4YHLH

Reversal agent for dabigatran
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
220
structure length
220
Chain Sequence
QVQLVQSGAEVKKPGASVKVSCKASGYTFTDYYMHWVRQAPGQGLEWMGETNPRNGGTTYNEKFKGKATMTRDTSTSTAYMELSSLRSEDTAVYYCTIGTSGYDYFDYWGQGTLVTVSSASTKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure-guided residence time optimization of a dabigatran reversal agent.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords aDabi-Fab2b heavy chain
total genus 47
structure length 220
sequence length 220
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhlH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhlH01
2VZVA 3IU4H 2FNBA 1N2RA 3MLWH 5TPWH 2HVKB 3OAYK 3UPRB 1N64L 3JWDH 5T1LD 2AEQH 3NPSB 3QDGB 2HFGL 4MCYA 1L6ZA 4MVBC 4NQCA 4BH8B 5E1AB 2CDGB 3GK8H 1PX3A 5T3XH 3UROR 4GAJH 4HBCH 4WFEE 3ARXA 4O2CA 1PZUB 3SE8L 1G9MC 3FB6A 3GSNB 2XTJB 3VRLF 2AERT 5HDQL 2FEEI 3ZYOA 4AG4L 4ZPVB 4P2QD 4KZDH 2Y4SA 5E2TL 5D2NA 4Q9CA 3LPWA 5I1LA 2ZKHL 1K3IA 1RD6A 5T5FL 5C2UB 1QFWH 1I8MA 4DOHE 2I27N 1AE6H 2AEWA 4P48A 3WO3B 4MGXA 4HV8B 3DURA 5TGBA 3VWJC 2AJVL 1WZMA 4IBLT 1FG2A 4ODTL 4P4RB 1WAAF 2ITDB 2FSEA 4XCCH 1R3LB 1JIBA 3EYSL 4M7JL 1N26A 4PJFA 1QBML 3F5WA 4AZ8A 4OFKA 1Q0YL 4HIEA 2Z8SA 3ARUA 1FO0B 3PWNA 4PLOB 1D6VH 3KYMA 4MA1B 3LMJH 3RIFK 4FQPA 5JQ6H 2D31A 4YDVA 2P5ED 3QUZA 4QRPB 3RWHA 1WBZA 2YC1A 5BOZG 2PCPA 3BP7A 2FYYA 3NIFF 1CXLA 4EOWH 4U0RC 5GGTA 1MRFL 3P9MB 4JFYA 1Q72H 2CH8A 2AVGA 4HJ0D 2H1PL 4J4PD 4U6YB 4F80A 4KJWC 5I1CH 5IK3B 5D7SL 4KK5C 4P2OC 5KSBA 2DQUL 3SJVA 3OKKB 1ED3A 2P24B 2YD8A 2Z31C 4WV1B 5IKCA 4LSSL 2DD8L 3K4ZA 2EIZB 2OTWA 4D8PB 3QIUB 3VA6A 4UILL 1WBZB 2YC1B 3F7YB 1VPOH 4M8QB 2P48B 1Z6JT 3QCUL 3DMMA 3VH8G 5HGBB 3KPSD 4AM0B 3CFBA 3GSUA 1I1YA 3MLXL 1QPXA 5AYUH 2J6EL 4I77H 3BJ91 4ISVB 2WUBL 1OAQH 5B39G 2QL1A 1MELA 1T83A 3BESR 1F3JB 1F97A 4ZO7A 1BQHB 4KROB 4J6RL 2CLZB 2J8UA 2PYEB 3QPXH 2VDNH 3EYFB 1FSKC 4KROD 5D7LD 3C87A 3GSRA 1NC2B 5C09B 4M1GL 3EYFA 4Q9BA 3MZTA 3R0MA 1KTRL 1CXHA 1XEDA 1FVCB 1WIPA 1M4KA 4HJJL 1IM9A 4P57A 3VFNA 4X83A 2M2DA 3IYLW 3T65B 2VMFA 1IBGH 3EFFB 4ONHA 3WIFB 4YEEA 4BSVB 5IHBA 3I3DA 4IMKC 2A74A 4LSTL 4NN6C 1T1YA 3ARGD 3IU3A 2QTEA 3T65A 4S0SD 1CQYA 2A0LC 3MBEA 5DRZB 3WS3B 5KS9F 5GJTL 5J12B 1QNZH 2W60B 2Y36H 5C0BE 4PD4K 5ANME 1U8NA 4WWKD 4ZAKB 2J6EA 1VFAB 1JZ7A 1NBYB 5DURB 1HKFA 5GGUB 2R0WH 1NC2A 4ZQKA 2JCCA 3MYJA 5EBMA 1RAMA 1YPZA 5IVXE 1S9YB 3LRGA 3IFNL 2OMNA 1MCQA 3BHBB 1BVKA 5ISZD 1MRCL 2BMKB 4HGWB 5CJXA 1LDSA 3KG5A 1T20A 1INDH 3WEXB 4PR5B 4JN1L 4YGAB 3AC0A 3DX9A 2R9HC 3C9NA 4JFDA 2X89D 5KS9B 5FM8A 2E6QA 4PRIE 1KB5H 3WIIL 3GJFA 4R26L 1XF5A 1U8NB 4ZAKA 4LGSB 4WI3A 1XCTA 1ACYL 5JXAH 4M7KH 5DT1H 5IHUH 4GG6F 1S9XA 5E99L 2X4RA 3FMGH 4U1KA 1DN0B 4JPWH 5D96C 2BJMH 3WHE1 3WXVH 2Z0BA 4MXVE 4FTVD 5DEGB 4Y4FB 3T0EE 4K94C 3TZVB 2GJZB 2DN7A 2GTZB 1H5BB 5K9KA 2BDNH 1T5XB 4P4KC 1X5GA 4CU6A 3FL7A 3JUYA 2GW5A 1K4CA 1YC7A 4HZLA 2VDPL 3QPQD 4GRMA 2J8UB 1DQLL 3WHXB 3UTZA 1M7IB 2VE6A 2OR9L 4PJHE 4QLRA 5IWLC 5C0GB 1H3PL 1MJ8H 2VLRA 4M93B 5H2BB 3ARDA 5E8NA 1FVDB 1C16B 3W9EB 1HKLL 3SKMA 1G7LA 4LDLB 5DFWH 4ZUWA 5JUEH 4NKIH 4X6BA 3D9AL 2FSEB 2HP4A 1MOEA 4GAGH 3HZVB 4RFOH 5J4MA 2IMMA 4HH9A 4IRJB 4P23C 1RZ7L 2X40A 3SDYL 4JFEE 1CLYH 4EN3D 2YUWA 1CDBA 5GJTH 5M95B 1RIUH 5FB8A 3C8HA 1RV6X 4JZOB 3DYOA 3BEVA 4L9LA 3S37H 1IC5L 3P0YL 2PW1B 2D4DA 4LLDB 4TSAL 5I19L 1BGXH 1LO5B 4JO4L 2DOCA 5MI0B 3OB0H 2C1OA 2HFEB 3TBVA 5TE4L 4NT6B 1Q9KA 2R8SL 3EOAB 5AWNL 4YDIH 2I25N 1X5XA 3S35H 1OCWL 3DOSA 3QDME 4TNWK 3LKOB 4XX1E 1H9VA 2P5WD 3CLFH 1T7XA 3BUYA 4F57L 3HNVL 1QA9A 3CFEB 4XVTL 4ONOA 4IM8A 5CZVH 1FZOB 5AYUL 3VRIA 4XPBL 1KEML 5KANI 4RMQA 5DJ8A 3TBYA 3CDYA 5L88L 3QXAB 4KHTL 4JFXA 1UQSA 4WFED 2VR4A 3GB7B 4PGCB 4YHOH 3H7BB 5DMGC 3D25A 3RRQA 4G6ML 3WFDH 5IOPA 4LSUL 4NNXB 3MUZ1 2HJLA 2Z93A 3TCLA 5LXGL 1KLFA 3LN5B 2GKIA 2EC9T 1V05A 1A21A 4MJIB 5I1EH 1QFOA 2YD2A 2AV1A 3MUHL 2X7LA 5I1DA 2ZG3A 1JYWA 1NH6A 4G8EA 1BAFL 4ODHH 3TBWB 1VENA 5I1DB 4ZFOL 1RHHB 4KI5F 2BFVL 3RFZC 3EYVA 4OFDA 4NDMB 3A6CH 2MFNA 4GRLC 4DN4L 5C07B 2VDLH 4ZOCA 1NBVH 1IGIH 2Q7YA 5CINL 4UINL 3O6LH 3QG6B 5C2BL 2VKXA 4GKNB 4APQA 4D3CL 4XBEH 5DR5L 1U91B 2OR8A 4MA7H 4ESKA 5C0JB 1JRHI 3U7WL 2JELH 1UXWB 4PJEB 4PJBE 5DMIH 4OCSL 2CRMA 2CUMA 4GRLA 3O4LE 3QIBC 1P9MA 2VZSA 3D2UA 4PJEA 2AV7B 3L3HB 2NPLX 1MFNA 3FRPG 1KCKA 4RGOH 3SGDI 5I73C 3FB5B 2MQCA 2HFFA 1JN6A 4OCYH 1FE8L 4WGWB 4AIZA 3VXTB 5ID0B 4XCNA 4XPHL 1RVFL 1OAKH 4KC3B 1WT5A 5F7LB 2A9NL 1X5HA 1HHGB 4Z7UF 5IOPB 4YHZL 1G84A 3AXLB 5BZDA 5JIKA 1SVZA 2NNAA 3NAAL 1LP9A 5FYLL 4J2XA 4YQXH 1NGQL 4E42A 3ZTJH 1JWMA 3BD5A 5DRXB 2CK0L 4UV7H 2UY7A 1IMHC 1UGNA 1KJ2B 2AKRA 1ZEAL 1VFUA 1UA6H 4NN5C 1B0RA 3WYRA 4H0HB 1CD1A 4H20L 2XWJA 5KVGH 3MRMA 2NCMA 4HS3B 5DUBB 5B8CC 5BVPH 5F7NC 5HYFA 3HE7C 4JZJB 3X3FL 1FL5B 3SEPA 4DVBB 1QD0A 4DGYL 1QSFA 2VDPH 2GAZA 2WZPD 2V5TA 2Z31B 4YGVB 4WV1C 1RJLB 3WJJC 2NTFA 4P23D 2EDTA 3C6LB 5A3IC 2Q1EA 5SX5K 4G6AD 4M62L 4UNUA 1R3IH 5JW3L 2AP2A 1QFHA 2WUCL 1QA9B 2FEDC 2GK2A 3CFEA 3BMVA 2GCYA 5B39A 3LKSA 4YWGH 3VFTA 3EDDA 4GW1A 1I1AC 3CX5K 4ENEC 