4YHLH

Reversal agent for dabigatran
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
b'QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGETNPRNGGTTYNEKFKGKATMTRDTSTSTAYMELSSLRSEDTAVYYCTIGTSGYDYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords aDabi-Fab2b heavy chain
molecule tags Immune system
source organism Homo sapiens
publication title Structure-guided residence time optimization of a dabigatran reversal agent.
pubmed doi rcsb
total genus 47
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhlH01
1UWEL 3EDEA 3PIQA 3LKPA 4XBEL 3HR5A 3O9WB 1SY6A 3DBXA 3T8XB 3VFTB 4LSQL 4MVBD 2Q8AH 4BZYA 4CRPA 3O0RH 5EZOH 1G0DA 2XN9B 4HS3B 1A0QL 3DUHA 3RVXD 5CEZE 3MNVB 3VRIA 5DO2D 3O11B 3RDTD 4X6DA 3VU2A 3WJJC 4JZNB 2NNAA 4HHAB 3SKMB 4S0SD 4P59H 3R8QA 4LHQB 4P5TA 4OT1H 4CU7A 1RMFL 3HAEH 2FWOB 1ZGLB 3B9KC 2AGJL 2EDLA 1ACYL 3G08A 2RIKA 3T3PF 3VD5A 3GRWL 3PHOB 3ZKNC 3SE3C 1K2DA 4X6CB 1QSFE 3CSGA 3KYAA 4APQD 1MFDH 3LKQA 1ZK9A 4ZODA 1NC4B 1RIUH 5C71A 4LVHB 4XX1G 2B0SH 2ZUQB 2F5BL 4ZTPL 4OCWL 4GAJH 5IP4A 3H9SE 1MCOH 2FL5B 4Y0GA 2PYEE 2E7BA 5EZIL 1H0DB 3BIAX 5IMMB 3VH8G 4Y1AB 3OJDA 5C0EA 2V2TA 1CDHA 5I1HL 1WWCA 1UJ3A 4MAYB 3CZFB 1Y6KR 4NFDA 1AH1A 2P44B 5TH2B 5DHVH 3D85A 5HHMB 3LIZL 3HNSH 4MLIA 4RMTA 5I8KH 1ZLWH 2VOTA 2BC4A 1R0AH 3WNLA 2BXZA 3EJZC 3IDMB 1SYVB 3TO4A 4KMLB 1KIRB 3D5OF 4HWBH 3GKWL 3D39D 2AJUL 5AYUH 1LO4L 3BJLA 2GK2A 1W72B 5FA3A 4M7ZB 4PJ5A 1LILA 1ADQA 1YEFL 4YFLF 4JDZB 1HSAB 4OGYH 3HNSL 2F58H 2PO6A 4QHUA 1ODAA 3V0AC 1J88A 3MLZH 2DM7A 4JRXD 5EBGA 1TZGL 1JZ7A 4MB4A 1NBQA 4O51A 4OZGA 2LU7A 2VZSA 1X7QA 1E4WH 3LRGA 3QQ3B 4OCRL 4F9PA 2J12B 1SJVA 2YUXA 5DJ8A 1DANU 3PV6B 2RQ8A 5B3JE 5I66B 5LCVL 5JO5A 3F65A 3PL6D 1UYWH 2YA1A 4XMLL 1AGFA 1GGIH 2R1WA 3X3FL 1FGVH 2YWYA 1WC7A 2X1PA 4P46B 4NNXB 5GIRA 5DD1L 2AP2A 4JEGB 5F88A 1QFWL 4KZDH 2DMKA 3QEUB 5HYSB 3BN3B 3B8SA 4ZAKC 4DGIL 5CBEA 4TUKH 4J3TA 2HVJA 1DQQA 1A7OH 1NJ9B 4KRNA 3UC0H 4HH8A 2EYSB 1ZAGA 1TVBB 4K3HA 4NWUL 1U58B 2EKSA 4MDIB 4YHMH 2JCCE 4X4MA 4I0PD 3VH8A 4P46C 3RVVD 1MELA 4RFNB 1AR1D 5L8KB 5DJCA 3L7EA 1SYVA 3TO4B 4TQEL 3KXFD 2HFFB 1IAII 1XGPB 4XGZB 1NAMB 1YN6A 1OF2A 4G6KH 2NYYD 4HLJA 4KJPC 1JPTH 3QCVL 5AD0B 2XKSA 1UZ8B 4GO6B 1D5BA 3MRKA 3TT1H 4I3GA 1NUNB 4L3ED 3S37L 3MOBL 3S88H 2GFBB 3U82B 3VWKD 3B6SB 3MLXH 1IEAB 4HUXB 3X12A 4OLEA 4GRWH 1XGTB 4YQXL 1FVEB 1ZHNA 3E6HA 2CR6A 1UZ8A 2WSKA 4IOIB 3W39A 5I9QC 1WBZA 4AIOA 1RQ5A 2FEEI 1GCFA 4G3YH 2GFBA 1CS6A 1KIUA 5FHBH 3OKYA 4WI6A 5D7JC 5D2NB 2LAAA 3OKNA 1G7HB 2CDFA 4GW4B 1QFPA 5CP3H 1U2HA 3BISA 4PRBB 3C5JA 2X1OA 5IFHH 2OTUA 4XPBL 3CDGA 1A7QL 4P2QB 5CD3A 3QA3A 5JQHC 5ICXB 4QKXB 2VDLL 4MCZA 2Z0BA 1OLLA 2CO7B 3P4MB 1AP2B 1VSCA 4KTEL 4WFEE 3MBXL 3MV8B 5F7MC 4MLSA 5CZXD 2Y7QB 2FIRT 3SDYH 5B38B 5KAQF 2NPLX 4KHTL 4ZUTB 5IM7B 4S1SH 4XXCC 5L2JA 3U48A 3V6OC 1A7QH 3SKJL 4KI5E 5GS1A 3P11L 3LQAC 3KLAA 3EYFA 2LU3A 4QT5A 4M3JA 2WIIA 4QXGH 3ARUA 4R4ND 4PV8B 3I6GB 3PDOA 4HX1A 4BA8A 2FHFA 3MRLA 2AXGB 4X9FA 5EIQA 1P6AB 3S35H 5T1LD 3OGOE 4N1CA 5D2NA 1VEMA 5A2FA 4JPVL 4X99A 5IMOB 3BD4A 1T04A 4HPOL 1HILA 2XPGA 5FUCE 3VXOB 3BQUA 4C4KT 2R2EB 3IDXL 2CRYA 2IAMC 3QJFB 3DSFL 1AHWB 4MQ7A 3BYTA 1NLDH 1WZ1L 3C2AH 4U1IB 2YD7A 4F7PA 3GMOB 3C6LD 1A6TA 5IHUL 1JWMB 5JW4M 4BKLA 4O2EB 4PJEA 1FZKB 3HAEG 2YKLL 1DBAH 2HKFH 3LAFA 1DQJA 4PJXA 4ZUUA 1RHFA 4WFFE 1F4YH 4OSUH 2ATPB 4HK3N 4MQTB 4WW2A 4R4BA 5D7SH 5JNYB 2JLLA 1EFXA 1AGDA 3UCRA 2KZWA 1KEGL 1K5NB 4X6FB 2R0ZL 1YMME 4JFDD 3T0EC 3O3EA 1ZLSL 3KLHC 1NFDE 4MNQD 2VXSL 5GGQL 4DCQA 2XZCH 3TNNA 1FYTB 2ZOKB 2XTJE 4XNUL 2CLRB 2H2PC 1LO2L 4LPWA 1TXKA 1FNEB 3S5LA 3I6KA 1LK2A 3EFDL 4GLRI 4TVPH 3RGVB 4Z9KB 2FGZA 1PKQB 5BO1H 1FN4A 4GRWF 4KKBD 1Q38A 5JPMB 1IAMA 3TC9A 4XNUH 5EU6A 4ODTH 1YNLH 2X70A 3MOQA 2P48B 1CICC 3CZJA 2Y5EA 2L0DA 2Z35A 2X6MA 4NO0A 1XIWC 3WFBH 3IFOA 3BH9A 2DWEB 4WW2F 5EULV 3RVXC 3MRHB 3LD8B 3HC4L 4UNUA 5KG9B 3T2QA 2JIXA 4XCFL 1H5BB 2YWZA 3ZYIA 4S10A 4QXGL 1MVUA 1OAZL 1UM6H 3IAQA 4OUUA 3SOBH 1C8PA 4YNYB 1T7YA 3ZKMD 3JWDH 1QTYT 1T4KA 3WHE0 5FO8B 2VWEC 4E5XB 3Q1SH 1Y6MR 1LE9B 1RZJL 3JBG7 3RNQA 3TA3C 3UTSA 4JFPB 2H26B 3MUGA 4N9OB 3AGVA 4JO2L 3B9DA 2DJSA 2Y5TB 3D0VA 3VG9B 1RV6X 2VLRA 4QRUA 3MREA 1IAOA 2D0FA 3PIQB 1HHKB 2DIBA 2JJSC 5F96L 3U0WL 15C8H 3LV3B 4FQXD 3SDDD 2Y23A 1DL7H 4ZO9A 3VDCA 2OZ4L 1OTUC 3GI9L 1V3LA 1B4RA 5T1KB 5D2NC 3T0DA 1EHXA 3D85D 3G6DL 3BGFC 3TN0C 2NCMA 4M6NH 2JJVA 5IJVB 3FB5A 1JHTA 4X4YA 4XMPL 4X8JA 1T1XB 4P4RB 4KH2A 4PRHD 4LLWA 3VXTB 3QCUH 4ZS6D 1N5AB 3EJZD 3LS5L 3MNZA 5MERA 1N8ZA 5IJVA 1XGUA 3QIUD 3GJFA 1WBYA 1FV1B 3AU1A 3ULVC 5FM4A 5F6HI 5JA8B 2UWEB 2LQRA 1ES0B 3DUSB 3S34H 4NQUA 3Q6GH 4Y5VA 2V2XB 4XVUC 5GZOD 3KLSA 4Y5YC 1DBKL 2VQTA 3ES6B 3FQXB 3IXAA 3TVMD 1V7NH 4B50A 2A77H 4L4VA 1QBLH 5DK3A 1IT9L 4N8VG 5C0BA 5AAMA 2NY3C 3RNQB 4ERSH 3SCMC 2HLFC 1FYTE 2VQUA 5DFVC 3UZEA 3SCMB 4O2FB 2YD2A 4XP4L 3RBSA 4M03A 5KVGH 4EN3D 2VLRB 1G6RB 5C0CA 4G42A 4PJHB 3KLDA 4FQCL 1VADA 2A9ML 2VAAB 4TPRL 3FB6A 4DFIA 4YPJA 2AQ2A 1BAFL 1T80A 3SDAB 3ARTA 2DLEA 3QG7L 3PE9A 5BVJA 3K8KA 4H1LG 1PGRB 2VUYA 3IRZA 4S1DC 1I3GL 