4YHPA

Crystal structure of 309m3-b fab in complex with h3k9me3 peptide
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
222
structure length
219
Chain Sequence
b'EVQLVETGGGVVQPGRSLRLSCTASGFTFRDYWMSWVRQAPGKGLEWVADINPDGITRYYIDAVKGRFTISRDNAKSSLYLQMNSLGAEDTAVYYCAREFHSGLGWHFDLWGRGTLVTVSSASTKGPSVFPLAPSSKSGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords H3K9me3 peptide
publication title Antigen clasping by two antigen-binding sites of an exceptionally specific antibody for histone methylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 47
structure length 219
sequence length 222
chains with identical sequence C, E, H
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhpA02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhpA01
5FKAA 5IJKC 4UNTA 1F3JB 3HAEA 5GRWA 3FO2A 4M62L 4WI6A 5FGRA 1MAJA 1DSFH 2NLJB 5LBSL 1NUNB 4K3EL 3PHQB 4XP5L 4XPGL 3EOAA 1I1FA 2DQJH 3LZFH 3MV8B 4MQ7A 1INDH 1XGQA 4ZYKB 3MODL 4AMKH 4LOUD 4RISH 2BVPB 2OM5A 4HWZB 4LBEA 4F80A 1Z9OA 2NZ9D 4I2XE 4Z6AT 3VU2A 3LRSB 4TTDD 4JFDB 1HHKA 5CLWA 4BM7A 5IB1B 4OQTH 2OX5A 3CPLB 4QY8A 5D70H 3ULVH 2PW2A 1LDPH 2W60B 2ICCA 5E08L 3BO8A 4LRIA 1G7MB 5J7CC 3OXSA 1IQWH 4NWTL 4KI1A 3IXAB 2UWEE 5TPWH 3IT8D 3GUTA 3EYQC 1NAMB 1FZKA 1IL1A 4QYOA 1M71B 1JF5A 4YO0A 3SY0B 3H9HB 4R97C 4YJZL 3QIWA 5E5MA 5HVHC 4HSQA 2XA8H 1CL7L 4PJFA 1FVEB 1E4XI 2ADJA 4NO5A 3CVIH 1D9KD 2D2OA 3EYOA 2J1KA 4FS0A 1A7RL 4NQXB 4BH8B 3RWJB 1IC1A 3DRTA 3GEWB 4Z76B 2QQQA 3VGGA 4YDKL 3C60A 5GZOC 3IKCA 2X9WA 1ORSB 2XKSA 4OT1H 2XWJB 5I8KH 2W92A 3MOQA 3MLTB 3SKOB 5KSBE 1VPOL 2EYTB 4JRWA 4NFDA 2BK8A 3AM8C 4JDZA 4YX2L 4ONHB 2CGRH 5T33H 3MJ9L 1HILA 5GIRB 1QSVA 4OF7A 1U3JA 2HH0L 2DTML 3MRGA 4D9RD 1QFPA 4MLSA 4GRWH 3X17A 2JK5A 4JRXB 1TITA 5IEKB 5JQ6L 1J1OL 2WQRA 2VDOH 3HPLA 4PJHB 3UTSA 1V05A 3O6FD 1A6WH 5EORH 2Y5TB 4HJ0C 2XN9E 1A64A 1XF3A 4QRQA 1XFPA 3VXRA 3DLQR 2BNQB 1R3JA 2XWBA 3RVVC 2I9TB 4Z7WA 3MXWH 1UXSA 3CZJA 3CMOL 3W9DB 3QNYB 1QQDB 5K59E 4KKNA 1B3JA 4OF5A 3MR9B 5JW4R 3PWPD 4G42B 5ID0B 1OP5H 3CLFH 4PP1C 1GH7A 3AFLA 4PJ8B 2X41A 1YECH 5CJ8A 1BFSA 3MV9A 4IBLT 2GJZA 4KTDL 1QSFE 2OTUB 1KLFA 5I1GL 1FVCA 1RY7B 4RZCB 5IVXA 3BPOC 4DVRL 2X4OB 5HHNB 3UZEA 1ITCA 3H9SA 5ESAA 4PY7B 5JHLH 3HLAA 3WKMH 1ZGLM 5C0CB 2X4SA 1FE8L 3TBVA 1RPQA 4O00A 4NM4H 1XGTA 1W8NA 3GRWA 1CLYL 5ESQB 3V6OE 3SN6N 3CDFA 3CFEB 4I3SL 4JFZH 5F96L 4P2RA 43CAB 1XMWA 2NMSA 1WT5A 1YMMA 5M7QA 1HHIB 4ZS7H 2EIEA 2CDEA 4JFOB 1S7QA 3BESR 4X98B 1DVFB 3RDTC 2JJWA 1E6OL 2J8UB 4JO1H 1RVFH 2YUWA 3D0LA 4OTXL 4UDUB 4O51B 1NBZA 5DJ6A 2WWMD 4JKLA 3PWLA 1XGRB 4OUUB 4PBVC 5D1XA 1CE6A 1A1NA 4U1NB 2NW3A 5EZJA 2HKFH 2IANE 4M1GL 4YXLL 4KHXL 3WD5L 3G6JE 2VNCA 4YHZL 1A6TB 1J05B 1DBKL 4LKCA 5DD0H 4JY5L 3BP5B 3NPZB 2DQUL 3PHOA 3VA2C 4M7ZC 4PJGB 1HQRA 1RMFL 1YY9C 4UIKL 1QVOA 2DL2A 4U2ZA 1KN4L 4MA3A 1ED3B 4IMLA 5C0ND 3QZWA 4PLNC 1DQLL 3MRFB 4NC1E 4Y1AA 2PR4L 5T3XH 5MEQB 4OD1L 1CICD 3BE1H 1QFWL 4GBXB 1ADQA 3B83A 2WSKA 3ETBF 1TQCC 4PRIE 3NFSH 4RMTA 4D94A 4ZAKB 1T7VA 1EAPB 3FCTA 3T04D 1CI5A 5T3ZD 5FYLL 4EN3A 3C8HA 4RFOH 2UUDH 4MA8L 3SE4A 4TOYH 2PYED 1ZWIB 4GW1B 4U6TA 5JMRA 4HBQA 4JHZA 5CJQL 5EA0L 4ZFOL 4OLVL 1P2CB 1SJVA 3ARDB 3GJFK 4WO4C 4WNQA 1M6OA 3GJFA 1IKNA 4LP4A 2A0LD 1J0YA 2X4PB 3MLWH 4ODUB 1YYML 1YDPB 3DO3A 4PRPE 1LP9F 4ALAL 5EBMA 1AGCA 1FYTA 4L3EA 2XNAB 5CZVH 4MNHA 2VQ1B 2E7LC 1J0ZA 2HJKA 4OZIE 4ZDHB 3IDMA 5C71A 3G6AA 5T5NG 3D3VE 1C5DB 3BPCB 4I0PA 1WIOA 2N7BA 3QPQD 3MA7B 5JTWA 5ID1B 4XP6H 3TVMA 2GAZB 5K9JL 4DAGL 5C0AB 5LG1A 3VXTB 5FKPA 1IGIL 1RZ8A 2AJ3B 4UQ2A 4XVTL 1NC2D 4M7KH 2ZUQB 5D1QA 3BVNA 4LLQA 3N9GL 2Z4QB 1KB9K 2XZQH 1OHQA 4HDIA 3S4SA 3RX5A 1D6VH 2VB5A 1F00I 1NC4A 5F1IA 4HS3B 4LLDB 4MCYB 4NZRL 1NFKA 3EIFA 1YYLL 1TVHA 2APFA 2P24B 3O4LE 5DF0A 4R4FL 3C9NB 1LE9B 3L3KA 4U0RB 4JY6B 5DVLA 5EIVA 1ONQB 3L5IA 2DYPB 4LVHB 2AJUL 4QHNA 3BD3A 1JNHB 3T0EA 3AXLA 1A6UL 3KLHC 1KCVH 4QXGL 4WFGD 1IGYB 3C5ZC 4CVUA 2A77L 3Q6GH 4HC1L 4H8WL 3EDFA 2C1OA 4TUKL 3V6ZA 2YUZA 4NQCD 5IB4A 2XYCA 5E1AB 2P7TB 1SVZA 2FZ3B 5I76B 3GMQA 3IXTB 3NCBB 5HHXH 1D5MB 3FO0L 5JPNA 4HK3N 4CADB 1IC5L 2F5BL 3O8XA 3WNKA 5CJ5A 5EO1B 1JFQH 5IMLB 1S9VA 2JJVA 1F45A 2ATPB 4NHUA 5EZIL 4U6YA 4MQTB 4G8EB 1RUMH 5HI5C 4EVNA 5J57B 2GK0B 3RWGB 3LKPB 5I30L 1NGQL 5D9SA 1Z6JT 1YEIL 1Q9OA 3NIFE 4ODXA 1QZ1A 1OAZL 5KSVA 1WZMA 1FNSH 1I8IA 4OD2A 1U8KA 1AXTH 4PGJA 1CZ8H 4WHTA 2BY3A 5ILTH 5IF0A 1U58A 4KVNH 1S7VA 5I1HH 4Z7VE 3TV3L 2JIXA 4QEGA 5DHYB 4R7NB 3UTTB 1IM3B 4UUJA 4WWKC 4S10A 4YK4B 4ZS6D 1B4JL 5D5ME 4Z0XA 4AIOA 3LB6D 5DYOB 5F3HB 5AAWA 1RK0B 4U6VH 4YFEA 4G8GA 3I02B 5MEOB 1XGYH 2B4CL 3LQAC 3JWDH 2JELL 4PRNA 3F8UB 4MXWH 4M6OH 5BS0A 4Y4HC 5ADPL 3VWJB 4Y5YB 3O2DH 3VI4F 1DEEB 5A1AA 2EICA 4R4ND 1VFMA 5FA3B 1DL7L 1ZLUH 5MP6L 5ANME 5F7YC 5IJKA 3PGDB 4TVSa 3QWRD 2CRYA 2E3VA 3QJHA 2V6HA 2YR3A 4HIHB 3CH1B 4X6DB 3DV4A 1U36A 4OCLC 5I1IH 4KJWC 1J1XL 2DQJL 4KUZH 1QLFA 1INDL 1YNLL 1KPUB 4P2QA 5FUCE 5FO9B 3EGSB 4RISL 4AT6B 1J1PL 5B8CC 4CVXA 4DEPC 4JQIL 5JOEA 2IADB 3UBXB 3AB0B 4FQLL 2CMRL 3IGAA 1HCFX 1KT2B 4PJEA 5FHBH 1MFAL 2P47B 4RGOH 3ARYA 2NY0C 4G6AD 3HUJA 1B0GB 5TQ2H 