4YHKH

Reversal agent for dabigatran
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
222
structure length
222
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGETNPRNGGTTYNEKFKGKATMTRDTSTSTAYMELSSLRSEDTAVYYCTIGTSGYDYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSC
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aDabi-Fab2a heavy chain
publication title Structure-guided residence time optimization of a dabigatran reversal agent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 46
structure length 222
sequence length 222
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhkH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhkH01
3CSPA 1EHNA 1U8OB 4MNGA 5L9DL 5BS0E 4N0YL 2GK0A 4D9RD 1P6FA 4MYWB 4K2UH 4W68A 2V5YA 3QEUA 4WI8A 3LKRB 1DVFD 5SX5K 4X83A 1BFOB 3ILPA 4ZPVA 3MLVL 3RPIB 3RDTA 4MVBD 4XTRD 4D9QD 4YH6A 2NCMA 5FUCC 3QIWA 4OZGF 4LSSH 32C2A 4PJ7E 1YNKL 1J18A 1NMAH 3QEUB 1NANH 1KACB 1G7LB 3IDMB 1MCWM 1AXIB 3ILPB 3PIQA 3RDTB 3SDXE 1MI5A 2FGWH 2NNAA 5EU3A 3QR2A 1KLUA 4P5TA 4LLQB 1MCWW 5C7XH 3MACH 5TQ2H 1NBVH 4JFEE 5LJYH 1XEDA 3PIQB 4YC2C 1HN1A 1MI5B 4WWKD 4PJAF 5EU3B 2YUXA 4AIOA 3OKKA 5F7NC 4BFEA 3WHXA 4WDIB 3MZGB 1EHLH 4UIMA 2J4WL 5L88H 4UQ3B 3RL1B 4NQCD 5K9JL 4CADB 3HHRB 2PETA 4R2GB 2EIZA 2YSSA 3OXRA 2WWMD 2IMMA 1YEHH 5E24E 1S7SA 2ZCKL 1WAAA 3HI5H 4S0TD 3OKKB 2IJ0C 3WHXB 1YNTB 1J8HD 3KDMB 4ZO7A 1MIML 1LK2A 3VFTA 1B4JL 4XP9L 5C9KA 2YPLE 3DWTA 2H2PD 1OOAA 1DN0B 2EIZB 2YSSB 3MLTB 3N50A 3VGAC 4DTGH 4DZBA 3QB7C 3RWCB 4P2QB 3QCVH 1A3RL 4JFHD 1ZHBB 3QQ9D 4LLVA 4DUVA 3LHPH 5D1ZD 1FIEA 4ISVB 2DM4A 4TRPH 2V7NA 1NL0H 4PJ5B 4OCXH 3T0AA 3N06B 3CSYA 4JB9H 5EZLA 2KPNA 4KKCC 5FGBC 4ALAH 5GS0H 4A2MA 2RCSL 4PLKC 1MWAA 2X70A 5B21A 1JGLH 5ESVB 4ZFOA 1I1AD 2Y7QB 4WFGE 4DVBB 4NZUL 4IOSD 1R5VA 3BW9B 3OKYA 5EZLB 5D2LE 4G3YL 4HIHB 3ULUL 1RJYB 5GRUL 1D7FA 5ADOL 3MO1A 1CICD 1KTDA 3H3KA 4UT7H 1JN6A 2X70B 4LEOB 3EJYD 3WIHA 4ZFOB 5E94A 1KNOA 1K4CB 2B1AL 5FYLD 1A1OA 4JM4H 5D72L 5HGAA 4M7KH 3S3PA 3ZE1F 4QKXB 1YEJH 1R5VB 1L9MA 2Q86A 4P59H 5GHWL 3RVXC 1MCNA 5I71B 3U0PB 1FFNA 3TIDB 4YHZH 5T5FH 1VFMA 2EC9T 4CU8A 5A43C 5GGVY 4R8WH 4XBPB 1OTSC 5BJTB 3VXUD 1H5BC 1TENA 3SGEH 2Q86B 2R9HC 1NSNL 4CN1A 5IV2A 1EXUB 1FFOB 4QRSA 3LMJL 1F2XK 4HKBB 2DM7A 1ZT7B 2NY6C 1RZIB 4E41B 4U49A 4JFDA 4P2QE 1DBML 3NCMA 3LZFH 4ZUUB 4U3CA 2IH3B 4K07A 1YEIH 4QRSB 4XWOD 1SYSA 1I7TB 4GG6F 2GTZA 4NHCL 4PJ5E 1MNUH 3SDYL 2BSTA 3C8HA 4NQEA 3NZ8A 1NCWL 2DQHH 1KYOJ 5I8KL 5IFHL 1F3DH 2OL3L 5EOQL 4CRPA 5TDNA 4XVUC 4S10A 3T3MF 4TVPE 3HZKA 3Q0HA 3UZEA 5GZOD 4NQEB 1NMBH 1CBVH 2V9RA 4OFVA 4ZYKA 5IVNA 3A67L 4D9LL 2M26A 4YHKH 4Y4HA 3IU3B 3SCMA 1GGCL 1MCJA 1YMMD 3EYVB 1H3PH 3S35L 5AD0A 4JLRA 3GGWB 2A1WL 3ZKMD 3S98A 3TJEH 4JN2A 3WJJC 3FFCA 4RZCA 2OR7A 4RGOH 4MA1B 1DQLH 1QOKA 4WHYG 2Q3ZA 4Y4HB 1B6UA 3P40A 4JRYD 1N26A 5DQJA 1OSZA 4C4KO 1QP1A 3MNVA 2ZPKH 1A3LH 3U7YH 4LCCA 2N7BA 4PB0H 4RZCB 5MERA 1ZHKA 3C5ZC 3OAUL 4E41E 4POYA 1A6WL 3HMWH 3EFDH 2YZ8A 2DICA 4ENED 4RMVA 2QSVA 4F15C 1YJDC 3RY6A 3ZDXE 4JPWH 5CILL 5MERB 3W9EB 3D87B 1L9NA 1B4RA 4HF5L 4MJIB 3FCTA 5E2VL 4MNQA 3RAJL 3NIFE 5FYLL 4ZTPH 1JZ8A 4Q6IA 5C0GB 1AD9A 2VDRL 4HKJB 2XN9A 5I15H 3HI6L 3BP5A 2A9NL 2D9CA 4AEIL 2PTVA 5D71L 3NBNA 4NT6B 1PLGH 3PWJA 1T83A 3STZA 5F21B 4R96A 4U7KA 5I76B 3BP5B 2NZ9C 1A6UL 4G43A 5EU7C 4CVZA 2DQCL 2QHRH 1WBXA 4WEBL 1BD2B 3MRKA 5D8JL 2E6JA 1MCLA 1QR1A 4K3EL 2VE6B 4R96B 3MREA 5MP6L 2P43B 2P47B 3EW3B 5HHOA 4P5KB 5GGQL 4CVZB 1A0QH 4M5YL 3DYOA 3NFPA 3TH4T 4R7NA 1WBXB 3MRKB 2P4AB 1BBJA 4H88L 1MQKH 4W6XB 3WXVH 5A2KH 4E0RB 4JAMB 1CLCA 4JZOB 1KB5A 4OM0L 4QHUB 4DWHA 4Z7WA 1J0HA 4C59B 2ADIA 4NCDA 5DJ6B 5HHOB 5CJQL 3VE0A 4Q74A 1AJ7H 3LOWA 3WNKA 4R7NB 4A2LA 4XT1C 4NQDA 1BBJB 1Z6JT 5TF0A 5ICYA 4U1KB 3NAAH 2W60B 2OSLA 3C2AH 4MXWL 1VSCA 5DD6B 3WCYA 4OV5A 5FA3B 3K1DA 4XPBL 1MLBA 2PO6C 4KVNH 4BH7A 4MJIE 4EQ2A 5I18H 3HUJB 1UQSA 3BEVA 3DVNB 3I3BA 4NUJA 2X4QB 1KIPA 4BA8A 5FYKE 1MUJA 4TSAL 2Q7NA 1Y18A 1SBSH 4MS8C 3ZDZE 3C5JA 3FQRB 2ADGA 1S5IH 3L95A 1BIIB 4NFBA 4D0DA 4PJ7F 1U8QB 3BPLB 1BZ7A 3S4SG 3BEVB 3KR3H 1R24A 2G2RA 1AIFA 1KTLB 1WBZA 4ONOA 1MUJB 3AS1A 3QUYC 3VXPA 1J9CT 2VQTA 3H9SE 2ADGB 3UJTL 3GIZH 4WTZG 4JJ5B 3GSWA 4F8QA 1BD2E 3HAEB 1TTUA 1OGTA 1FNEB 3MJ8A 1R24B 3KLDA 4OFIA 2V2WA 3FFCD 2NY5C 3O3AA 4XCEA 2FJHA 5EZJA 4Y19A 2NY4C 5SWQA 3X3GL 4OJFH 2XACC 1WLHA 4NN7B 3K4AA 4TSBH 1OGTB 1INEL 1U8JB 5IROA 3TBTB 2V2WB 4GMTL 1BJ8A 3O3AB 3SE3C 4IEFB 2QADD 4XCEB 1BHGA 3RTQB 4Z8FH 1UT9A 3U7WH 3WO3B 3KYOB 5IVZA 1MRFH 2IPTH 1JV5B 2CUMA 5JORA 2FBJL 1K3ZA 3H7BA 3MC0A 4K9EL 4PJBE 3NIGE 3HR5A 3DI2B 1EO5A 1OM3H 1DBAL 3LEVH 3OXSA 4JREC 3HUJE 4MNQD 5EU4A 1PW3A 5IUSA 3ZMRA 1QFWH 4LNRA 5EIQA 5JORB 5KZCD 4NN5B 4MB5A 3P9WB 3JV6B 3PWPA 5I30L 4QCIA 3S5LB 5E5UB 3EO0A 2Y9RT 3VI3E 3PGCB 2VDQL 3ZTJH 1BOGB 5LGHH 1RZGB 3IDNA 1YECH 5LVEA 2OQJA 2XQBL 5DEFA 2ARWA 3V5DB 3OBAA 4LGSB 4GSDH 3QPXH 5HYJA 3DLQR 4WI9A 4AYFA 4HC1H 4OGYH 5IP4A 3V0WH 3SE9L 3O9WA 1QLEH 1PSKL 2EIEA 1RIHH 1J7VR 1V8HA 3FT4A 3B9KA 3OHXA 1MJ7H 2C3GA 2OQJB 1MLCA 4G5ZL 4G8GD 3KYKL 3T1FB 5HYJB 4G9FA 3EKCA 