4YHPA

Crystal structure of 309m3-b fab in complex with h3k9me3 peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
219
Chain Sequence
EVQLVETGGGVVQPGRSLRLSCTASGFTFRDYWMSWVRQAPGKGLEWVADINPDGITRYYIDAVKGRFTISRDNAKSSLYLQMNSLGAEDTAVYYCAREFHSGLGWHFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antigen clasping by two antigen-binding sites of an exceptionally specific antibody for histone methylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords H3K9me3 peptide
total genus 47
structure length 219
sequence length 222
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhpA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhpA01
1ZTXH 4Y19D 5CHNA 4L3EE 4P5MB 5KW9L 2VDKH 4PLKC 1WZMA 4OZIB 3LD8B 5FA3B 4ZQKB 3RNQB 4MXVE 2P48B 4X6CA 3NACH 5J1SC 1OAXL 2HTKC 1H3GA 3MBXL 4RDQG 1LO3L 1WZLA 8FABB 3D2UA 4FABH 3RZCD 3FFCE 4P57A 5HJ3B 3LKOB 1BJ1H 4OD1H 4ZUWB 1HKLH 5KVFL 4GAGH 4K94H 4ZFOB 4PJXF 4NQUA 2UUDK 5GGSA 1A3RH 4NKMA 3SDCB 1EUUA 4L3ED 1CG9B 2X05A 3SE3A 3IF1A 2O26U 3MJ9A 4MZ3A 5MERB 4I8DA 3CD4A 4HKZB 4LKXB 3ULVD 4J6RH 4MNGB 4HWUA 4OTXL 2D31A 3ZHLA 1D5IH 5HHOB 3VDCA 1X9QA 2W60B 3QH3A 4JAMA 4POZD 1TNMA 5B3JF 4M5YH 4OM0L 2ESVB 5C6TH 3MRQA 2JIXA 2DTMH 2KKQA 4RWYH 5ILTH 3QRGL 4ZFFA 3QFJE 1U36A 2EICA 3BZEB 1UWGL 2CJUH 1DZBA 2X7LA 4U7KA 3DI3B 2LVEA 3UTOA 1RFDH 3WNNA 5CZKA 3N1QC 4JDTH 5CJ5A 1QNZH 3VXSD 2GSGB 3NCYS 1NCNA 1SEQL 5T3ZL 1JGLL 3CVHB 5KW9H 1K5NA 2ZCHH 3OAUL 5DSCA 3V79C 1SM3H 5FGCE 4GAYA 3BGAA 1J8HD 4DKFH 1LVEA 2BMKA 4QRTB 5D2LB 2DDQL 4F9LC 1AO7D 5FF6A 5HYSB 2DM3A 1ZGLM 2WNGA 1GHFL 4P9HC 2VIRA 2VLLA 1IQWH 3RAJH 3J8F7 2FR4B 5C07D 4TTDC 3TNNB 1MCNA 4TSAL 4MAUH 2VZ1A 2HG5B 3DRQB 3BMWA 3VJ6B 4AG4L 4PJ5A 3KPLA 5I74B 1QVOB 4XWGL 2VL5A 2Z9TA 2VXUL 2W0KA 1FP5A 1YZZA 5I6XC 1AD0B 3W0WB 1G6RA 1NFDE 5L8LB 2BXYA 4PY8I 2VAJA 1YY9C 4PJAE 5JHLL 1MLCA 5BOPA 1GGIH 5BS0A 1Z6JT 4BKLA 2JB6A 5IOPA 3WFCH 4QXTA 2BSSB 4GXVL 3K0WA 4ALAH 3BPNB 4JHZA 4R7DB 1FLRH 3CLEL 3I9GH 1EMTH 2PW1B 3NABL 3CMOH 3PWJB 3TA3A 3Q6GL 4P3CL 4U49A 4N0UE 3ZT6A 1GL4B 1HXMB 5IBLC 5JOPD 1EMTL 3KS0J 2Q6WA 3LKPB 1KJVA 3G5ZB 3BJ91 4RAUA 1FYTD 4CKVX 1TJHH 2QBWA 3MRRA 4M6AA 5D1ZC 1HSBB 3MNZB 5AD0A 3QFDB 5E4EB 4KKAD 3CIQA 2Q8AL 1J86A 4K8RD 3MFFA 1KCVL 3HFMH 5IGXH 4WI5A 4L5FH 3ARED 2H32H 3V4VL 1BFVH 3TYGH 3CFKB 5E2VL 4LCCC 4HDIA 5F1IB 4WW2A 2C4XA 3H9SA 4LFHD 2CDFA 1KT2B 4HX1B 3PQYD 5CSZB 4N9OB 4XWGH 5JW5A 5KSUA 4JVPA 1WFNA 1AO7E 4LLVB 1CDBA 2NNAB 1ZLUH 3M07A 3CH1B 1S9WB 2GIYA 3ULUC 1B4RA 2AABL 3FO2A 4IMLA 4NHCH 2CMRH 4LPTA 4M6NH 4XMKL 3KYOB 3SGJC 3VMNA 2IQ9H 3KLDA 4ETQB 2MCPH 3LHPL 3QWRA 4XCFL 4OZGA 5HYQB 4CADB 2VDMH 2D7PA 4NUGL 1S7SB 5FYKL 2BJML 5BZWB 4NN6B 1F3JA 3DJ9A 5BS0E 2DKUA 1NCBH 5DYOA 3LVEA 3S5LA 3ULVC 5EU6B 1KEGL 4HHAA 5L2KD 3IAQA 5J1AA 5DJ8B 1R5WB 2ESVE 1PKQE 3L3GB 2ED8A 1VACB 5ICXA 4AT6B 3KYNA 3MBEA 2UWEF 1UWGH 4K23H 4AEHH 4QRSB 1Z9LA 2QQLL 4GBXD 1KXQE 5JQ6L 1BBJA 4QRPA 3BWUC 2XA3A 4KVNH 3RZWA 1DQTA 1BM3L 5KSAC 3QDME 3PWNA 2EYRA 3BN3B 1L6ZA 3INUL 4MX7A 5DUPL 4WI3A 4OZIE 5CGYD 1SBBA 3EYQC 3DX7B 4NZUL 4APQD 1IM3A 5ITFB 1R3HB 1XCTA 4MCZB 5HYSA 1RURL 1P84K 4Y4FD 5FECA 5D2NC 5FIEA 5F7LB 1S5IL 4DKEL 1OARL 3GMMB 4BZ2L 1J1OL 1QPXA 4NNYA 1A14L 5HPMA 5I1HL 3SJVB 5K9OB 1I7UB 2NY0B 1WZKA 1NJ9A 4OZGE 4O5LL 4JB9H 5K9KB 2DWEA 4OSUH 3VFGH 3B2VH 3E0GA 5IEKB 4YBLC 1RZGA 3CXDL 4P9HL 1DQML 1UM4H 4UAOB 3H3PH 2Y25A 5HDOA 3TO4C 2VDKL 1U8KB 3EO0A 4NO3A 1ZGLA 2K7PA 3TBSA 3RVXC 4JFFA 1NL0L 3CPLB 3T0BA 3TESA 1ZTXL 4EEEA 1IJ9A 4R7DA 4DZBA 4X83A 3LKRA 4L4TE 5SX4H 3ZT7A 4Z78B 4AM0A 3MNVB 4GMSL 5L7XL 1BREA 2E27L 1E4KC 3FB7B 5DEGB 5DRWA 4P2QD 1A6TA 5EIVA 1BBDL 4HUNB 2X2YA 5I8EA 5DVOA 5H2BA 4GKZB 4CN1A 4U1NA 2VAAB 3ARXA 4HIEA 2BVPB 4QEGA 5D5ME 4EI5D 4R8WL 1IM9D 4JY6A 4DQOH 4MAYC 4NNXA 1T7VA 4HPOH 4Q9RH 4RAUB 2OZ4A 1HYSD 3VXSA 2F8VA 2HKHL 5MEOA 1OSZB 3MV9D 4IRJB 3TO4A 1TZIA 4ORGA 4YGAB 3L3KA 1WSST 5F70A 5KOMC 4P9ML 4NM4H 3SE4A 3D18B 3FQUA 1BEYL 2JTDA 2VC2H 2BSRA 4YFLI 4C56A 1JGUL 3D39D 1F4WL 2C3GA 4U2ZA 2MCG1 2X89D 3VWJD 3U9PH 4J2XA 2J6EA 5KANI 1XIWC 1PG7L 4Y7MA 2X09A 4ZSOA 3SDDB 1Q0YL 3W0WE 1NFDB 3FTGB 2R2BB 4FRWA 4F33B 1B0GA 1OAUL 1RIUL 15C8H 2IADA 4UT9H 3EYOB 3ETBF 2COQA 2PR4H 4NZUH 3FT3B 2HTKD 2GUOB 5F88B 4WFFD 3JUYA 5AUMA 4GSDH 1JFQL 2ATKB 3BH9B 4N5EC 2JCCA 3GK8L 4EI5B 3VFNA 4JFOB 4QF1B 2KDGA 2YC1A 2YKLH 3V5KB 4GQ9H 1YPZE 1FNEA 1QLRB 1T21A 4B53A 1N4XL 4QNPE 3O3EB 2ED7A 2IWGA 3FMGL 1JCKA 1ED3A 1S7RB 4KKBC 4XAWH 3QIBD 1T89A 3BQUB 5C0BB 4PJ8A 3PNWA 1Q9KA 1NLBL 3MR9A 5LJYH 3MOBH 3C09B 1FZOB 3IDIB 1R3IH 3BKCH 1MRCH 4LMQI 1MCDA 1I1FB 3OHXA 4M93B 3MV01 4LPCA 1NGPH 4K8RH 4OLXH 4PLNC 2VXVL 5EZLA 2IQ9L 2XKNA 4L9LA 3S34H 2WWMC 2GQHA 5D7SH 2F53E 3QIUD 2JIXD 4NNYB 4WWKD 1G7MB 4LF3A 3MOAH 1FN4A 4FQXD 5HDQH 3RI5F 4UIKL 1WWBX 2H45A 3UBXG 5EO9A 6FABL 1V3KA 7FABH 1FQ9C 1P7QA 3SCMB 3RBSA 1RVFL 2WANA 4OGXH 3JV0A 2R56H 2J5LB 1I1RA 5LG1A 3G5XB 3ZE0F 5DT1L 5KVEH 2ICWA 5C0FA 1L7TL 2OJZH 3P30H 4P4KB 2EDEA 2X4SA 3SKOA 1HXYB 2UZXB 3C60A 3U7YH 2DQGH 3L6FA 5GGTL 4E42B 1S7UB 3S9DB 1RK0A 4LEXL 2ZOLB 3ZTJG 2QHLA 5KAQG 1AI1H 2LAGB 3HR6A 