1BD2E 1TJHH 4P3DA 4PV9B 3BIKA 3MV9A 1MLBA 5DHVB 1F58L 5CD5D 4S1SL 5FAAA 3IFOB 2IANE 1Y18B 1KB9J 3BQUD 4Z95H 1FNEB 3N50A 3QHTC 5HI5C 2WBJD 2DF3A 3MBXH 3BPCA 1ZTXL 3KPNB 1A9BB 1KTLA 4Y5XC 1A7RH 4GKSA 1X5KA 3UPAA 4XP1H 2CIKA 5TFSL 3TNMB 4OKVB 4I8DA 5J13C 1WBYA 3NN8B 4XNUL 5SWZB 4H0IA 3CK0H 1I9IL 1XH3A 3BP4B 5DLML 1QSVA 4DEPB 5SWZD 3HG1B 1BX2B 1NAMA 1KT2B 5I74B 3WNOA 2AS5M 1NGZB 3PABA 4HKBA 3QR2A 4NQCD 4K3GA 4W6YB 5FO8A 3KYOB 4LK4A 5ILTH 2CUHA 1FVEB 3QQ3B 1T3FB 4LBEA 1EEZB 4AQOA 1AKJB 3VI3E 1HH6A 3VWKA 4YZFF 5E00A 1J8HD 3SKUD 2LTQC 4X7CC 4XXDA 4PB9L 5DEFA 1FL3A 2WK2A 1FFNA 4LDOB 5FYLD 4HAFA 4L8CB 5JLZA 1FNSH 2IALB 3LS5H 5IK3A 5CSGA 5ETUB 3K1DA 2PYFB 1S7QA 1RULL 3HAEA 5C0CE 4HUUB 3V4PH 2HJFB 1MI5E 3FOMA 4ZQKB 3GBNL 5IW6B 3BISA 4OF5A 2OYPA 3O3EB 1NCCH 2EO9A 1CT8A 2E9IA 3BAEH 4UDTB 2W0FB 3TBSB 1I3VA 1KPRA 4LKCB 1AP2A 3QUXC 3TJHC 3P9LB 4WY7L 4KKBD 2D31B 4YDVB 3MR9A 3IU3B 4TOYH 2XWTA 3PQYD 5EWIH 2HVJA 3RY6C 3MA7A 4GAFB 4K23L 3DX9B 5GIRB 1MCFA 2VLKD 1INEL 3F7QA 1CLCA 3QZWA 4MNGE 2VDOH 3IFLL 3ZYIA 2IALA 1XGYL 1KEGH 8FABA 1C5BH 5LGJA 5T1DH 5EBWA 4PJFB 4UTBL 2C4FU 2IAMB 4L1DA 3WFHA 3M17B 2WLYA 3GMQB 5I8EA 3L9RB 5D1QC 3O0RL 1BEYH 1MHHB 3GO1H 2F54B 4ACPA 5E1HB 2DS4A 2IBZX 3KPRA 4G6FB 2QJDA 4NNPL 2QEJA 1S7WB 2GSGB 4HJJH 3UMTA 2A6IA 4OI7A 5DVKA 3RUGE 2P47B 1I7RA 1U3YA 2NY1C 2A74B 4KUCF 3CGTA 1NMAL 5AG9A 3OJDA 1WBYB 1NMCB 3NN8A 1MIMH 5AUMB 1QFPA 4CMHB 5I6XB 5D2LF 2FO4B 4QNPE 3CVHH 1J8HA 3PP4H 2A6DA 1E6JH 2EEBA 4KUZH 3VRJA 3BPCB 3OKDB 1V3KA 3EHBC 5HI4D 4WY7H 3VFUB 1CXEA 4HCRH 1SYVB 4XCEB 3IGAA 1FCGA 4ODVL 2JB5L 2BOBA 2V9RA 5CGTA 3VXUD 2XZZA 5E0QA 3P4NB 4O5LL 2CKBB 4PJGF 4W4OC 1WFTA 1T2XA 2ZP0T 5DD1H 3I85A 1MEXH 4LEXL 4DKFL 1DSFL 4K71C 1HYSD 3HI1B 4GQ9H 3WMSA 4OZ4A 2GEEA 2X9YA 1W72L 1PG7H 4HX1A 2O5ZH 3SE9H 1LE9A 2VLRD 2HJKB 5C0DA 4D8PA 1SJEB 3EZ8A 2CDEA 2JIXA 4JQXC 1VEMA 3GRWA 3C6LA 3BT2H 3NZ8B 2NTSP 3DWTA 3S96A 1IGCH 4LVHC 1PG7W 5CEYB 4C4KT 4NZUL 5DXWA 4JRYE 4OM0L 1A6AB 4ODSH 3S35X 2DI9A 4MVBD 1KB5B 1S7RA 1XZ0A 4UOJA 5I1GH 4UU9B 1FC2D 5C08E 1LEIB 1S9VA 2APBA 4M6ML 2FJGA 1CG9B 5HYSB 3C5SB 2KZ1B 4R96B 3O4LD 4PJGE 4FP8H 1F58H 9CGTA 3A6BH 3DV4B 1MWAL 3C6LC 4G8IB 2ZUTA 4PGCA 4OF7A 4TRPH 3GHEL 3QWQB 3BPNB 1VADB 3R1GL 2Q3AA 3IS0X 4I9WD 1YYML 1A47A 3AMKA 4UDUA 4J7RA 3AREA 1MJ8L 4LPUA 4JR9H 1I3GL 2I60L 4WCYL 2VN7A 3FT4B 4OKDA 1ZHKB 3EYOB 2BY2A 3LKRB 3LKOA 4GXVH 5TQ0H 3KJ4B 4UOW1 5LAXB 2DBLL 2ZSWA 4XCNB 4PP1C 2P8PA 3NCFB 2P42B 3GDBA 1RU9L 1ZA3A 3LQAH 4BZ2H 1X5ZA 3IDGB 2HFTA 4CW1A 3RVUD 4FFZL 3ZE2E 4JFFE 3IU4L 1H3XA 2I5YH 1LQSR 2RFXB 3ARGA 1E4JA 3KYKL 4AIXA 1LDPL 4KK9C 3GZKA 2HRPH 2ITCB 1KIRA 4XB8A 5AZEL 3RWEB 1WLHA 4JVPA 3O2DL 4RZCB 4Q6YA 2PTTB 2Q3ZA 1UWEH 3FT4A 3I2CL 1UZ8B 3K74B 1PQZB 1DBML 4HKJB 1TVHB 5C0CB 1A1OA 1CFQA 1IZJA 1S78C 2VLJA 3BFOA 4NWUH 2DLTA 3UTZB 4PY7B 1BOGA 3MQIA 3I50H 3M8OL 4RBPK 3SGJA 3GUTB 4MNQD 3WXWL 5I8KL 3MFFB 2PTVA 3UDWC 3EO9L 4PRAB 5ENWA 5FYKD 3C5SA 1LO2L 4F9LC 1K9TA 3S36H 5FA4B 4E41B 1I8KA 3CFIC 1JHLL 3N9GH 2GTZA 1UM5L 2FHCA 4WWKC 1YUHA 2A1WH 2HMID 3RZCC 2FBOJ 3DTXB 1T0MA 1IAIM 4YAQB 1DE4A 5F96H 3LHPH 4BQ8A 4PJ5D 5SV3A 2LVEA 1SBSL 4U1KB 1MIML 5ISZB 4AIOA 2JIXB 4OV5A 4JFED 1BWWA 4TSCL 5C0FB 4NNXA 2CK0H 4JHZA 3RY4A 3QUYA 4RSVA 1EEYB 4GG8B 4P9HH 4G7VL 1FFPA 3PWUB 5CJBA 4TVPE 5GS1C 3IJSA 3ORJA 1CLOH 4K71B 1NBVL 1LEGB 4N8VB 1AI1L 4NUGL 5EH1A 4YO0A 1UH3A 4HLZH 2BSTA 1F3DH 3D18B 2Z92B 2IG2L 1I1FB 5C8JB 4S1DC 3IRZA 4XCCL 3N85H 3BUYB 4N9GB 3LKQB 4LP5A 5DR5H 3DO7B 2CDEB 1WAAA 1GGCH 4NFDA 4JO3H 4JREB 4I3RH 3SBWC 2CJUL 3MLSH 4MA1C 1HCVA 2GTWB 4BFIB 1GAFH 4Q74A 2Q8BH 4XP4H 2EC9U 5HHXH 4XI5D 3QUMH 2BRRH 1JHTB 2X9WA 4BA8A 5CEXB 5A2FA 4ODWB 5JOFA 2EH8L 2C1PA 5LCVL 3V5DB 5ERWB 1NL0L 2PO6A 3LHPL 3U4EB 4HIHA 4DN3H 1TDQA 2AEQL 3VH8B 2GJ6E 3DX6B 1RZIA 3RGVB 2IANB 4POUB 4CGTA 3RHWF 2ZSVB 5E7FA 1K2DB 2KKQA 1TJIL 4YFLF 4PLNC 1DN2A 1VGEL 5TF1H 5IHZA 1U41A 3C09B 3MREB 4JPIB 1DBAH 3C60C 4WUUA 5D2LB 2R1YB 4WU7A 4JAMB 3BZEB 2LU4A 3EJYC 1DFBL 1U8JB 2AK1H 3E2HB 1IAII 3ELAT 3V0AC 1FL6B 4KAQH 1UB5B 2ATKB 2QADC 4O9HL 3ZT7A 2DIAA 1IGYB 4LPVA 1XH3B 3BP4A 4BZ1L 4GG6B 3TBTB 1EAPB 2C5DC 1I1AB 1JYNA 1YQVH 3HG1E 1NFDA 4OFPA 3DX6A 1FHGA 2YPVL 3WDIA 4LFHG 3BX7C 2P8LB 4CNIA 4KMTL 4OJFL 2NY6B 4ZTOH 4C4KO 4LVHB 1NLBH 4OCWL 3NPZB 1Z9MA 2NTFB 5FYJU 4DTGH 1RQ5A 4KKLC 4WW1A 3RNKB 4EVNA 1MWAB 4O51B 2ILLA 1XF4A 1R3IL 5JW3H 1T7WA 2NXYD 2MCPL 1JPTH 3FO0L 1RIUL 4GG6A 2N1KA 1P84K 2R0KL 2QV2A 3TN0A 5J13B 4RWYL 1UWEL 5JHDE 1I8LA 2DQGH 4BM7A 3LKQA 3S36X 5J3HD 4TSCH 3IKKA 4PJ8D 1RURH 3KYMB 4XAWH 2GSIA 2YD3A 3BKYL 3QUMB 4PRPE 1EO7A 1OP9A 4JFFB 3CNKA 4X9FA 2DJUA 4Z18A 4U1IA 5EO0A 4FFZH 5T1KD 1TNMA 2UYLB 3ARBD 2FGZA 1SM3L 4H26B 4M7ZB 2ZPKH 4L8CA 3BYTA 4XBGB 1DLHB 2A83A 4OLZL 4AMKL 1S5IL 4LF3A 5CZVL 2BVQB 4Y2DA 1ZEAH 4PP1D 1IGYA 1NAML 2HT3C 4OTXL 5E00B 1FV1B 3FQXA 1LO2H 5DVMA 1V3LA 4Z7WB 1G7MA 5FYKH 5I1KH 5ERWA 3MRMB 4R90L 2ZUUA 4Z0XB 2F74A 2QSQA 1A7QH 2YPLB 3PIQB 1TTGA 5IVXA 4QY8B 5GPRA 2NYYD 3K2UL 5I73B 1NGZA 1OQOA 5IMMA 1M7DA 1JTOA 2XI9A 2BNRE 3PL6D 5DUPL 3JWOL 1A7NH 5GRXG 2FB4L 3D69B 5F8RC 4NGHH 4NP4L 