4YHTA

Braf complexed with an inhibitor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
271
structure length
256
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHTNETKFEMTKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKGSILWMAPEVIRMQDPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPTFPQILASIETLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title GSK114: A selective inhibitor for elucidating the biological role of TNNI3K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
total genus 77
structure length 256
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yhtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yhtA01
3TEIA 3EQFA 4WG3A 4KB8A 5IQGA 5L8LA 1LEZA 2HW6A 4FV3A 3BPRA 4DEEA 2PZIA 5C8KA 3LFEA 3EOCA 3NWWA 5HI2A 4QNYA 1XH9A 1UU8A 2CGXA 5JQ8A 3OWPA 5K9IA 3DXNA 3ITZA 5C26A 3F88A 1XBCA 1NT2A 4FV7A 4RIXA 2ITTA 1REKA 3BV3A 1JAMA 1WBSA 2GSFA 3MA6A 3O8TA 4YHJA 2CHLA 2XK8A 4BN1A 4IB0A 4YNOA 3FEGA 1OL1A 2XJ0A 5E1SA 5D41A 4MKCA 4ARKA 1KV1A 5CEMA 5C03A 4CKIA 3UOKA 2UW6A 4R77A 5AP4A 3THBA 3ORMA 4D2WA 4H3QA 1WZYA 2FSTX 2EVAA 2YM5A 3CSVA 4HPTE 3G51A 5DPVA 3OTUA 4RG0A 2PVFA 5IA0A 5JFSA 3HV3A 2IVVA 2WQMA 5IA1A 3KFAA 5CF4A 2GNLA 4EHGA 5CAPA 2FO0A 4X6QC 3F2NA 3ZLSA 4NCTC 1YHWA 4NWMA 3A7FA 5I9UA 4CFFA 4EK3A 2OZAA 3EJ1A 2W4JA 2PY3A 1JNKA 4WNMA 5LARA 2LGCA 3PJ3A 4J53A 4WG5A 4Q9SA 4CKJA 3G2FA 4UWCA 3UP7A 3VN9A 3VBVA 4BDJA 4BY9E 2CGVA 3PIXA 3N9XA 4AP7A 4UMQA 3D2IA 3KRJA 3FXXA 1A9UA 3KN5A 5A6OA 2IG7A 5M53A 2XCHA 5J1WA 4S30A 4X3FC 2B4SB 3UOJA 1LR4A 4B0GA 4UBAA 3VIDA 4EH9A 4FIGA 4FTJA 5T3QA 4F65A 4RA4A 3R30A 3QKKA 2VWBA 3LQ5A 2BR1A 3R71A 1PXJA 4AUAA 5LMKA 2Y0AA 4XLIA 3ZO4A 3NMUF 1LUFA 3FZTA 4ZTHA 5T68A 4DH3A 4BRXA 4J97A 3V5TA 4EJNA 2OJFE 2VWXA 4G3EA 4O0VA 1YKRA 3QWJA 4TZRA 4S34A 1V0OA 1JVPP 3FZOA 2JKOA 4A4XA 4DEIA 5AR8A 1PXIA 3BEGA 3G9LX 4KBCA 4LG4A 5F4NA 5AV1A 4D0XA 2VD5A 5AUZA 1GNGA 2W5HA 3Q9WA 3R8VA 3MI9A 4O7TA 3AC8A 4FTQA 3QUDA 4M97A 3FI8A 3E88A 3AGLA 3N51A 4GK3A 5EYDA 3MFRA 4UWYA 3SLSA 2PZ5A 2A27A 3UVPA 4CTCA 5E7RA 5C4KA 2ZM4A 2IVSA 4BICA 5CZHA 1WVWA 2OH4A 3B2WA 4WUAA 4OGRA 5B0XA 3FLYA 4R6VA 3UMWA 5CY3A 4DLIA 1O9UA 3KN6A 1DI8A 3UO4A 4CYIA 5M06A 3DK6A 1O6LA 4O0WA 4E6QA 4FA2A 3IW8A 2VRXA 4BZNA 4MEDA 4A9SA 4QNAA 1Y8GA 2OK1A 2UZUE 4FKUA 4KSQA 2QCSA 1YWRA 2A1AB 5BMMA 3JY9A 4PP9A 1K3AA 5KE0A 5EHOA 3E63A 2NRUA 2OZAB 2QI8A 3VRZA 3WYYA 3MH1A 3DQXA 5LQFA 3Q4CA 5IQEA 3KEXA 5TOZA 4EONA 4P7EA 2OBJA 2A4LA 5FDXA 4AZVA 1QPDA 2NPQA 1WBNA 5FP6A 4BHNA 4JBQA 3HUCA 5IA5A 4QTEA 5JEBA 1ND4A 4BVUA 4UZHA 3EZRA 2WAJA 3SRVA 4CRSA 4USEA 4C62A 2Q0NA 3GC7A 5JZNA 4OTGA 4EUTA 2HY0A 4XG6A 4ANOA 4EH6A 1YW2A 1H4LA 3ZYAA 4M68A 2R3PA 2IW9A 3VWAA 1JSUA 3BELA 2PK9A 3Q32A 3WF7A 4FK3A 4FV8A 4CFNA 1H1WA 3HECA 4V0GB 2WMRA 4YPDA 5B2KA 1UKHA 4YJVA 1ZOEA 3AG9A 3HNGA 2VUWA 2YM8A 2J5EA 2JIUA 1YI3A 3LXKA 4CXAA 1TQPA 1PXOA 4BDBA 4WG4A 1O6KA 2X6DA 3FMNA 3O8UA 3NDMA 3SXRA 1AD5A 2GPHA 2ITOA 1K2PA 2C4GA 4K77A 4I0RA 3WZJA 2CNUA 4NM5A 2GMXA 4QPMA 1GY3A 2F49A 4EH5A 2HAKA 4C57A 4DTKA 4GK4A 2J4ZA 3C0IA 3DAEA 1UWJA 4GEOA 5FTQA 4U42A 1OPLA 3O8PA 4I6BA 4YTFA 3TUBA 4LM5A 2EXEA 5GIPE 4H3PA 2WTKC 2PVRA 1Q8YA 4PPBA 4MD8E 1GAGA 4YO4A 1URCA 3EQPA 3K5VA 1R0EA 3VBYA 2CN8A 3FMHA 4WRGA 5E1EA 4ANQA 2YAKA 3OVVA 3ZFXA 2JEDA 4KBAA 4DE4A 4HZSA 2BZIB 2CGWA 3PTGA 5L8JA 3REPA 3U55A 4DA5A 1PKGA 3SW4A 2PSQA 3Q04A 3FMDA 3UP2A 4AGUA 4CD0A 3PZEA 4IB5A 4GFMA 4AG8A 3OP5A 2FA2A 1KE9A 2J0IA 2X1NA 4GU9A 3NNVA 4XBUA 4C58A 3SG8A 2XNPA 4UEUA 4BHZA 3ODZX 3C4EA 4BZOA 4H39A 5AP7A 5AIRA 4O0XA 2YABA 2CGUA 3QZIA 5ETFA 3GCPA 4BDCA 3GU5A 4YHFA 5KMKA 4NZWB 2VWVA 2YJRA 1RDQE 4FV5A 5CEPA 2G9XA 2JKKA 2RGPA 4EC9A 2PE1A 2R3KA 3PLSA 4RC4A 4XG3A 3TZ7A 5AP2A 4I0SA 3BLHA 3LCKA 5ETCA 4O6LA 4H36A 4KAOA 4F63A 4TTHB 3VS2A 2W9ZB 4RFYA 4W4WA 4RBLA 5H8EA 3T8OA 1FBNA 4GG5A 4QP3A 5TF9A 5M4CA 1UU7A 4C02A 5CYIA 2HYYA 3TKIA 4FZ7A 4BKZA 4FTMA 5J8IA 1VJYA 1BX6A 2C3IB 3LVPA 4MH7A 3TNQB 4JL9A 3T9TA 5DYJA 2GQGA 2JBOA 4YBKA 4AOIA 3HEGA 3PA4A 3QALE 4M69A 4X2JA 3HV5A 4K11A 2X6EA 3OG7A 4LL0A 5IPJA 4P2KA 2J5FA 1Q97A 4K8AA 4EZ5A 3H10A 3DXPA 2AC3A 2XK7A 3IGGA 4EZ3A 4M69B 2WIPA 4IC8A 1OM1A 4TY1A 2UW0A 4FIHA 4ZLYA 3B2TA 5JGBA 1J1BA 4I23A 1FVRA 4JAJA 2UUEA 5DHJA 4D4VA 4KKHA 4U45A 3NYOA 3DZOA 2JDOA 3MTFA 4QMZA 2I0YA 4YC6A 5IKWA 3W2PA 2HZIA 3GI3A 3RALA 3LMHA 3HV4A 4FUXA 1VR2A 1YHSA 2O5KA 2YACA 4O7YA 2GCDA 4YSMA 2XYNA 3NNXA 3O7LD 3QQGA 1GIIA 2C30A 1F0QA 3ENMA 4HOKA 4U40A 5CAQA 5A6NA 4TWPA 3GCQA 3EFWA 3PY1A 4JG6A 4JQEA 4FTRA 5J79A 5DLSA 3FLZA 4ALWA 3ZDUA 4FR4A 5I9YA 4YLKA 1OL6A 4FG8A 4FL2A 4IJ9A 4AGDA 2OW3A 2F7EE 3PA5A 3QTIA 4H1MA 4NW6A 4APCA 4LQMA 2QNJA 3ZTXA 2KULA 1UU9A 1G8SA 3H9RA 4DT9A 3JS2A 5BYZA 1Y91A 3HMMA 2PPQA 5LVLA 2ZMCA 1RE8A 1GIHA 1DAYA 3BYMA 3HMNA 3VUGA 3RM6A 3P5KA 4F7LA 3I5ZA 4MX9A 3I6WA 4ANLA 5IA2A 2ITYA 3TL8A 3QRJA 2YM4A 2C3KA 4KUJA 2WZJA 2GU8A 4RLLA 5CTPA 5FXSA 2CCHA 5F20A 2B1PA 4O7NA 2V7AA 2Y4PA 1ZZLA 3O0GA 1XH7A 2YCQA 5CSHA 5IUGA 2WKMA 4CLJA 4YP8A 3DK7A 3A4OX 5L2IA 1Q99A 4C8BA 2VX0A 1ZWSA 4KIPA 5HOAA 3FLQA 2OH0E 2GNIA 1P5EA 4BF2A 4R7IA 5IG1A 4O2ZA 5HZNA 