4YHKH

Reversal agent for dabigatran
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
222
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGETNPRNGGTTYNEKFKGKATMTRDTSTSTAYMELSSLRSEDTAVYYCTIGTSGYDYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided residence time optimization of a dabigatran reversal agent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords aDabi-Fab2a heavy chain
total genus 46
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhkH01
3FAXA 4F80A 1WZMA 2ICEB 3D0VA 5F9WC 1S3KL 1U8NA 2AJVH 4Z76B 1TXKA 25C8H 4UIMA 5TDOB 1BQLH 4U1SB 1CLOH 4L1DA 4RGMB 5L9DL 5DUBA 1N64L 4JB9L 3KXFD 1F4HA 4XAKE 3NCBB 5B22A 3ZYZA 3QUYC 5C0CD 3OKLB 3I6GB 3TO4C 3AMLA 2DYPD 3NCEB 4YIQB 2R56H 3O2VL 4LHUD 4OGAC 3P4MA 4L3AA 2QHLA 5E2UL 5TGBA 2X4RB 3LEYH 1HXYB 1K2DB 2EDEA 3T0ED 5J11C 3CLEH 3QEQD 3ALWA 5D7LD 1UB5B 5IEKB 3JWNC 2OTWA 1EXUA 2BVOA 4ZS7L 4F33A 3DX6B 4I4WB 4LARL 1Q0XH 1DQJA 5GISH 1IJ9A 4JANA 3L1OL 3THML 1P7HL 3OZ9L 1A3LL 2XKSA 4O2FB 3ARGA 2D7QA 2B0SH 4KK9C 1OGAA 1W72A 3VXUD 1EVUA 3FN0H 4RMUA 5D2NB 1MY5A 4MNQA 3D3VB 3ZTNL 3ARFC 1KCVH 4JZJA 1DVFD 4TSBL 3M17B 3OV6A 3WE6B 1KEGH 1MY7A 4LAQH 3GO1L 1U8KB 2DIJA 4P59H 5H37H 3ULVH 1I1YB 3GSNB 2BNRB 4OM1H 5DA0B 1BQSA 1O7VA 4M93B 2APTA 2GJ6E 4NNPL 1SMOA 2NR6D 5E2VH 3S35L 4AZ8A 4RFEB 1UT9A 3ESUF 3MA9H 3OHXB 3RUGF 1HQRB 4ZO9A 1J05A 5D93C 1G7PB 2EEDA 3TT3H 5E5MA 3PDGA 4X4XA 1HKLL 3NIDE 3AY4A 4KPHH 3DHJA 3U6RA 4HQQH 1ZHBA 2A74A 5HHMD 2XY1A 1A7QL 3CXHJ 3BP7B 3VGBA 3MOQA 1CE1H 1H8NA 5MEPB 1QOKA 4Z7VE 3HC3L 2F54E 2ZCLH 1I7TB 3OQ3B 4MA3A 1NLDH 2DBJA 4IOSD 1IGIL 2WWMD 1Z9OA 2F15A 1PJ9A 3T65B 2BVQA 4JFHD 1JUFA 1FNFA 1NFDF 2PCPA 3DYOA 2DJSA 4OZGF 4F58L 1MCKA 4G7VH 4CMHC 2XNAA 1MAMH 1MNUL 2GSIA 4ZFZA 4I3SL 4HUKB 1X5JA 5JA8B 1HE7A 2JJWA 2BY1A 2APVA 3KR3H 4H0IA 1OF2B 4QTHA 4YNYB 4YBHA 1UM4H 4LDOB 1A14H 3TNMB 1XAUA 1F58H 2GITB 1EX0A 4GG8A 4MD4B 5I8EB 2XTLA 4CVXB 2EKJA 4PJGB 3DV6A 1FFOA 3A6BH 3ZDYF 4XT1C 4JFDE 4MCZB 4OV6F 1U93A 1OT2A 4BK4A 4NT6B 2QV2A 1RIUL 2HVKB 4QCIB 4P2QA 4BKLA 4WCYH 3O2WL 3MJ7A 3U46A 1F3DH 3QXDA 2X5PA 4K94C 5HGBA 5JW3L 3BWUC 3KDMA 5E6IB 2C3VB 1RJZA 4G9FD 4XH2B 4G6JL 2D0HA 2FH8A 3EOTH 1XGUA 3IFPB 1MREH 1MHEB 4XB8A 5CINH 1H5BA 4XCCL 3IXTB 1MIMH 1A4KA 1NDMB 2ZSWB 1T5XA 3CXHK 1FSKC 4Y5YA 5MHSE 3GZKA 1ZK9A 2NXZD 3E6HB 3RTQD 1XF2A 1WAAF 2VLRB 5FO9A 5K9KA 5DSCB 4GO6B 5GRZA 2EO9A 4NHUB 1AGEB 4IS6B 3MO1A 4GMTL 5DI8B 3D18A 2Q8AH 3UYOD 1YEIH 1U8KA 4PJ7F 4CMMA 3DRQA 3AUVA 4QHLA 5CSBA 4BFBD 1FVEA 2ESVE 1QLEH 1S9VB 3VW3H 2V7NA 4KJYB 5EU5B 4XRCB 3AFLA 4BSVA 3VFNA 3MCLL 5FV1L 3CVHL 2C26A 2HG5B 1MRFL 5L7XH 1WUNT 3L5HA 1ZS8B 2B39A 4IIQB 1OAXH 2ATPB 4W6YB 4CKVX 5HHXH 4C55A 5ABDE 1WFTA 1QRNA 1A1NB 5HGAA 1AKJB 3WS3A 2EDHA 4JHBA 3EYVA 5HHOD 3DMMA 4KTDL 4JFFA 4X6EA 5CKGA 5EOCJ 4U6HA 5FHAH 4H1LA 1TIUA 4ACPA 1MF2L 2CIIB 3SHSA 4QT5A 3ZO0A 1EZVX 3STLA 3GK8H 2MMXA 5JORB 3N85H 1ZLVH 2XN9A 2VZSA 1GRWA 2BJMH 4JJ5B 2C7UA 2VABA 2JELH 1NCTA 3NA9H 3LS5H 5BO1L 1IGYB 4M9OA 4U6VL 1Q1JL 2NY4B 5GGTH 3CXDH 1B88A 1WC7B 1IQWL 4PGDB 3H3BC 3QEHA 4YHLL 1CL7L 1X5YA 3QBTB 3CDGB 2QLVB 2E5EA 3NCJL 1NGWA 3MNVB 4EN3D 43C9A 3T0WA 1EO7A 4PJEA 1MFAH 4HV8A 3RI5F 1IC4H 1E6OL 2R0ZH 5E4IA 1CD8A 4YX2H 4NZRL 2UYLB 5IB3A 4PRNA 4HUXB 2YMXH 1JGVL 1H9VA 1JNHB 3Q5TA 1K9TA 2FEDD 1LD9A 3I84A 4HLZH 5HYQB 5TF0A 5K59E 5K33A 4QHUA 1LE5A 3MLVL 4PV9A 4JRYD 3WNOA 3OB8A 1YMME 4AMKL 2OZ4L 4OI9A 1S7WA 5KAQF 1A47A 2EH7H 2IAMC 1R6VA 1X3DA 3VH8A 3S98A 2W0PA 3JSSA 3LDBC 4QWWC 3SDYL 4Q6IC 4OZ4B 3OJ2C 5CEZL 5IQ7H 2NX5A 4OF6A 1A6WL 2P46B 1QVOA 1VENA 3HZKB 4NQCB 1V3JA 2FLBT 1D9KA 3O3AB 5JW4N 1YMMA 5ISZB 5KSAD 1Q0YH 5ALCH 1EO8H 1N5AA 3TYGH 1DBAH 3IRZA 5I9QC 1WBXB 4NUJA 5SX4I 3O0RL 5BOPA 2VLKE 4I2XE 4D94A 1IAIM 2E7HA 1E4KC 3S5LB 1QFUL 2ADGB 4PLKC 3DX8A 1Z2KA 3VFRA 3PV6A 4R9HA 3NTCL 3MRDB 4G7YL 1T4KB 2R1XB 4WU5B 1YECH 1AO7E 1DN0A 4GKSA 3MUGA 5D72H 5HYSA 5JNYA 4FQIH 4YGAB 5SWZA 1L7TH 5CP3H 1KYOK 4TVSa 1DL7L 4CNIB 3FQWB 1CDUA 3O4OB 2YS4A 5C6PB 1I75A 3OAYH 3DVFA 3V4UH 2X4NB 3QFJB 2ORBL 5DJ2B 3OR7B 4P48A 4UINL 4XCNA 4M5ZL 2DTMH 4TUKL 3ARFD 4MLIA 4D0CB 5C0JB 4NO3B 2H8PB 1KJMA 5A2FA 3OKDB 2B1AL 3CFKB 1DANU 1WIPA 1IGJB 2V9TA 3QIUD 4YHKL 3W2DH 5DVLA 3ZDXE 1MREL 2CO7B 4HDIB 1RU9H 1BQHB 3SDXA 3VFOB 5FA3A 4LCWD 4LVEA 2GJ6B 4N0UB 2W9DL 4XZUB 5ISZD 1KEML 4DK6A 1J7VR 4CRPA 1IM9A 1CVSC 4KRNA 4FZEH 3DVNA 3V2AR 4YDVA 1FH5H 4HEPG 4WDIA 4MJIE 4PJIB 3RWHA 2X4TB 5SWSB 3MR9B 4YHNA 1V05A 3RUGB 5K93A 2R2EA 1ZT4A 3TESA 1BQLL 1IAKB 4NSKB 1CG9B 3CFJA 4Y5YB 1S9KC 1H3VA 2E6PA 4PJDF 4OUOA 2FYYA 4MD5B 5JDSB 5CBEA 3NGBC 4CADA 4PTTB 5T1KA 1KG0A 2MTPA 5HI3D 4KQ4L 3ZZ1A 5ERWB 5AZ2H 1M7IA 2JCCF 3CVIH 4PP1D 4AENA 1ZHKA 3Q48A 4XNYL 2AK4D 4Y1AD 2AJUL 2ICWI 3BP7A 5CKAA 4HKXB 5JIIA 4O02H 1BX2B 1FFQA 4M61A 3STLB 1B90A 4Z7OE 5AWNL 4DVBB 1YECL 1ZOXA 1TJHH 5C0AB 1YPZF 3T4AA 1OAKL 2J7LA 2VWEC 2VLLB 4JZNA 4HFUH 3HE6A 4V1DE 3QCUH 4LGRB 1TVHA 1GXEA 4WI3A 1G7MA 4U6YA 3ILQC 3IDNA 4L4TE 3DXAA 3AC0A 4OCWH 1JYWA 3MLPA 1ITBB 3UJIH 3BDYL 4H5SB 3TO4A 4X98B 4TUKH 4NQEE 3BP6B 5HXMA 4BH8A 3LD8C 2IPKB 2YPVH 