4F2MA 1WBXA 4KKCC 3QXUA 3ARVA 3SDCC 3SKNB 3BIKB 1NCAH 3MV9B 4LFHD 4ELMF 4X7TA 3U36B 1RSFA 4MWFA 1OARL 2BVYA 2W59A 1PX4A 2HTLC 2MPAL 5ALBH 1GGYA 3O2WL 1N6VA 2EE6A 2YPKB 3KXFD 5CBEB 1BFOB 4PRBB 3D0VB 1PSKL 4UV4L 3RWIB 5KN5B 4U6TA 1SEQH 4Y16A 4M6NH 4NQEB 5FF6B 2QLVB 5CIPB 3V5KA 4O02H 3QIWC 4BFEA 1UYWH 1RJLA 3FZUC 4K94H 4M7LT 3F7YA 3NCEB 1XR8B 3T4AA 1DBJH 5HHPB 2Y7QB 3L3GB 4KXZI 5E9DD 3U30C 1EBAA 1A6WL 1HDMA 1CXFA 1ZXQA 1NDGA 4IOSD 2R29H 5F1IB 3C8KB 3V5HA 1YEDB 1LMKA 3VFTB 3OKLB 1RHFA 2GCYB 1U95A 1OTSD 1DVFB 1WZLA 3AS3A 5KSBB 1A02N 3RGVC 1TTUA 3X3GH 2RHEA 3D18A 4NPYA 4KI5C 3UTPE 4AENA 3LN4B 5D1XB 2VH5H 5DQ9B 4G9FD 5F3HB 3F62A 4S0TD 5LGHL 1ORSA 4R2GC 1AGFA 3BP5B 3B9EA 4CNIB 3W81A 3BH8A 3IXTA 2OCFD 5J06A 4Y2DD 2JB5H 3TESA 3SDAA 3H9HB 5HYJB 2C3WA 3DV6B 1AGCB 4DWHA 4P5KA 2ZCKL 3QQ9C 1ZS8B 4F3FB 1EXUB 5MP6L 1A9EB 4X0KA 5GGTL 1UCBH 3REVB 4E9LA 1HZHL 5DWUL 2JB6B 5CJXC 3RVWC 4CN1A 5DD5L 3NCJH 4HIIB 2FH6A 2NR6D 3FN0L 2PXYB 4UAOB 1JNJA 4RZCA 4K7FB 1RJZB 3BWUC 1IC5H 3JWDC 3P0YH 3FRUA 4Y5XB 1PD6A 3X11B 5CLWA 2IPUK 3RU8H 4LSRL 2P46B 1CBVH 1XIWB 4JFOB 4XVSH 3T2NH 1DTUA 3NFNB 3R4DA 1TQBB 4NN5B 1BECA 3IDYC 1MHEA 1HILB 3B6SB 1OP5K 4ZNEA 5J1SC 5ICXA 1FBIH 1HEZB 5DK2B 3VDAA 1DZBA 3U0PB 3L3IA 3OX8B 3BQUB 1MUJA 2CUIA 3DBXB 3KNBB 4HF5L 4Q0XH 43CAA 1I3UA 5CP7B 2X4SB 3BO8B 2VDOL 4YHNA 1IQDB 5FA4A 4E41A 1G7PA 1EFXA 5J8OA 4JG0H 3CCHB 1RU9H 2H45A 4PJIA 5IB5A 1N2RB 1WQVT 5J89A 2ICWI 3JWNC 4Y4KC 4HMCA 2XFXB 3K8KA 5I17A 4XT1C 4JQVC 1P5VA 4NZJA 1TZHA 2EE9A 5DF0A 1IGTA 4GO6B 5FA3B 3ARGB 1AGDA 2YK1L 2VDRL 2AJVH 2NY7H 3H9ZA 4L3AA 4DKAA 4GXVL 5CJOH 3FZUD 1ZWIB 4JY4B 4L4TD 4HUVA 4QHMB 2HT3D 5EU6E 1J11A 4M3JA 1OLZA 1LE5A 3JV6A 4WO4B 1YYLL 1RZJH 3OB0K 2EZ0C 3QPQC 4Y5VB 4CMMA 1UZ8A 2AABL 1JE6A 5L7XL 5F9AC 2OL3H 2Z8VC 3BO8A 2X4SA 3LKRA 4TSBL 1ZSDB 2I9LA 3D39E 4YR6A 4ZS6C 4F15B 4L3CB 3TH3T 3HNVH 3VJ6B 4G42B 1KBGH 5DGRA 2BNRA 3DIFB 5HVGB 4JFXB 4JM4L 5CFHA 3MV7E 3BGAA 3RVUC 1X6NA 4K7PH 4N0UB 2B0SL 4ZD3L 5MEPB 1YEFH 5DUPH 4Y0GA 4F7CA 1JI1A 4JKPL 1RZFL 4PGEB 4RAVB 4MAUL 4QRQB 4QNPF 5MHSD 4WHCA 1HSAB 1KPUB 1EJOL 4W6XB 4BQCA 4CMMB 3GMQA 5I8EB 1LNUB 4PJBA 1A6AA 4MNQA 1OT2A 4M7KL 4PY7A 3T2OA 2VDKL 4O4YH 4G6KL 3ZTJG 4RISH 2J88L 4EI6A 2DQFA 5HHOA 4Z78B 1B4RA 3LMJL 5H94A 1AGCA 1IJ9A 5F6HJ 3Q6FA 3V4VL 4R97B 3S6CA 4WI9A 1D5MA 5I8CA 2E27H 3L5IA 5F44A 3EYQC 4NZUH 2ZCHL 3VE0B 2AXGA 4CMHC 2FO4A 2PTUA 5EIQA 3RQ3A 2IJ0C 3EOAA 4QXGH 4KDWA 4OZ4B 2YBRA 5JXAL 3O45A 3ZE0F 5F1NB 3VFUA 2MTPA 3PUCA 3B9DA 1GHFL 1F4XL 5FB8B 1SMAA 3MBXL 1T89C 3NZ8A 1FVCA 1YMME 4MHHG 4U0QB 2FLRT 5EOTB 2OI9C 4K8RC 3KPRB 1BJ1H 3GHEH 3PHQB 1KIQA 5ESVB 4QT5A 2C3VA 1KC5L 5JO5A 3HMWL 3NABL 2NY7L 4R4BA 5D72L 1T5XA 4OCXL 2B1AL 3QIBD 5E2JA 4LNVA 2W38A 3VMNA 1JYVA 3V4UH 1OM3L 1HIML 1T5WA 2DWDB 5CBAB 1YNTA 1NEZG 2CLRA 2NLJB 4YWGL 1XF1A 2X4TB 3BGMA 4PY8I 4HFWA 2E9WA 1T89A 2EZ0D 2DMBA 3VFPB 4GMTH 2VL5B 2P4AB 1FJ1A 3QFJD 2EYSA 2P5WB 1B0GB 5HGDB 5DK0B 1C5CL 1I9RH 4QHUB 4X9IA 3TFKC 4KJPD 2AK1L 4PRHD 1BD2A 3WKMH 4QHNA 3T0AA 3RDTD 4YDJA 4R7DB 3FOLB 4G43B 5ESAB 1CVRA 1EJOH 2VYRE 2P43B 1UA6L 3G6JA 3FN3A 5JDJA 3BHBA 4ZO8A 3UP1A 25C8H 3ES6B 4MNHA 5JORB 3RAJL 4OLUH 4PS4H 5EC2A 3V0WL 5IB2B 1AIFB 2EDNA 4ZPTB 3CAFA 5MENB 4YH6A 4F7PA 4XHQA 4HDIA 4PJ5A 5IT2L 1JTTA 4V1DD 5EU6A 4M7JH 3GSWB 5BVJB 4N0FB 3EIFA 2YEZB 1BZ9B 4WTXA 3PGDB 2XN9D 2Z31D 1JPSH 3HPLB 4YBQD 5C70A 5HI4C 2D7PA 3ZHLA 2N4IA 4RDQG 5BZWB 3VXRE 1CICB 1OPGL 4GW5A 5A2IH 3QIBA 4PRPB 4O51A 3S5LG 1N0XH 2H1PH 5FO9A 4NO0B 4DOHB 4FTVE 3N06B 3F6IA 1PZ5B 4H25B 1KUMA 1P7HL 5EUOE 3HC0A 1TVBA 5ICZB 1FV1A 3HZKB 3GI8H 4LNRB 4EBQL 4ODUA 4XNZC 3V52L 1AXIB 4WI7A 4MAYD 2VXQL 3BI9X 5I66B 1U8HB 2FJHA 5FYKU 3RNQA 3T2QA 4X98A 3VG0L 2EKSB 2RB8A 1FGNH 1Y6MR 5FECB 1YY8B 4P2CG 1GIGL 1LGVA 1PG7X 5DLMH 5BRZA 3FRPA 1EO8L 4IRZH 3VFMA 4WUUB 1OCWH 4HHAB 3KYOA 3BAEL 3LQZA 4NO0A 3F7RA 5FO9B 5LVEA 4EI5C 1XFPA 4FQLH 4KWUA 2A6KA 1AQDA 32C2B 2VC2L 4I2XE 1J18A 4WJ5B 4JZJA 3NIDF 2A9ML 5LJYH 1BAFH 5ACLA 4IIQB 2NY4C 5TH2B 4PJAF 5DUBA 3HFML 1PAMA 2W0KA 1YEIL 4D0DB 2PO6B 1RZ7H 3SDYH 4Z7UB 5D1QD 1LK2B 4QRPA 3RWHB 5I1IH 3CLEH 5J1TC 1EAJA 4X6DB 4HIEB 1QTYT 2DQIL 1GHFH 4S10A 5GZOC 2Y23A 2WWMD 5KW9L 4R4NC 1YN6B 2DM2A 4Y5YA 4XNXL 1I1AA 3WFEL 1NGPL 4HS3A 2XWJB 3VGDA 4FQXD 2B1AH 1FL6A 3MACL 4OGAC 2XV6B 4HIXL 2DKSA 4MJ4A 5F72S 3A0OA 2HH0H 1ZVSB 2W07A 4M00A 1H0DA 1D9KA 2YUZA 4C83B 2IADB 2XXCB 3ECBB 5DHYB 4ODBD 4V2BA 1NAMB 4XMPL 2AV7A 1MIEL 4X6FA 3DRQA 1Z3GH 3ROOA 1E4KC 3M45A 2HG5B 3STZB 2QQNL 5GZND 3I75A 2WQ8A 5DJ0A 4JHBA 3O9WC 3P30H 1A4KA 2FEEL 1I3RA 4CUCA 1DBBL 1TZGH 2HWZL 2KL6A 1U93A 2EDDA 1SJVA 3C09C 3L3HA 4H8WC 4HK3N 2FX9H 5IHZB 1W0YT 2OJEA 3GIZH 3LH2L 2E8ZA 3LPFA 5GJSH 4OAWA 2XFXA 3QQNA 4GLRI 4YBLB 3NZHH 2ZUXA 4E5XB 4QTHA 1F6LL 3QEHA 4KDTA 4ZYKA 4MCYB 1T1XB 5TE7L 3O6LL 3SDDC 3SQOH 1FN4B 3OGOE 5IBLD 5FUZH 3SY0A 4JR9L 5CP3H 43CAB 1R5VA 1AO7D 4BYHA 5BVPL 4FQXC 4OM1L 1LEKA 3QQ4B 4HUWA 1J1XH 1L0XA 5T1LB 1EIBA 4OFIA 4PRIB 1RUMH 4PJCA 1JWSA 3FQUB 3DGGA 5IHUL 2AK4A 1TQCB 2AQ1A 1KF9B 1HXYB 1TCRB 2Q6WA 4RQQA 3QDMD 1PY9A 7CGTA 4WHTB 4F9PC 4JN1H 4RMTA 