3UQCA 5BQ0A 1OKVA 5AAFA 1Y8YA 4FSYA 3ELJA 2C5OA 3AMBA 1R39A 3GU8A 3LQ8A 2ITZA 3P1AA 4O91A 3ZUTA 5IQFA 5M08A 3COMA 1Z9XA 4G3CA 4HZRA 4PX6A 3QCSA 5BYYA 4IDVA 4GUEA 2Z7QA 4TWOA 2YJSA 5AX3A 4F64A 3KRRA 2W05A 5AUWA 1W84A 5J9ZA 2AUHA 2GNHA 3D9VA 4JNWA 4RVLA 3ZC6A 2GS6A 4N57A 3QTUA 4P4CA 3VS4A 3KRXA 4KABA 4OR5A 2OIQA 2YISA 4NM0A 4CFMA 4MAOA 1UKIA 3GNIB 4O22A 3PDTA 4YZNA 2B9HA 4DG0E 5CI7A 2OG8A 4MXZA 4W4YA 4I4FA 1SM2A 4JLCA 3BGQA 3A8XA 3OCSA 4IW0A 4BTJA 4PMMA 4FV4A 5AR5A 4X2FA 3DKCA 3TZMA 3FXZA 3DAJA 5IDPA 4UN0C 4RC3A 2BHHA 5CQUA 5KBRA 3I60A 3QC4A 2YN8A 4AOTA 4H3BA 4BR3A 1CTPE 3P86A 2QOHA 4D58A 3ID6C 4DFBA 1OITA 5EFQA 4KS7A 1ZOGA 2ZM1A 1O6YA 4KNBA 4PNIA 3WF9A 3ZO2A 4Y72A 3ZONA 4AZTA 1KSWA 4OUCA 5EYKA 4USDA 1U54A 3RPOA 1GZOA 3GQLA 4JRNA 5HCYA 5L4QA 4IAAA 5DMZA 3PA3A 2HELA 1GZ8A 2VWUA 3G5DA 5GIOE 3FLNC 1BKXA 2W1GA 2BFYA 3E7VA 2C3LA 3Q5ZA 4FNZA 3RZFA 3KF7A 5IA4A 4KIQA 3QZGA 1ZY5A 2PVNA 2BAKA 4FIJA 4JT3A 4ZY4A 1JKTA 2PVYA 4I3ZA 4XP2A 3IGOA 3E62A 4ZTMA 3QA8A 4RJ4A 3BHYA 3A7JA 1T46A 2V22A 4X6RA 3Q4TA 3S2PA 4LGDA 4QRCA 4HYSA 3KMMA 4OBQA 4PL4A 5I3OA 3KGAA 2W1HA 2XBAA 3BU3A 4L42A 1IASA 1ZMUA 4F4PA 1NVSA 4MD7E 2B54A 3TG1A 4EWQA 4JG7A 3QQKA 4QD6A 3FZRA 4YMJA 4DH5A 3W33A 4G9CA 5FDPA 2BRNA 1YXTA 3L8PA 4XG9A 3CPCA 3CIKA 3D14A 2YZLA 3EQIA 4FT3A 3E92A 3R9NA 4R3PA 2IW6A 4AA5A 3GU6A 4EK5A 4YU2A 2VGOA 4MTAA 4BCQA 4HYHA 4IX3A 4EOSA 3BYUA 3C0HA 5H2UA 5CWZA 3C1XA 1HCKA 1P14A 2XNBA 5M4UA 3PVUA 4D5HA 4FVRA 4TNDA 4F9AA 1MQBA 2YZAA 4ENYA 2G1TA 3F5PA 3IDCA 3DA6A 2VU3A 5DBXA 2OF2A 4FSQA 4ZSEA 3MPAA 3R01A 5A4TA 4ONAA 4ZXTA 3ROYA 4CMOA 2IVUA 4F7JA 5FUTA 3VVHA 3EQHA 4MXAA 3GC8A 4FIEA 4M8TA 3WARA 2OF4A 2PE0A 5E9EA 1W8CA 3DNDA 3EMGA 4FV6A 4YJQA 1NA7A 2O2UA 1PMVA 2WQOA 3OBGA 3C4ZA 1QPEA 3CKXA 1M14A 2I6LA 3MJ2A 4O21A 4O7SA 4XLVA 5DEYA 2BZHB 3CR0A 3VS6A 1ZRZA 2C6LA 2I1MA 1K9AA 4G17A 4DCAA 5HU9A 3EQGA 4BIBA 3F7ZA 5EHLA 5G6VA 4IX5A 3DTCA 3UZRA 5CAOA 4AW1A 3IKAA 2VTJA 3RZBA 2XH5A 1JKSA 1XBAA 4FNWA 5K5NA 3DBQA 5K4JA 2C0OA 2XRUA 4MNEB 2XBJA 1UNHA 4MWHA 4XRJA 3JPVA 1M7QA 4G9RA 4DT8A 1TKIA 3R00A 3EIDA 4O0YA 4XCUA 3QTSA 4YO6A 3LJ0A 3POZA 3O17A 4Z55A 4E5AX 4FSRA 4G34A 4K33A 4PPAA 1H8FA 3HMIA 4FL3A 4ZTSA 3I5NA 4TYEA 2W9FB 4L3JA 4F9YA 5A4CA 2YAAA 5IEYA 2ZDUA 4XG2A 2E9VA 5AA9A 1IAJA 3OCGA 4J98A 3FC2A 2QU6A 2UW4A 1YWVA 2BRMA 2X7FA 5ITAA 4ALUA 4ZS4A 3WZEA 4CTBA 3O51A 4DLJA 3NX8A 5IMXA 3R1SA 4L46A 3UIBA 3KA0A 5T6KA 1MRUA 3R9HA 2WMQA 3NEWA 4CRLA 4IH8A 3FMLA 5CU3A 5C1QB 4WA9A 1WFCA 3M2WA 4NCTA 5L2QA 2VWZA 5AV2A 4F0IA 5JZJA 5C8NA 4DGOA 3C50A 2C47A 2CKEA 4H58A 1Q4LA 4IJPA 3AC1A 2SRCA 3C0GA 3G6GA 4FE2A 4MF0A 4HYUA 2G2HA 2WEVA 3DU8A 3O71A 4Y95A 3NNUA 5DE2A 3Q5IA 3V6SA 2WMAA 3I6UA 5DT0A 2QOQA 2HCKA 3OCBA 2WOUA 4KD1A 4EL9A 3KREA 3TDVA 3LAUA 4CVAA 2WELA 2Z8CA 5IA3A 4BCHA 4EKLA 4EOJA 4P5QA 2QQ7A 5JT2A 3V51A 4EOLA 2XK3A 5ANEA 2XCKA 4J8MA 2PMIA 3R7GA 3VO3A 3DAKA 4DHFA 3NIZA 3KMUA 2A2AA 3GC0A 4WIHA 3UC4A 3PVGA 5CAVA 3NIEA 3KY2A 4C59A 5A46A 2E9UA 4I5MA 5DR6A 5EOBA 4BDGA 5BYLA 4IVBA 4DBXA 4GT3A 4EKKA 3OEZA 2WO6A 1CMKE 4LV8A 3TJDA 4BBMA 5CU2A 1FMOE 2R2PA 3V8SA 5KCVA 3MH0A 3KXGA 3O7LB 3E7OA 5L6PA 3O96A 4WT6A 5FTGA 4NT4A 3C5IA 4EHEA 3G6HA 4NKAA 2X7OA 4FZFB 4TYIA 2ESMA 3TCPA 2YWPA 2EB2A 3F5XA 3FSFA 3LMGA 5CEQA 5AAGA 5I9VA 4UMRA 1M2QA 3P7BA 3EFLA 2C5VA 5HLPA 4FUYA 3LFSA 3NYXA 4XHKB 5TO8A 5EKNA 1YDRE 1STCE 2IWIA 5AUVA 4BC6A 3R7UA 5HTCA 3QXOA 4G16A 3W55A 4CMUA 1BL7A 3IDBA 4ANSA 5GZ9A 4CZUA 1UWHA 4RC2A 2VTPA 3ZEWA 2Y9QA 4YBJA 2GS2A 3IO7A 4BYJA 4V0GA 5IQIA 3F66A 2XB7A 3ZZWA 3NUSA 4ITJA 3FI4A 2I40A 3ZS5A 4BTMA 2PTKA 5CZIA 2W99B 5CLPA 3MIAA 3E8NA 2OICA 3HGKA 4FTKA 2IPXA 1GJOA 4UZDA 4JG8A 4L52A 1CDKA 4EK6A 2GS7A 3E3BX 2ERKA 3FHRA 1B39A 1Z57A 5KNJA 4AZEA 4DEGA 2OSCA 3D94A 1DI9A 3CGFA 3ORTA 4FOCA 1RQQA 4FK6A 2J90A 4M3QA 1NY3A 3F6XA 4RWLA 2R3MA 4D9UA 4QPSA 3R8MA 3R2BA 4EOQA 5ACKA 5I5ZA 4J96A 4BCNA 5EKOA 1YOMA 4J7BA 5ANKA 4MVFA 1YXXA 2Q0BA 3IW6A 4RFZA 3ATSA 4ZZNA 4ZS0A 4A7CA 2OJ9A 3QYZA 4RWKA 3F7WA 4O27B 4NK9A 4ZZMA 3S0OA 2XMYA 4O96A 3DKOA 2UZNA 5J9YA 4U5JA 1P2AA 4K6ZA 4PL3A 4BL1A 2C1BA 3QU0A 4BWKA 5LCKA 3C13A 1W98A 3N4VA 3EFJA 5IQAA 4LOOA 1J7IA 5EW8A 4S33A 2BKKA 4Z7GA 4USFA 4QT1A 2IZTA 4KRCA 3ZLYA 3Q6UA 4FSNA 1PYEA 3U6JA 5K0KA 1ZMWA 4FI1A 4FC0A 3BE9A 3KKVA 2WTDA 4F1TA 2GDOA 3A7IA 4L68A 4Y8DA 4B6LA 4XRLA 3TN8A 5D12A 3UTOA 2YEXA 3CCNA 2BILB 3CTJA 3LJ2A 3W16A 4BCIA 3VJOA 4E6DA 4G6NA 5IDNA 4DEBA 2OIDA 3AC2A 2XP2A 3BYSA 4E4XA 5EDQA 5HICA 3F3ZA 4IEBA 4F09A 3GFEA 3QLFA 3UG2A 3U4WA 1XH6A 2PVMA 3SHEA 3E5AA 3MV5A 5IQHA 5GJFA 4C2VA 1OECA 4GW8A 4YJOA 4G2FA 4ZK5A 4FIIA 2ETMA 2R3OA 5CSWA 4HGTA 2PULA 1F5QA 3ZC5A 3KRWA 3E8EA 5AR2A 4K18A 3GXLA 3QTZA 3W2RA 4FIFA 3L1SA 4AE6A 4QMQA 4Y73A 1YHVA 3IS5A 3UNJA 2H6DA 2J0MB 4QYEA 4C2WA 3UIUA 3KB7A 3TTJA 1VZOA 3RTPA 2JBPA 1NVRA 2J51A 4FGBA 3RI1A 3LFAA 4EI4A 5DH3A 3RJCA 4WBOA 1Q61A 2WMBA 2XVDA 3PSBA 1Z5MA 4QTDA 4QMSA 1H26A 1ZLTA 2UVYA 2YCSA 4J99A 3IOPA 4M67A 3EWHA 1IAHA 4FT9A 1ZY4A 3OT3A 4OBOA 4O83A 4FT7A 5JFXA 2O65A 4LV5A 5HE0A 3WZDA 4ASEA 2ITVA 4Y46A 4BWPA 4C4EA 3VRYA 4JR3A 3ZHPC 3L9LA 1CKJA 3OC1A 3MIYA 3RPSA 