4PTUA 4YO0A 2C7UB 3HE7C 4K9EH 4H26A 3GHEL 5E6IC 3VFMA 1J1OH 4NO0B 4U1GB 4MJIA 4HWZB 4ZPVB 3ARXA 4FQXB 1VACA 1JGDB 3DYMA 3DURA 1IBGL 2HKHL 5FAAA 1GHFH 1KTRL 4TOYH 1BM3H 4ODHL 1IAIL 3LS4L 3WN5A 5DS8A 4OZ4A 1VEPA 2HFEB 2EE6A 1JGVH 1XGRA 4HIXL 4ISVA 1W72H 3ARGD 4MLSA 3CMGA 3MRLA 5IFJA 2A74B 3SN6N 3KPRB 4XBGB 1E27A 1J0ZA 4HIJB 3H3PL 1S5IH 2IH3B 4HLZG 4P5KB 5DQDH 2WNGA 2XTJC 1FO0H 3SOBL 3H7BA 5EU4A 4HZAA 1H0DA 3S4SG 2ATKB 5E8OA 1X4XA 3GIZL 3IDMB 3CVIL 1DN0B 1RK0B 1OP9A 2VLKD 3RKDC 1SBSL 4J3VA 2ITCB 3DTXB 5DFWH 4G9FB 4PIRF 1AC0A 4ZTOL 1BAFH 4UOW0 1S9VA 4KJWC 3V6BR 2AKRB 4F7TA 5EOQH 2D4FA 4B0MM 1QO3B 3QPXH 1D9KD 3MXVH 5FUOL 5FECB 2F5AH 2R69L 3U0TA 3MCKA 4D3CH 3LIZL 3MLSH 3S37L 4I3RL 4PJ8B 5DK2A 1E6OH 2R0ZL 5FV2A 4RNRB 4G6FD 4GRLD 4C58B 2V17L 1FV1A 1M7XA 4XVTL 1CXHA 5HGDA 3BUYB 3DMMB 5IF0B 5JHDA 4KK5D 4LVNC 1IGCL 4R7NB 3VI4E 1JIBA 3I3DA 4W70A 4UTBH 4UT6L 2DMCA 2IWGA 2KKQA 5MEPA 1QP1A 1YN7A 1LGVA 5C0CE 3WNMA 5J57B 5KVGL 2VDOH 1UVQA 4XAKD 5HHVH 1DQMH 1JHTA 4OD1H 1RJZB 4MQXD 3EBAA 5E56A 1Q72L 1EEYB 4NCDA 3VGHA 1UJTA 2IG2H 1AO7A 2Z91B 3SDDD 1TJIH 4WW2A 1I1AB 5IM7B 2KZWA 1NCAH 1MFEH 4FXGA 4XXDA 1UH4A 3G5XA 1F4XH 1NBYA 4Y5XA 1O0VA 5GGSB 1FYHB 3PABB 4YX2L 3NAAH 1D3CA 5FYLH 5IB4B 3LN9A 4JVWA 4KHXL 3HB3D 4RDQF 4JFQB 4PJCA 2F19H 5DDHB 1NANH 3KLAA 4KI1A 4QRRE 5HHMB 3MXWL 1CGSL 4OM0H 4IOFC 3BGAA 1KGCE 5DK2B 3MJ9H 1EEYA 4MAYD 4UT9L 4ZO8A 3IKCA 5SWZD 1IZKA 1I8KA 1ZANH 4J8RB 1V3MA 2IAMD 3S97C 3FQTA 5I76B 1NBVH 2E9WA 4KJPC 2DQHL 3O4OC 4P2QB 2YWYA 1TZHA 2GK0A 4MB4A 1WT5A 2X09A 1G9EA 4LNRB 4JZJC 3PHQA 5HYJA 3D85A 4M3JA 3RWDA 4MYWB 2YD8A 1Z9SA 5MHSD 4BQBA 3G6JE 5DUML 3TJEH 3HRZA 2GFBA 1YEDB 2M26A 4NP4L 2EIBA 2OMBA 1I9JH 4GKZB 5ID0B 1QG3A 3GBMH 5ESQA 4MA8L 5L88H 3PF2A 3R8BB 1BP3B 3MLWL 1F13A 12E8H 2WUBH 3WLBB 1CR9H 1HHKB 1VGEH 3RVVC 1OARH 5LJYH 5JXEA 1CZ8L 3WDJA 4FRWA 1FDLH 5DJCA 2F9BT 5DVOA 4RIRB 4L8SC 5TE4L 3PWUA 1EHXA 5SWQA 2WBJC 5I2IA 3QXVA 5C0FA 2JJTC 3C5JA 2VDOL 1OP5H 2XRAL 4P2RD 5KTEH 4Y2DB 2WP3T 4WHTB 3ZKND 1EA9C 1NUDA 3O41B 4HFWB 3LPGA 4M4RA 3MJ8B 2X4NA 3QFJA 1Q38A 3MRCB 3TEUA 5CINL 5IIEA 1VGEL 4R3SB 2PW1B 3F5WA 3H8NA 4QRQA 5CD3B 3S9DB 3AM8C 1OTSC 1UB6B 4HWNA 2CH8A 3MRNA 2AABL 2K9UA 3O3DA 3FO9A 3H0TA 3ARTA 5D7KE 5A3ID 3F7YA 3EO1A 4G8GB 5KANG 5D93B 1TQBB 4WUUA 5CILL 4U7MA 4QRSA 1X5XA 4FOMA 4UDTB 5EPMB 5KZCD 1Q9WB 3CSBA 5IW1B 1WBYB 1NLDL 4X99A 1KTDA 4RBPK 3C60B 3L3DA 1CVRA 5JW4Q 1T7ZA 2VQUA 3CH1A 3VCLB 4JQIL 1QEWB 4X6FB 5EORL 1NBZA 4GAFB 5IK3A 2Q6WB 1NJ9A 2ZUWA 3WHE0 5T5NF 4GW4A 3C8KB 1CXEA 1IGJA 2HTKC 3TVMD 4PGEA 1V3KA 5ICZB 1J8HD 5L2JA 5T3XL 3UDWC 2JJSA 3MBEB 3TT1L 4EDXA 1HEZA 2BVUA 2EYRA 2VXTL 2Z91A 3GKWL 3LKNB 4K8RL 2BVTA 5LAXB 2Y07L 4WI8A 1RK1B 1AQKL 4WJ5B 1LO5A 2P8LA 3V79C 1G6RH 5IHUH 4PJBB 4PUBH 3QHFH 5BJTB 4WI9A 4J4PD 1AXSB 4YR6B 3X3FH 2F5AL 1RZIA 3B9VA 3KJ4B 3UO1H 3OX8A 2HJKA 2P5WA 2I60H 3MRKA 5D1ZA 5FHBH 2B4CL 4H25B 1OTSD 2PTTB 4U0RC 2EXWD 2YOCA 5D1XD 4P59L 5J4MA 1WV7T 2D7TH 1J9CT 1DUZA 5J1AB 2CXGA 1VACB 4L8BB 4P9ML 4QF1A 1OHQA 3QQ4B 1LEKA 1S7TA 4BZYA 1I8KB 2GJJA 3PWJA 1HXMA 1JMZA 5CJ8A 3UCRA 3O6FC 4HC1A 4HJGB 3GSQB 1MFCL 3AVEA 4HS6B 3ES6A 3VRIB 3T2NH 2YPLD 2J8UF 5C0DA 4F7PB 3KLAB 3LAFA 3VDAA 2Z35B 2EDFA 4NN7C 5I73B 5GXBB 5BQ7A 2AJSL 4WO4B 4XAWL 1CXIA 1FYTB 2GT9B 1KTKE 4DKFH 3HUJF 3S88L 4WDIB 3PGFL 2D0GA 1MVFA 3EIFA 4H20L 4WO4C 4JHWL 2YUVA 1LE9A 4LSVH 4HFUL 2CIKB 1V7NL 4FP8L 4LKCA 3PP3H 2VE6B 3BZ4A 4PJ7B 1D5XB 1A9BB 5F1IA 3HAEA 4KH2A 2PYEE 1BGXL 4AQ1B 3VWKA 4PJEF 1B0WA 3UTQB 3DX9B 1V7NH 2FJHA 5SX5H 1WFNA 1NCNA 2F53D 2HH0L 3WIIH 2FJFB 5D7LA 1JF6A 2WQ8A 4IJ3B 1G7IB 3H9SB 3EYOA 5JW4R 4WUKH 4Y16B 8CGTA 3C6LA 2R0KH 4K9EL 1TLKA 1IKNC 3JWOC 3QH3B 5KJRH 2DM7A 4OCSH 2FATH 1LDSA 1BIIA 1Q0XL 2PXYD 2NY3C 1UEYA 2CUMA 2NY1B 4F7CA 1JHKH 4KI5E 4UILH 2X4RA 1KT2A 5EZJA 3QG6B 3QYCA 4DKEH 1K3ZA 4JO4H 2XT1B 5A3IC 3CX5K 3OXRB 4JG1L 3V4PL 3MRIA 4P5TA 3DX9A 4UU9B 3VFWA 4HPYH 4JO4L 4ZUWA 1QBLL 2VKWA 4MMZC 1EUUA 5J3HC 1KIQA 4L8SA 4NJ9H 1JWUB 1IBGH 2Z8VC 1WCQA 4Z76A 5C0ND 4G6FB 1Q9LB 4PLKD 3RVWD 1SJXA 2AJVL 4ONGL 4PJ7A 4PS4L 2BK8A 2D0FA 4JEGB 5C2BL 4X6CF 4GKOA 4R4FL 5FO7A 3K8MA 1RD6A 1ETZB 2DF3A 2X4SA 4QOKE 3EYVB 1UM5L 4F57H 3I9GH 1AXTH 5C07D 4ONGH 4PB9L 2PYEA 4XBPB 2QQQA 2DIAA 3IU4H 4KK8D 1QYGL 1FVEB 2EICA 3RIAK 2DQTL 1RV6X 1BBJB 1TCRA 2HTLC 1NEZB 3VFWB 4B5EA 1RJCA 4G42A 4NKIL 2L7JA 1ORSA 1DFBL 3G08A 2W65B 4L29A 4EI5D 3PP4L 4F3FB 2P24A 1GGYA 2V2WA 1BJMA 1J0HA 3ZT6A 3O6LH 4NUGH 3L5WA 1AI1H 1YEKH 3M45A 2CIIA 5B39B 1O7SA 2FX9H 2AJUH 2R2BB 4P2RE 1GGCL 5TFSL 5ALCL 2QR0A 43CAA 3DNKA 5C08D 4HT1L 5GHWH 5KOVC 1QFHA 5EOTA 1JI1A 1I7TA 5KJRL 4QRTA 3REWB 4DFHA 1BZ9A 1DEEB 4KKBD 3TNNA 1H5BC 3RWGA 4MA7H 7CGTA 2ERJB 5H35B 3MBEA 5TQ0H 1SEBA 3MGTB 4G8FB 1UH3A 1T0MA 4G8IB 4NJAL 2OLDA 1BFOA 1I8LC 1NEZG 4RWYH 2A83B 4P3DA 1P1ZA 2MSPA 4FTVB 2J12B 4D9QD 2M2DA 4FFYL 4PJXE 4O51A 1FG2B 1U8MA 4X7SL 4NFCA 4XVSH 2YD2A 2OQJA 3ARFA 3LVEA 2H41A 5DD5L 4RFNC 4OGAD 5I1KH 3TBTA 1HDMA 3C5ZB 3TNMA 4GJTB 2DB8A 2GUOB 1YJDC 5IVXE 2WV3A 1PSKH 4JY6B 3DV6B 3ULVE 4APQC 1CR9L 4CMMB 5DF0A 1MLBA 2NY2D 