4KH2A 4UU9B 3MUHL 1WZ1H 3D5OF 5MHSD 5GGSY 1LE9B 5IHZA 3QHTC 2A83B 3M17A 3MRCA 4YFLF 4XP9H 4Z95L 1O7VA 4NO2A 4DJMA 3RNQA 1B3JA 3QFJB 2G5BA 5I15L 1ZHKB 1ZWIB 1RIHL 5C0ND 4YEFA 1M05B 3KYMA 3M1BB 4PGZA 3K4DA 3O3DB 5E6IB 3U6RA 3HE7D 4DW2H 4LCIH 3RPIB 3C9NA 1TNNA 4M1GL 4PJEE 3IFOA 4XBPA 1KJMB 2H2PC 3TBTA 1BAFH 1SEBB 4F9LA 3QULA 4KU1A 4CMHC 1DN0A 1MAJA 1XF2B 4XCNB 3LKNA 4YDIL 2N7AA 4L4VA 3VFOB 2BK8A 1CZ8L 5DMGC 2NY4C 2UYLB 3H3KA 3N1PC 2ZCHL 1U8MB 2VKWA 3CVIH 1OSPH 1AIFB 3P77B 4HWZA 5GIRB 4F2MA 4ZTOL 4IOFD 3O8XA 5AUMB 2LV4A 1XGRA 5EZJA 5T33H 1RFDL 1U41A 3WLBA 4F58L 3HPLB 1ZT4A 3VGAC 5B3NA 4LVHC 3LKPA 4DN3H 1T1XB 1U3YA 2AQ2A 5DJXB 5HGBA 5DZOA 3FB5B 3L7EB 5A16A 5C0BA 1AXSA 2ILLA 4KPHH 5C0RL 5GGQH 1UXSA 3CX5J 2PETA 1VADB 4P5KA 5HY9B 2VLJA 1UZ8B 1XZ0A 4PBXA 5KS9A 1Z9SA 3MUJA 4MJ5A 5C0RH 3W39A 1F8TH 2WMPA 1XF4A 1GCFA 3ISWA 1EHLL 1CXEA 4DN3L 1TETL 1A9EA 3DTXB 4Y5VB 5JDJA 4KV5F 1KUMA 5DGRA 5MEPB 2AXFB 1QBLL 2WINB 3GMLA 4Y5XA 2DBJA 1HKLL 1AQKH 3BPOC 1W0YT 1BD2D 3FQRA 5ID0B 3I6GA 1MFNA 3RFZC 1G0DA 3RWIA 1G84A 1UH4A 5F9WC 1P2CA 4X9GA 5DYOB 3S5LB 4DVRL 1F11B 3DV6B 3MSPA 4OLVL 3Q5YA 4IDJL 4FTVB 4WUUD 4PJ9B 1U3HD 3Q6FB 1N59A 4X6CB 1ZA3A 1FFRA 5DZLA 4L9DA 1ZVSA 1K4CA 4MNHA 5CJBA 4FQLH 7CGTA 3MREA 5DQDH 1BVZA 4MXQD 3WNLA 4YDVA 4RISH 1U93A 2A6IA 3MBED 1J8HA 3GM0A 1BOYA 5D70H 3WXVH 1FFNA 1MAKA 2X4UA 1JPTH 4NCC1 4Z76A 3ZKXB 2C3XA 3LS4L 1I7ZA 1PSKL 2O5YL 4H0HB 4XNYH 1RUKL 2AP2A 3WO3B 2MNUA 3DUSA 3O9WD 4HLJA 3IJYA 5D7LA 4WFEE 3D25B 4Y2DC 2NZ9C 4M1DL 4BFBD 3U82B 1PVHA 1K3IA 1NBYA 1AI1L 1DE4B 1KACB 2Y06H 5F44A 5FECB 4LDEB 4XXCC 3U7YL 2LU7A 5C0CB 3FB7A 2IBZX 3PDGA 3ROLA 3AS2A 4APQC 3L5JA 1OP3H 3DX6A 1WFUA 4UBDD 4OBSA 1LQSR 3QNZA 5E1AA 3E6FB 4YHOL 1CK0L 3NCEB 2HFEA 2R29L 4N0YL 5CEZH 5CZXD 1XGPB 3KPSD 3R8BB 4HT1H 1L0YA 5CUSH 4CVZB 3R1GH 4Y4KD 2AXGB 4RFOH 1CD0A 1AP2A 4JN2B 3FAWA 5FGCB 3QIWD 2IAMA 3BYYA 3VGBA 5BJTA 3U4EA 1I8IA 2VDQL 1L0QA 2BCKA 1S9YB 4PJ5B 1FH5H 3S96A 3RP1A 2DN7A 2Z31B 5HYEA 4WHYG 2GSIA 4FZ8H 3MRBB 1N0XH 1CD9B 2XXMB 2E9IA 1E4XH 5JQHC 5BVPH 1YQVH 5H94A 1I3GH 5IK3A 5JTWA 5C09E 4LFHG 2IALB 3MUY1 4KZDH 1KPRA 1NMCB 5TGBA 2IJ0C 4KUZH 2J8UB 1XF4B 4RGNE 4FFVC 2BVOA 3ARDB 1IBGL 1LNUB 1FNAA 1MFBL 2DI8A 3SGEI 1N4XH 2UZIL 4P2QA 2QQKH 1E4XL 3OB8A 2PO6A 5BRZA 1QBLH 4NM8H 4X99B 3VD9A 1U8OB 4G43A 5I8CB 3ZE1F 2DL9A 2YKLL 5AEAA 2EIBA 2YK1H 3NAAL 1MFDH 4OZFB 4UILL 3EOAA 4ONGL 4ZFFB 4ZPVB 2X89A 4NQDA 3MUGB 2ZOKB 4N0UB 3HTLX 4NC2B 4PJGB 1B0GB 2R23A 5D7JA 1JRHH 2Y07L 3BIKA 5GJTL 5L0QC 2XZQH 2F15A 15C8L 3EHBC 5A43C 1JZ8A 4N90E 1MCKA 1NEZG 1QSEE 1FZOA 1MCPH 3BRGC 5JW5B 4NN6C 4WY7H 1MHCB 4F58H 3BMVA 1CK0H 1NUFA 5GSVB 4X4ME 1KPUB 2HRPL 1G0YR 5CMAA 2V9TA 2QV2A 2UVFA 3CVIL 4JGJA 1KTLB 3RUGA 1MFAH 3OR6A 4TVPH 4DOHE 5IW6B 1I85C 4QTHB 4OZFH 5T3XH 4H1LA 1INQA 5L9DL 2X70A 1QP1A 2YUXA 3HC4H 2VNCA 3UTTE 4JO2L 4FN0A 3HNSL 4XWOD 1AD0A 3O2VH 2VTFA 3O4LA 4LP4A 3W81A 1X5XA 4YDIH 3NN8A 1I9IH 3FO9A 4G6JH 2XZZA 4AL8H 2CIKB 2O5XL 2DB8A 4NUJA 5E2TL 5AG9A 5BMFL 2FLRT 4OGZA 4K3GA 1MJ8L 2CRMA 1J18A 5JORA 3U1SL 3VGHA 3K1KC 1UC6A 4QHKJ 4HKXA 3O4OC 5DMJB 1C16B 4RQQB 5D70L 3WXVL 1A3LH 1T0PB 1FZMB 2HTLD 2NXYD 3UJIH 2PTVA 4NGHL 1MAMH 2D0HA 5DQDL 2B4CL 3L6FB 1VPOH 2FL5B 4JO3L 1VEOA 4V2CB 1T1WA 5I0ZA 3GMQA 1Z3GH 5E2WL 1A4JB 5FYJD 5FKAB 4IDJH 4M48H 5E2TH 2PO6C 3EDFA 4DVRH 3CXDH 3S35L 3U83A 5CEXB 1RJZB 4OZGF 4WWKB 1I9IL 4ELKA 5F89A 5EBLB 1D9KC 1ZVYA 4QOKE 1I7TA 3WO4C 3CFBA 2ZJSL 2NXYB 1ROWA 3HCVA 5C0BD 1DCLA 1Y6KR 1U91B 3KPPB 3Q5TA 4MWFB 4PBVC 5BV7B 2GTZB 1YC8A 1YMMD 4POZC 4P2OB 4JY5L 2BVUA 1JPGA 4BH8B 1CXFA 1CE1L 3STZA 3ARDA 3VFOA 4R6UA 5HDLA 4F7MA 2OZ4L 2OTWB 1NCAL 3QQ9D 2FECL 4OFKA 5TGBB 5H2BB 1TJIL 1MFCH 3B4NA 2PF6A 4OF8A 5C0GB 1Y0LA 3HHRB 2RB8A 2V7HA 1MCLA 2ZP0T 4GG6F 43C9B 1WBZB 5GRJL 3LKQA 3B3IA 4XH2B 5ESAB 5I9QC 4KPHL 3HPLA 5I1CL 1EUTA 3O3AA 3L3GA 4HLZG 1OF2A 5SWQB 5GS0D 3HZYA 4HWZB 2NLJA 1OAKL 3VI3F 1NDMA 4CJ0A 4YR6A 3KJ4C 1JZ7A 2K9UA 4X7DC 3U46B 1R3IL 3WS3B 4PJBA 4M1CC 4ZS6C 5C0AB 2WUBL 5IG7B 1X7QB 1YJDH 3WFDL 4Z7WB 4L8SB 4DTGL 3S3PA 4MCYB 3VFVB 3GJEB 4XXCA 3DECA 4MQXC 2ZUTA 3MXWL 4RNRB 1I1AD 4P57B 4TQEL 3KAAA 1LDPH 2CR3A 1HXYA 4GQ9L 1XCQB 3MJ7B 4QRQB 1YY9D 4FZ8L 4I48A 5TE7H 5DS8B 3UPRB 4ZUWA 1WC7A 1DANU 2CUHA 5ID0A 1GIGH 3LB6C 1KLGB 1HHJA 2AJXH 4KRPD 5D1QD 1K2DB 5JW4Q 5I1EL 3QXTA 2VN7A 3MLTA 3GMLB 5IGXL 5F7FA 4ZAKA 1UWXH 4MNQE 4O2CB 4DAGH 5IMOA 5KS9F 3R1GL 5E00B 4UT9L 2WIIB 4Z7NE 1QFWM 1LEKB 4NO2B 4G9DA 2JJUA 3RVTC 4EXKA 2R39A 2NCMA 3O0RL 4LPYA 3OG4B 4W68A 1SJEB 3O4LD 5J4MA 4OLWL 4HUVA 4IOFC 4YDKL 3AVEA 3OSKA 3V9FA 5EU3A 4APQA 1N5AA 2EKJA 3EKCA 1PDKA 5KG9A 1V3MA 3LEYH 1FLRL 3CLEH 4MNHB 4TSBL 2WAHA 2H2SC 4EUPG 5HHMB 3FQXA 2VOTA 2R4RH 3IDIA 4NSKB 2F54B 1C5DA 5CEZD 2CDEA 4LHUA 1HEZA 1JHLL 2YPKA 1KGCE 2J8UF 1XGUA 5DO2C 4N0FB 2BVQB 3S4SA 7FABL 1FO0A 4K71B 2B39A 1LWRA 3RY6C 4GW5A 4F8TA 3VW3L 1WFTA 2I9LA 3NCJH 4BJLA 1J0JA 3JTTA 4FQPA 4HPYL 1WWWX 1IAIM 4U33A 4Y19A 1JPFB 2GW5A 3P3YA 1NQBA 2VMFA 2VXQL 3VXQA 5IM7A 2E27H 1NC2B 3RZCB 4KHXL 3KYAA 4Q9CA 3WFZA 1FL5A 5KSAB 1EBPA 5I17A 1Q9WA 2NW3B 1RIVL 3RL2A 4FQQA 3K8MA 