4YHTA

Braf complexed with an inhibitor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
271
structure length
256
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHTNETKFEMTKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKGSILWMAPEVIRMQDPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPTFPQILASIETLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Serine/threonine-protein kinase B-raf
publication title GSK114: A selective inhibitor for elucidating the biological role of TNNI3K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
total genus 77
structure length 256
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yhtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yhtA01
4I22A 2KTYA 1ZAOA 2HWPA 4FTRA 4M7IA 4QMQA 5E92A 3EQCA 3UOLA 1GAGA 2W7XA 4YPDA 2BDWA 3G90X 2UVZA 3GENA 5K9IA 1Z9XA 5EI2A 3EL8A 3BYUA 2OXYA 4Z16A 3QZHA 2HELA 5I3RA 3NCZA 3KQ7A 5GJFA 2CMWA 3VC4A 2C5VA 2HZ4A 4L46A 4KBKA 3KF7A 4BICA 3FMJA 3BE2A 3LJ0A 4IZYA 5CU2A 1WVYA 3R9HA 4MCVA 4AN3A 2GMXA 4KUJA 5CTPA 3O51A 3SRVB 4EHGA 4GVAA 3UZTA 4MTAA 2BUJA 2JIIA 5A4QA 2W1GA 3POZA 2GDOA 3I7BA 1YXSA 4U40A 1ZY5A 3B2TA 4FV3A 5CT7A 4DF3A 5H8EA 2BALA 2B1PA 1FPUA 4JAIA 4JG6A 2BTSA 5AP4A 3R71A 5I0BA 4UBAA 3PY3A 3PPJA 4RX7A 4BWXA 5TT7A 3HP2A 4L42A 3D7TB 4RJ5A 4J96A 2CLQA 3PXFA 3SLSA 3UE4A 4EOIA 3TNWA 1B38A 2ZV2A 5HE3A 2R7IA 4FZ6A 4R8QA 4A07A 4G3EA 2VU3A 3PP0A 3SVVA 5IA3A 4RX9A 3EN9A 2G2FA 2O64A 4WKQA 2PZIA 2R4BA 4HW7A 3O71A 4RSSA 3DFAA 2QCSA 4APCA 1H1QA 3NW7A 3OG7A 3MH2A 2HZIA 3EHAA 3H4JA 2XM9A 1KE6A 3LCSA 3OBGA 4IJ9A 5CX9A 5CXHA 5TKDA 3C4FA 3FC1X 5EKNA 3ZFYA 1DS5A 4GW8A 4J8MA 5I3OA 4AGDA 2A4LA 5M51A 3T3VA 3TG1A 4O6LA 2E9OA 4GK4A 4KD1A 3R00A 4Y72A 3HUBA 4NM0A 4GG7A 5EHYA 5HO6A 1PXIA 3NS9A 3MVMA 5K0KA 5JFWA 3Q96A 2Y9QA 4EC9A 4D2VA 2GS6A 3EYHA 3QF9A 4IWDA 3CQWA 2BZKB 3MVJA 4BBEA 3EOCA 5JH6A 2O63A 2HIWA 1ATPE 4ANLA 2X9FA 4EHVA 1BL6A 5BVEA 3KN5A 4U41A 4O96A 3QUDA 2LGCA 4MAOA 5EM7A 3BU5A 1FMKA 4GT5A 4IZAA 3ZRMA 4QMMA 4G34A 3QRTA 4I6FA 4C33A 4QP8A 3UZPA 2I7QA 4QP7A 3COIA 4FV4A 2BKZA 3NNWA 3Q4ZA 5HKMA 4TW9A 4FIHA 3L9PA 5JFVA 4NM3A 3KRRA 4R3RA 4JVGA 5HD4A 4X2JA 3LW0A 3RWPA 4AW2A 2GNHA 3RPOA 3G33A 4P5QA 5AIKA 3ZEPA 4YZDA 2WXVA 3DKGA 3PE1A 5F9EA 1AD5A 1YXTA 2X39A 4F9AA 4PUZA 3R9DA 3C4XA 4I0SA 4KBAA 4HOKA 2BIKB 4O0SA 3EKKA 5CSVA 5HZNA 2CNUA 3IGGA 5GZAA 1OKVA 4XG8A 3KK9A 3P1AA 2C6MA 2GTMA 2H8HA 1Q61A 2XBJA 2J0MB 2CKQA 4K9YA 4Z9LA 3ZRLA 2XBAA 3JVSA 4D28A 5DE2A 5C8KA 2XJ0A 2ZM4A 4HGLA 2BDFA 4S2ZA 3VS3A 1QPJA 4CTCA 4DC2A 2OH4A 1OGUA 5AX9A 4FUXA 1XH6A 4P5ZA 5AM7A 3DTWA 4Z3VA 4EONA 2Y8OA 1YQJA 2J7TA 2V7AA 4IBMA 4X3FA 4FTJA 5ANJA 4E5BA 2UW3A 5J8IA 3VF9A 5J1VA 2QONA 2REIA 3L8XA 4H36A 4LRKA 4E8AA 5BYYA 3G51A 4U8ZA 4I0TA 4PDPA 4NJ3A 4HNFA 3ORTA 3TDWA 4BI2A 4Y5QA 3O0GA 5HCYA 5DT3A 2CNQA 2BFYA 2ZV8A 4QMUA 1ZYDA 3HL7A 3K3IA 4EKKA 3DNEA 4WHZA 3V5TA 5AIRA 4BGQA 2C6TA 5BNJA 1YI4A 3DJ6A 2GQSA 1JPAA 1RDQE 3PLAE 5IQEA 3W2CA 3VBYA 3CS9A 2QODA 3H10A 4CD0A 4OTHA 5CAVA 2J5FA 3EQPA 5HE1A 1K9AA 3N9XA 2CHLA 5I5ZA 2ZDTA 2OJIA 1OPKA 3FE3A 2NP8A 3UG2A 2WU6A 4NKSA 4IXPA 4I6BA 4NH1A 5AP1A 4FV1A 3R22A 3UQGA 3WZEA 5AWMA 3F66A 4FKSA 3QC9A 4CQEA 4FTCA 4UYAA 4EK4A 1QCFA 2IW9A 1OL1A 5FM2A 4AE6A 3PIXA 4ASXA 5M44A 2XEZA 3GU8A 5DH3A 4CYIA 1WFCA 3RPYA 4O91A 2BRMA 2GQGA 4AACA 1UU9A 1F3MC 4Z55A 2J0KA 3EWHA 4NFNA 3PE2A 2QU6A 4QMLA 2Q0BA 5E91A 4D4SA 4F7LA 5IF1A 2XKFA 1MRVA 3UOKA 4DTKA 3NYVA 3R30A 4YTCA 3FQSA 2WTJA 2QLUA 3WZDA 4FI1A 4RWIA 2PVKA 2OJGA 5CSHA 4ZSLA 3KN6A 3QZGA 1T45A 4FSTA 4CFWA 2YA9A 2XEYA 4YGAA 5DVRA 4I5HA 4IZ5A 5J7HA 4DFNA 2R3GA 4L01A 5HX8A 2O2UA 3P5KA 4HZSA 4XG2A 4WRSA 4L9IA 2VTAA 1R0EA 3V04A 3SGCA 4YJPA 2XZSA 2IVVA 3RK9A 5CASA 3S2PA 3D5WA 4ZTQA 3ZUUA 4DT8A 1KOBA 4BWPA 1MQBA 2H6DA 3QQUA 4IANA 5IQHA 4PMTA 2WMBA 4ONAA 4EK5A 1Q99A 4BKJA 3D5UA 5DEYA 2NNWB 1E1XA 4F09A 2O8YA 4CLJA 1VJYA 4XRLA 3PJ1A 4CVAA 5AAEA 4JX7A 1M7QA 5BMMA 3RAHA 1MQ4A 1UU7A 2PVHA 3ALOA 1ZZLA 3OOMA 5DPVA 4BCMA 4FG8A 3GGFA 3TXOA 4P90A 3MA3A 3H0YA 4R5YA 2XS0A 5CALA 2BVAA 1ZZ2A 3N4UA 1IASA 2GNFA 2C3JA 5A46A 4L43A 3QUPA 2PVNA 4JRNA 2C6IA 5B2MA 1FGKA 5J5TA 5G6VA 4PPAA 4BDCA 4ZXTA 3QU0A 3EB0A 4NKAA 4IM0A 2BIYA 4IMYA 2YIRA 3TV6A 3GVUA 4FEXA 4TXCA 4S34A 3R02A 5HIBA 2R3KA 4JIAA 2OJ9A 3D5XA 4YC3A 2P2IA 3FLZA 1H1WA 2C0OA 3HUCA 3FY2A 5KNJA 2XK8A 5FQDC 3GI3A 3ACJA 5EDPA 3RPVA 3GC0A 4JR3A 3IW7A 3WYYA 4ZTSA 3DY7A 4L7SA 4OTGA 3PWYA 2BFXA 2Y6MA 5FEQA 1JWHA 5KE0A 4DHFA 4DLIA 4F1OA 4EZ3A 1JQHA 4L00A 3OCSA 5EYMA 5BPYA 4GL9A 2LAVA 3HMMA 3S1HA 3TUBA 4CMOA 3U54A 5LARA 2B9FA 3FZRA 4OT6A 1WBPA 4DA5A 4RFZA 3NUUA 4GK3A 4LI5A 2WAJA 4BBFA 4BCOA 3FQEA 3HV3A 5DG5A 5EI8A 4CEGA 1XWSA 4D58A 1ZARA 5IQIA 1CSNA 4DE4A 3A61A 3EJ1A 3HKOA 3BWJA 4FC0A 4PTGA 1W7HA 2W4KA 4OR5A 4RA4A 3ENMA 4WG4A 2YITA 4ZSAA 2H34A 3ZTXA 3EN4A 2VN9A 1TVOA 3FMKA 3NLBA 3KB7A 1XH8A 2JITA 2XF0A 2UW9A 3COKA 3ENHA 2WD1A 1YXVA 3D0EA 3Q2JA 1IRKA 3GU6A 4BHNA 4CMUA 4GUEA 5FG8A 2W1CA 2XYNA 4M67A 4AGCA 4EUTA 2EXEA 2IG7A 4LOOA 4EK3A 4C57A 3KY2A 3OFMA 4MBIA 3N4VA 4DFBA 5J9ZA 3U87A 5M57A 4HYIA 5CEPA 4XMOA 3FLNC 3QD2B 2EXMA 3MY5A 3UDBA 