1IT9H 5LBSL 4M61B 3MRCA 3VE0B 4WWID 2DB8A 5HHVH 3HRZA 2VLKA 3QUMA 4JFEA 3FO9A 2ZUQC 4UAOB 4K3JH 2BOCB 5KBNC 4AIZB 5I1AA 1R3IH 4P4KB 3VI3E 2PO6C 5IBTH 3ULUE 2I24N 3KYMB 1N6QL 3DROA 5HHOD 4I5BB 5DUMH 2FDBP 3IXTA 1B0RB 3KXFA 4D0DA 2XY2A 1Q9KB 4UV4L 4DN3L 3GMPA 3OWEA 1MY7A 1FE8H 4GMTL 2VABA 3LQZA 5DSCA 4AJ0A 4F9PC 5I8OH 4Y89A 4J3UA 2AXGA 3UBXA 4KK8D 2F58L 1LEKA 4PJXE 5GS0C 4BQCA 1U8LA 1S9WA 3TBYB 5HDBE 3NCYS 4LGSB 4JY4B 4MSWA 4L4TD 1MH5A 4Y16D 1A7OL 4NSKB 4NP4H 3VWKC 1UXSA 4WO4C 2V9QA 4B5EA 2C9AA 4PRHE 4U6YB 4YO0A 3CC5B 2D31A 4ODSL 3OR6B 1PBYA 3IFPA 4MAUH 5J0BA 1NFDA 1F5WA 1CG9B 3D9AL 3GNML 3L3OB 1AGBB 1CXKA 4OCYH 1UFUA 1QZ1A 4ZMAT 4KK9C 4W81A 1OWWA 1YN7B 4D8PB 3WYRA 4UNTA 1XF1A 3NAAL 4OIIH 5T3XE 4JN1L 3QDHA 2W60B 3PWLA 1NSNL 4G8GA 4PREA 1I7UB 1FRGH 1J9CT 3HG1D 1QBLL 5FYJD 3HC0B 1XH3B 1WQVT 3PGFH 2AXFA 4P5MA 4ZNEE 1DQTA 1JIBA 3MUJA 1BPVA 2A6IA 3ZDYF 2Q3AA 4LEXH 4BELD 5GGRA 3L5HA 5IHLB 1SYSB 1XGTA 4LHUD 3LQZB 1IM9A 5B8CC 5ERWB 3QPXL 1XF3A 3EDJA 1B2WL 1RU9L 5C07A 4FQ2H 3HS0B 4QHKJ 3RNKB 1AXSB 4NYLB 1J12A 3R1GH 2AEPH 5JLZA 4LSPH 2PTTB 1KIQA 2ZSVB 2BY3A 1VESA 3B2VL 4FXGB 1PEWA 2ED8A 1OM3L 5HYJD 3BQUD 5IOPB 3CSYA 4NN7B 4U1LB 4U7KA 2VWEE 2FLRT 5KOVC 3EO1B 1DBML 4BSJA 3ARVA 5E8EB 2E7CA 3GSWA 5KSUB 3TO2A 4MJ5A 2VDOH 4HIHA 5F1OB 2EDHA 2G9HB 4NQVA 2DQDH 1TVHB 1RIVH 3FT4A 3NZHH 4LNVA 2NY2D 1REIA 4KJYB 3RKPA 2LE9A 1BEYH 3I2CH 4XXCA 4R2GD 3GSWB 5KSUA 8FABA 2R2EA 2H1PL 3BEWB 5EG6C 3BMVA 4U31A 2IAMB 3STLB 1D5IL 5I15H 1QFUL 3DGCR 4Y4KD 2ZG2A 4LLWB 1SMAA 4NP4L 3OSKA 2CDEA 4JFDA 4XVSH 4HUXA 4AT6A 3MJ7A 5C0IA 1T1WB 1HKLH 5GZNC 3GSRA 4Z7OF 4H8WC 3S7GA 3UBXG 4XPHH 2X4UA 5JO5B 3QDMA 3HI6H 5KN5B 1B90A 3IU4H 1RIHH 2LU4A 4JFZH 5IMKB 3IDXH 1IGYB 1OGAB 2ADIA 1K9TA 3T04D 3KPOA 1I4FA 1P7HL 1R0AL 2H32A 5CJOL 3FMGH 5D71H 5ABDE 3CUPB 3EOBA 5AWNL 1W0VB 5AZEL 1FPTL 3EDDA 3HZVA 4GRLB 5CINH 4WO4A 4X8JB 1ZHKB 3UAJC 4QRRB 1L4IA 1ZA3A 2QV2A 4ORGB 4D9LH 4HWEH 4NRZB 4LIQH 3ZE1F 1FYTA 1X5XA 2F74A 1UXSB 4NQCE 4I77L 1YY8B 3EO0A 2IBZX 4ZQKA 4ZS7H 1EEUA 2BFVL 4J4PA 1NMBL 4FQQA 1MFAH 3QXWA 43C9B 4HPYL 1BZ9B 3W82A 3BZ4B 2P5EA 4NIKB 4M9PA 4D9LL 1I1YA 4LDOB 3KPSD 4PJIA 5GRUL 2R56H 1TZIA 1EX0A 4NQVB 4L8BB 5HDOA 1CR9H 2WUCH 4N0CD 5D2LF 3VJ6A 5ICZB 5GS3A 4W6WB 1MFAL 5HGGS 1KYOJ 2EO9A 4DTGH 4AM0A 2P1YA 2BMKB 5FECA 1QFWI 1X5LA 3V7AG 2XYCA 2Z31B 3HPLB 1KEGH 1FZJA 3S4SA 2IH3A 4HFUL 4Y4FA 5F9WB 5B21A 2BNUB 3UTPD 4XVJL 1V3KA 2Y36L 3PWPD 5ITBL 9CGTA 5T1MB 3DVGB 3WIIH 4ZAKD 3KR3L 5EBMB 1AC6A 4L9LB 1HSBA 5J6HA 1R3HA 3ECBA 5CJBA 1NCWH 4JM2A 3WO3B 3D2UB 4U6VH 5E08L 3MRBB 3SE4C 4NO3B 3LDBC 4OM1H 5KZCD 3DXAD 1GGCH 2XXCB 3OF6D 1D3CA 1FNGA 3E2HB 1IC4L 1G7JB 1MFEL 4J23A 4OLYH 3PXHA 2V17H 2RFXA 3RDTA 1MREH 3BZEB 3WIFA 3VXUE 1JPTL 4K23H 3V5DB 2AI0H 1JVKA 1I1AC 1T7ZA 5C0DB 4L8BA 2DOCA 5DVKA 1NCBL 4OJFH 3VXMB 4ZS6C 1F3JA 4XP9L 4XPTL 1TZHA 4YXHL 2BVYA 4XP1H 1IGIL 4D8PA 3MUGB 3O2DA 3MXWH 4HDIB 2ZKHH 4PGDB 4Y4HC 5F3BA 1JI2A 1OY3B 2B8OT 4OF3A 4HIXL 5DQDL 3ULVD 4QTIH 5EIIB 4RGOH 5D72L 4G8IA 4P2QE 1UM4L 2ADGB 2DM3A 2XN9D 4OIAA 2DYPB 1MCFA 2HRLA 3ZLQC 4HS8L 2BERA 4YK4C 3O2WL 4JCMA 2EDRA 4HIEB 5DC9B 2MQCA 4G80A 4HXBL 3FJTA 3LMJH 2OR7A 4Q9BA 2IH1B 4LPTA 4MZ2A 4JHAL 5DJ2A 3OKNB 4NQDB 5DDHB 5FDWA 5EO1A 4Z78A 2F9BT 1WICA 3BPNB 2FCBA 3BPNC 3VXRA 2CIKA 2C7UB 4RGOL 2MQ3A 2G5RA 2UWEE 4XTRD 1EFQA 2IPUK 4J2XA 4KTEH 1JHLH 3QDJE 4MYWB 5FYLH 4BSVA 3O4LD 4G6JL 3CU1A 5DMYA 5DD3L 2L7JA 5DA4A 3QG6A 3HE6B 1KJMA 4GG6F 3P11H 4FQIL 2FEDD 4G9DA 3QDGA 1NMCC 3AY4A 2C1PB 5HHXH 3EYOA 2UZIL 3QAZB 4L8CA 1NANI 4RX4A 3ULVL 2X7LA 3SDCD 1UJ3B 4PJGF 5L0QB 3WEXA 2Y6SC 1N26A 4KROB 3CMOH 2YOCA 1VCAA 4I8DA 3LKRA 4PRIA 1X4YA 4U6HA 1IFHL 2JCCA 4X4ME 1NDGB 2JJTA 1RK0B 4F7TA 4G7YH 4J8RB 5H35A 4HS6A 4Z8FH 1DUZA 1KF9B 4P9ML 1C5CL 2QQQA 1OB1A 1CD8A 3PL6A 1HOCA 1Q9KA 3MQIA 1BZQK 3B3IB 4DEPC 5T1KD 1R5IA 2FO1A 5C86A 1BWMA 1RUQL 2J5LB 5JTWA 5EU6E 1EO8H 1NFIB 4V2BA 1K4CA 4GRLC 3JWOH 2CD0A 5E1HB 4LDEB 1ZHLA 2BHYA 1A6VH 3ZE0F 3FAWA 5EOCJ 4K94L 4FFWD 1W8NA 2QQLL 3ZE0E 1QKZH 3DECA 4UV4H 4JM2C 5DWUH 1FV1A 2DQFA 5T1DL 2Z31C 1VA9A 4KK9D 4YHPA 3HPJA 2CUIA 3DV4A 4C83B 2HAZA 4Q6YA 4XCYA 3N1QC 12E8H 3OKEA 3IFLL 3S3SA 1RIUL 1C5DB 3MLRL 1I1AA 2DL9A 1N6VA 3TIDA 2FJHA 1UVQB 3JVGC 2EIZB 5T5NG 4YXKL 3GBML 4HS6B 5JHDD 4XCCL 1AO7D 1IGML 4Q9QL 2ID5A 3DI2B 5C2BH 2OX5A 5D70H 3WDJA 1HHIB 1NCTA 2Q86B 4DZ8A 4PY8I 2YMXH 3FQWA 1KN4H 4J3OC 5GGUB 1W0YT 3ROLA 3FFDB 1CFNB 2DBLL 4HC1A 3PGCA 2F8OA 2R2CA 5I1IL 4E0RA 2YC1A 1JZ2A 4NGHL 1RJCA 2DYPA 3IRPX 1MCOL 4KVNH 3VFWA 4X6EA 1TTFA 1DBKH 5EU4B 5C2BL 3QI9C 5DJ8B 3QO0A 1BD2A 1KJVB 4RMRA 4CN1A 4UIMB 5C0AB 1G9NH 2A1WL 1TVDA 1DN0B 4WENB 3IFOB 4MNQB 1B3JA 1FZOA 1MUJA 4ONHA 1KN4L 2P8LB 3ABZA 1FLTX 4L3EB 1EHLL 2AKRA 3FB5B 4NGHH 5ISZB 1QFHA 1SBBA 1AHWA 2NY2C 3L5XH 4KY1H 4MQ7B 1MLCA 1RZKC 2VQ1B 3NA4A 4Y4KA 2YD3A 4TTGA 3FQNB 4KQ3L 3CVHA 4MXWH 1QLFB 4MAYD 1X7QB 5I1KH 3T4AA 4PTTA 4WEBH 4U3CA 3WFHB 1GH7A 1J8HE 4QRUB 1JRHL 1QQDB 1L7TL 4KK6D 4KGJA 4N9GA 4P23B 2AJVH 5JOPD 4KZDL 1DEEB 4AEIH 4LP4A 3P9LA 4U6XA 5DYOA 5FYLE 4NBZB 2P8MA 4R3SA 4Y5YA 2QADD 4LEXL 