3AM8C 1C1EH 3FRPG 3GMOA 5I2IB 4LQFH 5FOBA 1T5WB 5KSBB 2FJGB 3FT4B 3B9KB 3TO4D 4XWGL 4DGIL 3VD5A 4MSWA 1L0QA 1RUKH 3WFEL 3IJYA 3VG9B 3I84A 1IC4L 3BRDA 1QSFE 5IEHA 3ULSA 2ZJSH 3GMOB 3D25A 1FN4A 1FIGH 1NKRA 5BO1H 5FOBB 3KLAA 5MHSD 5ENWA 1A7OH 3DROA 3QDMB 4NQVA 5E1AB 5DZNA 4A6YA 4MSWB 3REVB 3D48R 3JVGC 4FQXC 5E2TH 1FHGA 5FHBL 5ABDE 2F54A 3D25B 1FN4B 3HFMH 4E5XA 5AZEH 1JPTH 4TYUA 5ENWB 2BNRD 5DK0A 5F1NA 4W70A 1XF2B 5AG9A 1BIHA 3CDGB 3R06B 4X6CA 4M6MH 4NNXA 5DS8A 1RV6X 3RI5K 4YLQT 5JA9A 3D3VD 5DK0B 3HE7D 3QEQB 4JQVC 3UJIH 3HZVB 3OKLB 5HTSA 4XCCL 4QRRD 1RUPH 1FGNL 2FO4A 4QYOB 2AJ3B 3MLYH 4ZQKB 2YRLA 3QEGL 2ENSA 2WMPA 3P9MA 2W91A 2XA8H 5DHVA 3MRFA 2IFFH 4YBHA 4ZS7L 1JF6A 2NLJB 4NZDA 4YC2B 1T2QL 3NZHL 3FAWA 4JO2L 3LRSB 5EN2A 2A2QT 2MJWA 4ZNEA 2F53B 4LU5H 4P46D 1H8OA 3DRTB 3PL6B 3B9VA 1CXEA 5KSBE 4Z77A 2RBLA 1RHHA 3MRFB 1X4ZA 5KJRH 3VXTB 1Q0YH 5F1KC 1IE5A 4QOKA 1D9KD 3I50L 3L6FA 5JQHC 1TCRB 4Z7OE 4FMKA 2WBWB 4RCAA 2X42A 3RNQA 5KVGL 4XPFL 2GSIB 3SDCA 3QDME 5GJSL 4G6ML 3ZDXF 2OK0H 1OWRM 2L4OA 4QOKB 4XGZA 5JUEL 4NPYB 1WGOA 4G6FB 5FGBA 5F7MC 3BWAB 1W8NA 4WO4C 3U1SL 4LLYA 2CJUH 3NIFF 3RU8L 1ZE3C 2PR4L 3GRWL 1I1AC 5HD8C 1KBGH 2BVTA 3G6DL 4XGZB 4XBGB 1VA9A 5FUCE 3VI4E 3S8WA 1CFTB 5C09B 1E4WH 1HHKA 4OZFA 2O26U 2IGFL 2HT3D 1DL7L 3BKYH 2VERN 3B9DA 3DVIA 3W2DH 3FB8A 4PBXA 3T4YA 3QEQE 4MXVE 4YHYC 4DCQA 1KG0B 4K7PL 3AMLA 5IT2H 3K2UH 2E7LC 2YRZA 4LCWA 2YC1A 2R69H 4YEFA 5JLZA 1W2KT 4JM2D 3T4YB 4DCQB 3WEXA 3QFJA 4GBXD 3QUMA 2F53E 2R4RL 3OTTA 4UOW1 4UV4L 1R3LB 3SDAC 5C6WH 3I2CL 1BLNA 4G6KL 3P4LA 2ILLA 4FNLL 2DB8A 3TYFA 4EDWH 1MFBL 5JLZB 3NVQA 5H35B 1H5BB 4BELD 4HDIB 5EPMA 5KSAD 4IRJB 4HWUA 3F5WB 5A3ID 3TYFB 1NC2B 1AY1H 1LO5A 4QOKE 1EEZA 5DQDL 1AGDA 1NGQL 3KPSB 3IETA 3QZWA 3G5YA 2NYYC 4AL8L 1INDH 3BP4B 4DZ8B 4G6AC 4EN3C 5JPNA 4O00A 2H9GA 3EO9H 4QRQB 1KCRL 1CDUA 2HT4D 3ZDZF 4XCNB 4YHOH 5C09E 3QZWB 3H3PL 3VFWB 3OKNA 5I1IL 3GJFB 4OKDA 4POZD 4AG4L 2BY0A 1CF8L 5JO5A 3A6BH 1G9NC 1X5AA 3QIBC 3P11H 1FCGA 4X6BA 3HAEH 3TVMB 5ITFA 3RHWF 4R3SA 2OP4L 2QLVB 4Y4FD 5D1QD 1JI1A 5ESQA 3UTOA 4WU5B 3GI9H 3WJJA 4WI4A 4NJAL 2VIRA 5TF1H 5JXAH 5TPWL 3TESA 3VWKD 7FABH 3BDXA 2AQ2A 4KJWD 4OQTA 5CJOL 3LS5H 4H8WC 2BVQB 2V6HA 3EGSA 3S7GA 5GRYA 2X10A 3C5ZA 1JGUL 1VACA 5SX4H 2VJXA 1FBIH 4F57H 3VXQB 3KVQA 1ZAGA 3ZSSA 1LMKA 3JTTB 3AC0A 5FCSH 1IGCH 3ALPA 3SDCD 2ZOKA 5HVWA 1EAPA 5ETUA 3NIGF 4Z95H 3RZCB 3MA7A 3C60B 4CVXA 2FEEI 3KPSE 2ZP0T 4P2OD 4F15B 4JKWA 2AXHA 3HUJF 2AS5M 2NY7H 1N6QH 4IOIA 2DQEH 2ZOKB 4WCYL 5SWSD 3CMOL 2JJTC 3CFIC 5IQ7L 2RR3A 1TQBB 4ZAKD 2IAMA 4K9EC 4KHXH 4YHIB 2EICA 4M7LH 1U41A 4IMLA 1BBDL 1P84K 4NC0B 5GRZA 3VI3F 1G7PA 4JFFA 4HQQL 3QFDA 1KCVL 4QHKJ 4RNRA 5ELIA 3NACL 1S7WA 1V7NH 4K3HA 5IF0B 4GRWB 1UWXK 3CZJA 4RFOL 1IAKA 2R1WB 1G7PB 3BOVA 1J1XH 5FFLA 4U6TA 4HCRH 1D6EA 4JZNA 2XTLA 2IPUK 3QFJD 5FHAL 1KJ3H 1VGKB 3QQ4A 1DQMH 1S7WB 3D0VA 2B5IC 3F7VA 3K2MC 5DT1H 2ATPB 3VFMA 4GO6B 1FZJA 2JIXA 1EFXD 4UTBH 5HVGB 1NGPH 5GSVB 1TXKA 5ERWA 1NCUA 5FYJE 4HWZA 3T8XB 2D7MA 3D0VB 1FL3A 2P5EB 3VFOA 3VFMB 3MYZA 4RIRA 5HHVL 2PXYC 4NUGL 3V5KA 2YA0A 3MV8D 5ICZB 2EC9U 5ERWB 4EI5D 3BQUC 4HWZB 4HZLB 2P24B 4LHUD 1F13A 3H0TB 1IILE 3PP4H 4KWUA 4U6XA 4W4OC 3VFOB 5D7IB 1TDQA 5IMMB 2PO6B 3V5KB 4H26A 3TV3H 1F58H 3QQ3B 1AD0B 3BSZH 3GHBH 3T1WA 3A6OA 1CLOL 1R3IL 5J3HD 4MWFA 4IS6B 3QUYA 4CJ1A 5HPMB 3FO2A 5SWZD 4BSWA 1L7TL 5JNYA 3BDYH 4RGMC 3OJ2C 2E7MA 1A9BB 3SKUD 5HDBE 4ZFGH 4GRWE 3IJHB 1RJZB 2HJLB 2UWEA 3QWQB 4EZMA 3QUYB 4I3RL 2CKBA 3FO2B 1DTUA 4KK5D 5INDA 3QPQD 4DKFH 2APTA 5EU7E 2EDDA 1AI1L 1GZPA 5GGTH 4BSWB 4K7FB 3V95A 5L7XL 3HG1B 5E2UH 3DVGB 3O6ML 4LBEB 4APQB 3P4MA 3UC0H 1UG9A 4Q0XL 3SE3A 3GMQB 5FM5O 12E8L 2NY4B 3EJZD 5KSBF 4M61B 1IQWL 2QJDA 2P5EE 4R90L 4OBRA 4M4PA 1YQVH 2VXSH 4ELMA 4Z7OF 4TSCL 5I1AA 3FQWA 3RNKA 2ZUYA 1IMHC 1NBQA 3QDAA 3QQNA 4D0CB 3I9GH 5E4EC 2VOTA 1ZT4A 4NKOA 2EH7H 2EDLA 3NN8A 4L8SA 4LGPB 3L9RA 1QTYT 5D7IE 1KTRL 4ELMB 4OCNC 1BEYH 3F65A 3STBA 3G04B 3NCJH 3I6LD 4P4KD 4RFNC 1K5NA 5GZNC 3K4DA 3NN8B 1FYTD 4K94C 1A21A 3P30H 3VI4F 2DIBA 4X0KB 1IL1B 4NKIH 1K9TA 2OR9H 3BP6A 4GAJH 2KQMA 2Z8RA 5HGGS 1GAFL 3QDGE 2DJUA 4UDUB 2R0WL 1I7RB 4MXVF 1GGUA 1UXWA 4NNPL 1WCBA 2MKLC 5C0JB 5D5MB 3OKDB 4L9LC 4UU9B 5DO2C 3T09A 3NFNA 2DI8A 1HSAA 2XZCH 4MB3A 4F7PB 3PF2A 4XCFL 1RULL 1R6VA 5CZKA 5KAQG 1ZLSL 4DJMA 3HG1E 3QXDA 5F3BA 3AM8A 3RJDA 2IANA 1MEXH 1Q94B 3MJ6A 1I8KB 1R5IA 3QUMH 3TO4C 4WUKL 1FVEA 2C7UB 1A5FL 1BF2A 3D18A 4JZJC 1XZ0A 4KTDH 2HTKC 4PLNC 2MFNA 2R1XB 1S7TB 2IANB 5E6ZA 1GC1L 1QYGH 1FNAA 1JHKH 1RK1B 1SM3L 2R0LL 4OIAA 1FH5L 1F90H 4OUUA 4XNZC 5CJ5A 2XRAL 1I8MB 2MSPA 1GZQA 3D18B 1XZ0B 3JVGA 4FQXA 3U0TA 2VXUL 4CL7A 4S1QL 5I9QC 4PJEA 4LSQL 4K23L 3MOBL 1IAIM 5C2BH 4OGAC 3F7RA 4YPJA 4C58B 1TJHH 4MAUL 5GRJH 3RZWA 2CPCA 5DRXB 2AI0L 3O2VH 4V2CB 4TTGA 4OUUB 1Z3GH 3GJFH 4FTVA 1NUGA 3AU1B 3UZQA 1OTTD 4HGWB 4ESKA 4HJ0C 2WIIA 4N5EC 3UTSA 4JQVA 4NJ9H 4OD2B 2CO6B 2DQGL 3MRQA 1N7MH 2VXQH 2DD8L 5JDSB 4H25A 4MQ7B 4YDIL 1MREH 4FTVB 3LRHA 2XWJA 5DJCA 5D5ME 3MLXL 4LARH 4LRNL 5J8OA 2EXYD 5L2KA 1H3WM 3BJLA 2MPAL 2YKLL 2VUOA 3MRQB 3PJSB 2OL3B 