1IQWL 1JRHH 4K7PL 1U3ZA 3MBEC 3KNBB 4XAKD 4HLJA 5JQHC 2F74A 3LEXA 5DFTA 5LVEA 1BF8A 4LHUD 4P9HH 4Q9QH 5E56A 1KIQA 1U93B 2PYFB 1QUNA 5T1DH 2EYSA 1YUHA 2WINA 2R9HD 3WV0A 3D0VA 5A3ID 3R4DA 2XA8L 5T1KD 5TDPA 3QWOB 5CEXA 3CVIL 3L7FA 3ARWA 5D6DC 5GHWH 1K4DB 3QI9B 3FB8B 4PTUA 1L7IL 5ALBL 1CFQA 5E24E 5E2VL 3UYRH 3BZFB 2F19L 3EJJX 3VFRB 3DTXA 4NRYB 5I18H 2Z93A 1EEZA 1RIHH 3CU1A 1CVRA 1FAIL 3VGHA 3QDJD 1ZVSA 1BJ1H 3VD7A 5ICZB 3SGKC 1TCMA 5D8JH 4S1DD 3TN0B 3R1GL 3WS6C 2W9LA 1FG9C 5CEZH 4M4PA 5TJWK 3AM8A 4WJ5B 3U7WL 4V2CB 5KZCB 2LV4A 5E4EC 3B3IB 3GBML 5T33L 3MLPA 2EEDA 4I2XB 3U0TA 3GMMA 2OBGA 2HVJB 1HE7A 4F9PC 5H94B 2VLJE 1IEAB 2CKBA 1U92B 4NO0D 5DURB 3CCHB 4FTVA 1EAJA 3S96A 2VDOL 4EZMA 5F7LB 3D85D 3DRQA 3K81A 2ERJC 3BJ91 1OP3H 2CIKB 1A2YB 5A2LH 4IOFD 1BQLH 3QULB 2W9EH 4G6MH 5D2LF 3RUGA 4DUWA 1ZOXA 1AQKH 1RI8A 1YQVL 2UWEB 3OR6B 1I7UB 4QRUB 5F6HJ 4UDTA 1GRWA 5JNYA 4MAYB 3E6HA 2NPLX 1M4KA 3SHSA 1EHNA 3CLFL 2FJFB 3ZKSD 1G9MC 1RZIB 2IQAA 1YECL 5FM8A 3CSPA 2ZUSA 3HNVL 1TZHB 5DSCA 1KOAA 4TNVF 4GAJH 3VXSE 2JCCA 3OXRA 1IKFH 5DQ9A 4LGSB 3QNZA 5DA0B 5I8EA 3G5YA 3IETA 1DFBH 1I1AB 4XP4L 1UKSA 4PR5B 1UWXK 3SDAC 3SOBH 1D9KB 5IVOA 4U6HB 1OAUH 1NKRA 3DUSA 5KSBB 4NT6A 1H3GA 3BGAA 3ZDZF 3L5HA 3KPRD 5F7NC 1EA9C 3LOWA 2D7TH 2MPAH 5CIPA 1T21B 4FZEH 2LE9A 2LU7A 2VKXA 3RDTA 4GUPB 3O2WH 4UINH 4FXGB 1RVFL 4XPTH 3EJZC 3MLZL 4G9FD 4P5KB 1K8DA 4X6CA 2BOCB 4LCYB 1P5VA 3KPRE 1CDUA 5IROC 2VIRA 4GMSH 1TETH 1ZHNA 4NUGH 2XN9B 1CDIA 1KFAH 2HKFL 4JY4B 5DT1H 5L8LB 4WDIA 5IMMB 5CUSH 3TH4T 4J3TA 5K9QG 1HSAB 1CG9B 3MRMA 1W72B 5DRXA 5IWLA 4U1SA 4PY8I 4F9LC 3D6GA 1EVTC 4PJXE 1SYVB 3QJFB 1QSFB 3EO0A 2E9IA 1S7SA 1UB6A 1ZVYA 3QDGD 3WE6A 4CJ0A 4G7VH 5C0IB 4FG6D 2QSCL 1MH5B 1MCBA 4NFBA 3PE9A 3KPSA 4H88H 5IB3B 1YNKH 5C0JA 4XGZB 2ED9A 2OMNA 1UM5H 2ZNXA 4MX7B 2FJHB 4LLMB 2ESVD 4APQC 5K93A 1JGLH 1Z9MA 1L9MA 1P84J 5DFWH 3NFSL 3IF1A 2ICWJ 5DQJB 2DDQH 3BH9B 4O2CA 4X6BB 3QSKB 4ELMA 2VZUA 3PL6C 4QRPE 1I8KB 4JM2B 2MQ3A 1Q9WA 1QP1A 2AKRB 1G1CA 2P8PA 1EXUB 4JFHD 3I3BA 4IDLA 4WO4A 5FYJE 4RGMC 3QEUA 3RWHB 2OYPA 4P57B 5JOPD 2BSSA 5SX4I 1NCAH 1YNTB 4MA7H 3VWKD 4BQCA 1HN1A 2GITB 4QRSA 2HMID 1JV5B 1DANU 1IILE 2R56L 5DK2B 4YQXH 2IANB 3V0WL 3C6SA 4JFHE 3KPMB 1X5AA 4GG8A 4TSBH 2E7LA 5CZVL 4GKZB 2ZCLL 4Y19D 4ZOCA 1QPPA 1LO5A 3TM6A 1INQB 3ARFD 1IEBA 1FBIH 1IGJB 1MCRA 3RL2B 5FFLA 3DIFB 4OJFH 1FNHA 3X3GH 4XP6L 4PGBB 3V7MA 3JZ7A 4JKKA 3QO1A 2FJGB 4KMQA 1AGFB 3RKPA 2MMXA 4HMCA 4M7KL 4AJ0A 1QKZH 3VFNB 3ZTNL 4M61A 4U6XA 1A4JA 3QQ9D 4OCWL 4PRIB 1T0MA 1QTYT 2XZQL 3RWFB 5DD6A 3NCEB 2DL9A 4P2OC 4MD0A 2OZ4H 1J11A 2V5TA 5C0EB 3WFHA 2W0FB 3P9MA 2HKHH 5L7XL 2AQ1A 4KK9D 4EI5C 1U95B 4J6RH 5CJXC 5BXFA 3FN3A 3RVUD 1ZHKA 3C5ZA 2HLFD 3BXNA 1KCVL 3EFDH 25C8H 1FAKT 2NY4D 3FQTB 1D5BB 1EFXB 3MNWB 1H3VA 3I3DA 3HR6A 4GRLB 4YNYA 3QUMA 4PRPB 4D0BA 1GGBH 3F65A 4B7IA 1CGWA 1JGDA 2K9UA 3NH7L 4P5MA 2Y6SD 4MNQD 1C08A 3WSQL 3WFDH 1BOYA 3AU1A 4OZIB 4M9OA 5J6GB 4XC3L 4PGCA 5IV2B 3D3VB 3L3JB 1RUML 3DMMC 4G6KL 3OKDA 1JMXA 4U1MB 5L8KB 5FYKE 3Q5YA 3GSXA 3HE6C 1U3HC 2GJ6D 2VLME 3P4LA 4JG0H 4WUUA 3SDDC 1A6ZA 4LCCC 1FNSL 2A6JB 2BVOA 4AM0A 5ECJE 5I17A 1CZ8L 5ILTL 5LQBL 1QFHA 1OWWA 4PJHF 3FQRA 3MFGB 5GS1A 2GJ6E 3I75B 5HHOE 2HWZL 4OSUH 5I1HL 5MERA 1LE5B 2W1NA 4XPAH 4KDVA 3UC0H 1G9NH 3ARXA 4WWKA 3ULVC 1BVLA 3UPAA 1YEJH 3O4LB 1NEZB 1J10A 4U6VL 1BZ7A 1YPZA 1BZ9B 2CO7B 1PX4A 4LLWA 3IJYB 1XGYL 1A9BB 4LK4A 4Y4FD 5HYSG 2BFVL 4KROD 1I75A 4DKFH 4MXWL 2D4FA 4M6OL 3V95A 4PJ5A 3KPNA 4G6JH 4LEOA 1EHAA 1OM3L 3O2DL 5C0BD 5I1KH 2VWEC 4RSVA 2R15A 3GMRB 3UTOA 1NFDE 4NYLB 2Z91B 2AJSL 4PJDF 2H26A 5C0BE 1KB5B 5AYQA 1P4IH 1H3UA 2W59A 3ULUD 4KUZL 2AJVH 1IRAY 4PBWD 2A6KA 2R2BA 4JPIB 3UTPD 5B8CA 5HYJA 2J8UF 5JUEH 4KQ4H 5H37H 4XAWH 4MA1C 3D1MC 2CJUH 3SQOH 3FB5B 2RHEA 3WNMA 3V0VA 5DHVH 3ULUE 1JVKA 4HJJH 2O26U 2ZUYA 1B88A 5FHBL 4ODHH 5I1EL 4RGOL 4Z7VB 3F12B 1SBBA 4I9WE 3MYZA 2X05A 3L9RB 5D5MB 4JHAH 4N8CH 5C0GA 3BZEA 4P9HL 5LXGH 1WV7T 3NZ8B 1NANI 3D2UA 5FA4A 3FT2A 1S5HA 5T1DL 3GIZH 4KI5E 4X9GA 3HC4H 1CFNA 3ARBC 4L9LB 5KSUA 4F58L 3DETD 4X7SH 2EE6A 5D6DA 3GO1L 3QQ3A 1IGFH 1RJLB 4Q97A 1AGDB 4N0CD 3V5KB 5ANMB 1P7QA 4KDTC 3QO0B 5I18L 1T22A 3CIQA 5J3HC 2Z31C 5F8RC 3TFKD 3NACL 4PRHE 3O0RL 5DTFB 5IFJA 3SGKA 3BGMA 4WFEE 4KMLB 5D8JL 2BDNH 3MREB 5FO8B 3BEWA 1P6FA 3N50A 5EFIB 4DVBA 4NQDD 1A4KB 1ACYL 2HLAB 2PO6D 5J6HB 1KLGA 3VXUD 4EXPX 4F9PA 4L3CB 5C07A 1LVEA 2CDFA 3FRPA 2AXFB 1N0XH 4N68A 1OARH 3MCLH 1S9YA 2EDOA 3A6CH 3BP7B 3IVKA 4M4RA 3RL1A 4YHOH 3W5NA 3BH8B 5DJAB 5ICYA 4ZTPH 1JRHI 4R0LC 1PVHA 4F33A 4YHYC 3VXUE 4MXVF 1IAOB 3FTGB 4DGIH 3PNWA 4K8RD 3U4BH 2PXYC 4BSWA 2WP3O 1CXKA 4KY1L 2F8OA 1VB9A 1B0RA 1ZS8B 2J6EL 4UT6L 4PS4H 2C3WA 3RNKA 4XCCH 3N1QC 1KLUB 3U4AA 3TWCL 2DLFH 1BVKB 2QADD 4X80L 3VE0A 3P30H 5F6IB 3FQUA 1JWMB 2VN4A 3GJEB 1LK3H 3O6MH 4GAJL 5CFHA 2YD3A 5IHUL 3MJ7A 5HGBA 1J5OH 4RGND 3C6LD 2FD6H 3PWNB 2VXQL 1N2RA 3M17A 3JTSB 3QWQB 3SDAA 1DFBL 3O6LH 3SOBL 3WLWD 1OAUL 3TT3L 3TBTB 1JUFB 1VCAA 2XG4A 4KAQH 1INEL 1NQBA 4E41E 2ZG1A 1YJDC 1ZV5A 3TPUA 3IFLL 3Q3GB 3QFJA 2D7TL 2MPAL 3HC0B 1UVQA 1P53A 2BOBB 5D96C 5HSFA 