3ZOSA 4BZDA 1LP4A 2CKOA 1ERKA 2V5QA 2WEIA 2RFEA 3BEAA 2HZ4A 2VO7A 4BCKA 4F99A 1H1PA 4JS8A 3AD5A 3GEQA 4IWQA 1E9HA 4JAIA 3VUMA 4GT5A 2Z60A 4DC2A 5AV0A 4YZCA 4L45A 4CV8A 2HW7A 2C6TA 4RQKA 3ZSIA 3PP1A 4WD5A 1PMUA 5KHWA 2EXMA 4D2TA 1KUTA 3DNEA 3U6HA 3F9NA 4LMNA 4FOBA 4GFGA 4X21A 4B8LA 3QKMA 3O23A 2BDWA 3PIZA 5EHYA 1BI7A 1P4FA 3BWJA 2A0CX 4NYEA 2WQBA 2ZV2A 3HV6A 3VQUA 5IQCA 2VTNA 3QCYA 1YDTE 3QRIA 3VW8A 2CLQA 3TDWA 4FTTA 4ZTQA 4F6UA 5KMOA 2R9SA 3N4TA 1JLUE 3QX2A 1OI9A 4C3PA 3FLWA 4K0YA 3ATTA 1IA9A 2XF0A 3JXWA 3ERKA 3PPZA 2ZMDA 4QQJA 4GIHA 2VTIA 5BUEA 5L8KA 2O63A 5E92A 4PPCA 5EK7A 4QMLA 3TNWA 2VTOA 4M13A 3CTQA 5CXHA 1CM8A 1IEPA 2UZVA 4Y5HA 5EM6A 5HGIA 3ZUVA 2JDSA 1J7UA 3L8VA 1JSTA 1WBVA 3E3PA 3T3UA 2HXQA 4RA5A 5HIEA 2RIOA 5FBNC 2G2IA 1BUHA 2W4KA 2W96B 3EZVA 3NLBA 4B7TA 3VS5A 2WNTA 4IAZA 3NAXA 3SX9A 2UW9A 5GJDA 4EHZA 1PXLA 4AA0A 1GZNA 4CMTA 2CCIA 5D7AA 2VO6A 2X4ZA 4YJUA 3RP9A 2Y7JA 2WD1A 4M0YA 4KS8A 3A99A 3D7ZA 3G33A 3NUYA 5AV3A 2P3GX 4FSUA 4M0ZA 3AC3A 4BCJA 3U4UA 5CAUA 3DFCB 4G5PA 3QTRA 3R1QA 2ITWA 3BBTB 1V1KA 4L8MA 1Y6AA 3E87A 4I41A 5FEEA 2ITPA 2PYWA 3GT8A 2W4OA 3DBCA 3CGOA 1U54B 1SMHA 2ETRA 3PJCA 4QYYA 3OMVA 4RJ3A 3LIJA 5HE3A 4ZJJA 5TE0A 3H9FA 3K3JA 3QTXA 4MXXA 3UZPA 4BDIA 3FZSA 4JVGA 3D7TB 4V04A 2RFSA 3EQDA 2I7QA 3Q96A 2ETKA 1UNLA 3NW6A 4TKSA 2YIYA 2YA9A 5BMSA 4XYFA 4RZVA 3HMPA 3AT4A 3M11A 4MXYA 4NTTA 4UY9A 5FP5A 3UPZA 2VN9A 3G90X 2W06A 2FB8A 4ZTLA 4DGMA 4DH1A 5K0XA 2BALA 5BNJA 4E4LA 4G3DA 5AA8A 4ZSJA 3LXPA 3UMXA 1Q3WA 1IR3A 3OUNB 5EW3A 4ZEGA 4PF4A 4QMXA 4QO9A 2OU7A 4ACMA 3B8RA 3MFSA 4Z7HA 1KE7A 2J50A 4UV0A 3MS9A 4Y5QA 4YSJA 2PU8A 3MDYA 3C4XA 1H1QA 3MVHA 3QZHA 4IZAA 4NUSA 5A3XA 4U0IA 2VZ6A 3RAWA 2Y8OA 4PTGA 3ZBXA 3KU2A 2QOKA 2ERZE 2G15A 3DOGA 1U46A 4FVQA 1PKDA 4X3FA 2YDJA 2UZWE 2P2IA 4R7HA 3LXLA 4PWNA 2CDZA 1P4OA 2DUVA 3HMOA 3PG3A 3BGPA 4W8DA 4G1WA 5LCJA 3MFTA 4IVAA 5AAEA 3PUPA 5DI1A 3QD0A 3VUIA 1M2RA 2B53A 2ITXA 4B9DA 5LMBA 3TUDA 4FVPA 4IM3A 5EM5A 3KULA 3EH9A 1VEBA 2YERA 3DBEA 3DQWA 4HNFA 3EQBA 4JBPA 3FC1X 3NVKI 3NNWA 4GS6A 2JDRA 2F4JA 3GB2A 4GMYA 1YXSA 3MVLA 4L43A 4LFIA 3IOKA 4OTWA 4I24A 5DGZA 4TW9A 4OTQA 2ITNA 3LZBA 3ORIA 5DT4A 5HBJA 4AT3A 3AMYA 3VBQA 2QODA 4IADA 3WE8A 5J5TA 4DTAA 5D9HA 2E9PA 2VWYA 5A14A 4FGRA 1YVJA 1DS5A 3LHJA 4FV0A 3Q4UA 5CVFA 4X2GA 3ZCLA 3LFCA 4YTHA 3QXPA 3R8PA 5LVNA 2GQSA 4MQ1A 3WF6A 5HVJA 1A06A 3W8LA 4JQ8A 3TT0A 3UIMA 2UW5A 3VS1A 3VF8A 4YURA 2X2MA 3ULIA 3MESA 5AFVA 4LRKA 3TIYA 3R7EA 3RK7A 3ALOA 4RIWB 1FOTA 4NJDA 5I0BA 1WMKA 2X2KA 5M4IA 4RJ8A 4R7BA 4BKJA 4D55A 4AACA 4KBKA 3W18A 2EU9A 4O1PA 5DNRA 2HY81 3CLYA 3IQ7A 3OOMA 3EKKA 5LVOA 4JOAA 4FT0A 3EN4A 1PY5A 3GVUA 4HVHA 1REJA 3K3IA 2VWWA 4AAAA 4J1RA 4FYOA 5KX8A 3I81A 5E8SA 4M7IA 4CFVA 1WVXA 2H34A 3QRUA 2ITUA 2PVJA 2BRGA 2HENA 3ANRA 3BLRA 4IZ7A 4EHVA 5AEPA 4ZSLA 2CKPA 1U5QA 4JIAA 3H0YA 4EWHA 5JFWA 1U59A 3UYTA 1IRKA 5KKRB 2JAVA 4G31A 4FZDB 2ZVAA 4HJOA 3G9NA 4PTCA 1SVHA 3VW6A 3DTWA 3R22A 4IM0A 3P9JA 4W9XA 5I9XA 3A7HA 3DBDA 2QO9A 3FBVA 5LVMA 2JC6A 4A07A 4O7ZA 2WPAA 4RX8A 3ZXTA 4F9WA 4EJ7A 2XRWA 3PP0A 3OROA 5AP3A 2VTTA 5BVOA 4FKPA 3I0QA 4QMMA 5ANIA 4ACGA 1FPUA 2J0LA 3FQHA 3KRLA 2FYSA 4N6ZA 4ENXA 2O8YA 4Z9LA 4AFEA 4Q5HA 4DFZE 1BMKA 3BZ3A 4EOMA 2X8IA 4OAVB 2C5NA 2XIKA 3L9PA 2B55A 2JFMA 5HQ0A 4BWXA 4TWNA 2ZYBA 1APME 3PPKA 4QTBA 3LQ3A 3T9IA 3D15A 1PXPA 2GNJA 2X9FA 4ITIA 2QLUA 4DFUA 2WXVA 3ZDIA 3CPBA 5DFPA 3AOXA 5C01A 3F3TA 2C69A 4AN9A 5KZIA 1OBDA 2XNNA 5CEKA 3W2CA 3CKWA 2QONA 2WOTA 3ORZA 2QLQA 2IZUA 3TM0A 3CBLA 3GC9A 4FEWA 1NW1A 4U80A 2YCRA 3QFVA 4WNKA 3IPHA 2CSNA 3IECA 4JR7A 4WUNA 4BDFA 2A19B 3LXNA 5IZFA 3L8SA 3DB8A 4JX3A 4L67A 1ZMVA 5HKMA 4EEVA 5EW9A 4JDKA 5HESA 3SG9A 3S00A 4ZAUA 3BIZA 5H3QA 4Z16A 5A4QA 3R83A 4EQCA 5ETIA 3EN6A 3QC9A 4JJRA 3RK9A 4BIDA 4E26A 3SVVA 1W0XC 2IW8A 2XA4A 3MY0A 4K2RA 4BDAA 2BAQA 3PSDA 4RLKA 4BDDA 5CT0A 4LI5A 2BMCA 5EG3A 4QYHA 1B6CB 4WRSA 3A62A 2OIBA 4W4VA 3RPRA 2F2UA 3I7BA 4MHAA 4NH1A 3OBJA 1SNXA 4U3YA 3MH2A 3QRKA 4OLIA 1H24A 4HCUA 3OXIA 1KE6A 4ZOGA 3WOWA 1BLXA 4AF3A 4E4MA 3GBZA 2W1IA 5TT7A 4ASZA 2XKCA 4EK8A 1U4DA 3HRBA 2RSVA 3K2LA 4YZMA 3WZKA 3DY7A 4D4SA 3PYYA 3Q9YA 4LMUA 4PDPA 4FT5A 3POOA 4Z3VA 2JGZA 5AR3A 2XYUA 3HA6A 3RK5A 1ATPE 4U97A 5FRIA 3DLSA 4CCUA 2JLDA 4G6LA 4F9BA 2YLEA 3ORXA 5CU4A 4F08A 4FSWA 1FINA 3ORPA 5FM3A 3WILA 3PVWA 5IEVA 2BDFA 2CKQA 2OWBA 3DDQA 2FSLX 5AMNA 5DT3A 4MWIA 4OT6A 4TN6A 4EH8A 2UW8A 3P7CA 2JIIA 1FVTA 4HCVA 4IXPA 4D0WA 5KHXA 5KMIA 1XO2B 2R64A 2QOCA 4AX8A 2P33A 1UVRA 3IW4A 2P4IA 3N4UA 4UMTA 4TPTA 4U9AA 5A4EA 2YCFA 4R8QA 3S4QA 2YIWA 4QP4A 3PXKA 2OFVA 4DAWA 5M09A 4F1MA 4GU6A 4FG7A 2VX3A 5BPYA 2W0JA 4I1ZA 3S1HA 4XV3A 4X7QA 5EQEA 5AR4A 1W83A 3MFUA 2QOFA 2X81A 4YTIA 2BIKB 3QLGA 2ONLC 1EH4A 3PFQA 5FXRA 1YDSE 4DTBA 4FKIA 3UO5A 3FL4A 3LJ1A 5IEXA 3TIZA 2J6MA 3BHHA 2OKRA 3FMMA 3PY3A 4I94A 1OPKA 5TKDA 4RWJA 2CNVA 2DQ7X 2PZYA 2I0VA 3PJ1A 3PXZA 4FZAB 2ONLA 3FL5A 3D5WA 5E8WA 3ZU7A 4FKQA 5CF8A 2WTIA 3UOHA 5EI6A 4DH8A 3AGMA 4MF1A 4ZTRA 4D4RA 4XOYA 4F0GA 5B2LA 3FYKX 5JH6A 2CPKE 2VTSA 2ZB1A 4QP7A 4APPA 2QURA 3BQCA 3ENHA 2XKEA 4GYIA 4ORKA 1WBOA 5M07A 5BVWA 1KE5A 