2XNAB 4H25B 4P46C 2HFFA 1A6VH 3C8KB 1JF1B 1JZ5A 4XVSL 4TOYL 2ZKHH 5L2KB 1IJ9A 3S37H 2UV3A 5TE6H 2G5RA 3ULUE 3VXRD 2P8PB 4WUUA 4IJ3B 5IGXH 4MMXC 4HKXA 5I1LB 4KY1H 1MCHA 4Y2OA 3FB6A 2HFFB 4IRSA 1J8HB 3QJFB 1U3YA 3WFCH 2V2TB 4PREB 1YJDH 3HC4H 1FAIL 4FQIL 3FO0H 4PRIA 3ZKSD 3FN9A 4D9RE 1XF3A 4WO4A 2NW2A 1HH6A 1CDCA 1RUML 3ARXA 3F58L 3O2DL 5D1ZB 4C4KT 1FL5A 1W0WA 2V5TA 5GS1C 5DUBA 4HJGA 2XY1A 4D9QE 1EEYA 4NRYB 5CJBA 1L4IA 1XF3B 2AV1A 4WO4B 1HH6B 5HGHB 4P9HC 3HCVB 1OCWH 3MGTB 2VDOH 4H0HB 5T1MB 2PTUA 1I1AB 4HUVA 4KRPC 1W0WB 5CJXC 4GRLA 2HTLC 3K80A 2FB4H 4GRWH 2DBJA 1OAYL 4JQXC 2ADFL 5BRZD 5BW7A 5L6YH 1EEYB 2E7LA 2Y25A 4XMLL 4ZO8A 1HCFX 4GOSA 1K8DB 1QSZA 1LP9B 2CLZB 1CICB 1I3RA 5DD0L 2X4OB 5T3XL 1JK8B 5DJ2A 4AM0B 1BWMA 4AIXA 3CLEL 2YN5A 5DK2A 4YHYB 3C9NA 4HMEA 5FUZL 4Z0BL 4PJHA 5KVEL 3SDAA 4XB7A 1U8LA 3LKPB 2J88H 1U91A 2VUYA 3O11A 5B38G 1T1XB 2VLMD 1I3RB 3N1GC 4RA0C 1QFWM 1GGBL 1W72A 4NSKB 5C6TL 3O3BA 3TLRA 5FKPB 1C7SA 1MJUH 2BOBA 2R2EA 3VXUB 2OMBA 4JDZB 4PJHB 2XWTA 4I48A 2VDNL 1HNFA 1BVKA 3BGAA 4M6NH 4HUXB 4R4ND 5DRNB 1J8HE 5K9OA 1IGTB 1ZTXH 1IEBB 4LRIC 1A1MB 1W72B 5KOVC 1BJMA 2BOBB 3TPUB 3O0RH 1JPFA 3CU1A 2DN7A 3CPLB 3ETBF 3HNVL 3MROB 4JFHE 4TPRH 4XVJH 2XWTB 3EYUH 1C5DA 4EN3A 1HILB 3FL7A 2DIAA 3QHZL 1CDJA 1MRDH 4BKLA 2VABA 5I8CA 1JPFB 4N0FB 5MEPB 1QRNA 1GYAA 1JE6A 1URLA 5L9DH 4POZC 4EN3B 3QIBA 3MFFB 3VFUA 5HYIA 4U6VL 5I0ZA 3EBAA 4X5LA 5D1QC 3S3SA 1X7QA 4YZFE 3MLVH 3WXWL 1LP9E 4OI8A 5DD3H 4X4ZA 3NABH 5HDBF 3UBXB 4GRWF 4N1CA 4L3CB 4NO2A 1WBYA 5FYLE 2BNQD 1YMMB 1S9XA 3CCHB 2NY5H 4RWYH 1X7QB 5HI3C 5ESAB 1I1CA 1OLZA 1ZLVH 3KPNA 4WTZA 3VXUE 3FOLA 4WNQA 1KXTB 4WUUD 5IMLA 2VDPL 3BZ4A 4JRYB 4LPUA 3SO5A 4ZFFB 5IHZA 5D2NB 1BVLA 1F8TL 3MV9D 4IRSD 1Q9OA 4RMWA 5CEYA 3L3HA 1LEIA 1UVQA 2SEBA 4ERSH 4OCSH 3T0BA 4WU7A 5DJDA 5K9JH 5K59E 3FQNA 4U6YB 5HGBA 5IHZB 1Q0XL 5E00A 1BVLB 3PWVB 5C9JA 4K71C 3U7AA 1V3LA 1LEIB 2JJTA 1A7QL 2SEBB 5D7IF 5FM5M 3MV7D 4HX1B 1MIMH 4WFEE 5DJDB 1B4JH 4Y5VC 1MPAL 2J7LA 5KN5A 4L3ED 3Q5YA 4KKLC 3CFKA 1J1PL 4OLZH 5HYQB 1GHFH 1T80A 4YXHL 2BC4A 1WWWX 5KN5B 2MMXA 1L0XA 3OPZL 2RCSH 2GIYA 4OFYA 1YMME 3DURB 5EORL 4OGXL 1P4IL 3X14B 3OB0K 2DQFA 3AY4C 4HPOL 4KPHH 2Z92B 5DD1H 1NLDL 4N8PA 4NO3B 4JPKL 3UBXI 5ADOH 1OPGL 4RAUA 4J6RH 4JRYE 3HZYA 1H8SA 2HYMA 5D2NE 3BN9C 5IB5A 3LKQA 5T1DH 1HHHA 2Q76A 4HS6A 4MD4B 5GHWH 2PXYA 1D6VL 2GJJA 1F6AB 1CDGA 1KFAL 5IEKB 2E9IA 4EI5C 4X5XA 4FQHB 2X2YA 2A6JB 1RUAL 5IB5B 3V8CA 3FRPA 2D2OA 2Q76B 3MV01 4D3CL 3T77B 4NCC1 1MCRA 2PXYB 3GIVA 1VKXB 2AKRA 4JEGB 4C57C 5CLTA 5IVOA 4ELMF 3QWRD 4TN9A 2A38A 1NLBH 3LMJH 3WLBB 3BQUB 3PGFH 2FX8H 3WIIL 3E2HC 1QRND 4NC1C 1AQKH 1MOEA 4GAYB 4DN4L 1GC1C 2ATKA 2PTTB 2XWBB 2NY3C 1AGBB 2GAZB 3UAJD 1DBMH 4G8FB 4KRMB 3IU4L 4QTHB 1PQZB 1KPRA 4S1RL 3WS3B 4XMKL 4YJZL 5HHXH 2Z93A 4KXZH 2QQLL 5DRZA 1NCWH 3MUGA 1BAFL 5I8KH 3EYSL 3FONA 3Q1SH 5IFHH 2OL3H 5EOQH 2CIIB 5MEOA 3C6SA 5D5MF 5GGVL 4RGMB 3TN0D 5KVMC 3WDIA 1JIBA 1KIRB 5EO1A 3SDDD 5CGMA 3KPTA 4JGUA 3RWFA 2YK1L 5DFWH 1T1ZB 2E8ZA 1RPQA 1S3KL 3WUWG 3G5VA 3TBWA 3MUGB 4XX1G 3ROOA 3RVWD 2X89D 3LEXA 4Q97A 1I1YA 8FABA 4BM7A 3A67H 2GITB 1D5MA 3EJZC 3PGDA 3GMPA 4N1HB 1AXTL 1ACZA 2J6EA 4JGMA 4ELKB 4W6YB 3F6IA 2ED9A 3ULUF 1IC7L 4M00A 1DSFL 3G5VB 3QUXA 4YHPA 3TBWB 3GUTA 2QADB 1N0XL 3GO1L 3B2VL 8FABB 5DJZB 3WLWD 3LPGA 3QIUC 3HNSL 3HE6C 2DM3A 1RSFA 1X5FA 3KNBB 1XIWC 5B39A 4YHPB 3HMXL 3L3GB 3UDWC 1JGDA 4P4KC 2X41A 1HHGA 3PDOA 5CAYB 2VZVA 1ULVA 3OAUH 1RZ8B 1GL4B 5DJYB 1CU4L 3BPOB 4NKDA 1A6WH 4R4FH 5B39B 2PYEA 2C3HA 3MRCA 4M4RA 3JBG7 5F9WC 2XT1B 4EDXB 4RFNB 2VLRA 2D7TL 4QWWC 5CILH 3PDOB 1B0RA 2OZ4L 4WI3A 4L9LA 5IB3A 4C56D 5FYLH 1PYWA 3QDJA 1WF5A 3MRCB 3L3DA 2ZG1A 3QNXB 2QBWA 2VDRH 3HI6H 1CFVL 1TVBA 4XAWH 3LEYL 2VLRB 2NXZC 2A9NH 2EYRB 5FO8A 1K6QL 5D71H 3WL9B 3VXSD 4L9LB 4P48A 3PXHA 4Z7UB 4U1JA 5F96H 3L3DB 4YDJB 2G9HA 3GSUA 5DRWB 2QKIA 5E99H 3MJ9A 2ID5A 5D7JC 4JZJA 4WW2A 1NCCL 5L8KB 3DV6A 4G8GB 5DJ0A 2EDKA 4IOFD 1A6UH 2CMRL 1W72H 4OIIL 4ODWA 4QTIL 5D8JH 2AV7A 4GQPH 4U1JB 1NFDA 2Q3AA 3TO4B 4Z5RA 2QKIB 1Z5LB 3D5OF 2QQNL 3MRRA 3QI9D 4HS8L 3DV6B 5GGRB 1A6AB 5H94B 1N2RB 5GGQH 3QEHB 1P84J 4H88H 1BZ9A 4HH9B 4MA3A 4XNZB 2WP3O 2HA1A 1ZWIA 1JPGA 3MRRB 4OM0H 4OKVA 1RMFL 3RVTD 5I9QB 4JHZA 3RGVA 2BNRB 1FO0A 3MJ7B 1K3IA 1M6OB 2MWCA 4X7CC 3MRBB 2FD6L 2ITCA 4XPBH 4OKVB 2R1YA 3GNML 5B3NA 3MCLH 1G9NH 1VEMA 1N4XH 2GHWB 5SV3A 2ZSWB 2DAVA 4YZFF 1JMXA 4WY7H 4J8RB 1P9MC 1LP9F 3WFDL 4HUUB 1CGTA 2C3XA 2A0LC 1U3ZA 2VLRE 3FRUA 3OKEA 3WO4C 5C2UB 2R1YB 4I4WA 1VEOA 5CZVL 1N3NB 5A2LH 4Z7UE 3VCLB 3RY4A 4H8WH 4OZIB 3Q3GB 3D2UA 3LQAC 4G8GE 1CLYH 3CFEA 3OKEB 2VSDA 2R4SH 4P46B 2ICWA 1OD9A 3J8F7 1ZLUK 1LDPL 4LAQL 3S36H 3EZ8A 5CP7A 2VQUA 4TTDC 2GTWA 1LE9A 5IFAL 1MELA 5CMAA 5CSGA 3KPOA 4L3AA 4R0LC 5C0BA 1PKQA 4M5ZL 3V5HB 5DURD 1TJGL 3P2TA 3X3GH 3B5HA 2UZIH 1OL0A 5F8QC 1KJVB 4AT6B 2GTWB 5K59F 3LKOB 1YYMH 3QP3A 3KXFB 5GS1A 3KPOB 3NOIA 2OMNA 2FH6A 2YS4A 1UXSB 4GMTH 5CCKH 4Q9RH 1NGXA 2EDNA 3IRPX 3AS0A 3BEWB 2PYED 2FBJH 4K9EH 1S5HA 2BNRE 5CJXA 4I77L 5IM7A 2O5YL 2WANA 2VDLH 1DBAH 3W0WD 4PG2C 5IBUG 5TE7L 3U4BL 3D3VE 