4LSPH 1HHGA 2OP4L 1YJDL 1CGXA 3VFNB 3BUTA 4WTWA 2NTFB 4E42A 2QL1A 4OKVA 1KC5H 2EDJA 4LPVA 1MFCH 3BMVA 1BIIB 5CLWA 4MQ7B 2E8YA 5MEOA 1T2QL 3VXMA 2AK1H 1P5VA 2DWEA 1J1XL 3ARPA 1KCLA 2WBWB 4NPYA 1INDH 3FO0H 4NQXA 3F7QA 1A6VL 4QRUA 3IF1B 2D7PA 1GC1C 3E1F1 1HZHL 3DO3A 4YDIH 5CJXA 4MDIA 1AGFB 3BKYL 3U0WH 3H3KA 1D6VH 4PY8J 3BE1H 3ZKXC 1IAII 1A6PA 4UAOB 3F5WB 3TCLB 3F7PC 3G6JF 2GITA 4GG8B 1CICC 1VSCA 4G6MH 4MD4A 1U8OA 4E42B 4GAYB 4PGEB 5ICZA 3MV7B 1L0XA 1AGDA 3MROB 1BD2D 2OJZL 1OF2A 1CTNA 1DLFL 4UV7L 4MCZA 3O41A 5GGRB 4P4KD 4A6YH 5CUSL 5TF1H 1NGWB 1JWMA 2AJYH 1AD9A 1EJ6A 3H42H 1YQ2A 2JIXB 4U4BA 4OD3L 4RCAA 4RFEA 3U0WL 2VZTA 1JK8A 4N5ED 2FD6L 3KJ4C 3GSNL 2Q7YB 4BQ8A 1FE8H 3QZWA 4U1MA 2OMNA 3CC5B 2R1WA 5JQ6L 2X1PA 3V6FB 4DOHB 2NY5L 3H7BB 3G5XB 4P3WA 4R97C 4XNUH 4NBXB 1I3GH 4GKNA 4LCWE 1J1XH 3ULVC 2CK2A 1CZ8H 5DJ8B 2FZ3A 4PBWD 3IJSB 3PDOB 35C8H 4QRPA 1ZT7B 3WCYA 4A6YL 3ELAT 1KBGH 3TBVA 1J8HA 3X17A 3EO0A 2R1YA 2ZUVA 1PY4A 4PRIB 5JO5A 3C6LD 2L7UA 3CZJA 4PGCA 3V6OC 1JCKA 4XTRD 3RVUD 1QA9B 2JB5H 2FECL 5E2JA 1IFHL 3NPSC 2QHRL 4KXZH 3C60C 4KFZC 4P5TD 5T5FL 1M7DB 1C5CL 5FK9B 4F8TA 4JO3L 2V7NB 4KJYA 4GRLC 1UKQA 5KN5B 3GHBL 3PWVB 1KENH 1LO5B 3PWUB 3A6CL 3T3MF 1KXTB 3MOAH 1MJ8L 2DQTH 4H5SA 5DR5L 4JR9L 3QXDB 5AG8A 4GBXA 4Z7VF 1MSPA 3GI9L 3D18B 3TO2A 4CU8A 5FA4B 1LILA 3TBTB 3Q3GB 1FO0L 4HIEA 5HI5D 3NN8A 4OCRH 5L88L 5CJOL 5GS0C 5JMRA 4WW2B 9CGTA 1M7DA 2P5EE 4BUGA 5GSVA 3P0VL 5HJ3B 1TQCC 1UB6A 3CFDA 2VITA 3HE7B 1R5WA 3CIQA 3K2UH 2DLFL 4NO2B 4ZD3H 3LZFL 2ZUQC 2WMPA 1KIRB 3MOAL 3BAEL 3REVA 1OTTC 3IRPX 4PP1C 1SJEA 1TQCB 3CFCH 4Q6IA 5CEZD 3VXRD 2IAND 4FQQA 3VFUA 5I30L 3MJ8A 4OT1H 5LBSL 2IANE 2Z4QA 1D6EB 5KS9E 3RHWF 4FQCH 1QLRA 4KVCL 4ENED 3BGFB 3IF1A 1LEGA 2CDGB 1GOFA 5KSAA 1NH6A 5CBAB 3MYJA 1JHLH 5GPRA 4JHZA 3GMLA 2BP3A 3D2UD 4ODTL 2AEWA 4IJ3C 1KF9B 3QJFA 3G08B 1WZLA 2QQKL 4RISL 4YHPB 1HSAB 4BFEA 2GAZB 5D7KD 3HFML 4NKDA 3HZYB 4ZPTB 4GRLB 1NSNL 5GGRA 4ELKB 2FBOJ 3UBXB 5I66A 3MGOB 3D9AL 1A7NL 3VFGL 4NKMB 4FQLH 5J3HD 1JPTL 4N1HB 1T7YA 1J88A 3KJ6L 2H32A 2H8PA 3OPZL 4G3YH 1U3HD 3W5MA 4N8VA 4JPWL 4K8RH 5CJBA 1CI5A 1AC6A 1IILE 3QHTC 4FQ2L 4QHMB 3QULA 2WK2A 5INCB 1FC2D 4LARH 3RDTC 2EIZA 5E94B 1MQ8A 1OWRM 3SQOH 5JPNA 4R2GB 2R2CA 3VFGH 5HYSB 1C16B 2GHWB 2HTLD 4JN1H 3SPVB 4FG6D 4KY1H 1RJYB 3QZWG 2DM4A 1MH5B 2C9AA 2Q7YA 3AS2A 4IHOA 2GUOA 2V2TA 1JGLH 2IANA 3VFSA 1SM3L 2IPTL 5I0ZA 5EU6A 5L2KD 2V2WB 4RFOH 3G5VA 5IBLD 4LAQL 2DLTA 4LOUD 3CFEA 4WW1B 4JG1H 1CBVL 1EFXB 4NNXA 1A2YB 4PBVC 4J1UA 4PJ8C 4TSAL 1NL0H 3U7YL 4FQ1L 5MP6L 3B9KC 4WI5A 1A22B 2VLJD 4ISVB 4LCUA 4KZDL 4PV9B 1X5ZA 1KJ2L 4D0CA 2R39A 4NO0D 1HNGA 5EU3A 3KPRA 5E2TL 4KTEH 3ALXA 2VB5A 5MP6H 3ZT5A 5JIKA 3DO7B 4L4VD 1F45A 4OJFL 4FQLL 2LU7A 3KLSA 3BKCH 3QP3A 4JKWA 5C0JA 4YHNB 3NA4A 4LP5A 1S7VA 2CQVA 3KJ6H 4RSVA 2GSGB 5D71H 4PRIA 3ARDA 4WTZG 4YIQA 3JV0A 4YE4L 4ODHH 1Z0NA 5DJZB 1N2RA 2GCYB 4F9PC 4MJIB 4MXWL 2CPCA 1LMKA 4AT6B 4XZUA 2X4PA 4IHOB 3BKJL 3HI1A 5DD3L 5DUBB 2PR4L 4OFVA 5T1KB 4YDKH 4OLZL 4B41A 1FCGA 2X4UB 1F5WA 1INEH 2ESVD 4HBCL 4DQOL 3D39E 3T04D 2IQAA 4JFXB 5E8DL 2BSTB 1FLRL 1H3XA 5GSRB 3ARDB 5IBTL 5C3LD 4C56E 3SO3C 1KLUA 3VXME 4UV4L 3PP4H 2VLLA 4EI6A 5D7IA 3QUXB 3IJYB 4XMLL 4NHCH 1ZLUK 2F8VA 3PWLB 4TVPE 1YDPA 2AAVA 4P9MH 5SWSD 1MWAL 1PQZA 3IETA 2V5TA 4Q58C 3HC4L 5DC0A 1JGLL 5B3NA 5DJCB 4NQCE 2BNQD 4PRPB 4JDZB 4LSTH 2FBJH 4JFOB 5A40E 3TO4D 1ZVYA 2CIKA 4LKCB 5IBUB 1C5BH 4WI2A 3VMNA 3GBML 4M5ZH 4WI6A 1B4RA 4GS7C 3QHFL 3ARSA 4F57L 3BD3A 5H37G 1MFAL 3L5WB 3SDDA 5IWLC 3SCMC 1XGPA 3HAEH 4P5MB 4UNUA 3VG0L 4DZ8A 4L3EA 1WAAA 2EEBA 1JFQL 1VKXA 1KPRA 1M05A 1KTDB 2C5DC 1W0VB 1JGDA 3PG2A 4Y88A 4XVJH 3MRHA 3CJJA 4U6VH 5L0QB 5CP3A 3P9LB 3TBSA 1MLCB 4LVOC 3UYPA 5HDOA 3PL6B 2X4OB 3BIAX 5DURD 1INQA 1DE4B 3HS0B 4KROB 4PRPA 1MCOL 3FFCD 4U1NB 3Q6FA 1QFOA 2BSED 1R3LB 3I6KA 3BQUD 1UZ6E 4NZJA 1P4BH 4K55A 3MZTA 3TO4B 3CK0H 1E4XL 5HD8D 1KN2H 1R3KB 4U1SA 1OOAA 3R4DA 4QXWA 5I1CH 2B7DT 2Y1VA 3GMMA 5C07E 1I7RB 4F7EA 3T2QA 5DXWA 4G8EA 4HX1A 5IOPB 3FB6B 5EIIA 3HHRB 4M1GH 1MAKA 1EDQA 1R3HB 4XXDB 3FO2A 3CX5J 2HMID 3LHPL 2X89D 5JQ6H 4OFPA 5TH2A 4TTGA 3WIHA 4A2LA 3O3EA 4Q0XH 5DJYA 1CE1L 4PRHB 3PWJB 3MRRB 2X44D 1W0YT 4XXCA 2EH8H 1JWSB 1A2YA 1F4YL 4M3KB 2ZOLB 2PXYC 3K2MC 3SO5A 1IGML 5DK0B 1BREA 1CWVA 2VDML 3KPLA 3MBED 1HSBB 3ARVA 3O9WA 1PSKL 2NZ9C 1ZA3B 3L3HA 3L7FA 5FK9A 2PO6C 3O0RH 3QIWB 1A6ZA 1BJ8A 1OP3H 4HFWA 4LLUB 2AV7B 4OGYL 3QXAB 3OJVC 1T89A 1P7QD 4DGVL 3S35H 4I3RH 1CL7H 4G6JH 3QUZB 3LMJL 4Q9QL 3GJFB 4UNTA 3O6FA 3TYFB 3DLQR 3VD7A 5JW3H 3VJ6A 3E6FA 4MVBC 4XP5H 2HKHH 4X7TA 5DUMH 1OSPH 2H1PL 4L5FL 4OUUA 3U46B 1I8MA 2G5RA 1F00I 1JF5A 5L2KA 3HN3A 2IJ0C 4QHMA 3Q2CA 3ZE2F 5K9JH 2CD0A 4RZCB 3DRQB 4QHLB 1F90L 3EFDL 5F7WC 3WSQH 2OL3A 3V5HA 4I0CC 4NQDD 1MHCB 1YEKL 2Y5TA 4B50A 5IB1B 2OP4H 4X9FA 1U8LB 4DCQB 4JKMA 3QIUC 3LDBB 3O3DB 3STZA 3UTSD 4XPBL 5LAXA 5GGSA 3SKOA 3UEZA 1OAKH 3KYOA 4S1RH 1AQDA 1FFNB 1Y6NR 3ZKSD 2F54A 2DDQH 3TT1H 2DIBA 4Z7VA 3ZSTA 1IEAA 4MNQE 5DQ9B 5T1DL 4P46B 5FYJE 5F97E 2CRIA 3RWCA 2XN9B 5B3JF 2V2XA 1BAFL 4QRQB 4LFHD 1U93B 