2VZUA 1TQCC 1EHNA 2VDQH 5FK9A 1FYHB 1KACB 2VKWA 4PTTA 5EO9A 3VXNB 1OSZB 1QFWM 3P11H 5MEOB 4N0CD 5C0IA 2G2RA 1F6AB 3CC5A 2R2HB 3ZKMC 1DQQA 3VXNA 5LG1A 3D39B 4P5TC 4LLAA 3VXRB 2FDBP 5I1JL 3MBED 3KVQA 4R96A 5D8JL 4P46B 3VG9C 4KK8C 3ULVC 1A1MB 4JY5L 1S7VA 2BP3A 3CLEL 1P4IH 3MRLA 1IGMH 3LAFA 3H9HA 2XZCH 1U8QA 1L4IA 2R0WL 5HGGS 4FXKB 2CRZA 5MEPA 1CI5A 2PW1A 3BKMH 5FM5M 2I9TA 4Q9QH 1AD0A 1DN0A 4XHJC 5JPNB 1INDL 2EEAA 3QDHA 3TO4D 4CVXB 3K80A 2FJGB 5IQ9A 5HYSA 1U3HC 4I77L 3QUZD 1M71B 4ZODA 2J3SA 2C4FT 4ODXA 1A0QL 4HWEH 3ARZA 3RU8L 5GGRB 2AK4B 3MSPA 1H3WM 2V2TB 1MREH 3EOTH 3GMNB 4CVWA 1YN6A 1F4WL 1MLCB 1INEH 2BMKA 4HGWA 2AQ2A 4RGMC 1BVZA 4PGBA 2VE6B 4FHBD 1WK0A 1M05B 4I3SL 4P99A 4WUKH 3S35L 4XCEA 1LEKB 2NQCA 2XZAL 4NQEA 1Y6KR 1KNOA 5FHAL 1OWWA 3AREC 1EFXB 2YUXA 3LB6C 1H8SA 3LS5L 3V2AR 2CDFB 5JOPD 4LPWA 3CUPA 2EYTB 3E6FB 4IRSB 1P4IL 4Y4HA 3WS3A 2JJTA 3ULSA 5E2UL 4LASL 3KPSA 2ADIA 3H42H 4NC1E 1V8HA 1MVUB 3HE6C 3Q5YA 4WFGE 3IGAB 3ARYA 2EKJA 1NBQA 3IT8D 2YXFA 4OQTH 1XIWA 3D87B 4JFOA 2ZNXA 3WSQL 4GFTB 4JHAL 5CILL 3WFBH 3U1SL 2G5BB 2R2BA 5HJ3B 1HN1A 5DJ2A 4Z5RB 4QOKB 12E8H 1S7RB 2ERJC 2DQHH 4H1LH 1FNAA 2PXYA 4RRPG 2GYSA 3C9NB 4JDZB 4GSDH 2IAMA 3WFHB 5F6IC 4PJDA 3GB7A 2BNUA 3AUVA 3MLZL 4ZO6A 4XNQA 4CJ1A 5D93B 3DJ9A 1REIA 1L9MA 3OAUH 1EMTH 2XWTB 4FQHB 2X4RB 1BGXL 2CSPA 1ZLVK 4ODSL 3P4OB 2D7MA 1CGTA 3MTRA 1XGQB 4G9FB 1N7MH 4LPTA 5ESQB 1IE5A 4OI8A 2G75B 1UACH 4CL7A 2D7TL 4DW2H 1LEIA 2W60A 3SE4C 2EH7L 1MFBH 2VZ3A 3ZKSD 2BSED 2P49B 1H15B 4Z7WE 1EH9A 3CFDA 4TVSa 3LV3A 1CFNA 1CIUA 5ETUA 2VLMD 4LOUC 2BDNL 3WIIH 1PBYA 2H2PD 3GSOB 4WHYG 3RL1A 2VR5A 4LHUG 3V4PL 3W82A 3MA7B 3PNWB 5K59E 4OSUH 3RDTA 1YYMH 4TTDD 3W39B 5IB3A 4JFYB 3AGVA 2PW2A 3SDXB 4UDTA 2BERA 2YN5A 4UB0H 1JGDB 3AB0B 4MDJA 4Y4HD 5CSZB 1XGRB 3RTQD 5F7FA 4MLSA 4A2LA 3OJDB 1EVUA 2OZ4L 1G7LB 5EUOF 1NFDE 1KCUH 5EBLA 3SGDH 3X3FH 1BQHA 2Y1VA 4XVTH 4Q7DA 2LVCA 4I18C 5L2KD 1R6VA 4N1EA 2APVA 5GRZA 3RGHA 2C9AA 1T21A 4NO3A 1JNNL 1ZGLA 3MGOB 5C0AB 3MA9H 2BNQD 1KTDA 1CYGA 4HPYH 4MZ3A 3UTPD 5A40E 4PG2C 5J57B 2WWMC 3DUSA 1A3QA 1Q9OB 4I3GA 5B4MC 1EHXA 2BHZA 2H2SC 3FQTB 3GMRB 3LRHA 4QT5B 2QQKL 3W0WA 3MCKA 3SDXA 4PRNA 4AT6B 2YRPA 1VA9A 3TCXA 3Q3GA 5DRZA 4D0CB 5JIIA 2PYEA 3NIDE 5EORL 3L7FA 1JPFB 1PG7L 2H32B 3FFCD 3OKOA 4GQPH 4NC0B 5KVGL 4S1QL 3ISWA 1CGYA 2ZOLA 4HBQA 1CFNB 3FCTA 3MODH 2OJZL 4BUHA 2ICCA 3HMXL 3VG0H 2YBRB 1EV2E 1A64A 35C8H 2AEPH 4LARL 1MLBB 2DD8H 2QADD 2AXFB 2LE9A 3PWVB 5GGSA 3U83A 5KSUA 3RA7L 4I5BB 1DJSA 2G75A 1CDGA 3SGEH 4PJFF 4ZPTA 1MPAL 3U48A 3QEQE 1D6EA 1OB1B 2WV3A 1P84J 3O8XA 4ZNCD 4OB5H 4MQ7B 4OCYL 5MEND 3DARA 4MSWA 1UACL 4OQTA 4M6AA 3EJZC 1SBBA 4MA7L 2BSTB 4FFVD 1WJ3A 4LSSH 4PV9A 5LGHH 1OVZA 5HYQA 3HAEH 5H35A 4XVJL 2OSLA 5B38B 1U6AL 3MXVH 3VXSA 1X5FA 7FABL 3C5ZC 4DGIH 4WU5A 5DDHB 5KSVB 4UNVA 3ILPB 5GRYA 4YHYB 2W92A 4LCWE 2EYSB 2P5WA 5CUSH 5DI8A 4PGZA 2KZWA 4Y19B 5DJYB 1IEHA 4QKXB 2OL3L 4PRPD 1VGKB 2UV3A 1IVLA 4HK0A 1Q9LA 5K9QI 3S7GA 1OTUD 4ZSOB 4YDJB 3CFDB 4JKLA 2BNUB 1VEOA 3OKNB 4JO3L 5IJVA 3PF2A 3ZL4L 3ARBB 3FQNA 4LHUA 5D6CA 1VACB 1MI5A 4B0MM 3TN0C 3JV0A 1U8MB 3HC3L 5F7UA 1CBVL 3FFCA 1LVEA 2KQMA 5CJQH 3VXTA 2DQCH 5CSBA 4YDLB 5DZOA 5HHMD 4JVWA 3RGVD 3N85L 5L0QB 4ELMA 3IF1B 1A7NL 1CVSC 3PV6A 1PFCA 4HKZB 4GAYA 5EZIH 2ZOKB 1TCRA 3TPKA 1LD9B 3OSKA 3MRIA 3T04D 4JVUA 2CJUH 4LCCC 3W9DA 3QA3B 4JO2L 5F96L 2Q86A 3ARFD 4I9WE 1KIRB 1WUNT 4PRIA 1FAIL 2ARJB 3O41B 3NIFE 4WFFD 3WLWC 4M48L 1KCRH 1T4KB 4FG6C 1SHMA 4OUUB 3CU7A 1W0VA 4YXLH 4P9HL 1KIPB 1ZTXH 2WUCH 4X7SH 3IDYB 5J3HC 4PV8B 5GZNC 2BVEA 3QFJB 3BIBX 1QKZL 2VLLB 4AYFA 2NY5L 4CVZB 3CX2A 4TSAH 1V7MH 2V7NB 5IESH 2XKNA 5CWSA 3V7AG 3G5ZA 4P5TB 4QXTB 4EUPG 5F7HA 3DETC 1AXTH 4V1DA 2V7HA 4KJPC 5IB1A 4BKLA 4WFHD 4E42B 4PP2A 1HI6B 1H3PH 3DVNA 3KPMB 2R69L 3GNML 5EZJB 4YGVA 3NCBB 2Z31A 3SDXE 5C07A 2VIRA 5I8KH 3VD4A 3OPZH 5JUEL 3GMOB 3TA3A 4Y2DC 3VRLE 4IOIA 2HG5A 1TITA 3RUGB 3STZA 4P5MA 3IDIA 1EFQA 3ULVH 4XX1G 5INCA 3DMMC 2YD4A 3RBSA 1HINH 3CFKB 2RCSH 2WINB 3P30L 3O2VH 4NKQB 5DQ9A 3VXUE 1D9KB 1NCUA 1R5VB 1NLDH 3VW3L 4FMKA 3F58L 2AEIT 3S37L 5DRXA 4K3EL 1ZHNA 4QF1B 5GS2H 4JFHE 1U92B 1OGAD 2FX9L 4FN0A 5JXED 2AXJA 3BN9C 3O6MH 1AQKH 1B2WL 2NZ9D 4NWTL 3BZDA 3GHBL 4U33A 2AJXL 5E1AA 3CH1A 1XR8A 5I15L 4I0PD 2B0SH 4NHUB 5SV4A 3SQBA 4M9PA 4PB0H 1ZT1B 3GSXA 1PKQA 4R90H 3CFCL 4MQXD 3D39A 1A1OB 4NJ9L 1KLUA 3PL6B 4Z7WF 5F9JB 3H2WA 1U8OA 1CDJA 1FH5H 2Y5EA 2R56L 3QIWA 5CBEA 3MLPA 4YUEH 1QP1A 4NO0D 5K9QG 3ULUL 1RUML 3OF6A 3MV7A 4LCUB 2F19L 1OD7A 1PY4A 1Z2KA 2R4SH 4BFGA 2RJMA 3MUGB 1YQ2A 1A8JH 2P5WE 4QTHB 1QRNE 4X6FB 4JRYB 4XMKH 2DYPA 2NX5D 2YRLA 3BKJL 2HAZA 3EDJA 1XCQA 2VDRH 1U93B 3LEXB 4HS8L 4GQ9L 3BQUA 4OD2B 5T1LA 3FHQA 1UJTA 3DMMD 4HUWB 2V5MA 3GK8L 3PIQA 4G5ZH 4KJQD 4KKNA 4NFCA 1JPTL 5C08B 5TDPA 1U8OB 5E6IC 5F9JA 4S1DD 2Q86B 2F8VA 2BK8A 4M6OL 1G7IB 5L7XH 2DIJA 3BW9A 4MD0B 2B8OT 5EZLA 4WO4D 4X8JA 5IW1A 3MRLB 3B8YA 1YEGH 1RURL 4Y5YB 5IG7B 4X7TB 3DRQB 1RUPL 3QZWG 4OAWB 4LSTH 2DIBA 5T3ZD 1IGIL 4RRPA 2EICA 3VFGH 1G7JB 5IFAH 1J0ZA 2V2XB 4R4FH 1FPTH 3IVKB 3CC5B 1K4DB 2CGRH 5INDA 3PWJA 3NA9H 