3LQAH 2FBJL 2EE3A 4F33A 3MOBL 3CC5A 5DA4A 1IZJA 2LE9A 3B2VL 4U6VL 1F13A 4JDVB 4CMMB 1UA6H 4P46C 5D1XD 4FQHA 2XPGA 1A6AA 1BVLA 2XV6B 5A2KH 4YE4L 3VDBA 4LLUA 2OL3H 5CBEB 4BUGA 2IPUK 4MJ4A 3KWWA 5FKPA 3U0PA 2VLMD 4G7VH 4E41A 2H9GB 1T21B 5D5MA 1WTLA 5MEND 1YUHB 3PP4H 2VL4A 2ZPKL 1YEFL 4J3XA 2DQIH 4CU7A 3Q3GA 4OFVA 3UP1A 4A2LA 4GSDL 1X5FA 3QUYB 3P9LA 4GS7C 2IFGA 5F1KC 2NPLX 2ADIB 1S78D 1JRHI 4JZNB 4F57H 3BDBA 1MCEA 1JI1A 3D1MC 3RZCC 1F58L 3L3OB 2VIRB 2X4OA 5DHVA 2X40A 4F15B 1P7HL 4BZ1H 1Q0YH 3HUJE 2PNDA 4MZ2A 4GBXC 5CZVL 3ILPA 5EZLB 5ITBH 1P7QD 5CFHA 3HE6A 2Y1VA 3BP6A 5JW4R 4ERSL 3K7UA 5T33L 3MBXH 4IRZH 4WVRA 4K9EC 3C6LC 2CLVA 5J11C 4DEPC 3V4PH 3VXMA 4YHYC 2A9MH 1VFBB 1YNTB 1PQZB 3QO1A 4PJ7E 1RJYB 2DI9A 4OJFL 4OFYD 5EZOL 1RI8A 3QI9D 1U9KA 2DQEL 3CDFA 5IB2B 4KGJA 5F3HA 3O11B 2F54D 4LIQH 4UDUA 3AU1B 2CMRL 4B41A 3BPNC 3AS3A 1IAMA 2JJVA 4UMGA 3B9AA 4X98B 2R8SL 4MB3A 3UYRL 1CI5A 3RNKB 2VLKD 3NBNA 5F72S 2JJTC 4WWID 4R90L 2KH2B 3SE9H 5ITFA 2YA1A 4RGNB 3EJYC 4EI6A 4F37F 3RHWF 3V4VH 3GSNL 3O45A 1BX2B 1HEZB 4YZFE 1U3HC 4U1MA 2CDEB 1BQHA 5HD8D 5HGAB 2HVJB 4LCYA 3FT4A 1DEDA 2ZCLL 4GKSA 2NY3C 4NT6B 3HUJA 3VA6A 4G6MH 4YHIA 1C5CH 1KN2H 1ZHKA 1ZWIA 3SQBA 2QHRL 5C0CD 1CGTA 1VSCA 4LAQH 2X1PA 5HSFA 3EYQD 3W9EB 1DBBL 4PJGE 2Y72A 4FQCH 4HUWB 4S1DD 4HXAL 1UJ3C 5JW3L 3K3QA 3PV6A 3IU3A 5DJZA 2MHAA 5JXEC 4GG6E 4OCLC 1ZHLB 2A6KB 1CIDA 4EDXB 5EU4B 1UEMA 2EIDA 5M95B 2GTWA 5DT1H 2VYRE 4P99A 4YO0A 2FR4A 1SJHB 1AGEA 1PX3A 3X17A 3K8LA 4DFHA 1CDCA 5FFLA 1I9JH 4JJ5B 2Y4SA 3INUH 1M71B 4EVNB 3RX8A 3FFCA 2EXYD 4G8GB 2Y36L 2MMXA 3PWUA 1INEH 3IRPX 2EH7L 1WIPA 5J12C 4L9LC 5JQ6H 4U1NB 2NY5C 2Q3ZA 2YHGA 4TSAH 1LO5B 1WITA 1E4WL 3QEHA 1P1ZB 4YWGH 1QSFD 3JWDC 1MREH 1IGFH 5FUCC 2HLFC 1G6RH 1BMGA 1S7WA 5IB1B 2NW2A 4OKDA 1CD1A 1S7TB 2VLJD 4GLRH 4CGTA 5BQ7A 1MNUH 3MV7D 3QEQD 4HK0B 2BY1A 3PQYA 4G80B 4ZNEE 1E6OL 5IWLA 3AXLA 1DL7L 3FN0L 1OL0A 5FK9B 1NFIA 4XNQB 5E8EB 3QZWG 1HZHL 2IMMA 2NQCA 3MRQB 5DQJA 1J5OL 1NCBL 1SEQH 2HVKA 1UJTA 3DSFL 3SE4C 3BHBA 2YWZA 3VXNB 2BNQB 1KJVB 3G5ZA 4KK9D 4YNYA 4KK5C 1FL3A 3QQ3A 3GNML 3DNKA 3C5SB 4H8WH 4HV8B 5LKNA 3LN5B 1GYAA 1IGTB 1OTUC 1CGVA 4XMKH 4PY7A 4Y0GA 1DVFA 4PP2B 4GLRI 2VZUA 3CLFH 1FYTB 1QRNA 3IJHA 5AYQA 4LSUH 2ZG1A 5INCB 1KTDB 4J8RB 4NRXB 3ZZ1A 1DQQB 5IMMB 2DQJL 3MRGB 5KSBB 1R5VB 2VDRL 4KHTH 2W92A 3RWCB 2ITDB 4HX1A 1H0DA 2D3VA 4NUJB 4G8IA 3PL6A 3QAZB 1FCGA 1K8DA 1GRWA 4LSRL 4PS4H 4OLYH 5DK3A 1Y6MR 4L4TB 1DBAH 1QVOA 5E5RB 1LO4H 5FO7B 4QKXB 4YX2L 1DR9A 1B0RA 2H3NB 1NKOA 2QQQA 4PJDF 3IXTA 4FQCL 2C7UA 2Y7QB 2ADFL 3S96B 4PJ9D 1PJ9A 2GSIB 4AMKL 2R2EA 3U0WL 3KPSB 4M3JA 4MA3A 1C5CL 4KGLA 4LEOB 4EDWH 4Z76B 2R2HB 1NAML 5DD6A 3PHQB 5ID1B 4GBXA 4YHZH 1WEJH 4ZUUA 2IBBA 3T3ME 3X14A 4LQFL 1A4JA 1F3JB 1A1MB 4JJHA 5IHUL 2W65B 2YUWA 1ZHBB 3L9RB 3FO0L 1NAKL 2I9TA 5IIEA 4XVTH 5TPWH 3P4LA 5HGAA 4HPOL 2ZOKA 4N0UA 3ZSTA 1BLNA 5IVXF 5EO0A 5HVHB 3SCMA 4W4NA 1MCJA 4KK6D 3TP4A 4YXHL 4J4PD 3O6FC 1S7VA 4MA8H 2GJZA 3KJ6H 2C3HA 1BBDH 5JA8B 1A6WH 4EJ1C 4YAQB 4KZEH 2FO4B 3ARBD 4MDIB 3QNYA 4X6DE 4PJ7B 2HJLB 2AJSL 1JK8B 3EJZD 5DLML 1MRDL 3PWUB 1IFHL 4ETYA 3OAUH 1M71A 5DD3L 1JGLH 1ZA6B 2X42A 3TV3H 3H9SB 5D93C 4KMQA 1NANI 3WKNA 4JB9L 4ERSH 3QHZL 3CFDB 5FHBH 2P1YA 4KVCH 4NFCA 2R4SH 1HNFA 4LHJB 1N5YL 4EN3A 4C4KT 2DTML 3FJTA 1GC1C 1B0WA 4GQPH 5JOEA 4MD0B 1MEXL 4F57L 2ESVA 3TH3T 5KVMC 5ETUB 4LRNH 3VFSB 5E8EA 5JXED 4S1RH 1IILE 1RUPH 4DCQB 4F7EA 4WEMB 3QEGL 1Q9OA 2DQIL 3DGCR 3TYFA 3RUGF 1YDPB 1O7SA 2HJKA 4PJXE 1G9NH 5EIQA 4G7VL 3FL7A 3T0XA 4GOSA 3P4OA 2WIMA 5KVFH 2FBOJ 4MX7B 1SEBA 5C0NC 4YHNA 4NQCB 3BFOA 3JTSB 5D2LE 4MA1B 1X5LA 3DVGA 4I4WA 3WHE1 1FFPB 4GG8B 4OZIA 4UQ2B 5E08L 1RZKL 3D2UB 2V5YA 3DPBA 1U8PA 1SQ2N 4CU6A 5INDA 4XP5H 4JKLA 5EOTA 2H2PD 5JUEL 4Z7QF 5SX5H 1X4XA 4YHMH 1GZPB 3LEVL 3UJTH 2DMCA 4ZODA 2ZWLT 4HH9B 2VUYA 3QNXB 4HS6A 4S0TD 4XCFH 5FUOL 5IVXA 1QYGH 2PYED 2VLME 3Q5OA 4QWWC 3WSQL 2IBGA 2EC9U 3VWKB 1EZVX 2GY7B 5CP7B 3W5NA 4IS6B 2Z35A 5D8JH 5C09A 1FJ1B 2GK0A 4PJ9A 1A4KB 4ELMB 2XZCL 3HI5L 4LLWA 5HYJA 3LS5L 3BZ4B 3CSYB 1FO0H 4N68A 1H3TA 1GZQA 2F8OA 2Q8AH 4LRIA 5C07B 2YA2A 5KSAD 5EA0H 3PGFL 4ZXBB 5C0JA 2IH3B 1JHKH 3OKOA 5EORL 5CZXC 1G9ML 2J88L 1QLEH 1A5FH 5ISZB 3LN9A 1AE6H 1H8OA 2G60L 4OUUB 1KB9K 1A1NB 1RU9H 2J8OA 5FF6B 1IMHC 4PJEB 5CJQH 4EUPH 2PXYC 3VH8A 2E6JA 1RZJH 1IGML 2RHEA 3CDGB 2ZSWB 3S36X 5HHXL 4LSSL 4K7PY 3X13A 4KQ3L 5DFWH 4FG6D 2IPTL 3T0ED 2VDPH 4DAGL 3HG1B 4N8CH 5JHLH 2AJVL 1MWAB 2ICEA 3PUCA 4JZJC 5I1EH 3QWOB 3OKMA 4HGKC 2X4PB 1QSEA 3RKPA 3O9WA 5D7LD 3OXRB 1V3JA 1WBYA 2ZKHL 2X4QB 4Y5VC 4FFYL 4Y4FA 5MEQA 3L95B 4XRCB 3SPVA 3NH7L 2C3WA 3N85L 1ZVSB 2OCFD 5IFJB 4ZOBA 1D5XA 4JHBA 3IXAA 5JPMA 3UC0L 1T83C 2BHUA 1CLYL 1HHJB 5C08A 5DI8B 3MXWH 3HLAA 3TBYB 3O4LE 4ZFGL 4O4YH 1ZAGA 2D31B 3ILQD 2EIZB 4Z0XB 5HYJE 4L29A 5I1AB 4KDVA 1PW3A 4P48A 4LIQE 3C6SB 1VACA 3LKSB 5ICXB 2JCCE 4XP4L 4WUUA 4RBPH 2LFGA 2J2ZA 3O2DL 3FONB 3PDOB 3RKDD 2VDOL 4DCQA 4F7EB 3VD7A 2XWBB 3HMWL 4Q2ZB 4AENA 4NWUL 4PY8J 4BSJA 1RULH 5E2UH 3VXPB 3V6ZB 4XP4H 3UBXA 4DWHA 1EBAA 2CJUL 4OKVB 5CIPH 2JLLA 3IFPA 3HB3D 1EGJH 25C8L 