4KMQA 3L9RB 4XPAH 2A38A 2D4DA 2X2YA 3BX7C 2APXA 1JUFB 2PCPB 4CU6A 2EEAA 5T1MB 3QDJD 4HT1H 3T0AA 5F7EL 2DWEB 2IBZX 2HWZH 1SY6L 3LQAL 4O58L 1T83C 4O2EA 5HYFA 2CSPA 4ZUTB 1QNZH 4KKAC 2DQFB 2F54B 4ZO6A 5L7XL 2N7AA 3RAJL 4JZOA 2CJUH 4KMTH 5EZOL 1IM9D 1ZEAL 4WCYL 4Z0BL 4U1IA 4DN4H 4H8WH 2COQA 3QUMA 4PJ9B 4L4TB 3T09A 4ERSH 2GY7B 2JF1A 4Y2DD 4LEOA 2B2XL 4PJDE 2B1AH 4Z78B 3OKKB 2ZSWA 2NY3D 2VQ1A 4KUCF 4ODWA 2XICA 5FXCH 2VN4A 2UY7A 3LKOA 2GTZB 3IFPA 1AXIB 1Q9OA 3W5NA 2GJZB 2GAZA 3BKMH 1UWGH 3EDKA 3DGGB 1I9IH 4PG2A 5FM4A 3BN3B 2ENSA 2WSKA 3FOMA 1DUYB 5C2UB 2PTUA 1QSED 5C2BH 1YMMD 4EXPX 2O5ZH 5ITBH 2BNQE 1CIUA 4OZFB 4WV1B 2HRPH 5K9QI 5SWZE 3GEWB 1ADQA 5KVEL 1S7VB 1BF2A 3VI3E 4ZAKD 1J1PL 1T0PB 3FFCE 4MA1B 5D96C 4FZEL 1MFDL 1NCBL 4HXBL 1ZV5A 5E7BA 2OK0L 3PGFH 4Y2OA 4MVBD 1GIGL 1WITA 1WFUA 1R3JA 4Q74A 2R1YB 2PTVA 4CUCA 3SDAA 4QNPE 2BHUA 4H8WL 1RK1A 1TZGH 1WGOA 1SYVA 4MAYB 1EBAA 1JHKL 4PJ9D 4OFIA 2AV1A 4JDTL 3QDHA 1CFQB 1HHKA 4Y1AE 2LE9A 5CWSA 5EO9A 4NO0A 4FNLL 4FQ2H 4X7EC 3FT3A 1FIGH 2MQ0A 3G6DL 2VDKH 3UZQA 4QY8B 3QUYA 3QJFB 5F7EH 3UPCA 5E0QA 2O5XH 3VG0H 4ZODA 3IFLH 4TSCL 3S36H 1OP5K 2BOCA 4F9PA 2AEQL 4D0DA 5KS9A 2ORBH 4X6DA 5GRYA 1NGXA 4DKDC 3G6AB 1YEHL 1MAML 1ADQL 6CGTA 5BZWA 2D7TL 2HH0H 3WIIL 1D5IL 1RUMH 5IGXL 3H7LA 5CP7A 1FYTE 3PGCB 2Z8WC 3MLTA 2YBRA 4F7MB 4UQ2A 2YMXL 3BW9A 3VD9A 5HVFB 3MV01 5DGQA 2DJ4A 4FFVD 4UB0L 1Q72H 5DQ9A 5B38B 1DQQB 4OGXL 3MRPB 2QSVA 4DVRL 5HHVL 2AW2A 5D70L 4FABL 2QSCL 2HVKA 4KTEL 2NY4D 1RZJL 4OCYH 5HJ3A 1I1CA 1N59A 3L9RA 5EZLA 3UTSA 5CBEB 4H88H 1A7OL 2BOCB 4OZHB 1A7OH 3LQMA 1S9XA 1GZPB 3IU4L 3WUWA 2ICWB 3A67H 4BZ2L 1G9NC 4DQOH 5DHYB 3HMXA 4NRYB 3I85A 3JTTB 4WNQA 2L0DA 4Q9RL 1A21A 1NCDL 2ZJSL 4I0KA 5GZOD 1I4FA 4EUPH 2X4TA 4YDKL 5SWSA 4K3DH 3QDMD 1SM3H 1U8OB 5FKPB 1JPSL 3U82B 5I1JH 4M6NL 2X9YA 3N06B 1T1ZA 3DMMC 2V5YA 2ZPKL 1GVIA 5DLMH 1B0RB 4R2GC 4HZLA 4Y5YC 4D9LL 2I07A 2O5XL 1P7KB 3X3FL 5JTWA 4ZDHA 4DKEL 3N1GC 5CZXD 1IC4L 3K1KC 1NAMA 3HE6C 4KVCH 1FYTA 5DRZB 4EUPB 4BA8A 2EH8L 1Q0YL 3QXTA 2AGJL 5F7YC 1SEBB 3T0EA 3P77A 3ZYOA 2R0WH 4N9GB 2E6JA 3CU7A 5FKAB 1X7QA 5DMKB 4JRYE 3K2UL 4HK0B 2NXYC 1KCSL 1R5IA 3WN5B 1KJMB 4DTGH 2NY7L 1N7ML 2CJUL 3BGMB 4KMTL 5EZOH 1LO0L 5CEXB 1D5IH 1T03L 1N5AB 1HDMB 3C5ZA 1NC4B 4G7YH 3QUMB 2QSQA 3GMOB 2P1YA 3T0XA 4OSUL 5C09B 3M1BA 3BHBA 3VMOA 2H2SD 5JA9A 3UO1L 1N8ZA 4NKOB 3QWRA 1ACYL 4ZTPH 3GSVA 2A0LD 5GIRB 1TNMA 3MRJB 1CICA 3S5LG 1NCDH 3DROA 3RUGE 3VXNB 4ODTH 1DQDH 3W11C 5SWSE 4EJ1C 3BJLA 4TTDD 3SQOL 5EC1B 1BLNB 5BVJB 3MV9A 2ICES 1J10A 1L4IA 2VZOA 2XPGA 2W9EL 5JW4M 3QIUB 5E1AA 2EDQA 1YEIL 1MI5B 3ULUF 1WEJL 1AO7D 3QDGA 4X4YB 3P4LA 3KHQA 2KZ1B 1CG9A 3CFJB 2J88L 4F2MA 1UB5A 2A6KB 2WBKA 3AAZB 3NMEA 4S1RL 3O2DA 2DAVA 4OV5A 5FYKL 4PRHE 5FYJD 2GQHA 4JM2C 4O2FA 4WEUD 2P24B 4I3SH 1XGQB 4NSKA 1IZJA 1T04A 2HVJA 1AH1A 3L3OA 1CXFA 1Z9LA 2SEBB 5C71A 2V7HB 4M6OH 4PJGF 1JTOA 4X5WA 4CJ0A 1FZKB 5IVOA 4DUVA 1BD2A 1XT5A 5EO0A 1I1RA 2VLJE 4LU5H 1BZ7A 3OB0K 3LSOB 3QNXB 5FCUL 3HR5B 4KQ4H 1RZKH 5JOFB 4NUJB 5C0GA 3X14B 1TVHB 4NBYB 1S7QA 2VXQL 4G6AD 4C54A 2ENYA 4MDJB 5I8OL 3U48A 2XZCH 5F72S 3KYKL 4LLQA 1N6UA 4GQ9H 3WHE1 2FCBA 3GRWA 5E00B 3GM0A 5IP4A 4UV7H 3SDAD 4CL7A 1CLCA 2ADIB 2XPGB 3HZVB 3LH2L 3WD5L 5I15L 5F3HA 5C7XL 3HNTH 2WINA 2Z9TA 1AHWB 1P5UA 2EDTA 4XP6L 3UROR 4L4VA 3FO1A 2VDNH 2EECA 5JXAH 3MUY1 4K07A 3NCFB 1F02I 2WBJD 2H9GA 3CMOH 1MIML 3PIQB 1K4DA 3ZDZF 4UAOC 4JPVL 4WWID 3SKMB 3PWLA 1FYTD 4HMCA 3T1FB 2DKSA 4JGUA 1KBGL 1CT8A 4NQXB 3W9EA 2A9NL 1JPGB 4M7LT 4OIBA 2IGFH 3BIKA 3L3OB 4ORGB 1I1FB 1U91A 1D7FA 2XY2A 3DRTB 2UUDH 1JGUL 3SKNA 1I1AD 2C3GA 1S9WA 1JNNL 1C7SA 4XCYA 5FUZH 2NY1D 3ARBA 1F6AB 4BH8B 3MSPA 3BJ91 2CKBB 4X5LA 4YDJB 4GXVL 4L4VB 3WIFB 4Z6AT 4PY7B 4WHYG 1QFUH 3NFPA 3VXTA 3RA7L 1KN4H 2H6PB 2FX9L 3IXAB 5F89A 2J6EA 3FAWA 4RBPH 4GW1A 2WW8A 2VLJB 1XCQB 1SVCP 3BP5B 1KULA 5FUOH 4P2CG 5J0BA 5I15H 1B3JA 1U8MB 2I9TB 4TVPL 2V5SA 5F6HJ 5FYLL 5LGKA 4L4TD 3X12A 2W59A 1R3IH 5MENA 1IKFH 3LRSB 2NXZC 3L6FA 4XP1L 4XVUC 3HB3C 2DQCH 4JQVC 4ZAKC 4ZDHB 4ZUVA 2IQ9L 1HOCB 2XWBA 3GSRA 4L9DA 5CGYC 3UPAA 1PYWA 2HP4A 4MAUL 5E1AB 3PJSB 3VWJC 4WTXA 1PKQE 1CFQA 3MODL 2DS4A 2ZUQB 1EAPA 1VFAA 1VFBB 4JRXE 3UBXA 1TTGA 4KTYA 1DQML 2WWKT 2CDFB 5GGRY 1B6DA 3OAYK 1SYSA 3DYPA 4XMPL 3KHOA 5D1ZC 2NY1C 4BZ2H 3ULUL 3KAAA 4R3SA 3SDCC 1RHHA 4Z7WA 3RWFB 4YEFA 3LV3A 4PG9A 4KJPD 4K3EH 5DWUL 2VXUL 2FB4L 2FEDC 3JXAA 1YJDH 4OZFH 2IQAB 4OIAA 4IRJD 4PREA 3RWIA 1QACA 1FFPB 2GEEA 3SKJL 3FT2A 1J8KA 1B0RA 4PBXA 4APQA 5L8LB 4YXHH 1NCUA 1II4E 2Q7NA 4XRCA 3WSQL 4YZFF 2NY6D 2BY3A 1I85C 2ILLA 1BLNA 4K3DL 4JB9H 1SEQL 2DM3A 4K8RD 4N0CC 2ZJSH 1GC1H 3OKKA 5I9QB 2DBLH 1BIHA 5FEBA 5C08B 4RAHA 2XACC 2P44B 4TNWF 1JZ2A 3C2AH 2GFBB 5DD3H 4UDUB 1GGCH 3LSOA 2NXYB 3QNXA 5I1CL 3VWJD 1XIWA 2NY0C 1IGCH 2RJMA 5EU7C 3QNYA 1QSEA 1QUNA 5FB8B 5EOCH 3RGVB 5EULV 3O9WC 4C4KO 3UJIL 5C0EA 2WIIB 3BVNA 3PL6A 1WWBX 4N0RA 3MXVL 1FZKA 1G7HB 2ZWLT 3I75B 5I1KL 2Q8AL 3U36A 3HPJA 2R0WL 2EIZB 1NGPL 5E94A 3VI4F 3WXWL 1IEHA 1JJUA 1T1YB 4M5YH 4XVSL 1RUML 1ZKAA 2M8XA 2EDKA 3ZE1F 1HHIA 1L0YA 1U92B 