5C01A 3PG3A 3UPZA 4ZZOA 3NUPA 4RJ6A 2PU8A 4U6RA 2UVXA 4IAZA 2UZEA 3FMMA 5ANIA 4YUQA 2PUUA 3OT3A 2J90A 3R6XA 2JIUA 3WI6A 1W83A 2E9NA 4YJUA 4FV5A 4IAYA 4G3CA 2ZDUA 4D5KA 5JZNA 5BVWA 5HX6A 2YM8A 3WF9A 3RHXA 2W1FA 4JBVA 2FYSA 4UN0C 5AAGA 4ZLZA 2OZAA 3VBTA 3ZXZA 3V5QA 1F5QA 3DQXA 2ZJWA 3W1FA 2CKEA 5JGDA 5KKRC 5M4UA 2YM3A 1FVRA 3NR9A 4E3CA 3VJNA 4BCNA 3U9CA 3EQFA 4I6QA 3CJGA 3RGFA 4CFUA 4QMZA 4MXXA 3I81A 4IWOA 2VTTA 3AMAA 4NUSA 4X6RA 3GCQA 2W1ZA 3L9NA 4CSVA 4BBMA 4D4RA 3RVGA 1T46A 2XK6A 2I0EA 3PA5A 1XJDA 2PPQA 1BX6A 4OUCA 4EOOA 1W8CA 4FKPA 2W4JA 1Q8TA 4L3LA 5FLFA 4D2WA 1J1CA 2FSLX 3SV0A 4AGWA 3OHTA 3E5AA 2ZM1A 4QPMA 3V51A 3KULA 3R1QA 1APME 5KMKA 5IU2A 3L9MA 3ANRA 1WMKA 3GC8A 3Q04A 2E9UA 3BEGA 1H4LA 1OUYA 5EHOA 4G3DA 5JRQA 4BB4A 5L6PA 5CSWA 2OZAB 2CKPA 4FEVA 3UBDA 4D2PA 1YDSE 2JKQA 4ZSGA 3ALNA 3I0OA 3PSCA 4RG0A 5IEYA 3QFVA 4N4SA 3GQLA 4QP1A 5DRDA 2YERA 3C5UA 5KMMA 3DAJA 4EWQA 3REPA 5IG1A 4JBPA 4JNWA 3SXFA 4EJNA 4CYJA 3UNKA 4XOZA 2PY3A 5JK3A 1J7IA 3QX4A 4MXYA 2ZAZA 5IA4A 1GOLA 4IAKA 5EH0A 4CRLA 3G0FA 2E9PA 4IE9A 3W2RA 4FIIA 4N0SA 4I6HA 1WBSA 1BI8A 3AC5A 5BVKA 4J97A 3S00A 2OJJA 2JAVA 3H3CA 4L3PA 3KVXA 3SOAA 1H08A 4FSQA 4F1TA 4BDDA 2O0UA 3D9VA 3MJ2A 1ZLTA 3FPQA 4C36A 1OL7A 4AOJA 3DXQA 2OWBA 1Q3DA 1GIIA 4UMQA 5AUZA 4H3PA 3RWQA 4C35A 5K4JA 3LPBA 4FKQA 1OITA 2YABA 4BGGA 2X8EA 4F7JA 5BUJA 5ACBC 2QC6A 5K0XA 4O1OA 3C4WA 4FV8A 3OEZA 4DAWA 2GQRA 1BUHA 3QTQA 4GIIA 2VV9A 4U45A 2IZSA 2HOGA 2NO3A 4ZTLA 3UO6A 4E5AX 4U3ZA 4OBOA 3HDNA 5E1SA 4C4GA 2W0JA 1Q5KA 1UU8A 5FDPA 2JDVA 4BGHA 5HU9A 3QTSA 4PMSA 4XS2A 2NRYA 3PZEA 4ALVA 2VWZA 2XVDA 3OW3A 5IQAA 5HVJA 2OK1A 1KE8A 5E8ZA 3AT2A 3E64A 2YACA 1TKIA 2ZVAA 4F64A 3ORKA 4CGAA 4FKOA 4QP2A 2XNMA 1H28A 3ULZA 2EVAA 3UC3A 4A9TA 4UMPA 1VYWA 1X8BA 3U55A 4ZMFA 4ITIA 4L53A 1IG1A 2PULA 2WIPA 3RCDA 4AX8A 2Z8CA 5L6WL 4ANOA 3CY2A 3M1SA 4AA4A 3NUAA 3ITZA 2OF4A 3IQ7A 3F3TA 4NCTA 4RJ7A 4C37A 4KABA 4TNDA 3OTUA 2I0HA 3FMHA 5AV2A 3VO3A 3ZZEA 1S9JA 3OUNB 5LVPA 2PHKA 3WZUA 4FKJA 2BZJA 4QYYA 4LYNA 4YNEA 2QOKA 2F2UA 4W8DA 4RIOA 3IDBA 3QTRA 5E8VA 3BWFA 4KKGA 4NM7A 1URCA 3TNIA 1O6YA 2UVYA 4GU6A 4DITA 3VUDA 4Y85A 2W96B 4Y5HA 5AP3A 1KUTA 3HX4A 3VS6A 2ZV7A 3FC2A 3DLSA 1KWPA 3QQKA 1CKJA 3QA8A 5C27A 4ACCA 2Y0AA 4DTAA 2GHGA 2Y6OA 2QURA 3EQBA 4XX9A 4UXQA 4YJOA 4I94A 1YHWA 4LRJA 4EI4A 3OCTA 4O7TA 5AV1A 3DAEA 3IW6A 4XNEA 2BPMA 5CS6A 1ZWSA 4YMJA 4NL0A 1YI3A 3R7UA 5CF6A 4E20A 5E1EA 2P4IA 4I1ZA 3UNZA 2CCHA 4XH6A 5HD7A 2PVLA 4A9UA 2B7AA 1J91A 1YWRA 1Q8UA 4USEA 4YZ9A 3R1NA 3KCKA 3P7BA 3ZMMA 1PMUA 4LMUA 4BCIA 3R73A 2GNLA 4KSQA 5CEKA 5IA0A 3NYNA 3ORNA 4M66A 4ALWA 1PF8A 2VD5A 4C4HA 2XIRA 4B6LA 4O2ZA 4O0RA 4D2TA 1GZOA 3AOXA 1JSVA 4DEEA 3DK3A 3LFDA 5IUHA 4DEHA 5JSMA 4O7WA 3DDPA 3A60A 4DH5A 3KK8A 3QTUA 3FLSA 4FTOA 2G2HA 3MFTA 2Y7JA 4IC7A 4R77A 1ZOGA 2QO2A 3VS4A 2IO6A 3EFLA 2J5EA 2YISA 3TTJA 5IH5A 4WBBB 1H26A 4MNFA 3OBJA 3PA4A 4I92A 2VGPA 3GT8A 4UEUA 5IH6A 3E8EA 4HYSA 3ZBXA 3QTXA 2ZMDA 3WYXA 4JI9A 5KBRA 1J7LA 1SM2A 3MJ1A 3QD0A 4APPA 2QKWB 3C50A 3NZ0A 2YM6A 4H3QA 5BVNA 2GTNA 2OF2A 3U4UA 3DS6A 3Q60A 2RG5A 4AWIA 4FZ7A 2H9VA 3FEGA 3PDTA 4GG5A 3QAME 2ETKA 2R2PA 4TKSA 3E7OA 5I9ZA 1U59A 2C3LA 4DBXA 3I7CA 3D5VA 3RTPA 5DT0A 1FBNA 2R64A 2ZM3A 3GXLA 4XV1A 2WTKC 4ARKA 5J9LA 2CNVA 3OD6X 4RT7A 3DBCA 2C68A 3KU2A 3QQLA 4FTIA 4DYMA 4F99A 4FZAB 4FKUA 5LJJA 5M4FA 3DKOA 2Q83A 2VTQA 3HV5A 4H58A 4U81A 2HYYA 4CT2A 3LAUA 1WCCA 2HY0A 3UQFA 3D2IA 4C02A 3BV3A 4MK0A 5I4NA 2UW6A 3RJCA 4M69B 5LOHA 4O84A 4FV2A 4L67A 2WEIA 4FF8A 2CLXA 1M52A 1SNUA 1XH5A 3PP1A 3U6IA 3MH1A 4G9RA 4ORKA 1WVXA 3AD5A 5FDXA 2YFXA 5AR4A 5C03A 3F9NA 4ALUA 5C8NA 3WF5A 5ACKA 4FTMA 1CTPE 3RZFA 4BHZA 3TCPA 4EBVA 2HZ0A 3OWPA 4HGEA 2PVFA 5J5SA 3UIXA 3R8MA 5CLPA 3FHRA 5HI2A 3I60A 4EH4A 4FTUA 1CM8A 1IA8A 4YJNA 3R2BA 2WTVA 3FL4A 2R3QA 4GS6A 5HIDA 2VO7A 1PXOA 2G01A 3FI4A 3C1XA 2V5QA 4C34A 3Q4TA 3F61A 4HCTA 4MXAA 4CCBA 5GHVA 3QRUA 3QA0A 5DYJA 3QBNA 2C5OA 4BCGA 3Q9WA 3DGKA 2EU9A 3FKNA 5KZIA 5DMZA 4RIXB 4U9AA 5EFQA 5HEZA 3NMUF 2W4OA 1J7UA 1YI6A 3R2YA 4RPVA 4CNHA 4ANNA 4HVGA 5JT2A 4QP3A 3TZ7A 4UZHA 4W8EA 4IB1A 4FL2A 4L44A 4TNBA 5E8XA 3ROCA 3VULA 3ZM4A 1QPEA 1J1BA 3FLQA 4GJ2A 1WBWA 4YZMA 5F4NA 5F94A 3BHHA 3BELA 3R9RA 4G6LA 3E88A 4IAIA 3TNPC 4RQVA 3KFAA 3DK6A 4BYIA 2ZYBA 4FVRA 4C7TA 4QMPA 2QG5A 4EBWA 3VUKA 2XJ2A 4Q2AA 5CAUA 3JR1A 1OPLA 5AR2A 3G15A 2DQ7X 4V04A 3WZKA 4MQ2A 4FT0A 4GV1A 2R3FA 1VYZA 3IS5A 4K8AA 3ZO1A 3PLSA 2JKMA 2JDOA 3G5DA 1ZY4A 2ONLA 4FNXA 3N4TA 2RFEA 1OPJA 2WHBA 1V0PA 4MNEA 4NT4A 2RGPA 2J0IA 5KMNA 3PFQA 2R3OA 1KE7A 3BEAA 3ZHPC 1WBTA 3JVRA 1CMKE 4B99A 2BAJA 1DAYA 3OEFX 4IFGA 2JKOA 4PL5A 2PMIA 3TKHA 4KIPA 3BHVA 3OP5A 3A8WA 4I5CA 4BL1A 3G2FA 3LLTA 5AADA 4K77A 1FINA 4FNYA 4LUEA 4L45A 3PUPA 1OKZA 1Q8YA 2VWXA 5EYKA 3V01A 4C62A 3KRLA 3ZZWA 1M7NA 4ZS0A 4QMNA 1KV1A 4BTKA 4ZLYA 3TN8A 2IZTA 3TWJA 1XBAA 2X8IA 1VEBA 4Q9ZA 3Q6WA 3AT3A 1UWHA 3BGPA 2I0YA 4M68A 4IM2A 1YHSA 2XRWA 3FMLA 3ID6C 3HV4A 4A4OA 4GCJA 4TWPA 5A54A 1LUFA 2XIZA 2XRUA 2WQNA 3NIZA 3LJ1A 1JKSA 1ZYSA 3KMUA 3ZONA 4YJSA 4BIEA 4ERWA 5DNRA 2WIHA 2FVDA 3QQJA 3FY0A 2UW0A 1PKGA 1XQZA 4NTSA 3LM5A 4YR8A 