4OTXH 2GJ6D 2X7LA 2HFTA 3SQBA 4QRRE 5IM7B 2NX5A 2Z35A 1F4XL 2EDBA 3OJDB 5D9SA 1C5BL 3T04D 1P5UA 2H2SC 3HRZA 1NJ9A 1RIVL 3B6SA 2G5BA 1QHOA 3AXLB 4OZIE 2QTEA 3WIFB 3HPLA 2NX5B 2NY0D 1UYWH 3G08A 4O4YL 3H9HB 1KENL 4I3SL 5HI5C 4X8JA 4LRIA 3DMMD 2G5BB 1U8HB 2K3TA 3SE9H 1I75A 4HSQA 4HMDA 1PSKH 4G8EB 5F93C 4HT1H 1WVZA 1C08A 9CGTA 4DN3L 4G5ZH 1JNHA 5AWNH 3WFBL 3KXFE 3SQOL 5K9KB 5B4MC 4N1EA 1KJ2L 5EZOH 2AJUL 2ZCLH 3DSFL 1NKOA 3C5SB 4ZG1A 1G7JB 4XWGH 4HAFA 4HD9A 1LO4L 4DGIH 3DIFA 2ICWI 3QRGL 2R0KL 3RGVD 1BJ1H 3WFEH 5JA8B 1UCTA 1IC4H 5IMOA 3NA4A 3FQTA 4PFEA 3UROR 4HLJA 4JE4B 1ZVSB 3EO1A 3TYGH 4OCYH 2Q8BL 5E8NA 4LSVL 2YWZA 5F1OB 1SJHB 3GKWL 2EZ0C 5ILTH 3DV4A 2X1QA 3H9YA 4XPHH 5INCA 5D1QB 4Y4FB 2X4SB 3UPAA 2XPGB 4LVOC 3UMTA 4OSUL 3KPMA 4OLXH 1JNNL 3VWKB 5CD5C 4NO0A 4UIKL 2BVOA 4JG0H 3DV4B 3TJHC 3IFOA 5INCB 4HGMA 4LSPL 2X1XR 1JP5A 3GZKA 3MBXL 4XCCH 1WICA 2Q7YA 3TBSA 1KXQE 3LS4H 1T1WB 4P23D 1ZA3B 4NOBA 5C0BD 4G42B 1VADB 3ZKQD 3BZEB 4ORZC 1GOGA 2XIDA 1OAUL 2Q7YB 4LLWA 2UZXB 4JO2H 1A9EA 1YNLL 5J11C 4PRNB 1WV7T 5T33L 4PJFB 1E4KC 2OTWA 1L6XA 1H3XA 4XXDB 1FV1B 1ORSA 1S9YA 2NMSA 4Y5VA 4LF3B 1NBYA 4P2OB 3KJ6L 1Y6KR 4JQIL 2IADA 3P0GB 5FB8B 4K71B 4FFWC 3CFDA 5EDXA 1I4FA 4MB4A 5HI4D 5GJTL 4ZAKB 3GMNA 3RKPA 2OXGA 3C6LC 4WFHD 4M8QA 4J7RA 5KVGH 4MA8H 1ORSB 4XPFH 3SPVA 4HUWA 5GJSH 1EV2E 2UUDH 4X98A 2BVUA 4KI1A 5E2WL 5DD5L 5JUEH 4L5FH 4J23A 4QRPD 4YXLL 1XF4A 3VRJA 3GMNB 3MRIA 4O5LL 1EBAA 4LCUA 4IM8A 5KSUA 2PR4H 3AY4A 4MCZA 4X7TB 4NM4L 1XFPA 4LASL 5GS3A 1WK0A 1DBJH 5CBAA 1E6JH 3VXMA 5GGSA 3MRIB 4O2EB 4OM1L 2VITA 4MJ6A 2BXYA 4MCZB 1KLGA 5I16B 4K7PH 4KKAD 1CD9B 1EGJL 1S8DB 2W0PA 3MJ9H 4QXUL 3KLHC 5DVMA 2VRAA 1MCCA 4WTWA 2VITB 4MJ6B 1JVKA 4LLUB 2W0FA 4PJFE 1LD9A 1FRGH 4G6KH 3DYMA 1N64L 4EI5B 1MFBH 4PV9A 4MNHA 4LSUL 1XH3A 3OQ3B 4LHUB 43C9A 1TTFA 3JV4A 5FAAA 4QXTB 3Q5TA 5SWSE 1RU9H 2EYSA 5DVLA 3OJVC 3O3DB 4KFZC 4JRXB 1C16A 2D7QA 1CVRA 3E2HB 2YXFA 3MLSH 1F3DJ 43C9B 5IG7A 3JV4B 1NCBL 4XNQB 1NGQH 3HI1A 4NQSB 4U6HA 3ZKND 4XZUB 3WFHB 1FL6B 5SWZB 1NFIA 4HEPG 1WWAX 1OP3H 3TZVD 3ES6A 4UMGA 4NNYA 1CDYA 1E28A 2HMIC 1RURH 3DECA 2DDQH 3KYMB 3W9DB 2BZDA 3ZHKA 3H3PH 3E6HA 5I1IH 4AG4H 1CF8H 4Z7UF 1A6TB 2ADJA 5E8EA 4HH8A 1CR9L 1U8IA 1UM4L 4NNYB 3X3FL 1E28B 2KL6A 5J6HB 4UI2A 3EHBC 3E6HB 1W0VA 3DETC 2LAGB 3QIUA 4NJAH 3WLWC 4DUXA 1SEQL 3HE6A 4LOUC 5E8EB 5IB2B 1U8IB 3NCYS 2EH8L 4FQ2L 5CJOH 3UDWA 3MV8E 4HULB 4KKNA 1EX0A 3QIUB 4ZXBD 1AQDA 3HE6B 1QSEA 4BK4A 3DUSB 4L8BA 5C0CA 2I9LA 5IBTL 4BZ2L 1XIWB 4N9GA 1MHPL 1KT2A 4D8PB 1GGTA 4QY8A 3V6ZB 3DOSA 5LQBL 3RWHB 4JRXE 4MMZC 5DFTA 4PJDA 4P4KB 2OI9B 5JHDA 1AQDB 4P9HH 1FYTB 1Q9KB 2H3NA 1DZBA 4L8BB 2VKXA 2I9LB 4KKBD 2AGJL 4PRHA 1IGFL 3HPJB 5ITBL 2A74B 4N9GB 4LSDA 3JV0A 3RWDA 3LKNB 1KT2B 5IHLB 5SWZE 2DQDL 3UXFA 4KUCD 2FX9L 2OJZL 3ARED 3L5WA 4YX2H 3AFLA 4GW4A 3CMOH 3RWGB 4HIIB 2EIBA 5IQ7H 2ZUXA 2BHZA 3QT2A 3JZ7A 3G9VA 2ZUQC 3VXMD 3QHTC 2N7AA 2DRUA 2H1PL 1V7ML 3BRGC 5D7JA 1KSRA 3T08A 1IEAA 3P73A 3FQXB 2NXZB 2APWA 1KCVH 2FL5A 4YPGA 4OZIF 5GRXG 5HHPA 1XGTA 4AH2B 3U0WL 3NACH 2F5AL 1ZSDB 1SBBA 3T3PE 4JY6B 5CUSL 5D7JB 1SMAA 4OZ4A 4PYGA 1WZKA 3P73B 4X6FB 3QI9C 4FFYH 1GSMA 3O4LA 1FGVL 5FHAH 1XGTB 4HXBL 3B4NA 3V6FB 1GGIH 4ZUWA 1VERA 1TJIL 2Z91A 5BMFL 3F7YB 5AAWA 3BKCL 3O4LB 1YPZB 2NR6C 4L4VD 5FGSA 3H42L 3P0YH 3SEPA 3T65A 4U3XA 4N9OB 3RBGA 3EOTL 2Z91B 4WTXA 3I6LE 3P0VL 1PG7L 3UTQA 1FYTE 3JWDL 4Y1AD 2BOCA 4Y2DC 4JFYB 1CD1A 5DQ9A 2HJFA 1CFNA 3T65B 3QCTL 1UZ6E 1NAMA 2YWYA 1P9MA 1G0XA 2WUBL 1CFSB 4WV1B 1QEWB 3FZUC 4FABL 1DBKH 2HKHL 4PJXE 5CIPA 3FHAA 1XGYL 3IXAB 1X44A 1CI5A 2VZ3A 1CLOH 3IDGB 2XZAH 1SJVA 3PHQB 4YEEA 3SKNA 4YDLC 1MY7A 1IM3B 3GMRA 1KC5H 2MCPL 3BIKA 5EUKB 1XGPB 1L7TH 3X12B 4UAOC 5F9DC 2HJKA 2HN7A 3QCUH 4NIKB 4Z76A 3UJJL 5BQ7A 4CW1A 3MRHB 1RUQL 3VXRB 3ZL4L 4NFCA 4HS3A 1BMGA 1VCAA 5FM4A 1AI1H 2Y23A 5T3XE 5L7XH 2IG2H 4F7CB 4NWUL 5EIIA 1QFHA 3JTSB 3O6MH 4R0LB 5J6GB 1CGUA 1YPZE 3WMSA 3VFVB 12E8H 5E8OA 4IMKC 1SY6L 5CP3H 4OLVL 2EDXA 4OB5L 5C71A 2N4IA 5E70A 5DA0B 2R23A 4KJQD 5EIIB 5JHDD 2CGRL 4QT5A 1MCQA 1HEZB 1RVFH 4PG2A 3FTGA 3WSQL 1VESA 2BY2A 2R23B 4NQTA 1P4LA 3TA3C 5CWSA 2RFXA 5BRZB 3MA9L 4U1MA 1G6RL 3VXOB 4KJPD 5CD3A 3FTGB 3RX7A 4PR5B 2ORBL 4PGCA 5EWIL 1LEGB 2I25N 2IQAA 1WEJL 4WI5A 3EOBA 2NW3B 4U1MB 3T2QA 2JCCE 5C0FB 4P2CG 2EEBA 2VH5L 5CD3B 1T03H 1G7QB 5CKGA 1JFQH 4PGCB 1MAKA 3BH8B 3VXRE 5HVHC 5F7LB 1JHLH 3EOBB 4TQEH 1JYNA 1TVHA 2ZNWA 4OLUH 4MJ2A 1ZLSH 4YHNA 1VPOL 5C3TA 3NFSL 5I1CL 4V1DD 4PJFF 3ZTJG 3ROLA 1IAOA 4Y5YC 5DSCA 4PJ9A 3S34L 3S35X 3HRPA 2WZPD 1A5FH 1ZLVK 5DJAA 2DM2A 4YHNB 2LTQC 1H3UA 1HINL 1KPVB 5IR1B 2GUOB 3GB7B 2HG5A 1FFPA 5JPMA 1U8PA 1GC1H 4O02L 3ZHDA 1SM3H 1IAOB 2CXGA 3ROLB 5A2FA 1YN6A 4QHMA 1S7QB 3RIAK 4MQXD 2HFGL 2VXUH 4S1QH 4N0UA 4LSQH 3Q48A 4K23H 1MQ8A 2CLRA 1FFPB 3RVVC 4ODUB 1XGRB 5BRZE 4MAUH 1YY8B 1X5KA 2AI0H 1YN6B 3VFPA 4PJ8C 2XKNB 1EHXA 5J1AA 4QHLA 5TQ0H 4U1GC 2A73A 3MBEC 1XCTA 4X4XA 2BNQB 3CVHA 3MRJB 5C07D 3MODL 2F58H 4PD4K 4KGLA 2DQGH 2EEAA 4LVOB 3VFPB 4I13B 2YD9A 2VLME 4AEHL 4YDIH 5C0DB 5J1AB 4QHLB 2WK2A 4R97C 2NXYC 3MLXH 3LN4A 4LRNH 2QSCL 