4FFYH 5J9PA 5EN2B 3SDCB 3DETD 2OR9H 3K8LA 4PJEE 3MYJB 3QR2A 3EJJX 4PJFB 4PRHD 1PY9A 1SBBA 2Y6SD 5J89A 2O26U 4Y1AB 4HKBB 2B5IC 3QDGB 2NY6C 5C9KA 1BD2E 4HIHB 5FM8A 4WV1A 3GHEH 4AEIH 5HVHC 3UZVB 3V95A 4E5XB 1RURH 5HHNB 5LXGH 1UZ8A 5AD0A 3BPCB 4NKDB 4WY7L 3NCYS 1E28B 3VXPA 2RR3A 4UOW1 5CHNA 4DZBA 3ARED 3ULSB 3SJVE 1SYVB 4MAYA 2Y7QB 5I19H 4JO2H 1S9XB 4AG4H 4Y2DA 3EFFA 1PZUB 1IEBB 4FQPA 1KJ2A 1XCTA 3QFJE 4Z77A 5CEYA 4BSWA 3S37X 3FT3B 3RL2A 1FL3B 2VLMD 2W9EH 3QO1B 2VTFA 4FN0A 1A1OB 5KSUA 4FXGB 5ID1A 3QISA 4K3GA 3FFCB 5ITBL 1KCUL 3H0TB 3RIAF 5L9DH 1D5MA 1AGCB 3PNWA 4JFHE 5HTSA 2AK4A 2P5EB 4Y16D 1HQ4A 3QULB 4PB9H 4WI4A 3S6CA 2JB6B 3RP1A 4GOSA 1SJHA 2F53B 1SJEB 1U58B 1FL5B 3IVKA 2XTJD 2LVCA 4N5EC 2UVEA 3RZWA 1FL6A 4G6KH 2UZIH 4BYHA 5TPWL 3U2SB 1YYLL 2XXCB 3K3QA 1A3QA 1FE8L 4LKXA 4KGLA 5F1SA 3WKNA 4F7MA 4F58H 2G5BB 2IPTH 1F6LL 4GRMB 4HLJA 2FGWH 2EIEA 4H25A 3UJTL 4P99A 1UH2A 5IB2A 2E7BA 3TIDA 4NZRH 1CXKA 4K3JL 3S96B 2DL2A 1CFSB 1JBJA 4XMLH 2MKLC 5CGYD 3WFCH 1JE6A 3O8XD 3GGWA 1IM3A 4GRLA 5LCVH 1B9ZA 3VFPA 4AEFA 2HMIC 4KZDH 3MV7D 5EBMB 4PJAB 5GGTL 5D96B 1UXWB 1AHWA 3SKOB 4NNXB 2VAAA 3HAEG 4NRXB 1VFBA 3KNBA 2HKFH 4X6BB 4RX4A 5GZOC 3P30H 4HJ0C 4WFFD 4YAQA 1BPVA 1CQYA 4LRIA 1A6WH 5MENE 5DMJB 5I19L 1MHCA 4P0DA 3UX9B 1U8HA 1DQTA 2OBGA 4M8QB 4X5XB 4KRPC 3BKJH 4PG9B 3UTZA 3BO8B 5KVMC 3CUPA 1NFDE 3AM8A 1FL5A 1JZ7A 4ZQKB 5AUMA 3WJJA 1LHZA 3MROA 3LKPB 2C3VA 3G5YB 3CGTA 3MUGB 3UTTD 5C08E 1KV3A 1KJVA 1BVKA 3DVGA 3QWQB 2I24N 1RU9L 1MI5D 3I6LD 3K4ZA 4O2EB 3GI9H 3BT2H 3C09B 1I9IL 3TBWA 3JV5A 1GCFA 3ZYJA 5IVZA 5EOTB 2F5BL 4IOFD 4K7FB 3C08H 3C6SB 1I1FA 1U91B 3CVHB 2X9XA 3LS5L 5BO1H 3VFTA 3GMRA 2AV7A 3L7EA 3GHBH 3QG7L 4K7PL 1KB5B 3E3QC 1I1AC 1OTTD 3FB7B 1JNJA 2IFFL 1KXVC 4G8GE 2XIDA 3D1MC 4U31A 1NLBH 4OFYA 3ZDXF 1NC4D 1BWWA 3OKOA 4UQ3B 5I1LA 2P43B 1DQLL 4KRLB 4KTDH 4IDLA 1BQHG 1ZEAH 1N6QH 1B6UA 2YD9A 3RIFF 1FGNH 3L5XL 5FCUH 4Z5RB 5F6HI 2X9WA 2YXMA 4S11A 4S10A 5DMIH 5FF6A 2V9QA 4ONHA 3GMPB 1PQZB 4MD5A 1JV5A 5B39G 1RULH 4C57C 4LLDA 1RHHB 3RWFA 4Z7WB 2ZUYA 3VDBA 1HHIB 1U92A 5I1IH 2J1KA 2VDMH 4F37F 5KBNC 2X6MA 5MEOB 2FD6H 5CCKH 3BD4A 1BEYL 2PF6A 2RGSA 5I30H 2JE8A 1MIEH 4GQ9L 3JV4B 3TFKD 3DJ9A 1U3YA 5SV4A 1DEDA 4K7PX 5LG1A 4YPGB 3RL2B 1R5VB 1MLBB 1VHPA 4W6WB 3RVUC 2OTUA 5HSFA 3RPIA 4JGJA 2JK5A 4E0RB 1G1CA 1MLCA 4KUCD 3C09C 4HK3N 1DQDL 5DC4B 1ORSB 3OWEA 1DBJH 3PP3K 4NZUH 5I8CA 4P9HC 2ZCHL 3BZFB 3TIEB 2G75A 5BXFB 3RY6C 2NYYC 3DBXB 2UWEF 3IDIA 1BFVH 3GMMB 3VFOA 3EHBD 1VFAB 2HLFD 1XF4A 3BN9D 1Z5LA 2FGZA 5D2LF 3T8XA 3QEUA 4YHIA 2QQNL 3WIFA 3CFIC 2H2SC 1KTLA 4JDZA 3HTLX 4G8EB 4IDJH 3IXAA 3MOBH 3T2OA 4HMEA 1XEDA 1LP9B 1ODAA 1U36A 3ZMRA 4J6RH 3DARA 2L4OA 1A9BA 3OBAA 1AFVH 3RY4A 5CUSH 5TF1L 4TTDC 5HHQB 4XP1H 1TTUA 5FO7B 4ZO7A 3CPLB 3IKKA 1DN2A 1FSKB 3KR3L 4CVZA 5E95B 4ZUSB 1IAOA 1RZKL 5TGBB 4OGYH 1UM4L 3MRMA 5HGGS 1MNUH 3LIZH 3MLSL 1A9EB 5KSBE 4XP9H 2FECI 4IM8A 4XCEB 5L8JB 1ACYH 5EA0L 3WMSA 5HHOE 3ARWA 3PWNB 1T0NA 3HUJB 4FG6C 5ESVA 1SJVA 1JPGA 2X1XR 5EG6C 1XR9B 1FJ1A 1NMCC 3MRPA 1B0GB 5KVFL 4K7PY 5DGRA 3V6FA 5B8CA 3T1WA 2DLHA 1FVDA 1T04B 2HVJB 3SKNB 1UYWH 2J8UB 5I1AA 5EZJB 1C08B 1JYVA 1YEJH 3UPRB 3LKQA 3M8OH 4ODUB 1FPTL 4OBSA 2ZNWA 2QADC 4LCCC 2FDBP 4MA7L 1PG7H 1RPQA 1EO5A 1H3TA 5D2NE 3MX0A 4JFYA 4JM4H 3ARFB 2BOBA 3SOBH 2G60L 4JQXA 1KC5L 1NC2B 3VA6A 1CLYH 4PJFF 4X9BA 2EZ0C 2Q8BL 3V0WL 2VUOA 3DI3B 4JPVH 5TFSH 3QDMA 4EZMA 4OCMC 3QFDA 1DVFB 1MCJA 2I5YL 5F7HA 3A67L 3FB8B 4MDJA 3MGTA 5KSVB 5HDBE 3ZHLA 3N9GH 4OLZH 1U95A 1ZVSB 4ODSH 4OZIA 4AM0A 4AG4L 4JM2D 1DVFC 4L3CA 2E7MA 2R56L 4QRRB 5ERWA 3FQUB 5DFVD 2F19L 2ZPKH 1LK3L 5IKCA 1BVZA 1K3IA 3WO4B 5IB3B 4Z0XA 4XTRC 5ECJE 4Y0GA 3SE3C 2XXMB 1Z3GH 1F3DJ 4GUPA 4U33A 5I1DA 5IJVA 1A6ZB 1KEGL 2C1OA 1U0QA 1FORH 1YEDA 1NMBH 2WWKO 3SKMA 4WFHD 2PW2A 4KJQC 3KPNA 1YNKH 2CO6B 1YEHH 2W0FA 3RRQA 1YYLH 4J2XA 2VO5A 4R96A 2NTFA 2VMFA 4LLMA 3VXSE 5KSAB 4NYLB 3VGGA 3GSWB 4OF3A 3FQXA 5EUOF 2CKBH 5B38A 1RUPH 3V52L 4P3CL 2NW2B 2BXZA 1UXSB 4M5YL 3P4NA 4LF3A 2AJYL 2Y72A 1IT9L 2WP3O 3ARDC 4FQ1H 5A2LH 4TUOA 1RUQH 4NJ9L 4QOKA 3RDTA 4PP2B 5EBLB 3T4AB 3ZE1E 1AGBB 4NHCL 5T1LD 4MNHA 3OF6D 2VQTA 4LEOB 1J0IA 3FJTA 1KB5H 1BFOB 5E03A 2G9HB 3QUYB 4M43L 5ACZA 4PJ9A 4Y5XB 4G80B 5IQ9B 4X6DB 4XHJC 2ZCLL 3BRDA 3GSOB 1ADQH 4OQ1A 4P46D 3VFVA 1CLYL 1JVKA 4CN4A 5FO8A 5ALBH 3D2UA 3JV6A 1WWAX 1A5FH 3MLTB 5IHZA 1ZHLB 1YEGL 1IAOB 4NQEA 5IW1A 3QIBB 4K9EC 5D7JC 5DEGB 2W0LA 4KPHL 2X4QB 3B9KA 1EEZB 4IOIB 3WDIA 3HG1E 2WLZA 4QGTA 3KXFE 4LFHG 1OAUL 2PO6A 3CSGA 5ICYB 3EHBC 2RQ8A 5GGVL 3DX7A 1IC5L 4AL8H 1SY6A 5EB9A 1WZ1L 4QHKI 4J8RA 4L4JA 4MSWA 1J8HB 3GMQA 4KK5C 3HI6H 1PX4A 1S8DA 3GJEB 4OLVH 1TJHL 6FABL 4QHNB 4XHQA 3OJMB 4XMPH 3VGFA 1KIUA 2CLRB 2XKNB 1CLZL 4KGJA 2RBLA 3CVHA 2H3NA 4FTVD 1Z0MA 2IANB 4XPHL 3L5IA 3IDMA 3WN5C 5BS0E 3G6DH 2ATPA 2EYSA 5F88A 1QLFB 1A3LH 5D7JD 2KL6A 1YEEH 3DXAD 5HYSG 3OKOB 2HFFA 5BRZD 1CFBA 5DEZA 2O5YL 4NN6B 5EZLB 4YXHL 2YA1A 1CD9B 3HRZB 2WUCH 5GJTL 1NAMB 4Y4HC 4XC3L 1JGEB 2BRRH 3CDCA 3VFTB 2Q6WA 2CDGA 2A6KA 1P84J 2MQCA 3W2DL 4J3XA 2BSSA 1DBKH 5ILTH 3R0MA 1AKJA 