4YHTA

Braf complexed with an inhibitor
Total Genus 77
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
77
sequence length
271
structure length
256
Chain Sequence
DWEIPDGQITVGQRIGSGSFGTVYKGKWHGDVAVKMLNVTAPTPQQLQAFKNEVGVLRKTRHVNILLFMGYSTKPQLAIVTQWCEGSSLYHHLHTNETKFEMTKLIDIARQTAQGMDYLHAKSIIHRDLKSNNIFLHEDLTVKIGDFGLATVKGSILWMAPEVIRMQDPYSFQSDVYAFGIVLYELMTGQLPYSNINNRDQIIFMVGRGYLSPDLSKVRSNCPKAMKRLMAECLKKKRDERPTFPQILASIETLAR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title GSK114: A selective inhibitor for elucidating the biological role of TNNI3K.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords Serine/threonine-protein kinase B-raf
total genus 77
structure length 256
sequence length 271
chains with identical sequence B
ec nomenclature ec 2.7.11.1: Non-specific serine/threonine protein kinase.
pdb deposition date 2015-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4yhtA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4yhtA01
3QZIA 2CKPA 3E64A 2QLUA 4BIDA 1JBPE 2WTIA 4X3JA 4L00A 3PE2A 5FGKA 4CQEA 3NSZA 5FWKK 5CEPA 3GI3A 5LWMA 4EH4A 5TKDA 1IEPA 3GQLA 5J5SA 3G15A 5FXSA 3OD6X 2J0KA 4MHAA 5JT2A 3FC2A 4FL1A 2C6IA 2J0IA 5A6NA 3DGKA 3OY1A 3SRVB 4QQTA 4KBCA 3LFEA 4Q2AA 2X9FA 4IC8A 2EUFB 2XK9A 4ZSLA 1P4OA 4DEBA 4HYSA 5B2LA 2QO2A 5JFXA 1PJKA 3RK5A 3R63A 2QNJA 5D11A 5DR2A 3VW8A 3RAIA 4I0RA 3PXFA 3DZOA 3R7YA 4ORKA 2VRXA 2YDIA 5AWMA 4IFGA 4D1SA 4DBNA 2C6OA 1GZKA 3UNKA 4DT9A 4ZJIA 3F2RA 5LVMA 1PMVA 2WNTA 4JAIA 4F6UA 3VVHA 3R00A 2JAMA 4D9UA 1H0WA 2H34A 4AOIA 4EJ7A 3FLQA 4MX9A 3SG9A 5GZAA 5DI1A 2Z60A 4CGAA 3NUYA 4H3BA 4LGDA 4OTDA 4RVMA 4FZFB 2UW5A 3HAMA 1OVEA 3JVSA 4OW8A 3QRUA 3U6IA 3SGCA 3G90X 1SZMA 1UNHA 3E3BX 4YZDA 4GT5A 3VS3A 5D10A 3TNHA 3V51A 4UWYA 4OTHA 2X7GA 3PWDA 5L2TA 2CHLA 4ZEGA 3I7BA 1Q8UA 2RKUA 3VBXA 4E6AA 5LVPA 3MFUA 3GU6A 4L42A 4NH1A 5A9UA 2J4ZA 4YJQA 4U8ZA 3ID6C 2ZAZA 4AZFA 5AP1A 5DIAA 1Y91A 4YUQA 4WO5A 5LCKA 3RWQA 4R1VA 5D41A 4BDFA 2NNWB 1YOMA 2GS2A 2GHGA 2E2BA 4C4JA 5K5NA 5F9EA 4LYNA 3HYHA 3U55A 1YWRA 3I0OA 4X2NA 5HBHA 3IS5A 3UVRA 3MWUA 4TZRA 4D0WA 3PP1A 2ZMDA 1KOBA 4FI1A 2XNOA 3ULIA 2Q83A 4FIEA 3GC7A 3PYYA 2CGWA 2C30A 3MB7A 4UZDA 3AC2A 4XG4A 5A14A 1XQZA 2VO0A 3UOLA 5CEOA 3I5NA 2HZIA 1STCE 3IGOA 2HY0A 4RJ7A 2IJMA 5L6WL 3MN3A 5JMSA 3BHYA 3F3VA 4O6LA 4O2PA 4FNXA 1BI7A 2PTKA 4IM0A 1KE6A 1XKKA 4ZP5A 4QNYA 4AS0A 4O96A 4UMPA 3QTRA 4TYJA 4AZWA 3SA0A 3GVUA 4YJPA 3FZSA 1U59A 2GS6A 3W2CA 2X0GA 1YDRE 3GBZA 2OG8A 4I24A 4M69B 5L2SA 4FKWA 3ENMA 5IEXA 4MXZA 1H01A 4UMUA 1XR1A 1H1RA 3BGZA 1NVQA 1J1CA 1KE9A 4FSNA 4LRKA 1G5SA 3EQFA 4L3LA 4BDJA 4HVDA 5DWRA 4XLIA 3ERKA 2QC6A 5DRDA 1Z5MA 3E88A 4N6YA 2G1TA 4E20A 5C8KA 4G3FA 5HQ0A 4QMSA 4H05A 3BKBA 4J71A 1TQMA 1U54A 4RX7A 3WF8A 3U51A 2OLCA 4W4YA 3C4WA 4LGGA 5J7BA 4UY9A 1KUTA 4WT6A 4KKGA 4UYAA 5HIEA 4J97A 2PUPA 4WBOA 2IPXA 5AJQA 4O7TA 4D4RA 5EDPA 3HV4A 3F69A 3FKNA 1ZY4A 4R5YA 5K9IA 2XIKA 2C3KA 5HNGA 3KQ7A 5ETCA 5DG5A 3V5LA 2NRYA 2SRCA 3MGYA 3P86A 4O6EA 1WVYA 4KABA 4IQ6A 2YLFA 3PVBA 4JG7A 5F20A 5EM5A 2XEZA 4XMOA 3TV7A 3A60A 5AR7A 2GHMA 1GAGA 4EONA 4TYHB 4XV2A 5TF9A 3ZBXA 3ZO4A 2P55A 2WMUA 3IW5A 3MI9A 5CAUA 1U54B 4G6NA 2JDRA 4BCJA 2OZAB 5IPJA 3M42A 4CFXA 5AUYA 3M11A 5KBRA 4AN2A 3ZS5A 3UPZA 5KMKA 3IK3A 5LWNA 3PJ1A 2F7XE 2R2PA 3Q4ZA 1RQQA 1SNUA 4OAUC 1TVOA 4GYIA 3DLZA 4S32A 3D4QA 5AP5A 3W33A 4C4GA 2ETKA 2W17A 3FE3A 2UZTA 3EQCA 1PXIA 3PPZA 1M2PA 2HWOA 5H8EA 4K8AA 3RKBA 3VNTA 5AAGA 2B0QA 3OWJA 3KREA 1S9IA 1GIHA 4LL0A 4RJ5A 5EYMA 2PVYA 3NNUA 3QQGA 5CI7A 2GDOA 3UNZA 2YACA 3CY2A 5AP2A 3NR9A 2QLQA 3L1SA 4E4XA 4PWNA 2BALA 3GC8A 2G9XA 3NW7A 2BFYA 1CMKE 3GCSA 4YLKA 2H9VA 3CPCA 4GU9A 3ZXTA 3KB7A 4BICA 4MD8E 