4FI5 A;  1YKE B;  4JI7 T;  4JI6 T;  4C91 A;  2WCA A;  3AEC A;  2HN2 A;  4CN6 A;  3P50 A;  5LGU B;  3BQL A;  2KXP B;  1UCU A;  3MJX A;  5LYJ E;  4U72 A;  2B76 A;  2E9X B;  4UV8 B;  2CLY B;  3SWH A;  2Y48 B;  4YJ2 E;  5M4Y A;  2UXB T;  1T98 A;  2E9X D;  4TV9 E;  4OFZ A;  4JI8 T;  3UQ4 A;  1D1C A;  4J2C A;  4QKN A;  3UU5 A;  5L3C B;  3OYX A;  4NIQ A;  1W0A A;  2BBH A;  3PDY A;  4EIW A;  2W4X A;  5JDH A;  2UXC T;  2YN6 A;  3BQI A;  3O9X A;  2BBJ A;  5ABG A;  3C50 A;  4CZZ B;  3AE7 A;  4MFR A;  4TN7 B;  2ZM0 A;  4DV7 T;  5F8P A;  3RC3 A;  2YKS A;  5LHG B;  1W9R A;  3RC8 A;  2XPK A;  5L3B B;  2HN1 A;  3CIR A;  2LSY A;  2MPK A;  5AQP B; 
#chains in the Genus database with same CATH homology
 4LF9 T;  2ZM6 T;  4JI4 T;  2E5L T;  4DV0 T;  4X62 T;  4DR7 T;  4JI7 T;  4JI6 T;  4DR4 T;  1XMQ T;  4B3R T;  4LF6 T;  1IBK T;  3T1H T;  2UUA T;  1J5E T;  1HR0 T;  3T1Y T;  4LFC T;  5LMU T;  4DV4 T;  4YHH T;  4JI5 T;  1IBM T;  4JI1 T;  5BR8 T;  1N34 T;  4DV2 T;  4X66 T;  4JI3 T;  4B3S T;  4B3M T;  4DUZ T;  4AQY T;  2F4V T;  4OX9 T;  4DV1 T;  1N32 T;  1XNR T;  4DR1 T;  2UXB T;  4DV3 T;  1I94 T;  3OTO T;  4DR6 T;  4JI8 T;  4GKK T;  4LF7 T;  2VQF T;  4DUY T;  4LFB T;  5IWA T;  4JYA T;  4B3T T;  1IBL T;  4LF5 T;  2UXD T;  1HNW T;  1HNX T;  2HHH T;  4YY3 T;  4X64 T;  4GKJ T;  2UUB T;  2UXC T;  5LMN T;  4DR3 T;  4NXN T;  1HNZ T;  4DR2 T;  4LF4 T;  4LF8 T;  4NXM T;  4JV5 T;  4DV7 T;  4DV5 T;  2VQE T;  4K0K T;  1XMO T;  4DR5 T;  4X65 T;  1N36 T;  2UUC T;  1FJG T;  4JI0 T;  4KHP T;  2UU9 T;  4DV6 T;  1XNQ T;  4LFA T;  1N33 T;  4JI2 T; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...