3PGDB 3T3PE 3QRGH 4QY8A 5LVEA 3UZEA 1DBMH 1W72L 5AZ2L 4HLZH 3QO0A 4LLYA 4Z7NF 1A0QH 1U42A 1FDLL 4FG6C 4CNIA 5C2BL 5IMKB 5DRNA 3QXDB 4K07A 4G5ZH 1JWUA 5F3BA 4WTWA 3CFKA 1NC2A 4R97B 4YDJA 3IDMA 4G8FA 1PEWA 1PYWA 3C2AL 5E6IC 4Z7UB 4PRPB 3WBDA 1D7FA 1V7MH 2AJVH 1KC5L 1CT8A 3E8UL 1XGQA 3ZE0E 3RJDA 3O2DA 4Y4KB 5H35B 4BFEA 4FABL 5HHPA 1A7NL 3MYJA 5DJAA 3MPCA 1OAXH 4JPKH 3LKNB 1RU9L 3K46A 1LDSA 5K9JL 1RZ7L 4YPGB 5CAYB 4ZFOA 1AE6L 4HXBH 4JO3H 1X6LA 4YK4C 4G6AD 3VFMB 3ECBB 3TA3D 1VFMA 1RZ8A 4GAJL 5ACZB 4N0RA 4FQJH 5GRVK 5T1DL 3FQWA 3TN0C 3ZKNC 3C5JB 1IC4L 4K3JL 3BPCA 4ZNCD 4XPAL 4NQDB 2VXTH 3WKMH 3OKNA 3IVKB 1A21A 4OBRA 3MLWL 3MRFA 2APBA 4D0BB 1MLBA 4LCUA 5ACMA 4ONOA 2AAVA 4P5TA 4MA3B 4OFPA 1JF1A 4Y8DC 5IHZB 4U6HA 5J9PA 1JUFA 3GHBL 3IS0X 2VR5A 3DX7A 3HMXL 5C9JB 3EZ8A 3JVGA 1QSFE 1HHIA 4BUHA 3QBTB 3QJFA 1D9KB 3BVNA 2X1WL 3HNSH 3HC4L 1IAKA 3NIGF 4XC3L 5IKCA 2AS5M 4P23A 4GRMA 4KI1A 4OCXH 2YWYA 5DDHB 2DYPD 2HRPH 4FNLL 1W0VB 1DFBL 3OV6A 1WFOA 4EBQL 5DMKB 2MQCA 5IVOA 1J9CT 3B9EA 4I0PC 4X80L 4KC3B 3OKLA 3OR6B 2WV3A 1CXLA 1ZLVK 4D3CL 3MNVA 4PRAB 1ZGLP 4KQ4L 5E6ID 1DUYB 3MODH 35C8H 2OQJB 1IEBB 1JWSA 2VLKE 1MJJA 4JFFB 1AXTL 3C5SA 1IGTA 4QRUA 5SWZB 3IDXH 3QUKB 1JGVL 1OVZA 5CD5C 5F21B 4ONGH 3T0EC 4ZDHA 3HNTH 3TIEA 4X6BA 4X8JB 1O0VA 3QB7C 2DKMA 5F9AC 3MV8D 1JZ2A 4J4PA 1KBGH 4X4XB 1NFKA 2V2WB 4Y4KC 4I2XA 2BNRE 2V2TB 2ATPA 1AY1H 2OR9L 3KPNA 4WW1A 1N5YH 3MV9A 4PRHB 1P84J 4KUZL 1R3HA 1XCTB 4MCZA 3TCLB 3QDGE 4QRRD 4LSDA 4NO0D 5I1JL 2OTUB 5LGJB 3BX7C 3MACH 5FO8A 3H6JA 1FG2A 1PFCA 5DJ6B 5FA3A 2PYEA 4G6KH 1IVLA 1YEKH 1P4LB 1OTTD 3UTPE 1AD9B 1JF5A 5DEFA 3WJLA 3BP5B 1U91A 3KPPA 4Z5RA 4MWFA 4GUPA 2EYSB 2EDLA 1FE8H 2FH6A 3P4OB 2G9HA 4OLUH 1MVUB 3FT3A 1XF5A 4OLEA 5T5FL 1CGYA 2GFBB 4QXTB 3EYOA 5B38A 3BSZL 1NMAH 2R2BA 2IADB 5IESH 4L3CB 4XTRD 2HJFA 3BWAA 3I75B 3QAZC 3SDXE 2K3TA 5CJXC 2CUIA 1UB6A 4WCYL 4YHOH 4OQTH 1YY8B 2G5RA 3G6DH 4XP6L 1IGYA 3MLVL 1F2QA 1UCTA 2VZOA 3A6BL 5B22A 1ZANH 2B5IB 4IOIB 2AVGA 2V7NB 1GGTA 4D94A 2FWOB 5L88H 2G2RA 2VN4A 5GJSL 3EFFA 3L3JA 1G7QA 4M93C 1KENL 2Z31C 3PF2A 4AQOA 2V2XA 3LOWA 3TO4B 3DMMC 1KNOB 3CZJA 4HMDA 2LVCA 5DHYA 3U0WH 3M8OL 3T04D 2CRIA 1UM5L 1AGFB 4YBLB 1KV3A 1PGRB 3B9KC 5KVDH 2FZ3A 1KCRL 3BQUC 3MRJA 3F65A 1DE4A 1E4JA 3VXUE 1N7MH 4PV9B 1GGCL 4R9HA 1IAKB 5GS0H 1JPTL 2FX8H 1G7PA 1U2CA 5C0IB 5CBAA 1T1ZA 2X4TB 4YXLL 2HFTA 2WUCH 3MRNA 4LPXA 3FN9A 5AWNH 2A77L 2PXYD 1W0WB 4WI2A 4W6XB 5INCA 3GI8H 2VLRE 4HULB 1FG9C 2HT3C 5FB8A 2A73B 3MCKA 3RKDC 1ZSDA 5LWYH 5I1KH 3T1WA 4JM2F 2ZNXA 2VZSA 2BSSA 3FHQA 3UTPD 3AUVA 5J12B 4HUUA 4U1KA 3CCHA 3VCLA 4EOWL 2BZDA 3CLFL 2BP3A 4IMKC 3IGAB 2VH5H 3GGWB 4BSWB 1KCUH 1HHGA 4XHQA 1UCBH 1NBZA 3SDDC 4QTIL 3KPOB 2JF1A 3I50L 4UDTA 3X14B 1WAAA 1CFBA 4H1LH 3QIUC 4HK0A 5CD5D 1WCBB 3GMOB 5E8PB 4G3YL 2QQNH 3ULUE 3G04B 3QEHB 3AS0A 3C5ZC 1MCWM 5JNYB 1LNUA 1EEQA 4PJIA 5FHAL 3M1BA 1BGXL 1A2YA 3GSUA 1T83A 3PIQA 1N64H 4Z77B 5DJ6A 4LU5H 3TVMD 4P2QE 1J0ZA 1E4WH 1P53A 1A1OA 2OTUA 3VXTB 1P4LA 4KMLB 2FX9L 4ZO9A 4JFPA 5CBEA 1M7DB 2DIJA 1CGUA 1FGNH 4X7TB 1OM3H 3L95A 4XRCA 1HCVA 4W4OC 4H8WC 1IT9H 3X11A 3TBWA 5F1OB 4WHYH 2Q8BH 4XVUD 3V4UL 1JZ4A 2F5AL 3K81A 5BW7A 4G8EB 1Q0XL 2KL6A 4HFUH 1JIBA 4XCEA 4KKAC 3SQOH 5IJKA 2Q76B 5TE6L 2Q7YB 5I17B 4OIBA 1AGBA 4UIMA 5DJDA 5HI4C 3SY0B 4CBPA 1JP5A 2VDLH 4OB5H 1S7SA 4WV1C 5E4EC 1DQJA 2YPLE 1AIFA 3P77A 4XVJL 5GIRA 4F2MB 4FP8H 3QQNA 5GGVY 1J0KA 4OIIH 1X5AA 4ZYKA 1D5MB 3GSQA 1RAMA 1R3LA 1HCFX 1WICA 5IEHB 5I8OH 2UYLA 2R0WL 4NJAH 3WN5A 2HKFL 3ZDYE 1FFOA 3VRJB 2K1MA 4PJ5E 4HIIA 5E24E 2NY4D 5EIIB 1Q72L 4OCRL 3MYJB 1J1PL 1M6OB 2UZYB 43CAB 2XN9D 5FYKU 3REWA 1C5BH 1RJLA 5MP6H 4YBHA 5CJOL 1DLHB 1UYWH 4LGSB 3GO1L 2BVEA 4R96B 4NCDA 2CLZA 4LVNB 4PB0H 2D7TL 3C8DA 2KZWA 4UUJA 1BWWA 1MHPL 3RY6A 3LDBB 1FAIH 4R90H 3D3VA 4QXUH 4XI5D 1N2RA 3BXNA 1A47A 3NIGE 4QRRA 4K3EL 4C56E 3OXRA 2NY5L 4S11A 4CVXA 4OAWA 1VCAA 3NVQA 5A1AA 4PLJD 1S8DA 4HKBA 2P5WD 4U1JA 3F7VA 3D69B 3V7MA 2QR0B 3REVB 3DXAA 1T6WA 4Y5XC 5FCUL 5J9PB 5GS1C 1T3FB 4H5SA 1RY7B 1UJ3A 4LNVA 4UV4L 4XC1L 5DJCB 5MHSE 3DX8A 4X9HA 1CF8H 1JHTA 4P46B 3SDXB 3RWIB 1P2CB 5EOCL 2VL5B 4ODUB 5KANG 3VWKC 6FABH 5ERWA 2NY0D 3I6KA 4P2RD 5F9OL 3FONA 3PDOA 4KK5D 1LEIB 1BVKB 4HW6A 5JPNA 1QLFB 4DGYH 5HGDB 3DHMA 1TLKA 3DUHA 4HIHB 4XCCH 5HD8C 2GY5A 4NKOA 3TNMB 1EHAA 3FT2A 4JG0H 2J8UE 1X4YA 3D87B 2R69H 4LF3B 5ESVA 3HKFA 3EUUA 3HZMA 5GISH 3E6HA 4LK4A 4XXDB 2P8MB 4MD0A 4S1DC 3TZVD 3K2UH 4P49A 3EYSH 1MH5A 2W9EH 2ED9A 4KTEH 4Z0BL 4P4KC 3NZ8B 2R0KL 5DD5L 5LAXA 1PKQA 1JF6A 3QIWB 3L1OL 3OAZK 32C2B 4M9OA 5EZIL 1OLZA 3LB6D 3P0YH 4KTDH 5EUOF 2ZCKL 1YMHB 4PTTB 4TRPL 3OBAA 4Y5YC 4CVXB 3VFPB 1T66D 3U7WH 3MGTB 3EJZC 3RGVC 3P11H 4I18C 5HHMD 3U2SA 5GRVL 2P5EB 4HUXB 4NBYB 2B2XH 3KVQA 2CLVB 1D9KD 5K33A 4YJZL 4LCWE 3OKKA 3TIEB 5ANMB 4GAFB 1FVEB 1NC4D 3ZMRA 3O6MH 2EZ0C 4RCAA 2R69L 4LLMA 1D5MA 2A77H 1JTPA 5FOJA 5E95B 3VFNB 2PCPA 1ZT1A 2Z8SA 3G6AA 1HILA 4PB9L 3WL9A 2GT9A 3WIHH 3NCJL 2FX8L 4HIIB 2GUOA 5GS0L 3VA2C 3QCVH 4DN4H 2YUVA 3FO1A 4HIHA 1IEAA 1KCRH 5TQ2H 2A9NL 3IETB 1KFAL 4FFWC 2EDDA 3P4NB 2DKSA 4Y16A 1FJ1A 