4G31A 3LXPA 3UOKA 5EW9A 4YSJA 2C6MA 4XV1A 1PY5A 3R8PA 1OL5A 3QHRA 5H3QA 3P1AA 1I44A 3NVKI 2ACXA 4MQ2A 4JAJA 4I4EA 3OBGA 4TNBA 3N4UA 1MP8A 4KB8A 4L7SA 5IMXA 4JQ7A 3BV2A 2W5HA 4EYMA 4AGDA 4AW0A 3E7OA 4RFZA 2C0TA 4I5MA 2R3MA 5HE0A 3SOCA 3P78A 3KULB 3GB2A 4G3GA 3WARA 3DAEA 3PJ2A 5HG9A 4HVIA 2PULA 4R3RA 4C3PA 4A9TA 4C4IA 3UIBA 3KXHA 4NM3A 4BF2A 2VO7A 5HCZA 5E8XA 4FGBA 2QKRA 4QP9A 4XS2A 2CGXA 3KU2A 4YHTA 1X8BA 1XHAA 5H9BA 2J0JA 3PXYA 4OTRA 4G6OA 2WQMA 2WTKC 4PDOA 2B7AA 2OIBA 4RA4A 2UZLA 4E93A 5LMKA 3CKXA 1ND4A 4K77A 3POZA 4BDGA 1JVPP 3IDPA 4FIIA 4I20A 4IFCA 4R78A 4KRCA 4FKQA 3F3TA 4YZBA 5A4LA 4AG8A 1XJDA 4O84A 4WUAA 2WFYA 5GIOE 3TUDA 3C5UA 3F6XA 4RIOA 5KO1A 3FMLA 1W8CA 4FTQA 3F66A 3S4QA 4Z55A 3KRXA 4BCMA 3UVQA 3H9OA 3OBJA 3ROYA 3KRJA 4ASXA 3PRFA 4I3ZA 4I93A 3KKVA 4GL9A 4JBPA 4TY1A 2YJRA 2W05A 2WB8A 5I9UA 3VF9A 4AACA 2I40A 4DTAA 4TYEA 5FXQA 4EZ3A 4DE4A 4WRSA 4ANOA 3CD3A 3LLAA 3EHAA 3Q4UA 4XP2A 4HNFA 4DC2A 3AT2A 1ZYDA 2GQGA 3CEKA 5CEMA 4QP8A 3NNWA 2WO6A 4FUYA 2WQOA 3BWFA 3I7CA 4S2ZA 4IZYA 4EH6A 4W4VA 4RC3A 3ZRLA 4LMUA 5E8WA 5AAEA 5CF5A 4CYJA 4NIFB 1RDQE 2UW7A 2J5EA 2UW9A 1Q4LA 3IW8A 4I6HA 4X2KA 3R28A 4MD9E 5ETFA 5LVLA 3GU7A 3H30A 2XBAA 3QTXA 4IWQA 1APME 4IDTA 4AAAA 3ET7A 3ZDIA 4NM0A 4CLIA 3LE6A 4PDPA 4A4XA 3ZYAA 4X3FA 5I9VA 4QMVA 3QC9A 4ACHA 2WMWA 4BKYA 4JL9A 1VJYA 4JXFA 2E9VA 4W8EA 4JLCA 4QP3A 5HI2A 4CT1A 3VAPA 5DLSA 4F08A 3UZRA 3WOWA 2W0JA 5KKRC 2OGVA 2WMAA 5BYLA 4YPDA 3DFCB 3GOKA 3H4JA 3KY2A 4EZ5A 4BDAA 5CSXA 4F0FA 4PRJA 2JAVA 3COIA 4DBXA 3QZHA 4GVJA 2J9MA 2OJGA 1H24A 4MK0A 5CSHA 3AQVA 2WU6A 3O7LB 5EDQA 4MYGA 5AR8A 1OPLA 3HV7A 4Y85A 3VHKA 4HYIA 2BRNA 4W9WA 3R01A 4WG3A 2VWIA 4YZNA 3IQ7A 3BE2A 3LQ5A 1FOTA 4M12A 4TWCA 4FV5A 5JGAA 3DT1A 3R7OA 3B2WA 4FG9A 3VUKA 5CI6A 3OCGA 3PSCA 3QXPA 4C8BA 3JR1A 1VEBA 4FZ7A 5LCJA 4DGMA 4BCOA 5CF4A 3QD0A 5ANDA 3PLAE 2YA9A 4O7SA 1AGWA 2DQ7X 3UPXA 4FKLA 1IRKA 4QMXA 2OF2A 5DNRA 5M4UA 4PL4A 4NJDA 4S31A 4GK2A 1Q3DA 3VULA 4DFZE 3AMYA 2UV2A 3MY0A 1Z9XA 3HMNA 3AMAA 4QP7A 3PDTA 1ZYCA 4HPUE 3VS1A 4BKZA 3QYWA 4G2FA 5AMNA 5E8SA 3TIZA 2J0MB 3TDVA 4FNYA 3LCSA 2OJ9A 1SNXA 5HE3A 4U42A 3V5QA 3U87A 3ATSA 2HXQA 4GG5A 3R02A 3HKOA 4FT9A 5EOBA 2QO9A 2YCFA 3R8LA 4C38A 1WVXA 1ZY5A 2PMNX 3EYHA 3F88A 5DT3A 1U4DA 2X4FA 3MY1A 5FEEA 4FEQA 4CFWA 3L9LA 1H1WA 2DWBA 4DLJA 4ARKA 2AC3A 4I92A 3QA0A 5KMMA 4BCKA 5GZ8A 3DKGA 4I21A 4UXQA 4L53A 4U5JA 4ANQA 4E5AX 3FJQE 2HOGA 3F5UA 3PFQA 3PY0A 4FC0A 5AX9A 4ACMA 3MH1A 2Z8CA 3NUUA 2WTKB 5IQHA 2R3FA 2WMXA 5D12A 1E1XA 4D9TA 4B9DA 2C5XA 4EBVA 3R73A 4YTIA 5T3QA 1M52A 3QTSA 4C7TA 2Z7RA 4OTPA 4RIYB 3PXZA 4DEIA 3VBWA 3U9NA 4IZ7A 2IZTA 5T68A 4IC7A 4KA3A 4MWHA 1TQPA 1ZYLA 2Z2WA 5CAVA 4RIYA 4PPBA 5CU2A 5FP5A 5E8TA 4KBKA 5J9LA 3FLNC 3MVLA 2W1CA 4MWIA 3KCKA 2VNWA 4MBJA 4O0SA 3VO3A 1BUHA 3OWKA 4J8MA 4YHJA 3PG3A 5LQFA 5BMSA 3WZJA 2FSOX 2W5AA 4ID7A 5F4NA 3TNPC 2W7XA 3QXOA 4C3RA 4EH7A 3R71A 1Q97A 2BAQA 2J2IB 3PPKA 4U7ZA 3RPVA 4O1OA 3A2CA 3SC1A 5CAQA 3V5WA 3OTVA 4XP0A 5D7AA 4TT7A 4UMRA 5DH3A 3I79A 3QWJA 4AZVA 1U5QA 4B99A 3BGQA 3BPRA 3PG1A 4PNIA 3QALE 5CTPA 2XB7A 5L2IA 1XH7A 2UZWE 3FL4A 2UW3A 4IVCA 5C8NA 2VTOA 1PKGA 2HAKA 4XCUA 3BYMA 4X7QA 2XKFA 2JD5A 4MNEA 5AUXA 4IB5A 4IXPA 4ZTHA 2JITA 2YM5A 4KAOA 1J91A 4RVTA 4YNOA 2PVMA 4EHZA 4QMZA 5A4EA 5AV4A 4FTIA 5LARA 1Q5KA 3OW4A 3H0ZA 2QQ7A 2HWPA 4FOCA 5D7VA 2BAJA 2CCHA 4O0UA 2VTMA 4DFXE 4CCBA 2YITA 4BBEA 3PA3A 4EYJA 5I9YA 4AXAA 4FKOA 4II5A 4J8NA 5CWZA 3ZSIA 3FLZA 3ORLA 3QF9A 4S33A 4DFNA 4JRNA 2CJMA 3RP9A 3UG2A 2QHNA 1JLUE 1XH4A 3AG9A 5BVDA 2GNLA 4MTAA 4RZVA 3ORMA 3RMFA 1OIRA 2EB3A 3P7CA 4FV7A 2G2FA 2C1BA 2JIIA 4EQUA 3QQJA 2F9GA 4HNIA 5AV3A 3FY2A 1UV5A 3OHTA 3Q60A 3K3IA 3P7AA 3NYOA 4XOZA 