2YC1A 4AZ8A 1S5IH 2IMNA 1WFTA 3PQYE 3WS3B 4IS6A 4LARH 4GAYA 4XPTL 2PTTA 4HUVB 4GAGL 2VC2H 2VLJB 3NIGE 5J13C 1FFOA 5IROA 4D9LH 4ZFOA 5E8NA 5IKCB 5CS7A 4NUGL 4LSRH 1KFAL 3N85H 5DT1L 1CS6A 1AP2A 2VDNL 4LCIH 5CUSL 1DBJH 4I0KA 5FYLE 5EWIH 1WAAE 4OFDA 4ZUTB 1A1OB 4DGVL 3R8QA 1NGWB 4N5ED 5H2BA 2VL5B 4F9LA 3LN9A 1EGJL 1JP5A 5EOCH 2BCKA 3MZGB 1RUPH 1NCNA 1EJ6A 2ID5A 2ZUUA 3FOLB 12E8H 4KHTH 3O9WC 4NRZA 4LGRB 3VRLF 4XB7A 3WFZA 4H88L 3SCMC 1BX2A 3VXSB 2EDLA 1A8JH 4JGJA 1UM5L 5SWZD 5EU4B 3QXAA 4APQA 1JGLL 1I3VA 4GS7B 1JF1A 4K23L 4G3YL 1Q9LB 2EXWC 4ZMAT 1VERA 4XVSH 3T8XA 1SY6H 3RTQC 1NBVH 3PL6A 1DUZA 2A2QT 1T1WB 1X5XA 3U9UA 1AR1C 2ADIA 4OLEA 4Z7QE 1ETZA 1TLKA 2DQDH 2YA1A 1T89C 1CDJA 1JBJA 2EE9A 1A47A 3PP3H 2AJZA 2Y7QB 5D93B 4FQXC 1NCAL 1N0LA 4UILL 1A7OH 1N3NB 2VQUA 4LSUL 2HN7B 5E0QA 3FFCD 5GGRY 2XPGB 2C5DC 5E8OA 3P0VH 3X14A 1LDSA 4HFWB 1UQSA 1FJ1B 1G6VK 1VADB 1K3ZA 1RIUH 3KWWB 3BOVA 1CLZH 1CGTA 4X6DF 1MY7A 3TJEH 4X4ME 4PJXB 4MWFA 1EZVX 2VXVL 5DWUH 1BREA 1FBIL 3M1BB 5CWSB 3FFCE 4UIMB 4OJFL 2VDRH 1B0WA 3TZVC 2NY5H 2ZUXA 4LDLB 5F7UA 1QBBA 2DAVA 3LVEA 2EKJA 1NAMH 4MDIB 5MHSD 4MJ5B 3NCJH 2X9XA 5F97E 1QKZL 3OKKA 4ZUSB 1MVFA 1YN6B 3MX0A 5D6CA 3QISA 3MGOB 1D5XB 3LKSA 3S37H 4Y2DB 5MHSE 4P2OA 3QDMA 4XRCA 3DX6A 2X1OA 3BKMH 4R90H 1G0DA 4KRPC 1JTOA 3VXQB 2OZ4L 3QIWD 4QRPB 2CD0A 1WGOA 5GJTH 2HKHL 1BBDH 1YMHB 1M1SA 1BQHG 3ROOA 5CJXA 5MEPA 3D39A 3HFML 4WIQA 1KCSH 1I9JH 4F7CB 1JYWA 25C8L 3EFDL 3EDKA 4N8VA 1MJJB 4GLRH 3QRGH 3ARSA 3QIUC 3PGCB 1MREH 3HE7C 5HYSB 4WFHE 3JWDC 5HI3D 3ROLA 4Y4KC 1GGBL 3C60D 3WFBH 4KTYA 4WW1B 4X9IA 3KPQB 2Q7YB 1N7MH 3GMOB 5IM7B 4XCNA 3WFDL 2NY6C 4NM8L 4H25A 2HFGH 1PY9A 4Q6IC 3T65A 3KG5A 2HTKD 2G9HA 1RJYB 3DMMA 2Q6WB 2WLZA 1WWAX 4PJCE 2OR8A 3AS1A 3HE6A 3X12A 1XH3B 3FB6B 1J0HA 4JG0L 3SDDA 5HYQA 2G2RB 3AREC 2GCYA 1EEUA 1HQ4A 2UYLB 4PLJC 1EJOL 3HCVA 2YSSB 3U36A 5SWQB 1A7NH 3CFDA 3UTSD 4QHMB 4B5EA 1ZVHA 1KN2H 4EUPG 3D9AH 5GGRB 2X44D 3S3SA 2XT1B 3A6OA 4JE4B 4OSUL 3IDGA 1XF4B 3MACL 1I7TA 4HCRH 4OQTA 4XPAL 3F7VB 3UC0L 4HXAH 5F3BB 4BSJA 5CGTA 1Z3GL 4ZD3H 5I1LB 1JMZA 2ZZUT 3FZUC 1MLBA 1RQ5A 3SDCC 4K3GA 4HLZH 1VEOA 1TMCB 5L0QB 3WJJA 2A73A 3MV9D 4RAVA 3GB7B 1ITBB 1GGYA 4RMVA 3VXPB 4QRRA 4P9HC 1YEGH 4N9GA 4EDWH 5HXMA 4G6JL 1AI1H 1U8PA 4MD4A 5HGHB 3H9SD 3TJHC 1REIA 3DGGA 4I3RH 4JEGB 4BQ6A 4PUBH 3KLSA 1JWUA 1J88A 5KS9E 1AC6A 3L5WB 2PCPA 2XQYG 1PLGH 3NABL 4LNRB 2O5ZL 5I8OH 1QO3A 1FCGA 5EU6A 4WW2B 1LQSR 3QNXB 3HAEG 3K4AA 4P2RD 4HG4K 5AD0B 4OCMC 5KSBF 4LPVA 1YMMD 4Q2ZA 1P4IL 4YHMH 2AJVL 4YDIH 1HZHH 4OKDA 5GS0H 1DQJB 4YFDB 5MENE 4X5WA 1K2DA 5JUEL 3NOIA 4KQ4L 4XAWL 4AH2A 4PTTA 5D1XD 2AI0L 1MI5A 2O5XH 2FWOA 4HJJL 2QKIA 4HIIB 3OL2A 5CD5C 3FT4A 4Y5VB 5HHOB 4ODHL 1N6UA 1T6WA 4HKZA 3MRBA 3O45B 1FGVL 4HX1A 1X5IA 3IDYB 1NBYA 2HT4D 4JHAL 1K4CB 3LMJH 4TVPL 3GSNL 4BH7B 4WCYH 3MRJB 5J06A 3BHBA 3LS4L 2QTEA 3JTTB 3LDBC 3WKNA 5DK3A 1DLHA 3CU7A 4FXKA 3ILPA 1NCWL 5B39A 2D0HA 1OB1B 2E6JA 3TIDA 1BOGB 2OJZH 3ARBA 3HC4L 1OP5K 4YIQA 2V2TB 3OJDA 1T0NA 2BXYA 1MCHA 2FL5B 5IW1A 4NDMA 4Y1AD 3U79A 4X7SL 1RU9H 5FYKU 1JE6A 4M1CC 5KBNC 1NFDB 5EPMB 5I1DA 2Z31A 3I6KB 4Y4HB 1T66D 4HIEA 2EIDA 1T5WB 1U8OA 3TA3B 5F7DB 5C0BB 4JVUA 4RFEA 1HDMB 4CMHB 2DWDA 2WK2A 4JM2F 1BIHA 1FZJA 2ZG3A 4QWWD 1TPXC 4D0DA 3BEVB 4BJLA 4NKQB 3EW3B 4NCC2 4I48B 3GNMH 4D0CA 1FV1A 1OARL 2Y36L 1KJVB 3H7BA 3ZT7A 4P4KC 5D7JB 3U9PH 4N9OB 5LGHL 4X4XA 1PY4A 3WMSA 3KJ4B 4L3ED 4YHOL 3VRIA 5ETUA 4R0LA 3O6KL 3FT3A 1BD2A 3VXMA 1TJGL 2BVUA 2YBRB 2R1XB 3G6JF 1K85A 4DGIL 4EEEA 1YEDB 1R24A 4I0PD 2PXYA 4OV5B 3U4BL 1TDQA 5BO1L 5I71C 1GPOH 2N7AA 4PJAA 4LEXL 4L3EE 1I7ZB 2J8OA 3TVMD 5JORA 3GSQA 4XCCL 3BKCH 1O7SA 2A6DA 4LCUA 1FG2B 3RZCC 1OTUC 5DJYB 4WI9A 3OMZA 4ORGB 3ZSTA 3TO2B 4HFUH 2F53E 4NZTH 4OKVA 1LK3L 3O6ML 5D1QD 5CMAB 2OXHA 5A16B 2WWKO 1QA9A 3NFPB 2GFBA 2W0PA 4JHWH 4JZOA 5A40E 4Y88A 3GHBH 2DLEA 1NC4D 1ZEAH 1OD7A 1UXWA 4LLAA 3ZDXF 2APTA 4PRHB 3O6LL 5DD5H 3HI1A 4M03A 5FUOH 1J8HA 2X9YA 3QIBB 1B2WL 5ISZA 3CUPB 4KAQL 1GAFL 5I2IA 5GGSA 1P9MC 2CPCA 1A7QH 1HNFA 3EFFA 3T0ED 2C3VB 4O5LH 1DE4A 1F3DH 5EC2B 3SGDI 1BGXH 2F54E 1S5IL 3MRIB 4HWNA 3DBXA 4KKCD 1MHCA 2IPUK 2UUDK 4P23C 2H32B 1FCCA 2XTJE 5L88H 4PV8B 5JPMB 5EBWB 4J23A 4D9LL 2XWTB 2CH8A 1S7RA 3H2WA 1MQ8A 1T4KB 1U6AL 3O8XD 3SE8H 1V3LA 1BEYH 4LCIL 4ZNEA 3OG6B 5I15H 3ZT6A 4NO3B 2C4FU 5EWIL 4OZIF 5JW4Q 4ZQKA 3MBXL 1WBYA 4KXZI 4R7DA 1VFOA 4JQXC 5INCA 2ERJB 3CVHA 3PJSB 2AABH 2NTSP 1HXMB 3I6GA 2YPKB 1H3TA 1Y18B 3O9WA 12E8L 4KHTL 3SCMA 3HZYA 4XNZC 3B8YA 3VGFA 1RUQL 3DUHA 4NO2B 2I9LA 3QZWG 3THMH 2WLYA 2O93L 4Z7UE 2JIXD 3UPRA 2GSIB 4PG9B 4HEME 4XX1E 1CXHA 5CGYC 3W11D 4AIXA 2DWEA 2AEIT 3RTQA 1SY6L 4G8GD 3QUYB 1NBVL 3OAYH 4E41B 3T77A 3QXDB 1T89A 1A9EB 1X6NA 2OK0L 3V52H 5BS0D 5HYFA 3PQYB 1BIIA 3QDHA 3W39B 4XCYB 2A74B 4JKMA 4FQXA 1QR1A 4ELKB 2CK0H 1JYNA 3CC5B 4XHJD 4POZD 4P46C 3UAJD 2CQVA 1Y6KR 5ITBH 3ZKNC 2HT2D 4YHIA 5IK3B 3BKYL 4X6FA 3F7YA 3GIVA 2VAAB 5T1LA 2QQNH 5IGXH 1XGUA 4PYGA 1CDCA 3P0VL 5TE6L 4AIZB 4YHLL 3E6FA 5GRVK 4NQVA 2LVCA 3CJJA 2GTWB 1JWSB 5D4QA 3L3IB 5DWUL 4P2QD 5KVEL 3TZVA 3ECBB 3HZKA 4ZO6A 3BQUB 1T7WA 4HZAA 