4C35A 4D2RA 2E2BA 2ZV8A 3BE2A 1UV5A 5BVFA 4FTOA 4HNIA 3LLAA 4QP9A 4K9YA 5CVHA 2OJIA 3UC3A 2IVTA 4BB4A 3U51A 1M17A 1MUOA 1R78A 2HZNA 4DFYA 3VAPA 5HLNA 2W7XA 4OBPA 2J9MA 4I0TA 3EN7A 1L3RE 2QD9A 4IE9A 3R1NA 4TWCA 4YUQA 1JOWB 3NRMA 4BYIA 1J91A 2BZJA 4RZWA 4FV1A 3OZ6A 3UVRA 5AIKA 4IQ6A 4IX6A 3R0TA 3OCTA 1YI4A 5J7BA 4FKOA 5DRBA 2R3IA 5HEZA 5HU3A 3QGYA 2ACXA 3R7YA 2IN6A 4AS0A 4YJRA 5LJJA 3DT1A 2WTVA 1ZYSA 2EUFB 2WMTA 4UALA 4NM3A 1KV2A 5H8GA 4DFNA 5DIAA 1OKYA 3EQCA 4M84A 5E4HA 3Q2MA 3DV3A 5EH0A 5M55A 2XIYA 4ASDA 2GNGA 2WU7A 3CD3A 4BCPA 1UNGA 4I4EA 3HA8A 3ZFYA 4KKEA 5DG5A 3P4KA 3WI6A 5CI6A 3UNKA 3CQEA 3ZZEA 4G5JA 2IZRA 3TZ9A 4U81A 4BFMA 4U44A 3FHIA 3UQGA 3DK3A 3ZRKA 5J9LA 5KO1A 5JQ5A 5J95A 3QBNA 3NR9A 2WTCA 4FF8A 4O0RA 3LW0A 4S32A 4D2VA 5CX9A 4Q5EA 3T3VA 2ZJWA 2W1CA 4FTIA 3F61A 4UYNA 5DRDA 3KL8A 3AQVA 3V5LA 5H9BA 4BCFA 3I1AA 3MY1A 5IU2A 3R04A 3MPTA 1OBGA 4O7VA 4LGHA 4N0SA 4O7LA 3TTIA 4PDYA 4QMPA 3VUTA 2B7AA 4D2PA 3R21A 4U7ZA 1B38A 1TQMA 4C36A 4GVAA 4QTCA 3CJGA 5C9CA 2WIHA 3GCVA 4FICA 4N70A 4HGEA 5FEDA 3I4BA 4QP8A 2R4BA 1WCCA 5HG8A 2YIQA 2XNMA 4GSBA 3O2MA 3SW7A 2WTWA 4NTSA 3UGCA 3QL8A 4NM7A 3RWQA 4E5WA 4H1JA 3VC4A 3AD4A 2B9IA 4GVJA 1OB3A 3Q52A 4ACCA 2X0GA 4Q9ZA 4QQTA 4AZFA 4ZLZA 3UG1A 1I09A 4XH6A 3HDMA 3FI2A 2Y4IB 4JIKA 4QMUA 4I21A 1H0WA 3EHAA 5LVPA 5I9ZA 3EB0A 4NEUA 1Q8UA 2C6OA 3HUBA 4IAFA 4C4GA 4L7FA 3AC5A 5HE1A 5LMAA 3IW7A 3BHTA 3RM7A 1KWPA 4HGLA 5DWRA 3D0EA 3II5A 3VHKA 4AGCA 4M15A 5EM8A 3W8QA 4RWIA 2G2FA 4NL0A 4BKYA 2C0IA 3VJNA 4FNXA 5L6OA 5CQWA 3TKHA 4RPVA 1QCFA 4L53A 4PTEA 1BYGA 2JDVA 2QOOA 4R1VA 3R7OA 4F7NA 1YWNA 4PNKA 1NVQA 4FV2A 5CF5A 4F7SA 3RBWA 3U9NA 1XQZA 1DAWA 4AWIA 4BCGA 3OWLA 2XK6A 3MY5A 4EH3A 4RX5A 3CD8A 3COHA 4IAYA 3R9OA 2X39A 2H96A 2QO2A 4CT1A 1GIJA 3CQWA 4FKVA 5HO7A 3R2YA 4O2PA 4LGGA 5ANGA 3QQHA 3UZTA 3DJ6A 3H0ZA 2J7TA 5G1XA 5HIBA 1PXMA 4IVDA 4YZ9A 3F2AA 1MRVA 1BI8A 1MP8A 2BTSA 1Q41A 4XV9A 5AX9A 3S95A 1PW2A 3A61A 3L9NA 2J0KA 3PRIA 1FQ1B 5IQBA 3NPCA 4X2NA 2UZBA 2JDTA 2BRHA 3KVWA 3OFMA 3UIXA 4LRMA 5CANA 4FTCA 4YC3A 2XIRA 3U6IA 2RKUA 4PRJA 4EYJA 2HOGA 4MXOA 5HNBA 1QPJA 3EL8A 3PPJA 4IB3A 2O64A 4ZSAA 3VBXA 4FKSA 5HHWA 1OIQA 2HZ0A 4IMYA 4PUZA 1FVVA 2XIXA 5GHVA 4WNPA 5ACBC 3EYGA 3HAVA 2R3RA 3DKFA 3IG7A 3GU4A 4NW5A 3SD0A 3F5GA 5DA3A 2PMNX 3CS9A 4PY1A 1H00A 4BGGA 1VYZA 3HAMA 1PMEA 4YJSA 3SGCA 4JDJA 4EUUA 1H1RA 5HNGA 5ANOA 5JGAA 5CSVA 3QQJA 4U41A 4BTKA 5L6WL 4YJNA 4TYHB 3A60A 4EBVA 3AT3A 1H08A 2P55A 4FKTA 5E8VA 2RL5A 1OIUA 3RPVA 2QOBA 5E91A 3ROCA 3SV0A 4EZ7A 2RG5A 2CN5A 3KF4A 2QU5A 3NCZA 3UDBA 4XNEA 3SDJA 5B7VA 3DJ7A 2ZM3A 2BVAA 3VS3A 5F95A 3F3UA 2BROA 3TXOA 4RVMA 2V0DA 3LKMA 4WSYA 1OZ1A 5E90A 4D28A 5BVNA 2V7OA 2NRYA 4GJ2A 4LL5A 4CFXA 2Z2WA 3V5WA 5J1VA 3V5QA 3F5UA 3LM5A 2WFYA 3KQ7A 4FODA 5FGKA 5HIDA 5HVKA 4E6CA 2JKQA 4LUEA 4QPAA 4TRLA 5IUHA 2OXXA 1HOWA 1G5SA 4IBMA 5JMSA 4OW8A 2UZEA 3D7TA 4IDTA 3FLSA 2OZOA 2QVSE 5IUIA 4BI0A 5ETAA 5KBQA 3AXWA 4D1ZA 1XBBA 2VGPA 2DWBA 3QF9A 4GV1A 5L2SA 4J95A 5CSXA 2X8EA 3QQUA 3D83A 3TJCA 1SVEA 3NW7A 3RCJA 5HLWA 4ZIMA 4J52A 5AUXA 3ZSGA 2BTRA 2XEZA 3CC6A 3FPQA 1M7NA 3CTHA 3NUUA 3MH3A 5K4IA 4O38A 4FMQA 1G3NA 2R7IA 4AW5A 2VO3A 2R3HA 1WVYA 1OUYA 3LMIA 4E4NA 5LOHA 4L6QA 1OGUA 3QD2B 3UNZA 4PP7A 3MSSA 5AWMA 3RWPA 2CLXA 5HX8A 1XWSA 5AV4A 4FSMA 5HTIA 2R0IA 3PVBA 4QYFA 1ZAOA 2I0EA 3B8QA 2Y6MA 4X3JA 5IH6A 5LXMA 3ZM9A 4LRJA 4QMOA 3WYXA 2R3LA 4KIOA 5C27A 4O0TA 5CU6A 4IANA 2PUIA 4HCTA 1JQHA 1YOLA 3ZO3A 4UB7A 3PWDA 2YM3A 1CKPA 3WE4A 4CT2A 4JDIA 5IMEA 1FGIA 2UZOA 4RVKA 3HKOA 4C4IA 2OFUA 1ZYCA 5IF1A 3G0EA 3UBDA 2XKFA 4CLIA 3SOAA 3AD6A 3BCEA 3C4WA 4TT7A 4O84A 2XK9A 4N4SA 2WTJA 5GINE 4OT5A 4YLJA 4AW2A 3R73A 4YHTA 2WB8A 4L01A 2F9GA 3IONA 3LCSA 1ZZ2A 2FSMX 4RX9A 4B99A 5M4FA 5DOSA 4LOPA 1XJDA 4KIKA 5DN3A 4D2SA 5B2MA 3UJGA 3PXFA 5DVRA 4E1ZA 4ERKA 2H9VA 3DB6A 3NW5A 2V62A 2YIXA 3HRFA 4IVCA 4CEGA 5HORA 4KIKB 2JITA 4BIEA 3BU5A 2UVXA 3JUHA 4AZSA 1Y6BA 4RRVA 3TNHA 1PYXA 3PG1A 4A9YA 3F3WA 2RG6A 1OL2A 3NUAA 2UW7A 1RW8A 1PF8A 1TQIA 5CNNA 1SNUA 1ZYJA 3CQUA 4GL9A 4M14A 3KC3A 4MNEA 5FTOA 2BRBA 4GCJA 3GOKA 4AFJA 5HE2A 3GUBA 3UOLA 4F1OA 5D10A 4ZMFA 2PUUA 3D5VA 2UVZA 2GHMA 5FBOA 1DM2A 1QL6A 2W5BA 3MVJA 3OWKA 5GZAA 1GOLA 3QCXA 2C3JA 2WMUA 3M42A 3V8WA 1WAKA 2VTQA 3DPKA 4FKGA 2EXCX 2HK5A 4ZSGA 3H30A 3VUKA 5CSPA 1OUKA 3KXXA 5CEOA 4JXFA 1Q8WA 4I93A 4FV9A 1KOAA 3PE1A 4MXCA 4C7TA 4HVSA 4G6OA 4O81A 3PSCA 2JKMA 3EQRA 4HVIA 3WF5A 4L44A 4D1XA 3CP9A 3MN3A 2RFDA 5F9EA 5I4NA 3AT2A 3V01A 5D11A 5HTBA 4YC8A 2C68A 1NXKA 5CT7A 5HD4A 3OOGA 4FKRA 4UXLA 5AM7A 4FL1A 2Z7SA 4YTCA 3SC1A 4ZJVA 3JR1A 1Q3DA 3V5PA 3NUPA 3QWKA 3TI1A 3W2SA 3SA0A 3QGWA 1LEWA 3RHXA 2XUUA 3KK8A 2ZB0A 2PL0A 4IWDA 4ZZOA 5HO8A 4C61A 4L3LA 2WHBA 3A2CA 1QMZA 3JVRA 4JI9A 2KTYA 5HBEA 4I5HA 4KA3A 5KMLA 3R9DA 3BX5A 3LFDA 4W9WA 5A4LA 3CEKA 1Q8TA 3FI3A 4QP2A 4HW7A 4PMTA 2AYPA 2Q83A 2OO8X 5GZ8A 4XG4A 1JWHA 4E5BA 4XOZA 3R63A 4ZTNA 3UQFA 4II5A 3QUPA 3QRTA 3D5UA 4JBVA 1URWA 2W5AA 2PMOX 4FEVA 4DH7A 4AGWA 2GTNA 1PMNA 4B8MA 1IA8A 5FD2A 3KXZA 3FQSA 3TUCA 3MTLA 3CJFA 2BKZA 2W1EA 2VTMA 3MA3A 3OF0A 4FTLA 1XH8A 2P0CA 2ZDTA 3GCSA 