2BZDA 1M6OA 4TULL 5E6IA 1IKFL 4O5LH 2VNCA 3EOBB 4XP5L 2H32H 5D71H 2QSCH 1RI8A 3JXAA 4PUBL 3OJVC 2NMSA 4P2YA 1GCFA 2WBKA 3U7YH 4RBPH 3C08L 2R2EA 3WJLA 3FFDA 3IFPB 1NGXA 3R8BB 1CWVA 3TP4A 3VWKD 4XNMA 1Q38A 2F5BH 5BV7L 2B4CH 4GKZB 5CEZD 2VIRB 1F4WH 3BZFA 1AJ7L 1TPXC 2P5EA 4G6FD 3ARFC 2PXYD 1DQTA 4YX2H 3B3IA 4RMRA 1ZHBB 3QJFB 1HXMB 5IHLB 5DJXB 1DQDH 4TOYL 4FS0A 3H3PL 3SY0B 5E5RB 3L1OL 3ARDC 4QCIA 2L0DA 4HUMB 3B5TA 5FEBA 4XTRD 3QB7C 2W65B 4JFDB 5KS9A 4RAUA 5EDXA 2NY2D 4KRMB 4DCQA 1LILA 1FGNL 4L3EA 4MD4A 1U0QA 3FCTB 4JAMA 3EYUH 1YMHB 1SQ2N 1XF3B 2HKHL 4PJAB 2BNQE 3NCJL 5F8QC 4F8TA 3QCUH 4JY6A 1BFSA 2WAHA 5AEAA 2YPLA 1AGBB 1S5HB 4DKEH 1FNLA 4BQ6A 5L8LB 2CK2A 2JK5A 4P4KA 1A6PA 5F9DC 3FQXB 3H9SE 3QEUA 3KJ4C 5AUMA 3CJJA 4HG4J 1RFDH 4XRCA 2DBLH 1S7XA 3QG7H 1G7QA 5JW4R 2B4CL 3SO3B 4HEME 4OF8A 3X17A 3BKCL 5IMMB 3I6GA 2NZ9C 3ESUF 4HAGA 5FKAA 3GSUB 4PJAA 1NCDL 1WFNA 5B3NA 1ZV5A 4L8DB 1NSNH 1NL0H 3NH7L 4R4BB 3O6KH 5I1AA 4FFWC 4NKOB 1NCTA 4H1LB 3PHSA 2KDGA 1T03H 5K9KB 4P2QA 1Y0LB 5IKCB 2EDKA 2W65A 4R2GB 5C6TL 2Y06L 3ARQA 2ATPB 1EERB 1NKRA 3L3KA 2OZ4A 4NQSA 2JCCF 4RMSA 1WWBX 3VDBA 4U1IB 5EO0B 4M6MH 5AD0B 4NM4H 5EOCL 4C59B 1P4BH 4YHIB 3QAZC 1X5AA 4K07A 2BXYA 3V79C 3LQMA 2HYMA 4AK1A 3H9SD 4YHYC 2YS4A 4N1HB 2WBJC 1S8DA 3MRGB 1EZVX 1MRCH 5DYOB 1N5YL 4XPBH 3MBEB 4RFNC 1EA9C 4FRWA 4X6DF 4S2SB 3HTLX 1A3LL 4RCAA 4IMLA 1B0WA 2H32A 4ZTOL 2EXYD 3ILQC 4NJAL 4APQC 1FLRL 1YNTB 1JNLL 1I1FA 4HQQH 1YEIH 2EDFA 4JHWL 2VLKE 4OUOA 3VFMB 3REWB 1HHHA 1S9YA 2ICWB 3MOAH 4GUPB 3TT1H 2GITA 4P4KD 4JO1L 5FGCE 4X4YB 2BJML 3LQAL 3HC4H 3P40A 3GJFH 3PWUA 5IVNA 3HN3A 4FQLL 4YXHH 2DLFL 2F54D 1JWUA 1HQRB 4Y1AB 3U4EA 4ZOBA 1QSED 2VL5A 3BDXA 4JG0L 4U1GB 3OGCB 4LLVA 2FJFA 3O2DH 4GG6E 3O45B 5HVWA 2ZOLB 4PJDB 2C4XA 3BZ4A 3SE3A 2J4WL 4LRIA 1L7TH 3BVNB 1VKXA 5AZ2H 1I75A 3DX8A 4RMWA 3AS2A 4PRPA 4KK9D 1OD9A 5IB3B 4Q6IC 1DFBH 4XVSL 1E6OL 3JV6B 5H94B 3GUTA 2NZIA 4HW6A 4WNQB 1E4XH 2N56A 5BQ7B 1RZKL 2B39A 3WDJA 4TQEH 1NFKA 3PP4L 1NANH 5E4EC 3V5DA 2DWEA 2KPNA 1H15A 3W0WD 4QHKI 4GKNA 4K3DL 4PRHE 4APQB 4DCQB 5AAWA 2BOCB 3O6FD 4KRPD 1QRND 2A9MH 1F90L 3ESVF 4KMTH 4APQD 1B90A 1BF2A 5E8OA 3IJSB 2H9GB 4FNLH 3QUXB 4D9LH 5DS8A 2C3VB 5JO5B 2ICEA 1VFBA 2PW2B 2WM0A 1N4XH 4KQ3L 5DD3H 5LBSL 2OLDA 4MX7A 4LLYA 3TT3H 2A9NH 5E8PB 1BQSA 2Y72A 4MZ2A 2X4OB 3GBML 1K5NB 4JM2A 1RZJC 2KH2B 3JBG7 2R9HD 5D7IB 1K8DA 2X7LB 4GXUM 4UIMA 1S7SA 4QO1A 5LAXA 2UVEA 1A3LH 3PDGA 3P4MB 3ZZ1A 5IF0A 3PDDA 2V6HA 1JBJA 2P1YA 2MKLC 2VDLL 3H0TB 3MFFA 4KKBC 4ORZC 3WN5B 3HC3H 2VABA 1KCVH 4DKDC 1F00I 4LSPL 4ODTH 3FTGA 4N0UA 1JWMB 1J7VR 3MLSL 4HUKB 4P23B 1IRAY 2XY2A 1FZOA 1JV5A 3QUML 1HH9A 1R3JA 1JK8A 4XP9L 2VERN 5TF0A 1LNUA 4FQCL 2FIKA 2UWEB 1YPZF 1OT1A 4UT9H 1KELL 1UH2A 3QUKB 3QCTH 5K33A 1GZQA 1Q9KB 3TA3D 3DI2B 5CJ5A 4K3JL 5FO7B 2RFXA 5GS2D 3RX5A 1QLFB 3L5XH 3PWLA 4EI5A 5I1EL 3S4SG 5L2KB 1C5CH 1X3DA 3D2UB 2XZAH 4XXCA 5C0NC 3C8KA 5T5FH 5GRJH 4E5XA 1DLFL 2ZUQB 3H3BC 2DLGA 5KSBE 2ZUVA 4ORGA 2OQJB 1GGIH 1R3HB 4UQ2B 1AHWA 1TETH 2EDLA 2VXTH 3T0ED 3O9WA 5FYKL 1YEKH 3LZFL 3N0PB 5IB4B 4FQJH 1X5LA 1QHOA 3U0TA 2Y07H 3SDDD 5J9PB 4X5WB 4PJHF 2BOCA 4PJGA 2ZCLL 1IEAA 1URLA 1F3RB 2BHUA 4WWID 4XP1L 1MAKA 4KHTH 3V0WH 1QLFA 4GRLD 2OR7A 2NY6C 2WP3O 3X11A 3PXJA 1NQBA 1WCQA 4JPVH 3WD5L 3BDYH 3WFDL 2PO6D 1FNFA 4PRID 3QIWD 3SKNA 4Q9QL 3CFJB 4MA8L 1WC7A 5DJCB 1JZ5A 5EIIB 3OF6D 3Q5OA 1JNNH 1MJUL 2W91A 3CZFA 3IDMB 5DQDH 4YDKH 3P2TA 5IJVB 3O2WH 3M8OH 4R8WH 3PL6C 4QY8A 4IJ3B 5KAQF 3FT3B 4BZ2L 2X42A 3DV6A 4M62H 4JPKH 1VEPA 1KENL 4O00A 1AXSA 2R0ZH 1LDPH 3QDJB 2W9LA 4U31A 4DTGL 1IC4L 1ZANH 4CN6A 1T04A 3QDJD 2DLEA 1J05A 4LAQL 4P2OD 2X05A 3SKJL 4NFBA 2D0FA 5D7IA 1G0XA 4ZUVA 4WO4A 1GPOH 2F8XC 1PKOA 2J8UE 1TXKA 2JCCE 5HDLA 1NDMB 5C0AE 2XNAA 4LLQA 5HGAB 4KK6D 4Z7UA 1MIEH 3F12B 2DRUA 3LS4H 2HVJB 2YUVA 3DNKA 5ITBL 5KVDL 4LSQH 1WIOA 5B21A 2F53B 3R1GH 5KSAD 1J9CT 3RY6A 3SDDA 4PTUA 3RVTD 1UWGH 4FFYL 2XN9E 4WDIA 1LO3H 1IM9D 3T77A 3DYPA 3ULUE 3BIAX 4XCFH 1BX2A 2W9EL 3GSNH 3LCYA 2V5SA 1S7QB 3DPBA 1BMGA 1MHCB 5C0BA 2DQEH 1QVOB 1IL1A 4XCYB 1KIUA 1JZ4A 3PQYE 4OGZA 5FECA 4BK4A 4PRBA 3RWIA 5KN5A 4FOMA 2J5LC 5SWQB 3OKDA 5EOQH 3QBTB 2CIKB 5BW7A 2ADJB 2A6JA 3EFDH 5FUOL 1NMAH 5DHYA 4N0UE 2H2PC 1IFHH 3B4NA 2BY0A 1IBGL 3QQ3A 3GHBH 5E7BA 4GRWF 3IFNH 5KG9A 2CQVA 2PUQT 3DSFH 2YA1A 5TFSH 2XTJC 2HT2D 2JB6A 3ARFB 3PABB 4U05A 1I7RB 3L95B 1E6JL 1EBPA 3D0VA 3U1SH 3TN0B 4IS6A 3UZEA 1J1PL 4XRCB 1MFCH 5FCSH 3BJLA 2VB5A 2W0FA 4N8CL 1KB5L 3QIUC 4Y2DB 1JGUL 3VI4F 1XF2A 1QO3B 1MWAA 3RVXC 1A22B 5GSVB 1KTLB 4EJ1C 1MEXL 5HYJD 2QQQA 3ARRA 2UYLA 3WS6A 1KENH 2YOCA 4X5LA 3IJHA 8FABB 5E9DB 4NPYB 5TQ2H 1UZ6E 3ZYZA 1RZJL 2GQHA 5JLZB 1G7MB 4N8PA 3QEQD 5IBTL 4U6XA 4M1CC 3B9AA 4WI5A 1JGEA 1OF2A 1MCIA 5DRWB 5D5MA 1WWCA 1KELH 3S5LA 5D1XD 4HG4K 5E8DH 4Y88A 15C8H 5CHNB 2IPKA 3PWJB 4YE4L 2MCPH 1L0QA 5D7IF 5E8EB 5L2KE 2N7AA 2MOVA 2DQTH 4P49A 4DZBB 3MYJB 4DEPC 5I1JH 1UVQB 2ENYA 4FQQB 2IFFH 3WNPA 1CE1L 3AAZA 3D1MC 1KEMH 1FL5A 4TULH 4H1LA 4PJ9C 5J12C 4NKOA 1EDQA 4N68A 2XIDA 1OTSC 3RWGA 1P2CA 1QVOA 3EGSA 3VFSB 4JGUA 3G5YB 2NX5A 1ZT7A 1YNLL 1XCQB 