2AJXH 4PRPA 4MA7L 2VLKA 3D0LA 4GUPA 4GQ9H 3WUWA 2MHAB 3MV9B 4PGZA 2X4TA 2BJML 4TNWF 2EKSB 5ADPL 1FNGA 1NGYA 3PWLB 1E4KA 2V17H 1G0DA 4HWEL 2LU3A 4O51A 3U79A 3VA2C 1L7IH 2A9ML 1TNNA 2JB6B 4Y0GA 1G7MA 4L1HA 2X4TB 1ADQL 5J11B 1YEEL 4MLSA 5HI4C 1FNGB 2HRPL 5F1IA 3C6LA 2C1PA 3MV7B 5FUOL 1KELL 4MCYB 4ZUTB 5B8CC 1WFTA 1N5YH 2ZWLT 3QUZD 4OZHA 3WD5L 4KZEL 1FFQA 5C0AA 4NRXA 1FZKA 3R0NA 2V2XB 2LV4A 1AKJA 1BM3H 3O2DH 1XGQA 1NCDL 3HLAA 3B83A 5I75C 2O61A 3BD4A 1S78D 2X4NA 2UYLA 4GKNA 2OM5A 3GI8L 4TULL 5JTWA 5C0AB 5I73C 4NRXB 5JMRA 2BNQE 1AKJB 3P9LB 2LU7A 2I26N 3HLAB 3V0VA 5ANMA 1U58A 2X4NB 1N6VA 5F71A 1FSKC 1FLRL 2ADFH 4K7PY 3LN9A 3O6FD 1G9MC 3CIQA 5GGRY 3U4EA 4WJ5A 4ZNCD 5T3XH 3CLEH 3T3PF 3MV9E 1QFOA 4LP5A 4P0DA 4Z0BH 5HYSA 2VLLA 3U46A 3LN5B 4NGHL 4YE4L 3BKJL 5ISZD 1UWEH 1NC4D 2VXTL 4PJCA 4LLMB 3KPLA 2AEQL 4M1GL 5CHNB 3T2NL 4WJ5B 1GGBH 1UENA 4PJ9D 2R0ZL 4TNVF 2AK4A 2C1OA 2VDNH 1YC8A 1C8PA 3BO8B 3MV7E 4CMMA 3V52H 1JZ6A 1OAZL 3KPLB 4ZO9A 4JKMA 1FNSL 1OHQA 2HWZL 3D85D 1C12B 3PHOA 4L3EE 1IM9A 3ZKNC 4NZRH 1A4KA 2CDGA 3KS0J 3NMEA 3O6LL 4CU7A 1GIGH 1TNMA 1UZ6F 3VXNA 2GFBB 5C0IA 4HIXH 3ARFD 1YN7B 2P1YA 2WP3T 3EZJB 3BP7A 5FO7A 2X4PB 4U1HA 5DLML 3SE8H 1IC1A 1A4KB 1O7VA 2OLDA 3T0ED 2B0SL 3IDIB 3SDDB 3VMNA 3L1OL 4U6VH 1QVOA 3O8XD 4BQCA 1G7HA 1BQHB 1ZGLB 5IB4B 3WXWH 1U8NA 3LQAH 3QXAA 1NCAH 1SMOA 1VB9A 5DWUL 5TFSL 1FE8L 4OFDA 1A22B 2MTPA 1WZ1L 1J10A 1JTPA 1U8MA 2VLKD 5DA4A 5E6YA 2IBGA 3GSNL 3U36B 3VDAA 5I1DA 5J13B 1G7HB 3QJHA 4NWTL 1U8NB 2LQRA 2FHBA 2WQ8A 1FYHB 1ZS8B 3RKDC 4FQQA 1S9KC 2Y6SD 2G60H 4I18B 3UTTA 1MAML 2VDPH 3TNNA 1YPZF 1BREA 3HAEG 3TT3H 1F8TH 1X5GA 5ACZB 4IBLT 5E6IA 3CFBB 1G7IA 4HK3N 1TZHB 4UBDC 4ZUSB 5IBLD 1HDMA 1QA9B 4ODVL 4ODSL 1B0GA 1Q0XH 5J9PB 1G7IB 2DOCA 2AJYL 1ODAA 3KWWA 2AK1H 3CFJA 1A7QH 2E9BA 2ZUUA 4B41A 2A77L 5BZDA 1VGEL 3GMLA 2RB8A 3TBYA 1CXFA 4C56B 1F4AA 1UA6L 4LCYA 1BZQK 1T0MB 3NCEB 4NQUA 4K3JL 3DX7A 2E6PA 5KTEL 4EBQL 3L5XL 4NRZA 5D7SL 3CX2A 1FVDA 2IH1B 1J1PH 3GMLB 4MD0B 4RQQB 3MNWB 5D6DC 4DGVL 2BNUB 2ZUQB 4YXHH 3FMGL 2VWEC 5TDPA 5E9DD 3DX7B 2RHEA 3THML 3OPZH 4OFKA 3MRGA 4U33A 4PLJD 3S5LG 3GJEA 3IJSA 4OGXH 3V4VL 4V2BA 3FOMA 5IFJA 4HPOH 2BFVL 3VGEA 4OV6F 3P4OB 5TDPB 4P2YA 3QI9B 3CZFA 1CXIA 5FYKU 1UADC 1KEML 2AERT 1BQLL 2QR0A 4OZGA 2I24N 4XH2A 2D7PA 4CU6A 1DUZA 3UPRB 4F37K 3JWOC 1D6VH 4Y2DA 5EG6C 1RHFA 5DFVC 5IKCA 5F7EL 5F88A 4JKPL 4G80A 4UB0L 1RUAH 1HXMB 4TUOA 4NM8L 4D3CH 1UM6H 1A6ZB 4AZ8A 5F7KC 4Q2ZA 5JZ7C 4PJAA 2CRIA 4C56E 2DJSA 1JBJA 1KJ2B 5I66B 4TUOB 5BVPL 1M4KA 4N68A 1RZJL 2DQIL 3BGMA 4D2NA 3RFZC 2CKNA 5CFHA 2DWDB 3VXSE 1ETZB 4JPVH 4XMKH 5HYEA 4NBZB 3B2UD 3CVHH 2X9WA 2HLAB 3BUYA 3MOQA 4XHJC 4YDLB 1U95A 2QQKL 1BAFH 1EH9A 3EYSH 1ITCA 3BGMB 4KZDH 1U3HA 5GGVH 3IKCB 3TBVA 4UAOB 5H37H 1NEZB 2YK1H 3T0VA 4H1LB 4RDQG 1AP2B 5DEGB 2VLJA 4TUKL 4YHML 4MAYC 4CMHC 4LK4A 4K7PX 4HFUL 4UINH 1JL8A 1AXTH 1Q38A 3SKMA 3WKMH 1U36A 1IC7H 4XC3L 1J0KA 1DSFH 4X7SH 3ILQC 1N0XH 1RJLA 3GO1H 1KPUB 4HKZB 3BVNA 3DX9A 1H0DA 3HNSH 1T5XB 3FT2A 2P5WB 3TA3A 1ZGLP 3HS0B 1A7PH 1Q9LA 2XTJC 4GXUN 1YEDB 1KOAA 1S7XA 2VSCA 3G5XB 4K3DL 4XXCC 3W0WB 1IBGL 1EVUA 3BVNB 3DX9B 1H0DB 4Y16C 4S1SH 3T0WA 4L4JA 1QRKA 2I07B 5KSVA 2VO5A 1J0IA 2GJ6B 4ZFZA 2F74B 3QG6A 1CU4H 4KHTL 2VISB 5D93C 5IOPA 1Q9LB 1T0NA 2A6IA 3TFKD 3PNWA 3IVKB 2FIKB 4NKMB 4BFIB 2YPKA 4JFOB 1I8IB 5I1JH 1HH9B 5CGTA 4ZFZB 4XBEH 2NY0B 4MZ2A 1IGIH 5IESL 2EKJA 2Z4QA 1TETH 5H2BA 2ZZUT 1CFVH 4YBQD 2YPKB 3TWCL 1EERB 5GRVK 4DVRH 5I1GL 4F3FB 1K6QH 3C08L 3DMMB 1QR4A 1UACH 3PWUA 4GG6A 5HVHB 5D7LD 2ZOLB 4Y5YA 5BXFA 3WV0A 2OJEA 2H41A 4XMPL 5C08A 3V4PL 1DLFH 1HXYA 5H2BB 2BHUA 4P5MB 4NQXB 2DLFL 3EYQC 2CMRH 4KVCL 4YUEH 3OGOE 4GG6B 4QTIH 1NAKH 3PG2A 4H20H 5BXFB 4HFWB 3IXTB 5C08B 5I1HH 1P69B 1R3HB 2JK5A 2QQNH 4HBCH 4LPTA 3B3IB 2EDEA 3J7HA 4HS8H 2EDJA 3W11D 4AIZB 2P5WE 4UQ2A 1ND0A 2YA2A 4QGTA 5DHYA 2X4RB 3Q2CA 4FQPA 5EU5A 3UYRH 1Z0MA 3W0WE 2A83A 5GS2H 4PJ8A 5JXEC 4KRLB 4JCLA 3MOAL 1TITA 1JRHL 2PCPB 1RMFH 3IGAA 4GKZA 2GJ6E 1B2WL 1ND0B 5KBNC 1S9VB 3MBEA 1XAUA 3IDUA 3I3EA 3IDYB 5DI8A 2APFA 3BT2H 3V7MA 1ES0A 3M8OL 2LVCA 3P4NA 3CX5K 5BV7C 3KPRD 2VDMH 2FD6H 1GRWA 4M1DL 2FX7L 3GNMH 3IGAB 1NANI 1R5WA 4U1GB 2UUDK 4JFQA 3MBEB 1E27B 1BWWA 2Y5EA 1FPTL 4X5WA 4GG8A 5DI8B 3CNKA 1X4YA 4K8RC 2WIMA 4QHNB 3OR6B 1JGVH 3OL2A 1YYLH 3MUJA 1R5WB 3M1BA 1D5ZA 4P23B 2NXYB 2DYPA 2VLJD 3QZWG 1LO3L 4MD5A 1MCDA 3HNTL 4XRCA 4GG8B 5K33A 4UILL 2FR4B 2DI9A 2VL5A 3EOAB 4EI6B 4DAGL 1XGUA 5C0EA 3PQYA 4YQXL 1LDPH 4LAQH 1D5ZB 4M7ZC 2DYPB 5JW5A 4ETQA 5FGCB 3MSPA 4XRCB 1GH7A 1OGAA 4P2RA 3QBTB 5L2JA 4IHOB 1HNGA 4M5ZH 3E6FA 4CN4A 4YAQA 3ARDD 3CK0L 3EYOA 25C8L 4ETQB 2EE2A 5B8CB 4JHAL 4P2RB 2CK0L 4F33A 4X6EB 1RZKL 4WENB 4YXKL 2FWOB 4QRPB 4QRTA 3BHBB 2H6PB 5ID0B 1QSVA 5LKNA 3V9FA 4YAQB 4Y4KC 3EYOB 4L4TA 2CLVA 4LL9A 1RAMA 5KVFL 5I75B 1QBML 1BECA 2O5YH 3GHEL 3DRQA 4PP1D 2HAZA 1P7QB 2HKFL 3PABA 4QRTB 5I73B 5EO0A 1CL7I 2CLVB 3BMWA 3U4BH 4DK6A 3QH3B 4DW2L 4HK3J 2IQ9H 3D39A 1FSKB 3DRQB 4UUJA 5BS0A 3N1PC 2I9TB 5AG8A 1CIUA 4FXGB 1ZA6B 2YXMA 2HVJA 1CDIA 4MDJA 1N59B 3CVIL 1RIVH 4NO5B 3S88H 1MIEL 5A16A 5E8PB 