1CLYH 1RZFL 5SX5H 3VMNA 2UY7A 4NN6B 5CILL 4PV9B 2EDWA 4RDQF 1NC4D 1L9MA 4MXWL 4Y2DB 3CLEH 4Q2ZB 1S9YA 3VXPB 3MRFB 4FQPA 3SE9L 3FHAA 5GS1B 4EI5B 1CXEA 5F7NC 4IMKA 2BVOB 1IL1B 2J8UF 4LLAA 4OIIL 4XNMB 4C56A 5A16B 4XBGA 1BVLB 3C09B 4RWYH 5SWZD 5SV4A 1CGSH 1FO0H 1U8PB 2IANE 3OX8B 3HE7A 2XWJA 5AUMA 5I76B 1CFSA 4DVRH 5HD8C 5DURB 5D6DA 1RJZA 5J8OA 4XWOC 4ISVA 4RAVA 1IM3A 4GBXA 3BAEH 1HILB 2XPGB 2CRMA 3EKCA 3V4UL 4XVUD 1YY8A 3EO0B 4ZQKB 1DBJH 5ITFA 2J5LC 1KCLA 4OQTL 3HE6C 4I0PA 2A77L 1D6EB 5E6IA 2HKHH 4M4PA 5T3XH 2MMXA 4GJTB 5TDPB 4CU6A 1EBPA 4M62H 1YDPB 1S5HB 3OJ2C 3VFMA 3FN3A 2KKQA 4U1GC 4TULL 4J3SA 1W72L 1NAMH 1C1EL 3W9DB 1GIGH 4HIIB 5B3JF 1MI5B 3WO4C 4H88H 3PQYB 4XP5L 4Z7WA 3VG0H 1A4JA 3L3KA 5CKGA 3KPQA 3GGWB 1U8KA 3JTTA 5CBAA 3EOTL 3U1SH 4HZAA 1GHFH 5F8RC 3VXSB 1A0QH 1S7VA 4XP6H 4Z7UF 4XBGB 2PCPA 5DMKB 4YIQA 1T3FA 5CJQH 2NXYB 5E00B 2NY4B 3U6RA 5KSAC 3DGGB 5F7YC 2ERJC 5C7XL 2DI9A 5DUML 4PJIB 4HT1L 1J8HD 4K3GA 1YPZB 4OF5A 4PJ5E 1DSFL 4E0RB 4FP8H 1U8IB 2L7UA 3LKRB 1A2YB 2H6PA 3A6OA 3B2VH 1JFQH 2PW1B 5CGYC 5DUBB 3U46B 2YBRA 1NBZB 1WT5C 1MAJA 1F4XL 3HMWL 3QJFA 4M5YH 4YHPB 1LO0H 3NCCB 4WI5A 1J0IA 1M71B 4Y4FC 5FO9A 3EO9H 3O3UN 3MLSH 4ZOCA 3WIHL 4L1HA 3FFCE 2R4RL 3VXUD 3SE8L 5EUOA 3ZYOA 1L0QA 5A40E 5ITFB 4LFHD 1G9EA 4K55A 2HTLD 2R1WB 4PGCB 4F15C 1ZVYA 2O5XH 5KAQG 1JGVH 5BV7C 3TN0B 3UPCA 4G5ZH 3SPVA 1Q0YH 3VXSA 2CK0L 2FSEB 4YHLH 5IESH 4LF3A 1TPXB 3QNYA 3EJYC 4XC3H 2BNQD 3L3OA 5TF1H 1F6AB 2Y25A 2O5XL 1AJ7L 3QIBC 3RDTC 4IMKC 4PV9A 3PGCB 2A0LC 4JHWL 1OSPH 3E2HC 1G7LB 4HUUA 4NN5B 3S37H 3I3EA 1Q0YL 1EFXB 1QBBA 1UM5L 3K4DA 4WEMB 3T0BA 2AJSH 4MJ5B 5DGQA 2OJZL 2UZXB 1P4LB 1YPZA 5ENWB 1CLOH 3HI1B 2ZSWB 5D6DC 4PJFF 3C6LA 3MO1B 2OJEA 4PG2C 4NNYA 2HKFL 4JHAH 5F9OH 5LKNA 1ND0A 3QB7C 4HMCA 3RIAF 5JDJA 2E6QA 2J8UB 4XNQB 2Z4QA 1JMXA 3GMMB 4XT1C 1B0RA 1HDMB 1M71A 5FHBL 4PRPA 5TE6H 3INUL 2VLJD 3HAEA 5FKPA 3ULSB 3V0VA 5C0AA 3P77A 3MRJB 2H2PD 3PGDB 1LK3L 1MHPH 2VDPL 4TUJA 1MWAA 3GMQA 5DRZB 1NFKA 4ONHB 2LV4A 2OZ4A 5IUSA 4OV5A 4NQSA 1F13A 4Y8DC 3Q3GA 1HH9A 2J7LA 1YJDH 4LRIA 2XG5A 1GL4B 4FQQB 5FYJU 3A0OA 4X6DF 2DQJH 4HUUB 3V7MA 3VXMD 3O6LH 3SGEI 2BX5A 4X98B 1TCRA 2VLKD 3QHZH 4HHAA 4JFED 3SKMA 2R69L 1CICD 1CG9A 5I15L 3MUY1 2QSVA 5LG1A 3SKJH 2E7MA 3HMXH 1WWWX 1OP3K 3BPLB 2CPCA 3T1FA 3GJFK 3C5SA 5IB2A 3ZKMC 5I2IA 5J57B 2R69H 5MHSD 4W6XB 1NBVL 1I7RA 1TJIH 1IC4H 4ZPTB 2E27H 4RNRB 4HGWA 5IESL 3PL6C 3F7YA 3KJ4B 2VDKH 1PAMA 4XB8A 5MEOA 2FR4A 5T33H 4P57A 3PWPB 4I0PB 5D2NE 3KPPB 2OM5A 4R97C 1BBDH 1FNSH 5SWSE 3BPOC 5BV7L 4MJ2A 4RA3A 3JV6A 4IDLA 4HFWA 4YHZL 2VLRD 2ITCA 3DOSA 1ZVSB 5EO9B 4AZ8A 1T7WA 3C8DA 1U95A 2R56L 3C60D 5IMKA 1QSEA 4GS7B 2D7PA 1NKOA 1BBJA 5J4MA 4HEPG 1F58L 1F8TL 4NPYB 3DO7B 2VB5A 4CN4A 4WWKB 5E8EA 5J6HB 5TQ2H 1GVIA 1A6VL 4U0RB 4QRSB 1KT2A 5E1AA 5DVLA 1FNEA 4JKPL 1KENH 5DJCB 3VFTA 3OJVC 2P8PB 1ORQA 4PGBA 3BEWA 5EBLB 1PY4A 1AD9B 2FBJH 2YXFA 2C3WA 5GSRA 4D2NA 5KVGL 4RNRA 3NH7L 1K3IA 1B6UA 5FA4A 2N4IA 2ZOLB 2V7HB 4HJ0C 3EJJX 1LEGA 2QSCL 2DQIH 2FHBA 4QHLA 1X5ZA 4LEOB 3FQNA 5DJYA 1NC4A 1QOKA 2Y06L 1UT9A 4GUPA 4O00A 4ZSOA 4JRWA 5EB9A 1I7TB 3W2DL 1UKQA 2BVQA 4G7VL 1FLRH 4Y8AA 4Q74A 1UWGH 4C56D 1I8KA 3GBLA 5EN2B 3LB6D 1N6QH 4TNVK 1RULL 2EDKA 2YK1H 1ZVSA 3CFDB 3HC4H 5CIPA 3TJHC 3HCVB 4JRYB 3SHSA 2XNAB 5E2VL 3L3IA 5F8QC 5MHSE 5IVZA 1Z6JT 3V8OA 3MRIB 5LQBH 1RD6A 1UB6B 4F7MB 4GQ9L 4MHHI 1D7FA 5HHNA 1FFNA 3KPRB 2W59A 3LKPB 1IGMH 4WW1B 4X7FC 4Q9QH 3FQTA 5GGSA 5L7XH 4K3JL 2CLVA 2ITDA 4JG0H 3WJLC 2YMXL 3T8XA 3B9VA 1OQOA 4JG1H 5SWZE 4AM0B 4XCNA 3TO2B 3M1BB 5F96H 5D9SB 1JHKL 1B4JL 3BT2H 1U42A 1WEJH 3KNBB 3SJVE 5B39A 1FL6B 3C6LB 4JJ5A 2V6HA 5JUEL 2D3VA 4NO2B 1NDGA 3VXQA 1LEIB 2ZOLA 2QTEA 1EA9C 3RIAK 4L8DA 2ZOKA 2C7UA 2DKMA 2GTZB 2Z8VC 4WFHD 3P0YL 3RZCD 1SEQL 1NGXA 1IEBB 4HJJH 2IAMD 4A6YL 4LCWE 1G7IB 1A1OA 4GXUN 1RJLB 3MA7B 4JN1H 5EZJA 4BH7B 4LKXB 4R8WL 3OGCA 5EO0B 1VGKA 4JJHA 5D70L 1KJMB 1QSFB 4WUUA 1T1XA 3N06B 1WF5A 3LDBB 1INDL 4J4PD 4P4RA 5D2LA 1JL8A 1I4FB 1RJLA 3MA7A 1G6RL 4NO0B 4LBEA 4LP5A 4YBQD 5F70A 1MCCA 1JV5B 3SY0A 2HFGL 1KBGL 5ICYA 1T5WA 4M1CD 3CJJA 4JFYB 5IJKC 2X4NB 5FB8B 1IAIM 3IJHA 1AC0A 4P9MH 3C60B 4YHOH 3JVGA 1FLRL 1U8MB 3OKKB 4MNGA 4FNLL 2CXGA 2AK1L 3EGSB 2YN3A 3DETD 4RGND 4BH8B 3E3QC 4EI5A 3DYPA 4PJXF 3REVB 3MRPB 5FGSA 4EI6A 3HZYA 3L3JB 4OZ4B 2JJSA 4BSWA 3C2SA 1CQYA 3DVNA 4PP1D 3IVKB 1GGUA 4NT6A 4FFWC 1XGYL 5FCUL 3R1GL 1QVOB 3QFDB 3AREB 1T89A 5HHOA 5BZDA 3LN4A 1BGXH 1OGAA 1ZA6A 2YD8A 2X4SA 3QI9A 5LXGH 3I6LE 1RMFH 4NNPH 5LAXA 5TDOB 3RJQB 3L7FB 3VRJB 3QG6B 3EO9L 2AXJA 2Q6WB 3GRWH 1CL7H 5GIRB 3BGFB 3IXTB 1YEIH 2UWEA 1HSBB 3SO3C 3T4YB 3LKOA 3UZQA 2X2YA 4D9QE 3MRMB 4FQLH 3TCXA 1JFQL 2Q20A 4WU5A 2W1NA 4MCYA 2UY6A 4Y4KC 1I9IL 4QRPA 4BYHA 3HC3L 4D3CL 5IVNA 4UTAH 4LCWD 4OCNC 3MRQA 5D7LA 3GUTA 3P4NB 3D2UD 1OW0C 4JRYE 4EJ1C 3H42H 3ZSSA 1JN6A 2VLJA 1S7XA 4PRIB 2XWTA 4B41A 1KELL 4I3SH 4NOBA 2OL3B 3O2DH 3RTQC 3A6BL 1PQZA 2VC2H 4L5FL 4ZO7A 3U30C 1S7QA 5SWQA 2FO4A 5IVXE 2OLDA 4TQEH 5D1ZD 2HMID 3G5YA 2MFNA 1T2QH 4OFDA 2ZCHH 2A74B 1L7IH 1IC7L 4YH6A 3E0GA 3AS2A 2E7LA 2XZQL 5E4EC 