2W9FB 4NSTA 3LXKA 5L2QA 2JKKA 2XNBA 4GJ3A 4JNWA 2OO8X 3OZ6A 1W7HA 3CPBA 3Q6UA 4AE9A 4XG6A 3BELA 5IG1A 1G8AA 2W4KA 3TV4A 2XP2A 1Y6BA 3I6UA 3DXNA 2R3RA 3PP0A 5EW8A 4B7TA 4MCVA 5AA8A 5HX8A 1Y57A 2PSQA 4GG7A 2ZM3A 4PP7A 4JRVA 3ENHA 3C51A 2BILB 4PL5A 2XCHA 5HGIA 4AW2A 1YVJA 5IISA 3DK6A 2X8DA 1CSNA 3NUSA 2J51A 2PU8A 3RI1A 2PVJA 3BEGA 5AIRA 2P2IA 3UO6A 2JKMA 3RPOA 3QRJA 2J6MA 3V8TA 3ANRA 1FQ1B 3Q9YA 4M14A 3U54A 2I0YA 2BTRA 3UGCA 3IGGA 1H4LA 2R4BA 4U97A 2F7EE 5AUVA 4E3CA 5HG8A 5T6KA 3GU8A 4YGAA 4CFNA 2PWLA 4QYYA 3BI6A 3DDPA 3EFJA 4M84A 5A54A 3TJDA 4BI2A 1Q61A 3G9LX 1O6YA 2WMBA 1LEWA 2XCKA 3KMUA 4F9WA 4AX8A 4M7IA 3C1XA 4NFNA 5HD7A 5E8YA 2JGZA 3GENA 1T45A 4YJUA 1CKIA 1OL2A 1UNGA 2GNHA 3VS4A 3ZLYA 5GIPE 2QOLA 4QYHA 1J1BA 2I6LA 4ANNA 3R7IA 2OZAA 4WOVA 1OL7A 2ITTA 3MJ1A 4YNEA 5DHJA 3UIUA 5IDPA 2LGCA 2VZ6A 3A4PA 2GQRA 1OKVA 4RMZA 3B8RA 1DS5A 3LMIA 5IEVA 2ZJWA 1M2RA 1O9UA 5FD2A 5K4JA 4OTGA 2BROA 1R0PA 5CQUA 3BU6A 4YLLA 4O83A 4QMWA 1ERKA 3QTIA 5I9ZA 4BBMA 4QP2A 2C5OA 5EI8A 4NWMA 2PE0A 2W96B 4QYEA 3QLFA 2UW6A 4DGOA 4MXAA 1YDSE 2PMIA 5M51A 2ITXA 2VTQA 5CENA 1JSTA 3TN8A 2OI4X 2R3IA 2XH5A 4CNHA 2C69A 2W4JA 4EOPA 3R9HA 4PDYA 2QKWB 3R30A 4WG5A 1BX6A 1R39A 3F82A 3NIZA 1UU3A 4AZSA 4CZUA 3NYXA 3DTCA 2XYNA 2JKOA 3UZTA 4WUNA 4FOBA 1GIJA 2VX3A 4X0MA 4CMOA 4RFMA 4YLJA 3R8ZA 4GCJA 1WBWA 3VN9A 3G9NA 4IJ9A 1OKZA 1PXJA 3SXSA 1UA2A 1YXXA 2AUHA 2X2KA 1QPEA 3OOGA 4FSZA 5AR2A 3MYGA 1QPCA 1URCA 3FWQA 2PZIA 4NKSA 5M57A 1OZ1A 1PXKA 2KULA 4EH5A 3ACJA 3P79A 2WIHA 4JX7A 1FBNA 3WF7A 5IQCA 4O0YA 3FQEA 5I9WA 3PXRA 4I4FA 4XG2A 4I22A 3VBYA 5I4NA 3KCFA 2X6DA 4MXXA 3FMKA 2FUMA 3NAXA 1H26A 3FQHA 3CQUA 3FBVA 3KRLA 1ZRZA 4EOQA 3O8TA 5CSPA 3R1NA 4LL5A 4CFVA 3BU5A 1Q8ZA 5EHOA 5JGBA 1OMWA 3R7VA 4KIOA 5JZJA 3W2OA 2FGIA 2JFLA 2ETMA 2OFUA 4H3PA 4G9CA 3PSDA 1PXOA 4FIGA 3ORNA 4IAZA 2XIZA 4W4XA 4HVSA 4NW6A 3MSSA 4A9YA 4EJNA 4K33A 4HYHA 1IAHA 3L8SA 4IJPA 3DXQA 4AN3A 4HGLA 3HVCA 3JXWA 3DDQA 1NA7A 2NO3A 3TACA 4HOKA 4AGUA 4TWOA 3LM5A 5HD4A 5IUHA 1YWVA 4AZEA 4HYUA 4G3CA 4D4SA 2BIYA 1NW1A 4EQMA 1ZWSA 3HRBA 1M7NA 2W5BA 2X7FA 5DT4A 2GU8A 3UYSA 5BVOA 3W8LA 2WEVA 4FG7A 4XG3A 3F7WA 4ZTNA 1BKXA 4QTCA 4AA0A 2XUUA 4R77A 2HELA 3FXXA 5DGZA 2WGJA 4KKHA 4YPSA 5JN2A 4OAVB 3BE9A 4DFLA 2YM3A 3HEGA 4BI0A 2R3JA 4HGTA 2VNYA 4QQ5A 2AC5A 4GRBA 4MAOA 4W9XA 4APPA 5KCVA 4L43A 3UOJA 5M06A 5M08A 1OBDA 2YLEA 4RJ6A 3EFWA 2OF4A 4W4WA 3NAYA 3WILA 4L9IA 3LFSA 5BX0A 4QYFA 5EQPA 1M17A 5E8ZA 4HPTE 4FT0A 4XH6A 4Y8DA 3EN7A 4S30A 4WKQA 2OK1A 4FV4A 3D5VA 1DAWA 3BHHA 1GY3A 1BYGA 4IX6A 4O38A 1ZMVA 2HYYA 4LRJA 3RAKA 1VYZA 4FTCA 3BHUA 3L8PA 4E1ZA 3Q53A 1SVGA 4UV0A 3EL8A 3FPQA 3MW1A 2FA2A 2WQNA 1KSWA 4GV1A 3MFRA 2R3QA 4WNMA 5CNNA 1NVSA 3D2KA 4I1ZA 4DG3E 5A4QA 2Y8OA 5CQWA 3CLYA 3ZLWA 2CNVA 2PZRA 3PY1A 5A4CA 4WNPA 4IX3A 4MNFA 4NZWB 3ZO3A 1WBNA 2JBOA 5KX8A 4ZLYA 4A07A 3HA8A 5JK3A 1K3AA 4QQJA 4FG8A 2OSCA 1QPJA 4M15A 4M0YA 3SAYA 4FV6A 3KVWA 4BHZA 1W84A 5CAPA 3TTIA 2DYLA 5KZIA 2X6EA 3EQIA 4ZSAA 1MQ4A 5HVJA 4EUTA 5EI6A 3KVXA 2CCIA 4FV9A 3VBQA 3LPBA 3AC5A 5CVGA 4YC3A 4RWIA 5FQDC 5ICPA 3NUAA 2UZEA 4F70A 3CR0A 4RC2A 3A7IA 4OBOA 2XF0A 2ONLA 4Z9LA 4FKJA 5A3XA 3P9JA 1XH8A 5IA1A 3DOGA 4GKHA 3HRCA 1Q8WA 3ZOSA 3UP2A 3DBFA 4A4OA 1UU9A 1UKIA 1E1VA 2PYWA 4IB3A 4GEOA 2Z02A 3WZKA 3DPKA 5I3RA 1WMKA 4FL2A 3IPHA 3QZFA 3RZBA 1SYKA 4A9UA 4FUXA 2VTJA 3GCQA 4BHNA 2QD9A 2WKMA 3A7GA 4NYEA 2XNNA 4BCFA 1YI3A 3QLGA 2BIKB 1R0EA 3A62A 4CXAA 1GJOA 4NT4A 5A46A 4PTEA 2R7BA 4YO4A 4C37A 2UVXA 1H00A 1YOJA 4ITHA 4U9AA 5FTQA 1YXVA 2X7OA 3C4CA 3RHKA 1UVRA 2YDJA 4C35A 4E4NA 3G33A 4AP7A 3LCDA 2GFCA 1JSUA 2PHKA 4QPSA 5FM3A 2G15A 2YEXA 3E8CA 4GUEA 2ZOQA 3V6SA 5M44A 3PJ8A 3RPSA 5LOHA 2YERA 5IUIA 