4L6QA 4FSYA 3CGFA 4IZ7A 4G17A 4PTEA 3DB8A 2V22A 3NX8A 3UO4A 2ITVA 4IW0A 2BTRA 4RJ4A 4X2FA 5J7BA 1SZMA 5JFSA 2F2CB 3DJ7A 3RINA 1PXPA 3C7QA 5ITAA 2IVTA 4IM3A 3O50A 2QI8A 4IEBA 3W55A 3HV6A 3FAAA 4ZY5A 2R3RA 1NA7A 3GEQA 3QQFA 4FKTA 3WF6A 4RA5A 3DXPA 1P4FA 3VBVA 2DYLA 1BYGA 4FSNA 4R78A 1Y6BA 2XJ1A 2CGWA 2VTHA 4LG4A 4R5SA 5BVOA 5HTCA 1OBGA 3WE8A 4HGTA 5D7AA 4F1MA 4XG3A 4XBUA 3RP9A 3TJDA 3IK3A 1SVGA 5KMJA 1Q8ZA 2XCHA 4XJ0A 4BZOA 1XKKA 4I20A 4FV7A 5LVNA 4U97A 2OXXA 3UOHA 4YU2A 3B8QA 4G2FA 2FSMX 5ANKA 2X1NA 3CE3A 2RFNA 1H25A 4HCVA 4XV3A 5E8UA 4FKIA 2YLFA 5TO8A 3UP7A 1DI8A 4ANMA 4O21A 4G1WA 4GVJA 5CANA 4CG8A 3VUGA 3KMMA 3DKCA 4FTLA 3THBA 2VTJA 1V1KA 2PZRA 4AT5A 3OC1A 1FGIA 2X2LA 3PY1A 3ZOSA 4EOPA 4BF2A 1E1VA 2GSFA 4RX5A 4FEQA 4PY1A 4IX3A 3A7IA 4XG4A 3RI1A 5IQCA 2YDIA 2YIYA 3A4OX 3A4PA 2DWBA 2YHVA 3DCVA 2UUEA 4H39A 1YDRE 3PVGA 3QZIA 5CENA 5E9EA 3AMBA 4MXZA 5CSPA 4EH2A 3NGAA 3RK5A 3Q52A 2WB8A 4LOPA 3VJOA 5FUTA 2PSQA 5LWMA 3QHRA 4FA2A 3GUBA 2UZLA 1OB3A 5D41A 1XH7A 3LHJA 4A9RA 4FOCA 4HVSA 3PJ8A 4EOKA 4AA0A 4OTIA 1OVEA 3QYWA 3AC8A 5BQ0A 3C5IA 3CQEA 4USDA 3C4EA 1BLXA 1FQ1B 2BZHB 4DTBA 3LXLA 4DGOA 4YTHA 1L3RE 2FB8A 4FSZA 4C58A 4EOLA 1PXNA 3C4CA 4ZOGA 4UWYA 1B6CB 4K0YA 4EYMA 1UA2A 3MB7A 3E8CA 4QMXA 5LCJA 1H27A 3VIDA 4UY9A 2FSTX 5AAFA 2UZVA 2CGVA 5EQEA 4X3FB 4W4YA 4RQKA 2BILB 4WD5A 3KXHA 5A6NA 5IQBA 4R6VA 3Q5IA 4IQ6A 4OLIA 5EDQA 5JFXA 3IDCA 4AW1A 2CSNA 3MH0A 1CKIA 4BIBA 2OICA 4WT6A 3F2RA 2FSOX 3CR0A 5JEBA 4I5PA 5CVFA 1U54A 2XYUA 3PIZA 4UALA 2W99B 3K5VA 4FL3A 3PZHA 3FBVA 3BBWA 2VNWA 4MD7E 3VF8A 3VS7A 3E62A 3I0QA 4OTRA 3O7LD 3MA6A 3F3WA 5AP6A 3AD6A 4RC2A 4QMWA 2JLDA 3PJCA 4FSWA 5HG7A 3VUTA 5LXMA 3ZO4A 1SVHA 4F9YA 4H05A 1PXKA 5IMEA 1PKDA 4CZUA 4E93A 3TT0A 3Q9YA 3OXZA 4OTPA 4Z7HA 4M12A 3CKXA 2YWVA 4DT9A 3TM0A 2GNIA 3PXZA 3F5GA 4MBJA 4E1ZA 3QD4A 4MWHA 4DGLC 4YSJA 1ZOHA 5CU6A 3TUCA 3M42A 3PG1A 5CEMA 4BTMA 1MUOA 5JN2A 2X4FA 3ZC6A 1PXJA 2W5BA 4PF4A 3LCTA 3ZO3A 4NTTA 4AUAA 2QO7A 2R9SA 3PRFA 4XRJA 5J87A 4QQTA 1LEWA 3ZUVA 5B2KA 1NT2A 3BYVA 3AC3A 4YSMA 3P86A 2XIYA 3QKMA 4IVAA 3DZOA 4FT9A 3F82A 3IG7A 3MV5A 4D4YA 5FBOA 1TQMA 2V7OA 2X0GA 3AD4A 4IAAA 4QNYA 3OVVA 3L9LA 5EW8A 4E7WA 5HCZA 4OTFA 2RIOA 4LOQA 4EORA 2O3PA 1QPDA 5KZ0A 3VBXA 4JX3A 5HGIA 3ROYA 4OTDA 2P2HA 2Z7SA 3LQ8A 3W2SA 4JR7A 4U5JA 1FOTA 4W9WA 2XMYA 4BDFA 3O8UA 4LMNA 4DEGA 4G9CA 4F9CA 3UVQA 3MTLA 4MXCA 1XO2B 4EC8A 3CIKA 3NNVA 2CPKE 4IC8A 4J52A 2WU7A 5TOZA 4F0FA 4I5MA 5EW9A 1R3CA 4V05A 3OZ6A 3V8TA 3WARA 2YM5A 3ZCLA 2X2MA 5AP5A 2XIXA 3UOJA 5E8SA 1YW2A 2OIQA 4EQUA 5E90A 4BCPA 4IX5A 5EK7A 1KOAA 3N51A 3QRIA 4TPTA 4A4LA 3JPVA 4ACDA 4RC4A 1S9IA 3I5NA 5CEIA 2YJSA 5KHWA 3I1AA 3OMVA 3GCSA 5HVKA 2WMUA 4NWMA 3FJQE 2A0CX 1K3AA 3F2NA 3TV7A 5HNBA 3NPCA 3MY1A 4IWQA 4RZWA 4LQMA 2PZPA 4FTAA 4XP2A 3U9NA 4TYJA 3D4QA 3VNTA 4KS8A 2C3IB 4QPSA 3DA6A 3ZBFA 4EH3A 5GIPE 3D2KA 4X2GA 4RGJA 3Q6UA 1H07A 4GUBA 4M13A 3BHUA 1M2RA 3WZJA 1AGWA 3QQHA 2QOFA 4DGGA 4BDAA 3QWKA 2OIDA 2X7GA 3UJGA 2HAKA 3CP9A 4KRCA 4JIKA 4WUNA 3VHKA 5D10A 3C9WA 3FV8A 4S30A 4NZWB 3VUIA 1V0BA 2ETRA 4GSBA 4GYIA 5DT4A 1HCKA 3AMYA 4H1JA 4MD9E 4UWCA 4ZEGA 4ZTHA 3R9NA 3M11A 5KUPA 3BQCA 3ZDIA 3HRBA 4B8LA 1SMHA 5IQDA 1OKYA 5EQPA 4BWKA 4PQNA 4KA3A 1XBBA 5HVYA 3M2WA 4GFOA 4EJ7A 3DV3A 4O22A 3V5LA 3CY3A 4R1YA 1UVRA 4I3ZA 2YCRA 4KB8A 1QPCA 4DN5A 2FUMA 4YP8A 3F3ZA 5HE2A 4Y95A 4FBXA 2VTNA 3LOKA 2PK9A 4LV8A 3ZSGA 5HE0A 4PL3A 4FEWA 5HO7A 3T9TA 3UNJA 2B53A 1OIQA 2I1MA 2QQ7A 2X9EA 3DBFA 4DLJA 3QGWA 4I4EA 4UV0A 1BKXA 3MBLA 3LXNA 4RIYA 4YZNA 4E6CA 3MY0A 1H01A 1JSTA 4BI1A 3P79A 4QTEA 3OS3A 3HMPA 4J7BA 4O7ZA 4BY9E 4MQ1A 4L7FA 1Y57A 3ACKA 2GNGA 4ZY6A 5LVLA 3LLAA 4BN1A 5G1XA 5LMKA 2ERZE 1HCLA 3Q9XA 5AV3A 3R7IA 5EI6A 2WNTA 2HWOA 4RWLA 5EYDA 1LR4A 4CRSA 4C4IA 5CU4A 2QOQA 1H00A 3ORIA 5TR6A 2BRGA 3R8VA 1LP4A 2WQEA 3ANQA 4ANQA 3MSSA 1PXMA 4FGRA 2I6LA 4R1VA 2QLQA 2W9FB 2J0JA 3AT4A 5CF5A 1JAMA 2I0VA 2IZUA 4JDJA 2Q0NA 2QOIA 4YJRA 5GJGA 4R3PA 3V3VA 4A9SA 4F4PA 3ATTA 4XOYA 3MYGA 4R3CA 4BR3A 3IW8A 4CQGA 3FLYA 2C30A 2JDRA 5T6KA 1K2PA 3ORLA 5DR9A 4AS0A 4X3FC 1OIYA 4F63A 5AP7A 2G9XA 2C5XA 3FZSA 4DEBA 2IPXA 3EFWA 1LEZA 1PMNA 3KXGA 2JGZA 3QCYA 4PWNA 2R3NA 3AGLA 4YZCA 4CXAA 3R8UA 2NRUA 4GRBA 1PRYA 4O7LA 3EFJA 2JC6A 3PTGA 1BI7A 5FXRA 3IDPA 4JLCA 5L3AA 2R3JA 5T68A 3KULB 4IHPA 5L8KA 2GPHA 1OL6A 2GCDA 3FXXA 5C9CA 5IEVA 2XP2A 3QTZA 1GIJA 3MVHA 4BFMA 2PTKA 3CD3A 1H0WA 4HZRA 4IAFA 1R1WA 2RF9A 4ZP5A 1U5QA 5DBXA 3EYGA 4CKIA 3DXNA 4ACHA 5AA8A 3C4ZA 4ZSEA 1OBDA 2WMWA 3K5UA 1OM1A 4FICA 3VN9A 4F9BA 3WE4A 3A7FA 3FHIA 4EQCA 3GQIA 3EIDA 4FE2A 2C6EA 4JDKA 5IQGA 1PYEA 4BC6A 4DFXE 3BCEA 4JRVA 3QRJA 3UIBA 3R0TA 4C4JA 2PVYA 3EN7A 1GZ8A 5F95A 2C6LA 4MD8E 4EOMA 3F5UA 4I24A 3PWDA 2QOBA 4NU1A 3S4QA 3KXZA 2C3KA 5HU3A 1PY5A 3JY0A 4D0XA 4ANBA 3RNYA 3UVRA 4EH5A 2W06A 3AC4A 4Q5HA 4GYGA 3LXKA 2IVUA 1YOLA 3FXWA 4E73A 4R7IA 2ITXA 4HVDA 3PXQA 4M84A 2P0CA 2QOOA 5FRIA 3V8SA 4UZDA 5BUEA 4O0VA 5IPJA 3BGQA 1O9UA 1ZMWA 1YWVA 5ANDA 1G8SA 4O83A 1RQQA 2WTDA 1KE9A 1OL2A 4FYNA 4IX4A 4L8MA 4ENXA 2Z7QA 4NIFA 5A14A 4FSRA 3MFRA 2HY81 4V0GA 3OROA 4YBKA 3RNIA 5FP5A 3OT8A 4FGBA 