4EUPB 1EAJA 3ARSA 5CBEA 5EFIA 4ZDHA 2AJSL 4O4YH 1KCSH 4PLOB 4WW1A 1DCLA 4I3SH 5FGCE 1NGZA 4LIQL 5GS0D 2HVJB 2XG4A 3PWNA 4PJ7A 5HVFB 1JPSL 1QD0A 3LKSA 2HLFC 3D9AH 1I85C 5A16B 1H8NA 3EFFB 3SDXA 1ZANH 4DN3H 4WW1B 3ZE0E 4WFHE 3KPPB 5DYOA 3WFBH 3FB7B 3DBXB 1JHTA 3MUY1 1XF1A 1J0JA 2DLIA 3IDXL 3I3DA 4JFEA 2AJVH 4JO1H 3MR9B 1EO7A 1KJ2H 2AJUH 3C87A 3Q6FB 3SY0B 3QULA 3DSFH 5E08L 4QRPE 3DNKA 3SDXB 3TEUA 5FDWA 4NZTH 2YD7A 4JFPB 5LAXA 3TZVB 2PW1B 4RMQA 3PP3H 4JFEB 1HIMH 3QULB 3RP1A 4K2UL 2XOTA 1F4YL 1CT8A 3CGTA 5FDWB 1ZEAL 1VENA 4G6JL 1F02I 4LSVH 3O4OB 2CD0A 3GKWH 1KTKE 4YGAB 4M1CD 2XZQL 2YPLA 2XY2A 4LSSL 5FF6B 3D6GA 1U8OA 2R2BA 1NMAL 4DQOL 4KK6D 1MCEA 4OSUH 3LKRA 1JNNH 4X7FC 2FGWL 2DKUA 4XNUH 2FLRT 3RPIA 5EBGA 2YPLB 3ZYJA 4LSPH 5C7XL 1M71B 3MACL 1UH2A 2R2BB 4S1DC 1WUNT 1U93A 3CDYA 3ARGD 1FCCA 1U2HA 3B9AA 1OARL 4PBVC 4ZXBB 4KI5D 1I1FA 1G7LA 3IDMA 1CDHA 2VYRE 1CLZH 1TCMA 1KULA 1XR8A 5L88L 1U93B 5D2LA 3ZHLA 4LLQA 1YNLH 5BCAA 3HI5L 1I1FB 4PD4J 4U0QB 2KH2B 4U1NB 1P7KB 2H32B 3MRDB 1P7HL 1XR8B 2YD3A 1OTUC 4OCWL 2R56H 2IWGA 4L4TD 5FKAB 5D2LB 4BH8A 1SJXA 4WDIA 4DTGL 4XNMB 4UQ3A 3RL1A 2WBJC 3QCVL 4CADA 3RIFK 4E42B 5D6DA 3WS6A 2DTML 2D03L 2LFGA 2CIKA 5JOPD 5J12C 5EU6D 5JHLL 4KMQA 1P53A 4TRPL 5E2WH 3PL6C 5DD5H 1NL0L 4BH8B 4OCXL 5FYJU 1RD6A 4YXLH 1YNTA 4JB9L 3KDMA 3ARQA 3GBML 3UZVB 4O5LH 5GS0L 1DN0A 3MLTA 2X9XA 2MOVA 5BS0D 2CIKB 3RWCA 1JGLL 3NCCB 4P2QA 3DO7A 3MXVL 4YFDB 2GSGA 5T1LD 3H2WA 1ZHBA 1IAII 1YA5A 1I8LC 3V4UH 1AR1C 4ISVA 5ALCL 4HJJH 4PJ5A 5JW4M 1I7UB 4HUNB 4D94A 4BJLA 3DO7B 2GSGB 2RQ8A 1KXVC 1JZ4A 4JM4L 4LDOB 4PY7B 4M7KL 4J3XA 5ESVA 4P59L 4QXUH 2Y7QA 2X6MA 4DVBA 5CGYC 4L4VB 2APXA 3ZYZA 4GXVL 3BW9A 5T5FL 4YHZL 4BQ8A 4HIHA 3GEWB 1RJYA 3LPFA 1C5CL 5F7HA 1EZVY 4M48L 4LEOA 4Y1AB 1K4CA 5AUMA 2Y36H 1N64H 1CL7H 2B7DT 3CH1B 5D1XD 2EE6A 5DMGC 5I8EB 4LSUH 1N0LA 5ID1A 1AO7D 5GGUB 1B88A 1NUDA 3GM0A 1HWGB 3G5ZB 4MXQC 3U0PA 3TIDA 4HC1A 4J4PC 3OX8B 1X6LA 4KQ3L 5AUMB 4XBPA 1SJEB 5ALBL 4OLWL 5BJTA 1NPUA 3ARYA 1YEIL 2ITDA 5ID1B 1VFAA 2AABH 1EXUA 1NCBH 2BDNH 1FFOA 4HKBA 4M6OH 2DQHL 3LRGA 1ZT7A 1JWMB 3E8UL 3EUUA 1RZIA 1UH3A 4E41A 4PUBL 1P2CB 2ITDB 3CJJA 1VFAB 2VWEE 4ZUUA 1DQJB 4AMKL 4MAYA 2J1KA 2IH3A 1NBZA 4H5SB 4IRJC 5FK9B 3X13A 5AAMA 4B7LA 4F58L 1I7TA 3DHMA 1NMBL 3I02B 4HHAA 5CLWA 2J8UB 1FJ1A 5C6PB 1MF2L 2R8SH 4RX4A 1UM4H 4MAYB 1KF9B 3VWJC 4AENB 1NBZB 3X13B 2ZG2A 4CMHB 1IGJB 1V3KA 4L4VE 4P3CH 3CU7A 4HHAB 3AMKA 3IDJB 3SJVB 2Y72A 3KJ4C 1FJ1B 3RDTD 3WNMA 3WFZA 3QIWD 4R4BB 2HT2D 4YO0A 4PP2B 4FQ2H 4H0IA 4Y1AE 3FQUA 1OLLA 4X9HA 4XXCA 3UP1A 1U0QA 4MJ5A 3TVMC 3IU3A 2VR4A 4I1NB 1A3LL 3RWEB 4YIQB 3EYVA 1MI5D 4Z7VB 4PB0L 3GGWA 4BZ2H 1WIOA 4P5TD 2CDEB 1MHPH 4YO0B 1CDBA 2XTJB 4U1IA 4X9BA 1IT9H 1F97A 1QFWI 3FQUB 2FEDD 4KMTH 5JW4R 4QLRA 4R2GD 2AEPL 5TH2B 1UFUA 4MJ5B 4Y16B 5SX5H 1XR9A 1CD0A 4Z9KB 4NBYB 1IAMA 2AGJH 1SQ2N 4DKEH 1IGFH 5ITBH 5D93B 4U1IB 1JNJA 3PV7A 3TNMB 4ZTPL 2AVGA 2OJZH 4MX7A 4YDKL 1G9MH 1XR9B 4ZODA 4FQLL 1JNLH 1MVUB 1OF2B 1PLGL 3W9EA 5B38B 2PN5A 1E4XL 2J8UE 4MX7B 4UZGA 4DGYL 4MJIA 3RZCC 3ULVD 3C60C 3DHJA 1UH4A 1S9WB 4LLDB 1N8ZB 5C0GA 3U0WH 3ARBC 1J86A 4HKJA 1AGEA 4V1DB 2QHRL 4F9PC 3RUGE 1DEDA 5CZXC 5CUSH 1TQBC 2XKUA 3SJVE 4NT6A 4PGDB 2H26B 1FGVH 4I0PC 3VFRA 5DGQA 4DOHB 1T3FB 1AGEB 1A0QL 5I76A 3ZE0F 3DXAB 3H9SA 1A4JB 3WXVL 3PV6B 4N0CC 4Z7VE 1LILA 1BD2A 3A6CH 3DX6B 3FB5B 3VFRB 2XTJE 2VE6A 3EOTH 1AJ7L 3P0VH 3H9SB 3NAAL 5GIRA 1U2CA 2Y5TB 1IAIH 1M7IB 4P5KA 3L5HA 2CSPA 1AHWC 4HUKB 2P48B 2CH8A 2V5SA 5F7YC 4G7VH 4UT6H 4E0RA 4JAMA 5C07B 4JZOA 3RGHA 4DEPB 2WUBH 4QHUA 1YQ2A 3RPKA 3SE4A 5BV7B 5GIRB 5DJ6A 4HK0B 3OV6A 2IBBA 4PJBA 4U1KA 2W60A 3W5NA 1S5IL 2OCFD 3DPBA 1SYVB 4GKSA 3F7QA 2YZ1A 5DD6A 1O5DT 5FA3A 1WSST 2YD2A 2VMFA 2MCPH 3HUJA 4JFDD 3DVNA 2X4QA 4PJBB 43CAB 3SGJC 3I6GB 4V1DE 4GKSB 3UBXG 3FQRA 4FA8A 2L7JA 1HZHH 1BIIA 1RUQH 2C9AA 3ZL4H 1U8QA 2FLBT 4NQED 3UX9B 4KROD 4M7ZB 4DOHE 1KTLA 5EZIL 1UB6B 2BRRL 2VC2H 4XI5D 1CE6A 2DLHA 4OJFL 3GSNB 4TSBL 4XPGL 5EO9B 3DXAE 3U9PL 3QUZB 4BQ9A 2AAVA 4JJ5A 5DDHB 4XCYB 3N85L 3ME0A 4JKLA 3HAEA 4ONHB 1FNEA 4Y4KA 1SY6H 3S96B 4OB5H 4JDTL 3SDXF 3DGGA 5HSFA 1CE6B 2AJZB 1MRFL 1BFVH 2CGRH 4Y4HD 3W81A 2K7PA 3SCMD 2VTFA 3GMMB 2B20A 2DQUH 3ULVL 1EZVX 1U8JA 4Y4KB 4F2MA 4RISH 3QO0B 3TBTA 3CFCH 5C07E 3WSQH 2LVEA 4APQC 3DGGB 3RTQA 2WWKO 2ED7A 2XKSA 3KYOA 3GBNL 1H3TA 1JV5A 3O6FB 3SKOB 1QSFA 1FORH 4F2MB 3BH9A 3V8OA 1MWAL 1HWHB 4ZFOL 3RL2A 1BGXH 1YECL 5ISZB 1NC4B 2VH5H 1QSFB 4JDVB 5EIVA 3JV6A 1JTTA 1KGCD 3BH9B 4GSDL 3BPCB 3QPXL 3BX7C 1I85A 1XMWA 1S7RA 3S5LA 3FT3B 4HW6A 5I0DA 3WIHL 3V0WL 1P6AB 1QLEL 3RL2B 4XP6L 1RIHL 3L3IB 3PGCA 3JWOH 1MJ7L 1BOGA 4TVPH 3O41B 1RZGA 2CO7B 3QO1B 2XN9D 1VPOH 4OLYL 3NFSH 3D85B 1S7RB 3V5DA 3GSXB 1C1EL 4TUJB 2E9WA 1BJ1J 5DUPH 5C8JB 2Z31C 4QNPE 1MCFA 4Q58C 5J57B 3S34H 5J0BA 4F9LC 2CUHA 4X9FA 1QLRA 2X40A 1JZ7A 5D2LF 4X4YA 5D70H 2ZJSL 1PDKA 4O02H 3VFSA 5BO1L 4HCRA 3SOBH 3T1FA 3LVEA 4EVNA 3VFGH 5I2IA 1QLRB 5KSBA 1FFRA 1T5WA 2FJGA 4D0BB 5A2JH 1IARB 5JIIA 2YN3A 4X4YB 5E2TL 5HHOD 3VFSB 3HFML 3ULUC 3MRPA 5EOTB 4EVNB 2VDKH 1IVLA 4KK6C 2DL2A 1KN2H 3QDMA 