3C4ZA 3MPTA 3HUBA 4E5WA 4EOIA 1YI6A 3LXNA 5GHVA 1W0XC 5TE0A 3PIYA 4C4EA 4LOQA 4KKEA 5HICA 1GZOA 4FSMA 3C4XA 3D7TB 3QCQA 3LMHA 4I5PA 5CVHA 4BDKA 2C3JA 5KHXA 2YN8A 1CKPA 2EVAA 4EK8A 3FZ1A 4LUDA 4V01A 4P5QA 2IW9A 1J7LA 4IMYA 4QMOA 4NKAA 4O7VA 5H8GA 4F1OA 5ANGA 2XKEA 1YKRA 2B4SB 3C0HA 4YJRA 4EWQA 3E92A 5AUZA 2YM4A 4IANA 4KIQA 4Z3VA 5J1WA 3UTOA 4GH2A 4PQNA 5LJJA 5CU3A 2QU6A 2A27A 2QR8A 4QMNA 3DJ6A 1Y8GA 3V01A 3KXMA 4L67A 4ZLOA 1JPAA 4GU6A 1IR3A 4JBQA 5BYZA 3FZOA 2ZV7A 4AW1A 2ITQA 3CXWA 3FMMA 3DQXA 3LVPA 4PP9A 3RWPA 4D5KA 2A4LA 5L2WA 2UZNA 3VUHA 3F9NA 4ZTRA 3R9OA 2IVUA 2VGOA 3FLYA 4FX3A 4JG6A 4Y72A 1CM8A 4O0XA 5KMOA 3N4TA 3DJ7A 3MB6A 1J3HA 2WTVA 4FT3A 5IQGA 1ZOGA 3AGMA 4FIHA 3WBLA 4AT3A 4DAWA 3PZEA 4AT4A 2OICA 3PUPA 2XM8A 4MD7E 2GNIA 4QPAA 3RAHA 5ACBC 2RF9A 3MDYA 3V5PA 1YDTE 4M97A 4QP1A 5K3YA 4ACCA 4BIBA 1NT2A 5C4LA 4DH1A 3SW4A 4XLVA 4U3ZA 5IUGA 3ALNA 3ANQA 1I09A 4IBMA 3I1AA 4OBPA 4BTJA 3MTLA 5BNJA 3MH2A 2R3HA 2B9HA 2IW8A 3OCSA 5IH6A 1A48A 4RJ8A 4RWKA 3Q6WA 2VWXA 3U9CA 4YURA 4BR3A 2PE2A 1B38A 1Y6AA 4GIHA 2VWVA 1UWJA 2C0OA 2YCRA 5AIKA 5C8MA 4F6SA 3GCVA 3OOMA 3I4BA 1NVRA 4FTRA 2XJ1A 3TUCA 3A99A 4XV3A 4YHFA 3HV5A 2OIQA 5FBOA 3HX4A 3HV3A 3VIDA 3CCNA 4FICA 2PZ5A 3HP2A 3AC4A 3KXGA 3UMXA 4BBFA 4F9CA 2G01A 4J95A 3MVJA 4B8MA 4Y5QA 5M4FA 5C4KA 5EQEA 1VYWA 4G3EA 2FH9A 3TWJA 4WSYA 3PPJA 3KXNA 3TNIA 3HUCA 2FSMX 4MBLA 3Q5IA 1OUKA 2V5QA 3NW5A 4BYJA 1JOWB 1YXSA 3D15A 3E5AA 3E62A 4CMUA 4ASZA 4CRLA 2I7QA 2BR1A 3FI2A 5L6PA 3F3WA 1KWPA 4HGSA 3WZEA 2QI8A 3R9NA 3ZCLA 5HG5A 4A4LA 5F94A 4D5HA 4PMPA 5IA0A 5DEWA 5AR4A 3O0GA 5F95A 4MNEB 3QAME 2C3LA 3QTQA 4XRLA 4IAYA 4DH3A 4FKTA 5FG8A 5LMKC 2R3LA 5IQIA 4IACA 4F7LA 1V0PA 3CC6A 2HENA 3JYAA 2C6LA 3F5XA 1DAYA 5JQ8A 4QQCA 1O6KA 2PVFA 4L3JA 3RGFA 5AA9A 4HGEA 3GGFA 1PYXA 4F6WA 4I94A 3DK7A 2UVZA 2WELA 5EHLA 4H1MA 4JQ8A 1ZZ2A 2O64A 4XP3A 4QMUA 2WD1A 1JWHA 3UMWA 3LCOA 5H2UA 4CD0A 5G6VA 4PNKA 4K11A 4RZWA 5IU2A 3HDMA 3UIXA 2ETRA 2XNPA 4J96A 3ZO2A 4O7RA 4HCVA 1OL6A 5AP0A 1R78A 1SVHA 3C9WA 3CQWA 5B2MA 2YIYA 3NPCA 3TI1A 4QMQA 3ATTA 3GEQA 3QBNA 4OGRA 3V6RA 5FEQA 3IW7A 4U79A 1Q8YA 4IX5A 5KMLA 1W98A 5C27A 4E7WA 5IF1A 5GJGA 3JVRA 1AD5A 4R3PA 4DFUA 3DNEA 4WNKA 3ZUVA 4K9YA 4Z7HA 1ZOHA 3CTQA 4MXOA 3UIMA 4YBKA 2BKKA 3SW7A 3ZFXA 4UMQA 5M4IA 2XZSA 4A06A 2O2UA 4G9RA 2PVKA 2A19B 3UC3A 2XK7A 4KUJA 1V1KA 4FSUA 5JEBA 5IQEA 2DS1A 4ITJA 5CANA 5GJDA 2WOTA 2HW7A 4KIKB 3SHEA 2R3OA 4X3FC 3HMPA 3R1QA 4KNBA 3PIZA 5AP3A 2GNJA 3DA6A 3BYVA 3FC1X 3FZRA 3ODZX 5I9XA 1V0OA 1QCFA 3R8VA 3Q4TA 3Q9XA 2VN9A 4NCTA 4ZJVA 4U40A 5CVFA 4FZ6A 3F5PA 3THBA 2X39A 3O23A 2Y4IC 3V8WA 4BCQA 4FV2A 5GJFA 2H8HA 3OWLA 1KE8A 2BHEA 2Z7QA 4YZMA 3EQPA 3U6JA 4BDDA 4U81A 5C26A 4O81A 2ESMA 5HBJA 1WBVA 4C58A 4QPMA 4Y83A 4BWKA 3PVWA 2X2LA 4IE9A 3W2QA 3ZXZA 3Q3BA 4BDCA 1TQIA 4U3YA 3DNDA 4QD6A 2HXLA 5IEYA 3EKNA 3TM0A 5HNBA 3RCJA 2XYUA 2XJ0A 4FVRA 4L68A 4NM5A 4JIKA 3VUGA 3NZ0A 3W32A 2UZBA 2O3PA 4GKIA 2YCQA 4J98A 2EWAA 2V22A 4R6VA 1RW8A 2YIRA 4CRSA 3SV0A 4D4YA 2Y6MA 3S2PA 4AF3A 3Q5ZA 5IH4A 4D1ZA 2PZYA 3O51A 4YJSA 4RIXB 3SX9A 1AQ1A 2CKOA 3H10A 3GC9A 2IVSA 1MRUA 1W82A 4TKSA 4EK3A 2CNQA 3KRWA 2CDZA 3R8MA 4XV9A 4RRVA 5IQFA 1LR4A 3GU5A 4HJOA 1WAKA 3FI4A 1YRPA 3R1YA 3NRMA 4I41A 3VRYA 2F57A 3ZFYA 2X8EA 1XWSA 3EFLA 5HHWA 4R7HA 5L6OA 3I60A 4QOXA 3IECA 4R1YA 5BUJA 5DT0A 2OW3A 3LXLA 3MIAA 3NYVA 4XUFA 1F5QA 3F2AA 4F7NA 2GHLA 4UALA 4ANBA 1FPUA 1M2QA 3PSBA 4N57A 3KRRA 4QMYA 2UZDA 2B9JA 3DS6A 2HZ4A 4PMSA 4O0WA 3SLSA 4LUEA 4AE6A 4BCPA 5CZIA 2GS7A 1KOAA 2XIYA 3DCVA 1Z57A 2BRGA 2B1PA 3GXLA 2QOIA 3DK3A 3GOPA 2A1AB 3IW4A 2Y6OA 4F1TA 2R64A 4AGCA 1LEZA 3EJ1A 2KTYA 4RX8A 4TNDA 2XNEA 4U41A 2J50A 3BX5A 3VHEA 4UX9A 3IOPA 4U43A 