4DEAA 3SG9A 4FV6A 3GC7A 1R0PA 3NUSA 3KRXA 1Q97A 2JAMA 4XG7A 2EWAA 3FI2A 5HBJA 3TACA 4DH1A 4QYGA 5EQYA 4EKLA 4AN2A 2WEVA 2JD5A 3FKLA 3UTOA 3ZFXA 3A2CA 3ZLSA 1YVJA 3GU4A 2CCIA 3UYTA 3A7GA 1G5SA 1WBOA 5JGBA 2ZB0A 4HPUE 4AW5A 3H30A 4NJDA 4QOXA 4AN9A 3K2LA 5M06A 3IO7A 5BVDA 4AG8A 4PDYA 2J0LA 2B4SB 3GB2A 3NVKI 4G31A 2PZ5A 3QLFA 5CVGA 3HRCA 4EUUA 3Q3BA 2R3PA 4F65A 3DBDA 4DFZE 4BTFA 3Q53A 1P14A 4PPCA 5CWZA 1DI9A 2WZJA 3BQRA 3T3UA 3VBQA 2G1TA 3R1SA 4HCUA 4KKEA 2RG6A 5DA3A 4BDKA 2WTCA 2PE2A 3ZSHA 5A4CA 5E8TA 4DCAA 2W1IA 2VWYA 1U4DA 3P78A 3NRMA 2JDSA 3HECA 4NM5A 3TNQB 5AUWA 4RIWA 1VZOA 5HICA 3W2OA 4AGUA 3NNXA 2EB3A 4MXOA 3HZTA 3GCVA 4GK2A 4PMMA 4MYGA 5H8BA 2X81A 4JXFA 3WF8A 4DCEA 4U43A 5CU0A 2G2IA 3OOGA 1URWA 2O65A 5CF4A 5A9UA 3BLQA 3NSZA 2X7OA 4K6ZA 3R8ZA 3DFCB 3F6XA 5CU3A 5JMSA 4GJ3A 2GHMA 3HMNA 3D94A 4QMVA 3KREA 4AP7A 4UXLA 3VW6A 3MS9A 2XK9A 1I09A 1REJA 4W4VA 3V5WA 2FO0A 2QOHA 4PPBA 1UNLA 3AC2A 4U7ZA 4EQMA 4FT7A 3MPAA 5TF9A 5AR7A 4ITJA 3R1YA 3SOCA 4EH7A 2VO0A 4G5JA 1BMKA 3NCGA 3Q4UA 4MKCA 4YLLA 2OW3A 2C0TA 3TDVA 2OFVA 2Z7LA 3EQRA 4U79A 1PXLA 3I5ZA 4MX9A 5AP2A 5CEOA 2PUPA 4FIFA 5B0XA 1UKIA 2ITOA 2VWIA 4O0XA 4W4WA 4RVKA 4EH6A 3FI3A 4C38A 5A6OA 3VAPA 3P7CA 2VAGA 4FYOA 3T8OA 1HOWA 2FGIA 4I21A 5H2UA 4TWOA 1UNHA 4PP7A 2PE1A 3ORZA 3SXSA 5A4EA 4QQ5A 4CKJA 1NW1A 4K1BA 4JQ8A 4FODA 5M4CA 4M15A 2DUVA 2HENA 3IGOA 4BKYA 4BI0A 2Z2WA 5AV0A 4DFLA 3HNGA 3IONA 3LMGA 4R7HA 4U0IA 2X6DA 4WG3A 5D1JA 1B39A 3LIJA 5K4IA 2B9JA 3BPRA 1KE5A 2BMCA 1P4OA 2OLCA 2BCJA 3MIYA 3F3VA 4U44A 4EEVA 3TZ8A 4AF3A 5D7VA 2BHEA 2B9HA 3EQHA 3BU6A 4QTCA 3MESA 3VBWA 4YTFA 5ETFA 4FZDB 1ERKA 4BCJA 3DT1A 2AYPA 2HW6A 3KRJA 5HBEA 2Z60A 4IWPA 5D9HA 1H0VA 2DS1A 2HZNA 2QHMA 3O23A 2C1AA 4IDVA 4FG7A 1Q4LA 4RMZA 2RL5A 2VUWA 3ORXA 4D5HA 3OXTA 4FMQA 4A4XA 4WRGA 5LMAA 1YOMA 3FZPA 4E6AA 3G0EA 3PY0A 5B7VA 4WSYA 4FV0A 2R3HA 3DKFA 3PPZA 4XYFA 2E9VA 5L4QA 3E92A 5F1ZA 3P9JA 2HCKA 3P23A 4G6NA 2ITZA 4GEOA 5HO8A 1A9UA 1OECA 3VVHA 4FSMA 4QD6A 5E7RA 4BZNA 3F69A 1XH9A 4M97A 4W9XA 3WIGA 2CKOA 2AUHA 3ODZX 4EZ5A 2ZB1A 5EW3A 2AC5A 1NY3A 1FMOE 2VO6A 4TYHA 3PJ2A 2C6DA 3LFNA 3KRWA 3B2WA 4ZS4A 3LFBA 1H24A 4CFNA 3QWJA 4PL4A 5AUXA 4ZLOA 1U5RA 5IMXA 2VWBA 4NW6A 4ZY4A 5M07A 3FUPA 3V6SA 3NW6A 2ERKA 4B7TA 5KX8A 4N57A 2YAKA 3QC4A 3R9OA 2VTIA 4J53A 1NVQA 4D4VA 4UWBA 4QPAA 2UW7A 3CJFA 4NW5A 1YXUA 4S33A 4B0GA 3HP5A 5KMOA 3LVPA 1PMEA 2YIQA 4Y46A 1M17A 3NUYA 2CJMA 4LV5A 4GIHA 3F5XA 3QXPA 4A9YA 5DR6A 3BYSA 3UG1A 4C61A 3R21A 2C6KA 3FMEA 4ACMA 5HLWA 4MH7A 1IEPA 1WBVA 1XR1A 3DJ5A 4KWPA 4X21A 2W1EA 3Q4CA 3F7ZA 4GMYA 4FX3A 1QL6A 5C4KA 1OIRA 4FVQA 3ZUTA 3GC9A 3LCDA 2R0UA 4O2PA 2V55A 3ZDUA 3A8XA 3LMIA 4ANSA 3ZEWA 3CSVA 3BLRA 4WNKA 3FWQA 2ITTA 3BRBA 2PE0A 5DFPA 4JL9A 4IH8A 2C5YA 3HV7A 4XG9A 4G5PA 2W17A 2GS2A 4AOTA 4ZSJA 1ND4A 2OFUA 3OY1A 4O0UA 5HORA 3ZSIA 3FL5A 3P4KA 3UODA 4X6QC 5A4LA 5CAQA 3MFUA 3MVLA 4GH2A 4BCKA 4LFIA 4C0TA 5A4TA 4AT4A 3O96A 5AR8A 5L2IA 4F70A 5HOAA 4TYEA 3IECA 5LCKA 2UV2A 3R28A 2QVSE 2QR7A 3FYJX 4TZRA 5LQFA 3MWUA 2VTLA 4FL1A 4BDBA 4C2WA 5CAPA 4TY1A 3AC1A 5FEEA 2WMXA 4FKRA 4RC3A 3R8PA 2B55A 4BDJA 2XNEA 2YWPA 5AEPA 2QG7A 3E3PA 3VS5A 4FG9A 4DINA 4RJ3A 4GKIA 3D7TA 4JT3A 2J9MA 3SDJA 3PSDA 3OF0A 5J9YA 3E3BX 3CTJA 1Q3WA 4BDHA 4QQCA 4M14A 1Y8GA 4YLJA 4F0GA 5M53A 1OL5A 1JKLA 2QHNA 2WQOA 3O8PA 3A99A 5J1WA 5HNGA 3RKBA 1ZXEA 4FSUA 2HW7A 2QKRA 1WBNA 4NCTC 2ITUA 1ZYCA 2Y4IB 3QRKA 3QUEA 4O86A 4JDIA 3DNDA 4D1ZA 3LQ3A 2E2BA 4CTBA 5BX0A 3DTCA 5C4LA 2UZBA 2YJRA 4WOVA 4WSQA 3W8LA 2UZDA 1R78A 2EXCX 4AT3A 3E87A 4IB5A 3RALA 2O5KA 2C47A 3QXOA 3RPSA 3TL8A 2FH9A 2EB2A 4J95A 2C0IA 4XUFA 3UZRA 2JIVA 3QCSA 2RFSA 3KC3A 3QLGA 4XLVA 5JRSA 5K5NA 5CQWA 4MNEB 5EM5A 3ORMA 2BROA 4PV0A 2VX3A 1JVPP 2ZMCA 5LVOA 5CT0A 5CSXA 5IA5A 2C69A 3DLZA 3CQUA 4PMPA 3W10A 4JQ7A 1OZ1A 3UGCA 4AZVA 5M55A 2CDZA 3D83A 3QHWA 2XIKA 4X7QA 3RAKA 3SA0A 2XUUA 3LFFA 5FM3A 3TI1A 1R39A 1Y91A 3G9LX 2UZTA 4F7NA 3CTQA 3U6JA 4CKRA 3U4WA 5L6OA 4AZWA 2XK7A 4PRJA 2BRNA 3QCQA 5D12A 3COHA 4RZVA 5FXSA 3A7JA 1JSUA 4LGDA 4WNOA 4FTKA 4KIKA 5HG8A 4OAUC 2JBOA 1SNXA 1W82A 3BE9A 1VR2A 3LFEA 2ITYA 3VWAA 4DG2E 4F0IA 2HXQA 3TUDA 3NVMB 3ET7A 1MRUA 4M0YA 4ASDA 5DIAA 2I40A 1LPUA 2UZWE 4BKZA 2GNJA 4FIGA 4DGNA 1CDKA 3L8VA 4PX6A 4CFVA 1OMWA 4FR4A 3OCBA 3RAIA 4CFFA 4CZYB 1PJKA 1OUKA 4ZK5A 3SX9A 5JKGA 5L2TA 3ULIA 3SXRA 5DEWA 4FNZA 3ELJA 3VUHA 3W32A 1O6LA 1F0QA 3VUMA 2B52A 3H9RA 4G6OA 4YBJA 3SW7A 4KIKB 5EM6A 3CTHA 5AX3A 2F7EE 3CLYA 4UMTA 4ERKA 4O82A 3CCNA 4F6SA 3FXZA 3C0IA 3ZM9A 2BDJA 1UV5A 2UZUE 4ID7A 4NSTA 3ZS5A 1WZYA 1ZYJA 3KGAA 2XNGA 3SHEA 1IR3A 5CI7A 2ITPA 3QYZA 2JBPA 3BYMA 2A1AB 4I93A 4CV9A 3HAMA 5IA1A 4MVFA 4YJQA 3PSBA 4RVMA 4TYGA 2OJFE 4FT5A 3WOWA 2PMNX 3VS0A 3IOKA 1A06A 1V0OA 2F7ZE 3E63A 4QMSA 4YHFA 4U42A 2VTMA 4J99A 3PJ3A 4X0MA 3L8SA 2IWIA 2WOTA 3R63A 1GIHA 4MBLA 5IH4A 5KKRB 5FTQA 3NYOA 5DRBA 1YOJA 3GP0A 4OBQA 3KEXA 3BLHA 5AP0A 4ACGA 4JBQA 3W18A 4HVHA 1MRYA 5EYCA 1QMZA 3I6WA 2BAQA 4S32A 3SW4A 1UWJA 3FMNA 4RLKA 4CG9A 2X4ZA 3GOKA 2YAAA 4IVDA 2XKCA 2OU7A 3PA3A 3QD3A 3E8DA 2YLEA 3LE6A 3SAYA 3EFKA 3PRIA 4AZTA 3B8RA 1JOWB 3G6GA 3NWWA 