4HWBH 43C9B 5J12C 2GI7A 1EO5A 4QGTA 3FQXB 3C5SA 4LSPL 4NKOA 5B3JE 4PJBF 4N0UA 3P0YH 2Q86B 2ADFL 4PLKC 4MS8D 3ES6B 3QG7H 32C2B 4FQJL 4Z7VF 3EYQD 3SO3C 3KJ6L 1OW0C 2NY3C 3L6FB 4EI6A 5KG9A 5DEGB 2EE3A 2EE2A 4PJEE 5D5MF 3MRCA 5EO0A 3BP6B 1U91B 3SDXB 1ZANL 4JDVA 1CE1H 1FFNA 5E8EB 1G9NC 2XZAH 5GRUL 1BBDL 3BDBA 5JOFB 4DN4H 3U2SB 2CRMA 3KPLA 1FSKC 3OZ9L 1NDGA 3H42H 3HZVB 4NQEE 2NXYB 3MRDA 4XTRC 3QIUA 3HE7A 1FNEA 2VLKA 3NZHL 3QRGL 4UV4L 4X9HA 4Y4KA 3MRRB 5D7IE 3V7AG 4L29A 5IESL 2EC9T 4LL9A 1KPVB 2GEEA 2ORBL 3A6BH 4UOW1 3GK8H 1N7ML 1T6VN 3RWDB 1WK0A 5BZDB 4XVUC 3E3QE 5D1ZC 1N5YL 4QXTA 4EOWH 4Q6IA 5AG9A 4ONFH 3QEQA 5GRJH 5I9QB 1KXTB 1Z5LB 4KJYA 3FFCB 2DICA 3MJ8B 5DA4A 2HAZA 3AREA 4JGMA 2ZCKH 1KPRA 2GY7B 3RI5F 4FTVD 5FGSA 1A7NL 2V5RA 4D2NA 4HJ0D 2KBGA 4HMEA 1TZIA 3D9AL 1MIML 2DI7A 3TF7C 2QL1A 3RVVD 4ZPVA 4DKDC 4K7PY 1Q9KB 1FGNH 4IJ3C 1H8SA 4NGHL 3I2CH 2AXHA 2R0ZL 3JBG7 4PP1D 3SDCA 5IQ9A 1X5JA 4JANB 2NX5A 5DMKA 4R8WH 5FK9B 3CLEH 1OT1A 3D25A 4IDJH 2AK4A 4F7EB 5E7BA 1Z0NA 4EDWL 4GLRI 5EUKB 2OSLA 1NDMB 1A3QA 1AI1L 1EH9A 5CBEB 3K8MA 4F15B 3TYGH 2P5WA 2H45A 2HA1A 3O41B 3PDOA 4I3RL 1KBGH 4HGKC 1G9EA 4PUBL 4X6EA 4EI5B 1I9RL 5EUOE 3L3HA 4UV7H 4AEHL 4QNPF 4D8PB 1FL5A 1OD9A 5E2UL 2R1WB 3DRTB 3T1WA 1KB9J 4PJCB 3RDTD 3DYMA 4L4VA 4YDJA 2AXGA 1BFOA 1MAKA 4RDQG 4YDIL 3FFDB 5C8JB 3DWTA 1A22B 1HZHL 3OHXA 4WFFE 5BZWB 5HTSA 4IEFB 4WV1B 1GHFL 2HJLB 3I50L 5GRZA 4ZXBB 3VH8A 3INUH 3U6RB 3GSOA 2O5XL 3MLXH 4OZHA 1JNLH 2R2EA 3DX8A 1L6XA 4TUJB 4YHKH 1A1MB 5GRXG 5TGBA 5I66B 3C8KB 4LFHG 4RAUB 1FVDB 5HHQB 1QSEA 1OP3K 3LMJL 5L2KA 5JHDA 3WEXB 1UA6H 5TF1L 1YY9D 1KCRH 2WAHA 2XWBB 1AGEA 1CFTA 4GSDH 1BZQK 3CFKA 4L8SC 1XF2A 3KPSD 3VRJA 1MHHA 4LRNH 2PTVA 3IFOA 3H3PL 3F7PC 1RU9L 3U1SH 5KS9B 4JFXB 1VFBB 1FIGH 4X7DC 1OGTA 1MFDL 3KPSE 6CGTA 4HHAA 4MD5A 1R5WA 3CDCA 1W8OA 4NOBA 4Z5RA 3WNOA 1EDQA 1MCNA 4G6FB 1S9KC 4Q9RH 3L1OL 3VFOA 3MGAA 1BLNB 4JFFA 4WO4D 1XCTA 2NY2B 3N1FC 5MENB 1LMKA 5I6XC 3SKJL 5JDSB 5CSGA 5C6TL 3EBAA 2DLIA 4A6YB 1MWAA 2MOVA 3MUY1 3MYJA 4P4KA 1KYOK 1I7RA 4XCFH 4CN1A 4E42A 1Q94A 4LAQH 2NYYD 3HC3H 3FKUS 1CT8B 1CE6B 1A1NB 3DVNA 3HN3A 3IKKA 2P8MA 5ESVB 5B38A 5IJVA 3TNMB 1GPOL 3UMTA 4AG4H 3BSZL 3RZCA 2ZSVA 4IMKC 1I8MB 4Z7NE 3N1PC 3D69B 4FABL 3HB3C 3GDBA 4N90D 4RMWA 1K8IB 1URLA 1WCQA 5FO7A 3TNNA 1KJ3L 1LO3H 4JHWL 5F9JB 1OWRM 1PBYA 3GHBL 3ESVF 5TFSH 1IAMA 5ICXB 3L3GA 5T3ZH 1HI6B 2DKSA 5F88B 1LEIA 2DMCA 3VG0H 3ZDYE 4N90E 4NC0B 4KUCF 3VI3F 3KXFE 1P9MA 1BHGA 1N5AB 2WW8A 1ZA6A 5C0FB 3KLHD 1A7QL 3C5ZD 2HFTA 3DO7A 3S34L 1IZJA 1BGXL 5FM4A 1GC1H 1LP9A 4U33A 4O9HH 4AENA 5L88L 3CZFA 4ZUWB 2Q3AA 2EIZA 4ZUUA 2UY7A 5IB5A 2WUBH 4X7EC 3SE8L 1BEYL 2HFFA 1N8ZA 5I15L 3NAAH 1ZT7A 5TE4H 1LHZA 1V5JA 5E7FA 4GH7B 2DQGH 4JQXA 2EDXA 5EBMB 2W91A 4L3EB 2FO4A 1OTSC 4MNHB 1JZ8A 3TO4A 4WUUD 1F2QA 5C08E 2AABL 3IDMB 4QOKE 5IIEA 1D6EA 3HI5H 4GG6E 5FM5M 3IU4H 1MFBL 1PJ9A 2F53B 3JWNC 1AD0B 3IDJA 4OCYL 1JN6B 5EIIA 4HAFA 1OAKH 1OAYL 5IVNA 4F7MB 3THML 1HOCB 2NY5C 1WLHA 4WUUE 3BIKA 3EAKA 1VGEH 1H0DB 2LAAA 4OAWB 5E6ZA 4DQOH 4WWKD 5JLZB 1BJ8A 4OCNC 1BWWA 2FLBT 3KS0J 2GK2A 1KTLA 1LEKB 2OR9L 4GRMB 1PYWB 1KCUH 3RBSA 3DUUB 1RFDL 4PIRF 2JB6A 3PV6A 4HDIB 2AXJA 1A5FH 3CFJB 2Z8VC 5EU7E 4PJ5D 2F54B 1T04A 2R0KH 4HJGA 2EDKA 1ZKAA 3UTZB 4P5TA 4HKBA 2XTJB 1EHXA 3L3KB 3GGWA 1KB5H 4P46A 4H5SA 3O3DA 1I4FA 4U1LA 5LGJB 3ZKQD 5ITBL 4JZNB 1SEBB 1RHFA 4C83B 2DQFA 1T83C 3Q0HA 5IGXL 2IBZX 2MHAA 4GXVL 1F02I 2I60H 5GQBA 1MAMH 2CLVA 5GSVA 4KJWD 5SWSE 3HMWH 4WW2F 2NY1B 1C5CH 4Z77A 2OCFD 4JPVL 1PKQE 4KJPC 1CGYA 1S7UB 2L0DA 1HIMH 4C58B 5DLMH 4DW2L 3F6IA 1G7QA 3BUYA 1S9VB 3EOBB 4WI4A 5HYJD 3ZO0A 3BZ4A 2H3NA 2CR6A 4D3CH 1A6AB 4JPKL 1UJ3B 1G7LA 4WI5A 4XT1C 5EBGA 4YUEH 4NC2B 1FO0L 2AEPH 2NY0D 4Z7UB 1MFNA 4GKSA 3S35X 1X4ZA 5CSZA 1OW0A 4HXBL 2FO1A 2H9GA 4NP4L 3HRPA 2R4RL 4LQFL 4RX4A 5H35A 1KIPA 4PJ8C 3RWIB 2YD2A 3D2UD 8CGTA 2JIXB 1CE1L 2ZKHH 1U8MA 4OGXL 2GT9B 3K1KC 4OV6F 2IC2A 3MGTA 5DEFB 1FNGA 4YHPA 2XZAL 4UUJB 4Z0XB 3MXVH 4DN4L 1OVZA 2LFGA 3QEHA 2CXKA 3AGVA 1JPSH 3GSVA 4FQ2H 4JFPB 3TIEB 2Z8RA 3P9LB 5E1HB 3FB7B 4TRPH 2WIIB 1OAQH 3BWAB 1P7QD 3WL9B 3X13B 2P43B 3GHEL 1Y6MR 1WC7A 3GMNB 2VISB 3VI4E 1NFDF 2FIKB 1VEMA 4JN1H 5D1ZA 3VDCA 3UBXI 5HGDB 5FEBA 4XNMB 4EOWL 4O4YH 3VJ6B 4QCIA 5GRJL 5CLTA 4XNQB 1YEEH 2C7UB 2YK1L 3OKEA 4DTGL 5C07D 1I1YB 2BVTA 2ZCKL 3G04A 4M1DH 5L8JB 1YY8A 4MXQC 1H3XA 2R0WL 3ALWA 2PNDA 4S0SD 2ZOLB 3ULUF 3S3PA 5GS0C 3ZHDA 1PQZB 5C70A 1MHEA 1UKTA 2VITA 2DB8A 2VDKH 1UM4H 1NCUA 1WCBB 4HK0A 3I2CL 2JTDA 5K9KB 2X1QA 4PJEB 4AEFA 5DK0A 1UWEH 3IDNB 2E27H 1SBSH 1F11B 2YPVH 2CDGA 3LEXB 4OZFA 1RZJL 4PRBA 4K3DL 4NQEB 4EKXA 3FQWB 1QRNA 4GBXC 2AGJH 5C0DB 3I6LE 3TYGL 5HD8C 5D7IB 4PJ9B 3MRPB 1KBGL 4YR6B 4ZAKC 4ODSH 4HIXH 5DUBB 3SDAD 4TVPE 3KYNB 3HZMA 2A9NH 1CN4A 5JO5A 1R3IH 4R6UA 1W0WB 4PP2A 1CFQB 5B21A 1TJHH 3DTXB 5BOPA 4M7LH 1CDHA 2V2WB 3OX8A 1DBML 3ARDC 3EJZD 1X9QA 1ZSDA 3HG1E 3OB0H 1EO8H 4EXKA 1HYSC 2YEZB 2R4SH 5D2LA 5CJBA 3LN4A 1LK2B 3FONB 2P46B 4OCXH 1JNLL 4KKBC 3MA9L 4M3KB 4IRZL 1UH3A 2CKBB 3GMLB 2AERT 2RFXA 1DN0B 3S96B 3VD9A 2VDML 5BRZD 3FL7A 4ZFFB 2EDDA 4XXDB 