1T5XB 3UTOA 1FRGH 1ZGLA 2FWOB 4HBQA 5HY9B 5IBLC 3QNZA 2PR4H 2DQUL 4PGCB 3OPZH 4QNPF 4WJ5A 4TPRH 4J23A 4H0GA 3JBG7 5JHDE 3VFUB 1BOGB 3BH9B 3U9UA 3UP1A 3VH8G 3L5JA 1JPTH 4QTHB 4YNYA 1T6WA 4LLYB 1L9NA 5FYJU 2FHBA 4LLWA 1SHMA 4PJ7E 4KUZL 4PGBA 3GMLB 4R8WL 1HHHB 4KROD 1NBYB 2ED8A 1OSZA 1UG9A 2Z31A 5IK3B 3HLAB 4D0DB 5KS9B 4RGMC 3NZ8A 3QEGL 4ALAH 3TYGL 1LP9E 4TNVF 4HC1L 3D85B 4RMSA 2YKLH 4XHJD 1ORQB 1CFVH 1HKFA 32C2B 4YHLH 1QR1A 3ZL4L 4RMWA 4JM2F 5DTFA 1KJ3H 5EOQL 4JRWA 3KYNB 2P7TA 1N0XH 1RZ8A 3AB0C 5CSZB 5DYOA 5JORA 3VXOA 1FGVH 4UINH 3CCHA 2DQDH 5E08H 5DZLA 1CGVA 4L8BA 2JIXD 3OG6B 3OGCA 3GK8L 3EYSL 3I6GA 3I6LE 4Q0XL 3BO8A 4MNQB 3MGAA 5BV7L 2E6QA 3HUJE 1T3FB 3E8UL 3N0PB 3MPCA 3C5ZC 5TDNA 3GSNH 3CX2A 3C5SA 4M7ZB 1DL7H 3QRGH 1KIPB 1TVDA 3RWDB 4POYA 3OAUH 4LBEA 3P0VH 4GG6F 5CSGA 3VXMD 12E8L 1KB5L 1NCCH 3I2CL 3KPQA 2N1KA 3KPTA 1MHHA 1P69B 2LU3A 4MXVF 1P4IH 4J7RA 5DC9B 1N4XL 2ICCA 4NQCD 3QWRD 2OR7A 1G7QB 2ESVB 3HRPA 3QI9B 3OKEB 2VDNL 4TRPH 5T3ZL 4GSDL 3VXQA 4X6CB 4YUEL 1G6RB 1J05B 1QSFB 4I8DA 1WEJH 5IHBA 3ROLB 5EIIB 3D25B 1MIEL 1DSFL 1T6VN 2AJXL 3CD4A 5E1HB 2AXFB 3T2NL 3V6ZA 4LHQB 2R4SH 5F96L 1GHFL 2XA3A 3IDJA 3KPPA 2I9LA 4LGSB 2BNRA 2YD7A 1L7IH 3VMPA 4J3SA 4S1QL 3BXNB 5C0CA 4OFKA 4U6XB 4AMKH 2R2HB 2J3SA 1I7ZA 1RZ7L 5JHLH 2EZ0D 4FQJL 2H45A 4NQVB 3HR5A 5FHAL 2WIIA 4HIHA 2EIDA 1BFVL 5H8DA 1LO2L 5DHXB 5H35A 1MRFH 4F9LA 3KYAA 1GGIL 4DGYL 1A0QH 1W0WB 3D39A 3N1FC 5FYJL 3PL6C 5GGVY 5EIQA 5F9OH 4C59B 1HILB 3SGKC 3BMWA 1UADC 5ENWB 3MACL 3WLWD 3LKOB 1KN4L 5FGBA 1RZJC 5D4QA 3KPLB 5LBSH 1T21A 3ULSA 3VFVB 5KVGH 1VEMA 5FM5O 3JTSB 3D48R 3MRFA 2XWJB 1WTLA 1JF1A 2G60H 4X6CA 1XGPB 4P5MA 5FUCE 3QUKA 4OZGE 5BVPH 4HUUB 3QCTL 5EZIH 1X6LA 1FC1A 1AR1D 3FRPG 1S9YA 3MRBA 1WVZA 4K71B 4KJWD 4LEXL 5I17B 5IR1A 3Q6FB 5DVNA 4AYFA 2OSLB 3MA9L 2IADA 3O45B 4PRAA 4XC3H 4HWBL 1CFTB 1NCCL 3I2CH 3NIGF 3I3EA 3QNZB 4JO2L 1MRDH 1FG9C 4XCCH 3H9ZA 1XF4B 4L1HA 4OM1L 3C60D 3IDYC 3GSXA 3KPRE 2FLRT 1D6VL 1A02N 4ONFH 1R3KA 4K2UH 5LXGL 4Z7VB 2LABA 3GJEA 3FQXB 5C7XH 4NQDE 5IMMA 3PWPD 1VADA 1HH9A 3IT8D 4HCRL 3I6KB 1MCOH 4S1QH 2XI9A 1FVDB 2H1PH 1AJ7H 2KQMA 5C0EB 2FYYB 1CGTA 3W0WA 3IDUA 1FLTX 4ELMA 4YDJA 5T5FH 2YA0A 5IJKA 3RTQA 4NQSB 3RWHB 4I77H 1BBJA 1TCRB 1QLFA 4CVWA 5TH2B 5E99H 3RDTD 5ADPL 4ZS7H 5IOPA 3AGVA 1IE5A 1JWMB 3W39A 2YC1B 2R2BA 2X4QA 3INUL 5SX5K 4Y16A 4XCFL 4FQXA 3QPXL 1YMHB 3AU1A 4G42B 2WUBL 4LSTL 2VLJA 2R8SH 2FGWL 1IGIH 4NO3A 1QRNB 5HGAB 2HFGL 1R3LA 4O00A 1LO0H 4E5XA 1J5OL 1T0MB 4G8IA 1PVHA 4MSWB 3MREB 1IRAY 5CAYB 4WGWB 5DO2D 1XF3B 4KI5D 1DEEA 2Z93B 3E8UH 4XNZC 1KELH 4P2OD 1M6OB 1TENA 2VDKL 7FABL 4DUWA 1FRGL 5F7LB 1DQJB 3TA3D 3GB7A 3A6BL 2A6DB 4AIOA 3TJHC 3KPOB 1YMHA 2P5WD 3BP4A 4NDMB 1F58L 4C4KT 3VXSB 3HMWH 2VAJA 1F6FB 4K7FA 4NGHL 3TT3L 1TVBB 1E0OB 3MNWA 5SWZB 3VXMB 4ELMB 4Z7UA 4WVRA 4N1EA 2X40A 2YRZA 1T22B 1A64A 1NGZB 4P9HL 2YZ8A 3GSOA 4MA1C 4U3XA 1CDIA 2HRPL 1UACH 1ZE3C 3QQ3B 3FO0L 5F7FA 1LNUB 3C6LC 5IMLA 4YK4B 2R2EB 2HLFC 3HFMH 1AP2A 4KC3B 5JDJA 3VI3F 4OLWH 1OAZH 1PG7X 4JAMA 2E8ZA 4Z7NF 3FZUD 2VIRB 4P23A 3VXSD 5EUOA 2XTJB 3VRJA 4C56B 5BMFL 4HIJA 2W9LA 2XA8L 3QIBC 5D7JB 3RVTC 3UYRH 2Z93A 3TA3B 4KKLC 4OF7A 1R24A 1BJ1H 3OZ9H 1U6AL 1ZT4B 5ADOL 1KLFA 5A1AA 2CKNA 3O81A 4IRJC 5GGVH 3ULUC 4BH7B 4JFEE 4CADB 1W2KT 2YD4A 1T1WA 3HCVB 4DGIH 1EH9A 4DKAA 2Z92A 3KXFB 3LKRB 4XNZB 5IMMB 5DMGD 2BNRE 1F4WH 2AJ3B 5F7DB 1HINH 4FXKA 3L3GB 4JFFD 3O3BB 4HUWB 5T1LA 4FQXC 5JO5B 2DMKA 5MEQA 3MNZB 2P8PA 4NM8H 3QIUA 3ARYA 1IQDA 4N0YL 4NM8L 5I6XC 5F9WB 4JM4L 4KKNA 5IEHA 1CD0A 4W81A 1S3KH 3LB6C 1FO0A 1NKRA 3JWOL 1CN4A 1YC7A 4OD2A 3VXOB 1CD1B 4M43H 1MJ8H 5IR1B 4OAWB 5C0BA 5EO1B 5T3XE 3QAZC 1A7PH 2CRYA 3RL1A 4Y4FB 1MCRA 4U1LB 3RJDA 4HKJA 2EC9U 4Z9KB 2BVYA 1LEIB 4GKSB 3QO1A 1HN1A 3GNMH 2BNUB 4M9PA 3D25A 4WV1C 3EYFB 1WQVT 3RTQB 1U6AH 5SWQB 4ERSL 3V6ZB 3KLHC 4HUNB 1ND0A 3O11A 5DWUH 2R23A 1S7SA 1OPGH 4PV8A 1PBYA 2KUTA 4O4YH 4X6BA 2NZ9D 5KVEH 4DZBB 3NN8B 5I8EA 1OGAD 1MCDA 4EQ2A 2J8OA 1T89C 3BPLB 2VYRE 4H1LH 2CGRL 4W4OC 5J06A 2D31A 1ULVA 1YNKL 4OLWL 5L0QC 3L3GA 4R0LA 1KB5A 1RUKH 3F8UB 2VSDA 5DD1H 3TIDB 2OZ4H 3BUYA 5FYKE 2VLRA 4NRZA 4I1NB 1J12A 3S3JA 4ELMF 2FJGA 1TZHB 2DQCL 2GJ6A 3EO1B 1C7TA 4KK8C 4RGNB 3ZT7A 1H8OA 1XIWC 4K71C 4KHTH 5BRZE 2IH1A 1T2JA 5EC2B 4ZD3L 4X9GA 3SBWC 3ZE2E 3FONB 4NN6C 4PJ8A 2NLJB 1FDLL 3HE7A 4NO2A 3KS0H 3BW9B 1D5BA 4NOFA 3G6JB 2WZPD 1YY8B 3BPOC 4MA8H 3T0EE 2J6EL 2O5ZL 4HS8L 1HYSD 5F7NC 5ESAB 4NP4H 3J8F7 1TQBC 3B83A 5EPMA 4LRNH 1KJ2B 1BJ1J 3BKML 5EBMA 4XGZA 1FZMA 3W9DB 4LIQL 5I1GH 2HYMA 3SPVA 4PGBB 5JMOC 4JJHA 1OTUD 1QKZL 5HHME 3EOAA 1AY1L 5E6ID 2NLJA 1MEXH 5D1ZD 4UT9H 1K8IA 1T66C 3V7AE 3KPSD 3G6JA 4JFDB 1EJOH 2R4RL 3ZTJG 4QYOB 1AE6L 1LK2B 4K3HA 1LEKB 3CK0L 4EN3C 1Q9OB 3RX5A 2IF7A 4XPBH 3GMRB 4XAWH 2R0LH 2AXFA 2GJ6D 5GRJH 1EVTC 4EOWL 1DLHB 2HG5A 5E9DD 2NX5E 4HWZA 5E9DE 4FXLA 2MKWA 1HIML 2UY6A 5EBWB 1V3LA 4X7CC 4R8WH 2ZG1A 4QXTB 5E4EB 3KLDA 1KYOJ 4GXUM 4POUB 4CVUA 3LKNA 3WBDA 5ACLA 2IADB 3CLFH 2DRUA 4G9DB 1QBBA 4JG0H 4PGZA 4ZQKA 1YPZE 3P0GB 2BDNH 2EYRB 1KCVL 3CDYA 1N0LA 4HKZB 3IFNH 