2OH4A 4D2VA 4FNZA 2BPMA 3LW0A 4FTOA 4JDJA 1ZAOA 3PTGA 5DE2A 4NUSA 3DKFA 2YM8A 3JUHA 4Q5EA 2REIA 3QHWA 5CT7A 3VUTA 2PUNA 3UOHA 4TL0A 3JY0A 1YHWA 5CF8A 4CFUA 4FE2A 4BCNA 5M09A 3WF9A 3ZSHA 3OCBA 3PJ3A 4EH3A 2YIXA 4R8QA 5J87A 3R7UA 3QCYA 3MPMA 4XG7A 3ZLXA 3T8OA 5CXZA 3E8NA 4UZHA 4BTFA 2ZM4A 4HCTA 5EM6A 3L9NA 4CVAA 3QX4A 1PHKA 5EFQA 2EXMA 1UNLA 5LMAA 3UQCA 3HP5A 3F3UA 3OC1A 1H28A 4DH8A 1OIQA 2VTIA 2WMRA 3TZ7A 5TO8A 4DGNA 4ZIMA 3MTFA 4L6QA 4P2KA 2ZDUA 3QQKA 4NCTC 1H1PA 2OU7A 3WYYA 3OMVA 1JQHA 3UBDA 4FVQA 1V0BA 4EH2A 1PW2A 2OJJA 2NRUA 4DHFA 1XH9A 4A9RA 5J79A 3MVHA 4F99A 3BRBA 3P7BA 3PXKA 3QKKA 2OJFE 4IW0A 5AM7A 4F0IA 3BV3A 4MH7A 5L8JA 3RBWA 1H25A 2C1AA 3EN9A 3QQHA 5J1VA 3S95A 5IH5A 1URWA 2V62A 5BUEA 5GINE 3NIEA 4EUUA 4B6LA 3EZRA 5A4TA 2VWWA 4CT2A 4N4SA 4GFMA 1H1SA 4IH8A 3RPYA 3SVVA 3OXTA 3DB6A 5HTIA 3CKWA 3KL8A 3AD5A 4XHKB 3CJGA 2C0IA 4O22A 3RALA 3MIYA 2XK4A 5ANEA 2VO6A 3WE8A 5KMIA 4AQCA 4IWOA 4EK5A 4QNAA 5D1JA 5CYIA 3TV6A 2YWVA 4U0IA 4G3DA 3RZFA 2BRBA 4RVLA 1PMEA 4FTTA 2RFEA 3KA0A 4ZZMA 4FL3A 3AXWA 2B9FA 5CU0A 3D5UA 2W1IA 4ZTLA 3TT0A 5HTCA 5DMZA 1WBTA 2VV9A 3CQEA 3O71A 2CSNA 4K2RA 4EHVA 4EOLA 3EQGA 4NK9A 2F7ZE 2RIOA 2UZOA 4YBJA 2GQSA 3H9FA 4CMTA 3EKKA 4IVAA 2RFSA 4ACGA 2QO7A 4L3PA 3RM6A 4FNWA 4OT6A 5FDXA 2Y4PA 1U5RA 2YIQA 4DEDA 5E7RA 1YHVA 4G5PA 3E3PA 4ITIA 3ORZA 2C68A 4AN9A 1REJA 4YTCA 1SVEA 3AC3A 4FSQA 4JX3A 4MXYA 4ALVA 5J9ZA 3QGYA 3RNIA 4P5ZA 2O8YA 3LMGA 2PY3A 4FMQA 3QX2A 2ITWA 1GZNA 2XEYA 4U44A 4OTWA 1IG1A 3QU0A 3DJ5A 2WPAA 5HCXA 3Q04A 4QMTA 1F3MC 3F5GA 3ZUTA 4R3CA 4GSBA 4ZAUA 1PRYA 2YWPA 2OZOA 5AR3A 3OROA 1PXMA 3CGOA 4L52A 3I0QA 3IG7A 5H8BA 3LLTA 1O6LA 1YI4A 2YAKA 3UP7A 3GCUA 3OFMA 4DLIA 5JFVA 3ZEWA 2J0LA 2VWYA 5EKOA 2QVSE 2FSLX 5HESA 1KE7A 4J52A 5CU6A 4GVAA 4F0GA 3AGLA 3HZTA 5J95A 4BCGA 4CG8A 3NS9A 3PJCA 2GSFA 4FEWA 2YISA 2JDTA 4YSMA 4IAKA 3DBQA 3A7HA 3K3JA 3MBLA 2B52A 3D83A 2IWIA 4RT7A 4P7EA 2BDFA 1ZLTA 2VTAA 4QTBA 2BUJA 3BU3A 3G0FA 1WZYA 2R7IA 3FLWA 3K2LA 1P5EA 2VWBA 4CKRA 5HO7A 4D0XA 4MQ1A 4QMMA 4HCUA 3R83A 3LZBA 4JT3A 1ZYSA 4JG8A 4KIPA 4RG0A 5DR6A 3T9TA 4TYHA 4AFEA 3NYNA 4I6FA 4JIAA 4LMNA 4D2TA 4ERWA 4DG0E 1IA9A 1JKTA 2GNGA 4FIJA 4E6DA 2JDVA 4FTKA 4O91A 5ITAA 3FMNA 3O7LD 4KS8A 2X4ZA 2YM6A 1MQBA 3BBWA 4BI1A 2HZ0A 3HAVA 4ANSA 3LFCA 4EEVA 3LFBA 4EORA 5BVWA 5CALA 2VU3A 2WAJA 1UU7A 4ZTSA 4I0SA 4HVHA 4CFMA 4O86A 3R21A 3UJGA 3KMWA 4EC9A 1Q62A 4E4MA 4GT4A 4YZ9A 4V0GB 3QD4A 1W83A 3N51A 4ZY5A 3S0OA 3ORPA 4IIRA 1OL1A 2PVLA 5HO8A 5JRSA 4FZAB 4BGHA 2VAGA 1HCLA 2WU7A 2LAVA 4LV8A 4PDSA 5EYDA 2UW8A 2PPQA 3P4KA 4LOPA 2X81A 4FSWA 2BZHB 4IB1A 5HCYA 2Z7LA 3WYXA 2FYSA 4TYIA 4FTAA 4C2VA 1Y8YA 4E4LA 4USEA 3RK9A 5AUTA 3KFAA 2QOBA 1ATPE 4NM7A 4GYGA 2IW6A 5EH0A 5EG3A 4E5BA 2B54A 2ZM1A 5C1QB 1KV2A 2PMLX 4X2FA 3UO5A 4JQEA 1RE8A 2XK3A 4IB0A 4USFA 3O8UA 4MXCA 4O21A 3B2TA 3CP9A 4J7BA 4LGHA 4XOYA 4AA5A 5BQ0A 4LRMA 4YJVA 4ASEA 4GIIA 2C6EA 4GJ2A 4FKSA 4LM5A 1LP4A 3WIKA 3LJ0A 3DLSA 5ETAA 4FVPA 4AA4A 2P4IA 2ZB1A 3FSFA 4PX6A 5K4IA 1BLXA 2Y0AA 5TT7A 3AMBA 3DXPA 3W10A 2VWZA 4EC8A 2A0CX 2HK5A 2E9PA 1QPDA 2W06A 4XEYA 3FMDA 3ELJA 4EOJA 2R9SA 2OKRA 3DZQA 4RGJA 4DEHA 4EWHA 4EOOA 2YDKA 4RWJA 3NVMB 4EBWA 3QCSA 3R1SA 3FHRA 3ZC6A 1R3CA 1PXLA 2BVAA 2ERZE 3GU4A 3PZHA 5CNOA 4ENYA 4EOMA 4BY9E 5HU3A 3QD3A 1YWNA 2QOFA 3AD4A 3EYGA 3LIJA 3OS3A 3P08A 4KRDA 5D9HA 5TOZA 4YMJA 3SXRA 5J5TA 3VUIA 2NP8A 3BYOA 3TNQB 4EKLA 3DTWA 4GUBA 1SMHA 5IKWA 4CKJA 5L8KA 1JKLA 5K0KA 4M66A 3RHXA 2R5TA 3E93A 3VWAA 2C47A 5FXRA 2YZLA 3C0IA 3VJNA 4ZSEA 4Q9ZA 2DUVA 1H27A 2P2HA 1BL7A 1XBBA 3UO4A 3VBTA 4Q9SA 4XNEA 2C5NA 2CGUA 3WF6A 3ZDUA 5JQ5A 3QUEA 4BC6A 3DB8A 1OITA 4WD5A 3BLHA 4PV0A 1OI9A 4O7YA 4Z16A 1GIIA 4BGGA 5CXHA 5M4CA 