4TNVK 5JPMB 1B90A 1KJ3H 4PJAA 1YNLH 3HLAB 4RIRA 1CLZH 1HHHB 3GI9H 3PWVA 3IDJB 1GGBL 1IAIL 5D2NA 3BP7B 3RU8H 1OAYL 3DROB 3U36A 2Z92B 1A7PL 3FFDA 3H8NA 2FD6L 2DLEA 1XGTA 1KIRB 3QJFB 2DWDA 4PGBA 4ZG1A 3B2UC 3TVMA 2CH8A 1C16A 2OL3A 1ZLWH 1AGDB 4QNPF 4PRPD 3ULVE 3TIDB 3O0RH 4OCYL 2NX5B 1XH3B 2FATL 4LCWA 2FYYB 2AJUL 4Y4HD 5B39G 4L3EB 1OTUD 4OLUL 3H9HA 3RA7H 3CDGA 3VXSE 4YHLL 1SYVA 3NCMA 3TEUA 2X6MA 4X6DF 1NL0H 2JELH 4MQXD 1UJ3B 1R5VA 1JN6A 3BRFA 4WEBL 2NTFA 4EQ2A 1RHFA 4OZHA 3WUWB 4P9HH 3LQMA 4E0RA 5D7KD 4Z7OF 1EJOL 2VE6A 4IRSB 4WUKH 4O2FB 1YY8A 4XMPH 5IVXE 1Z5LB 1ZGLB 4CU8A 4X8JA 3VFRA 5D4QA 4HZLB 1RZGB 3PJSB 1Q8MA 4BZ2H 4JANB 3QUZC 1XGQB 3ARDD 1D6EA 1S5IH 5DD5H 5GRXG 4DKEH 1T1ZB 2H1PL 4P2OC 1DANT 1HHKA 2GJ6B 2H6PB 2OR7A 4FXGB 4CDHA 3EYSL 3TT1L 3CCHB 3L3IB 4QLRA 1NJ9B 2WUBH 3EO9L 1NAMB 1MF2L 2OM5A 1NFIB 4XNQA 2AJ3B 1DQDH 3AREA 2Z8WC 3S97C 5E94A 5IBUG 5DVNA 5I1IH 4X4YB 2FZ3B 3BW9B 3KXFD 2VJXA 2C3VA 2P49B 3O8XD 1T2XA 1IT9L 4XBGA 3O81A 2PO6B 5BRZB 5BZDA 3MJ9L 3T0EA 2FIKA 2W0LA 1Q1JH 3OF6A 5CLTA 1KTKE 5CGMA 1A6ZB 35C8L 1RZIA 3UJJH 5IW1A 3OKEB 3KPMB 1EEZA 1ZT7B 5TDPB 2PN5A 4WFED 2F54E 2EDHA 4WFGD 1U8HB 3UBXB 4HIEB 1KIPB 4Y4HC 1HQ4B 3Q48A 2VXSH 4X8XA 2DJUA 4LSVL 3BAEH 2QQNL 4C4KO 4C54A 3BQUD 4XMLH 3GSRB 3S37X 4RNRA 1F42A 2H1PH 4OZHE 1PY9A 5TJWK 4ELKB 1AO7B 1IGJB 5HVGB 5C8JA 5DK0B 3KPOA 2VH5L 4ZSOB 3PABB 4N5UA 4MNQB 4GRLA 4K3EH 2E5EA 4EOWH 3VXME 1K8IA 5DUBA 4GS7B 1OLLA 1MHPH 5IB4B 5ID1A 4TVPE 2D7TH 4FXKA 3KPSE 4ONFL 4OUOA 4JFDD 1Y6NR 5D72L 2YR3A 3MRMB 4I0KA 1MUJB 3GO1H 1R6VA 4I9WE 1BFVL 3TYGL 4LLVA 2B4CH 3MROA 5MP6L 2ADGA 4ODWA 3AFLA 4PRIA 4LNRA 4XPGH 4NBXB 1NMBL 3QISA 4K3JH 3UJIL 4DGVL 4QCIB 1LO5A 4YXLH 2D03L 1B4JH 4FQJL 2FHBA 3DGGA 4XBGB 3NMEA 4J7RA 3WN5C 3HNVH 3HS0B 4JN1L 5E0QA 1Y0LB 1AKJA 5ENWA 1FNHA 5GS1B 4NRZA 3VXRD 4RRPG 1QSED 1G7PB 2HKFH 2WLZA 4R3SA 1LD9B 3ZSSA 2XFXA 4XPFL 4JPWL 1RZIB 4XGZB 4NO5A 1PLGH 1ETZB 4TSCH 1YYLL 3MGAA 2O5XH 2X1XR 5TH2A 1IAII 3ULSB 5AD0B 3DRTB 4GXVH 4ALAL 4AEIH 4NJ9H 5FYLH 1JNNL 3BKMH 3F7QA 1EFXB 4G42A 3K4ZA 1S7QB 1ES0A 2DQTH 3LH2H 3HRZB 4W6YB 3DBXA 1GGIL 1HWGB 1QHOA 2VE6B 3ARBB 1KJ3L 4NQEB 4MJIB 2YPVH 3BKJL 2VITA 5B4MC 1ITCA 4WO4C 4OQTL 2YD1A 1ORSB 4YPJA 2YD5A 3EDDA 4IOSD 2VXUH 1NMCC 5IROA 2ICWI 2XA8H 4P5TC 3HZVB 4KXZI 3W0WA 1F4AA 2WBWB 5B38B 1KJ2B 1MHHA 3WFBH 1ORQA 2HFEB 4ISVA 4LKCA 4ZS6D 2XRAL 1ND0B 2QKIB 3HA0A 4QHLB 3RVXD 4RFEB 1T04B 4JJ5A 4EVNA 2DDQH 5KBNC 2HN7B 2E7HA 3WUZA 3NTCH 4EZMA 4JLRA 1OB1A 3C6LB 4N9GA 5J11B 4TVPD 2YK1L 1FYHB 3NAAH 5BRZE 1UACL 5C7XL 1KB5A 3H0TB 1BBJB 3D9AL 4HK3J 5BZDB 5EBGA 2NX5E 3OKEA 4F15C 2V2WA 3UTSD 2B1HL 4JREB 3BD4A 1C12B 1NC4A 4HC1L 4KI5D 1OW0A 3QUZB 1ZLWK 1QUNA 3IU3B 5D1XA 1I3GL 5C6TL 3OX8B 1MRFH 2IEPA 1KULA 1UM6H 4POYA 3T08A 4K55A 3QUYC 4GO6B 3ZT5A 3QQ3B 3QXWA 4I3RH 5FOBA 1FH5L 4AIXA 3PG2A 3X13B 3QCTL 3DO7A 5CJXA 2FO1A 3VXQB 1TZGL 3WFHB 4JE4B 3JTTB 2EIEA 1UB5B 5FV1L 4XCCL 4MJ6B 5IB3A 4RFOL 3FT2B 3ZKND 3G5VB 3CZFB 3OJ2C 2P44B 3CH1A 5DTFB 1FVEA 3ARFC 3ZKSD 1ZLVH 2ADJA 5EOCH 4XCNA 3WFEH 5IFHH 5EBWA 4DVBB 3RDTC 2P5EA 4G9FA 3EIFA 1S7TA 1CQKA 1QG3A 2AQ3A 4MD4B 3ZTNH 3EDEA 3BZDA 1UGNA 3CSYA 2VLLB 2CDGB 3VWKD 2HLFD 4G8GE 1HI6B 2PKDA 2CKBL 2SEBB 1BZ9B 2XN9A 1JHKL 4I0CC 3EJYD 4WFFE 4WJ5B 3R8QA 4CMMA 2A1WH 2X1QA 4P23C 8CGTA 2NY2D 3QUML 1Q38A 5IMKA 4CNIB 3C2SA 1PAMA 3FB6B 4ODXA 2UV3A 4ODHL 2X4OB 3DROA 2Y9RT 3NZHL 1VFAA 4PD4K 1BD2B 1CXKA 4IEFB 2JB6B 5DD1L 5ICZB 3ILPB 3IAPA 4WHTB 2JIXB 3BUYA 4JVWA 4NQEE 5C70A 5FYJH 2MSPA 1IC4H 12E8H 3L5WA 3HG1E 1A6VH 5IR1B 4FQLL 2YEZB 1I8MA 4GT7A 5LXGH 1QRKA 3LQZA 3MXVL 4LCWB 2F53B 1L0XA 4O9HL 5B8CA 1JWMB 2HT4D 3IDUA 3L3HA 5E8OB 5C08D 3ZDYF 5B39A 3HB3C 5BOZG 1JYWA 3ZTNL 4H1LG 4FP8L 4X9FA 1Z0MA 5I1JH 1CD8A 1TTFA 5JDSB 2Y7QA 4GKNA 5KSBF 5HHPB 1VA9A 4ZUSB 1IGIL 1X5HA 2B1AL 3WFEL 5IFHL 5C9JA 1MHHB 5ICYA 3IB4A 4I18B 5TF1H 3WDHA 3RGVB 3H9HB 1XGTB 4AH2A 5DSCB 2XN9E 1Q0XH 3O6LL 2DJ4A 3OKNB 1VGKA 3GBNL 1A6AB 1H3VA 3HZYB 3HNTL 1AGCB 1QFHA 3VU2A 4HIJB 1P4IH 2G75A 4U6YA 3TWCL 2W0PA 5EU6D 1KF9B 1RUPL 3QCTH 2NZ9D 3TM6A 2P8PB 3B8SA 4X7FC 1NGWB 3F12A 1DDHA 2FEEI 3H7LA 3S7GA 3V6OC 5E00A 3CFJB 4URTB 3EOYG 1RHHA 4L3AA 3REWB 2AJYL 4N8VB 1CE6A 1CLOH 5HTSA 1S7RA 3DVFA 4PJCB 1IC5L 5CSGA 3C5ZA 1A1OB 5E2JA 2VDNH 4JFZL 4KDWA 3KLHD 1V8HA 5D96B 5E99L 4KVCL 2DQFB 4P4RB 5CGTA 3WIHA 2OYPA 1G7HB 5D7IF 2WBKA 4X5WA 4MXWL 4G3YH 3RIFF 3MNWA 1D6VH 3GMNB 5T3ZE 1ZS8B 2CIIA 4GRWH 3FO1B 4PRPA 4LHUG 4LLDA 3GJFB 1KG0B 3R06B 3NTCL 3VD5A 3HCVB 1L6XA 5DTFA 1TZHB 4NCC2 3UTQB 2AJSH 3NPSC 4P2RE 5L0QB 5F8RC 4KROB 3HMXH 4LVOB 3GHBH 4PLKD 5GRYA 2PW2A 3KJ6L 1JPSL 4JHAL 1HE7A 3KYMB 2DQCL 1MFEL 3P0VH 1WBXA 3SY0A 2BNQD 5I30L 3I2CH 4NPYA 3GI8L 4P2OD 5C0DA 3SJVE 4Y16D 2SEBA 1P5VA 5EUOA 5F7EH 4FFYH 1BZ7A 1J8HE 4JQIH 1FVDA 3SCMC 5ESVB 4FFVD 4XVTL 5TPWL 4BFIB 1TQBC 5MEQB 4W70A 2R2EB 5DS8A 4ZTPL 5FUZH 2O93L 3QUXB 3PWPE 5FGBA 3V5HB 5ADOL 2CIKA 3WYRA 4JPKL 3D3VB 4XXDA 1SJXA 4NKIH 2DD8H 3N9GL 1HIML 3OZ9L 4PJIE 4Z0XA 4NC1E 1FFPA 4YBQD 5EWIH 4JEGB 5ADOH 3KNBA 5KVGH 2AEQL 1F5WA 1F00I 5I1DA 2OP4H 3MMEA 4FZEH 1GGUA 1G7HA 5EN2B 2O61B 