3PWNA 4L8SB 4P5KB 1GPOL 2Q7NA 3O4LA 2OR9L 4QRTA 5GHWH 1T1ZA 1RZIB 4PS4L 1KJ2L 4DOHE 1FFRA 1R5VA 2MQ0A 1R6VA 4OAWA 3S96A 1IGJA 1CYGA 4LCIH 5C09E 5JW3H 4KKLC 1OTTC 2PUQT 4LSDA 1X5AA 1HH6B 4JDVB 4ZFGH 4H0IA 2FYYB 1KGCD 1ZWIA 2XTJC 1F00I 2Q7YA 5B8CB 4HIHB 5E94B 5JPNB 5DFVD 1VFBB 4HZLA 3I3DA 3DV6B 4DK3A 3MPCA 4PJAE 5E03A 3D0LB 5HGAB 4MD0B 4ODXA 3V5HA 1WTLA 1BZ7B 3S9DB 2NZ9C 1CGSL 3O6LL 4FXGA 3QPQC 2H9GB 2PCPB 1YEHH 2WP3T 1RURH 1PKOA 4URTB 2GHWB 3WD5H 4M5ZH 1QSED 1A4JB 3ARDD 3L3KB 4J8RA 5C6TL 2QHRH 4U2ZA 2IADA 3OXSA 4WI2A 1UA6H 3WIFB 4KDWA 5HYSG 1SBSH 4JRXE 1JF6A 3ARQA 3QH3A 1J0YA 2G9HA 1GC1L 5HD8D 2YC1B 3O41B 1T89C 5KOMC 4GKNB 1I9IH 3UPRB 2VLLB 3N1FC 4PB0H 4ZFOB 3CUPA 4P5MB 1K4DA 1MCPL 4GW4A 3MV9D 1BF2A 4CDHA 5F9JA 1EIBA 1ETZA 2YUWA 4G8GB 4HC1H 3LMJL 4PR5B 3NZ8A 4G3YL 3GMLB 5IROC 1U91A 1C16A 1UQSB 1X3DA 3UYOD 5IQ9B 5D2LE 4H88L 4PRPB 3QDME 1QLFA 4YGAB 1S5IH 3TZVB 3VRJA 1CLCA 2DD8H 3ARFD 1VFBA 3DROB 3GM0A 2X4UB 2EYRB 2A83A 2XA8L 4JFYA 3GZKA 1V3JA 4WO4D 1UH3A 4WGWB 3MNZB 1MCSA 4ZG1A 5CJQL 4A6YB 2DS4A 1FQ9C 3PV6A 4JZJB 5CFHA 1CXHA 2P5WD 3G04A 3QEHB 4W4OA 5GRWA 1C08A 2BXYA 1XF3B 5B38A 4Y19D 3DX7A 1OPGH 1PSKL 4P3WA 5ETUA 4R4FH 3REVA 2P5ED 3P2TA 2CSPA 3MBXH 3O3EB 3CNKA 3L3JA 4OZ4A 5I6XC 4PJ7F 3O41A 2IANB 1I9JH 1DN2A 1JNLL 1XZ0A 2XIDA 5IG7B 5FB8A 3P0VL 2HP4A 3P30H 1S7SB 3VFNB 1ZSDB 4U7SA 4ZUTA 5IM7A 5ITBH 2DICA 3S4SG 2R4RH 1W0WB 4GG6E 3O6FB 2DQCL 1UXWB 2VIRA 1NBYB 3UTZA 5F3HB 2EZ0D 3TBTB 4I0CC 1ULVA 2B1AH 3W2DH 3EYQC 4PJGE 5A2IH 1SYSA 3ALXA 3DSFH 2EXYC 4OBSA 4XNYH 1NGPL 3QQ3A 1UZ6E 4CDGC 5HDQH 1IC5L 2I5YL 3TP4A 5DD6A 2YPLA 2FYYA 2VITB 4GMSH 1CTNA 1BFVL 2X44D 2AW2A 2IFGA 1GSMA 1PX3A 4R96A 4PTTB 2JJUA 2AERT 1G6RA 1NBVH 3KDMA 5CWSA 4JRYA 1DJSA 3L7FA 5J11B 4XVJH 2A0LD 4PJBF 1S9XB 4NO2A 3BRDA 3RHWF 1PG7H 4WEUD 5H94B 4HC1L 3QEQD 2I5YH 1H8SA 3L95B 3FO2A 3GBNH 1JP5A 4Z7QF 3LN5A 4HXBH 4XX1E 5I1GH 2BVOA 1P69B 4Z7QE 4NKQB 4CNIB 4PGJA 4YEEA 3QQ9D 5D9SA 4PJCA 4KV5F 5GZND 1FZMA 3FB7B 2WIMA 4YBLB 4M1CC 5HY9B 1YYMH 3TYFB 3ARED 2M26A 3TYGH 5IR1B 3OKOB 5B4MD 2YKLH 2DLTA 1TQBC 2APVA 4OZGB 5FEBA 3UJJH 4S2SB 1FNAA 3EFFB 1BREA 4LARL 4ONFH 5DZLA 3QDGB 1MHHA 1YUHA 2XQBL 2IMNA 1I8IA 4GAYA 2VL5A 1LO5B 3OXRA 4ZOEA 3H6JA 5D7KD 2EDTA 4HD9A 2A83B 3AS3A 2HLAA 1S9XA 3O2WH 4OFYD 3IFNL 1F3DJ 2NW2B 1SQ2N 4M8QA 3P30L 1G1YA 1MQKL 2R2BA 5D2LB 4JR9H 1IILE 5KVEL 1T83A 2P8LA 1UKTA 3MREB 3SDCA 3MLTB 3HZKB 4A6YH 1FH5H 1G0YR 4LVNC 2DQCH 4OZIE 5DT1H 5I1KL 3ARZA 1KPVB 1CFQA 1OAKH 4LASL 1MPAH 2JK5B 2P24B 2GJ6E 4QCIB 3UYRH 5DO2C 5AG9A 4KPHL 3U0PA 4PJ5B 1OHQA 1BBDL 1DQML 1Q0XH 4WI7A 4X4XA 5D96C 3C09C 1I9RL 1MOEA 4NNYB 5IK3A 3L9RB 1YEKL 4NC2B 5C3TA 4X6FA 1JBJA 4L8DB 1P4LA 5EZOL 4KUCD 5I75B 2J3SA 4XGZA 3VFGH 4KK6C 4IRSA 2R2HA 1OD9A 3LKNA 1OB1B 4ZSOE 2Y72A 5FYKL 3GSNB 1A3RH 1EJOL 5E8NB 5I19L 2PR4H 4JFFA 5FUZL 3BPCA 3STZB 5EO9A 3QCUL 5FCSH 5J13C 5GXBB 2EYTB 4N68A 4XZUB 2DMCA 2X40A 3WNNA 4Y5VB 4FG6D 5DUPH 5IMOA 3QISA 3ZHDA 4M43H 2CK2A 2IPKA 5B22A 2MCPL 3U0WH 3V0VB 4ODBD 2YRLA 5EWIH 3BHBA 4H1LA 1B88A 1T0PB 4FQLL 4HH9A 1I1AD 4TUJB 4GRWE 4F7MA 3TN0A 4YJZL 2X70B 3X3GL 3UBXI 2VO5A 2H32B 3LKOB 3GI9H 4XXDB 1A4KA 4CADB 4JPKL 1R5WA 4FZEL 4H20L 4ELMB 3BH9B 4JM2F 2BRRL 3HR5B 5SWZA 2QSCH 1GJIA 2PYFB 5JHDA 3P4LA 4WW2B 3AY4C 1OP9A 4ODUB 4N8VA 1XF4A 4GFTB 3RY4A 5C08A 4KKLD 4BH8A 4L3EE 3WIHA 3CVHL 1S7SA 2HFFA 2HN7B 1RVFH 1UCBH 1M7DA 2X4OB 4K8RL 4EUPG 1JRHI 2DWDA 4OQTH 2HT3D 5F7FA 1WGOA 3CPLA 3RGHA 5LBSH 4JM4H 4U3XA 2JELH 4F7TB 1XCTA 1CIDA 1MEXL 4GG6A 3ETBF 4XI5D 1IAOB 4NJ9H 5FA3B 2UV3A 3WFCL 5HY9A 3KJ6H 43CAB 4JFOA 1FO0A 1VFOA 2VDNH 4MJ6B 3LB6C 3TPUA 3O3DA 4PY7A 2BK8A 2C4FT 3VFRB 5EBMA 1CFVH 4L8SA 2QJDA 4WUUE 3TFKD 1LEKB 5D96B 3G6AB 4GKOA 4NPYA 1ZHNB 3QDAA 2VDNL 3NA9L 1KNOB 3MBEA 4HUWA 4YHNB 1FZKA 3OMZA 3GB7A 1UENA 4GMTH 2VXTL 2A9NL 5LWYL 5A2KH 5D7JB 1B2WH 4XAWH 3BFOA 2BDNH 3QIWB 1QSEE 2GUOA 4TVPE 1WITA 4KI5D 4JM2B 2OTPA 2DQUL 4LSPL 3IDGA 1FSKB 2Z91B 5CP7A 2OQJB 3CFJB 3LH2L 5B39B 5CJXA 3MFGB 5E4IA 2YZ1A 5FGBC 5E99L 3RL1B 3SBWC 1J86A 3SQBA 4KJPD 2P5EB 3H0TA 2OI9C 3THMH 3P73B 3P0YH 4HEME 3JXAA 5E5UB 4PB9L 3VDBA 4PJCE 1N5YL 3OB0H 5MP6L 3SGEH 3S4SB 5JW4N 1DLFH 1WZKA 4GRLD 4Z7UE 5JZ7D 2WANA 1JUFB 1UACL 1ZHBA 3OKMB 1JGEA 3HE7D 4JHBA 5HDBF 4JO1H 1DBJL 4JKLA 1FVCB 4XVSL 5C0FA 4Z77B 2F53B 5IHZA 3VWJD 5CIPB 4UQ2B 2P5WE 3BAEL 3L5XL 3MODL 3F12B 2KZ1B 3DO3A 3QCVH 1GZQB 3GNMH 1KPUA 3NZ8B 4NRXA 2J2ZA 1ZWIB 5HHNB 4GRWB 3CCHA 1BIIA 4PLNC 4RWYL 2KQNA 2X89D 5J1TC 1CGVA 3TO4D 5CJOH 1CN4A 4I9WD 3ULUF 2H45A 1Z5LB 3VH8B 1HDMA 1I7ZA 4LCWB 3FKUS 3X17A 2F8VA 1FFPB 3IDGB 3QUZD 1XR8B 3BP7B 2H6PB 4PD4K 5D5ME 1SJEB 5C6PB 2NLJA 1MHCA 2DQDL 1D6VH 4F37F 1ED3B 2Y7QA 3WLBA 5E2TH 3H3BC 4C56B 3KNBA 5L8JB 1UB5B 3VJ6B 3S3JA 2CDEB 3V4PH 3D87B 2H1PH 4P59L 1T3FB 3E8UL 1HXYB 1GYAA 3HG1E 1T6VN 2OL3A 3O4LE 5H35B 3IFPB 1LO0L 1ZT7A 1P7QB 2BZDA 4PBXA 1FE8L 4YDVA 5JXAL 4OKVB 1TNMA 1MY5A 5C09A 1H3VA 2B1AL 4EEEA 2RCSH 1A6ZB 1CXIA 3EOAB 2DKUA 1D5XA 3AROA 4PJFE 4LF3B 1FCGA 1CGXA 4XNYL 5I6XB 5C7XH 3BN9D 4UTAL 4X99B 3G5XB 2I9LB 4PJ9C 4U1NB 1CDYA 5F88B 5H37H 