4K9EL 3X11A 3V5DA 3MV7A 5E95B 2X4NB 2QHRH 1KCRL 3FOMA 3BX7C 4XC1H 4GQ9L 5HPMA 2A6IB 4L8SA 3AAZA 3SJVE 2D7MA 2Z35B 4UDTB 4L8CB 3MFFB 1UYWL 4LIQL 5BRZE 1HKLL 3LH2L 4QHKI 1ZLVH 4W6YB 1T5XA 4G7YL 5EBLB 2BHYA 4APQD 2BNRE 3VCLB 3BPLB 2W65B 4HUUA 4XZUA 3U1SL 1BECA 3DURA 1ZMYA 5EUOB 2AP2A 1F6LL 1PZ5A 4YAQA 3V6FA 1UC6A 4HWUA 1GGCL 4F7TA 1I9IH 2X4QA 1JPGA 3PL6D 4IOIA 4U0RC 4K7FA 1IC4H 1HH6B 1QFWM 2N4IA 4LVHC 3VD4A 4NKDB 1GOFA 4I4WA 2DJ4A 4Q9RL 4BFIB 1S7TB 3KGRA 2R2CA 2Z8WC 3VFTA 4DOHE 2J88H 1MCOL 2AV1B 2X7LA 1PKOA 1CLCA 1ND0B 3MNVA 4MJIE 1MNUH 3FRPG 5DVMA 4XCFL 5E4IA 2WBWB 1JGVH 3ILQC 4WTZA 4BKLA 1GGIH 3HC3L 1NUFA 3UPCA 1S7WB 2VYRE 4OFVA 2IALA 3OR7B 1SYSA 2ITCA 3L3DB 1WAAF 1GZPB 1H3PH 1WBXB 5DDHA 3T0XA 1TFHA 3T1FB 2CUHA 2OL3L 3LPGA 3EOYG 2AJXH 3R06A 5CP7A 3ALXA 1JNJA 4HULB 4LQ1A 2ARJB 3P4NB 4AG4L 3PUCA 1DANT 1IQDB 4IMKA 5IR1A 1C5BL 4WU7A 3FHAA 4NSKB 2VABB 3GZKA 5DJCA 1NLBH 3OKYA 3JV4B 3DVIA 3IFNH 5D2NE 3VFGH 1M7IB 5ALCH 4YK4C 3PGFH 1LO3L 5D71H 3KPSB 5FB8B 4P2OD 4P4RA 5FYJH 3QDMD 3LHPL 1BVZA 4OI8A 5FGBC 5T3ZL 3VA6A 1S8DB 4HV8A 1QYGL 2JF1A 3VG0L 2ZCHL 4J1UA 2Q8BH 5FF6B 3BRGC 5CINH 3VFPB 2M1KA 4Z7QF 3D39D 3VWJC 5CEYA 4Y16B 4EQ2A 4Y5YC 1GC1L 3DVGB 3VGBA 5HY9B 4LPCA 4O9HL 3KYAA 1Q9WB 3KYKH 1F3JA 3RZWA 2B0SH 3FRUB 3MOAL 1TPXB 2NLJA 5HVGB 3PHQA 2BXZA 1WZ1H 3MV8A 2J2ZA 3NAAL 4ZYKA 4QRSB 1KJ2L 3DMMD 4XPBH 3KVQA 2BVPA 5GGTA 2FR4B 2OP4H 4HWZA 2AV7B 3HE6D 2DQGL 1GXEA 4I8DA 2GUOB 4CNIB 4C56E 3LRSA 1U8HA 4WVRA 5EU3B 1F6FB 5BQ7B 4JFDA 2MNUA 3SDDD 3EJYC 5IB1A 3AMLA 4JKPH 3CPLA 4C4KT 3LKRB 3AB0C 5IBUB 2W60A 1JK8B 3IU4L 4JFQA 1NCDL 4RWYH 1G7MA 2QV2A 1BM3H 5I1JH 1OAKL 3UYOD 3IXAA 3S36H 4O02H 1S7XB 3P3YA 4XPHL 1NAMA 1VGEL 3ULVD 3ZE1F 4DQOL 1MEXH 7FABH 3SY0A 3H9HA 4OB5L 4P9MH 2Y4SA 3HS0B 2DLGA 2H8PB 1A4JB 1V7ML 2PF6A 3KXFB 4GKNB 3REWB 2YD4A 1FVEA 2HRPH 4LLYB 4OUOA 1A5FL 4QRRD 4KTEH 2RIKA 3QI9C 4BH8A 3RWJA 4OF8A 1ZLWK 4FFVC 4Z76A 3DARA 2IPKB 1JYVA 5E2WL 1ORSA 1ZHKB 4QRRE 4BSVB 2XWJA 4P59H 1FL3B 3MLTA 1T83A 5EU6D 1CK0H 3SKOA 2EYTA 3VFUA 3TN0C 1DZBA 2EC8A 2I60L 1K3IA 4P2YA 3FAXA 5HHVL 1FN4B 4ONHA 5AUMB 4KJQC 2BJML 5GIRA 3HHRB 4DCQB 4HH9B 1T0PB 2XTLA 4PJCF 5LBSH 4KMTH 4K3EH 5C08B 3UCRA 4QOKB 4XP5H 4XPGH 1NSNH 5IEKA 4GG6B 2HG5B 4D3CL 2FX8L 4PJHA 1F97A 3MODH 1GCFA 1MI5D 1JJUA 2BNQA 3HR5B 3MLVL 3SKNB 1ODAA 2D7PA 2I9TA 2Q1EA 3EO9H 2VSDA 3W9DA 3QNYA 3IJSB 2D7QA 1MY5A 1WWCA 3MR9A 4MAYC 4G42A 5ID0A 2LU4A 4FQHB 4PJ8A 1TIUA 4JVWA 4PGDB 4XNZB 4NBYB 3RWCB 3E2HB 5E9DD 1LGVA 2OTUA 4HCRA 5D7LE 1J0JA 4RZCA 1JF6A 1UH2A 2X4OA 3ARBD 1U2CA 3ZKMC 3MXVL 5HHNA 3EYSL 1AD9B 1QHOA 1A0QH 1JPSL 4FQ2L 4PY7A 3WIHL 5E94B 5E9DE 4N8VG 5C0CA 4TRPL 3QP3A 3K2UL 1OAQL 1CL7H 1I1AC 1EBAA 4AQOA 4J2XA 2Z31D 2W0KA 1D9KC 5ESQA 2QQKL 4YZFE 2NTFB 3QQNA 4QHLB 5C3TA 3TYFB 3CFEA 5IVXF 43CAA 1X6LA 1IARB 1JIBA 3RKDC 1HHIA 5SWSB 4JFOA 3SKMA 1DVFA 3ULUH 1PKQB 2J8UA 4JFEE 1I9EA 4UDUA 4O51A 3SPVB 5GGUB 5I74B 1R3LB 2H41A 1XGRA 4OUUA 4P3CL 3F7QA 3OJMB 4U1NA 3REVB 1R3HB 3QB7C 4M1DL 5AWNH 5T1MA 4B7LA 2DTMH 4KWUA 5I75B 3FQNB 3G08B 1BD2D 4XP9H 3VXMD 2RCSH 1J05A 4LASH 2A83B 3FN0H 3QAZB 1NCBH 3B2UC 3BP5A 2PXYD 1QEWB 4GMTH 3V9FA 2YN5A 4PJGA 3P9WB 1KELL 2YD7A 2FEEI 3BUTA 1TXKA 3CMOH 1SBSL 2YPVL 1ED3A 4V2BA 1NGZB 3O3BB 4LMQE 1U8JB 3MRFA 5MEQA 2EECA 5DJ0A 5EC1B 4GBXA 2WNGA 2FYYB 4XNYH 4PJAE 3DVFA 4CVZB 1FRGH 2B1HL 1KTDB 4ZAKA 5I1GH 3U7YL 4DVRH 1EAPA 4ODSL 4HIXL 3V6OC 4LVEA 5KSUB 4OM0L 4CMMB 5T3XD 2H32H 1J8HD 3NMEA 3BKJH 4JM2C 5E5RB 5ISZD 1ZWIA 4GW1A 1ORQB 2COQA 1P7QB 1TQBB 5AEAA 2Z0BA 4O58H 1P2CA 3ARDA 4MSWB 5L2JB 1CLYH 1P7HL 2X4PA 4ODUA 2Z9TA 5C2BH 3BN3B 5ISZE 4C59B 2X70B 4K07A 2XNAA 1RHHA 4OTXH 5C09E 4OCXL 4F3FB 4WWID 4ZDHA 3O4OB 4CUCA 2CDFB 1C5DA 3QG6B 4K8RH 3BPCA 4HWEL 2OTWB 4CVWA 3RVTC 4WEBH 3PP4H 2IPTH 3MA7A 5ID1A 3QUZB 4M1GH 4YXLH 4MXVE 4KHXH 2IAMB 4BQ8A 3QA3B 3WD5H 2GAZA 1OQXA 5C0AA 1AO7E 4ZFGH 3VXTA 2QHRL 3DHJA 2AJ3A 3HNSH 4XC1L 1JPTL 2X89A 4HKJB 3O9WD 5B39G 3NFNB 4NC1C 3SCMD 1F5WA 1TCRB 1G7IB 5DHVB 2DQUH 4OBSA 1Y6NR 3P73A 4Q6YA 4NPYB 3RNKB 4AK1A 2Z4QA 4L4TE 2BSED 1MJ8L 1I8LC 1UACL 4NN6B 4HS3A 3UJIL 4LLDA 4MCYA 3GSNB 2P24A 1I9IL 1T1XB 2PR4H 3C9NA 1DCLA 3RTQD 1LE9A 1VDGA 4XBGB 3OWEA 5IG7B 3JSSA 4URTB 4JY6A 5I16B 1ONQA 4OLZH 4LHJB 1AR1D 2DYPA 3DV6B 5D7KE 5JIHA 1IC4L 1JNHA 2G60H 3LEVH 2EDNA 1IGYA 4QT5B 3NN8B 4MZ2A 1I3UA 4M00A 3ZYJA 2EIBA 5FYLH 3S35L 4FQXD 3HG1B 5E1AA 1H8NA 1XIWD 4ETQB 2P7TA 3SE3C 2FZ3A 3IXTA 5C2UB 4MYWB 1D5MA 4NZDA 4CADA 5CJQH 1OGAE 3G5ZB 5IFHL 5GGVH 5EO1A 5CHNA 1JGVL 5T1LD 2ATPA 2A0LC 4PJ7E 3WHXA 2YWZA 1FORH 4L8DB 3EDDA 4G8EA 4WHCA 1YYMH 4O2FB 3TT1H 2GK0A 3RWGA 2HRLA 1H3PL 3Q2CA 1IM9B 5SV4A 2IFFL 2I26N 5JA9A 2AJXL 4OFYA 3TZVD 4J4PC 4NKMB 1H3WM 3SJVB 5CD3B 5E00B 4HG4J 5H2BB 2OXGA 2FEDC 5BRZB 2YPLE 3CFIC 2VERN 5DHYA 2BNRB 4R7NA 3UTTA 1NLBL 1IGIH 1IM3A 1G6RH 4XVTH 3IU3B 3RGVB 4Z7UF 5DYOA 3PGFL 5F3HA 1RK0A 5T5FL 1HSBB 1XR9B 1JHLH 2Y1VA 4KRPD 5FGBA 3RPIB 3I02A 5MEOA 1IFHH 2C9AA 4W6XB 3N9GH 3R0MA 4LCWE 2DS4A 1GZQB 4I18B 4NZRH 3VWJA 4UZGA 4Y5YA 4LPTA 4R4FH 3MRLB 4DOHB 1CF8L 1JZ6A 3QIUD 4OLWH 3HE7D 2VLKD 1UCTA 1DEEA 1PAMA 2XRAH 5FA3A 