2VR9A 2XQYK 43C9A 1MY5A 4EDWL 5I75B 4Z77B 4EN3B 2V2XA 2UWEF 1N59A 1QYGL 5J7CC 5E6YA 3SGJC 1U3HB 4ZUUA 5DHVA 3PHQA 2JLLA 4ODHL 1VSCA 2CDFA 3AAZB 1S7UB 4OIBA 3MLUL 3HPLA 1AGBA 1P5UA 1DBBH 2VLJB 4NO3B 3FO9A 5BS0D 4L4VA 1BJ8A 1WCBB 1KN4L 3RPIB 4ETQA 1VDGA 2ENSA 4Y89A 3TF7C 3HNTL 2A2QT 4YPJA 1BBJB 1V7NH 4U1SA 4PG2A 2DQJH 5KOMC 5DA0B 1ZE3C 4G6JL 2RGSA 3S88H 3VE0A 2DQCL 4TQEL 1HOCB 2H26B 3DSFL 2GJJA 1QEWA 4M43L 3HRZA 1IQWL 3GMPA 1WWAX 3BSZL 2MKWA 4NSKA 1YECL 3IFPA 3FFDB 3G6JB 2R2EB 4N0YH 2LV4A 5FUZL 3UO1L 5F7EL 5HYEA 3ZKNC 3K4DA 2GFBB 4RDQF 5HHOB 5FKPB 3CDFA 1MFCL 3TWCL 3MV8D 3Q0HA 3K2UH 3U4BH 2FBJL 1QHPA 5GS0L 5BRZE 4U1MA 3L3DA 3T1FA 5GSVA 1FFPB 4PJ5B 2I5YL 5T5NF 3UDWA 1FNGB 1P4LA 2LTQB 1AFVL 4HPOL 4L8SA 5HGDA 4FA8A 4BFIA 5GHWL 1G9NL 2PCPB 3BP7B 1GOHA 1XGQA 2IAMD 1JPGA 4PFEA 1ZLWK 4K3DH 3V6ZB 4I2XA 4OZFA 1HK6A 1HIMH 3OR6A 2DLFH 1A7QL 4PB0L 1RUQL 2V17L 3TLRA 5E2VL 3EOBA 1W72A 1W72H 1D7FA 3D85A 3MRJB 4G42A 4H5SB 5F7WC 5D96B 1D5XB 1ZA6B 4GMTL 2IWGA 4NWUL 2ESVE 3MNZA 2IBZY 2ZSVA 3EKCA 2A6JB 2Q76B 4WW2B 4TRPL 1HYSC 3B2VH 1XGPA 4GS7C 3HNSH 3MLRH 3D25B 4L4VD 5FCUH 1NANI 1ZWIA 5B3JF 2QHRL 2WWKO 5IJKA 3QI9B 3V0VB 4FQ1L 1J87A 5I30L 3DXAD 3QULA 4ZDHB 2Y9RT 5FYLH 1T0MB 3HPJA 3QI9C 2CLRB 2DTMH 2NLJA 2D0HA 3VGGA 3PGCB 1OW0A 1MRDH 4P3CL 3OTTA 5IB4A 4HX1B 2FR4A 2BCKA 4UTAL 2JF1A 3RTQA 3UEZA 5EN2A 1T1WB 2OZ4H 4R9HA 5L2KA 4QHMA 1MUJB 4LEOB 4RFOL 4NZDA 1NGWB 5JW5B 5KTEH 3K1KC 1RUQH 5IVZB 1JNHA 3WKNA 3L7EA 3ULUF 1SY6L 1JRHL 3K46A 4RA0C 1N6UA 1DQJB 1XGUA 4U1NA 5E08H 2P8PB 4ONGH 3O9WB 1J05B 1MCKA 3P4MA 2XG4A 3W9DB 5KSAC 5E2WL 1EEYA 1UCTA 3A6BL 4JZNB 1YJDH 1MQKH 4AL8H 3B9KA 5ID1B 4Y5VC 3TGXA 2XQBH 3QCVL 2J2ZA 3PE9A 3JV4B 4MMZC 5DI8B 3HUJE 3PWLB 2X6MA 5LCVH 2AI0L 5CILH 3WFBL 1IQWH 3BSZH 4JDVA 1XCTB 2NY3C 1ZSDA 2I9LB 1ITCA 4HH8A 5KAQG 2VC2H 3GI8L 4EUPH 2EIEA 3AU1A 5ITFB 5D7SH 3O3DB 2UWEA 2FIKB 4HXAH 2GITB 4OT1L 2HJLB 2Z93B 2CMRH 3QHFH 4HUXA 5CKAA 3MGTA 3TZVA 3MRCB 2Q8BL 4PJIE 4TUJB 1IILE 3MRFB 5GGRY 3DVNB 4ZXBA 1FCCA 1ADQL 3HE6D 2APFA 3FAWA 4X6DA 4PJ8B 5BQ7A 4EDWH 4Y19A 1PQZA 1OAYL 2ARWA 3VXSD 1AI1H 3SPVA 4RMUA 4DKEL 4RNRA 3SDCA 3T0VA 4D0DA 4NBXB 1A6VL 1I85A 3C5ZB 4M43H 1KPVB 1QG3A 3EUUA 5GSRA 5DVOA 1GC1L 3HPJB 5HI3D 1GXEA 5E8NB 2VZOA 3V5KB 1EGJL 3B2UC 4I0PB 2AGJH 4MXQC 1AH1A 2Q8AL 4CW1B 5C0RH 4MA3B 2VISB 1RJCA 5IVZA 4P2OA 1LK3L 2ZG2A 2C3XA 4IMKA 4LLYB 1CF8H 5JHDD 2H6PB 4O58H 3F7PC 4OFVA 3MBEC 4RFNB 4MQ7A 3ULUC 3UC0L 1CGSH 4K9EC 1FBIL 1Z9OA 3VWJA 1FPTL 2O5XL 1U8PA 4DGVH 4BH7B 1PDKA 1RULH 4I4WB 1G9MH 3ARBA 3FQNB 4LHUB 5D6CB 1ZA6A 1A1NB 2VDML 1R3JB 5D1XC 3PWVA 3VXQA 4TUOA 3KXFB 1U8LB 5E95B 3O0RH 2F74B 3W2DL 2GSGA 1KTKE 2HLFD 2VABB 3GI9L 3KGRA 2GUOA 1L6XA 3RIFF 4PBXA 1A6TB 4G8FB 2X4NA 3D69A 5FOJA 5C0BD 5JW4N 4TUKH 4EZMA 1G1CA 3UTSD 3CSYB 2EYRA 5M7QA 5KS9E 3OR7B 4XZUB 3SJVB 4MB4A 4HKXA 4I0KA 4R4FL 3Q2CA 1J1PH 4FQXB 5EOQL 4HIIA 3RWDB 2DLHA 4LLUA 4HSQA 3HUJF 5FDWA 5DMYA 5IP4A 5EBWB 4I0PC 2IMNA 4NRXB 5EO1B 1BFTA 4BJLA 3DO3A 2D7QA 1NDGB 4PJXB 2VLKB 5C0EB 2IC2A 1QFWL 4HLZG 4H0GA 4HDIB 3CFBB 2B1HH 4BUGA 4YXKH 2A83B 5DFVC 3IS1X 4XPAL 3MLTB 3T3PE 2A77H 3T1WA 1GC1C 1OWRM 4KKCD 5E9DA 1HKLH 2E5EA 2EXWD 4I48B 4Q2ZA 5FOBB 2BVPA 3GMMB 4UBDC 4JFEA 4Y1AE 1LO3L 1NJ9B 5FIEA 1G6VK 1YA5A 1LK2A 4NCC1 4JRWA 4AEEA 2YD1A 2P8LA 2X1PA 3SE9L 4PJDE 1I7UB 1AE6L 5DRWA 5I74C 5IUSA 3JWOH 5D7JB 1OL0A 4JDZA 1D6VL 4PJXF 4P9HC 4BQ9A 3U9UA 3VXOB 5GS1B 4F2MB 3P9LA 2EDRA 1PYWA 5FHBL 1A9BA 1FFOA 1HDMB 2H3NA 1B88A 4L8DA 1XF4B 4G8FA 1UB5A 2ATKA 1YJDL 4AL8L 1UM6L 4GRWB 3MNWB 2QQNH 5BO1H 5GS3A 2FO1A 1PW3A 3ARSA 4MXWH 4QOKE 1IKNC 3TYGL 4Z7WA 2EEDA 1KT2A 1VERA 4K2UL 3TEUA 5DMKB 3F5WB 5JQHC 4LCWD 4KI1A 4RAUB 5EU5B 1CDUA 2I24N 2DTSA 2V9QA 5EOCH 4LQ1A 2WSKA 3WNLA 1GGTA 1HH6B 5HDBF 4HZAA 1K6QL 1P1ZA 4XNUH 3TNNB 5A16B 4WGVB 2YN3A 2ZUWA 2R1YA 3W39A 4RGMB 3QDMB 5FKAB 2IPKB 4JY6B 4AEIL 3VXMD 1P7QB 4OD3L 5TDOB 1I9EA 3HE7B 5IEKA 1NFDF 4P3DB 3EGSB 5CJ8A 4UILH 4NN7C 1AXTL 4GRLB 3O2VL 1QLRB 3MUGA 4G8GD 3CUPB 4PJ9B 4UT7H 1RK1B 5F3BB 2CR3A 1A14L 1ZT4A 3FB8B 3P4OA 3BEWB 4YIQA 1JCKA 3KLAA 2GIYA 3LEVL 5HYSG 4ZUVB 5E5MB 1VPOL 4M5YL 4KTYA 1Z5LA 4HS6B 3THML 1CDIA 1NFDB 5I8OL 3ZT5A 1AC0A 1GGBL 3ARED 2NXYC 4XBPB 1Y0LA 5EZLB 4YHML 5I6XC 2DDQL 4FXGA 1VESA 1NGXB 1SYSB 5E8DL 2COQA 4LASH 1FVEA 1E28A 4IOFD 5HD8C 4RAVA 4PGEA 4Z7VA 3BDYL 1FO0A 1G7JA 1A7PL 3P9WB 4S1RH 3GNMH 4PTTB 3KDMB 4Z0BH 5EO9B 4B50A 4M1GH 1K4DA 5INDB 4P9MH 5H37G 1WITA 3B83A 5E5UB 4LHQB 4XAKD 3LDBB 1CGSL 2HLAB 5DHVH 3TWCH 5SWSE 3TIEA 3BRFA 4P4KB 3IETB 1TETL 4LCUA 4WEBL 1YJDC 4ZUSB 2ID5A 3AROA 2F5AH 3MLUH 1SEBB 1U3HD 1X6LA 3KAAA 3NGBB 2YWZA 2CD0A 3TO4B 1KJ2A 3F7VB 3LB6D 5F71A 1G9NC 4NHCH 1QSEB 3GSXB 1X5JA 2VLJD 1JN6B 1QYGH 4AJ0A 2YHGA 3IJYB 4F7TB 4ZS7L 1A7RL 4J3WA 1KCVL 5FUCC 1RUKL 2K1MA 2XWBB 3KPRD 1RZGA 3P4LA 3BPLB 4NT6A 1IC1A 1XGYH 3IJYA 1KEGL 2ESVD 4L3ED 4NQVB 4ODXB 1M71A 4NJ9H 1U8IB 3KPPB 5LQBH 3DLQR 1CTOA 4X4MA 3ZSTA 1ZA3B 1IL1B 4I3RL 3LD8B 1D5ZA 1FGVH 4E41D 5KVFL 4KK5D 4OLXL 5IFJA 5B38G 2BSRA 3U79A 1A5FH 2CXKA 4Q97A 4MJIA 1CFBA 4NKDA 4K3JH 3IDIB 3GKWH 1UT9A 2IG2H 4X80L 