5TR6A 3PWYA 3QD2B 2PZPA 5EDRA 2ZV9A 2BZJA 3N9XA 3WZUA 3PVUA 3ZLSA 4R7BA 3HNGA 3ZZEA 2WTDA 3HRFA 2YABA 4RWLA 4OR5A 1U46A 2BHHA 3C0GA 4GK4A 5HE2A 3RJCA 2QONA 3AC8A 4C36A 3U6HA 3FUPA 2V55A 3SRVA 4RJ4A 3IDBA 4Y95A 2XJ2A 3D5XA 1P14A 4IX4A 2WTWA 4V05A 4ONAA 4V04A 3OUKA 2YCSA 3AT4A 4XRJA 4Y5HA 3FZTA 2JBPA 2PL0A 3K54A 3ZH8A 3W2RA 3NUXA 5HU9A 2YAAA 3C5IA 2V7AA 5FP6A 3LCTA 2ITOA 4CLJA 2WOUA 2CNUA 2FO0A 3FYKX 3EQHA 3R0TA 3W16A 4OBQA 4JDHA 2CKQA 3CTJA 2OWBA 3U4WA 4FEVA 4HZRA 4CSVA 2XVDA 4RIWA 1PYEA 5LMBA 4PPCA 2W99B 2C5YA 4FV8A 3ZU7A 4TWPA 3RM7A 2VWUA 2WEIA 2ZYBA 5FEDA 2X1NA 3FQSA 3MH3A 5M55A 4YC8A 3W2SA 4GW8A 5EQYA 4RIXA 4NFMA 3EWHA 3RINA 4U45A 3VJOA 3E7VA 5HLPA 3L9MA 2VTRA 2ITVA 3DQWA 2XRUA 4K18A 2QU5A 2ITNA 3VS0A 1YXTA 2ZMCA 3D14A 3I6WA 1JKKA 3RCDA 1ZYJA 3TKUA 3UC4A 3G5DA 3R7GA 3TNWA 4RX9A 4ERKA 2O5KA 4LQMA 4BL1A 3EIDA 2JDOA 3MA6A 4TYGA 2GTNA 5BVFA 5B0XA 1OIUA 4I0TA 4ZTQA 4L01A 3FMEA 1RJBA 4AU8A 4CTBA 3QTUA 4F64A 1FMKA 3ORKA 4C34A 3QA8A 2IVVA 5HEZA 1OECA 2XNMA 2XS0A 2C6TA 4BTMA 4FV3A 2YIWA 1FGIA 3HL7A 5KE0A 1XBAA 4GFOA 3EMGA 3A8WA 2HCKA 3KF7A 3ZRKA 5E4HA 3VW6A 3OEFX 3F2NA 3O8PA 5AUUA 4FSRA 2GMXA 3EN4A 4EI4A 5HX6A 1FVVA 5KKRB 3QFVA 4BZOA 3G6HA 1PMUA 4UBAA 3TZ8A 3QUPA 2QOCA 2JIUA 3VF8A 4BGQA 4JDKA 2FSTX 4W8DA 4X6QC 3S3IA 3R9RA 2HW6A 4RLLA 4EL9A 4TPTA 2PVNA 1L3RE 4KIKA 4X2GA 3ULZA 3A7FA 3NDMA 1OUYA 3QQLA 2HY81 3NGAA 3KF4A 2PK9A 2R0IA 5M07A 3D5WA 4LV5A 4D2WA 1WBPA 3DAJA 3P5KA 4OT5A 4O2ZA 3MJ2A 2O0UA 4N70A 1OM1A 4G5JA 3W2PA 5IA4A 3LHJA 3LQ8A 4OTIA 3DY7A 4O7LA 2C4GA 5AADA 3OVVA 3CGFA 4FGRA 3KXXA 4IM3A 3ZO1A 3HV6A 4B4LA 3VBVA 1PXPA 5FUTA 3FZPA 3OWPA 2ZVAA 5BVKA 3SDJA 3SOAA 4CV8A 4MVFA 4C4HA 2JIVA 4F63A 4L7FA 4QP6A 2GPHA 3IKAA 4F9YA 3V5JA 4FZDB 4JR7A 3QGWA 3W1FA 4UB7A 4QO9A 4RIWB 4UWCA 2O63A 3BHVA 3L8VA 5FM2A 4DEEA 5HORA 1B6CB 5HZNA 3POOA 3G2FA 3FAAA 4IVDA 5L3AA 3QRIA 2VO3A 4WG4A 5CS6A 3PA4A 4QRCA 3FLSA 3FMHA 2WMQA 3KN5A 3PLSA 5AV1A 3HMOA 1UU8A 3IW6A 3TEIA 4RC4A 1Q3WA 3QZGA 4MEDA 2OH0E 1M7QA 5BPYA 4Q5HA 4I5CA 3CD8A 5DVRA 5KBQA 1VR2A 1Q8TA 3NCGA 4FYOA 5E8UA 4P4CA 4C57A 2J90A 5FLFA 2F4JA 3KGAA 1FINA 2BTSA 3Q32A 3D7ZA 3U8WA 3Q96A 2XIXA 1NXKA 3GQIA 3TXOA 5C9CA 3P23A 2UW0A 4GS6A 4BRXA 4EH9A 4K0YA 4OLIA 4B0GA 4BYIA 3M2WA 3OTUA 1Q24A 4O7NA 2OJIA 4O7WA 4EOKA 4ZK5A 4YR8A 4G1WA 4WHZA 3I81A 4OTFA 4DH7A 1GZ8A 2CN5A 4HZSA 2RGPA 4FV0A 2QG5A 3FY0A 4M13A 3RK7A 4CEGA 3LCKA 2XK6A 4IEBA 2CGVA 1LPUA 4AUAA 4C61A 2W1DA 1QMZA 4FTNA 3QKMA 3T3UA 3ODYX 3OF0A 3S00A 4UN0C 5EM7A 2G2IA 3GNIB 1OPJA 2BZIB 1PKDA 2R3KA 1P2AA 3LJ1A 3OCTA 1Q99A 4KWPA 5IDNA 3DAKA 3UNJA 4D2RA 4L45A 4Z7GA 4LG4A 2E9OA 3RTPA 3UQFA 2IO6A 5E9EA 4BFMA 4QTEA 2WZJA 5ANJA 4C62A 4IAAA 4BTKA 2JLDA 3EL7A 3Q9WA 2QOHA 2H96A 2QOKA 4D4VA 3EQRA 4UMTA 3ZM9A 2HIWA 1ZMUA 3MH0A 3LJ2A 3KK9A 5CSVA 5CAOA 2WTCA 3B8QA 2C3IB 3ORTA 5CX9A 4EHEA 5IMEA 5LVOA 4RPVA 3LFFA 1TKIA 1OKYA 3LFNA 2YZAA 5EM8A 5EK7A 4CFFA 3WI6A 3W8QA 3K5UA 2QOQA 4J53A 4ZXTA 2OXYA 1CKJA 5J8IA 4HW7A 5BMMA 3DBCA 4H58A 5HVKA 4DH5A 3MPAA 4FKVA 4D55A 5EKNA 3ZONA 5HO6A 3R2BA 4R7IA 4UXLA 3A4OX 4UWBA 3F3ZA 3FMJA 4ASDA 4FTMA 4EHGA 5AEPA 4PL3A 4C33A 5M56A 5KMJA 3ZM4A 3NUPA 2GCDA 5CASA 3JPVA 4E73A 3EB0A 5BUIA 2YM7A 3DKCA 2JC6A 3Q2JA 3A8XA 4ANLA 2WQEA 3BHTA 1XH6A 3QCXA 4IDVA 4APCA 4O82A 4DFYA 3VS2A 4KSPA 1SM2A 4AZTA 5HIBA 5IQBA 4YTHA 2FB8A 2BKZA 1ZZLA 3W18A 4BCIA 1B39A 4YZCA 4BWPA 2W1ZA 4UEUA 3ACKA 5E91A 5L8LA 3VC4A 4IZ5A 3TIYA 3VQHA 1KE5A 4H39A 3ZBFA 5LXMA 3Q52A 4BDHA 3COMA 4WIHA 5M53A 3D2IA 4IAFA 2R3GA 2V7OA 3VUDA 3JS2A 4YJTA 4FIFA 4FT7A 3FV8A 2EU9A 4N0SA 4PTCA 3D7TA 4MBIA 5JFWA 4F7JA 2Y9QA 5HKMA 3T9IA 2WIPA 2QODA 3GT8A 3AC1A 4FBXA 5CSWA 4V0GA 3W55A 4AOTA 2WQBA 3PE1A 1UWHA 4ALUA 