4F7EB 4FQJH 5E1AA 1ED3B 5ISZE 3REVA 4NQDD 4S11A 3MRPB 2XICA 3RA7H 4AEHH 1FNHA 1RUPL 4X4ME 3BPNB 2EDTA 3MLYL 4KI5C 1DVFC 2OYPA 1XF2A 3WDJA 4HIJA 5J89A 1TTGA 1ZVHA 3CDGA 4MVBC 2IFFL 4XTRC 3R06A 1ZGLM 5SX4I 3TO2B 5EULV 2BJMH 3MUHL 3NPZB 2NY1D 4PY8I 3QEQA 3HZVA 3OKLA 4HIJB 4R7DA 3CX5J 4QYOA 2AJ3A 4ZQKA 4I5BA 1WITA 4IDJH 3WBDA 1Q0YL 5CSZA 4KUZH 1YEEH 2QQQA 1E0OB 1UJ3C 3ZTNH 1JWUA 2NLJA 1S7UB 1KELH 3LRSA 4R7DB 2E27L 2F53A 4I5BB 5GGTA 4OCRL 3DRTA 3PL6A 4WWKC 5EUOB 3WD5H 1EMTH 4KMLB 3T0EE 5GISH 2BVPB 2C4FT 5CSZB 5KG9B 1QFPA 2WBJB 1RZFH 3NA9H 3VXTA 4Y19D 4WI2A 1JWUB 1TCRA 5J12B 2WWMC 4IJ3C 1WZMA 3GI8H 4ZSOB 1CG9A 4TULH 4Z0XB 1NMCB 1OP5K 5B39G 2GSIA 5TGBB 1PVHA 1QPXA 1E4WL 4LMQE 4KAQH 2H2PC 3O6KH 4NPYA 3ARWA 3AGVA 2IPKB 3W2DL 2J8UF 3BWAA 4FFVD 1DFBH 1FLRH 3OGCB 3ZLQC 1CG9B 3QQ9C 2DMCA 2UVFA 5D1ZC 4Z6AT 1VFUA 2R69L 3WJLC 4OAWA 4XBGA 5FYKH 1CFTA 5C09A 2X4UA 4RFEB 5JQ6H 3PWPD 4QXGH 4YE4H 1A1NB 2AEQH 1IZKA 1KG0A 4M1GH 5D1XC 3BZFB 4ODHL 2DMBA 3LV3B 4OAWB 4EDWL 2NY2D 4F7MB 2X4UB 35C8L 4FMFA 4Z7VF 1CICC 5F72S 4J4PA 2MNUA 3EJYC 3IFPB 5E03A 1AGFB 1KB5L 4EXKA 2K7QA 1FNSH 1PFCA 5HYJD 5EUOE 1R3LA 4CVWA 4LPCA 1AY1L 2EEDA 3O9WD 4G7YL 1K2DA 1MY5A 5BV7H 3B9KD 4UNVA 3O6LH 3VRIB 4U0RB 4WFFD 3KG5A 1INQB 5H35A 1H5BA 3L7EB 5MEQB 4HDIA 1RFDL 3ARUA 1ORQB 4G9FD 3CMGA 4K8RH 4ZSOE 4IRJA 3F5WA 2EO1A 1K2DB 4HLZH 3REWB 3DX8A 4U31A 1NC2A 5IWLC 1WC7B 2VZUA 1KEGH 2FECI 4JHWL 3L1OH 1DP0A 3KPSA 4X9GA 2ICWJ 3N1MC 3BP4A 3VWJA 4DZ8A 3C2SA 1XCQB 4XWOC 4OFPA 1E6OH 3DX8B 1AFVL 5DWUH 4U1LB 1FE8H 3GI9L 4QRQA 5TFSH 4XCNA 1HHJB 4RBPH 5JXAL 3RWJA 7FABL 3GSNH 1CK0L 3VFWA 3VWJB 3GJFA 4J3SA 2F54D 5F7WC 5T3ZE 3SKJH 3LS5L 4KH2A 3TVMA 3X11B 3KJ4B 1NDMB 5GZOC 2ESVB 4OUOA 3RWJB 5MENA 3U83A 3V6OE 4WU5A 1UC6A 4P5TC 1F6LL 1T1YA 4F57L 3TH3T 1IGCL 2X1WL 4G9DB 1XF5A 5MENB 2BVQA 3U9UB 3BE1H 5DF0A 4Z95L 3ZKMC 1EO8H 3M07A 1T1YB 4M03A 2X44D 3IFNL 3OAZK 5BVJB 1HSBB 2NY7L 3VXQA 2DQEL 2A77H 1XF5B 3JTTA 5D2NC 4IIQB 5I1EH 5KVDH 2YMXL 1Z9OA 1MCPL 4KHXL 1UA6H 4M7LL 1LQSR 4K3JH 4QOKD 3RZCA 3C60A 4PRDA 4X6DB 1AE6L 5KTEH 3L5XH 4G6FD 4PJIE 5D7SH 4JGJA 3VA6A 4RRPG 5E7BA 4ENEC 1T04A 5D7LB 3K74B 4F9PA 3VGHA 4PJBF 4PIRF 4J2XA 4LHJB 1IZJA 1RQ5A 4PRDB 4YHIA 4KKCD 4I0PA 4PLKD 3MLZH 3V4VH 3NGBC 3ARBB 2R2CA 1OY3B 1T04B 4OD1L 1FZOB 2BFVH 5EA0L 1J88A 4PPTA 4CUCA 3BN3B 1MH5A 2R2HB 2GY7B 4PTUA 3MGAA 3QG7L 2ESVE 5IF0A 2EDFA 4I0PB 1NGPL 3WDHA 1KEMH 4KK9D 1I9IL 1PY4A 4QNPF 2R1WA 3OR7B 2Q87A 2CXKA 1MH5B 2VZ1A 1JMZA 4PTUB 1RIUL 4M62L 1OAKL 2YEZB 4U1SA 4F80A 1AHWA 1VGKA 3RVXD 5MENE 4LCWD 2ATPA 1IC5H 3O45B 4JKPH 3LPWA 4UB0H 2Y07L 4BFBD 4DK3A 1UKQA 2DL9A 5GSVA 4CVUA 1OTSD 2IC2A 4PGBB 4FRWA 4U1SB 2YOCA 2R9HD 1AHWB 5BZWA 3T8XA 1RJCA 4A6YL 1H15A 2P5EA 3TV3L 1KJMB 4MHHI 1MVFA 2APVA 3BSZL 5BVPH 2E9JA 2NY6D 3JUZA 4I0CC 5ICZA 5ECJE 4X6DE 4Q7DA 1RZJH 1ITBB 5BZWB 4HZLA 2P24A 3H0TA 1H15B 1A14L 5E8DL 5D7LE 3BDYL 3OKMA 5D7IA 3W82A 1PZ5B 1BX2B 5IMMA 5F44A 2PO6A 3STLB 3QQ3A 2W9EL 4OF3A 5EC2B 1AD0A 5MI0C 4FP8L 1YEGH 4XP4H 1U92B 4KROC 2RIKA 4XVUD 4HWBA 4KK8D 4ODXA 1G9EA 2PKDA 3OKMB 2EECA 4IS6A 1W0YT 3EAKA 5HPMA 4J3WA 4YHMH 1A9BA 3QDGA 3RY5A 3N9GH 3UC0L 5T1KA 3IJHA 4HFUH 1RJZA 3MLWH 2HJLA 4ODXB 1J1OL 2JJSC 1T22A 2WINB 3VW3L 4XC3H 4QRUB 1ZHNA 1YQVL 4JN1H 2VXSL 3QDGB 4K7FA 3KPQA 4LIQE 3C09C 3HG1A 5T1KB 2AXJA 4O2FB 3I9GL 3DVGA 4LBEA 3GK8L 4FZ8H 4APQA 1T22B 3GMQA 4S2SB 1T6VN 3LH2L 3UPCA 3TF7C 2JF1A 1ZHNB 4J12A 3KPRE 4M61A 2WBKA 3KPQB 3LIZL 3VU2A 4K3DH 1IBGH 4YR6A 3NCJL 3M17A 4FQ1L 3N0PB 3Q5OA 4LCCC 4PGEB 1CFQB 1H3VA 3C5ZD 1ONQB 4D0CA 2QADC 4KHTH 4KGJA 3P30L 4X80L 4MQSB 1TZIB 2OR9L 4YR6B 2YBRA 5F97E 3M17B 4N5UA 1DQQA 3CXDL 3PP3K 1QLFB 5F7DA 3TGXA 2A6KB 3G04A 2WUCL 2Q8AH 3DUHA 1QNZL 5IESH 2XZCL 2W9LA 5T3ZH 1J05B 3FO1A 4Q6IC 1UZ8B 3TWCH 2YBRB 1DQQB 5I1GH 3VH8A 3BPOC 4X0KA 1IL1A 5F7DB 3C08H 3BXNB 1IRAY 4OIBA 2V5MA 1QG3A 1UGNA 2DMKA 4DKDC 2IAMD 2Z31A 4UDUA 2M8XA 1I7RA 4XMPH 2FEEL 4F9LA 3FKUS 3FO1B 3QUML 5JOFB 2B4CL 1T83C 1WTLA 2DLFH 3K81A 5D5MA 3OKDA 4UU9A 5C0JA 3VH8B 4JFFD 2NZ9D 4F7PA 2KDGA 2I60L 2Z31B 2BCKB 2W0LA 3D69A 3QHFL 1QYGL 1JHKL 4NCC2 4I3GA 4JANA 3JWNC 1XT5A 5M95B 1Q94A 5EUOF 1I8KA 3QSKB 3L3KB 5F6HI 5C2BL 2C7UA 1TJHL 2R29L 3D69B 2D7OA 4LHUG 5GRJL 4JANB 3MOAH 1JRHH 2R1XA 1S7TA 3O2VL 2JIXD 3L7FB 1RK1A 4LHQB 2K1MA 1NGWB 3SHSA 1FDLH 2H8PB 3FJTA 1I8MA 4ZTOH 5IK3B 2AXGB 3NH7L 3M8OH 3LDBC 1KUMA 1DLHB 1LE5A 5DMIL 4NJ9L 2BVEA 5I8OH 1I3GL 4LPWA 2VXQL 2YD4A 3E1F1 2KUTA 2PO6D 2YA1A 1MREL 5DRXA 1I9RL 5TDOA 2ICES 4YFLF 1KIQB 1T21B 1E4JA 1LE5B 3AU1A 1S7VB 4MS8D 2NY1C 3MNZB 4HGWA 1GGYA 1DVFB 4OD2A 1T7VA 1BVZA 1OT2A 1PG7W 1A6VL 1II4E 1HOCA 3FN0H 4HV8B 5J56B 4KQ4L 5JDSA 3EDEA 5TDOB 4MQ7A 2ZKHL 4G8IB 3S37L 4OQTL 2ZCHL 2VB5A 2OX5A 3QUYD 4YQXH 4Q9QH 4GMSL 3HE7C 4AQOA 3TIEA 3PJSA 1HOCB 4NN6B 2OL3A 2XNAA 1YMHB 4WWKA 1T7YA 2BX5A 1YJDL 2Z9TA 3C8KA 4JFXB 5BOPA 1JF1A 3MPCA 1UJ3B 3CK0H 25C8H 2HH0H 1F11B 4BQBA 1OB1B 3TIEB 2P8PA 4ONFH 4JHAH 1OQOA 5I1LA 1Q72H 4WWKB 2CK0H 2IBZY 1RZKH 3FFDB 3OF6A 1J8HA 1PG7X 4NC2B 3QJFA 4M93B 4NQCB 5T5NF 1TVDA 3MRLB 5FYJH 4GT7A 2V2TA 4PREA 4YDVB 1D9KC 1OCWL 