3QJHA 4GBXC 4RBPK 1EEZB 2BRQA 2DQEL 2FR4B 2FJGA 4ELMA 5BXFA 3WFHA 3K8LA 5HHMD 1MF2L 3TF7C 4YR6A 2NTFA 2EC9U 3VG0L 5AZ2H 2R0LL 5CJXC 3DARA 4WDIB 2O5YL 4JZJC 4YX2L 5LGJA 1FFNB 3KPRA 2J8OA 2J4WH 3KLAB 1EEQA 1FJ1A 2G60H 4MJID 4TSAH 2NQCA 4L3CA 5TQ0L 3PDDA 3Q2CA 4AK1A 5I0ZA 5EOQL 5ESAA 4M7ZC 1DBAL 5T33L 4I77H 1KB9J 1JF5A 3C08L 1MAKA 2DD8L 3DVNB 4M6OH 3V0WL 3IVKA 5GHWL 5DEGA 1CGYA 3BYYA 2C1OA 2VZ1A 4TTDD 3DSNA 4MWFB 3QFDA 2CJUL 5HYIA 4X7SH 4K7PX 4MJ6A 5F9OL 5IKCA 1RUPH 2OJZH 4Y2DA 2Q86A 4DZ8B 3FMGL 1MJ8H 1A2YA 3HZMA 1EPFA 4UB0L 3C8KB 3L5IA 3FONA 4OZGF 1CFNA 2A38A 1RI8A 5D7KE 3RZWA 5FUOH 4UIKL 4GW1B 3VI4F 4CVWA 3KPNA 4MA3A 3VGAB 1WAAF 2LAGB 4O58H 1Z9SA 3C8KA 2OYPA 3NCFB 2JJTC 5D1ZB 1SM3H 4MDJB 2Y06H 1UWXH 4EVNA 4HZLB 4U1KB 5C9KA 5C0AD 1LP9A 1AO7E 1JWUB 2P24A 4G7VH 2EIZA 1F02I 2XACC 3OTTA 3PP3H 4I13B 3MGTB 3VDAA 3P4NA 1EEZA 4WU7B 1LK3H 5EUOB 1J87A 2Z92A 2NY0D 1SM3L 2NY2B 2QHRL 1EBAA 4L3CB 4EOWH 1I3UA 4O58L 3UYPA 5JXEA 3QUXC 5E2VH 1RZ8B 4K3DH 5J1AB 5DT1L 5HPOA 3OQ3B 1YQVH 3ARDC 3QRGH 2B4CH 4O4YH 1X5GA 4P23A 3SDCB 1T22A 1MCLA 1VADB 2ESVA 4JPIA 1ZS8A 3RY6C 2G75A 3IS1X 4MD5A 2UUDH 3BKJH 5C0RL 4O2FA 3STZA 2D03L 3TN0D 2DDQH 1CCZA 3HMXL 2EYSA 1AR1C 3TJHD 2IH1A 4YZFE 4DKDC 4H5SA 1MCJA 5F72S 1NLBL 3VFNA 5E00A 3DLQR 3U79A 3VXPA 4YUEL 2BP3A 4PJFB 4QTIL 5IR1A 3TM6A 3VFGL 4TSCH 1I1YB 5CEZL 4LARH 5ANMB 5BVJB 3BKMH 4YQXH 5DFTA 3DX8B 4XPFL 4LSRL 3F6IA 5IV2A 1EO8L 4EXPX 4NKDA 3OR7B 1ONQA 2Y9RT 1F6FB 1G9NC 4OUUB 4R0LB 1RZGA 3VFMB 5DQ9B 4XP1L 2KL6A 4BZ1H 3MR9B 3P77B 1Z5LA 2YD5A 3MRHA 3GSVB 4CJ0A 4L8CB 2NW2A 4WHTA 4FABH 5D7JD 2HLFD 4FQIH 3GJEB 3NFNB 5DSCB 3LZFH 4O2EA 4XMPH 5HYFA 2NTFB 4BFIA 4G8EA 1G7MB 4Y5XA 5DK2B 4NQTA 2IGFH 32C2A 1LDSA 1XF2A 3VGEA 3O2VH 2UZIH 1S7WA 1YMMD 3AXLA 2P42B 2RJMA 1LQSR 3LEXA 5CZXC 2ZG1A 4YFLI 4JZOA 4LOUC 4XHJD 4N5EC 4ZSOB 1NDMB 2D31B 5FYJE 2LABA 5K93A 1B0WA 1BQHG 3V6BR 4XNMA 4UDUA 4GW5B 2VIRB 4GXUM 1AD9A 1JTPA 3IS0X 4XC1H 5I73C 1G84A 1EH9A 2QQKH 5FYJL 5AG8A 5D1QC 5DD5H 2ZCLL 1NDMA 5E8PB 1IKNA 1T20B 5DVMA 3T0XA 4X5LA 1YEGL 1XCTB 4BQ8A 4JFFB 7CGTA 1VKXA 4KK8C 1DEDA 2ZSWA 2APBA 4G43A 2D9CA 4XC1L 5EUKB 2HFEA 3BP4A 4J12A 2BVPB 1A47A 2VNCA 4HUNB 2DQHL 5F1NA 5ISZD 3Q6FB 2ZWLT 5HYJE 1DQMH 3TBVB 2CLVB 2ITDB 1FNLA 1U3YA 3HS0A 4G7YL 3IJSA 1PG7L 2HVKB 4MB3A 3KYOA 1N7MH 4Y4KB 5I9QB 3SDXA 3DVIA 4QGTA 3RX7A 5JPNA 3HE7C 3G04B 5H8DA 4XP9H 2GI7A 1AXTL 3S3PA 4WEBL 1PZ5A 3RUGF 3MX0A 2CDFB 5A2LH 1QPXA 5IHBA 1Z9LA 4XRCB 4PJBE 3MV7B 1H8NA 2GUOB 2OSLB 4KKCD 5M94B 1I1CA 1XIWA 3OAZH 5DLMH 4ZUWA 3R06A 2G5BA 4YR6B 1ZT4B 1ZSDA 3ARGB 1P7KB 4RFNC 4ZXBC 5C0FB 5KJRH 4FS0A 3O8XB 2IPUG 3FFCD 3BEVA 1LO2H 5BW7A 1GAFH 1CL7I 1KYOK 3MGAA 5EPMB 4JVWA 1TETL 4OFPA 3LKNB 3X3GH 3K8MA 4GKNA 2YSSB 1I8IB 5HHQB 2AQ1A 1QFWM 3RWHA 3KYNA 4U0QB 4XNZB 5TGBA 4P2YA 3VFPB 3PWUA 1F42A 1RUKL 1IGCL 4N0YH 3QZWG 5E2WL 4QHKI 5J6GB 3PUCA 4Y19A 5EU5B 4BJLA 4HFWB 4RBPH 2EC9T 1HCFX 5DK0B 4R96B 4ZXBB 3LY6A 4HV8B 1UCBL 1DLFL 1P9MC 1BFOB 1Y18A 2AEQH 5E6IB 2P7TB 4K7FA 1OAKL 3L3IB 3RQ3A 1GZQA 3BESR 4YLQT 3QIWA 4M1GH 3DTXA 4O2CB 1EXUB 1H3WM 4P9HC 2O93L 1RUKH 4N0YL 3PF2A 1MRCL 1WT5A 5D8JL 2Q87A 3LH2H 4G8EB 4MDJA 1AO7B 5SWZB 1MI5A 3ZYZA 1KEML 3AUVA 5C08E 1G7JA 5CLTA 1FL3A 5TPWH 4AEIL 3ZYJA 1T1YB 4KK5D 3RPKA 5MENB 2DKSA 1HZHH 1P1ZB 3MRDA 3VFOA 4PRAB 3BN9C 3X13B 1G6RH 3BI9X 1WVZA 2AV1A 5E9DB 2C3XA 4ZFGL 4MHHG 4LFHG 5EORH 4FQXC 3RAJH 1XAUA 3KPRD 1ZXQA 4QXUL 5GSRB 2VJXA 4Z7OE 4MJIA 5FV2A 4AG4L 3KPMB 3V52H 3WO4B 1N59A 2DQUH 3SQOL 3VGGA 5F93C 5TF0A 1EVUA 4PPTA 3QXAA 4HWBA 2X41A 3UTZB 5HHOE 1H3PL 2E9WA 3NTCH 2BVEA 2FX9L 4FFVD 1INDH 4IRSB 3OV6A 4NUGL 3DX9A 1Q72L 4R7NB 3TA3B 3U4BL 4F33B 3B4NA 1D5IH 4PJ7B 1T7XA 4YHIA 1G7PA 2DQEH 2WV3A 1T0MB 1VFUA 3VMOA 4NYLA 4PJ9A 5CEXA 1J5OL 1HIML 1FP5A 2OCFD 2EH7L 4XCCH 4Q9RH 1ZLUK 4LBEB 2GJ6B 3D2UA 3MV7E 3RWDA 4DGYL 3O3AB 1MFDL 1CGTA 2OQJA 4GS7C 2IQ9H 2HT4D 1DBBH 1J0JA 4DK6A 1G7HA 4YEFA 5CIPH 1HHGA 4HK0A 4NRZA 1L0YA 4DN4L 1AQDB 1EJ6A 1YNKL 1O5DT 1X5JA 5JW4R 3VFVA 2GJ6A 5CMAB 4QRTB 1FPTH 3CXDH 4QHMA 4RGNB 1BQSA 3IGAA 4I2XA 4PLKC 3RBGA 5E70A 4IMLA 1EMTL 4QEGA 4MA7L 4WI8A 1MAMH 3P40A 1JPGB 1HXYA 2R0KH 2XICA 2Y4SA 1IZJA 1KJ2H 4HUMB 2R39A 4HSQA 5I1JH 4JREB 1PQZB 4D3CH 4OTXH 5I8KL 1CXFA 3AM8A 1IC1A 1CF8H 3G5YB 2FIKA 2ZZUT 4ZO8A 5HJ3B 2UUDK 2R0KL 5EU3B 3QXAB 4MNHA 3QO0B 2W38A 1PSKH 4F3FB 5GGVY 4KHXL 43CAA 4Z7VB 1GOFA 4WFGE 3MFFB 4WJ5B 2F54A 1OL0A 3U4EA 2GSIA 4JKMA 4KXZH 2Y1VA 5ESQA 3ZDXF 3DI3B 3VXRB 3BOVA 4N1HB 3L3DB 1OAXH 3E8UH 4JREC 4K7PH 2B39A 2XKNA 4KHXH 3MRNA 2W9DH 3W11C 5DMIH 4JY5H 4EOWL 3KPLB 3LRSB 4W6YB 1QHOA 3TVMB 3GB7B 3AU1B 4RGNC 2EZ0C 4I0KA 1TJHL 1NEZG 1U2CA 4XMKH 1N6UA 1L6XA 2DQJL 2AV7B 4JO1L 1N0LA 3LRSA 3PABA 3ARDA 5FECB 4JY5L 3SDDA 5L6YH 2NY6D 4OB5L 5ENWA 4MS8D 3WE6B 4ODHH 3GSNL 4ZDHA 1NGPH 4QHLB 3GSQB 5IK3B 5ADOH 4ZOAA 5EU4A 4U1MB 3QWRD 1NFDB 4YUEH 1UJTA 1BQHB 3O3BA 2UVEA 1NUGA 1YQVL 3HZYB 3IAPA 2ICEB 2PN5A 5JW3L 1ACZA 4U1MA 2XQYG 2N1KA 4MMZC 1RZJC 6FABL 3TT3H 1FVDA 4WHDA 5ADOL 1LDPH 4U4BA 3PXJA 2B5IB 1JJUA 1WBZB 2EDYA 3S5LG 3WKMH 2ZP0T 3MRMA 1P84J 3RVTD 4P4KA 