4CYIA 5AFVA 2BRHA 2VX1A 1G8SA 3D0EA 4FTJA 3UE4A 4RJ3A 5J7HA 1IASA 3CY3A 3ZC5A 3PRIA 3UODA 3EN5A 3IDCA 4FTUA 4ZSJA 4EH8A 4FEUA 2PVRA 4HVGA 3ETAA 3TL8A 4OUCA 4YU2A 2RSVA 3QYZA 3ZRMA 4ZMEA 2WXVA 5JSMA 4JI9A 4DT8A 3OXIA 4KD1A 2PUUA 3OEZA 1JSVA 3UDBA 4RX5A 1IA8A 2OBJA 2UZUE 3QL8A 4NEUA 3HA6A 4RSSA 4AWIA 3LM0A 4J1RA 4QP4A 2P0CA 1JKSA 2XNGA 3MFSA 3P0MA 4UYNA 4Y73A 5AUWA 5FDPA 1J7UA 5DA3A 1WCCA 1HOWA 2VTPA 3DBDA 2PE1A 4LOOA 3FPMA 2FVDA 1H08A 1UKHA 3FI8A 3KN6A 3NNVA 5HNIX 3HGKA 4FT5A 4R5SA 3CS9A 2UUEA 4XX9A 4EKKA 2XA4A 2Q0NA 3KXZA 4G17A 4XJ0A 4ZSGA 4DTKA 4FR4A 1PF8A 4IADA 3TZMA 4JR3A 2ITZA 3TZ9A 4ALWA 1LUFA 3ORIA 5CZHA 2XK8A 4ZZOA 4IWPA 4FKIA 3ZHPC 1GNGA 1E9HA 2QHMA 3L8XA 4TW9A 5IA5A 2WTJA 4M68A 1MRVA 3H0YA 2IG7A 4GFGA 4DYMA 5DYJA 3ZFMA 4RQKA 5FTOA 4GMYA 3KC3A 5E8VA 4G6LA 2A2AA 2VTLA 3BIZA 3AT3A 4FKRA 4O0RA 5EI2A 2CN8A 1H0VA 2C6DA 3O96A 4RLKA 5EYCA 4C4FA 3LOKA 3O2MA 2WMTA 4JOAA 5JH6A 3ZTXA 1REKA 4EK6A 3BQCA 4F7SA 5AM6A 5JFSA 5HBEA 5HIDA 4L46A 5J9YA 4NJ3A 2E9UA 2C6KA 3QC4A 4K6ZA 4M8TA 1GOLA 4M0ZA 4C0TA 3GFWA 3DBEA 5KMNA 1FGKA 3DV3A 3RPRA 4DEGA 4DINA 3DU8A 2OXDA 4O0TA 5HE1A 2CLQA 2O65A 5LVNA 3BBTB 2RG6A 4CZTA 3OXZA 1FMOE 4ZS0A 2BFXA 5ETIA 4BKJA 2Q0BA 3IONA 4EK4A 3MESA 3SD0A 3R8UA 1WBOA 4QTAA 2JKQA 4E6QA 4BIEA 4CCUA 3Q4CA 3FSKA 4JDIA 4L44A 1BMKA 1YW2A 2QOOA 1ZOEA 2QCSA 5B7VA 1JAMA 3QRKA 4M67A 3FI3A 2VGPA 3TG1A 4DGGA 1OIYA 1FVRA 2GNFA 2F2UA 2XMYA 4FYNA 3ALOA 4GT3A 4IZAA 3EOCA 4M69A 3BZ3A 4FK3A 4YO6A 5DRBA 4IWDA 3BYSA 4WA9A 4BB4A 2PMOX 3KULA 1DI9A 3IOKA 4WRGA 5EYKA 4ZY4A 1J7IA 5HG7A 5FTGA 4C2WA 5ANIA 3O50A 4ZOGA 5I3OA 4PTGA 5I0BA 3E63A 2RG5A 2QURA 4DEAA 2NPQA 3S1HA 4IVBA 5JZNA 4EZ7A 4BVUA 2UVYA 4O27B 1JNKA 2WMSA 4O7ZA 5HLWA 3QRTA 1OBGA 4TRLA 4IAIA 3G6GA 3NEWA 4TWNA 5FRIA 4BCHA 1CTPE 3R6XA 4BDIA 4AGWA 5K5XA 2I0EA 2XM9A 3HDNA 3PA5A 3V04A 4FF8A 2ZV2A 4QT1A 3PIXA 2J7TA 1G3NA 2C5VA 4FODA 3VS6A 4BDBA 1MUOA 3ITZA 3ZEPA 4DITA 1H1QA 4FTLA 3R04A 4RQVA 3TCPA 1PMNA 4ACDA 3QKLA 4D1XA 2PUIA 3EZVA 4ZTMA 3WE4A 4PMTA 3IO7A 4MF1A 1A9UA 4I6QA 3UQGA 3VUMA 3COHA 4JBOA 2B9IA 3FXWA 1DM2A 4PY1A 5IZFA 4XYFA 3BLRA 4AOJA 5BYYA 2CKEA 4G34A 3NLBA 3FL5A 4GK3A 3T3VA 4XG9A 4BDEA 3E8EA 3REPA 3KMMA 2ITPA 3TKHA 5EOLA 3A7JA 1ZXEA 2OIDA 3MFTA 5F1ZA 5CY3A 3NWWA 3R22A 3OP5A 3LKMA 3MS9A 3SQQA 3MA3A 2IN6A 2BAKA 3HECA 3QQUA 2HZNA 5HLNA 4NW5A 4BZDA 2I1MA 4JS8A 3VRZA 2VX0A 1WVWA 2XKCA 2RL5A 3F7ZA 3C4EA 3UZPA 2X9EA 4FSTA 5ACKA 4PMMA 3OUNB 5KZ0A 5BVEA 3G0EA 3KEXA 2I0HA 3UVPA 1OKWA 4USDA 4DF3A 4DG2E 2P33A 3NMUF 4FEXA 4NU1A 5DR9A 4AFJA 3E8DA 4I23A 5EHYA 2GFSA 4C02A 4D2SA 2W9ZB 4A7CA 4WBBB 3RVGA 3ZSGA 1XBCA 3RNYA 5AX3A 2VTNA 4RBLA 2IVTA 4CV9A 4E8AA 2W1EA 3R7EA 3ZMMA 3PXQA 3BQRA 4QTDA 5HTBA 3CSVA 4ANMA 1YHSA 1A06A 2H6DA 3PY3A 3N4VA 3C4FA 4H1JA 4X6RA 4IM2A 4TN6A 3CIKA 3H3CA 3II5A 5DBXA 1OGUA 3TKIA 4E26A 3TJCA 2JFMA 3CJFA 3DKOA 1Q41A 4JVGA 1MRYA 3ZUUA 5A6OA 4B8LA 4F65A 5CEIA 4DCAA 4A9SA 3FXZA 1YOLA 2IZUA 4F1MA 2X2MA 4XBRA 1NY3A 2VTHA 3JY9A 4O1PA 4NTSA 4LI5A 2V0DA 3COKA 3GFEA 2Y7JA 1DI8A 2ZV8A 2VTTA 1OB3A 1BL6A 3QTWA 4I6BA 4IHPA 4YJOA 1XH5A 2I0VA 2Z7SA 1L8TA 5IQAA 3AD6A 1M14A 4KBAA 2YFXA 2J5FA 4XG8A 3QQFA 3EH9A 1K2PA 2AYPA 5AR5A 4WNOA 4CTCA 4L8MA 1VZOA 4CZYB 2VD5A 4TTHB 4DTBA 1YQJA 3BLQA 5E1EA 3BYUA 4JJRA 1PXNA 1F0QA 3QTZA 3EQBA 3FDNA 2EB2A 1YXUA 3EQDA 3VQUA 4AW5A 3AOXA 4PF4A 3FKOA 2F2CB 1R1WA 4S34A 2E9NA 5GZ9A 2VUWA 2UZVA 4U80A 3L9PA 3LFDA 4X2JA 4XBUA 4OTQA 4YTFA 2QG7A 4ZY6A 3SG8A 3Q9ZA 4ZJJA 1IAJA 4QYGA 2ZB0A 5JRQA 3QWKA 3UG1A 5BVNA 3GP0A 5KUPA 5E1SA 5DFPA 3RAWA 5DPVA 2BDWA 3C13A 2OFVA 4PPAA 5AP6A 3D94A 4FKGA 1K9AA 3V3VA 2IZSA 2RFNA 2WHBA 5AP7A 3TUBA 1WFCA 4O0VA 4NL0A 2XBJA 3LFAA 5KNJA 5DOSA 3NX8A 3BCEA 