3C09C 1QSFB 3B6SA 3MV9B 4PRHA 5DHVH 4P59H 5ISZA 1HSAA 2YD9A 5SWSD 4QYOB 3P30L 1U8LB 1CBVL 2I25N 4XX1G 1CDYA 2IFFL 3AM8A 3PE9A 4XP6H 5CIPA 3GJFA 1FN4B 1FYTA 1NSNH 3HR5A 2CPCA 4XP1L 4D0DA 4E5XA 4HJJL 4OI8A 4JPVH 2VKXA 3RX5A 1I3RA 4MSWA 4KJPD 5IESL 5D7JC 1MQKH 3EDJA 3U0TB 1JL8A 5KSVB 4H5SB 1WV7T 2DQDL 2XTLA 2EDOA 3WJLC 3UO1H 2YPLA 5GGUA 5FGSA 3SJVA 2HMIC 25C8H 1MJJB 4A6YH 2UWEA 3O2WL 4HWEH 1E4KA 4QOKA 1P6FA 2GYSA 2IGFL 2VXVH 4H8WL 4OF6A 4OZ4B 1CR9H 2MOVA 1UQSB 2HT2D 3MRNB 3BDYL 2GHWB 3QI9C 3WIFB 5DFVD 1L9NA 1D6VL 3O2DH 5FO7A 5JUEH 1G9EA 4Y2DB 4L8DA 3BAEL 2VZTA 4B0MM 3SJVD 3PWPA 4F7MB 3U7AA 3MLZH 3EFFB 3D39B 3V5DA 3IDNA 3IDGB 2R0LL 3O4LB 1JGDB 3PWNB 2BY3A 4DK6A 2FB4L 3NFPB 4U1IA 1EEUA 3F6LA 5D2LF 2AJYH 1T04A 5EOQL 5C07E 1NGYA 1CFSA 4PRHE 1AR2A 4YIQA 1Q1JL 1QA9A 2UY6A 5F7NC 4NFDA 2DOCA 3ROOA 1OGAD 4UINL 1FFQA 3N85H 3LKRB 2WBJA 5TE4H 5IFAH 3EYFA 1OTSC 4YGVA 3TZVB 3OB0H 2ZKHH 5IIEB 4LSQH 3HZVA 2LAAA 4LL9A 4K7FB 4NO0B 1GAFH 5DUML 4UTAH 1T1WB 1FNFA 3KPRB 3IVKA 5IEKA 3MZGB 1MEXH 4L8SA 5TDOA 1UVQB 1ONQA 2FL5A 3EO9H 1MCQA 4UI2A 5D7JB 3CH8A 4KQ4H 5CWSA 4NT6A 5EOTB 1DVFC 5TF1L 1ZEAH 3MA9H 2XPGB 3CFDA 5CJQL 1K8DB 4JGMA 4OIAA 1MELA 2EEBA 4JQVA 2CO6B 2NY1C 5E1AB 3GRWA 3JUZA 5I2IB 1JGUH 3X11B 3ZDZF 4O9HH 2GT9B 3QWQB 5IHBA 5EORH 4RMWA 3SCMD 4PJ8C 4W6WB 2DQUH 1VKXB 4XC3H 3MRLA 5EBWB 3O6KH 3RVTD 4BH8A 3GIZL 3D39A 4OD2B 3V5HA 3D25A 5CD3B 3G5VA 3TO2A 3RGHA 2ZUWA 3EGSA 5L2JB 4PJIB 1JZ3A 2XTJB 2YC1B 4DQOL 5BO1L 1WAAF 4HUMB 1MQKL 4M4PA 2JCCB 3BW9A 4MQSB 2VITB 3TO4D 2IH3A 4HJJH 5I1LA 4LCCA 4HUWA 3AMLA 4JZOB 4WNQB 2DQEH 5E8DH 4H26B 4ZDHB 3SOBH 1U8LA 4NKQB 4KDTC 1XF1A 4TTDD 4KMTH 2IG2L 3WNPA 1H15A 4TNVF 3N06B 4ODTH 3OKDB 1BOGA 1YNKH 3SDAC 2VLRB 2EZ0D 5EWIL 4YDLC 2WWMD 5C3LD 5E08H 4ODXB 4MVBC 5F7KC 2LTQB 4IRZL 3WUWA 3KLHC 3DETC 3EO1A 4NC1C 2A9NH 5EDXA 4BH7A 4OD3L 5A3IC 5CKAA 4WW2B 5DVLA 5DEZA 1KB5H 1OARH 3QT2A 1KC5H 4WJ5A 1CDGA 3IU4H 3MJ8A 3RWDB 1T66C 4QOKB 4QXWA 5F1NB 1SYSA 3C8KA 4LSRH 4PS4L 1S9YA 2MFNA 3HI6H 1Q9LB 1F97A 4S1RL 1KPRB 3D39E 1I8LC 4J3WA 5IROC 1KOAA 5GGRA 5DMIH 4HS3A 4KHTL 1HQRB 2DQCH 2RCSH 4JHAH 4KVNL 3W9DA 4JR9H 3ZDXE 5EFIB 1V7NH 2FJFB 3CK0L 2WW8A 2NTSP 3AREB 4PBWD 3SKNB 1KPUA 3WE6B 3BPOB 4N8VG 1GSMA 1T7YA 1UT9A 4KY1H 4OQTA 2AW2A 5BVJA 1HH9A 4PLOB 4MA1C 1BIHA 1CFSB 3QUKA 1TENA 3L1OH 4N1HB 3IFPB 4Y5YA 4G42B 4KTEL 3QG6A 5FXCH 3CFEB 2VLRD 5HHNA 1HYSC 4M62H 5ACLA 1S5HA 3ARTA 4I2XE 4WI9A 2BJMH 4F9PC 1B88A 1G7IB 1M7IA 5FYJE 2VDML 2VDNL 2OJEB 3GMMA 2CDFB 1BQSA 5JXAL 4FFZL 4NHCL 3S4SG 3HC0B 3RTQB 4NNPL 4XBPB 2P5WE 3TBTB 3T65A 4WIQA 2EE9A 4OCWL 3WEXA 4DGYL 2BDNH 5I2IA 3MRKA 3V7AE 1BF8A 3IXAB 2XQYG 2BNUB 3MRHB 3NCFB 5I6XB 1R0AL 1I9JL 3BKJH 3VWKA 4Y2OA 1CQYA 1J1XL 2W07A 5D93B 2KQNA 3D0VA 2ENSA 4U0RC 5HYJD 5FCUH 2EECA 2BC4B 4LSSH 2E9WA 3ARGA 1K6QL 1NGZB 3U4AA 2I07B 4LVOC 2CD0A 3KYNB 1RUQL 3NZ8A 4KROC 5LAXB 3TFKD 1BLNB 1FVDB 3OJMB 4YK4B 3OXSA 5E1HB 1EHNA 5CINH 2P46B 1R5WA 2M26A 3KYKL 3T4AA 3ZDXF 3PL6C 5AG8A 3HNVL 2IPKB 4GRWE 2GAZA 5GPRA 3STBA 3PV7A 2XWBA 1VGEL 5ECJE 3O45B 3QCUL 4GKNB 3KWWB 5MI0B 2A6DA 3U0PB 2ADIA 1MCOL 3PHQA 5FCSH 2Z8VC 4U1MB 4YZFF 1HOCB 4HEME 3DV4A 3FRPG 5CS7A 5CLWA 1FIGL 3AGVA 3DSNA 3QDGB 4MJ6A 1B0RB 4Y88A 2FCBA 3CX2A 5C0CA 3QUMH 2R0WH 4NJAL 4PJEF 2G75B 4U6YB 4PG9A 4JPIB 4M7ZC 4OIIL 1KCKA 4UIMB 4R26H 5MENB 1QR1B 5IQ9A 5E6ZA 3TBVA 4YHML 3ZHKA 4GKOA 1CE6B 1TTGA 1YN7B 1HI6A 1LE5B 1YJDL 4V1DA 5D1ZA 5FB8B 1I3UA 1NPUA 4LSVH 3VFMA 3ULVL 1X44A 3RL2B 3DX9B 4RRPA 1IL1A 1N6QH 2WBJD 2Q8BL 3L5XL 3V4UH 1NBQA 5HYIA 3EYUL 4U31A 2YD8A 3QIWA 2E7MA 3IDJA 2YRPA 4MD5B 4KJYA 1MREL 3LD8C 1F2XK 2GK2A 4YWGL 3O3BA 1GC1H 4BYHA 1NDGA 1FNEB 1QLRA 3BRDA 4Q2ZA 4AENB 1YEDA 1WAAE 4CL7A 1OPGL 4Q6IB 4OFYA 3WHXA 3ZE2F 1INEL 4D0CA 3C8HA 5D6DC 4RMQA 2FYYA 1MQ8A 3GKWL 5GSRB 4J12A 1GJIA 3DUUB 4EUPA 1AFVL 3FRUB 1G9NC 4TUKH 2IF7A 4FQXA 3RWFA 4F37K 3PP4L 3RPKA 4P2QB 2JE8A 1SYVB 1TTUA 1SMOA 4HH9A 3VI3E 1NLDH 2X4NA 4UB0L 3AB0B 5DDHA 5C6PB 5HDBE 4P23B 1PYWB 2N4IA 4XMPL 2HWZL 1I8KB 4RA0C 1L7IL 3DVNB 2DMKA 3D69A 4U6VH 5C7XH 3NIDE 4EI5C 1UVQA 4XPTH 2XG4A 4XTRC 3O6FD 3BOVA 2C9AA 2V5MA 1HDMA 1OGAA 2BOBB 2DBLL 3JTSA 3LCYA 1RIVH 4X5XB 2JELL 2Z0BA 4KFZC 4M7JH 5FDWB 1KIQB 4FXGA 3O6FA 1EVUA 3AC0A 2IAMB 4K2UH 5EU6E 3THML 4D9QD 3SKOB 3UZQA 2P45B 1BHGA 4O00A 4Z77A 1T1YA 4CVZA 1RD6A 4YXHH 1XIWB 4UNUA 4Z7QE 3UXFA 4TNWF 1GGCH 5ACZA 1TVHB 3T4AB 1EPFA 5DFTA 3GJFH 1VB9A 3E3QC 3ARPA 2ATPB 3L3JB 1WWCA 1HOCA 3PP3K 1WTGT 3DYPA 3C6SA 1EGJA 2A6DB 5DD0H 4GW1A 3QXUA 1DLFL 2AJZB 1DSFH 4JM2C 4J3OC 3RU8L 3U46A 4D9LH 3OQ3B 3BKML 3MLYL 1TCRB 1JNNH 3PABA 5CKGA 4NJ9L 3JZ7A 1FL3B 2PYFB 3QDJB 4QRRE 2UWEB 4NZDA 3QFJA 3UYOD 3BH8B 1ACYL 4WHTA 4PGCA 1DQJB 1YYLH 1JNHB 3HAEH 1Z9MA 4OCSH 5TQ2L 4PJGA 4YDKH 1CN4A 1CTOA 5CZVH 5ITBL 2X9YA 4PRID 1A6UH 3NOIA 2RIKA 4FQ2H 4WFGE 2JK5B 4JKPL 5CHNB 2NR6D 5E9DB 1KPVA 2ZZUT 1DBAL 3FOMB 5IVXB 3FN3A 5HPOA 3FOLB 3MGOB 3P2TA 1OSZA 4PRHD 1Q94A 4DZ8B 3OKLB 1PD6A 1NMBH 1DTUA 3DVIA 4JKMA 3GB7B 1U92A 1XGYL 3QR2A 5C0FB 1BOGB 1BVKA 2BY2A 3ZKMC 2YRLA 5J6HB 3FFCB 1H0DB 4G8GA 3T8XA 3RGVA 2OSLA 4ODUA 5IW6A 