5KMLA 5CZIA 5ANEA 4TWNA 2ZOQA 4IB3A 1U46A 1GNGA 3BHYA 2KULA 4WO5A 2WMQA 4MWIA 4NYEA 1TQPA 2X2KA 4QT1A 2A2AA 3GNIB 4DFYA 2R0IA 1OIUA 3SKCA 4Q9SA 3IW4A 3DBEA 3LQ5A 1GZKA 2IW6A 5EM8A 3CD8A 3IW5A 4BIDA 4M8TA 3MN3A 4YO6A 4HJOA 2R3LA 5FWKK 5IUIA 1YWNA 3HYHA 3PYYA 2HK5A 3GFEA 1L8TA 3AQVA 2WTWA 4AU8A 3EL7A 2C1BA 2OBJA 1JNKA 3LFCA 4ZTMA 4TL0A 5E8YA 2PVRA 1CKPA 3QCXA 2XM8A 3ZLWA 4BDIA 4O7SA 3OWJA 4ASZA 5C26A 2WMTA 4BTJA 3NIEA 1H8FA 4X3JA 3VRZA 3E93A 4CFMA 2OO8X 1YRPA 3O17A 4N6ZA 4PDSA 5L2WA 4MHAA 5K5XA 1U54B 3QTIA 3VHEA 3LFQA 4QMOA 4RVLA 3DOGA 3JYAA 3QX2A 3SD0A 3HMOA 3TKUA 4EHZA 3RZBA 2R7BA 1OKWA 4QYEA 3ZYAA 3T9IA 4ZMEA 3EQIA 5GINE 5M56A 3BGZA 3U8WA 4O1PA 1ZOEA 2GS7A 3BHTA 3LXPA 4TT7A 3R7YA 4AQCA 5HIEA 3HAVA 5CZHA 2F57A 2J2IB 3RMFA 4TTHB 3R04A 5GZ8A 1H1SA 5DI1A 2C4GA 2YM7A 3E8NA 3P7AA 2OI4X 3DAKA 3UC4A 5HLPA 3R83A 3V6RA 5HQ0A 2PUNA 4JG7A 2Y4IC 3QL8A 3ZRKA 4O7RA 3BBTB 5ETAA 3DQWA 4U3YA 4Q5EA 3IKAA 1IA9A 4HGSA 3EN5A 5AR5A 4F6UA 4CFXA 3NUNA 3GCPA 2WFYA 3RM7A 3G9NA 5I9YA 5JQ5A 2QD9A 3Q9ZA 4D2RA 4OGRA 2BRBA 2A19B 4EK8A 3DBQA 2IJMA 2R3MA 3II5A 2WMVA 1Y6AA 3LFSA 2F49A 3NW5A 4BDEA 2ONLC 5AV4A 3PIYA 2P33A 5H8GA 4I41A 1NVRA 3GU5A 2BAKA 3BX5A 2VTSA 2AC3A 2YDJA 4DGMA 3AXWA 3E7VA 2YN8A 4O38A 1NVSA 4O0YA 4XP0A 3ORPA 4O0TA 3K54A 5FXQA 3R7GA 4O7NA 2CGXA 4V01A 5IKWA 4TRLA 5DLSA 1UKHA 2ACXA 2B54A 5JQ8A 2XNNA 4C8BA 2BRHA 2OSCA 3PVBA 5D11A 3K3JA 4TWCA 1J3HA 4EK6A 3FI8A 4D9TA 1WAKA 3L8PA 1JLUE 3PPKA 4F08A 4UMUA 5BMSA 3TZ9A 1TQIA 3G6HA 4WA9A 4UX9A 5CI6A 1GY3A 3MI9A 2XA4A 2XKEA 4XV2A 3NAYA 3TEIA 2WPAA 3CBLA 4NEUA 4XHKB 5EG3A 3OWKA 2XNPA 1W84A 3HA8A 4ENYA 3FQHA 2IW8A 3H9OA 3BZ3A 1SVEA 4QO9A 5K3YA 4EOQA 4ZZMA 4A06A 4EHEA 4AOIA 4S31A 2JDTA 3H0ZA 4GFGA 4KRDA 1Q8WA 4AW0A 3D7ZA 5CXZA 2J50A 3FPMA 4IIRA 4KAOA 3DK7A 4C3PA 1NXKA 2VRXA 4GU9A 5CVHA 2J6MA 2B0QA 3KCFA 4FIJA 3ERKA 4A7CA 5HCXA 3BKBA 3QKKA 4K11A 4FKGA 5J79A 4FVPA 2H96A 3FKOA 2W9ZB 2XNOA 4KKHA 5I9XA 4QRCA 1GZNA 3EQGA 3JY9A 5JZJA 5KMIA 4O7VA 4CCUA 2CN5A 2X8DA 3F5PA 4O7YA 4F7SA 3D15A 2YCFA 4GT4A 3R8LA 4QMYA 5AM6A 3NYXA 3UQCA 4PDOA 2QOCA 3CGOA 3FSKA 1UU3A 2OG8A 3FSFA 5IDPA 1PYXA 2YEXA 3KKVA 2V0DA 5AFVA 4CZTA 4RFMA 2PVJA 2VGOA 2W05A 4O27B 5H3QA 1G8AA 3R7VA 3V8WA 2JEDA 3C51A 3RK7A 3VW8A 4LM5A 4O6EA 3CXWA 4YC6A 4FT3A 2OKRA 2F7XE 4OTWA 4EOSA 4CV8A 4ZJVA 2P3GX 2C6OA 3HGKA 4BRXA 2GHLA 5M09A 2XK4A 3LM0A 2J51A 4AZFA 4F6WA 4WIHA 3SG8A 3EZVA 2W1DA 4BDGA 2PUIA 3O8TA 4R7BA 4FUYA 4QYHA 4LGHA 3JUHA 4AXAA 5AA9A 4KS7A 4B9DA 4I4FA 1DM2A 4I0RA 3O2MA 4IVCA 5IUGA 4EWHA 4XP3A 5AUTA 3C13A 3L1SA 4RIYB 4UB7A 4G3FA 4UMRA 4XG6A 4YTIA 3TNHA 4EOJA 2B9IA 4QMTA 4AFEA 3R7OA 2WMRA 3TIYA 2GU8A 2OIBA 4WNPA 3DDQA 3UMWA 4E4XA 5FTGA 2XK3A 2X7FA 4C3RA 3GCUA 4PNKA 3ETAA 5F20A 4DH3A 2NPQA 3LCOA 4O81A 5DOSA 2W1HA 5I9VA 1Q62A 4LL5A 5CAOA 4IX6A 3CKWA 5TE0A 2Z02A 1A48A 3NEWA 5ETCA 1IAJA 1ZYLA 2CN8A 2WTKB 3LCKA 4HNIA 5ANOA 3ZH8A 3ATSA 2OGVA 1Z57A 5EHLA 3PVUA 4XV9A 5HLNA 4OBPA 4W4XA 5ETIA 3U51A 3W2PA 2WKMA 4FTTA 3VQUA 3DPKA 3BV2A 2PVMA 2QO9A 4C4EA 4RWKA 1Q41A 3NUXA 2C5NA 4J1RA 5FD2A 2VWWA 4ZTNA 5BYLA 4E4MA 3W33A 2ZV9A 3CEKA 4GKHA 5HNIX 5L8JA 4DFUA 2P55A 5E8WA 2WMSA 3C0HA 5CY3A 4U80A 2YDKA 4PP9A 4AZSA 4B4LA 4Y8DA 4WBOA 4K2RA 2VTPA 2YCSA 1FVVA 4X2KA 4YJVA 4J98A 5IA2A 1YKRA 4QYFA 2PWLA 1STCE 4IVBA 3NNUA 3EQDA 3F3UA 4QP4A 1BL7A 4X2NA 5DHJA 2WO6A 4KSPA 5FP6A 3ZFMA 3KF4A 4ZJIA 3DB6A 3F88A 3QTWA 3DU8A 4N6YA 4D1SA 1IAHA 3OCGA 3UO5A 4DEIA 2ETMA 3MIAA 5A3XA 2Z7RA 4DH8A 5EDRA 1O6KA 4E26A 5C1QB 3KXNA 5FGKA 3GOPA 3MFSA 1P2AA 4P7EA 4N70A 5H9BA 2OZOA 4JQEA 4IDTA 1GJOA 4QNAA 4LRMA 4YO4A 5AMNA 4YLKA 3W16A 3S3IA 3PVWA 5IQFA 5I9UA 4YPSA 3QKLA 4AFJA 4PTCA 3ZXTA 3JXWA 4TYIA 1W98A 3I6UA 4BCFA 1YXXA 1H1RA 3DZQA 1REKA 2WELA 5AJQA 5IZFA 4F9WA 5L2SA 1JBPE 2WMAA 2PL0A 4BZDA 3FLWA 3UIUA 2ITWA 2V62A 3ZC5A 5EOBA 4FK3A 1YHVA 2QU5A 4WNMA 4C4FA 3RM6A 1Y8YA 3UVPA 2IZRA 4YHJA 3PXYA 5BVFA 4WG5A 1ZMUA 3UMXA 4J8NA 3HMIA 3LFAA 5FBNC 4AAAA 4IADA 5HHWA 1XHAA 5CYIA 3D14A 4NIFB 4JG8A 1W0XC 4E5WA 4V0GB 2ESMA 4KNBA 5BYZA 4P2KA 4QTDA 4IJPA 3HEGA 3HRFA 4M0ZA 5GZ9A 3SQQA 3KA0A 4MF1A 3VS1A 4CT1A 3HDMA 4HYHA 5AR3A 4JDHA 2A27A 3POOA 2BZIB 4J71A 4FV9A 4AA5A 4EYJA 4CLIA 3JS2A 2R3IA 2XCKA 3GFWA 4GT3A 4RRVA 5CEQA 3TIZA 5L8LA 4L3JA 1SYKA 5LVMA 3MTFA 4YZBA 3HLLA 2WGJA 3P08A 3KXXA 4D2SA 3W2QA 1G3NA 3BYOA 1M2PA 4RJ8A 3PXKA 4D55A 3FMDA 3UYSA 3VRYA 4P4CA 4QTBA 2RSVA 1PMVA 4BCHA 4ZTRA 3LKMA 3LMHA 3BU3A 4I23A 5IEXA 4ZZNA 2XNBA 4DG0E 5IDNA 2VWVA 5KO1A 1XH4A 2W5AA 4YURA 1RW8A 1DAWA 4II5A 5BUIA 3HVCA 4KIOA 3Q5ZA 2RKUA 2SRCA 4XLIA 5EOLA 3OY3A 1JKTA 1FVTA 5ANGA 3R7EA 1OI9A 3IPHA 3RAWA 5EKOA 2YZLA 3BI6A 4RBLA 3UIMA 2WQMA 3OWLA 2QOLA 1KV2A 3ODYX 4FTNA 3OW4A 3LJ2A 1YDTE 4RIWB 3VS2A 3TJCA 2IVSA 1ZRZA 2VX1A 4IB0A 4ITHA 4NFMA 5CNNA 2PYWA 3QQGA 4JAJA 5GNKA 3FYKX 1M2QA 4O0WA 5C8MA 5AUVA 4D9UA 2PZYA 3IOPA 4XCUA 3KVWA 5AUYA 1H1PA 3WBLA 3AGMA 4EL9A 5B2LA 1RE8A 4H3BA 2WOUA 3MB6A 2XH5A 2YM4A 2VTOA 4GFMA 1WVWA 2F9GA 3CC6A 5DR2A 1AQ1A 3CPBA 2VWUA 4TN6A 3O7LB 4QP9A 4RFYA 4YC8A 4L52A 1I44A 5ICPA 3TTIA 3W8QA 4OTQA 4USFA 5M4IA 2GFSA 5KHXA 4PNIA 3QZFA 2YIXA 2R5TA 3GBZA 