2CGRL 2AXHA 2H8PB 1FYTD 3MXWH 2HKFL 1X4XA 5KZCB 4WW2A 5HVHB 3CXDL 4L4TE 1ZHLB 4PJ7A 3SKJH 4W81A 5D7KE 2MWCA 4ONGL 5ICYA 3B8SA 4ZOAA 5IMLA 1AR1C 4BSJA 5HYIA 4H5SA 1C08A 4LVNC 1J5OH 1GZQB 2VOTA 3QWOA 4POZD 1UG9A 4HZLB 4B41A 2VRAA 4C56E 1K4CB 4WENB 3UZVB 3V8OA 1KCSH 3MRKB 3KS0J 2UY6A 4CU8A 1N64H 5FK9B 3SCMC 2HRLA 1LP9B 3EJZD 3D39D 4NHUA 3ROLA 5IG7A 1JPGB 1NC4D 4LIQL 1SY6H 3LN5A 4J4PC 2IQ9L 2NW2A 5DC0A 3OHXA 4PJ8C 3SQOL 4QXGL 3JTSB 5TDNA 3FONB 5GGSY 2XA8H 3ILQD 4RFEA 4JZOA 4G8IA 4MA8H 5GGVY 3TBWA 3QQ4A 3QNYA 5I1HH 5IMLB 3SDAD 4JHWH 3O4LB 3GFUA 4HH9B 4I18B 4IRJA 3ALWA 1A6ZA 4CVZA 1H3GA 3DROA 3PP3H 3U9PL 5DS8B 4GBXA 3PHOB 2V7NA 2DYPD 2OL3B 3QXTA 4HFUL 3NACL 4HJGB 4FABL 1Q8MA 4JGJA 4F58L 1LO5A 1F02I 4M1DH 5DGQA 2NYYC 1HINL 2HFEA 1G9NH 4EI5B 4MSWB 3Q1SH 5FYJD 1MHPH 5AWNH 1J12A 1I4FB 5ACZA 3FO0H 3BXNB 3QIUD 1TVHA 1L7IL 4HKJA 1CK0H 4MDIA 1U3JA 3R8QA 3QA3A 1YZZA 2E7BA 2MQ3A 3VCLB 3O41A 1U8IA 3WFCL 3MRQB 3P73A 4L9DA 1GH7A 3V8CA 5C0RL 1YY9D 1AY1L 2W9DH 5IW3A 5KVFH 1NBZB 5B22A 5GQBA 1VADA 5TF1L 2NY0D 4NN6B 5DK2A 4PJBF 4QF1A 5DJYA 4UINH 4DGVL 2NY0B 4NBZB 3WUWG 1J88A 2GK0B 4U1HB 4JKPH 1PKQE 5T3XE 3RI5K 2XRAL 3MNVB 1XF5B 3GJFB 5A3ID 3VG9B 2X4UB 3HZVA 3DX8B 1JJUA 4FXGB 4TPRL 1MI5B 1JUFA 3LY6A 4U7KA 4X7FC 2F9BT 5C3TA 3E0GA 1IAKB 2KUTA 3H7BA 2EDWA 2R15A 3QHFL 3ZYJA 1T20B 3L3OB 2I60H 4POZC 4MX7B 4HK0B 3KDMA 3B2UD 2Z91A 2G60L 3QNXB 5IROC 1AO7E 4HGKC 1I9JL 4OFYD 2JELL 5T1KA 3QPXL 2X2YA 4GW4B 2VITB 1HHIA 4NQDD 4F15C 4KMLB 4N5ED 1CG9A 1J8HE 5IF0B 2AXFA 2OI9B 3EOTL 3IXAB 1T2QL 4W4NA 5C0ND 5TH2A 4Z7NE 2VAJA 4GXUN 1N7ML 3OJ2C 5D7JA 3UTSA 5GXBB 3IDJA 1F8TH 4OUUA 4DGIL 1E4WH 2NR6C 3VA2C 4EVNB 4OCMC 4NQCE 2BRQA 1MSPA 3V5HB 3H8NA 3N1GC 1G9EA 2EYRB 4R0LC 5IMOA 1XAUA 3BGFC 4WTWA 4Y5YC 5SWZE 4LKCA 1SY6A 2Z9TA 2IFFL 1N0LA 3Q48A 4XNYH 1LE9B 4X6CB 1U8HA 1CXIA 1MF2H 5D2NE 3SE8H 3MRIB 1DBKL 3RZCD 1WZ1L 1D5IH 1A0QH 4HWEL 4KKAD 1D9KC 5FF6A 3G9VA 5CP3A 3KXFA 5I0DA 3VFVA 3TO2A 4NZTL 1FORL 3A67L 1KLGB 3WSQH 3LQZB 1YNLH 4U1LA 4HC1H 2BVOA 1DQML 3H6JA 3NTCL 4OZIE 2FL5B 3MREA 4JPIA 2QKIB 5E94B 3RWJA 3MCLL 5F21B 3STLA 3X13B 4H8WL 2FGWH 3Q3GB 1WBXB 3U30B 1OGAA 4RAHA 4XPFH 2RBLA 3AY4C 3RWCB 1H5BA 2VXUL 2OK0H 1IKFH 1U2HA 4FQJL 1KN2L 5DUMH 2VISA 2FZ3A 3U7YL 3RIAF 4XCYA 5D93C 3TV3L 1YEHL 1L0YA 1D5BA 3OBAA 1RUPH 3P77B 4J12A 5K93A 3AM8A 4NQDA 4GRWH 2EDYA 5GS0C 1VHPA 2C3HA 1AJ7H 2ZUQC 4DVRH 1HHIB 4YZFE 3TJEH 1UEMA 4M7ZC 5K9JH 1H5BC 1MCBA 4Z7OE 3IDXL 5EB9A 1I9IH 4TTGA 4OZHA 1UZ6F 2R1XA 1KCUL 3EOYG 4HS8H 1ED3B 2Z35B 3HZYA 4G3YH 4NRXA 1ZGLB 3MRCA 4TUJA 4KY1H 2GAZB 1QSFB 6CGTA 3UCRA 2VAAA 4HWBH 3T3PF 4N8VA 4X9GA 4ZUTB 3O8XB 3RKDD 4HJGA 1Q0YH 1WSST 3VXRD 1EEZA 3MLTA 2CO7B 4PJAE 2QR0B 1CD1B 4LU5L 5IMOB 1CGWA 2D7TH 2P5EB 3U4AA 5TQ0L 4TSBH 3TYGH 1R5WA 4PGJA 2PYEE 4HKXB 2F53D 2OTUA 5KSAB 4Q9RL 4TVPD 3PDOA 1YMMB 3AXLA 3EZJB 5BV7B 3NBNA 2ADFL 5BCAA 1KN4H 3MZGB 3QDGA 4JM4H 4XH2B 3DURB 3KR3L 3RVTC 4KPHL 3UYRL 2R39A 1T3FA 3VD7A 5F9WC 5EA0L 5T1KB 3RWJB 1GPOL 5CEZH 2NY3B 2LAGB 1ETZA 1ND0B 1MCEA 3V6OA 4D2NA 3GSNL 4DJMA 5SWSB 4TUOB 3OAYH 5K9OA 3T0WA 4WVRA 2ERJB 4X5WA 1INQB 5BZDB 4X4XB 3FB6B 4Z8FL 4O2CB 2XOTA 4YK4C 5IQ9B 1T1ZB 3SOBL 4HUNB 4HV8A 5CKGA 5TGBB 1FNHA 4GKSB 3MV9D 5DT1L 3KHOA 2BVTA 3EW3B 3TVMA 2XTLA 3QYCA 4HC1A 4X9BA 4KZEL 1IM3A 1BWMA 4KV5E 3RX7A 3TJEL 5I16A 4GS7B 4JFPB 2FX8L 4QRTA 1FNEA 1C1EH 4L29A 1QBLL 4UIKH 4NQVA 3MRHB 5T3ZE 2J4WH 4LRNH 4MNQE 1X44A 4UV7L 4PJBB 4Y8AA 4NQED 4G3YL 4YNYB 1KG0B 1RZKC 4HWUA 5DQJB 2VO5A 2NXZD 2KQNA 1Q94A 1JL8A 1RFDL 3DGCR 4LVNB 5F7EH 3M1BA 2HVKA 1MREL 1R5IA 3HR6A 3C5JB 4OZIA 2EDEA 1II4E 4UDUB 4QRSB 3O4LA 1OSZA 3RJDA 4HT1L 5MEOA 4LPYA 3NGBC 3MLVL 5JHLH 4PGBB 1I3RB 5HHOD 4Z7QF 3MJ7B 1A4KB 1CU4L 5TQ2L 4R4ND 1RVFH 2OS7A 3DVGB 5INCB 3CH1B 3RIAK 4H8WH 5F97E 4U7SA 2Y6SD 4X6CE 5D6DC 2EH8H 1J86A 4QRPD 3TPUB 3NA9L 4YR6B 4UTBH 4NJAH 1G7IA 5FYKE 1I1RA 3MACH 4PJHA 4JO2H 4F7MA 4M4PA 1FDLH 1MCCA 3QWOB 3KPMA 1T2JA 1WZ1H 3ZHDA 4I18A 5FYJE 3LQAC 4O2EB 3B5HA 3A6CL 4XTRC 4JY5H 3C5JA 4OZIB 1LP9E 1JZ6A 2A0LD 1FN4A 2IPTH 1MRFH 3QDAA 5J0BA 5I76A 3DVIA 1NGWA 4U1JB 3W5NA 3HRZB 1OAUL 4E0RB 3OHXB 3MRNA 2WBJB 2YRZA 3C2AH 4KMQA 5L2JB 2DM4A 3V6ZA 2ORBH 2C7UA 2J12B 4QXWA 1KV3A 1T0PB 3NAAH 1QZ1A 1KNOB 1QBMH 3TO4A 4PPTA 4KGJA 3RAJH 1R5IB 4L4VB 5CGYD 4BQBA 1MCWW 5ICXB 3WV0A 5F89B 3T3MF 3K2MC 3AFLA 1SYVA 1CU4H 2HMIC 1DVFA 4UTAH 2XWBA 4S1RL 1XGPB 4RQQB 3QEHB 3UTTD 4AEFA 4E0RA 5DEZA 4N5EC 1C16A 5BS0B 1HOCA 3LSOB 2PNDA 3E1F1 1R3KB 3OB8A 4J3VA 3DROB 2AJUL 4X99A 3WFZA 5KTEL 4NZRL 5DMIL 3WNMA 5ISZE 3D3VA 3NOIA 5ALCL 1QSEA 3UZQA 4LRNL 3CDGB 4JFZH 2AJSL 1JRHH 2VZ1A 3MJ9A 4X6DE 1RUAH 2IPTL 3TFKD 1NGYB 2FB4H 4KQ4L 4KTEH 3VXMB 4LVEA 1S9KC 4PJXE 1KJ2L 3O3AB 3HR5B 1FVDA 1W8NA 4N5UA 3WKML 3GBMH 5D1ZD 1O0VA 2HLAA 2J8OA 2OJZH 3MV8B 4G8GB 1FSKB 5D1ZB 5EC1B 4J8RB 4XMLH 1C08B 1S9XB 4C58B 4TPRH 5DSCB 3DUHA 1AKJD 2BFVH 1W72B 1MPAH 3H0TA 1JI2A 4IMLB 3ULUH 2WP3T 1C8PA 1F90H 4JRXA 1AFVH 4WHTA 3MR9B 4UIMB 3WUWA 5E4IA 3SDAB 4F58H 4M03A 1JHLH 1P6FA 5EU7C 1W8OA 1Z0NA 1HCFX 1VGKA 1TZIB 3ZDZE 1WEJH 4I1NB 3VFWB 1CL7I 3BGFB 5E2VH 5E8PA 