5KSBB 4BKLB 3K7UA 2BERA 3HMXH 4Z7OF 3G5VB 4FQIL 1F4AA 5DHYA 2FBJL 1GGBL 4GS7B 2YN5A 1NC4A 2VDLH 4POZC 3U1SL 5BZDB 3VFSB 2R23B 2VWEE 1T7VA 2VDPL 2C1PB 4PJXA 4R90H 4W6XB 3O2WH 4OAWA 1NDMA 1VFMA 4LSQH 4NQVA 1WFOA 1LNUA 4JO1L 1JPFA 5H94A 5JXAL 4LHUG 2BC4B 4G9FE 2VXUH 3VWKC 2D9QB 4I18B 1P4BL 4YZFE 1PDKA 4PJ5E 5IBTH 4OLXH 3EYSH 3MRNB 4ZFOL 1EUTA 5DT1H 3KDMB 3PXJA 4FQHA 3DV4A 2BFVL 3DUHA 2YSSB 2E9BA 3RGVC 1HIMH 3G9AB 1IGTA 1G1YA 5K9JL 1FFOB 1CDBA 1Y0LB 1E4JA 1BZQK 5DZNA 4Y5VB 5BZDA 4U1HA 2NY0B 2XZAL 3X3GH 2D7MA 4NM4H 3OMZA 3QPQD 5JLZB 2PO6D 4Y16C 5J56B 4MJ5B 1JRHL 1NEUA 3FCTB 3IFOA 3Q6GH 1AE6H 2BCKA 2XWTA 1N5YH 1DDHA 4JRYB 1XF3A 3I3BA 3HI6L 3MCLH 3MRGB 4UQ3A 1WISA 1HCFX 1OM3L 1KGCD 3U7AA 3HC4H 2IPKA 2XG5A 3CZFA 1IC5H 4ETQB 2IFFH 5F96H 5F1NB 3O8XA 5GS1C 3FT4A 2EDLA 2XKNA 4Y5VA 5FYKD 4UV4H 3U79A 5MI0B 4PJFA 3MLXL 2QSTA 4OCXH 3IAQA 1JGEA 4M93C 5HHPA 4FFWD 4LLUA 4U3CA 4NJAH 1RZKC 1UA6L 3UAJD 1JFQH 3DIFB 1XGYL 1T5WB 1OARL 1UZ8B 3QIBD 4NWTH 4OCSL 3MZGB 4M00A 1XGRB 4Y4FC 4G6ML 4X7TB 4M62L 4CJ1A 2WUCL 3GSQA 1CQKA 3MNZA 5JZ7C 4RGND 4OZIF 2YXFA 4XGZB 2QR0B 1IL1A 1P2CB 4PJ5D 1HH9B 4ZTOH 1C8PA 2CRMA 4YGVA 3QIBA 1AKJD 1T1XA 5JDSA 1NGYB 5F9DC 2G9HA 1RIVH 2A6DA 1RVFL 2OL3B 3V5HB 2Y6SC 5B38G 2Z8RA 4TUJA 1ED3A 3OB0H 3LV3B 2IBBA 3ISWA 1G7JA 4H20H 5E8EA 2DICA 1P1ZB 4M7KH 1T20A 2HN7A 4YJZL 4XWOC 3RIFK 4WW2F 5DZOA 2FX8L 3BOVA 1BBDL 3MRRA 3RZCC 4OZHE 4PP2A 4BQCA 5ADPH 4DVBA 4M4PA 2EKSB 3QFDB 2DTML 1WIOA 3C08L 5I75C 4XX1E 2LV4A 4QRTB 5DRXA 2PXYA 3QI9D 5IFHL 1WTGT 3HS0A 2C3XA 4H0HB 3LRGA 1WK0A 3VE0B 1ZGLM 3QWOA 3RWGB 2VLRD 1MOEA 2Z31C 3DROB 1F3JA 4RNRA 3RL1B 5L8KB 3W81A 3GNML 3TV3L 4GW1B 1ED3B 1RI8A 3WIHH 1TJIL 2A1WH 4I3GA 3GO1H 3T3PF 4PY7A 1YY9D 5IG7A 1JPSH 3MLYH 1WLHA 5C0AA 4G6KL 4QRSB 5JR1L 2E3VA 4JHWH 3REWA 4EUPG 5LGJB 25C8L 2F53E 1JNLL 4YHYC 5JOEA 4L29B 3TP4A 1R24B 1B2WL 4HJJL 3W0WD 3TCXA 2LVEA 3DSNA 5FB8A 3GSWA 5ICXB 4GT7A 2NZIA 1AQKH 1MAJA 5GHWL 2LU4A 4PJIA 5CZXC 1D5XA 3EAKA 1W8OA 3KPNB 2APWA 2VZVA 4XNQB 5FDWB 2OQJB 3V0VA 1UGNA 5T3XH 3V4UL 1RFDH 3LN5A 2KQNA 4LVOB 1QRNE 4ODVH 2XTJE 1ETZA 5BV7B 2WBJB 3RNQA 4DGIL 4TULL 4Z0XB 3MRLB 2AEPH 4PJBA 2P5ED 1I8MB 5HVWA 1NGQL 2NY5C 3ILPA 5F89B 3PGDA 4P3DB 3RVWC 3BH9A 3U9UB 4JY4B 4K3EL 4DN3H 1EHAA 1ZVSA 3TV3H 4OZIB 2O93L 4LP4A 4EDXB 2CDEA 2EDYA 2NYYD 1FAIH 3QDGE 3LPFA 1KLGA 3OAZK 1OWWA 3BDXA 4RMRA 1UWGL 1EEZA 2B1HL 4I13B 3SE3A 2A0LC 2GW5A 3KPSE 3CFEB 4PJEB 2AJSH 3A6CH 2DM2A 5D1QB 4DZ8B 4JFDD 5GISL 1ZA6B 2A6JB 4ZFFA 5JW5A 4A6YA 4ZOEA 1UENA 4OTXH 1ZLVK 4JGMA 1BMGA 3S4SB 4BZ1L 2IPUG 3UTTE 4EI5C 5ISZE 1CU4H 4RQQA 1DE4A 3S3SA 3C9NA 3IXTA 2CK0H 2CR6A 5E7FA 1I8IB 1MPAH 3FO2B 1A7NH 3SEPA 2KPNA 1PAMA 4P2RA 5H94B 3OKMB 3NIDF 2J8UE 3RDTB 1G7JB 4OBRA 5E8EB 5F9AC 1CE6A 4NZTH 4Y4HD 1LD9B 4MWFB 2RAMA 4P2OB 1U2HA 2YEZB 4OLYL 5BQ7B 3L3JB 4I0PD 4OD2B 5ANMB 3QJHB 1KELL 4AIXA 3JUYA 5CS7A 5FGSA 3SY0A 5F70A 3ZTNH 3OAUL 4KDWA 4LEXH 5DA4A 4P5TC 5DRXB 4Y4KA 3L95A 3M8OL 4ZXBB 2X4UA 1S9YB 4OCWL 4OD3H 2OTUB 4IIQA 5ITFB 2ADFH 2NXYD 1EHLH 2HFGH 4BM7A 3F6LA 4M1CC 4JHAH 3MLUH 1BEYH 1T20B 2HN7B 3W0WB 2Y36H 2XWTB 5TQ2H 2FSEB 4CN1A 1FFRA 4R0LC 1S7UB 5I8KL 1ZA3A 2W38A 2UWEB 4EBQH 4YFDB 2DKUA 4OZHF 3B9KB 2XN9E 4IOIA 2EDDA 2OJEA 4MA3B 4DAGH 1FN4A 1IM9B 1K6QL 1H15B 4LHUB 4WHDA 3VXUA 1QA9A 3T65A 3BKYH 3ZHKA 1Q9KA 4WWKA 1OAXL 3TH2T 1MVUA 2VISA 5I18L 1A1NA 35C8L 3IYLW 1JRHH 3RVXC 2VKXA 1AR1C 3OR6B 4M6AA 1KIRA 1QLEL 3AS3A 3DGGA 4WRLA 5CLTA 4YFLF 3DIFA 3IDGA 5C70A 1NFIA 4KAQL 2I9LB 4URTB 1KENL 5DHVH 2C1PA 1DR9A 4PJCE 4E41A 3RGVD 3EW3B 4PJXF 4HJ0D 5JLZA 3AU1B 2Z31B 3O6KL 5L6YH 4OM0L 5CEYB 5IT2L 3Q3GA 1V7MH 1JZ4A 2OK0H 3KPSA 4ODSL 1IL1B 5FF6B 3OKNA 1J1PH 2XYCA 3EGSA 4R90L 3O4LB 2GK2A 4Z7WE 4X6DF 3VXPB 4QLRA 1HH6A 4GW5A 3C87A 4ZUTA 2P48B 4I2XA 3BXNA 2K1MA 4KHTL 2W60B 3HMXL 5E8DH 2BJML 1I3GL 1M71A 4XVUD 3QRGL 1YEEL 5GSVB 3NH7H 4GRMA 4I5BA 2JJUA 1SBSH 2P8MA 1ITCA 5M94B 2J4WH 1A1MA 3RGHA 1ZS8A 2H32H 4KKBC 5A2JH 5I2IB 1QQDA 1SJHB 4JO3H 1ZT7A 3WJJC 4Y4FD 3ZKQD 4NRXA 4ELKA 1I9RL 3MV9B 3CUPB 4EIGB 3L5XH 1QR1B 5A16B 2VXSL 2YA2A 5FECA 1N7MH 2VXSH 2EYTA 4GRWH 4O4YL 3KPMB 2ESVA 1I9RH 5EUKB 3TGXA 3UTTB 4PJGE 3DSFL 1U2CA 4U6YB 3JTTA 2P47B 1NGYA 4I48A 5TJWK 4Y8AA 4QXGL 4RRPA 4Z78A 3NBNA 1UWEH 5EU6B 3FQNA 2EH7L 1BFSA 4V2BA 5D1QD 4UI2A 4HKZA 5KSBA 3CDGA 3DVGB 4GMSH 1FNSL 4NKQB 4X99B 2UZIL 3PHQB 1QPXA 4POZD 3SDAB 4HXAH 1A5FL 4Q6IB 3MJ7B 4Y89A 3BWAA 4LSDA 1UM6H 2YN3A 3KGRA 2VH5L 1L0QA 4EUPA 1PLGH 1QR4A 3RZCB 3NIFF 4JKPH 3GI8L 4QTIH 2D7OA 3GMPA 1D5MB 3QDAA 2FO4A 5IWLA 4FZ8L 3V5DB 2VXVH 2PNDA 3NACL 4NT6A 3KWWA 5F1KC 2DN7A 2P8LB 2VN7A 3OHXA 1F3RB 4JN1L 5DDHA 1A6TB 5T5NG 3O6ML 5AAWA 1LK2A 4FQHB 3U4BH 3LEXA 4WENB 1FLRH 2X7LB 1XZ0A 4Z5RA 1A6UH 4NCC2 1MCQA 3D3VD 4PRID 3NIGE 3U30B 1MCPL 2NY3B 1JN6A 2K7QA 4O02L 3GBNL 1DZBA 5TQ0L 3S34L 4XPHH 1NBZB 3DXAE 3D0LA 5I71C 1OSPL 5JZ7D 3GMOA 1PW3A 4JZJB 2Q76B 1NGXB 3GUTB 2BNUA 5FO9B 1W0WA 3D39B 1AD0B 5CEXA 4PS4H 3FB5A 2KBGA 4RA3A 3WEXA 3D3VE 2OCFD 4OZHA 3WUWB 4DGVH 2BHZA 3BPNC 3SGDI 1BX2A 3EO0B 4M61B 1OQOA 3GSNA 3D87B 3SJVB 5E2UH 3BKCL 