3EBAA 1CICA 2EDTA 3DARA 4LSUL 4XVSH 4D9RE 5F1NA 1UEYA 2GTZA 3TN0D 3V0WH 1KJ2H 4DK3A 5L2KA 1MCSA 1WCBA 3OGCA 5GSRA 2Y6SD 1EO8L 4GRLD 3NFSL 5D6CA 1U0QA 4GBXB 2D4FA 4Y1AA 1ZKAA 2VWEE 3QA3A 3BDXA 2KQMA 3W9DB 3KS0H 5JOPE 3K2UL 2X4RA 4RZCA 2DQFA 4M5ZL 1MWAL 2ZUXA 2LABA 2P47B 2QADB 5TH2B 4NRYB 1DL7H 4DGIH 3FQWB 4NQEA 1MNUL 4AIZB 4PJGF 3CDCA 4RQQA 2ARWA 5GGTA 4NKDB 3NCCB 4YFDB 3WE6A 3EOTL 2DLTA 2YD4A 2CR6A 4GG6B 1EO7A 1C12A 1NC4B 5C6WH 5GZOD 5ALBL 3UTZA 3TC9A 4UT7H 1TZHA 1M7IB 1TJIH 4NRXA 2RJMA 3BE1L 3TT3L 4N0YH 4AYFA 4X7CC 5I1IL 5INDB 3MV8E 1CF8L 5L2JA 3QNYB 4X80H 5HHNB 2C26A 5DURD 5C09D 1MVFA 1ACZA 1EK3A 1DFBH 2VAAA 4KKCC 4UNVA 1NGQL 3GGWA 4QCIA 3R4DA 3L7FB 1UKTA 1A6TB 4A6YB 5BVJB 4KRPB 4OV6F 5D1QB 3T2QA 5L2KE 1GPOL 1N8ZA 1HH6B 3ARQA 3PXHA 4I77L 3OX8A 2QHRH 4WUKL 2D4DA 3BISA 3T2OA 2ZNWA 2FWOA 4HKJA 3PWVB 3QO0B 3MA7B 5DURB 1EJ6A 4PB0L 4PJAB 5BS0B 2W1NA 3MOQA 4HCRL 4D8PB 4MB4A 3P73B 3EYFB 5DRXA 4JDZA 3U9UA 3QUXD 5IW1B 5T1DH 3QZWA 4KXZH 1UH2A 4G8EA 5HI3C 4RAVB 1JYNA 3X12B 5EC1B 2HLAB 1KIPA 4QRPE 3QIBA 3ES6A 3VG0L 4I2XB 3S35X 2VQTA 4Q6IC 1AR1C 1KB9J 1ITBB 4OLVH 1ZT7A 2Y23A 1H3PL 1N26A 5KSBE 4XVJH 2ZUYA 5IJKC 3RBGA 1A7PH 4U0QB 3WIIL 4JO2H 3KPRE 3S36H 3DVGB 2XG5A 3G6JA 2J4WL 3IAGC 4JHWH 4RX4A 4QRUB 1UFUA 1GOFA 5GGVH 4XNUH 2X4QA 4WI8A 3RDTD 2ARJQ 3VXRE 2RAMA 1HNGA 1CVSC 5BJTB 4LP5A 5TFSH 4ETQA 1QR1A 2BRRL 1FSKC 2GJ6D 1R3LB 1CGWA 3FO2B 2I5YL 1G1YA 3QCVL 4DN4L 3HUJF 3OGCB 3PJSA 4LSTH 3WIHL 1KEML 4Z5RB 2J8HA 4OLZL 1L9MA 4NRYA 3WS3A 1HHKB 2GJ6A 2H6PA 3I6LD 2BFVL 4OD2A 1JRHL 2Y07H 4L4TA 2I5YH 5DC4B 5JIIA 3BHBB 3SGKC 4QHMA 4WNQA 5TFSL 2FJGB 4BQ6A 1FCCA 3QIUA 1CDJA 3N1GC 4PJ8D 3DMMA 5HGGS 2XT1B 4L1DA 4KRPC 5D1QC 2OQJA 1TQCB 3ROLB 4PJXA 3VI4E 1AH1A 4YIQB 1LILA 4GRWF 3EOAB 5EUKA 3HS0A 4U7MA 5AZEH 3EFDL 1RMFH 4PJHF 2LQRA 2UZIH 1OT2A 2QL1A 2ZJSH 1MFBH 1PKOA 2D9CA 1CZ8H 4LPWA 1OP3K 5I16B 3VFTB 4XI5C 3P0YL 2IANA 2G2RB 2CGRL 1ONQB 1P6AB 3W0WD 2YD6A 1XZ0B 3KPRA 1CDIA 1YQVL 3QEUB 4ZMAT 3LQAL 3ARGB 1KNOA 4Y2DD 3KPNB 3QXDA 4M1GH 4WTZA 1EDQA 4HS8L 1AGEB 2XYCA 3NH7H 2QADD 2J7LA 4LHQB 2VXQH 3VD3A 1H8SA 2H8PA 1JTTA 1LO0H 1WK0A 4IOIA 4R4BA 4DUWA 2NW2B 2X4NB 5HGHA 5DUBB 5IB4A 2IMNA 3LDBC 3U1SH 4JREC 3V0VA 4RIRB 2GJ6E 1DJSA 3MA7A 4NWTL 2EIZA 1EEZB 2MTPA 1LP9E 3FRUA 1RZJL 4DFIA 3I85A 3DYMA 4WWKC 1T80A 3RWFB 1IQDA 4OGYH 3ULUL 1KENH 1HINH 4ZAKD 1WWAX 3N1MC 3U2SB 1A5FL 1GZQB 4JLRB 2VRAA 4HQQH 2R4RL 3MGTA 5C0IA 4YQXL 5SWSB 4B7LA 1YMHA 4PTTA 4NO5B 3BP5A 3OKYA 3AAZB 4NYLA 5D5MB 1FHGA 3F7VB 4UOJA 1HINL 3A6CH 3MNWB 4Y5YB 4WV1B 2VLRA 9CGTA 1AHWC 5ANMA 5F3BB 1T7WA 1NMAL 3GSNB 5HVWA 4LBEA 5T5FH 4P2YA 1DQQA 5IMMA 3CC5B 1EERB 2E6PA 3MRMA 5D9SB 4HFWB 3GSVA 1C5BL 4LLAA 1QYGL 3HC0A 3J7HA 4X5LA 1VGKB 3RTQA 1Q72H 4OLXL 5HGDA 2FGWH 4L4VD 1Q9LA 1XGRB 2NY2C 5EZJB 5TE7L 3WHXB 4P2CG 1T7ZA 3MLXH 3STZB 3QH3B 1K85A 4M43L 2Q86A 5JIKA 1QQDA 2E7LC 3P4NA 3SO5A 1U6AH 4MNGA 4XX1E 1NFDF 3OJVC 1IBGH 3LZFL 1RZKH 4NQED 3GB7A 3P9LB 3C5ZB 4RFEA 4U6TA 1QRND 5JIPA 3RVWC 5IB2A 1KBGL 5F93C 3RL1B 3VG9B 4FFWD 1FFOB 1Q9OB 4XB7A 1HH9B 1RMFL 2OL3B 3VRJA 2LTQC 4G6FB 5I18H 5AZEL 1A7QL 2DWDB 4XVSL 4Y5XB 3VFWA 1XF3B 3GSOA 4NQVA 2BERA 1FNGA 3GK8H 1X5YA 2IAMC 3T0AA 1A7OL 1EO5A 3DTXA 1JF1B 4UDUB 4X7SH 1AXTH 1XH3A 4D0BA 1U8PB 4OLZH 3BGFB 5I16A 1DBKH 3F62A 4HWBH 1IZKA 1N64L 3D0LA 3VGFA 1KN4L 1BD2A 1HYRC 3DHJA 3BQUA 5FHAH 1JUFB 2FSEB 3W5MA 3VGDA 4C57C 4U1JB 1CE1H 3PL6D 4KWUA 1T03H 2MKLC 1F4WH 3RWGB 3U0TA 4S1SH 4PJDB 4M61B 2I27N 3LRSA 3GBML 4J3SA 5E9DE 1EVTC 1JJUA 4OF5A 1K9TA 4JPIA 4ZFOL 1I8MB 3T65B 1JPGB 4XCYB 3W2DL 1UCBL 2MPAH 1KCUL 4IIQA 4KK8C 1MRDH 1BF2A 1BQUA 2R1WB 1HKFA 1TPXC 5JDSA 4JCLA 1T3FA 4XAKD 3PWPB 1KGCD 5JPNB 1TMCB 3KHQA 4ELMA 4PJHA 4R8WH 3G5YB 4PJBF 4Q6IA 3SDXA 4LCIL 4NN7B 4RFNB 2XWTA 5FYJU 5AWNL 1R3KA 3O3BB 4NSKA 5F96H 1FV1A 5C0AE 5EU3B 4Z7WE 4GAJH 1T5XB 2UVEA 2A0LC 4GG8A 4ZS7H 1VESA 1MJ8H 2BHZA 1INDL 5T1KA 2APWA 1WEJL 1W8OA 3MR9B 1UM5H 5KVDL 1BD2E 3QG7L 4XPTL 1M1SA 1I1YA 2NZIA 4EDWL 4L4JA 1IGCH 3GZKA 1E4XI 4JFED 1A7NH 2WK2A 3GSNA 1XGUB 5JW4M 2A6JB 3WMSA 5HYSG 4LEXH 1AQKL 1GPOH 2X41A 1J1OH 5T3XL 4ZFZB 3E8UH 5I66B 4F3FB 1H5BC 1KJMA 4NQDD 3UPRA 3L3HB 4Z7UE 5E8OA 5B39B 2OJZL 3GBMH 3C2AH 1A8JH 4FOMA 4OLYL 1H15B 3WD5L 4TUKL 4ZUTA 1RJLB 1OGTB 3G08B 3RIAF 3MV8B 4CDGC 3HMXA 3PWPD 4QRQA 4QHLA 4PTUA 1TFHA 3O9WC 1FDLH 4ZO6A 3G6AB 2HN7A 2VDRH 3WL9B 1RZKC 4MQTB 3UTTB 3CPLA 3CUPB 4D8PA 1SJEA 4PJ9C 1OWRM 4BSVB 2GK0B 1QBAA 5I9QB 1NGYB 2X1OA 5EB9A 4ENEC 1SHMA 3RWJA 4L3CA 4UILH 3JBG7 3GRWH 4NWUH 2YMXH 3BXNB 2CK2A 1YEKL 1RHHB 5C71A 4G6KL 4NM8L 3BKCL 2VLJB 2J12B 3LSOB 1PZUB 3GHEL 3ULSA 4PG2A 2V2XB 3QYCA 3ZTJH 5FYKH 4FQXB 4D2NA 3MMEB 4PJCE 1U8IB 3RWCA 4JFDA 3DMMB 1EXUB 1U6AL 3C60C 4KZDL 4PJXB 3MLXL 2AABH 2YD7A 3V0WL 1SVZA 4PJDE 1FZKA 5DHYB 5DJYB 4PV9A 5C0CE 5J1TC 4LGRB 2V9QA 2X70B 4PRPE 4FMFA 5IB3B 4NQCE 5IUSA 5C0EA 5L6YL 3I3BA 4M61A 2HP4A 5E2VH 5MERA 5EUKB 2GJZB 3SKJH 1OAQL 4HKJB 4DVBA 5F7DB 4L5FL 4DZBB 5E70A 5T1LD 4HUXA 1WF5A 3EJJX 3HFML 2R2HA 2VZVA 4TUOB 3BEVA 3FFDB 3TCXA 1T0NA 5LCVL 5FKAA 1FC2D 1MVUA 5F6IC 3QJHB 4JVUA 4FTVE 1RJZA 