4G6AC 3FO1A 2X44D 4KVNH 2P45B 5BXFA 1TJHL 4KI5E 3VRIB 3P0VH 3MODL 5DTFB 3S9DB 3LEYL 5CHNA 3HE6B 4M6OH 5EIVA 4PJEE 4K2UH 4JJ5A 1JF1B 1AIFA 5I0ZA 1W0WB 4KTEL 3GM8A 4XNZB 3QEGL 2GT9B 4ZFZA 4C54A 2AJYL 3SKMB 1Q1JH 5CS7A 5H35B 5KSUB 4QRRE 5IEHA 5F7DA 5BJTA 1CLZL 3T2PA 3HNTH 4JFDD 5HI5D 3GMLA 4YHLH 5C0GA 4WRLA 1GIGH 1BZ7B 1MAJA 1NMBL 4GMSH 2OM5A 1C5DA 3HFMH 4ZXBC 5HGHA 3L7FB 5D1ZC 4G80B 1F2QA 5D2NC 3CIQA 4WNQA 4M3KB 1BFOA 1YY9C 1F4YH 3I6KB 1F5WA 4H20H 3DRTB 1BM3H 3RKDC 4PYGA 4IIQC 1DBMH 3QXDB 4G6KH 4KXZH 5I1HL 1KXVC 3K8LA 1YN7A 4QXUH 5D72H 3B9KC 1EO8H 3UTQA 2Q20A 5C0CD 4OCRL 3DXAA 3IF1A 3KPLB 4NKIL 4R3SB 1MI5D 3G08B 5ADPL 2VXVH 1KJVB 1NAKH 1XR9B 1UEYA 1JWUB 5J6HB 1EMTL 3PWPD 1JF5A 1C5DB 2R0LH 2UZIH 5LWYL 2IF7A 4N9OB 5ABDE 5FGRA 1MCRA 4EQ3A 4HMDA 2OSLB 4X98B 1IARB 5J56B 3BT2L 1YEHH 3PJSA 4MNHB 3ES6A 1C7SA 4ERSH 3QCTL 5CLTA 5HHXL 5DD6B 3V9FA 4PREA 2OBGA 4U3CA 5HYJE 4XPFL 3O6FB 4KRPB 5IMKA 1V7NL 2M26A 1OB1A 5EBLB 4ZD3H 2DB8A 3ULVD 2XYCA 3S88L 1KPVA 4QHUA 1OAUH 2DAVA 1CCZA 4WHYH 3EO0A 4LSPH 3TV3H 1OSPL 2YPLE 2L7JA 1LO0L 3G6AB 5ISZA 1CICA 3JVGA 1TJIH 1KJMB 3VFPA 2AK4E 2Y07L 3UJJL 4HFWB 2UVFA 1RJYB 3FJTA 5FDWB 3IDJB 3QG7L 4PR5A 4DVRL 2FD6L 1NFIB 3MRFA 3BZEA 1JHKH 2F5BL 2YEZA 3MRRA 4MXVF 5DJAA 3MCLH 1F6FB 2XY1A 4CKVX 1OAYH 3TA3C 3K8MA 3MLYL 4F7PB 1OGAB 3IFLH 3O3DA 1T04B 4OIIH 1CICC 3IDNB 4HF5H 2DICA 4Q0XL 2BSSA 1N6QH 2NY2C 4LLWB 4Y4KA 1BFVH 3E6HA 3GO1L 4DN4H 4PJCE 5E6ZA 5D5ME 2DDQH 4JRXE 1MCPL 1IAKA 4W70A 3PP3K 3T8XA 2XZCL 4LARH 4NO5B 4L8BA 2IAND 2RIKA 3AB0C 3P11L 5JTWA 3INUH 4DUXA 4ODVH 5DD0H 4AT6A 3CZFB 3MNVA 3QCVH 5EWIL 4OB5L 1RZIB 2VDMH 3RGVA 3VH8A 3FO2B 1GZPA 5ACZB 4F37K 2CLZA 2NY5C 4KJYA 4YFLI 1B9ZA 3UYOD 4N9GA 4I0PA 4ZO9A 2WLZA 5FO7A 5DK3A 4MA3A 2HN7A 1JHTA 5JQ6L 1CFVL 2Y5TB 5EU4B 3VWJD 5HPMB 5JPMB 5D9SB 4OLYL 1QOKA 5ITBH 4OFYA 3K7UA 3VXPA 1JZ8A 3RVWD 3LIZH 1CDYA 1G6RL 3HG1D 1QSFD 4BH7A 2X1XR 4IDJH 2LABA 1MY7A 3NFSH 4JQVA 3WLBB 5DJXA 4P23A 3HRPA 3UJIH 4NO2A 3LPGA 3T09A 1U3ZA 3JSSA 5ESAA 1IT9L 1T22A 4LLUB 4MNQB 2P7TA 3B9KB 4XWOD 4XGZB 3JV5A 4U6VH 1JUFB 1T66C 4JDTL 4Q9RH 1ADQH 3O6ML 1P4BL 1DBJL 5IBUG 3T0DA 2OMBA 4P2RA 5GZOD 2YD7A 2X1WL 3Q6GH 1A6TA 1KFAH 3MOBL 2B4CC 5I8CB 3AU1B 5ITFA 3QUZB 3I6LE 4M1CD 2BXZA 1NCNA 3DVGA 4M6NL 2C3GA 1A7OH 2K7QA 3GIVB 5DFTA 2HT2C 3O3BA 4YUEL 3BN9D 3VGHA 1K3ZA 1OOAA 2NY4D 2DI7A 4POYA 3RVVC 4TNVF 4KZDL 3CMOH 3BW9B 4MD0A 4OQTL 2ZWLT 2WIMA 3MC0A 4KY1L 2V5YA 1JWSB 4PLJC 3DUUA 4TTDC 2R69H 1ZLWH 4LIQE 3P3YA 5J11B 4Q58C 1E4XL 1WFOA 2CLVA 4JY4A 3CDGA 3WE6A 3QWRA 4U2YA 4M93C 12E8L 3LN4A 1G0DA 2IFGA 5FA3A 3RZCB 5AAMA 4ZS6D 2X4OA 1K8IA 2FX7H 1XMWA 3IKCA 3OKLA 4ONFL 4JHAH 5C9KA 3G6JE 1SEQL 4C56A 4C55A 3OJMB 4YHNB 1I1CA 3FQUA 3WXVL 1T1ZA 3CCHA 2SEBA 3C6SB 3MV7B 4NO5A 3W11C 1D5XA 4X4XA 2K3TA 3ZO0A 2BVUA 4M48H 2XZQL 5JPMA 1I7ZA 2VLRB 5H2BA 1Z3GL 4PJ5E 5L0QC 4TNVK 3B6SA 1A9EA 4X0KB 4HFUH 1RMFH 5CZXC 4XPAH 4UB0L 4AY0A 2VXTL 4YJZL 2YPKA 5BOPA 3U6RB 2BSSB 1MLCA 3S8WA 1UB6B 1QNZL 4PJ9D 3BH9A 4K7FA 1JYXA 2WBJA 5HVHC 3VXRA 5JW4Q 4DK6A 4NZTH 1HSAA 1KPUA 1T7ZA 1P9MC 4TVPH 1J8HB 4WHDA 3ET9F 2ZUSA 5BV7H 3W0WE 4WEMB 4IEFB 1JF6A 3VXME 5MENE 5DJ6A 1MNUL 4FQ2H 2DQIH 1U95B 2I9TB 3ABZA 4NNYA 2DQJL 1HXYA 1DLFH 3OV6A 4RGND 5GRJL 3G5VA 4IHOA 1MJJA 1U42A 1UCBL 2D0GA 1AGFB 1GGIL 1ORSB 3KLDA 4M5ZH 3FOMB 2HJFA 4KFZC 4KK8D 2V7HB 4JFFA 3V52H 1G6RA 5C7XL 5DMJB 4NQXA 3M07A 4YIQB 4P46D 3HCVB 5KBNC 3I6LD 3KPPA 3M1BB 2XPGA 1VFMA 5GRUH 1Q94B 1X7QA 2E7LA 4F7EB 5GS0H 1FFNB 1S7TB 1RZFH 1ZLUK 5IQ7L 5TE6H 4D9RE 2DQTL 1C5BL 3GMPB 1QEWB 2O5YH 1S8DB 3HE7A 5IEKB 4OZGB 4NM8H 4XP9H 4MS8D 2ICES 5L6YH 4RA3A 3TVMD 4Y1AD 2PYED 1SEBA 1X4YA 3QHZH 3VFSA 1FQ9C 1RK1A 5F3BA 4M7LL 4QRRB 2O61B 3MJ9H 4P2RE 3NFNA 1WT5C 5C09D 4L5FH 1VGEH 3CDCA 1YEDA 5TPWL 2JK5B 5C2BH 3VGFA 3E8UL 2IH1B 4JB9L 5DEFB 1DLHA 2IBGA 4LPCA 4FQQA 5DO2C 1RZGB 3N9GL 2EE3A 1X9QA 4I13B 4OZGF 2NY0C 2QHRH 4IRSD 2PETA 5IIEB 3D85B 3MRJA 4H88H 2EDOA 3F7VA 3FN9A 3G6DH 5LGJB 2FJFB 4K9EL 1P1ZB 3IFOA 1SYSA 4NIKB 1T7YA 3GBNH 2FJHB 1SM3H 4AEHL 4ZUSA 5CD5C 3UTQB 5B8CA 5GRVK 1T6VN 5SWZA 1UVQA 3D3VD 3E3QC 2E9BA 4X4YA 3MRGA 1A2YB 1P4LB 5TE7H 1CL7H 3S98A 2RQ8A 5TJWK 4Z7QE 2MPAH 5ALBL 5I1KL 3CPLA 4WV1A 1ZHBA 4NC2B 1HQ4A 3MO1A 4MCZB 1F45A 2E7HA 4HUUA 5FKPA 2FX7L 2GFBA 4XPTL 4JZJC 3MROB 4S2SA 3BWAB 5E03A 1UM4H 1QLRA 4JO1H 1R24A 1DUYB 1NEZB 5DYOA 4FTVB 1CZ8H 2FBJH 1S9WB 1NEZA 1DUYA 2B5IC 4KHXH 3HKFA 5I18H 1AKJA 1X7QB 4Z7VF 4U3HA 4FZ8H 5FUOH 2FECI 3UBXI 2D4FA 2J7LA 2YD5A 3D9AH 4FQHA 4LSDA 2E27L 3FOLA 4G43A 4N0FA 5KG9B 1MCJA 4JRXD 4XWGL 3ZDYE 3KYAA 3CPLB 1BF8A 5J6HA 4JM2C 3VMPA 1EVTC 1E27A 2EDQA 3G04A 3MV8A 1FIGL 1XGTA 4FG6D 2ATPA 4V1DE 3U9PH 1ES0A 3V6FA 5EC2B 2VQ1A 4XNMB 5HHNA 3T4YB 3BKYH 4NQDE 1J1XL 2QSTA 2OTPA 3R06A 3PJSB 3GRWL 1NGYA 3UTTA 3VXMA 3ULVE 1R24B 1FJ1B 1MFDL 4F33A 1IZKA 3K0WA 1TENA 3TT1L 4YDIL 1AQDB 1A4JA 5CIPH 3MRDB 4K3HA 3FT2A 3SKOA 2HTKD 1J1OL 4RMVA 4IRJD 4JB9H 4PBWD 2EDJA 3MXWL 5FYLE 1BD2B 4DW2L 4J8RA 2JJWA 4OM0H 1WISA 4YBHA 2MMXA 1J0YA 2DM7A 4MNGB 3KPSB 4X4ZA 3SGKA 3RWGB 2DJSA 3O6KL 4FZEH 3SJVE 4PJFE 5BJTB 4OLXH 4OGYH 4HIHB