3LQAL 4HGMA 2X4NA 5BJTA 3U7WH 3GJFB 3NIGF 1G7PB 3UJIH 5L0QC 2Y6SD 1ZE3C 3ARYA 5IB1A 4D0DB 4ZD3H 4W70A 1A64A 4HKXA 1JNJA 3KLHD 4HWNA 3GJEA 4UDUB 4NQCD 5KTEH 5BS0B 1XGPA 4IRJB 3DX7B 3QHZL 1HHGB 4F57L 4R2GB 4Y5XC 1EK3A 3C6SA 4OQ1A 2HMIC 4ELKB 3BRGC 3ULVH 4EQ3A 2O26U 4UI2A 4P49A 2GAZB 4TNWF 5CZVL 5EIIA 1JNLH 2OK0H 3INUH 1EAPB 1S7UA 1JWSB 4IOFD 4POZC 5IT2H 2M2DA 1ZLVH 3JWDL 1BP3B 1NEZB 2CIKB 3SDYL 5L9DL 1DVFC 1IEHA 2EYTA 1AQKH 2XZAL 4EBQH 4PRAA 5H37G 1LO3H 5D1QA 3E1F1 4O9HH 4HFUH 3N9GH 4I1NB 1IKNC 3FONB 2FD6L 4GMSL 2VDKL 2EIDA 4RISH 4HXAL 3WNMA 4TSAL 4LHUB 2XZAH 5FYLD 4PGEB 2X4RA 4LMQE 3BP5A 4X5XB 2J4WL 2D7TH 4DAGH 4FXKB 4RQQB 1CE1L 3BO8A 4N0FA 1T4KB 1OPGL 4M7JL 1C08B 1DEEA 3WUWB 5DURD 4UZGA 4PGEA 5GGRB 4L4TB 4Y16B 4A6YA 4ZUSB 4LSSH 2R8SL 2NXZC 4HXAH 4OLYL 2KBGA 1HNGA 4QXWA 3MLUH 2EE2A 5ELIA 2X4PB 3RI5F 3QUXA 3S6CA 4MD4B 4QHNB 5TFSL 3AFLA 2BNQB 4L9LC 5DLML 1Z9OA 4ZUSA 4P3CL 4PP2B 2CLZA 4OI9A 1V7MH 1MSPA 1IMHC 1W2KT 1G9ML 2RR3A 3VWJA 1F4YL 4OSUL 1NFIA 3SE4A 5EH1A 4M6ML 5GS0H 4M3KB 5J9PB 1U3ZA 2XXMB 3PWVA 3KG5A 2D4DA 1MI5D 3VFRA 3ZDYE 1TETH 4JKWA 5CEYA 1MQ8A 1KXVC 3QR2A 3QH3B 5ESVB 4YDVB 5LVEA 5FGRA 4FZEH 5I8EA 1JWUA 3HPJB 5F7WC 4JDTH 4X5XA 4POYA 2X10A 1K8DB 1QLEH 4TSBL 1N3NA 4MAYC 2ED9A 3CSPA 3UTTE 5GZOC 5F9AC 1N7ML 3T1WA 2GSGA 1PD6A 4TVPL 3QUZA 3QWOB 2ICWJ 1MJJB 1YJDL 4U1IA 4UT6L 2F5AH 4NJAH 1E4KC 3SPVB 1WBYB 3BGAA 3W0WE 5CD3B 5DD5L 2DN7A 4UV7H 4Y5XB 3AS1A 3WFEL 3JV6B 3KXFB 1CD1A 1QYGL 3W5MA 1YEGH 1NLBH 4QOKA 4G8GE 5IEHB 3KJ6L 2XQBH 3DTXB 3G5VA 1B0GB 1T21A 3UYRL 3LKSB 1CFVL 2ENYA 3IU3B 4QRRA 2VLMD 1GZPB 3F6LA 4S1DD 4X6EB 4HWZA 1I9EA 5C09D 1L7TH 2WWKO 1AD0A 5HGHB 2AK4D 1HHJA 3K7UA 4L1DA 2WWMD 5CILH 3OHXA 3VGFA 5MEPB 1QYGH 3DUUA 1FAKT 4XWOD 1C5CH 1P4IH 4M1GL 1P5UA 3LRHA 3OKOA 4F33A 4GRMA 3ZT7A 4OLUL 4G6FD 3IDMA 5TDNB 3RWHB 4XCEA 3S36X 4KWUA 1JZ6A 1FN4B 2J8HA 2VR4A 3WJLA 5I19H 4JY6A 4P0DA 3MXVL 2QSQA 4JJ5B 1HN1A 4IHOA 4BZ2H 4LSTH 3VXNB 3U4BH 3ILQD 5JMRA 4RZCB 1RFDH 1BQHA 3V2AR 2J88L 3QBTB 4NKIH 2PXYA 1IGTA 3PGDA 2H26A 8CGTA 1XEDA 3H9ZA 4NQDA 5DDHA 5FDWB 5FM8A 3WV0A 2MJWA 2WLYA 5JZ7C 3EHBD 5AEAA 1T66D 3HAEB 3R0MA 4KDVA 5BS0A 5FYKH 3KDMB 1AFVH 5CWSB 1R3JB 2A6IB 2XZCL 1HEZB 3HZVB 3NN8A 3IKKA 4GRLA 2K7PA 4PJBA 1RUAL 1F6AA 4L9LA 1O7VA 3MRRB 1FYHB 4JDTL 3WLBB 1E28B 4NRYB 1NCCL 3SDCC 5C1MB 3MCG1 2Q76B 5JHDE 4M43L 2XT1B 1JV5A 4JM4L 3SY0B 5HJ3A 3GSOA 4NQEA 1CU4H 3RUGA 4LQFL 3GM8A 2OXHA 4R7DA 1E28A 4NRYA 5FDYA 7FABH 3MMEB 1H3TA 5BVPL 3W0WD 4YXLH 4NZUH 2YZ8A 3CH8A 3NPZB 4F9LC 4UINL 4OKVA 1EJOH 1G7LA 3I6KB 1B6DA 3QXDA 1XGYH 5FCUH 3RFZC 1C16B 1UQSA 4Y4FD 4OM0H 4G9FA 1N64L 3M1BA 3WNOA 3M8OH 1QSFD 3PWPA 3ALPA 4IRJD 4U1HB 1FZMB 3FB7A 3UTSE 3MRPA 3NIFE 4G6ML 3FT4B 4U05A 1BVKB 1BOYA 2YK1L 2DMBA 5DHYA 4BK5A 3NCBB 4CJ1A 3U2SA 1TLKA 4IRSC 1S7UB 2OP4L 3ULUL 4TRPH 1N4XH 4PRDB 4PV8A 4ENED 3LSOA 5JXED 2BY0A 4POUB 4D0CA 1N8ZB 2P5EE 4WU5B 2AK4E 3QYCA 4DW2L 2RCSL 5KVFH 1F97A 3DXAA 3WS3A 4NNXA 3KPOB 2ZSVA 1YEDA 1P9MA 1QFUH 3UTTB 3AMLA 4KKCC 1S7VB 4QNPE 1BJ1H 5TE7H 3CFEA 1W0VA 4MD4A 2X9WA 4UILH 3ZT6A 2BHUA 3WHXB 3GO1H 3MRNB 5C70A 1NL0H 4RGNE 4XXDA 1PG7X 4A2MA 3BX7C 3WXWH 5IQ7H 35C8H 4NM8H 4MCYB 1F3RB 1BF8A 3BZ4A 5FKAA 5E6ZA 5JIKA 1NBZA 3OAYH 4UILL 3L7EB 4FQ1H 1J0HA 5GRYA 1CF8L 3K2MC 4P2OC 2JB5H 4ONOA 5KSBF 2AJZB 1HIMH 5EZLA 1IGJB 5EU5A 4LLDA 4XWGL 2BVPA 3I6LD 1W0WA 5KSBE 4GUPB 2BFVH 4YK4B 3VWKB 3C5SB 4FG6C 5IB2B 1CFSB 3FQWB 1WTGT 5IGXH 4CGTA 4KAQL 3D69B 2ZUXA 2VXVH 4GKZB 5T3ZD 2ZCKH 3SGDH 4OB5H 3FRPG 4JE4B 4Q6IA 3G6AA 2IBGA 1RHHB 3U9UB 4NT6B 5TQ0H 1ZT1B 4XWGH 4PY8J 1WCBB 1UJ3C 3FB8A 3BIKB 3E6FA 3VRLF 1UADC 5EC2A 4B7IA 3HKFA 4Q0XH 4KAQH 5BMFL 1YMMA 5ESVA 1BZ7A 3RWCB 3QDGD 5BV7B 2EO1A 2NY7L 3GIVA 4CL7A 2YRPA 5E95B 2X9XA 1BFOA 5DVNA 4BQ6A 2P46B 4P4KC 3RWDB 1E6JL 4Y2DD 1P1ZA 3IU3A 3UTSD 1KT2B 5E1AB 1D6VL 2VDMH 3CFJA 4ODWA 4PJ9B 1VERA 5CEXB 4N0RA 3T4YA 4X9BA 4PYGA 4HQQL 2AVGA 1NUDA 1KIRA 1CQKA 4ONGL 2OXGA 3KXFE 3UZVB 1MJUH 5D5MA 4N90D 1ZLWK 3IDIA 4YDIL 3SDAC 3JSSA 1UA6L 5E2TL 4JANB 1MFNA 5FAAA 1IJ9A 3SBWA 1TQBB 1JCKA 4MX7A 4N8CL 5F21B 1OAQL 3IETA 4RFEA 1DBMH 4U1NA 3CXHJ 1T6WA 1OAUL 3NZHL 1RIVL 2YD1A 3BWUC 3O6FC 4R7NA 3HNTH 4LAQL 4YC2C 1MCPH 4DFHA 4S2SA 1IL1A 2WBWB 5SWQB 1KTKE 5I71C 3UTOA 2XA3A 1F90H 5GRXG 1M7XA 1N59B 3FRPA 2D4FA 4V2CB 3PWJB 1OAUH 4PJFA 3WBDA 4I48B 5A3ID 4X6CA 3VXOA 5D72H 4DN4H 5BQ7A 3BKJL 1DBBL 5C0RH 3SE8H 4KI5C 5ESAB 2R4SL 3LKQB 2WQRA 5ID0B 5I73B 4HS8H 3VA6A 2DQTH 1U9KA 1DQQB 3TBYA 1BQLL 3GMRA 1KIQB 3GMOA 3QDJB 3N1MC 5C08B 3JWOC 3QEUA 1IAKA 4DUXA 4H0HB 3NIDE 2O5YH 3IDJA 5C0BD 3MUZ1 4B7LA 3SGDI 4Y1AA 4WHTB 3ISWA 3I02A 1EUUA 1PJ9A 1R5WB 4JFHD 2IGFL 3R06B 1DE4B 3I85A 1ZGLP 4HJ0D 5DJXA 5EC1B 5DF0A 4NHCL 4PTUB 4XH2A 1N0XL 5HGDB 1UGNA 1CT8B 2W0FB 1JUFA 3PHQB 4FQJH 1TFHA 3LN9A 3QCTH 3FN0H 4G9FE 3T3MF 2GTZA 3VWJC 4PJHA 5JHLH 4WNQB 4XZUA 2ADGA 2DJUA 3T3ME 3WSQH 4APQB 1YQ2A 3G08B 1A1OB 4GG8A 4QRRD 4U1SB 4DQOL 4UQ2A 4NUJA 2OTWA 4OGAD 1DUZB 1G7QA 4JGUA 1Z9MA 4LCCA 3T09A 2P49B 3QEQB 4GW1A 2X1QA 4KTDL 1H5BC 3WMSA 4G8GD 3ZE2E 3VW3L 4MXQC 2MPAH 2ZJSL 4KUZH 3B5GA 