5C08B 5GGRB 5HVFB 4I5BB 1A9BA 2FJFA 4X6CE 3QIWC 4RGND 4BQBA 4M8QB 1TVHA 4OCSL 5J6HA 3Q6GH 3RDTA 2VISB 1MH5B 3VCLB 4C55A 1EV2E 1XIWA 4R0LB 2DMBA 3V5DB 1W8NA 3VI4F 1GOGA 3V0AC 3WFCL 1L7TH 1CFNA 4Z7VB 3G04A 3QUXA 4Y8AA 4Z7VF 5IMOB 1DEEA 4ORGB 1JGDA 2XI9A 4Q9RL 4IRJA 1NUGA 1CGSH 1J05A 2HJKB 2AK4B 4U1IB 3EO1B 2A74B 2R2CA 3IDMB 5ISZE 4WW2C 3WSQH 4NOBA 4NQCA 1F4HA 3VFRB 2JJTA 4ZO8A 1LO0L 5DRNB 3RAJL 3T0EB 4E9LA 3DXAD 3MO1B 4M00A 1HN1A 2P7TA 4K8RL 4MB5A 4XNXH 2QJDA 3ALXA 3CUPA 4YHKH 5DVMA 1JPST 1MRCL 4ISVB 4LKCB 3GSRA 2OR8A 1OGAE 4TUOA 4NQCD 3NIFF 4JN2A 4KRNA 4PTUB 1OWWA 4KK6C 5FYLD 1S3KL 4K9EH 1DQMH 1UM4L 2EDRA 2AXGA 1VEMA 2BRQA 1N8ZB 1XMWA 1CICB 1CL7L 3TVMC 4XPBH 4O5LH 2HWZH 4PRBA 2C1PB 2VSDA 4HUKB 3TPUA 1P69B 4M9PA 5B38G 5I1HH 4X4MA 3D85A 5CSBA 1BJ8A 4NKOB 4WI4A 1V7ML 2VWEC 1GZPA 5L2KB 1JFQH 2NXZC 1S7XA 1AFVH 1M6OA 4Z7VA 1VFOA 1D5IL 3SKUD 4X9BA 4LRNL 4UBDC 4WU5B 5C2BH 3L5WB 2GITA 4G6FD 4QRTA 3V6OE 1A0QL 3QXAA 5D71L 3MRFB 3BI9X 1YEFH 5DWUL 5ICZA 3BVNB 3WHE0 4EQ3A 4TTGA 1DBML 1W72H 2E8ZA 5GGQL 2EKSA 4NZRH 1C08A 3DXAB 3VXNA 2DL2A 2OL3L 2VABB 1G7JA 2OMBA 1QHPA 4YE4H 3RY4A 2HVJA 4LCYB 4R4BB 3QHZH 3LN4A 1R24B 5BCAA 5E2UL 1G7QB 1CL7H 1N3NA 4NQTA 3MUGA 5ICYB 4JRXD 1N6QL 2VC2L 4JO4L 3NIFE 5EU4A 1DVFB 4PP2A 4K7FA 1S3KH 4K9EL 3TV3L 3AROA 5F7DA 4ODTL 2GFBA 4ELMF 1IFHH 1NCWH 2IC2A 4JANA 4XNXL 1QZ1A 4KHXH 2F19L 5DHXB 5J3HC 1YEDB 1D3CA 3ALPA 2DLGA 4MAYD 5KJRH 4HPYH 3IF1B 1AO7A 1DUYA 1IGJA 2DF3A 3UC0H 1OCWL 3I6LE 4S1QL 4W81A 4RBPK 3IJSA 2HT2C 4ZOEA 5IB1A 4BK5A 1LGVA 2AQ1A 1CGSL 2CXKA 4Q6YA 3F12B 4R97C 1NDGB 1HQ4A 1CFNB 4I13B 4GMSH 5L7XH 1RIHH 3QIUB 3JV6A 4WFHE 1PKQB 1KCVH 4HCRH 5IHUH 4X5WB 3ULUF 5I1GL 3U36B 1C7SA 1JNLL 1AGFA 4JDZB 4NN5C 3U9UB 4LQFH 2P24A 4NQSA 1BECA 1KTRL 4JQXA 4U1HB 4AY0A 4JDVA 5HHXH 3E2HB 4UUJB 4TOYH 5IT2L 3ALWA 3OAZH 4HV8A 3LEYL 1WZ1L 1WCQA 1AGDA 1FV1B 5IWLC 4AMKH 4KUCF 1EAJA 2EC9T 1QFUH 4MMXC 1QRNB 3IJHB 3WXWL 3OJDA 1G9MH 1K6QH 4IRJD 2BHYA 4PJ5D 1I9EA 1NGQH 5LCVH 1H3WM 1AQDA 3OPZL 2R56L 5IMLA 1T1YB 4UTAL 5DUMH 2PW2B 1RVFH 5HJ3A 3DX8B 2JJSC 1IEAB 1OP5K 4F3FA 5ALBH 1QOKA 3LKSA 1ERNA 4ZQKA 3MOAL 4Q0XH 1WIUA 2VZ3A 4AG4H 1MIMH 5D7SL 4UDTB 4TQEH 2FX7L 3KLAB 4ZUTB 5FM8A 3W11C 4OFIA 2Y5TA 2D0FA 3FOMA 1ZMYA 5SV4A 2NY1B 4X0KA 2NY0C 2XNAA 3PWLA 2Z92A 1NCTA 1Z2KA 1Y18B 1IM9A 1YUHA 1YEGH 4WI7A 4AEFA 3ARWA 1NCWL 1MWAH 3TPKA 4JFFE 4A2MA 3ARBA 4Y16B 3QXAB 4PYHA 3VXTA 2CQVA 2GITB 5SWZE 1TCRA 3IFNH 5KS9B 5GGRY 3C5JA 3VGGA 2V7HB 1F45A 1KYOJ 1OB1B 3C6LA 4N9GB 4PD4J 3TVMB 4U3CA 3SDXF 4M6NL 4WTXA 3VDAA 1CFQA 3T0EE 2WWKO 1B2WL 3B9DA 1ED3B 4KJWC 5GRJH 2ADJB 4MVBD 5DWUH 3HE6B 2ICWJ 1N6UA 2R1WA 4UQ2A 4MDIA 3G9VA 4PREA 4MD4A 2WLYA 4GH7B 1AQDB 5FEBA 2OSLB 4CAGA 4L4VE 2WBJC 4WI6A 3VG9C 2PR4L 2CDGA 2NY7L 5E4IA 3UX9B 5JXEA 2OJEA 4Q74A 4V1DD 1I7TB 2ZG3A 5D1ZD 1JN6B 4JY5H 2E7BA 4P59L 4HFWA 4HUUB 3QXVA 4X6EB 1KB5L 1UZ6F 3REVA 4FQ2L 4ZYKB 4CN6A 1OQOA 1DBBH 4U1GC 3U9PL 4Y19E 3F7YB 5DQ9B 5D96C 4LAQL 1OHQA 3HZKB 4EN3D 3HAEA 1ACYH 1IARB 1HIMH 1IKFH 2RR3A 5MENA 4O2CA 1A4KA 3UDWA 1MSPA 1BJ1J 3MLTB 2C1OA 2ITCB 3F58H 1HK6A 1WGOA 5DD3H 3JWDH 1KLGA 4LVEA 4U1HA 3IJYB 3FQTA 2AEPL 3W11D 2FGZA 5SWZA 3SOBL 1FNGB 3DX9A 3GSNH 4M8VA 3QA3B 5E8DL 1MAML 2VQ1A 2FIRT 4HD9A 4KZEL 4HG4J 4OAWB 2X10A 4BFGA 1AHWB 5JO5B 5GRUL 3QDJE 4QRRB 3I2CL 4S1QH 3UYRH 4JY4A 2YRZA 5F6IB 4KK8D 2ZSWA 4UV7L 5GRUH 3P9MB 3BT2H 2P8MA 1I8LA 5IG7A 4OF3A 1GHFH 3TCLA 3BJLA 1QSZA 3M45A 5EZOH 2OI9C 3OR7A 2AEPH 2V2TA 4P46A 1OTSD 1BIIB 1SM3L 1QFPA 2XQYK 5L9DH 5J6GB 2R1YA 1RK1B 3QUXC 1MFAL 4TVPL 3F58L 3OKMB 3DIFA 4OSUL 3VFGL 1IKFL 1L7IH 3SPVB 4MXWH 4ZD3H 3ORJA 2P8PA 1BQHG 5IR1A 3SDAA 2DLFL 1X5KA 3TBYA 3RVUD 3K80A 4HMEA 4JFZH 3SGEH 4NZRL 4TYUA 4YX2H 4XBEH 1IC5H 2H26A 3MCKB 4OZGB 1RURH 5IM7B 4PJ7A 5DFVC 2R15A 2P43B 4G8IB 2CKNA 3FB6A 4G43B 5I8CA 5DUPH 1GOHA 3VFWB 4ZAKC 1ZA6A 1P4IL 3QUMB 4NQXA 3TWCH 4F7TB 1BM3H 2WP3T 1K3ZA 5AAMA 4NKDA 1KG0A 3R06A 1JWMA 3MBEC 5GS1A 1GC1L 4OKVA 3GSWA 4K23L 2IPUG 4GAGL 2CRZA 2O5ZL 3BGMB 4K94L 2J3SA 3VE0B 4AEHL 1V5JA 4BM7A 3UAJD 1LO3H 1C5DB 2BVYA 4PYGA 4X6DA 3FKUS 4JZNA 3BPLB 3QIBB 4JRYD 4H26A 4L4VB 3MJ6A 1A7BA 3ABZA 4PGBB 3KXFA 4P3DB 1NBVL 1J5OH 4UT6H 2APVA 3F6IA 2K7QA 2R1YB 3JWOL 2AGJH 1W2KT 2W0FA 1XT5A 2C7UB 4JCMA 5D7KE 4X7TA 1CFTB 2ORBL 4A6YA 1G6RL 1UB5A 2EDKA 3DVNA 1TIUA 5DJ2B 2R1XB 5CBAB 3PDDA 3TBWB 3SE8L 2EKSB 2FX7H 4KKBD 4WGVB 2DQDH 5HHOD 1H3XA 2WQRA 4Z6AT 3MJ8B 3RWDA 2Q76A 3TFKC 5KZCB 1N3NB 1U3HB 1ZE3C 4YPGA 4WU5A 3FQRB 3FZUD 2F74A 5IHLB 4PJAF 5IBLD 4PRIE 1JHLH 3CFIC 4G9FE 4PUBH 1MCOH 2Y5EA 4RA3A 2A1WL 5KAQF 5F88A 3TNNA 1ND0A 2QKIA 2EEAA 4N8PA 1CBVH 4O2EB 4YQXH 1EIBA 1YEIH 4UQ3B 1TJHL 2BNRD 3TF7C 2JCCF 3WXWH 4HXAH 3B83A 3BD5A 4KJWD 2R9HC 4NRZB 1YEHL 2FHFA 1TPXB 2N56A 1I3VA 2BVPA 1I75A 3JV4A 3PQYE 1RUQH 4UAOC 4TOYL 5JNYA 2J1KA 4W4OA 5IT2H 2E9BA 5EBMA 2ZCLH 5FOBB 4F7CB 3KXFE 3FT4B 1JNLH 2VLJE 3VXOA 1BQHB 3ULVF 4ZS7L 5I1GH 3FHAA 5GS0C 3BZ4A 3LS4H 5CEXA 1SBSL 3RIAK 3T3PF 5C0EB 3UAJC 3LPGA 4P4KD 3WFHA 2AJXL 5EO1B 1CDHA 1NCDL 4RISL 4K7PL 1ZK9A 4MJIE 1W0VA 4I3RL 1WT5A 2Q7YA 4CN4A 3G6JF 4OCWH 1OCWH 1MFEH