3LE6A 4NFNA 2VWIA 3D4QA 3OHTA 2EWAA 4L7SA 3RAKA 1A48A 2HWPA 3BKBA 4IM2A 3R8ZA 3P7AA 1M52A 3I0OA 1XKKA 3NZ0A 4XV2A 5AADA 5IQDA 3KXNA 4V05A 5BVEA 4BDEA 4DFLA 4ACHA 5KUPA 3P79A 4XEYA 3E93A 1H27A 4LYNA 4CFUA 4TYJA 5TR6A 3R8UA 4YGAA 2OI4X 4GT4A 4DYMA 5FXQA 3FY0A 4OTHA 3ODYX 4LUDA 3HYHA 4CSVA 1JBPE 2C0TA 1X8BA 3DDPA 5E8ZA 3Q3BA 4E20A 5E8UA 4MQ2A 4H05A 3PZHA 4C37A 4AE9A 4YJPA 3W32A 2NNWB 1JKKA 1UU3A 4NSTA 3RMFA 4FSTA 4O7RA 4DN5A 1E1XA 4RJ6A 1OPJA 2W17A 3BI6A 3GGFA 3R02A 3FJQE 5EM7A 3RCDA 5M56A 3MVMA 3ZUUA 1OMWA 2UV2A 3VBWA 2HXLA 3OXTA 4WO5A 3VUDA 2RFNA 4WSQA 4XX9A 4BDHA 2BHEA 1MRYA 2FVDA 1H0VA 3L9MA 4C0TA 3NUXA 5BX0A 4AN3A 4JDHA 2FH9A 3E8DA 3O50A 2IJMA 3MGYA 4JX7A 2VTHA 4IFGA 1U5RA 4TNBA 4RFMA 4QMYA 1S9IA 2G01A 2XNOA 4WBBB 5C8MA 5BUIA 3COIA 5K5XA 5LMKC 3Q2JA 4DGNA 1PXNA 5L2WA 4G3GA 1WBPA 4N6YA 4DITA 4DINA 3E64A 3L8XA 3HX4A 4CG9A 5AP6A 2C5YA 4CV9A 4PV0A 3M1SA 1S9JA 2W1DA 4EH7A 2WMXA 3SXFA 1Q8ZA 4CFWA 5EQPA 2JIVA 1H07A 4PL5A 2WQNA 4S31A 4U43A 2QKRA 3BBWA 3FZ1A 2R3GA 3LCOA 3QKLA 2YWVA 4HVDA 3DLZA 5ANJA 4E6AA 4PDOA 3RAIA 2OGVA 3SRVB 3A7GA 5EQYA 3NYNA 2QHMA 4EH2A 3JYAA 4ZY5A 1CSNA 4Q2AA 2XEYA 1XH4A 3PXQA 4J71A 2R5TA 5FLFA 4A9RA 4EYMA 1OIRA 3DZQA 2X7GA 2B9JA 3TACA 2YFXA 3IK3A 4MK0A 3ORNA 3R1YA 4AQCA 5LWNA 2E9NA 5EDPA 4BGHA 5EI2A 5IISA 5IH5A 3I7CA 5JSMA 2QG7A 4JQ7A 2O0UA 4EOOA 3FPMA 4RJ5A 2XJ2A 5HCXA 4CQEA 1WBWA 3U54A 2YITA 2BCJA 2VNYA 3LPBA 5CF6A 4AW0A 1OVEA 4WKQA 3SXSA 2XK4A 3ZLWA 4DGGA 3W10A 5DR9A 4YJTA 4E93A 2VTAA 3WIGA 4GJ3A 3OUKA 2R3NA 3LFQA 2ZV7A 4AU8A 3EN5A 3IW5A 5KMNA 4EORA 4QP6A 3BLQA 1VYWA 2OJJA 3DGKA 3RPYA 5HO6A 3WIKA 4O0UA 4A4LA 4BBFA 3ALNA 3H4JA 4F6SA 5CENA 4FKLA 4EBWA 3MW1A 5CEIA 1I44A 3MJ1A 4HVGA 4XG7A 3UVQA 4IWPA 1J3HA 1R1WA 4ZY6A 2C6KA 1YI6A 4HPUE 4MCVA 3FAAA 3MBLA 4XBRA 5AR7A 2XM8A 3PIYA 4ID7A 3UYSA 4ANMA 3VS0A 2OLCA 4FTNA 4OTFA 4P5ZA 4U3ZA 3A8WA 3Q9XA 1Q62A 4U6RA 5J5SA 2QR7A 2QR8A 5BUJA 3C9WA 3CXWA 3F69A 4FZ6A 4ZJIA 4O86A 3HVCA 3QCQA 4CQGA 4PQNA 4WHZA 4GYGA 2CJMA 3HZTA 4W4XA 4DEDA 2GFCA 3E8CA 5HVYA 5HNIX 2WTKB 4QQ5A 3ZBFA 4A4OA 4QQCA 3RINA 2BZKB 5AJQA 5I9WA 4Y85A 5AM6A 3NGAA 3JY0A 4YLLA 4C38A 5JRSA 4E8AA 3HP5A 3G15A 2WMSA 4R3CA 3GU7A 4IC7A 2GTMA 4DBNA 4G3FA 2QKWB 4BTFA 3DJ5A 3EL7A 3GQIA 4AXAA 4DEHA 5F1ZA 3LCDA 2YM7A 3FMJA 3TNPC 5CALA 1WBTA 4FEUA 2X2LA 1JSVA 5AP0A 1E1VA 1OL5A 1FGKA 3MB6A 3FQEA 4E73A 2PUPA 3KXMA 3KCKA 5L2TA 5CVGA 1H25A 3BU6A 3KK9A 3C4FA 2LAVA 4OTRA 4TYHA 4FX3A 4GKIA 3V8TA 2C1AA 4XV1A 3TWJA 5M51A 2WMWA 2BFXA 3UODA 3P0MA 2BAJA 1XR1A 3P78A 4V01A 2WU6A 3OW3A 2FGIA 4QMTA 4KKGA 4FEQA 1QPCA 4L3PA 3ZM4A 4EK4A 4NIFB 3R9RA 3ZMMA 4GUBA 3VBTA 3PJ8A 4I6HA 1Q5KA 4RQVA 1PHKA 4GH2A 4M66A 2NO3A 3WZUA 1R3CA 5K3YA 4MBJA 3ZXZA 4NIFA 4AA4A 3HRCA 4C3FA 1M2PA 4P90A 3TV7A 5BVKA 4KRDA 2FUMA 2OXYA 4IHPA 4F70A 3HV7A 2VAGA 1ZARA 2UZDA 3PXYA 2PVLA 3VUHA 4AN2A 2XM9A 2Y4IC 4ANBA 4EH4A 5A9UA 4ZMEA 5KMJA 3D5XA 2ZOQA 2F57A 4QMWA 1F3MC 2R0UA 3HDNA 4IWOA 3NS9A 5DEWA 5D7VA 1TVOA 5FWKK 3HLLA 5HCZA 3F3VA 4I20A 5H8BA 1YOJA 4E7WA 5M44A 5JKGA 5EYMA 4GK2A 4O7WA 3JVSA 3PE2A 4XJ0A 2WMVA 5HBHA 4XMOA 4IFCA 1H01A 2ZV9A 4GIIA 3FXWA 2VV9A 2FSOX 4R5SA 5EOLA 3LLTA 5JFVA 3QTWA 3TKUA 3NAYA 4BCMA 3ORKA 2DS1A 5FQDC 3BHVA 3OY3A 2HIWA 3HP2A 3AC4A 3CE3A 4MBIA 4DFXE 4R3RA 4TL0A 4X2KA 1FMKA 3WBLA 3UE4A 4DG3E 3NUNA 5IH4A 2XIZA 4XP0A 3VQHA 2C6IA 2Z7LA 3FDNA 2Z7RA 3U8WA 4UWBA 2WGJA 1YQJA 4FKWA 4KWPA 3EKNA 3ZO1A 5ICPA 3QYWA 3G0FA 2PMLX 2VTLA 4EOKA 4GKHA 2B9FA 4XS2A 5M57A 1SYKA 2PE2A 3LFFA 3OW4A 4NU1A 1GZKA 1CKIA 3GFWA 3SAYA 4R78A 2XJ1A 4GG7A 3FV8A 4CZYB 3KCFA 2EB3A 2YDIA 4RJ7A 4QMNA 3LOKA 1MQ4A 4OTIA 5F94A 3FY2A 3TV4A 5JRQA 1HCLA 5E8YA 5FG8A 5J87A 3UPXA 5LWMA 4RGJA 2CMWA 1Q24A 2JAMA 3NCGA 4PMSA 4YZDA 2OXDA 2PZRA 4QTAA 1PJKA 3W2OA 3FE3A 1H28A 3LM0A 4YZBA 2OJGA 2YLFA 3GENA 4NKSA 4QP1A 4XG8A 3TNIA 3VHEA 4CZTA 2J2IB 3FKNA 5HG9A 3QA0A 4QMVA 5CU0A 1RJBA 3TZ8A 4BCOA 3FYJX 3Q60A 3D2KA 1OKWA 5C4LA 3OEFX 1KOBA 4C3RA 5A54A 3F82A 1ZYDA 3S3IA 2QC6A 5E8XA 1XH5A 2X8DA 3LFNA 1J7LA 5AUUA 4R5YA 2RF9A 2PWLA 3GCUA 5CXZA 2WQEA 5JN2A 2R3JA 4U79A 3UO6A 3DKGA 3KVXA 4RSSA 3SOCA 3V6RA 3OT8A 4U8ZA 4FBXA 2B0QA 4DGLC 5CASA 4BGQA 3I79A 2Y6OA 4FSZA 4NFMA 3Q9ZA 3RHKA 4KINA 5EI8A 2QG5A 3DS6A 2VX1A 4A9TA 4J8NA 5HD7A 4D5KA 2GHGA 1J1CA 5FEQA 4ANNA 4QYGA 2GQRA 3C7QA 4CYJA 4DEAA 4GFOA 4AOJA 3ORLA 4X3FB 3ETAA 4F0FA 3DFAA 3U87A 4UXQA 3ANQA 4IX4A 4PDSA 4CCBA 2ITQA 2R3QA 3AMAA 2XZSA 2XS0A 3GP0A 3ZSHA 1IG1A 1Y57A 2VTRA 3QTQA 1ZOHA 3CY2A 3KULB 3VNTA 1JPAA 4I92A 4XUFA 3V04A 4HYIA 4FKJA 3QAME 4B4LA 3EFKA 3NSZA 4JRVA 4OTDA 2NP8A 3BHUA 3RKBA 4C34A 3NYVA 5KMMA 3C4CA 1W7HA 4HGSA 4TXCA 1BL6A 4FYNA 4C4JA 3PXRA 4IAIA 2YDKA 3BQRA 4GRBA 2PUNA 1UA2A 4RVTA 1T45A 2XNEA 3FZPA 3P23A 4WNOA 5L3AA 5KKRC 1AGWA 3V3VA 4ACDA 3H9OA 3Q4ZA 3ULZA 1PXKA 4O0SA 2JFLA 1SZMA 3ACJA 3FWQA 1PRYA 1LPUA 2X9EA 2XNGA 3KMWA 1YXUA 2C5XA 2GHLA 5AP5A 3QX4A 3V5JA 2BDJA 3Q6WA 3ET7A 4MD9E 4AT5A 2R3FA 5EDRA 3TV6A 4BI1A 1H1SA 4O1OA 4RIWA 2REIA 2IO6A 3FMKA 2ZAZA 2IZSA 3GOPA 3QUEA 2J0JA 4I5CA 4A9UA 2PVHA 4OAUC 3FKLA 5BVDA 3PY0A 4IIRA 5CNOA 4ASXA 2HWOA 2GNFA 4MBLA 4KSPA 4ZP5A 3ZLXA 