4MAYA 1YMHB 5C07B 1BFVH 3EYVB 3NGBC 3TH3T 5ICXA 2HFTA 3WXVL 3EYOB 3QUZC 1GRWA 4HCRA 4L4TA 4Y16A 3MLTA 4EBQL 3WEXB 1HYRC 2Z92B 2JKXA 2ZJSH 4KUZL 4JFDE 4K9EC 4QRSA 1QD0A 3LOWA 5C6TH 4PBVC 3N9GL 5HGDA 3T0AA 1DR9A 4EN3B 3GHBH 2LTQB 5IEHA 1F6LL 4JZJA 4QHUB 1BOGA 1RZKH 4HIJB 4PG9A 1XR8A 3BP7A 5I17A 3RJDA 2IH3B 1HOCB 2BOBB 4X6DB 3DRTB 2IWGA 5HVHB 4PJDA 3CPLB 6FABH 1RIHL 3RVWC 4Z77A 4R0LC 5TGBB 2BMKA 4NUJB 5DI8A 1J05A 3WKML 4HIJA 5FXCH 3MR9A 1FNHA 3VA2C 4XPGL 3CX5K 4YDKL 3PL6B 2PF6A 4RAUA 1QLEL 4TSBH 2FEEL 2AABL 4GRMB 1IAIL 3IDNA 2W65B 4X0KB 2I9TA 1GC1C 2PR4L 5FUZH 4KZEH 4WJ5A 3ORJA 4UT6H 4WW2C 1U8QB 5IW1A 2AAVA 2W65A 2I9TB 3I9GH 2VDPH 5E8OB 2XNAA 4BUGA 1YMHA 3WFEH 4H1LB 1H3UA 1KPVA 2F19H 4RMVA 5CBEB 5CCKH 2ADJA 5K9OA 3DMMB 1EO5A 1WJ3A 1UB6A 4XB7A 4R8WH 3BSZL 1MJ7L 1JWMA 4P2CG 2R1XA 3T4AB 5FYKE 1HXMB 1MQKH 2MWCA 4ALAL 3QUMH 2DWEA 2FX7H 3B5TA 3QUXB 3T0WA 2HLAB 5HGAA 5DS8A 2F19L 3C5ZC 5CCKL 1KUMA 4ENEC 5JXEC 5J1AA 2HG5A 1OP3H 5AD0A 5HYJB 3H0TB 5L2KB 4PP1C 4NQSB 5GSVA 3KHOA 4LVNB 1FORL 1ZTXH 5DJZA 2CLRA 3CDYA 4ALAH 4PJ8C 3HLAB 5IB4A 4ODWB 3RGVA 3WIIL 1FGVL 2VLLA 1GOGA 4Z7VE 3B83A 4LSRH 1LEGB 3F12A 4JFOB 1MRDH 4I9WE 1IEAA 4YHKL 2ZUYA 1EEYA 4HMEA 5I1LA 3OR7A 1FVCA 3RTQB 4PJEE 5GS2D 1VDGA 4M48H 1A3RL 3G5ZB 2EKJA 4G9DB 2Q8AL 4DVBA 2EEDA 2FGWH 3PJSA 3FQRB 2HWZL 5IFJA 2RAMA 1BX2A 3NCJH 3NFPB 5DRNB 3PHOA 4P3CH 3N85H 4CVZB 2C5DC 2E3VA 5TFSH 2EDEA 4J3XA 4PRHB 2X4PA 1G0XA 3BUYA 4HBCH 2I60L 1II4E 2JJWA 1JNHB 2A9NH 2W9LA 2XFXB 1YDPA 4O02L 3SGJC 5CMAA 4Y5YB 3FN9A 2Q7YB 2LFGA 2R1XB 4DVRL 1RSFA 1J5OH 1YEIL 4HLZG 5I1CH 4KMQA 4KU1A 3BHBB 4Z95L 4KVCH 1AKJA 3TLRA 4TNVF 4WDIA 4EIZC 1SEBA 7FABL 3FO1B 4OUOA 5L2KA 2V5RA 4KMTH 4M7LL 5C0NC 2J88H 3FFCA 1JHKH 3MJ6A 4QT5B 4JLRA 3SJVD 3EDKA 2NY6B 2FJFB 2FX8L 3L1OL 5CEZD 2NY1D 1I1RA 3PDOB 4KVCL 1D5BB 2IALA 5INDA 3BXNB 5TDOA 3GO1L 5HHME 2VN4A 3G5ZA 1RUAH 1KELH 4I3SL 5DQJB 3OAZK 1ETZB 3LN4B 5EO1B 1E6OL 1RPQA 3QJHB 4KMTL 4M7LH 35C8L 1IC7H 4TPRH 4UBDD 4NO5A 4Y19E 4PRIE 4NQCA 2BSTA 3QEGH 5KVEH 1JNNH 2XZQH 2YRZA 3L3GB 4WNQA 1SVCP 2EIEA 2UYLA 1KTLB 3IDYB 3QXUA 1KLGB 4XCYB 4DUVA 4PJAF 4L3AA 3QFJB 2Z91A 4L4TE 5GRJL 3RWFA 5FKPB 1E6OH 3BIKA 3E6FB 3QPQD 2PNDA 1FCCA 4EZMA 3JV5A 3MLZL 4AIXA 1JF1A 1AXSA 3Q5OA 2YPKA 1EV2E 3JTTB 4OD2B 4LOUD 4OLUH 1OVZA 5F6IB 3MBEB 4YHNA 5I8CA 1G7MA 3TH2T 4MD0A 5EORL 4YGVB 2XWTB 5HI4D 1GAFL 1RU9H 2BY1A 5D1QD 3OKMA 2HWZH 4E42A 4JB9H 5DJ6B 4RDQG 2I07A 2XN9A 2YEZA 1UACH 3JV0A 5C0AE 1Y0LB 1U3HB 3LHPL 4MA3B 3MRFA 2EEAA 5DUBA 3VFWB 1YJDC 5MP6H 1I1FB 4TUKL 5H2BA 4S1RL 3GHEH 3N1GC 4O02H 4Z6AT 2GY7B 2ZCKL 4QY8B 2CMRL 1HE7A 1W72A 4M93C 1NCUA 4N8PA 43C9A 1ZMYA 3U2SB 2B5IC 3VD3A 5KS9A 4QRPD 3L6FB 2VL5B 2AQ3A 4OZFH 5F1NB 1UXWA 3GMNB 4NO5B 5C0BE 4MS8C 2QR0B 5DEFB 3GI8H 2V9RA 3O45A 4PJ8B 5KVMC 2R0ZH 1A6TB 1FVEA 4PB0L 1ZANL 4ZYKA 1TJGH 5ECJE 4PJCF 4NSKA 3QIBD 1VEPA 1AGFB 4NC1C 4IJ3B 2GYSA 3DUSA 4QRPB 3RNKA 4R6UA 3CC5A 4Z76A 1JF1B 3QWRA 4HH9B 4IDJL 4QCIA 3HC3H 3MV7A 5K33A 2R0LH 3PP4H 3A6CL 4ZXBD 1HHJB 2XRAH 1PX4A 1PZ5B 5ALCL 3DMMC 2B1HL 1G9NL 2A1WH 5D71L 4PP2A 1SEBB 4UDTB 3UPRA 1A1NB 4ODVL 1MFBH 4HCRL 1XCQA 4Z7VA 2A6JB 2C3HA 1R3LA 5I1HH 1SJHB 3SQOH 4F7CB 5T1KA 2KPNA 3HFML 5HI5D 2I26N 1EHAA 3A6CH 5HHQA 1FIEA 1HSAA 2R0WL 4PGDA 5BRZD 4FHBD 5EBWB 1C5BL 4XCFH 3BPCB 1Q72H 4NZRL 4J6RH 1FBIL 1FL6A 3TGXA 3RY6A 1PYWA 5F9JB 1TITA 1UZ6F 5I8OL 3NIFF 4PY7B 4JQIL 1CXLA 4U1HA 1CBVH 1LP9F 1JGEB 2X4QA 1OAYL 2F54E 5E9DD 2VR5A 4G8IB 2MPAL 3I50H 5IQ7L 4BM7A 4X6BA 5IF0B 3LQMA 1IM9B 3T65B 1R3HB 3ECBB 3HRPA 1CZ8L 2FL5A 1URLA 3U30B 4KDTC 4DQOH 4FQ1L 1CD1B 1ZA3B 1YPZF 4IRZH 2NX5E 2R2BB 1X5KA 3I50L 4IOIA 3W39B 3WNPA 4H26B 3SE3A 2MSPA 2ZNWA 3KWWB 4PJHF 3QQ9C 3VWJB 3MMEA 3TA3D 4CVZA 3H9HA 4YX2H 1T5WB 3W9EB 4EIGB 3RPIB 2NNAB 4ZNEA 4NQEE 5HVWA 4LDLB 1A9BB 4AIZA 5I1AB 3OHXB 1WIOA 1VKXB 2DYPD 4ORZC 4C4KO 5IWLA 3FQUB 4NBYB 3NCEB 5I8EB 1JZ3A 3RZCA 1C7SA 3SO3B 5C9JB 3TPUB 5IW1B 1OSPL 3G6JE 4JZNA 2UWEF 3QUYB 1WAAA 5GS0L 4YDKH 2AK4B 4LVOB 3BDXA 4JFQB 1JHTB 4TSCL 4U33A 2AJSL 4W4NA 3K2UL 4YFEA 3IAGC 1KB5L 2HVKA 3VI3F 4Z7WE 4Z7VF 4KKAC 3OB8A 1EGJA 4FQ2L 1JGUH 3QWQB 1E6JH 1H9VA 4P5KA 1I7TA 1AY1L 4X0KA 1ZHKA 3SGKC 5ID0A 1DUYB 4EDWH 4PBWD 4LEOA 3QIUC 3U36B 5EU7C 4XPGH 5DJAA 3UTQA 2PTUA 4NWTH 3NPSC 3ELAT 4FQXB 2GAZA 4S11A 3Q5YA 4K3DL 4H0GA 4CUCA 1TPXC 3V4VH 1M4KA 5GRVL 5E6ID 4YC2B 4OCXL 1S3KH 4HT1H 4UIKH 4LNRA 4O2CA 3DMMA 4OLXL 2AJXL 1P5VA 5L6YL 4M7KH 1WZLA 2X7LB 1RZKL 4FFZH 3HCVA 3LS4L 5GGTA 5IT2L 1I3VA 4EDWL 3K1KC 3TEUA 2AJ3B 4RFEB 1MIML 5L9DH 1NCWL 3B43A 4F7EA 4QO1A 1V05A 1I85C 5EUOE 3VFSA 4NKMB 3L3HA 5HPMA 2HRPH 5F1SA 2BSRA 2YD9A 3G5VB 3SDDC 5HHPA 3BSZH 4UT7H 5MEQA 1JPFA 4OLXH 3W0WB 4AENA 1TZHB 1BX2B 5FYJH 3VMPA 5I71B 1W8OA 4GG6B 1BQLH 1OCWL 3FFDA 2HJKB 2DQTL 2GQHA 4H5SB 3QRGL 4G5ZL 3O45B 1KJ2A 4U1SA 5MENE 4TVPD 3KPPA 1BWWA 2X4QB 4XCEB 1QO3A 2H8PB 3QEQA 4M02A 5JA9A 2IF7A 3ARFC 4ZPVA 2R8SH 4FTVB 2NY1C 3TBWB 3VGBA 3QHFH 4KDTA 3VI4E 4BQ9A 2G60L 5DFWH 4BK4A 2K9UA 3DIFB 5ID1B 1QR1B 1BLNA 4JPVH 1KPRB 2NZIA 3CVIL 3OKEB 5DRWA 2IBBA 3CFCL 4D0BB 1DE4A 3B9AA 3X13A 2NY6C 