4FOBA 3TV4A 4FEUA 4Z7GA 2WTIA 4EH8A 3FDNA 1EH4A 4YJTA 4OAVB 3Q2MA 4YHTA 3A7HA 2PMLX 4UYNA 3FZOA 4AE9A 5I9WA 5M08A 4M3QA 2JFMA 4EZ7A 3WIKA 4E6QA 5GIOE 1JKKA 2QR8A 4ASEA 2YCQA 4HYUA 4XBRA 5T3QA 3MGYA 5LMKC 5LWNA 1RJBA 3EKNA 4HPTE 3UP2A 4M69A 3Q32A 4JBOA 4Y73A 4ZJJA 3KL8A 3FZTA 5LMBA 1XBCA 2EUFB 2F4JA 4K33A 3I79A 4C2VA 3H9FA 3CPCA 5IISA 3V5JA 3A62A 4E4NA 5DWRA 5HTBA 4ZAUA 3AG9A 4RWJA 3C0GA 4FKWA 4LUDA 3OTVA 4OW8A 2GFCA 3I4BA 3NDMA 4KINA 4IFCA 4Y83A 5L2QA 3TZMA 3MH3A 3OXIA 2ITQA 1UNGA 4FKLA 3VQHA 2WQBA 3WF7A 4B8MA 3F7WA 4DG3E 1M14A 2VX0A 3F2AA 5DN3A 2RFDA 4XEYA 3SC1A 2PMOX 3KMWA 4BYJA 2OH0E 2XB7A 4FIEA 2JKKA 3MPMA 4WUAA 2IN6A 4FNWA 5HG9A 3FZ1A 3EN6A 4RX8A 3QALE 4IACA 2QNJA 2UZNA 5HESA 3RBWA 2UW4A 4ZIMA 2VNYA 5CF8A 4JOAA 5FEDA 4DH7A 2XKDA 4MF0A 4FK6A 2UW5A 3MW1A 4KBCA 2X6EA 5CNOA 3EMGA 3KXMA 5DGZA 3P0MA 2BR1A 3UPXA 1E9HA 1ZMVA 4FTQA 4RIXA 4TYHB 2CGUA 4BVUA 3ZU7A 4FKVA 4YNOA 4FZFB 5GJDA 3RHKA 2ITNA 4H1MA 4JJRA 4RLLA 4D0WA 5KBQA 3MPTA 2G15A 4LL0A 1PHKA 4JS8A 5J95A 2J4ZA 5HG5A 4E6DA 5AUUA 3RCJA 3BIZA 3S95A 4D1XA 2VTRA 1KSWA 3EZRA 3V5PA 1PW2A 4BCQA 3PXRA 4HVIA 2JFLA 3LZBA 3TKIA 4CMTA 2BKKA 4QQJA 3GU7A 3ZO2A 3OUKA 2YZAA 5CQUA 4K18A 5JGAA 1Q24A 5E4HA 3U6HA 3NAXA 2FA2A 2UW8A 4RVTA 3RPRA 4QTAA 4MEDA 4AZEA 4DEDA 4OT5A 3ZLXA 2UZOA 2HXLA 3ZLYA 2YIWA 4C3FA 4L68A 5HTIA 4KIQA 2VO3A 4E4LA 3MDYA 3S0OA 3QGYA 5KCVA 2VZ6A 5FTOA 3WILA 1P5EA 3R01A 4DBNA 2Y4PA 3HA6A 3SRVA 4LGGA 5HBHA 1Z5MA 3COMA 3EH9A 4NK9A 4G3GA 2OXDA 2W5HA 4C59A 1MP8A 2BHHA 4G16A 4EH9A 4QP6A
chains in the Genus database with same CATH superfamily
4I22A 2KTYA 1ZAOA 2HWPA 4FTRA 4M7IA 4QMQA 5E92A 3EQCA 3UOLA 1GAGA 2W7XA 4YPDA 2BDWA 3G90X 2UVZA 3GENA 5K9IA 1Z9XA 5EI2A 3EL8A 3BYUA 2OXYA 4Z16A 3QZHA 2HELA 5I3RA 3NCZA 3KQ7A 5GJFA 2CMWA 3VC4A 2C5VA 2HZ4A 4FRFA 4L46A 4KBKA 3KF7A 4BICA 3FMJA 3BE2A 3LJ0A 4IZYA 5CU2A 1WVYA 3R9HA 4MCVA 4AN3A 2GMXA 4KUJA 5CTPA 3O51A 3SRVB 4EHGA 4GVAA 3UZTA 4MTAA 2BUJA 2JIIA 5A4QA 2W1GA 3POZA 2GDOA 3I7BA 1YXSA 4U40A 1ZY5A 3B2TA 4FV3A 5CT7A 4DF3A 5H8EA 2BALA 2B1PA 1FPUA 1W2DA 4JAIA 4JG6A 2BTSA 5AP4A 3R71A 5I0BA 4UBAA 3PY3A 3PPJA 4RX7A 4BWXA 5TT7A 3HP2A 4L42A 3D7TB 4RJ5A 4J96A 2CLQA 3PXFA 3SLSA 3UE4A 4EOIA 3TNWA 1B38A 2ZV2A 5HE3A 2R7IA 4FZ6A 4R8QA 4A07A 4G3EA 2VU3A 3PP0A 3SVVA 5IA3A 4RX9A 3EN9A 2G2FA 2O64A 4WKQA 2PZIA 2R4BA 4HW7A 3O71A 4RSSA 3DFAA 2QCSA 4APCA 1H1QA 3NW7A 3OG7A 3MH2A 2HZIA 3EHAA 3H4JA 2XM9A 1KE6A 3LCSA 3OBGA 4IJ9A 5CX9A 5CXHA 5TKDA 3C4FA 3FC1X 5EKNA 3ZFYA 1DS5A 4GW8A 4J8MA 4O4CA 5I3OA 2A4LA 4AGDA 5M51A 3T3VA 3TG1A 4O6LA 2E9OA 4GK4A 4KD1A 3R00A 4Y72A 3HUBA 4NM0A 4GG7A 5EHYA 5HO6A 1PXIA 3NS9A 3MVMA 5K0KA 5JFWA 3Q96A 2Y9QA 4EC9A 4D2VA 2GS6A 3EYHA 3QF9A 4IWDA 3CQWA 2BZKB 3MVJA 4BBEA 3EOCA 5JH6A 2O63A 2HIWA 1ATPE 4ANLA 2X9FA 4EHVA 1BL6A 5BVEA 3KN5A 4U41A 4O96A 3QUDA 2LGCA 4MAOA 5EM7A 3BU5A 1FMKA 4GT5A 4IZAA 3ZRMA 4QMMA 4G34A 3QRTA 4I6FA 4C33A 4QP8A 3UZPA 2I7QA 4QP7A 3COIA 4FV4A 2BKZA 3NNWA 3Q4ZA 5HKMA 4TW9A 4FIHA 3L9PA 5JFVA 4NM3A 3KRRA 4R3RA 4JVGA 5HD4A 4X2JA 3LW0A 3RWPA 4AW2A 2GNHA 3RPOA 3G33A 4P5QA 5AIKA 3ZEPA 4YZDA 2WXVA 3DKGA 3PE1A 3AKKA 5F9EA 1AD5A 1YXTA 2X39A 4F9AA 4PUZA 3R9DA 3C4XA 4I0SA 4KBAA 4HOKA 2BIKB 4O0SA 3EKKA 5CSVA 5HZNA 2CNUA 3IGGA 5GZAA 1OKVA 4XG8A 3KK9A 3P1AA 2C6MA 2X0OA 2GTMA 2H8HA 1Q61A 2XBJA 2J0MB 2CKQA 4K9YA 4Z9LA 3ZRLA 2XBAA 3JVSA 4D28A 5DE2A 5C8KA 2XJ0A 2ZM4A 4HGLA 2BDFA 4S2ZA 3VS3A 1QPJA 4CTCA 4DC2A 2OH4A 1OGUA 5AX9A 4FUXA 1XH6A 4P5ZA 5AM7A 3DTWA 4Z3VA 4EONA 2Y8OA 1YQJA 2J7TA 2V7AA 4IBMA 4X3FA 4FTJA 5ANJA 4E5BA 2UW3A 5J8IA 3VF9A 5J1VA 2QONA 2REIA 3L8XA 4H36A 4LRKA 4E8AA 5BYYA 3G51A 4U8ZA 4I0TA 4PDPA 4NJ3A 4HNFA 3ORTA 3TDWA 4BI2A 4Y5QA 3O0GA 5HCYA 5DT3A 2CNQA 2BFYA 2ZV8A 4QMUA 1ZYDA 3HL7A 3K3IA 4EKKA 3DNEA 4WHZA 3V5TA 5AIRA 4BGQA 2C6TA 5BNJA 1YI4A 3DJ6A 2GQSA 1JPAA 1RDQE 3PLAE 5IQEA 3W2CA 3VBYA 3CS9A 2QODA 3H10A 4CD0A 4OTHA 5CAVA 2J5FA 3EQPA 5HE1A 1K9AA 3N9XA 2CHLA 5I5ZA 2ZDTA 2OJIA 1OPKA 3FE3A 2NP8A 3UG2A 2WU6A 4NKSA 4IXPA 4I6BA 4NH1A 5AP1A 4FV1A 3R22A 3UQGA 3WZEA 5AWMA 3F66A 4FKSA 3QC9A 4CQEA 4FTCA 4UYAA 4EK4A 1QCFA 2IW9A 1OL1A 5FM2A 4AE6A 3PIXA 4ASXA 5M44A 2XEZA 3GU8A 5DH3A 4CYIA 1WFCA 3RPYA 4O91A 2BRMA 2GQGA 4AACA 1UU9A 1F3MC 4Z55A 2J0KA 3EWHA 4NFNA 3PE2A 2QU6A 4QMLA 2Q0BA 5E91A 4D4SA 4F7LA 5IF1A 2XKFA 1MRVA 3UOKA 4DTKA 3NYVA 3R30A 4YTCA 3FQSA 2WTJA 2QLUA 3WZDA 4FI1A 4RWIA 2PVKA 2OJGA 5CSHA 4ZSLA 3KN6A 3QZGA 1T45A 4FSTA 4CFWA 2YA9A 2XEYA 4YGAA 5DVRA 4I5HA 4IZ5A 5J7HA 4DFNA 2R3GA 4L01A 5HX8A 2O2UA 3P5KA 4HZSA 4XG2A 4WRSA 4L9IA 2VTAA 1R0EA 3V04A 3SGCA 4YJPA 2XZSA 2IVVA 3RK9A 5CASA 3S2PA 1OGYA 3D5WA 4ZTQA 3ZUUA 4DT8A 1KOBA 4BWPA 1MQBA 2H6DA 3QQUA 4IANA 5IQHA 4PMTA 2WMBA 4ONAA 4AXFA 4EK5A 1Q99A 4BKJA 3D5UA 5DEYA 2NNWB 1E1XA 4F09A 2O8YA 4CLJA 1VJYA 4XRLA 3PJ1A 4CVAA 5AAEA 4JX7A 1M7QA 5BMMA 3RAHA 1MQ4A 1UU7A 2PVHA 3ALOA 1ZZLA 3OOMA 5DPVA 4BCMA 4FG8A 3GGFA 3TXOA 4P90A 3MA3A 3H0YA 4R5YA 2XS0A 5CALA 2BVAA 1ZZ2A 3N4UA 1IASA 2GNFA 2C3JA 5A46A 4L43A 3QUPA 2XANA 2PVNA 4JRNA 2C6IA 5B2MA 1FGKA 5J5TA 5G6VA 4PPAA 4BDCA 4ZXTA 3QU0A 3EB0A 4NKAA 4IM0A 2BIYA 4IMYA 2YIRA 3TV6A 