3CH8A 2AJUH 4MJIB 4Y4KD 5IHBA 4QXGH 3KYKL 4KZEL 3S5LB 3HAEH 2X4RB 4JVPA 4PY8J 5E5UB 2AJZB 2B0SL 4H8WH 3CH1A 4X6DA 1RULH 2NY6D 5I6XB 3H3KA 5C3LD 2YWYA 4NWUH 3L3OB 3QEQD 3VGEA 3ISWA 5F9WB 4V1DE 5KOVC 3FO0H 1KPUA 5FO9A 3EGSA 4AT6A 1VEPA 2F5BH 5B22A 4IRSB 2VDQH 5EN2B 3KDMA 3TBSB 5BVPL 3TBYB 2IADA 2K7PA 2O61B 3ARED 4XMKL 4EIGB 2YKLH 3UBXA 4PLJD 1F4HA 4JKPL 4N0RA 1MLCA 1KT2A 3EZ8A 3U0WL 5J11B 2Y5EA 3R0NA 4RWYL 4WHYH 5I30H 1NGQH 1B0GA 3ESUF 1YEIH 1EIBA 1BM3L 1OAZH 5I1JL 3KNBA 5D2NB 4HWBA 4PRAB 4ERSH 3F5WB 2RJMA 7FABL 1U93A 3FZUD 1WBZB 3SDCD 2PYFA 4IHOA 4G8FB 5FCUH 3TV3H 1F8TH 4P9ML 4PJEF 2NX5D 1HNGA 3L95B 2B7DT 4H20L 1IC7H 1AIFB 3QWOA 2AK4D 5TH2B 4L9LC 2OJEB 3ZE2E 1K4DA 3QI9A 3FB8A 3WDHA 4KTEL 4HKXB 2A1WH 4KVCL 2B4CH 5GISH 5ACLA 2JELH 3BZFA 3VFRA 2P5WD 3O3EB 4NRYA 4FFWC 1T2QL 3ROOB 3BGFB 3S97C 1T1YB 3DECA 4HS8L 4UQ3B 5ICZA 3TN0A 3ZMRA 4DZ8A 3V8OA 4O2EA 4R4NC 4WJ5A 2P8LB 1L0YA 3B3IA 5FUCC 1II4E 4I2XA 3RP1A 4L4VD 3U83A 4C56B 2E5EA 2HVJA 5H94A 4U7KA 1IEAA 4KMTL 1U92A 2E8ZA 3CCHA 5CEZD 1NSNL 1J1XH 4LLVB 1YNLH 2CIKA 1A2YA 4JKWA 3ET9F 3QULA 5CD5D 1J1PH 5ABDE 2UWEA 2YD1A 3EO9L 1PG7X 3OR6A 4JQIH 2QR0B 1I7UA 4QRUA 2GCYB 2FSEB 2JKXA 5I1CH 1KGCD 4FQLH 4MAYA 4YBLB 2CMRH 2UY6A 3MPCA 1YC7A 4R96A 2YRLA 4YGVB 1UEYA 1MFAH 1QSED 2FJFA 5L2KD 5JHDD 4CBPA 1RZIA 4OZHE 4U2YA 2DIJA 4K2UL 4K7PH 4KC3B 4L3AA 4X4YB 5EG6C 1Q38A 3IDGB 1TZHA 3BPNB 3ULSB 1I7TB 4X5XB 1IGTB 1KGCE 1OT2A 5F6IC 4HQQL 1E4KC 1QSEE 4MQXD 3QCUH 1SM3H 1A0QL 3RY5A 3MRHB 2G75B 3JV6B 3LN5B 5A3IC 1I1AA 3BISA 1FZMB 4PR5A 4QRRB 4U6HA 4PGZA 5DVOA 3RY6C 3BD4A 2B20A 2D7OA 5EUOF 5KSBA 4XI5C 4A6YH 1L7IH 2MQ0A 5ALBH 4S2SB 2OLDA 3BI9X 4OIIL 5E2VH 1P69B 2F19H 3UZQA 2VR5A 1T21A 3ZL4L 3ZT5A 1I3GH 2BY0A 1DDHB 4GUPA 4M5YL 4ZPTB 3ULUL 4FXGA 1FAIH 4KGLA 3PWUB 3OKOB 4JFFD 3WNLA 4JB9H 4P5KA 3B5GA 3R1GH 2BOCA 4LCYA 3DX9B 4ODTH 1M05B 3EOTL 4X8JB 5JIIA 2NXZD 3U7WH 2FIRT 4F57H 1VKXB 3GBMH 4P4KD 2XN9A 4PPTA 4FQPA 5AWNL 4JY4A 2N56A 5IMMA 1FH5H 3GBLA 1WVZA 2IBGA 1FFRA 1XF5B 4X5WB 1HSAA 4X9BA 1CG9A 4XP9L 1W72A 2RCSL 4LASL 3FN0L 4PREB 2XV6B 1YN7B 1YEKL 1NCBL 1KEMH 1SYVA 4GMTL 4IOFC 2D3VA 3MO1B 3QJFA 2QKIB 1QSFA 2NNAB 2WBJA 1YQVH 4D9RE 1ROWA 5D7LB 5C0IA 3RZCD 4U1KA 1OTUD 1MH5A 1OSZB 1FDLL 5IB3A 4XGZA 4IRJB 2DMKA 5GS2H 2AEWA 4LLMA 2F15A 3MUJA 5KN5B 3BN9C 4J8RB 3RJQB 1QBML 3HNVH 3DX7B 1CXEA 4OZ4B 4XNYL 4NJAH 5E9DB 5J89A 4KZDL 1FRGL 3EYVB 1CL7I 4GS7C 3RWEB 5F1KC 3V6OA 4YIQB 3WXWH 1WTLA 3PWPE 1T0NB 2FX9L 4U1GB 4X6BA 4NDMB 4DK3A 1I8KA 4JM2A 3C08H 2VL4A 3BKJL 4FMKA 4XP4H 1A3RL 2AKRA 4JFEB 5DJ2B 1EXUA 1WIUA 3P77B 3IFPB 4O58L 3SGEH 3GKZA 3Q5OA 3HMXA 4PJDB 5D93C 4LAJH 4LIQE 3RWHA 4P57A 1XGPB 2VLRD 1YNTA 4PYHA 2IQ9L 4NJ9H 2GITA 1OY3B 4GXUN 2B39A 5C2BL 1JPFB 1JV5A 5DK2A 2IANA 1SJHB 1FZJB 3KPMA 3UDWC 4C54A 5F7HA 4GKZA 1OAXL 3MLZH 4H1LA 5EO9B 2VLRE 1INQA 2JJSC 4K8RL 4FFZL 1IGJA 3RL2A 3ARGB 4H26B 3DIFA 4JAMB 5CAYB 4WEBL 3PP4L 2IPTL 4ZUVB 4BQ9A 2EYRA 4PGBA 2FJGA 4LSQH 3TO4D 1AGFA 4D9QD 5C6WH 1WISA 4ZFGL 3HNSL 2AJYH 5DVKA 1WSST 1WJ3A 4YHNB 1JZ4A 3VFNA 4Z7NF 5E6ID 1KC5L 2C4FT 4HZLB 1WIPA 2PETA 2NW2B 4FQQB 4PRIA 4E9LA 1K5NA 1HHGB 2A6DB 3RWFA 2QSCH 4Y2DC 3EDEA 3BRDA 2FX7H 5C0EA 4KDWA 2W0FA 3B9KB 4X7FC 3CFBB 4OLZL 2ICEB 1U95A 3ZDYF 2G60L 3ZDXE 3LEVL 1S9XB 1WQVT 1NGYB 5ACMA 3FQTA 1D5BA 1F90H 1LD9B 1Y0LB 1EFXA 3LQMA 3MNWA 4P5TD 4JN2B 5GRYA 3CDGB 4GRLA 3SE3A 1IZKA 4P46D 4PRPA 3OPZL 5ISZB 3ME0A 5EZOH 3ZKND 1M7DB 3VFVB 1E6JH 4PJIE 5EDXA 5C09B 4U1JB 4G43B 4OZIA 5GGVL 3W5MA 5T3ZE 3RU8L 5J6GA 3L5JA 5IV2A 3D3VA 1FORL 2L7UA 3WN5B 2MSPA 3E0GA 4U1MA 2PYEE 3TT1L 2HVKB 5JMOC 2R56H 2VZOA 4JG1H 3V0WH 2ZCLH 1AO7B 5DJXB 4J4PA 5B38G 4QHUB 4L8BB 1J9CT 1WF5A 2A6JA 3UJJL 1MCPL 2YRZA 35C8H 4GG6F 2Y72A 4K94H 3G5VB 3I75A 5BVJB 4L4TB 3RX8A 5C9JB 1LE5A 4FOMA 1BJ1J 4KRMB 4PLKD 4XBEH 1ZHBB 3CSBA 1G6RL 4JPWL 4G80B 3T2OA 2NY3D 1AY1H 2ZSWB 3O4LA 1NEZA 3KLAB 4RX4D 3ZTNH 1JHLL 1QFWI 4RWHA 3IAQA 1BZ9A 5L0QC 1CDYA 1IFHL 1A6VH 4OCWH 3D18B 2IH1B 1E28B 1DQMH 4QF1B 1Q1JH 3JXAA 1NCCH 5E70A 2DWEB 1J12A 4XTRD 4OLWL 5L7XH 4KK9C 3NCMA 2XRAL 3GMRA 1DUYB 5TDOB 1OGAB 5KVFH 4NYLA 2Z91A 4PJ7B 4WW2C 4XVUD 5D1ZD 1RULL 1KB5A 1CTOA 1XIWB 3IDXH 4E5XB 3D87B 4NWUL 3NH7H 2R2HB 2Y6SC 1NLDH 4WFGE 4G5ZL 4JPIA 2D4DA 1N64L 3WSQH 1L4IA 2VDQL 3AS3A 3S8WA 1WFOA 4NRXB 1X7QB 1UCBL 4XC3H 3ZYIA 4NQCE 3FB5A 2YKLL 3GKWL 5FAAA 4M02A 4G6KH 2BVQB 2J5LB 2I25N 1IVLA 1CD8A 2YPLB 4Z7VA 4Y5VC 5C1MB 5IMOB 1PFCA 1MCJA 3F12A 2D31B 3GMPB 3L9RA 5D5MA 3IDYC 4M6NH 5HGAB 2ZG2A 4ERSL 4PJBE 5CCKL 1R3KB 5LQBH 3NZ8A 1KYOJ 5CSBA 3T2NL 4XXCC 4IIQB 1JZ2A 1R0AL 2HWZH 3HA0A 5FCUL 4C57C 1JTTA 1F8TL 4LCWB 2D03L 5EZLB 2XZCL 2CUMA 1FNFA 3N1GC 3S9DB 1J87A 1IC7L 1SJEB 4L9LA 3QUXB 3MROB 5KSAB 1QRND 1C7TA 1RJLA 2A1WL 4GKOA 5GISL 1AGDA 1JHTB 3V5KA 5ANMA 2BFVH 1AQDB 2MKLC 2H1PL 5DTFA 3MC0A 1RV6X 1UG9A 5CKGA 3TA3C 1OM3H 5ERWA 3EYFB 3MREA 5FO8A 5HI4C 3MUHL 5EFIA 2QSQA 3O2VL 3FHQA 4V1DB 4CMHC 1A4KA 2HT3C 1G7JB 2HLAA 4L29B 5J6HA 3RI5K 2ITDB 2AJSH 4L3CA 2AXFA 2CKBH 4G8IB 4R2GB 4RCAA 5HHMD 3BP7A 3ULUC 5D7JC 4ZSOB 1D7FA 3BH8A 3KJ4C 5J9PB 4PRDB 1IAOA 3FTGA 3V4VH 5I1CL 4X8XA 1ZS8A 