2E9OA 3U9CA 4Y83A 3R8LA 4LOQA 4O82A 4C4FA 4C4HA 2DYLA 2PHKA 1YRPA 4IZ5A 3BYVA 3DBFA 3FMEA 2YM6A 3K54A 3QQFA 5GJGA 2B52A 3VULA 4ZLOA 4MNFA 5JGDA 3R28A 3QD3A 3F2RA 2W1ZA 5HX6A 3EYHA 2C6DA 4UMUA 3FKOA 4I5PA 3W2QA 4ERWA 4EQUA 3FUPA 4F9CA 2R7BA 2Z02A 3OXZA 3Q53A 4I6QA 4CG8A 3CY3A 5CS6A 2JD5A 3LCTA 2BPMA 4D9TA 1XHAA 3QQLA 4K1BA 3LFBA 2P2HA 3RVGA 3COKA 5JK3A 3RAHA 4ITHA 5DR2A 3VF9A 2UW3A 2F7XE 3RGFA 4BDKA 5I3RA 4WOVA 2V55A 2XKDA 3DXQA 4EQMA 3WF8A 3C51A 3VS7A 5J7HA 4RX7A 4I6FA 5HG5A 2PZPA 3MPMA 2H8HA 3IDPA 4RIYA 1L8TA 2QOLA 3MWUA 2BUJA 4RIOA 4EC8A 4FG9A 3BRBA 3ZEPA 3KXHA 4RIXB 1KE8A 2C6MA 3NVMB 4YPSA 3ZRLA 4L9IA 4XP3A 4NJ3A 4RIYB 4DCEA 3PWYA 5KZ0A 3BWFA 1OIYA 4AZWA 2PVKA 4M12A 1YXVA 4C33A 3W1FA 4CGAA 5ANDA 3PRFA 4D4YA 3BV2A 3ACKA 3H3CA 3ZH8A 3BGZA 3BYOA 3A4PA 4YNEA 3HL7A 1ZYLA 3OWJA 3OY1A 3R7IA 2GFSA 5E8TA 4E3CA 4S2ZA 4CKRA 1ZXEA 3PJ2A 3RNIA 3QHRA 3OD6X 4BI2A 5GNKA 4UX9A 4ALVA 3QD4A 4EOPA 3MYGA 3C5UA 4L00A 5AUTA 4UMPA 3OTVA 1AQ1A 1JKLA 1SVGA 4FTUA 4W8EA 3K5UA 4JBOA 4CNHA 3P08A 4D1SA 2QOIA 2X4FA 1W82A 5EYCA 2I0HA 2F2CB 4OTPA 4X0MA 2O3PA 3FSKA 2QHNA 3MB7A 3QHWA 4RMZA 2VNWA 2YHVA 4IZYA 2VO0A 5FM2A 4A06A 1R0PA 5D1JA 2YIRA 4FNYA 5AP1A 4IB1A 2C6EA 3ZRMA 3R7VA 4F6WA 1OL7A 2BIYA 3ZFMA 4DF3A 2UZLA 3SQQA 3EN9A 4O6EA 4I22A 2QO7A 3RNYA 4MYGA 4EOIA 2W1FA 3QZFA 5HG7A 2CNQA 4PMPA 1V0BA 4BBEA 4RT7A 2AC5A 3DCVA 2UZTA 3OS3A 3SKCA 5AUYA 2F7ZE 4YR8A 3R6XA 4IAKA 4FEXA 1G8AA 1OKZA 4TYGA 4QOXA 4FTAA 4R1YA 4UYAA 3PLAE 4AT4A 4IACA 4DG2E 1V0PA
chains in the Genus database with same CATH superfamily
3TEIA 3EQFA 4WG3A 4KB8A 5IQGA 5L8LA 1LEZA 2HW6A 4FV3A 3BPRA 4DEEA 2PZIA 5C8KA 3LFEA 3EOCA 3NWWA 5HI2A 4QNYA 1XH9A 1UU8A 2CGXA 5JQ8A 3OWPA 5K9IA 3DXNA 3ITZA 5C26A 3F88A 1XBCA 1NT2A 4FV7A 4RIXA 2ITTA 1REKA 3BV3A 1JAMA 1WBSA 2GSFA 3MA6A 3O8TA 4YHJA 2CHLA 2XK8A 4BN1A 4IB0A 4YNOA 3FEGA 1OL1A 2XJ0A 5E1SA 5D41A 4MKCA 4ARKA 1KV1A 5CEMA 5C03A 4CKIA 3UOKA 2UW6A 4R77A 5AP4A 3THBA 3ORMA 4D2WA 4H3QA 1WZYA 2FSTX 2EVAA 2YM5A 3CSVA 4HPTE 3G51A 5DPVA 3OTUA 4RG0A 2PVFA 5IA0A 5JFSA 3HV3A 2IVVA 2WQMA 5IA1A 3KFAA 5CF4A 2GNLA 4EHGA 5CAPA 2FO0A 4X6QC 3F2NA 3ZLSA 4NCTC 1TFFA 1YHWA 4NWMA 3A7FA 5I9UA 4CFFA 4EK3A 2OZAA 3EJ1A 2W4JA 2PY3A 1JNKA 4WNMA 2IEWA 5LARA 2LGCA 3PJ3A 4J53A 4WG5A 4Q9SA 4CKJA 3G2FA 4UWCA 3UP7A 3VN9A 3VBVA 4BDJA 4AXFA 4BY9E 2CGVA 3PIXA 3N9XA 4AP7A 4UMQA 3D2IA 3KRJA 3FXXA 1A9UA 3KN5A 5A6OA 2IG7A 5M53A 2XCHA 5J1WA 4S30A 4X3FC 2B4SB 3UOJA 1LR4A 4B0GA 4UBAA 3VIDA 4EH9A 4FIGA 4FTJA 5T3QA 4F65A 4RA4A 3R30A 3QKKA 2VWBA 3LQ5A 2BR1A 3R71A 1PXJA 4AUAA 5LMKA 2Y0AA 4XLIA 3ZO4A 3NMUF 1LUFA 3FZTA 4ZTHA 5T68A 4DH3A 4BRXA 4J97A 3V5TA 4EJNA 2OJFE 2VWXA 4G3EA 4O0VA 1YKRA 3QWJA 4TZRA 4S34A 1V0OA 1JVPP 3FZOA 2JKOA 4A4XA 4DEIA 5AR8A 1PXIA 3BEGA 3G9LX 4KBCA 4LG4A 5F4NA 5AV1A 4D0XA 2VD5A 5AUZA 1GNGA 2W5HA 3Q9WA 3R8VA 3MI9A 4O7TA 3AC8A 4FTQA 3QUDA 4M97A 3FI8A 3E88A 3AGLA 3N51A 4GK3A 5EYDA 3MFRA 4UWYA 3SLSA 2PZ5A 2A27A 3UVPA 4CTCA 5E7RA 5C4KA 2ZM4A 2IVSA 4BICA 5CZHA 1WVWA 2OH4A 3B2WA 4WUAA 4OGRA 5B0XA 3FLYA 4R6VA 3UMWA 5CY3A 4DLIA 1O9UA 3KN6A 1DI8A 3UO4A 4CYIA 5M06A 3DK6A 1O6LA 4O0WA 4E6QA 4FA2A 3IW8A 2VRXA 4BZNA 4MEDA 4A9SA 4QNAA 1Y8GA 2OK1A 2UZUE 4FKUA 4KSQA 2QCSA 1YWRA 2A1AB 5BMMA 3JY9A 4PP9A 1K3AA 5KE0A 5EHOA 3E63A 2NRUA 2OZAB 2QI8A 3VRZA 3WYYA 3MH1A 3DQXA 5LQFA 3Q4CA 5IQEA 3KEXA 5TOZA 4EONA 4P7EA 2OBJA 2A4LA 5FDXA 4AZVA 1QPDA 2NPQA 1WBNA 5FP6A 4BHNA 4JBQA 3HUCA 5IA5A 4QTEA 5JEBA 1ND4A 4BVUA 4UZHA 3EZRA 2WAJA 3SRVA 4CRSA 4USEA 4C62A 2Q0NA 3GC7A 5JZNA 4OTGA 4EUTA 2HY0A 4XG6A 4ANOA 4EH6A 1YW2A 1H4LA 3ZYAA 4M68A 2R3PA 2IW9A 3VWAA 1JSUA 3BELA 2PK9A 3Q32A 3WF7A 4FK3A 4FV8A 4CFNA 1H1WA 3HECA 4V0GB 2WMRA 4YPDA 5B2KA 1UKHA 4YJVA 1ZOEA 3AG9A 3HNGA 2VUWA 2YM8A 2J5EA 2JIUA 1YI3A 3LXKA 4CXAA 1TQPA 1PXOA 4BDBA 4WG4A 1O6KA 2X6DA 3FMNA 3O8UA 3NDMA 3SXRA 1AD5A 2GPHA 2ITOA 1K2PA 2C4GA 4K77A 4I0RA 3WZJA 2CNUA 4NM5A 2GMXA 4QPMA 1GY3A 2F49A 4EH5A 2HAKA 4C57A 4DTKA 4GK4A 2J4ZA 3C0IA 3DAEA 1UWJA 4GEOA 5FTQA 4U42A 1OPLA 3O8PA 4I6BA 4YTFA 3TUBA 4LM5A 2EXEA 5GIPE 4H3PA 2WTKC 2PVRA 1Q8YA 4PPBA 4MD8E 1GAGA 4YO4A 1URCA 3EQPA 3K5VA 1R0EA 3VBYA 2CN8A 3FMHA 4WRGA 5E1EA 4ANQA 2YAKA 3OVVA 3ZFXA 2JEDA 4KBAA 4DE4A 4HZSA 2BZIB 2CGWA 3PTGA 5L8JA 3REPA 3U55A 4DA5A 1PKGA 3SW4A 2PSQA 3Q04A 3FMDA 3UP2A 4AGUA 4CD0A 3PZEA 4IB5A 4GFMA 4AG8A 3OP5A 2FA2A 1KE9A 2J0IA 2X1NA 4GU9A 3NNVA 4XBUA 4C58A 3SG8A 2XNPA 4UEUA 4BHZA 3ODZX 3C4EA 4BZOA 4H39A 5AP7A 5AIRA 4O0XA 2YABA 2CGUA 3QZIA 2XAMA 5ETFA 3GCPA 4BDCA 3GU5A 4YHFA 5KMKA 4NZWB 2VWVA 2YJRA 1RDQE 4FV5A 5CEPA 2G9XA 2JKKA 2RGPA 4EC9A 2PE1A 2R3KA 3PLSA 4RC4A 4XG3A 3TZ7A 5AP2A 4I0SA 3BLHA 3LCKA 5ETCA 4O6LA 4H36A 4KAOA 4F63A 4TTHB 3VS2A 2W9ZB 4RFYA 4W4WA 4RBLA 5H8EA 3T8OA 1G8JA 1FBNA 4GG5A 4QP3A 5TF9A 5M4CA 1UU7A 4C02A 5CYIA 2HYYA 3TKIA 4FZ7A 4BKZA 4FTMA 5J8IA 1VJYA 1BX6A 2C3IB 3LVPA 4MH7A 3TNQB 4JL9A 3T9TA 5DYJA 2GQGA 2JBOA 4YBKA 4AOIA 3HEGA 3PA4A 3QALE 4M69A 4X2JA 3HV5A 4K11A 2X6EA 3OG7A 4LL0A 5IPJA 4P2KA 2J5FA 1Q97A 4K8AA 4EZ5A 3H10A 3DXPA 2AC3A 2XK7A 3IGGA 4EZ3A 4M69B 2WIPA 4IC8A 1OM1A 4TY1A 2UW0A 4FIHA 4ZLYA 3B2TA 