3GVUA 4FEXA 4TXCA 4S34A 3R02A 5HIBA 2R3KA 4JIAA 2OJ9A 3D5XA 4YC3A 2P2IA 3FLZA 1H1WA 2C0OA 3HUCA 3FY2A 5KNJA 2XK8A 5FQDC 3GI3A 3ACJA 5EDPA 3RPVA 3GC0A 4JR3A 3IW7A 3WYYA 4ZTSA 3DY7A 4L7SA 4OTGA 3PWYA 2BFXA 2Y6MA 5FEQA 1JWHA 5KE0A 4DHFA 4DLIA 4F1OA 4EZ3A 2A98A 1JQHA 4L00A 3OCSA 5EYMA 5BPYA 4GL9A 2LAVA 3HMMA 3S1HA 3TUBA 4CMOA 3U54A 5LARA 2B9FA 3FZRA 4OT6A 1WBPA 4DA5A 4RFZA 3NUUA 4GK3A 4LI5A 2WAJA 4BBFA 4BCOA 3FQEA 3HV3A 5DG5A 5EI8A 4CEGA 1XWSA 4D58A 1ZARA 5IQIA 1CSNA 4DE4A 3A61A 3EJ1A 3HKOA 3BWJA 4FC0A 4PTGA 1W7HA 2W4KA 4OR5A 4RA4A 3ENMA 4WG4A 2YITA 4ZSAA 2H34A 3ZTXA 3EN4A 2VN9A 1TVOA 3FMKA 3NLBA 3KB7A 1XH8A 2JITA 2XF0A 2UW9A 3COKA 3ENHA 2WD1A 1YXVA 3D0EA 3Q2JA 1IRKA 3GU6A 4BHNA 4CMUA 4GUEA 5FG8A 2W1CA 2XYNA 4M67A 4AGCA 4EUTA 2EXEA 2IG7A 4LOOA 4EK3A 4C57A 3KY2A 3OFMA 4MBIA 3N4VA 4DFBA 5J9ZA 3U87A 5M57A 4HYIA 5CEPA 4XMOA 3FLNC 3QD2B 2EXMA 3MY5A 3UDBA 5C01A 3PG3A 3UPZA 4ZZOA 3NUPA 4RJ6A 2PU8A 4U6RA 2UVXA 4IAZA 2UZEA 3FMMA 5ANIA 4YUQA 2PUUA 3OT3A 2J90A 3R6XA 2JIUA 3WI6A 1W83A 2E9NA 4YJUA 4FV5A 4IAYA 4G3CA 2ZDUA 4D5KA 5JZNA 5BVWA 5HX6A 2YM8A 3WF9A 3RHXA 2W1FA 4JBVA 2FYSA 4UN0C 5AAGA 4ZLZA 2OZAA 3VBTA 3ZXZA 3V5QA 1F5QA 3DQXA 2ZJWA 3W1FA 2CKEA 5JGDA 5KKRC 5M4UA 2YM3A 1FVRA 3NR9A 4E3CA 3VJNA 4BCNA 3U9CA 3EQFA 4I6QA 3CJGA 3RGFA 3UDZA 4CFUA 4QMZA 4MXXA 3I81A 4IWOA 2VTTA 3AMAA 4NUSA 4X6RA 3GCQA 2W1ZA 3L9NA 4CSVA 4BBMA 4D4RA 3RVGA 1T46A 2XK6A 2I0EA 3PA5A 1XJDA 2PPQA 1BX6A 3W0PA 4OUCA 4EOOA 1W8CA 4FKPA 2W4JA 1Q8TA 4L3LA 5FLFA 4D2WA 1J1CA 2FSLX 3SV0A 4AGWA 3OHTA 3E5AA 2ZM1A 4QPMA 3V51A 3KULA 3R1QA 1APME 5KMKA 5IU2A 3L9MA 3ANRA 1WMKA 3GC8A 3Q04A 2E9UA 3BEGA 1H4LA 1OUYA 5EHOA 4G3DA 5JRQA 4BB4A 5L6PA 5CSWA 2OZAB 2CKPA 4FEVA 3UBDA 4D2PA 1YDSE 4I6LA 2JKQA 4ZSGA 3ALNA 3I0OA 3PSCA 4RG0A 5IEYA 3QFVA 4N4SA 3GQLA 4QP1A 5DRDA 2YERA 3C5UA 5KMMA 3DAJA 4EWQA 3REPA 5IG1A 4JBPA 4JNWA 3SXFA 4EJNA 4CYJA 3UNKA 3AKJA 4XOZA 2PY3A 5JK3A 1J7IA 3QX4A 4MXYA 2ZAZA 5IA4A 1GOLA 4IAKA 5EH0A 4CRLA 3G0FA 2E9PA 4IE9A 3W2RA 4FIIA 4N0SA 4I6HA 1WBSA 1BI8A 3AC5A 5BVKA 4J97A 3S00A 2OJJA 2JAVA 3H3CA 4L3PA 3KVXA 3SOAA 1H08A 4FSQA 4F1TA 4BDDA 2O0UA 3D9VA 3MJ2A 1ZLTA 3FPQA 4C36A 1OL7A 4AOJA 3DXQA 2OWBA 1Q3DA 1GIIA 4UMQA 5AUZA 4H3PA 3RWQA 4C35A 5K4JA 3LPBA 4FKQA 1OITA 2YABA 4BGGA 2X8EA 4F7JA 5BUJA 5ACBC 2QC6A 5K0XA 4O1OA 3C4WA 4FV8A 3OEZA 4DAWA 2GQRA 1BUHA 3QTQA 4GIIA 2VV9A 4U45A 2IZSA 2HOGA 2NO3A 4ZTLA 3UO6A 4E5AX 4U3ZA 4OBOA 3HDNA 5E1SA 4C4GA 2W0JA 1Q5KA 1UU8A 5FDPA 2JDVA 4BGHA 5HU9A 3QTSA 4PMSA 4XS2A 2NRYA 3PZEA 4ALVA 2VWZA 2XVDA 3OW3A 5IQAA 5HVJA 2OK1A 1KE8A 5E8ZA 3AT2A 3E64A 2YACA 1TKIA 2ZVAA 4F64A 3ORKA 4CGAA 4FKOA 4QP2A 2XNMA 1H28A 3ULZA 2EVAA 3UC3A 4A9TA 4UMPA 1VYWA 1X8BA 3U55A 4ZMFA 4ITIA 4LV7A 4L53A 1IG1A 2PULA 2WIPA 3RCDA 4AX8A 2Z8CA 5L6WL 4ANOA 3CY2A 3M1SA 4AA4A 3NUAA 3ITZA 2OF4A 3IQ7A 3F3TA 4NCTA 4RJ7A 4C37A 4KABA 4TNDA 3OTUA 2I0HA 3FMHA 5AV2A 3VO3A 3ZZEA 1S9JA 3OUNB 5LVPA 2PHKA 3WZUA 4FKJA 2BZJA 4QYYA 4LYNA 4YNEA 2QOKA 2F2UA 4W8DA 4RIOA 3IDBA 3QTRA 5E8VA 4O4EA 3BWFA 4KKGA 4NM7A 1URCA 3TNIA 1O6YA 2UVYA 4GU6A 4DITA 3VUDA 4Y85A 2W96B 4Y5HA 5AP3A 1KUTA 3HX4A 3VS6A 2ZV7A 3FC2A 3DLSA 1KWPA 3QQKA 1CKJA 3QA8A 5C27A 4ACCA 2XALA 2Y0AA 4DTAA 2GHGA 2Y6OA 2QURA 3EQBA 4XX9A 4UXQA 4YJOA 4I94A 1YHWA 4LRJA 4EI4A 3OCTA 4O7TA 5AV1A 3DAEA 3IW6A 4XNEA 2BPMA 5CS6A 1ZWSA 4YMJA 4NL0A 1YI3A 3R7UA 5CF6A 4E20A 5E1EA 2P4IA 4I1ZA 3UNZA 2CCHA 4XH6A 5HD7A 2PVLA 4A9UA 2B7AA 1J91A 1YWRA 1Q8UA 4USEA 4YZ9A 3R1NA 3KCKA 3P7BA 3ZMMA 1PMUA 4LMUA 4BCIA 3R73A 2GNLA 4KSQA 5CEKA 5IA0A 3NYNA 3ORNA 4M66A 4ALWA 1PF8A 2VD5A 4C4HA 2XIRA 4B6LA 4O2ZA 4O0RA 4D2TA 1GZOA 3AOXA 1JSVA 4DEEA 3DK3A 3LFDA 5IUHA 4DEHA 5JSMA 4O7WA 3DDPA 3A60A 4DH5A 3KK8A 3QTUA 3FLSA 4FTOA 2G2HA 3MFTA 2Y7JA 4IC7A 4R77A 1TZDA 1ZOGA 2QO2A 3VS4A 2IO6A 3EFLA 1ST0A 2J5EA 2YISA 3TTJA 5IH5A 4WBBB 1H26A 3VONA 4MNFA 3OBJA 3PA4A 4I92A 2VGPA 3GT8A 4UEUA 5IH6A 3E8EA 4HYSA 3ZBXA 3QTXA 2ZMDA 3WYXA 4JI9A 5KBRA 1J7LA 1SM2A 3MJ1A 3QD0A 4APPA 2QKWB 3C50A 3NZ0A 2YM6A 4H3QA 5BVNA 2GTNA 2OF2A 3U4UA 3DS6A 3Q60A 2RG5A 4AWIA 4FZ7A 2H9VA 3FEGA 3PDTA 4GG5A 4LDTA 3QAME 2ETKA 2R2PA 4TKSA 3E7OA 5I9ZA 1U59A 2C3LA 4DBXA 3I7CA 3D5VA 3RTPA 5DT0A 1FBNA 2R64A 2ZM3A 3GXLA 4XV1A 2WTKC 4ARKA 5J9LA 2CNVA 3OD6X 4RT7A 4QEBA 3DBCA 2C68A 3KU2A 3QQLA 4FTIA 4DYMA 4F99A 4FZAB 4FKUA 5LJJA 5M4FA 3DKOA 2Q83A 2VTQA 3HV5A 4H58A 4U81A 2HYYA 4CT2A 3LAUA 1WCCA 2HY0A 3UQFA 3D2IA 4C02A 3BV3A 4MK0A 5I4NA 2UW6A 3RJCA 4M69B 5LOHA 4O84A 4FV2A 4L67A 2WEIA 4FF8A 2CLXA 1M52A 1SNUA 1XH5A 3PP1A 3U6IA 3MH1A 4G9RA 4ORKA 1WVXA 3AD5A 5FDXA 2YFXA 5AR4A 5C03A 3F9NA 4ALUA 5C8NA 3WF5A 5ACKA 4FTMA 1G8JA 1CTPE 3RZFA 2IEWA 4BHZA 3TCPA 4EBVA 2HZ0A 3OWPA 4HGEA 2PVFA 5J5SA 3UIXA 3R8MA 5CLPA 3FHRA 5HI2A 3I60A 4EH4A 4FTUA 1CM8A 1IA8A 4YJNA 3R2BA 2WTVA 3FL4A 2R3QA 4GS6A 5HIDA 3PFYA 3TYKA 2VO7A 3UDTA 1PXOA 2G01A 3FI4A 3C1XA 2V5QA 4C34A 3Q4TA 3F61A 4HCTA 4MXAA 4CCBA 5GHVA 3QRUA 3QA0A 5DYJA 3QBNA 2C5OA 4BCGA 3Q9WA 3DGKA 2EU9A 3FKNA 5KZIA 5DMZA 4RIXB 4U9AA 5EFQA 5HEZA 3NMUF 2W4OA 1J7UA 1YI6A 3R2YA 4RPVA 4CNHA 4ANNA 4HVGA 5JT2A 4QP3A 3TZ7A 4UZHA 4W8EA 4IB1A 4FL2A 