5J1SC 1KEMH 4FFZL 2IAMA 3R0NA 5F7UA 5IIEB 5IVNA 2OI9B 4TN9A 4P9HH 4XWGL 3O3UN 4LGPB 5J6HB 5C09D 1SMAA 4N90D 3K4DA 2P42B 3MMEB 5CFHA 3EGSB 1A3RH 2ZCKL 4X4XB 4CW1B 1LO4L 2NNAA 4PJ9C 4J4PA 2DL9A 4JCMA 3BEVA 1YEGH 4X0KA 4XNYH 3UZEA 3WJLC 4CVZB 4N8CL 3I9GL 2FATL 1CGUA 3L3KA 1HHJB 5AZ2L 4NKMA 4RGNC 4E41B 2HRLA 3SGEH 2W60A 4JLRA 3UTPE 4XC1H 4YC2B 3BAEH 3O6MH 4WTZA 2Y06L 3HPLA 3P2TA 4XBGA 4Q6YA 3TPKA 4BUHA 1HHGB 1YUHA 4KY1L 1NAKH 1QD0A 1BGXH 3JWDL 2CRZA 3BPLC 3QCUL 2WINB 5I16B 3V4PH 3EYUH 4LNRA 3BEVB 3IJYA 4JFYB 3UBXG 2V9RA 4P2OA 3DGCR 3PWPB 2VXTH 2EDOA 4ODUA 4M7JL 4XVJL 4H88L 1P84K 3PXHA 1XH3B 3DX6A 4I4WA 1FNAA 1UCTA 3WFZA 2F74A 5CIPA 3IKCB 4FMKA 1HSBA 3O9WB 4HCRA 4ENEC 3LRHA 4YQXL 1G9MH 5DEGA 2HJFA 2FO1A 3QUYD 3TCLA 1FHGA 4O2CA 2B1HH 3CFDB 3SE9H 4UB0H 4M48L 4XPGL 5HDQH 2YD1A 3D9AH 3FRUA 5T1LB 3NZ8B 4HCRH 1TVBA 3PWPE 1CYGA 2CKBA 3DRTA 4LCIL 5BZWB 1OAUH 3TM6A 5TE7L 2VIRA 5DJZA 3TZVD 1CT8B 1QFWM 3SE4A 1S7SB 4X6EB 4HX1B 4PY8I 3UTTA 1UQSA 4CNIA 1S8DB 2NCMA 2VOTA 3RX8A 1S7RB 5C0BB 4HG4J 2Y9RT 4MQXC 4Q9RH 1GC1L 4YBQD 2PUQT 1RAMA 1KIQB 5F7MC 2CDEB 1FNGB 4RDQG 4UOJA 3RA7H 5DUPL 4JVUA 1EK3A 1S5HA 3V0WH 4LF3B 4QRRA 1XR8B 4KROC 1TZGL 3FL7A 4GXVH 3S36X 5KSBF 3LEVH 1HOCA 1SQ2N 3GSRB 2YUXA 4K94H 4LDLB 1MJ7H 1T1YA 3T8XB 2GYSA 4FXKB 3RWIB 1X5FA 2VXVL 1MCFA 1XCQA 1ERNA 2JJVA 5EN2A 3X14A 3DUSB 4RZCA 1RY7B 3EYQC 1M05B 3MLZH 1M71B 1MF2H 1RUQL 4PLOB 3NTCH 4J12A 3MV11 4NZDA 1IT9H 4WHYH 3BSZL 4GXUN 5DURB 2VDLL 3MRDA 1MCWM 2RCSL 5DJXB 4L3CB 1WC7A 3NABH 3E2HC 1T22A 2XQYG 4M7LL 2XWBB 3BD5A 1KG0B 1BZ7B 3S3PA 1PZ5B 3STZB 5GZND 5DJ6A 5DRWA 1VPOL 1RUAH 1QSFD 1HXMB 2J4WL 2UZYB 3NCJH 1A4JB 3BYTA 5FOBB 3LH2H 3MV8E 4S0SD 2MQ3A 3MJ6A 5DJ2A 1W0VA 1XIWB 3G9VA 4HWEL 3L3JA 1K5NA 4RWHA 4JE4B 1YMMB 1Q1JH 3U7YH 4HPOL 2B2XH 4XP5L 1Z3GL 1I7RA 4HPOH 5IQ7L 2BFVH 5E9DB 4LPUA 2GTWA 2BNQB 4PRPD 1D5BB 2MNUA 3TFKC 4RMQA 2RFXB 3TPUA 4JZNB 1DBBL 3DOSA 4LLAA 5HYIA 4MJ2A 4XNQA 5FDWA 2NW2A 3KG5A 2LAAA 5HPMA 2AQ2A 4NWUH 4IIQC 4UMGA 4XP4H 1FAKT 2Q1EA 3TA3A 4MZ2A 3GJFH 2ADGA 3BPNB 1F6AA 3BT2L 4MQTB 3VGAB 5JHDD 1AGFA 43CAB 4G43B 3P9LA 5ACMA 1FFPA 2MFNA 3CAFA 3TBSB 2DBLL 4GKZA 5ID0A 3HPLB 3MLRL 4RMTA 4HWBA 4OCRL 3JTSA 1N8ZB 4NKOA 2HJLB 5FUZL 3LKRA 4XPAL 4JFZH 2OX5A 3IGAA 2Z0BA 1OGTA 2V6HA 1I3VA 1FNSH 3RPKA 3VFRB 1FFNA 2DQHH 3ARQA 4U7SA 3V0AC 3T3PE 4X98A 4XBEL 3PUCA 1ZANL 3FO9B 3O4LA 3BFOA 4ZUVB 1MI5A 2HKFL 4XH2A 3RY6A 3RBGA 1RMFL 2V17H 4ZUUB 3RGVA 1PKQA 3EJYD 5IB5B 1PYWB 3CSYB 1A14L 2VL5A 3QQ9C 5DQJA 4ZSOB 2HLAA 4XP6H 2DJUA 1F8TH 3SDDC 4ONOA 3IJHA 4N0FA 3B9EA 3WFCL 3TPUB 4MCYB 4GRWB 1GJIA 1NJ9B 1S7RA 1QBML 4XCNB 4S1SH 4Z7QE 3AREB 4RISH 2NX5B 3E6HA 3NAAL 1J86A 1XF2B 5IROC 4U1KA 3P4NB 5F9JA 3LQAH 2BSTA 5D8JL 3MODH 4Y19B 1OB1A 5EO0B 4L8DB 4Z7UF 4LSRL 1MFEL 3UJTH 1QKZH 3ABZA 2P5WE 4V1DA 4G5ZL 3CFBA 2C3HA 3SE9L 2EKSA 4NC2B 1C5DB 4OFDA 3EZJB 1UM5H 1OP3K 5ETUB 4XNMA 2FH6A 5JPMB 3ZDZE 5TDPB 5LGJA 5D5MB 3F58H 5EO9B 4WU7A 1IGYA 4LPYA 1D9KC 1DBJL 4NZUL 1NUFA 1CDHA 4UZGA 2DWDA 3PQYE 5IUSA 5I75B 2W07A 1MCEA 3BH8B 3L7EB 3GJFK 3VH8B 1NFDA 2X70B 2ZNXA 5KS9F 5C0IA 5DJ6B 1U58A 4AIZA 1D6EA 3QQ9D 3ME0A 4FFVC 3UDWA 1P53A 3TBVB 1AHWC 4L8CB 5HPOA 2E7LC 3BWAB 5I1EL 1FNGA 3MUJA 1DUZB 5J1AA 5F3BA 3EOAB 1A1OA 1JF1B 1LDPL 1VGKB 2IBGA 1CDJA 2VUYA 2FHFA 1HQRA 5E08L 3TWCL 2YPVL 3RBSA 2BY0A 3PNWB 5BS0D 1MFBH 5FUCC 3LN5B 4PR5B 4WEMB 1DP0A 2GIYA 3AS1A 1KCRL 5DRWB 3FN0L 4F9LC 4Y8DC 1AGEA 2UYLA 1RZGB 1HILA 1CDCA 2VRAA 4XI5C 4YHOL 2XFXB 1F4WL 4KRPB 3RWEA 1I1YA 3HA0A 1T03H 3DI2B 4JFPB 5D7LE 3ZSSA 4X80L 3SGKA 3OGCB 4GBXB 4QY8A 3EUUA 3MC0A 4ZG1A 4OGXH 5EFIB 1DBMH 1T2XA 5IFJB 4TULH 1KCSH 5CD3A 3IAPA 3S88H 1RSFA 1X5LA 5TQ2L 2AXGA 5E5MB 4GMTH 5A2IH 1GZPA 1JPFB 3G5YA 4KVNH 4U2YA 4MJ5A 5LWYH 3C2SA 1H3UA 1EGJH 3ROOA 1N64H 2AJZB 3SO3B 1FVCB 4AQOA 3WEXB 3WLWC 1CLOL 1AJ7L 1K2DA 1BVKB 5DYOB 3BQUC 4FQQB 4L9LB 2OTWB 2CDFA 1J18A 1RIVL 3K0WA 2QKIB 3F7RA 3P40A 1XMWA 1NAMH 3RWJA 4DW2H 3MLYL 2EDBA 1EPFA 1U41A 4YXLL 5CZKA 5D2LA 4KKCD 3FB7A 2FR4A 1I85A 5GIRA 2I25N 5C0RL 1RZGA 4WW1A 2X7LA 3MFFA 2X1QA 4DUXA 1NANI 5DD6A 3FT4B 5JHDB 1DFBH 3JVGA 4BSWB 5C0DB 5JUEL 1EXUB 2BVOB 5ADOH 3C6SA 1XGYH 4M1DH 2V2TB 1A4JA 4JKPL 4NN7B 1WWWX 5EUKA 5INDB 1G7QA 2R0KL 2QKIA 5J12C 1LVEA 3U0TB 1A4KB 3H9SE 1X7QB 5DMKA 1JNLH 1S7TB 1JZ5A 4WIQA 5D2LB 3CU1A 3CNKA 4PD4K 4XPFL 3B2VH 4X7FC 5F8RC 4QCIA 4GG6E 4M02A 3BDBA 1F11B 3OXSB 32C2A 3MACH 1H8SA 3BH8A 4U7KA 2B8OT 4RX4D 1GAFH 4M7ZC 2JJTA 1KNOB 5GS1B 4RAVA 3MR9A 5EA0H 3DO7A 4HPYL 5T1KD 5EU4B 1MWAH 3UBXI 1Q8MA 4X4ZA 1MHPH 2CXKA 2FL5B 4EVNA 3Q6GL 2AEPL 1U3HA 5EUOE 3BVNB 4RIRA 5IFHH 3ARUA 1OL0A 1AO7B 4NOBA 5DJ0A 1A7PL 5FYLE 3T77B 5GRUL 4KK6C 5JIPA 3MRGA 3OKNB 1G84A 4M6MH 1CICB 4NHUA 5DJYB 2JCCA 4JRXD 4JREB 5D2LE 5DD6B 1XZ0B 4JLRB 3FN3A 5GZNC 5BW7A 1INEL 4MHHI 4R4ND 1YYML 2DQGH 4P4KB 4WNQB 2VSCA 3BEWA 4XB7A 5E2VL 1P4LA 3VG9C 1J8HE 5MEND 1X5KA 3HE6B 5EDXA 4CAGA 4M6NH 2PYFB 5C8JA 2RIKA 3EOBB 3TVMA 5GRVL 3ULVD 2VC2H 1AI1L 1FH5L 4F37K 4FTVA 4OZFA 3LKPA 3GRWH 5C9JB 1F11A 3OXSA 5GS3A 4F15C 3DHMA 2AXGB 3U1SH 1CXLA 1EV2E 1U8QB 5LKNA <