4LLAA 5C70A 2VDOL 3GSQB 1M7XA 3VJ6B 3GHEH 4FFVC 4FZEL 4B50A 4F7TB 4PJIF 5D1ZA 1H3GA 3CAFA 4XB8A 3MLUL 3L3OB 4MDIB 2EDHA 4OT1L 1DDHB 4I2XB 1Q1JH 3DGCR 4JFZH 3WJLA 3GDBA 1MFEH 3CUPA 1ACYH 1IGYB 4Z78B 1SEBB 4NRYA 1DEEB 4FFZH 1U6AH 5HGHA 3I85A 3HCVA 1X5XA 3MGTA 5T1MA 4KI5E 1I1AA 4UT9H 3AB0C 2J88L 2PNDA 4K55A 1HKFA 1MIEH 3CUPB 1I3VA 1RY7B 4J3VA 1N5AA 2PW2B 1K8DA 4RGND 1LP9A 1MJUL 1CICA 2CLZA 2AJSH 2HT3C 2X4OA 1JK8A 4AM0A 1FG2B 4XP1L 4P99A 5D1XB 1NH6A 1ZTXL 4RMRA 1N5AB 3LKPA 1O7SA 1T1XA 2DBLL 5HJ3B 1TMCB 1CXHA 3WFCL 4JM2C 4TPRL 4NSKA 5EBMB 3EYUL 4L8DA 2QSQA 5FKPA 3VXUA 5JOPE 4JDZA 4GBXC 4U7SA 5EU6E 5HPOA 5FA4B 3AS3A 1MRDL 2IAND 2XXCB 2XYCA 5E08H 4HUXA 5DRNA 1ZT1A 2YPVL 1IGTA 5IWLA 1IEBA 4NQCE 1A1MA 4L8DB 1MJJB 1X5IA 2AQ1A 4N8VB 3TPUA 4KXZI 3CPLA 3MROA 5EOCH 2YUVA 2YD5A 4EQ3A 4X6DF 3GSOB 5KSAC 1QQDA 4CNIB 3LSOA 1HILA 1F4YH 1ZT1B 5A3IC 1ZEAH 3ELAT 4G6JH 4I2XE 3R1GH 1K4DB 4LSRH 2D3VA 5DD3L 4MNGB 3NABL 4N0FA 5MEPA 4BUGA 3BYTA 4FQXD 2GK0B 5LCVH 2XZQH 1QQDB 3LSOB 1J5OL 4DQOH 3HKFA 3MFFA 3ARPA 2NY5L 4RWYL 4ZPVB 5J06A 2CKBL 5E56A 2HT4C 4HWBH 3NPSC 3QIWB 4FTVD 5DR5L 32C2B 3UBXA 4N0YH 1HQRA 4L3CA 1PY9A 3UTSD 5KW9L 1OARH 4EOWL 1J0ZA 1YMMA 3CCHA 1AO7E 2NNAB 4Y4FC 3AUVA 4ERSL 1KLUB 2Z8VC 4OCSL 4P5TB 4WGVB 5ESAA 4YBLC 1HQRB 2ARJQ 5L2KD 1E4XI 3VWKC 1YNKH 3QNYA 4JRYA 4ZFFA 5DVKA 4KJWC 5D2NA 3OF6D 4UIMB 4OCWH 3DJ9A 5JR1L 5EH1A 4PJGA 1U3JA 5DC4B 4UOW0 1KN4L 3MFGB 3OXRB 3UTZA 3QNYB 1S7SB 4U6YA 4XVTL 2DTMH 2D03H 2N1KA 3PWVA 3WUZA 4OLZL 3SDCC 5JHLH 1GHFL 1LK2B 2J5LB 3VFTB 2C4FU 4ACPA 4PJGB 4HX1A 4DZBB 4MNGE 2J4WH 3GBMH 4JJHA 3UTZB 4PRID 1A7BA 1O0VA 1QBBA 5DHXB 2WWKT 4WO4D 4OF7A 4P2OC 4LLVB 2V5RA 5HD8D 3MXVH 2ZCKH 2LAAA 4BZ1L 2V7NB 1A47A 4XC1L 2JB5L 4ZAKC 4KPHL 5HYQA 3CSYB 5DD1L 4XP9H 5ALCH 5DUML 4KK9C 3NGBB 1MWAB 3DUUA 2EDRA 4J6RL 1MRCL 1A3RH 4OLEA 4GRLD 5T1DL 3DURA 3H8NA 1MI5E 3GM8A 2WAHA 3X14A 2RAMA 3MO1B 1IKNC 1KTDB 2ENYA 2Z92A 3DUUB 1JN6B 4GXVH 5E94B 1KNOB 4NO3A 3ESUF 1C5CH 2FCBA 4M48H 1A1OB 5HGAB 3HC3L 2J8HA 2F8XC 3SDAD 2B4CC 4OGZA 1NLBL 2BXZA 4NZUH 3W39A 4MD4A 3PGFL 1FFNB 2FX8L 1SVZA 3MXWL 1F6AA 4G3YH 1AQKL 3ULUH 5GRUH 5DMYA 5IEKA 1BOYA 4Y8DC 4C54A 4FQHA 4KQ3H 2A6JA 1WAAE 5IV2B 2B1AH 5ALBH 4OLWH 2N56A 5D72H 4JG1L 2GQHA 3W39B 3T77A 4P9ML 1VKXA 4PJGE 5HHXL 3ULVE 4ZS6D 3WLBA 3BQUA 5DJXA 4WFED 2IBZX 4JFDB 1REIA 2NYYD 3BESR 3Q1SL 3E8UH 4GAYA 4W4OA 4PUBH 2PTTA 2XWBA 4R9HA 1AGBA 4KK8C 1DQDL 2GAZA 4G6AD 4EN3D 1SYSB 4G8FA 1NSNH 1TQCC 4QTHA 2BSRA 1PQZA 2GTZB 4EJ1C 4AMKH 2OS7A 1J11A 3WS3A 2BSTB 5MI0B 4F58H 5DJXB 3NZ8B 5D96B 2NQCA 4KROB 5F6IC 2BHYA 5TDNB 1MF2H 2JJSA 5J3HC 3BUTA 3QIBD 1M05A 3ARTA 3HZKB 2BSRB 2CIIA 3V7AG 1ZLWH 2DWEA 1OAXL 3CLFL 2E7CA 1KIRA 3CD4A 4XAKD 1T1ZA 4NHCH 2O93L 4ZYKB 3SDYH 2FNBA 2HVKA 4PGJA 2M1KA 1M05B 2UVEA 4KK5C 2GITA 3QPQC 5H37G 3SCMB 2DWEB 2YD1A 4ELKA 1QZ1A 3C09B 4JLRB 1CS6A 5AD0B 2MKWA 5E2JA 4J1UA 2HVKB 4JN2B 2EE3A 3FFCB 5DJZA 2X05A 4D9LH 1G0YR 3U82B 1PEZA 1QPPA 1KLFA 4R4FL 5DQJB 3VGGA 1OSZB 5F9AC 2AEPH 2FH8A 1WISA 4J1UB 3MNVB 1GGCH 3KNBA 5GSRA 4LCCB 3S35H 3L3GA 2A1WH 1ZHKB 3K8MA 4JFDE 4YDKH 1GCFA 1ROWA 2P8MA 1RZ8A 3E0GA 5DJYA 5GSRB 2D4DA 4XAWL 3DI3B 1DUYA 4FQLH 4EDXA 4YWGL 3FCTB 2IAMC 2OI9C 4NQEE 4KI5F 3LAFA 4MNQB 5F96L 1E4XH 4Q6IB 5KZCB 4DGYH 2P8MB 1AD9B 5E99L 2XN9B 3IYLW 3IB4A 1DUYB 3QNXA 1W72L 1R3JA 2EYRA 3PWJB 4HF5H 3WL9A 3GRWA 3STZB 5E2VH 2EDOA 3RAJH 2DQJL 4Z7UA 3HC0A 4XHQA 2L7UA 4OFYD 4YDJA 4G43B 5DRWA 1CQYA 1R3JB 4G8GA 4LVNC 4EKXA 3KHOA 4AEIH 4LFHG 4ODTL 1QR1B 3FFCE 4EEEA 5HYSG 1EUUA 4WIQA 3MREB 1WJ3A 3HC0B 3TO4A 3V0AC 1Z5LA 3SBWC 1FC1A 3NFPB 2VXVL 5GGRA 1A6AA 1CGSL 5H94A 1N2RA 2E8YA 1A7NL 3HB3D 3F62A 1T66D 2E7BA 2DQCH 4Y7MA 3QEHA 2PXYD 4WEBH 3OZ9L 1KB5B 4Z7WB 3MCLL 4HH9A 1G9NL 2ADIB 3O2WL 1U42A 3BQUD 4K3EH 1N4XL 3VE0B 3LDBB 4WY7L 5MP6H 4NQDB 5HHMD 4I9WD 5ICYB 1LO0L 2OSLB 3OB0H 4M5YH 1KGCE 1AH1A 4OV5B 2BNRA 1MLBB 4BH7B 1BFTA 3WYRA 3MJ7A 1M6OA 1OT1A 4MNQE 3MRBA 1UQSB 5KS9A 4NUJB 3F7PC 1KIPB 1VHPA 2XN9E 4H8WL 5CJQH 1Y18B 2ZSWA 1BQHG 1CLYL 2NY1B 3C5JB 3D3VA 4J8RA 2R4SL 1OTTC 1UB5A 3HE7A 3L95B 4MXWH 4D0DB 4HUUA 3S36L 4QRRA 4P3DA 4WV1C 1A2YA 1BZ7B 2F8VA 2FDBP 3GKZA 5KS9B 2G2RB 1AIFB 1WBZB 3Q6GL 2EDQA 4JCMA 3OWEA 1N3NA 1IKFL 2X5PA 3VXPB 3D3VB 3VCLA 2EXYC 1UB5B 2HRLA 5EZIH 2YRPA 2BRRH 3HE7B 4OZIA 3Q3GA 2UZIL 4TSAH 3GSWB 4QRRB 4P3DB 1A2YB 4XPGH 1MCIA 2W65A 3U9PH 1YYML 4P46A 1WWBX 3MJ8B 2OTUA 3N85H 2FGZA 5CCKL 4Q9RL 1Z9MA 5LGJA 2FJHB 5EZJB 4Y19B 5HHOE 5SWQB 2FRGP 4JDTH 1D9KA 3G6JA 5EBLA 3RHWK 3V5HA 3UYPA 2W65B 4LKCA 3UJTH 5E5MA 2OTUB 5CKAA 3QUXD 1KJVA 2VDLL 4AT6A 3LKOA 5LGJB 3ULVH 4Z7WE 3KXFA 4GKOA 4JO4L 1UXSA 3IAGC 1D9KB 5IVZB 3G6JB 4L8SC 5EBLB 4NQDE 4OTXL 3H7BB 4LKCB 3BEWA 3GBNH 3HR5B 4MQTB 5E5MB 5MHSE 1INEH 3ARVA 1EJ6A 3OXSB 5GZND 1IFHL 5EU4B 1MWAH 4LNRB 4RRPA 2BK8A 5D7KD 2FATL 4RGNC 3PWPB 1UYWL 4QCIB 3AB0B 2DKSA 5I1KL 2VLRD 3EO0B 5LWYL 5IJKC 4JQXA 3OJDA 5CEZD 4QEGA 5KS9E 3S97C 2NY2B 4X9IA 3WIHH 1J0YA 5DO2D 4XP6H 3IDNB 4NYLA 4C55A 4JM2A 4HT1L 4ODBD 3QDJD 5DEFB 3AXLA 4RBPK 1F3JA 1YY9D 4GLRI 4Z7QE 3WIFA 1Z9LA 1T2XA 4GBXA 4OLYH 5AWNL 5I30H 3LD8B