4L44A 4TNBA 5E8XA 3ROCA 3VULA 3ZM4A 1QPEA 1J1BA 3FLQA 4GJ2A 1WBWA 4YZMA 5F4NA 5F94A 3BHHA 3BELA 3R9RA 4G6LA 3E88A 4IAIA 3TNPC 4RQVA 3KFAA 3DK6A 4BYIA 2ZYBA 4FVRA 4C7TA 4QMPA 2QG5A 4EBWA 3VUKA 2XJ2A 4Q2AA 5CAUA 3JR1A 1OPLA 5AR2A 3G15A 2DQ7X 4V04A 3WZKA 4MQ2A 4FT0A 4GV1A 2R3FA 1VYZA 3IS5A 4K8AA 3ZO1A 3PLSA 2JKMA 2JDOA 3G5DA 1ZY4A 2ONLA 4FNXA 3N4TA 2RFEA 1OPJA 2WHBA 1V0PA 4MNEA 4NT4A 2RGPA 2J0IA 5KMNA 3PFQA 2R3OA 1KE7A 2X0QA 3BEAA 3ZHPC 1WBTA 3JVRA 1CMKE 4B99A 2BAJA 1DAYA 3OEFX 4IFGA 2JKOA 4PL5A 2PMIA 3TKHA 4KIPA 3BHVA 3OP5A 3A8WA 4I5CA 4BL1A 3G2FA 3LLTA 5AADA 4K77A 1FINA 4QDVA 4FNYA 4LUEA 4L45A 3PUPA 1OKZA 1Q8YA 2VWXA 5EYKA 3V01A 4C62A 3KRLA 3ZZWA 1M7NA 4ZS0A 4QMNA 1KV1A 4BTKA 4ZLYA 3TN8A 2IZTA 3TWJA 1XBAA 2X8IA 1VEBA 4Q9ZA 3Q6WA 3AT3A 1UWHA 3BGPA 2I0YA 4M68A 4IM2A 1YHSA 2XRWA 3FMLA 3ID6C 3HV4A 4A4OA 4GCJA 4TWPA 5A54A 1LUFA 2XIZA 2XRUA 2WQNA 3BLAA 3NIZA 3LJ1A 1JKSA 1ZYSA 3KMUA 3ZONA 4YJSA 4BIEA 4ERWA 5DNRA 2WIHA 2FVDA 3QQJA 3FY0A 2UW0A 1PKGA 1XQZA 4NTSA 3LM5A 4YR8A 4L6QA 4FSYA 4AAYA 3CGFA 4IZ7A 4G17A 4PTEA 3DB8A 2V22A 3NX8A 3UO4A 2ITVA 4IW0A 2BTRA 4RJ4A 4X2FA 5J7BA 1SZMA 5JFSA 2F2CB 3DJ7A 3RINA 1PXPA 3C7QA 5ITAA 1XMLA 2IVTA 4IM3A 3O50A 2QI8A 4IEBA 3W55A 3HV6A 3FAAA 4ZY5A 2R3RA 1NA7A 3GEQA 3QQFA 4FKTA 3WF6A 4RA5A 3DXPA 1P4FA 3VBVA 2DYLA 1BYGA 4FSNA 4R78A 1Y6BA 2XJ1A 2CGWA 2VTHA 4LG4A 4R5SA 5BVOA 5HTCA 1OBGA 3WE8A 4HGTA 5D7AA 4F1MA 4XG3A 4XBUA 3RP9A 3TJDA 3IK3A 1SVGA 5KMJA 3TMOA 1Q8ZA 2XCHA 4XJ0A 4BZOA 1XKKA 4I20A 4FV7A 5LVNA 4U97A 2OXXA 3UOHA 4YU2A 3B8QA 4G2FA 2FSMX 5ANKA 2X1NA 3CE3A 2RFNA 1H25A 4HCVA 4XV3A 5E8UA 4FKIA 2YLFA 5TO8A 3UP7A 1DI8A 4ANMA 4O21A 4G1WA 4GVJA 5CANA 4CG8A 3VUGA 3KMMA 3DKCA 4FTLA 3THBA 2VTJA 1V1KA 2PZRA 4AT5A 3OC1A 1FGIA 2X2LA 3PY1A 3ZOSA 4EOPA 4BF2A 1E1VA 2GSFA 4RX5A 3W0SA 4FEQA 4PY1A 4IX3A 3A7IA 4XG4A 3RI1A 5IQCA 2YDIA 2YIYA 3A4OX 3A4PA 2DWBA 2YHVA 3DCVA 2UUEA 4H39A 1YDRE 3PVGA 3QZIA 5CENA 5E9EA 3AMBA 4MXZA 5CSPA 4EH2A 3NGAA 3RK5A 3Q52A 2WB8A 4LOPA 3VJOA 5FUTA 2PSQA 5LWMA 3QHRA 4FA2A 3GUBA 2UZLA 1OB3A 5D41A 1XH7A 3LHJA 4A9RA 4FOCA 4HVSA 3PJ8A 4EOKA 4AA0A 4OTIA 1OVEA 3QYWA 3AC8A 5BQ0A 3C5IA 3CQEA 4USDA 3C4EA 1BLXA 1FQ1B 2BZHB 4DTBA 3LXLA 4DGOA 4YTHA 1L3RE 2FB8A 4FSZA 4C58A 4EOLA 1PXNA 3C4CA 4ZOGA 4UWYA 1B6CB 4K0YA 4EYMA 1UA2A 3MB7A 3E8CA 4QMXA 5LCJA 1H27A 3VIDA 4UY9A 2FSTX 5AAFA 2UZVA 2CGVA 5EQEA 4X3FB 4W4YA 4RQKA 2BILB 4WD5A 3KXHA 5A6NA 5IQBA 4R6VA 3Q5IA 4IQ6A 4OLIA 5EDQA 5JFXA 3IDCA 4AW1A 2CSNA 3MH0A 1CKIA 4BIBA 2OICA 4WT6A 3F2RA 2FSOX 3CR0A 5JEBA 4I5PA 5CVFA 1U54A 2XYUA 3PIZA 4UALA 2W99B 3K5VA 4FL3A 3PZHA 3FBVA 4MUQA 3BBWA 2VNWA 4MD7E 3VF8A 3VS7A 3E62A 3I0QA 4OTRA 3O7LD 3MA6A 3F3WA 5AP6A 3AD6A 4RC2A 4QMWA 2JLDA 3PJCA 4FSWA 5HG7A 3VUTA 5LXMA 3ZO4A 1SVHA 4F9YA 4H05A 1PXKA 5IMEA 1PKDA 4CZUA 4E93A 3TT0A 3Q9YA 3OXZA 4OTPA 4Z7HA 4M12A 3CKXA 2YWVA 4DT9A 3TM0A 2GNIA 3PXZA 3F5GA 4MBJA 4E1ZA 3QD4A 4MWHA 4DGLC 4YSJA 1ZOHA 5CU6A 3TUCA 3M42A 3PG1A 5CEMA 4BTMA 1MUOA 5JN2A 2X4FA 3ZC6A 1PXJA 2W5BA 4PF4A 3LCTA 3ZO3A 4NTTA 4AUAA 2QO7A 2R9SA 3PRFA 4XRJA 5J87A 4QQTA 1LEWA 3ZUVA 5B2KA 1NT2A 3BYVA 5BV3A 3AC3A 4YSMA 3P86A 2XIYA 3QKMA 4IVAA 3DZOA 4FT9A 3F82A 3IG7A 3MV5A 4D4YA 5FBOA 1TQMA 2V7OA 2X0GA 3AD4A 4IAAA 4QNYA 3OVVA 3L9LA 5EW8A 4E7WA 5HCZA 4OTFA 2RIOA 4LOQA 4EORA 3KIOC 2O3PA 1QPDA 5KZ0A 3VBXA 4JX3A 5HGIA 3ROYA 4OTDA 2P2HA 2Z7SA 3LQ8A 3W2SA 4JR7A 4U5JA 1FOTA 4W9WA 2XMYA 4BDFA 3O8UA 4LMNA 4DEGA 4G9CA 4F9CA 3UVQA 3MTLA 4MXCA 1XO2B 4EC8A 3CIKA 3NNVA 2CPKE 4IC8A 1ST4A 4J52A 2WU7A 5TOZA 4F0FA 4I5MA 5EW9A 1R3CA 4V05A 3OZ6A 3V8TA 3WARA 2IF8A 2YM5A 3ZCLA 2X2MA 5AP5A 2XIXA 3UOJA 5E8SA 1YW2A 2OIQA 4EQUA 5E90A 4BCPA 3NFGB 4IX5A 5EK7A 1KOAA 3N51A 3QRIA 4TPTA 4A4LA 3JPVA 4ACDA 4RC4A 1S9IA 3I5NA 5CEIA 2YJSA 5KHWA 3I1AA 3OMVA 3GCSA 5HVKA 2WMUA 4NWMA 3FJQE 2A0CX 1K3AA 3F2NA 3TV7A 5HNBA 3NPCA 3MY1A 4IWQA 4RZWA 4LQMA 2PZPA 4FTAA 4XP2A 3U9NA 4TYJA 3D4QA 3VNTA 4KS8A 2C3IB 4QPSA 3DA6A 3ZBFA 4EH3A 5GIPE 3D2KA 4X2GA 4RGJA 3Q6UA 1H07A 4GUBA 4M13A 3BHUA 1M2RA 3WZJA 1AGWA 3QQHA 2QOFA 4DGGA 4BDAA 3QWKA 2OIDA 2X7GA 3UJGA 2HAKA 3CP9A 4KRCA 4JIKA 4WUNA 3VHKA 5D10A 3C9WA 3FV8A 4S30A 4NZWB 3VUIA 1V0BA 2ETRA 4GSBA 4GYIA 5DT4A 1HCKA 3AMYA 4H1JA 4MD9E 4UWCA 4ZEGA 4ZTHA 3R9NA 3M11A 5KUPA 3BQCA 3ZDIA 3HRBA 4B8LA 1SMHA 5IQDA 1OKYA 5EQPA 4BWKA 4PQNA 4KA3A 1XBBA 5HVYA 3M2WA 4GFOA 4EJ7A 3DV3A 4O22A 3V5LA 3CY3A 4R1YA 1UVRA 4I3ZA 2YCRA 4KB8A 1QPCA 4DN5A 2FUMA 4YP8A 3F3ZA 5HE2A 4Y95A 4FBXA 2VTNA 3LOKA 2PK9A 4LV8A 3ZSGA 5HE0A 4PL3A 4FEWA 5HO7A 3T9TA 3UNJA 2B53A 1OIQA 2I1MA 2QQ7A 2X9EA 3DBFA 4DLJA 3QGWA 4I4EA 4UV0A 1BKXA 3MBLA 3LXNA 4RIYA 4YZNA 4E6CA 3MY0A 1H01A 1JSTA 4BI1A 3P79A 4QTEA 3OS3A 3HMPA 4J7BA 4O7ZA 4BY9E 4MQ1A 4L7FA 1Y57A 3ACKA 2GNGA 4ZY6A 5LVLA 3LLAA 4BN1A 5G1XA 5LMKA 2ERZE 1HCLA 3Q9XA 5AV3A 3R7IA 5EI6A 2WNTA 2HWOA 4RWLA 5EYDA 1LR4A 4CRSA 4C4IA 5CU4A 2QOQA 1H00A 3ORIA 5TR6A 2BRGA 3R8VA 1LP4A 2WQEA 3ANQA 4ANQA 3MSSA 1PXMA 4FGRA 2I6LA 4R1VA 2QLQA 2W9FB 2J0JA 3AT4A 5CF5A 1JAMA 2I0VA 2IZUA 4JDJA 2Q0NA 2QOIA 4YJRA 5GJGA 4R3PA 3V3VA 4A9SA 4F4PA 3ATTA 4XOYA 3MYGA 4R3CA 4BR3A 3IW8A 4CQGA