4GQPH 1IBGL 3OJMB 3F58H 4P9HH 1TQCC 1CT8A 1F58H 1OGAE 2W0FA 3QXVA 3OL2A 3SGJA 3WUWG 3SCMD 4LVHC 5K9JL 1NMAH 2W0PA 3EIFA 3DV6A 4P5TB 5J12C 1J1XH 5D5MB 5I17B 5ICYB 1A7RH 3UEZA 2BNQA 3I02B 3RZCC 1QR4A 3KPSB 2A6DA 3WNKA 2K1MA 3LEYL 3CFIC 3CGTA 2IMMA 4FABL 4LPUA 3CX2A 2PXYD 1H8OA 1JK8B 1IBGH 4IS6B 1AIFB 4HGWB 1DFBL 5F7DB 5F9WC 1CDUA 3B3IA 4CKVX 2XWBB 4NCC1 1A7RL 1XH3A 3DPBA 3HZMB 3TZVC 3TJEH 3QT2A 5DD1H 3LEYH 2VXSH 5M7QA 5J6GA 3EYVA 4NJAL 1CD9B 2I25N 2ICWA 3VXUA 4OF6A 3UTTA 3K74B 4OF7A 3T2OA 5DMGD 2F53E 1IKFL 5ADPH 4GKSA 2HJFA 3WN5A 5F3HA 5IW6A 4LCYB 1MREL 1PG7W 4F37K 4PRNB 2VYRE 4JR9L 2VABB 4LLMB 3BD5A 4P2QA 1QEWB 1A7PH 2EH8L 1MRCH 4IRJC 4BFGA 3RL2B 1R24A 1ZOXA 4L9DA 4QHNA 3P4MA 4HK0B 3UTSB 4IRSD 3LPFA 5FIEA 4KY1L 1S9WB 5KSVB 4POZD 1JTTA 2OP4H 3ULUH 4KPHH 5LQBL 5I16B 1AIFA 3B9KB 3LKSA 1KCUH 3C6SB 3VXRE 12E8L 4CBPA 3PNWB 1DDHA 1VENA 3H9SA 3TYGL 2GK0B 3RRQA 3P9MA 5FO7B 3QO1B 2KQMA 4V1DA 1X9QA 2FH8A 1JYVA 3GBMH 2VZUA 2A74A 4PJAA 2BNUA 3P9WB 5FK9A 4KC3B 1OD7A 5ISZE 3MNWB 2O5ZH 4K8RC 4MNHB 3OX8A 4R97B 1F8TH 4K7FB 5BJTB 3QFJE 2B20A 1QVOA 2HJFB 1K4DB 1MRFH 3WHE1 2GSGB 4CVXA 3G5XA 5I18L 1U8NA 1FNGB 3L3GA 2AEQL 3HNVL 3VXUB 2VXVL 5EZJB 2CRZA 4LLDB 4X7DC 4NM8L 4NKIL 5J89A 3BH8B 1SHMA 1OTSC 4U0RC 5IFAH 4RSVA 3UROR 2IQAB 3L1OH 3PWUB 4ZPVB 1U92A 1F4AA 3AAZB 3WS6A 3MJ8A 4W68A 1S9KC 3T2NH 1NAKL 1CD0A 2JB5L 3BH8A 4L4JA 2ARJB 5DXWA 2YN5A 3VFOB 5HVGB 4DTGL 2XY1A 3QEHA 3GRWA 4XVTH 3P9LB 2VITA 3ARSA 5E9DA 4YGVA 1RFDL 4QOKB 4C58B 2DQIL 2PTTA 5BRZE 2HA1A 2F53D 1OQXA 1JNNL 2NY4D 4JVUA 4UUJB 3MCKA 3U4AA 4YDJA 4A2LA 1N2RA 2VTFA 5DS8B 1OF2B 1ZKAA 1HZHL 3RAJL 5GISL 4MA7H 4Q0XL 3JWOL 4G6MH 3UJTH 2ZNXA 5CP3A 4P5TD 4U2YA 3FFCB 4TUOA 4RMUA 3MXVH 1XFPA 2E8ZA 3WFBL 4XP4H 1N64H 3DVFA 3TA3A 1MUJB 1KIPA 1WBXB 3HUJE 2B7DT 3NGBB 2XRAL 1G7IA 1FAIL 4DW2H 1S7TA 3DX6A 5CZKA 2APXA 2VKXA 1KCKA 3L6FA 5E4EB 4M4RA 2XTJD 5DUPL 1PY9A 1I8KB 4RRPG 4U6TA 3KPTA 4Q9CA 1MWAL 3U4EB 4MJIB 4ACPA 2CXKA 2YSSA 2YPLD 2JTDA 1RZJH 4I4WA 4ETQB 4DKFH 1EGJL 2VR9A 5EDXA 1BFSA 3C60A 3HFMH 3CH1A 2HT2C 3L5WB 2EH7H 1NCDH 3HG1B 3FQRA 3SKOA 5JR1H 1FGNL 5L2JB 2Q3ZA 3V5HB 4HIXH 5DQDH 1QA9B 4ESKA 5DJ0B 2Y5TA 3WXWL 4M1DL 4PJEB 2P4AB 5JUEH 4WTZA 4GAFB 2Z4QB 2A73A 4JQIH 4LQFH 4WCYH 5TDPA 2FJFA 1S9YB 4ODXB 1BD2E 4QTHB 4DUWA 1KOAA 4ZO6A 4NUGH 3D18A 4OD2A 4H26A 3Q3GB 1EVTC 5CEYB 1ITCA 2HKHL 3MBEC 4KVNL 5I16A 2Q76A 4PJ5D 4FTVD 2Y07L 4YHLL 3CIQA 1P4BL 5TE7L 3TNNB 4QGYA 1I3RA 2XWJB 3O2DL 4NZRH 3TH4T 4ZFOA 5DZNA 4QYOA 4G42B 4P3DA 1OOAA 4KJQC 1CVRA 5EUOF 5DD3H 5E6IC 4P2RD 4NQCB 1IM3B 1ZHLB 4AEFA 3O11A 2BSSB 4NN5C 2VC2L 3TV3L 1T2QL 3IJYA 3KYNB 4WVRA 4MNGE 3D69A 1OAZH 1UM6L 2W07A 1T66C 3C8HA 3MODH 1FFOA 4UB0H 3VRIB 1FL5B 2VZOA 4OZIF 4ETQA 5MEOB 4X6BB 1UH2A 3BO8B 4N0FB 4FP8L 5E8OA 3D25B 4ZAKB 5I1DA 1KULA 1Y18B 1G6VK 1I1AB 3ILPB 3QCTL 3N50A 1F11B 5F6HJ 5L88H 2EDBA 5DHXB 4ELMF 4MJ4A 1K2DB 2OSLA 1S3KL 2K3TA 4OLVL 1U8HA 1JGUL 3MLSL 5FM5M 1A6WH 3QPXH 5ILTL 1N5YH 4QRQA 4FQHB 2Z93A 3TIEB 2CMRH 2FZ3B 1S7WB 4OCLC 1FHGA 1R3IL 2WIIB 5HGBB 1PEZA 1JWSA 1MVFA 3Q48A 4M8VA 4WWKD 5CZVH 3LV3A 1HNFA 2FX9H 4IHOB 1NCDL 5KVDH 4K9EL 1B9ZA 4OM1L 2FZ3A 2QKIA 1KJVA 2WW8A 3O4LB 3MA9H 4O5LL 1TJGL 5SWSB 1MCBA 5D4QA 5E5MB 1CFTA 4P2OA 1AJ7H 4CAGA 2YD4A 3CFBA 1LO3L 3FO9B 5JXAH 1A6ZA 4L29A 1F90L 2VLJE 4KROD 1GXEA 4PUBL 5BCAA 2VZVA 3DHJA 4KQ4L 1WK0A 2ZUVA 2NY7H 3U7WL 4YZFF 2D7OA 5ALCH 4NQXB 1OGAD 3MA9L 4MQXD 1AKJD 1LDPL 5DEZA 2Z31D 5IVXA 3RVWD 4ODSH 2NW3B 1AGEB 4GXVH 1VB9A 2QR0A 1HKLL 4UT9L 4P2RE 4QXTB 3FT3A 2RGSA 3SJVA 1BMGA 5J56B 5C0JA 3CVIH 4MD5B 3MGOA 1XMWA 1A8JH 1V8HA 4HUVB 2G2RB 5AZ2L 4LRNL 3D0VB 1QSZA 1EMTH 2NW3A 4ZUWB 3ZE2F 4ZNCD 3HR6A 1FC1A 1GGYA 1WC7B 2EICA 2CLZB 3JUYA 3BVNB 3CLFL 4PG2A 4F7EB 3VFVB 4LCWA 2VMFA 1KTDB 5DJDB 1IVLA 2JB6B 1XIWB 2Z8WC 4FQJL 4HG4K 3FQUA 2YEZB 1MHEA 4LIQL 2FECL 2V2WA 1K8IB 1NGZB 3G6JA 4NKDB 4F80A 2XN9E 3CFBB 4YBHA 5C8JB 3HUJA 3CFKB 4B53A 1RZGB 4UU9B 5EOCL 3F58L 4PLJD 2J8UA 4XNQA 3RI5K 5C6WH 1GGTA 1I9JL 3QI9D 4RAVB 4Y19B 5KS9F 3TJEL 2VLRE 4OQTA 3O6FA 4HDIA 4K7PL 5KS9E 3TZVA 4XMLH 4S1SL 3O9WC 1N0XH 2W9DL 4BFIB 1EZVY 5FM5O 4RMSA 5T3XD 1A7NH 2WWKT 3PP3K 5C09B 3BUTA 1U93A 2ORBL 4RA0C 3BPLC 2YA2A 4G80B 5DRXA 3BJ91 4E5XA 3FZUC 2R1YA 3NCJL 1E4XI 4NN7C 5DHVA 1A02N 3RGVD 3D9AH 3GMQB 5DRZA 1QSVA 4EUPA 4JRXB 1AQDA 4K8RD 3SDAD 1YPZE 1KTRL 2B2XL 1KXQE 1MCEA 4O4YL 1BFTA 4YPGB 4LSSL 3V0WH 2ADFL 1FO0L 2QADC 1IKFH 5HSFA 1F3JB 2QADB 4LNRB 4HKXB 2BCKA 5I1CL 2WBJC 4OZHF 1MJ8L 1Q94B 4DAGL 3RIFK 4LPCA 3BZDA 2A73B 4PRPE 3S88L 1G9MH 1I85A 3O6KL 2BOBA 2DLFH 4M7JH 4KKAD 1KG0B 5CSZB 2F15A 1RZ7L 1H15B 4JGJA 4JKPH 5L8LB 5EU6D 4ZTPH 5E5RB 4P9HL 5K9OB 4LPXA 3BT2L 5CUSL 5DJYB 2UYLB 5K9JH 1LK2B 4HX1B 3D25A 1UM4H 3K46A 4OF0A 5ADPL 5I1DB 2VZ3A 3I75B 3K80A 2V7HA 1YYML 1J1PH 4F9LA 5BZWB 4OZFB 4PRBA 4P99A 3ULSA 1U93B 1CE6B 4KK5C 2FSEA 5LJYH 3EBAA 4DKAA 3ARFA 2DQGL 1SY6H 2DQFB 3D85B 4WO4B 4BUHA 3DO7A 4HMDA 2JIXB 2DM2A 5K59F 4GH7B 2V2TB 2N7BA 4UTBH 2EDFA 4FOMA 3QIBB 2FJGB 5BXFB 2VN7A 1TZIB 4OD3H 3MZGB 5HHPB 4PJGA 5JQ6L 1HK6A 2E9JA 3QAZC 3RL1A 3VRLE 1KJ3H