5JGBA 1J1BA 4I23A 1FVRA 4JAJA 2UUEA 5DHJA 4D4VA 4KKHA 4U45A 3NYOA 3DZOA 2JDOA 3MTFA 4QMZA 2I0YA 4YC6A 5IKWA 3W2PA 2HZIA 3GI3A 3RALA 3LMHA 3HV4A 4FUXA 1VR2A 1YHSA 2O5KA 2YACA 4O7YA 2GCDA 4YSMA 2XYNA 3NNXA 3O7LD 3QQGA 1GIIA 2C30A 1F0QA 3ENMA 4HOKA 4U40A 5CAQA 5A6NA 4TWPA 3GCQA 3EFWA 3PY1A 4JG6A 4JQEA 4FTRA 5J79A 5DLSA 3FLZA 4ALWA 3ZDUA 4FR4A 5I9YA 4YLKA 1OL6A 4FG8A 4FL2A 4IJ9A 4AGDA 2OW3A 2F7EE 3PA5A 3QTIA 4H1MA 4NW6A 4APCA 4LQMA 2QNJA 3ZTXA 2KULA 1UU9A 1G8SA 3H9RA 4DT9A 3JS2A 5BYZA 1Y91A 3HMMA 2PPQA 5LVLA 2ZMCA 1RE8A 1GIHA 1DAYA 3BYMA 3HMNA 3VUGA 3RM6A 3P5KA 4F7LA 3I5ZA 4MX9A 3I6WA 4AAYA 4ANLA 5IA2A 2ITYA 3TL8A 3QRJA 3VONA 2YM4A 2C3KA 4KUJA 2WZJA 2GU8A 4RLLA 5CTPA 5FXSA 4AQKA 2CCHA 5F20A 2B1PA 4O7NA 2V7AA 2Y4PA 1ZZLA 3O0GA 1XH7A 2YCQA 5CSHA 5IUGA 2WKMA 4CLJA 4YP8A 3DK7A 3A4OX 5L2IA 1Q99A 4C8BA 2VX0A 1ZWSA 4KIPA 5HOAA 3FLQA 2OH0E 2GNIA 1P5EA 4BF2A 4R7IA 5IG1A 4O2ZA 5HZNA 3UQCA 5BQ0A 1OKVA 5AAFA 1Y8YA 4FSYA 3ELJA 2C5OA 3AMBA 1R39A 3GU8A 3LQ8A 2ITZA 3P1AA 4O91A 3ZUTA 5IQFA 5M08A 3COMA 1Z9XA 4G3CA 4HZRA 4PX6A 3QCSA 5BYYA 4IDVA 4GUEA 2Z7QA 4TWOA 2YJSA 5AX3A 4F64A 3KRRA 2W05A 5AUWA 1W84A 5J9ZA 2AUHA 2GNHA 3D9VA 4JNWA 4RVLA 3ZC6A 2GS6A 4N57A 3QTUA 4P4CA 5BV3A 3VS4A 3KRXA 4KABA 4OR5A 2OIQA 2YISA 4NM0A 4CFMA 4MAOA 1UKIA 3GNIB 4O22A 3PDTA 4YZNA 2B9HA 4DG0E 5CI7A 2OG8A 4MXZA 4W4YA 4I4FA 1SM2A 4JLCA 3BGQA 3A8XA 3OCSA 4IW0A 4BTJA 4PMMA 4FV4A 5AR5A 4X2FA 3ML1A 3DKCA 3TZMA 3FXZA 3DAJA 5IDPA 4UN0C 4RC3A 2BHHA 5CQUA 5KBRA 3I60A 3QC4A 2YN8A 4AOTA 4H3BA 4BR3A 1CTPE 3P86A 2QOHA 4D58A 3ID6C 4DFBA 1OITA 5EFQA 4KS7A 1ZOGA 2ZM1A 1O6YA 4KNBA 4PNIA 3WF9A 3ZO2A 4Y72A 3ZONA 4AZTA 2NYAA 1KSWA 4OUCA 5EYKA 4USDA 1U54A 3RPOA 1GZOA 3GQLA 4JRNA 5HCYA 5L4QA 4IAAA 5DMZA 3PA3A 2HELA 1GZ8A 2VWUA 3G5DA 5GIOE 3FLNC 1BKXA 2W1GA 2BFYA 3E7VA 2C3LA 3Q5ZA 4FNZA 3RZFA 3KF7A 5IA4A 4KIQA 3AKLA 3QZGA 1ZY5A 2PVNA 2BAKA 4FIJA 4JT3A 4ZY4A 1JKTA 2PVYA 4I3ZA 4XP2A 3IGOA 3TYKA 3E62A 4ZTMA 3QA8A 4RJ4A 3BHYA 3A7JA 1T46A 2V22A 4X6RA 3Q4TA 3S2PA 4LGDA 4QRCA 4HYSA 3KMMA 4OBQA 4PL4A 5I3OA 4O4BB 3KGAA 2W1HA 2XBAA 3BU3A 4L42A 1IASA 1ZMUA 4F4PA 1NVSA 4MD7E 2B54A 3TG1A 4EWQA 4JG7A 3QQKA 4BJJA 4QD6A 3FZRA 4YMJA 4DH5A 3W33A 4G9CA 5FDPA 2BRNA 1YXTA 3L8PA 4XG9A 3CPCA 3CIKA 3D14A 2YZLA 3EQIA 4FT3A 3E92A 3R9NA 4R3PA 2IW6A 4AA5A 4BJJB 3GU6A 4EK5A 4YU2A 2VGOA 4MTAA 4BCQA 4HYHA 4IX3A 4EOSA 3BYUA 3C0HA 5H2UA 5CWZA 3C1XA 1HCKA 1P14A 2XNBA 5M4UA 3PVUA 4D5HA 4FVRA 4O4DA 4TNDA 4F9AA 1MQBA 2YZAA 4ENYA 4FJVA 2G1TA 3F5PA 3IDCA 3DA6A 2VU3A 5DBXA 2OF2A 4FSQA 4ZSEA 3MPAA 3R01A 5A4TA 4ONAA 4ZXTA 3ROYA 4CMOA 2IVUA 4F7JA 5FUTA 3VVHA 3EQHA 4MXAA 3GC8A 4FIEA 4M8TA 3WARA 2OF4A 2PE0A 5E9EA 1W8CA 3DNDA 3EMGA 4FV6A 4YJQA 1NA7A 2O2UA 1PMVA 2WQOA 3OBGA 3C4ZA 1QPEA 3CKXA 1M14A 2I6LA 3MJ2A 4O21A 4O7SA 4XLVA 5DEYA 2BZHB 3CR0A 3VS6A 1ZRZA 2C6LA 2I1MA 1K9AA 4G17A 4DCAA 5HU9A 3EQGA 4BIBA 3F7ZA 5EHLA 5G6VA 4IX5A 3DTCA 3UZRA 5CAOA 4AW1A 3IKAA 2VTJA 3RZBA 2XH5A 1JKSA 1XBAA 4FNWA 5K5NA 3DBQA 5K4JA 2C0OA 2XRUA 4MNEB 2XBJA 1UNHA 4MWHA 4XRJA 3JPVA 1M7QA 4G9RA 4DT8A 1TKIA 3R00A 3EIDA 4O0YA 4XCUA 3QTSA 4YO6A 3LJ0A 3POZA 3O17A 4Z55A 4E5AX 4FSRA 4G34A 4K33A 4PPAA 1H8FA 3HMIA 4FL3A 4ZTSA 2XALA 3I5NA 4TYEA 2W9FB 4L3JA 4F9YA 5A4CA 2YAAA 5IEYA 2ZDUA 4XG2A 2E9VA 5AA9A 1IAJA 3OCGA 4J98A 3FC2A 2QU6A 2UW4A 1YWVA 2BRMA 2X7FA 5ITAA 4ALUA 4ZS4A 3WZEA 4CTBA 3O51A 4DLJA 3NX8A 5IMXA 3R1SA 4L46A 3UIBA 3KA0A 5T6KA 1MRUA 3R9HA 2WMQA 3NEWA 4CRLA 4IH8A 3FMLA 1W2CA 5CU3A 4WA9A 5C1QB 1WFCA 3M2WA 4NCTA 5L2QA 2VWZA 5AV2A 4F0IA 5JZJA 5C8NA 4DGOA 3C50A 2C47A 2CKEA 4H58A 1Q4LA 4IJPA 3AC1A 2SRCA 3C0GA 3G6GA 4FE2A 4MF0A 4HYUA 2G2HA 2WEVA 3DU8A 3O71A 4Y95A 3NNUA 5DE2A 1ST0A 3Q5IA 3V6SA 2WMAA 3I6UA 5DT0A 2QOQA 2HCKA 3OCBA 2WOUA 4KD1A 4EL9A 3KREA 3TDVA 3LAUA 4CVAA 2WELA 2Z8CA 5IA3A 4BCHA 4EKLA 4EOJA 4P5QA 2QQ7A 5JT2A 3V51A 4EOLA 2XK3A 5ANEA 2XCKA 4J8MA 2PMIA 3R7GA 3VO3A 3DAKA 4DHFA 3NIZA 3KMUA 2A2AA 3GC0A 4WIHA 3UC4A 3PVGA 5CAVA 3NIEA 3KY2A 4C59A 5A46A 2E9UA 4I5MA 5DR6A 5EOBA 4BDGA 5BYLA 4IVBA 4DBXA 4GT3A 4EKKA 3OEZA 2WO6A 1CMKE 4LV8A 3TJDA 4BBMA 5CU2A 1FMOE 2R2PA 3V8SA 5KCVA 3MH0A 3KXGA 3O7LB 3E7OA 5L6PA 3O96A 4WT6A 5FTGA 4NT4A 3C5IA 4EHEA 3G6HA 4NKAA 2X7OA 2X0PA 4FZFB 4TYIA 2ESMA 3TCPA 2YWPA 2EB2A 3F5XA 3FSFA 3LMGA 5CEQA 5AAGA 5I9VA 4UMRA 1M2QA 3P7BA 3EFLA 2C5VA 5HLPA 4FUYA 3LFSA 3NYXA 4XHKB 5TO8A 5EKNA 1YDRE 1STCE 2IWIA 5AUVA 4BC6A 3R7UA 5HTCA 3W0RA 3W0SA 3QXOA 4G16A 3W55A 4CMUA 1BL7A 3IDBA 4ANSA 5GZ9A 4CZUA 1UWHA 4RC2A 2VTPA 3ZEWA 2Y9QA 4YBJA 2GS2A 3IO7A 4BYJA 4V0GA 5IQIA 3F66A 2XB7A 3ZZWA 3NUSA 4ITJA 3FI4A 2I40A 3ZS5A 4BTMA 2PTKA 5CZIA 2W99B 5CLPA 3MIAA 3E8NA 2OICA 3HGKA 4FTKA 2IPXA 1GJOA 4UZDA 4JG8A 3AKJA 4L52A 1CDKA 4EK6A 2GS7A 3E3BX 2ERKA 3FHRA 1B39A 1Z57A 5KNJA 4AZEA 4DEGA 2OSCA 3D94A 1DI9A 3CGFA 3ORTA 4FOCA 1RQQA 4FK6A 2J90A 4M3QA 1NY3A 3F6XA 4RWLA 2R3MA 4D9UA 4QPSA 3R8MA 3R2BA 4EOQA 5ACKA 5I5ZA 4J96A 4BCNA 5EKOA 1YOMA 4J7BA 5ANKA 4MVFA 1YXXA 2Q0BA 3IW6A 4RFZA 3ATSA 4ZZNA 4ZS0A 4A7CA 2OJ9A 3QYZA 4RWKA 3F7WA 4O27B 4NK9A 4ZZMA 3S0OA 2XMYA 4O96A 3DKOA 2UZNA 5J9YA 4U5JA 1P2AA 4K6ZA 4PL3A 