5I1EH 1FL6B 3MV7D 4KI5C 4P2CG 4GW5B 1KLUA 3WIIH 4MJ4A 5I1AB 1OF2B 1BVKA 3K74B 1JWMA 2CIIB 2BSRB 4NOFA 3VFSB 3GJEA 3ARRA 5DMGC 1O0VA 1E4KA 4HUMB 1FO0B 3UP1A 3QCUL 1SM3L 2EZ0C 3PWNA 1KEGL 4XAKE 1OTTC 3JTSA 1F58L 4ZO8A 2R69L 4F58H 2ARJQ 1RZFH 2AW2A 3CX5K 4C55A 3GRWL 3TBTA 3GO1H 1JUFA 3QIBC 3UO1L 4A6YL 5IVZB 2XKNB 3Q3GA 3HC0A 5CIPH 5CILH 4QNPE 1I3GL 1MCWW 3MZTA 1Z0MA 2BOBA 3L3HB 2ADGA 1UB5B 2OMBA 3NACH 2VXTH 3WS3A 3O0RH 2IFGA 4HUVA 5IW3A 3W81A 2DQTH 2VLJA 4JB9L 3H0TB 4MNGE 4ENEC 4ODTL 4WI8A 3NA4A 4LPYA 2IWGA 3HNTL 4LP5A 1JZ7A 4F57L 4DUXA 1ACYH 2H6PB 1KENL 1FH5L 3QDJE 4ZUTA 3OB0K 3TH2T 2VL5A 1U8LB 1KEML 3QDAA 5KW9L 1FPTL 5TGBB 1NCTA 3FOLA 4JZJB 4K8RC 1RZ7L 1XAUA 3CSGA 1W0YT 2PKDA 3VXSA 3VXOB 4KY1H 1QSEB 1GL4B 2I24N 4OZFG 2J6EH 3HB3D 4UT6H 5EU4A 2UV3A 3V0AC 1N59B 5E8PB 4I1NB 3ALPA 1KIRB 1CFTB 4NJAL 3TWCH 5C9KA 1S9WB 3MMEA 4X80H 1CXLA 1R5VA 1Q9LA 1ULVA 3MRKB 3TCXA 1MHHB 4UTBL 4BK4A 5KTEL 4X83A 3WXWL 1ZLVK 2AAVA 5IHUH 3QUYC 1T1WA 2YXMA 5TDNB 4YGAB 2VXQH 3C08L 4W81A 1MCQA 1H15B 2CLRB 4FFYH 1ZT4B 2Y7QA 3S88H 4MMZC 1ZGLB 3TT3H 4X99B 5HHPB 4M43H 2VZVA 1INEH 3AROA 5F7EH 2VAJA 3B6SB 4Z7OE 4NJ9L 3IFLH 1CFSB 1N3NA 2HN7A 3QHFH 1X5LA 3DXAD 4N0FB 5I8CB 2XPGA 1T1ZB 3UDWA 1Q72L 2D0FA 3DYPA 3DJ9A 4GAGH 1FJ1A 1VADA 3OAZH 3KWWA 3MV8D 2JJSA 1ZA3B 4NUJB 1MCSA 4PJXA 3DXAE 3M1BA 3KR3L 5CWSA 5DEZA 3HTLX 3CK0L 5M95B 2VDNH 1OTSD 3BQUC 4JFDD 2DN7A 2V9TA 3O3UN 4G9FE 4LSQL 4MDIA 4MJ5A 4TSCL 4DGVH 2AJYL 3ZE0E 1EGJH 3O6FB 1RSFA 2Y06H 4LHUG 4ZFZB 3CSYB 4ZUSA 1YN6A 3MGOA 2FBJH 1D5XA 2ZOKB 4Y2DA 2P48B 8FABB 1X44A 3PWPB 3VXQA 2FX7L 3P0GB 1CGXA 4QRPA 2P44B 3GSWB 3DROB 5DC0A 3HI6L 3OGCA 3QDGE 2ENYA 3UX9B 5HJ3B 3LPWA 4K23H 4G3YH 3SGEI 4F7CA 2BNUB 1MJJA 2NXYC 1PG7L 3BDYL 1F90L 3PGCA 5HYSA 3SKUD 3CXHK 1K9TA 1F4WL 3VI3E 1LEIB 1MUJB 2ESVE 5EZOL 3KPQA 1TNNA 1U42A 3GMOA 1E6JL 5IM7A 4P3WA 3STZB 3C09B 2VLRB 1HHHB 1NGXA 4XMPH 4WTZG 1RJYA 1IBGH 4UILH 2Q6WA 4LSUH 5I9QC 5KVGL 1XH3A 1ZLSL 3FB6A 4JG1L 4JFYA 4H8WC 2G2RA 3G6JB 3FN9A 5AZ2L 2UYLA 5JA8B 2HFFB 3BP4B 2YSSA 2WV3A 5JOPE 2MQCA 3FO9B 2X1XR 5SWQA 4G9DB 5LAXB 4QHMA 35C8L 2VXVH 4X9FA 5GGRA 4K94L 3QHZL 4XWOC 2BNQD 2C3GA 5DUPH 1XF4A 4Y19E 3F7VA 1RK1B 5F3BA 4XBEL 1V7NH 1M7XA 1AY1L 4K55A 2OL3B 5E6IB 3K46A 4PJ8D 3VD5A 1R6VA 3GB7A 2XG5A 2EEAA 1A6VL 3BIKB 2E7HA 1NJ9B 1V3JA 4Z78B 2V5SA 4XH2B 2VUYA 3C5JB 3B2VL 1B90A 1DQML 1Q1JL 3ULVF 5HGHA 1NCCL 4YXHH 1CICB 4F15C 1DQTA 5C0CD 3L5WA 2JB6B 4NNXB 3PV6B 4AEEA 3T4YA 4PJIB 3HFMH 4LNRA 4MHHG 5DJ8A 3RHWK 5KVFL 4XHQA 4WW2A 3QNXA 4OZGE 2B4CC 3VXNB 1YA5A 2SEBA 5AD0A 1PW3A 3GGWB 2JLLA 3O3DB 3IDXL 4JRYA 2PYEB 1DVFD 2B1AL 4TPRH 3N06B 4RRPA 5GZNC 1NLDL 4OLYH 1DQJA 3W0WA 5J56B 2OQJB 3DNKA 4NM8H 3FO1B 1FZOB 3PDGA 2HTKC 4WV1C 4ZXBC 4MXQD 4R4BB 4X7TB 4HIIA 1JNNL 4Y5VA 5HHOA 1AHWB 2KZWA 4MNQE 2BRQA 3S3JA 4B50A 5GS0D 1UEMA 2IH3B 3O45A 1EJOH 4M6NL 1K4CA 1KJ2B 4BH7A 1P7KA 3MRJA 1CCZA 4QXWA 4XXCA 5IHZB 4GKSB 5FOBB 2E8YA 5IMKB 5E8DH 1OB1A 3MACH 1S78C 1BOGA 3KPOA 4AEIH 1Z3GH 1ZAGA 2V2TA 1NC2B 4L5FL 2FL5A 1CQKA 1I3RB 2BVEA 2GW5A 1X5HA 5H35B 4GBXD 2AK1H 1U8NB 5F21B 5HD8D 4ZAKD 3TBWA 1FNGB 1NFDA 4HPYH 5EPMA 5IBLC 3I6KA 4RQQB 4Y4HA 4WGVB 3ZZ1A 5BV7B 4U31A 1T5WA 3TA3A 5EOCJ 4F37K 1FFPB 4YZFF 5C0BA 4Q9CA 5MI0B 2MJWA 5HDOA 4LU5L 4NCDA 1HDMA 3NABH 1RUAL 3T4AB 2O5ZH 3ARDD 1P4LB 2NY2C 3BEVA 4DGYH 1N4XL 2FECL 2G5BB 5FECB 4I48A 4NQCB 4B0MM 3M45A 2CKBL 4NZUH 1HYSD 1KJVA 5D7JA 5K9OA 1J86A 4KKBD 4OGAC 1KACB 5DXWA 1UT9A 5JZ7C 1QHPA 4E0RB 2R1XA 2H2SC 5JDJA 2Y25A 1YEDA 4PJBB 3V4VL 2AI0H 1YY8B 3MJ9A 4KRNA 4S1SL 4XP1H 5ENWB 5FDWB 2FGWH 5CZKA 3RIFK 1I7ZA 4CAGA 5ACZB 3UTPE 4JREB 4QTHB 4KK5C 5C0AD 1FG2A 3MBEA 1PG7W 3WIIL 1FGVH 5DJYA 2X89D 2ICWB 4ORGA 4TVPH 5F44A 3GSNH 3TO2A 4U1HB 1V3KA 3SBWC 4JLRA 3LS4H 5A16A 3NFPA 1KUMA 1NCWH 1PGRB 5C0AE 1KNOB 4PJAF 2UZXB 2R29L 3W82A 4PRHA 3N0PB 3RVXC 1RZFL 4J7RA 4N8PA 5HDQL 4TYUA 2DM4A 3QIBA 2F8XC 4GW4B 3CUPA 2DYPD 4JQVC 1IGCL 1GJIA 2C3VA 2HJFB 5CILL 1AE6H 1G7PB 5EC2A 4AL8H 2J4WL 3MRIA 1T66C 1MVUB 2VXTL 2V17H 2H32A 3ZKXB 3MLUH 1QFUL 3WS6A 2DQTL 5JPMA 4PP2B 5EBWA 3SE4C 1ES0B 4NCC1 2XWTA 3T0VA 4PB0L 3V5HB 5FDYA 5FUZL 2EDFA 1T4KA 3WHE0 4I3GA 3ILQD 5F93C 1BBJB 3G9VA 1F4AA 1IKNC 3WO4B 5SX5H 4J3OC 4MJ6B 3QFDB 2Y36H 5LGHH 4LPUA 4NQDE 3LN4B 3PV7A 2Q7NA 3PJSA 4OFYD 3O6KH 4S11A 1TJGH 2YPKA 1Y18A 5TQ0H 3O3AB 3OKMB 4RIRB 3WCYA 2X1WL 2KDGA 5BO1H 5CP3H 4NO2A 2E6QA 4PV9B 4LEXH 1PZUB 3OKNB 3X11B 4XCEA 4JDTH 4JJ5B 2GSIA 3UTTD 3OBAA 4PG9A 3U30B 1VGKB 1X5FA 3TEUA 3QH3B 4LHUB 4NQSB 4WTWA 1LILA 5IOPB 4MDJB 1EUTA 3OKLB 3B5HA 3QUYA 4GO6B 5F1OB 4E41A 1LNUB 2X6MA 5JXAH 3QXDA 1IAIH 1A9EA 1W0VB 5L6YL 5T1KB 3PQYA 5F89B 4FFYL 3LQZB 4OGZA 3VWJD 2FHBA 5BJTA 4EBQH 3LIZL 4XCYA 2A74A 2LTQB 3S88L 4HAGA 1TVBB 4ELKA 2XTJC 2KH2B 3CC5A 4ODWB 1B2WH 4MNGB 5IEHB 4M43L 4RGNE 1G84A 5F7EL 1GAFH 2LABA 5IK3A 2MCPL 4M93B 3I9GH 3KPPB 1D5ZB 1E27B 3QHFL 4OCSH 4YDVB 3BYTA 2VAAA 3KYOB 2XY1A 3QDJB 2P45B 1WAAA 3VFTB 1QLRB 2NR6D 1OSPL 2BSTA 4PJ7F 2NY1C 2X7LB 2GTWA 1JWSA 3L3IA 5CGMA 1U6AH 2V9QA 5DS8B 2YMXL 3ECBA 3BQUA 2KQNA 4NNYB 3EJYD 5EOTB 43C9A 1UJ3C 5CBAB 2OR7A 4NO0B 2LVEA 