4BL1A 2C1BA 3QU0A 4BWKA 5LCKA 3C13A 1W98A 3N4VA 3EFJA 5IQAA 4LOOA 1J7IA 5EW8A 4S33A 2BKKA 4Z7GA 4USFA 4QT1A 2IZTA 4KRCA 3ZLYA 1ST4A 3Q6UA 4FSNA 1PYEA 3U6JA 5K0KA 1ZMWA 4FI1A 4FC0A 3BE9A 3KKVA 2WTDA 4F1TA 2GDOA 3A7IA 4L68A 4Y8DA 4B6LA 4XRLA 3TN8A 5D12A 3UTOA 2YEXA 3CCNA 2BILB 3CTJA 3LJ2A 3W16A 4BCIA 3VJOA 4E6DA 4G6NA 5IDNA 4DEBA 2OIDA 3AC2A 2XP2A 3W0MA 1XMLA 3BYSA 4E4XA 5EDQA 5HICA 3F3ZA 4IEBA 4F09A 3GFEA 3QLFA 3UG2A 3U4WA 1XH6A 2PVMA 3SHEA 3E5AA 3MV5A 5IQHA 5GJFA 4C2VA 1OECA 4GW8A 4YJOA 4G2FA 4ZK5A 4FIIA 2ETMA 2R3OA 5CSWA 4HGTA 2PULA 1F5QA 3ZC5A 3KRWA 3E8EA 5AR2A 4K18A 3GXLA 3QTZA 3W2RA 4FIFA 3L1SA 4AE6A 4QMQA 4Y73A 1YHVA 3IS5A 3UNJA 2H6DA 2J0MB 4QYEA 4C2WA 3UIUA 3KB7A 3TTJA 1VZOA 3RTPA 2JBPA 1NVRA 2J51A 4FGBA 3RI1A 3LFAA 4EI4A 5DH3A 3RJCA 4WBOA 1Q61A 2WMBA 2XVDA 3PSBA 1Z5MA 4QTDA 4QMSA 1H26A 1ZLTA 2UVYA 2YCSA 4J99A 3IOPA 4M67A 3EWHA 1IAHA 4FT9A 1ZY4A 3OT3A 4OBOA 4O83A 4FT7A 5JFXA 2O65A 4LV5A 5HE0A 3WZDA 4ASEA 2ITVA 4Y46A 4BWPA 4C4EA 3VRYA 4JR3A 3ZHPC 3L9LA 1CKJA 3OC1A 3MIYA 3RPSA 3ZOSA 4BZDA 1LP4A 2CKOA 1ERKA 2V5QA 2WEIA 2RFEA 3BEAA 2HZ4A 2VO7A 4BCKA 4F99A 1H1PA 4JS8A 3AD5A 3GEQA 4IWQA 1E9HA 1W2FA 4JAIA 3VUMA 3NFGB 4GT5A 2Z60A 4DC2A 5AV0A 4YZCA 4L45A 4CV8A 2HW7A 2C6TA 4RQKA 3ZSIA 3PP1A 4WD5A 1PMUA 4O4CA 2EXMA 4D2TA 5KHWA 1KUTA 3DNEA 3U6HA 3F9NA 4LMNA 4FOBA 4GFGA 4X21A 3KIOC 4B8LA 3QKMA 3O23A 2BDWA 3PIZA 5EHYA 1BI7A 1P4FA 3BWJA 2A0CX 4NYEA 2WQBA 2ZV2A 3HV6A 3VQUA 5IQCA 2VTNA 3QCYA 1YDTE 3QRIA 3VW8A 2CLQA 3TDWA 4FTTA 4ZTQA 4F6UA 5KMOA 2R9SA 3N4TA 1JLUE 3QX2A 1OI9A 4C3PA 3FLWA 4K0YA 3ATTA 1IA9A 2XF0A 3JXWA 3ERKA 3PPZA 2ZMDA 4QQJA 4GIHA 2VTIA 5BUEA 5L8KA 2O63A 5E92A 4PPCA 5EK7A 4QMLA 3TNWA 2VTOA 4M13A 3CTQA 5CXHA 1CM8A 1IEPA 2UZVA 4Y5HA 5EM6A 5HGIA 3ZUVA 2JDSA 1J7UA 3L8VA 1JSTA 1WBVA 3E3PA 3T3UA 2HXQA 4RA5A 5HIEA 2RIOA 5FBNC 2A98A 2G2IA 1BUHA 2W4KA 2W96B 3EZVA 3NLBA 4B7TA 3VS5A 2WNTA 4IAZA 3NAXA 3SX9A 2UW9A 5GJDA 4EHZA 1PXLA 4AA0A 1GZNA 4CMTA 2CCIA 5D7AA 2VO6A 4F78A 2X4ZA 4YJUA 3RP9A 2Y7JA 2WD1A 4M0YA 4KS8A 3A99A 3D7ZA 3G33A 3NUYA 5AV3A 2P3GX 4FSUA 4M0ZA 3AC3A 4BCJA 3U4UA 5CAUA 3DFCB 4G5PA 4O4EA 3QTRA 3R1QA 2ITWA 3BBTB 1V1KA 4L8MA 1Y6AA 3E87A 4I41A 5FEEA 2ITPA 2PYWA 3GT8A 2W4OA 3DBCA 3CGOA 1U54B 1SMHA 2ETRA 3PJCA 4QYYA 3OMVA 4RJ3A 3LIJA 5HE3A 4ZJJA 5TE0A 3H9FA 3K3JA 3QTXA 4MXXA 3UZPA 4BDIA 3FZSA 4JVGA 3D7TB 4V04A 2RFSA 3EQDA 2I7QA 3Q96A 2ETKA 1UNLA 3NW6A 4TKSA 2YIYA 2YA9A 5BMSA 4XYFA 4RZVA 3HMPA 3AT4A 3M11A 4MXYA 4NTTA 4UY9A 5FP5A 3UPZA 2VN9A 3G90X 2W06A 2FB8A 4ZTLA 4DGMA 4DH1A 5K0XA 2BALA 5BNJA 4E4LA 4G3DA 5AA8A 4ZSJA 3LXPA 3UMXA 1Q3WA 1IR3A 3OUNB 5EW3A 4ZEGA 4PF4A 4QMXA 4QO9A 3TMOA 2OU7A 4ACMA 3B8RA 3MFSA 4Z7HA 1KE7A 2J50A 4UV0A 3MS9A 4Y5QA 4YSJA 2PU8A 3MDYA 3C4XA 1H1QA 3MVHA 3QZHA 4IZAA 4NUSA 5A3XA 4U0IA 2VZ6A 3RAWA 2Y8OA 4PTGA 3ZBXA 3KU2A 2QOKA 2ERZE 2G15A 3DOGA 1U46A 4FVQA 1PKDA 4X3FA 2YDJA 2UZWE 2P2IA 4R7HA 3LXLA 4PWNA 2CDZA 1P4OA 2DUVA 3HMOA 3PG3A 4DHIB 3BGPA 4W8DA 4G1WA 5LCJA 3MFTA 4IVAA 5AAEA 3PUPA 5DI1A 3QD0A 3VUIA 1M2RA 2B53A 2ITXA 4B9DA 5LMBA 3TUDA 4FVPA 4IM3A 5EM5A 3KULA 3EH9A 1VEBA 2YERA 3DBEA 3DQWA 4HNFA 3EQBA 4JBPA 3FC1X 3NVKI 3NNWA 4GS6A 2JDRA 2F4JA 3GB2A 4GMYA 1YXSA 3MVLA 4L43A 4LFIA 3IOKA 4OTWA 4I24A 1OGYA 5DGZA 4TW9A 4OTQA 2ITNA 3LZBA 3ORIA 5DT4A 5HBJA 4AT3A 3AMYA 3VBQA 2QODA 4IADA 3WE8A 5J5TA 4DTAA 5D9HA 2E9PA 2VWYA 5A14A 4FGRA 1YVJA 1DS5A 3LHJA 4FV0A 3Q4UA 5CVFA 4X2GA 3ZCLA 3LFCA 4YTHA 3UDSA 3QXPA 3R8PA 5LVNA 2GQSA 4MQ1A 3WF6A 5HVJA 1A06A 3W8LA 4JQ8A 3TT0A 3UIMA 2UW5A 3VS1A 3VF8A 4YURA 2X2MA 3ULIA 3MESA 5AFVA 4LRKA 3TIYA 3R7EA 3RK7A 3ALOA 4RIWB 1FOTA 4NJDA 5I0BA 1WMKA 2X2KA 5M4IA 4RJ8A 4R7BA 4BKJA 4D55A 4AACA 4KBKA 3W18A 4QDEA 2EU9A 4O1PA 5DNRA 2HY81 3CLYA 3IQ7A 3OOMA 3EKKA 5LVOA 4JOAA 4FT0A 3EN4A 1PY5A 3GVUA 4HVHA 1REJA 3K3IA 2VWWA 4AAAA 4J1RA 4FYOA 5KX8A 3I81A 5E8SA 4M7IA 4CFVA 1WVXA 2H34A 3QRUA 2ITUA 2PVJA 2BRGA 2HENA 3NFFB 3ANRA 3BLRA 4IZ7A 4EHVA 5AEPA 4ZSLA 2CKPA 1U5QA 4JIAA 3H0YA 4EWHA 5JFWA 1U59A 3UYTA 1IRKA 5KKRB 2JAVA 4G31A 4FZDB 2ZVAA 4HJOA 3G9NA 4PTCA 1SVHA 3VW6A 3DTWA 3R22A 4IM0A 3P9JA 4W9XA 5I9XA 3A7HA 3DBDA 2QO9A 3FBVA 5LVMA 2JC6A 4A07A 4O7ZA 2WPAA 4RX8A 3ZXTA 4F9WA 4EJ7A 2XRWA 3PP0A 3OROA 5AP3A 2VTTA 5BVOA 4FKPA 3I0QA 4QMMA 5ANIA 4ACGA 1FPUA 2J0LA 3FQHA 3KRLA 2FYSA 4N6ZA 4ENXA 2O8YA 4Z9LA 4AFEA 4Q5HA 4DFZE 1BMKA 3BZ3A 4EOMA 2X8IA 4OAVB 2C5NA 2XIKA 3L9PA 2B55A 2JFMA 5HQ0A 4BWXA 4TWNA 2ZYBA 1APME 3PPKA 4QTBA 3W0PA 3LQ3A 3T9IA 3D15A 1PXPA 2GNJA 2X9FA 4ITIA 2QLUA 4DFUA 2WXVA 3ZDIA 3CPBA 3BLAA 5DFPA 3AOXA 5C01A 3F3TA 2C69A 4AN9A 5KZIA 1OBDA 2XNNA 5CEKA 3W2CA 2XARA 2X0OA 3CKWA 2QONA 2WOTA 3ORZA 2QLQA 2IZUA 3TM0A 3CBLA 3GC9A 4FEWA 1NW1A 4U80A 2YCRA 3QFVA 4WNKA 3IPHA 2CSNA 3IECA 4JR7A 4WUNA 4BDFA 2A19B 3LXNA 5IZFA 3L8SA 3DB8A 4JX3A 4L67A 1ZMVA 5HKMA 4EEVA 5EW9A 4JDKA 5HESA 3SG9A 3S00A 4ZAUA 3BIZA 5H3QA 4Z16A 5A4QA 3R83A 4EQCA 5ETIA 3EN6A 3QC9A 4JJRA 3RK9A 4BIDA 4E26A 3SVVA 1W0XC 2IW8A 2XA4A 3MY0A 4K2RA 1VLRA 4BDAA 2BAQA 3PSDA 4RLKA 4BDDA 5CT0A 4LI5A 2BMCA 5EG3A 4QYHA 1B6CB 4WRSA 3A62A 2OIBA 4W4VA 3RPRA 2F2UA 3I7BA 4MHAA</