3BMWA 3FQXA 3MBXH 1WEJL 2Z92B 5DDHB 1DR9A 2VLLB 3D85B 1PEWA 2Y06L 1NUGA 3WUZA 3DOSA 2Q86A 2ZNWA 5DRZB 1EV2E 3ES6A 4CN6A 2FBJL 1U8IB 3L6FA 3LSOB 1DN2A 3LD8B 1LO2H 5DEGA 3BT2H 3U0PB 4L1DA 2VR4A 3Q6FA 1RUQH 1U91A 3BP6A 4ORZC 3SDXA 2UVFA 5F7MC 5E8EA 5DJDB 4NQTA 5JOFA 1WICA 1RIVH 3U2SA 1HINH 3W11C 3HZVA 4KV5E 5AAMA 3QI9D 3LRGA 2XXMB 1OPGL 3WHE1 5SWZE 4FFVD 2VUOA 5JW4M 1ZHLB 3MRRA 1ZT1B 4J1UB 4CU6A 3QUML 4NN5B 1X5ZA 3GM8A 3VD3A 2OK0H 1F13A 1KPVA 3G5XB 3W9EB 2I5YH 3RWDA 5BZDA 3TN0D 1DQDL 2P1YA 1JYXA 3KPRB 4FP8L 3U46B 4XMPL 2HT2C 1D5IL 4KJQD 1IBGL 1Z5LA 4B41A 3DXAB 3MSPA 3BKYH 4WU5B 3FFCA 3O11B 4HC1A 3MJ8A 5DGQA 4HW6A 5HDLA 4KKAD 2B5IB 4G9FB 5TE6H 1RJCA 4YHLH 5DURD 3K4DA 1N26A 3PIQB 1CGVA 3EUUA 3SE9H 5KVEH 5DMIH 1U8HB 1G7HA 3RQ3A 3HRZB 3JUYA 5DUPL 1Q9KA 3IAGC 5ITFA 4FN0A 4MAYD 4ONGL 3VFWB 4JFQB 1MCWM 4LSPH 1V7NL 2BMKB 3GSRB 1MRCL 1E4WL 1H5BB 4JANA 1KG0B 2EEBA 1VFAB 3C2AL 4NHCL 5FK9A 4MCZB 1OL0A 2ADFH 3LQAL 4MS8C 3ZE1E 4FQJH 4Z9KB 3QDGB 2V2XB 1UWGH 3KJ6H 4F7EA 3ZKMD 5EUKA 3V4UL 1NDMA 5I73B 5E03A 1ZANH 3K1DA 5CBEA 2EC9U 3ZE2F 1FC1A 4YXHL 2GY5A 2XFXB 3O41A 1JTPA 2ESVB 4EI5A 4PJ9C 5GRUH 2VE6B 1I1AD 1GVIA 5DJZB 3OZ9H 1XR8B 5F1SA 4D8PA 3NZHH 3E3QC 4UV4H 4XNUH 5FIEA 4U7SA 3RKDD 1WFNA 2R1WA 3BAEH 5E2TL 4PJCA 1HEZB 3LPFA 5EULV 3PWVB 1NFIB 5IESH 3OSKA 3PHSA 4PJFE 3M07A 1P1ZB 1HWHB 2ORBH 3FFDA 4TPRL 5C8JA 4OLYL 4QRTB 5J1AB 3VFUB 5BZWA 1EEYB 4OLXH 1N5YH 4BFBD 5CZXC 4X0KB 4WV1A 4IM8A 2HJLA 3VWKB 4ZXBA 3WNPA 3U6RA 3K2MC 4UMGA 2XN9D 3UBXG 4NZJA 4YWGL 4TUJA 1U3HA 1X3DA 1A1MA 3GFUA 3NPSB 5I66A 3C8KA 4Y19B 1AGBB 4RAUA 2DOCA 1UH4A 1SQ2N 4LCCA 2IMMA 5DRNB 1FVDA 3ARFB 5HHQA 3B2UD 2ZP0T 1CYGA 3JV0A 3WEXA 3TC9A 1MIMH 1F3DJ 1QSFD 3VXRD 2HFEA 2WBJD 3MV01 5FXCH 1RURL 4OZHF 4MLIA 5E8DL 4NGHH 5FYJU 4CW1B 5DMJB 4CGTA 3QUKB 1UENA 2R0ZH 5DI8B 4AEIL 3UTSE 1VA9A 5IBTH 2J7LA 3VGDA 1RJZB 3AVEA 3F7RA 1HXYB 3VXRE 2AK1L 3BPLC 1GSMA 2Y23A 5DD1H 4FRWA 5KS9A 4JFXA 4Z7WE 1VFBA 2ATKB 1U8QB 3HPJB 4Q0XH 4Y7MA 4HPYL 3PABB 4XNXH 1CLOL 4UT7H 4OZGB 1C7SA 4LGPB 5A2FA 2NZIA 4UAOB 5D7SL 5IB2B 4JM2D 3MV9E 4Y5XB 1I9RH 2FHCA 2Q76B 3NTCH 4OCRL 4AEHH 5IVXE 1BLNA 2FDBP 5MENA 4F7PB 2NY4B 5JDSA 4DGYL 4A6YA 2RR3A 3H9SE 4FMFA 4OGYL 3MUGB 5E2UH 2BX5A 1DBBH 1LEGB 4NZUL 3SKMB 2CUIA 3PXJA 1PX3A 1L9NA 2IAND 4MNQB 3PWJB 4WGWB 5SX4H 4P2RE 4F2MB 1CT8A 4I13B 1GHFH 3I50H 1YMME 3RVTD 4XP1L 5ESVA 4H0GA 1QACA 5T1MB 3B8SA 3TNMA 4HIJB 4DUVA 3H9YA 2GJ6B 4UB0L 1G9ML 2FGWL 2B2XH 3K4ZA 1T3FB 5EU5A 2X2YA 4QXUH 1I8MA 3D69A 5IWLC 5TE7H 3LKQB 3SBWA 4BZ2L 4MVBD 5TF1H 1C12B 3EO1B 1K8IA 1QR4A 5EOQH 2V7HB 4Q74A 4PRID 5F9JA 3K80A 5T5NF 4XBPB 5ICXA 1HI6A 3H3PH 3K0WA 5DJ0B 5F88A 4Y89A 1T7XA 2CLZB 1YJDH 1N5AA 4JQVA 4X5LA 1YEFL 5C0FA 4Y4FB 2V7NB 4KDTA 4DWHA 2RQ8A 4KROB 5BW7C 2R23B 1AE6L 1MFDH 4Y16C 2APVA 4AL8L 1I1RA 4NNPL 3MRQB 1C16B 1EFXD 2V17L 4U1IB 4Y1AE 4EN3D 3MLUL 4GRLD 3F58L 4YBQC 4PRPD 3ZLQC 4M8QB 4ZUWA 4HMDA 2J3SA 2E9JA 3L1OH 5IW6B 1R5IB 4N0YH 1WWWX 2GTZB 1UM6L 3SKJH 2B8OT 5ADOL 5C6TH 2YOCA 3D3VD 2KQMA 3B4NA 5F7KC 1NMAL 1RHHB 5F1NB 1FYTD 3CVHH 2NYYC 5BCAA 4J4PD 1O5DT 3MOBL 1H8OA 2XOTA 5TQ0L 2F53A 1AD0A 3GSUB 4AY0A 2WM0A 1JN6A 2FEDD 3MCKA 4F7MA 2BC4A 1FYTE 1HOCA 3U4EB 4ACPA 4U49A 3BSZH 1H0DA 4JDTL 4DZBB 4OAWA 5JLZA 9CGTA 5INDB 3O4LD 1LEKA 4FABH 1QFOA 4KGJA 4NBXB 3LKOB 4GRMA 1PYWA 2P42B 3DUUA 3P73B 4LF3B 2F9BT 4LVOB 2DQCL 1KJ3H 5JXAL 2X4UB 1MIEL 3CFJA 1IAIL 2XACC 1HHJB 3TCLB 2F54A 2A38A 1JGEB 3T0DA 1AFVH 4EBQL 3UTZA 4KKLD 5DQDL 2VOTA 4OM1L 5SV3A 4WTXA 2FLRT 2VTFA 1KXVC 5LGJA 3LKNA 1TTUA 5KAQG 4JZNA 1SEBA 3I9GL 1YC8A 4C83A 4OCSL 3S34H 4ZODA 1E0OB 4JR9H 5GGVY 4HUXB 5DRWB 4GXUM 4PJIF 2EKSB 3DI3B 2Q8AH 1KJMB 4KH2A 4H1LG 5GXBB 1ZXQA 4NQDB 3TH3T 3MLSL 3T0EE 1F6AB 1S7UA 1NPUA 5LGKA 3KAAA 3ARUA 1UKQA 4Z95L 2PO6B 5CHNB 3EOBA 4HGWB 3VXUB 2I07B 3WHXB 1A6AA 4QHKJ 1UJ3A 3V7AE 5JW5B 3QQ4B 2WP3T 3IRPX 4NIKB 3JWOH 4UOW0 2WQ8A 4Z7UA 4DKAA 2JB5L 1MFBH 2X1PA 1LO2L 3BT2L 4TN9A 3RWIA 4OCYH 2FH6A 5GS1C 1OAYH 2EXYC 3E2HC 5C7XH 3MNZB 2GT9A 5DEFA 1IAII 4I5BB 3P4OA 3BFOA 3TGXA 2QADB 5EU7C 1RIVL 2YUXA 3GBNH 3BW9B 4BYHA 1HKFA 1HINL 4JFPA 3TIEA 2OR9H 1NANH 3P9LA 3FB7A 1RFDH 4RGNB 3C6LB 2WIIA 3BWAA 2YS4A 2IJ0C 4FFWD 2R1YB 3WL9A 3X13A 3CXDH 1FHGA 5B3NA 1WTGT 2OI9B 3GMNA 1VACB 2VISA 3T09A 1AXIB 2CR3A 2I5YL 2FIKA 2L7JA 3IJHB 2DD8L 3NIDE 4G8GE 3UJTH 1BQHB 5HGDA 4Y0GA 4XNMA 3VFMB 3EHBC 3EYUL 4UOJA 3WFCH 3VJ6A 3RA7H 2GSGB 4XNQA 2VSCA 5BS0E 2C7UA 4GFTB 1OCWH 5JIKA 3LV3B 4GXVH 4OF6A 5I74C 1DSFL 1I1YA 1Z9SA 4M9PA 1WZKA 5GSRB 1HH9B 1AXSB 1MCFA 3LZFL 3J8F7 2G5RA 4PGEB 4JPVH 2APBA 4AMKL 2ZOLA 4MB5A 3SE9L 1IAKA 1KCLA 4DW2H 5I75C 3O81A 5JXEC 1PQZA 3KDMB 2K7QA 5DMIL 5BOZG 4JPKH 3QAZC 4OQTL 1WCBA 5D70L 3RVWC 3ULVL 2X42A 1MLCB 1LDPL 5K9KA 1FO0H 2IEPA 3WLBB 2PW1A 4YEFA 4M6MH 3IDNA 1Q8MA 4P2QE 1NEZG 2FCBA 1F11A 1RZGB 5KOMC 1XZ0B 2WIMA 5TPWL 3VDBA 3B5TA 1DQQB 4HXBH 1UWGL 4NP4H 4EUPB 2R4RH 1G0YR 4LQFH 4NQEA 1CD1B 3S4SG 3B9EA 3FQWA 2DF3A 2C1PB 1ERNA 4IHOB 5C0DA 5SWZB 4IOSD 3HUJE 4OGXH 5D7IA 4PJ9A 3MRPA 4WY7H 4YR6A 5L9DH 1G6RB 4J12A 5DUBA 2E7MA 3KYNA 3AY4C 2BY2A 5DO2C 4WI2A 2DQIH 1W0WA 4XI5D 3L7EB