4FKPA 3QUDA 2BDJA 3A61A 4RFYA 3FKLA 5AP4A 4ZZNA 2B53A 3Q2MA 3WF5A 2ONLC 3I5ZA 2CLXA 5CEQA 5AV2A 2W1GA 3CBLA 5GNKA 4CG9A 2PVHA 5K0XA 4BZNA 4ENXA 4RVKA 2XRWA 3C7QA 4FV1A 4YC6A 3ROCA 1H07A 2ITYA 4U6RA 1S9JA 4D2PA 4AT5A 3OG7A 2R0UA 3V5TA 4PUZA 4F9BA 3OY3A 4BWXA 5CEKA 5L4QA 2ERKA 2YHVA 4H36A 1XO2B 3HLLA 4K1BA 5KHWA 3WZDA 3V8SA 3C50A 1T46A 4ZS4A 2JEDA 5JKGA 3HMIA 3WIGA 5ANOA 2JDSA 4QMPA 4N6ZA 2VTSA 5DEYA 2BMCA 4FSYA 3F61A 3CTHA 4ZMFA 3ORXA 2EXCX 4EOSA 2XIRA 2BRMA 2W1FA 3SXFA 3PVGA 2G2HA 4F9AA 4EQCA 4KSQA 5E92A 4DA5A 3CE3A 3MV5A 5B2KA 2X8IA 5CT0A 2R3NA 3OT3A 4FA2A 1ZARA 2XKDA 4JBVA 5G1XA 3UYTA 3E87A 3EFKA 3MY5A 4DGLC 5JGDA 1QL6A 3FYJX 5CLPA 3G51A 4YP8A 3VS7A 4C59A 4KS7A 3DFAA 1FVTA 4KINA 2WMVA 3FEGA 3BGPA 2Y4IB 3LQ3A 4WSQA 5IA3A 3BWJA 2CPKE 4CQGA 3GC0A 2UW4A 2W4OA 5C03A 2YJSA 3SKCA 2ITUA 3NW6A 5ANKA 4F09A 2BCJA 3OW3A 5DN3A 3TTJA 2F49A 1EH4A 3EN6A 4H3QA 4G16A 4D58A 3VS5A 3HMMA 4D28A 4QMLA 3R9DA 2IZRA 4FK6A 4X3FB 5C01A 4YJNA 1OPKA 5I5ZA 3KK8A 3FHIA 4DN5A 2BZKB 5EW3A 5IQDA 4C3FA 2OXXA 5FBNC 4E6CA 4NTTA 5IA2A 2CMWA 5HOAA 1ZMWA 3M1SA 3K5VA 4J99A 3TDWA 3OT8A 1HCKA 5HVYA 5CF6A 3BEAA 4LFIA 4TXCA 2QR7A 4F4PA 2GTMA 4NIFA 4FKUA 5E90A 4DFBA 2RFDA 3MVMA 2R3PA 3D9VA 3NUNA 4X21A 5CU4A 2P3GX 1WBSA 4Y46A 1H8FA 4CKIA 3O17A 4RA5A 3ZZWA 4MKCA 4P90A 5AAFA 4BN1A 1P4FA 2EXEA 3GCPA 3GUBA 3NCZA 3LFQA 3H9RA 4I5HA 4DCEA 3R2YA 3U4UA 3LAUA 2B55A 4MF0A 4M3QA 5AV0A 1KV1A 2W1HA 1CDKA 1BI8A 4ZLZA 2ZDTA 3NNXA
chains in the Genus database with same CATH superfamily
3QZIA 2CKPA 3E64A 2QLUA 4BIDA 1JBPE 2WTIA 4X3JA 4L00A 3PE2A 5FGKA 4CQEA 3NSZA 5FWKK 5CEPA 3GI3A 5LWMA 4EH4A 5TKDA 1IEPA 3GQLA 5J5SA 3G15A 5FXSA 3OD6X 2J0KA 4MHAA 5JT2A 3FC2A 4FL1A 2C6IA 2J0IA 5A6NA 3DGKA 3OY1A 3SRVB 4QQTA 1ST4A 4KBCA 3LFEA 4Q2AA 2X9FA 4IC8A 2EUFB 2XK9A 4ZSLA 1P4OA 4DEBA 4HYSA 5B2LA 2QO2A 5JFXA 1PJKA 3RK5A 3R63A 2QNJA 5D11A 5DR2A 3VW8A 3RAIA 4I0RA 3PXFA 3DZOA 3R7YA 4ORKA 2VRXA 2YDIA 5AWMA 4IFGA 4D1SA 4DBNA 2C6OA 1GZKA 3UNKA 4DT9A 4ZJIA 3F2RA 5LVMA 1PMVA 2WNTA 4JAIA 4F6UA 3VVHA 3R00A 2JAMA 4D9UA 1H0WA 2H34A 4AOIA 4EJ7A 3FLQA 4MX9A 2NYAA 3SG9A 5GZAA 5DI1A 2Z60A 4CGAA 3NUYA 4H3BA 4LGDA 4OTDA 4RVMA 4FZFB 2UW5A 3HAMA 3AKLA 1OVEA 3JVSA 4OW8A 3QRUA 3U6IA 3SGCA 3G90X 1SZMA 1UNHA 3E3BX 4YZDA 4GT5A 3VS3A 5D10A 3TNHA 3V51A 4UWYA 4OTHA 2X7GA 3PWDA 5L2TA 2CHLA 4ZEGA 3I7BA 1Q8UA 2RKUA 3VBXA 4E6AA 5LVPA 3MFUA 3GU6A 4L42A 4NH1A 5A9UA 2J4ZA 4YJQA 4U8ZA 3ID6C 2ZAZA 4AZFA 5AP1A 3PFYA 5DIAA 1Y91A 4YUQA 4WO5A 5LCKA 3RWQA 4R1VA 5D41A 4BDFA 2NNWB 1YOMA 2GS2A 2GHGA 2E2BA 4C4JA 5K5NA 5F9EA 4LYNA 3HYHA 3U55A 1YWRA 3I0OA 4X2NA 5HBHA 3IS5A 3UVRA 3MWUA 4TZRA 4D0WA 3PP1A 2ZMDA 1KOBA 4FI1A 2XNOA 3ULIA 2Q83A 4FIEA 3GC7A 3PYYA 2CGWA 2C30A 3MB7A 4UZDA 3AC2A 4XG4A 5A14A 1XQZA 2VO0A 3UOLA 5CEOA 3I5NA 2HZIA 1STCE 3IGOA 2HY0A 4RJ7A 2IJMA 5L6WL 3MN3A 5JMSA 3BHYA 3F3VA 4O6LA 4O2PA 4FNXA 1BI7A 2PTKA 4IM0A 1KE6A 1XKKA 4ZP5A 4QNYA 4AS0A 4O96A 4UMPA 3QTRA 4TYJA 4AZWA 3SA0A 3GVUA 4YJPA 3FZSA 1U59A 2GS6A 3W2CA 2X0GA 1YDRE 3GBZA 2OG8A 4I24A 4M69B 5L2SA 4FKWA 1XMMA 3ENMA 5IEXA 4MXZA 1H01A 4UMUA 1XR1A 1H1RA 3BGZA 1NVQA 1J1CA 1KE9A 4FSNA 4LRKA 1G5SA 3EQFA 4L3LA 4BDJA 4HVDA 5DWRA 4XLIA 3ERKA 2QC6A 5DRDA 1Z5MA 3E88A 4N6YA 2G1TA 4E20A 5C8KA 4G3FA 5HQ0A 4QMSA 4H05A 4O4CA 3BKBA 4J71A 1TQMA 1U54A 4RX7A 3WF8A 3U51A 2OLCA 4W4YA 3UDTA 3C4WA 4LGGA 5J7BA 4UY9A 1KUTA 4WT6A 4KKGA 4UYAA 5HIEA 4J97A 2PUPA 4WBOA 2IPXA 5AJQA 4O7TA 4D4RA 5EDPA 3HV4A 3F69A 3FKNA 1ZY4A 4R5YA 5K9IA 2XIKA 2C3KA 5HNGA 3KQ7A 5ETCA 5DG5A 3V5LA 2NRYA 2SRCA 3MGYA 3P86A 4O6EA 1WVYA 4KABA 4IQ6A 2YLFA 3PVBA 4JG7A 5F20A 5EM5A 2XEZA 4XMOA 3TV7A 3A60A 5AR7A 2GHMA 1GAGA 4EONA 4TYHB 4XV2A 5TF9A 3ZBXA 3ZO4A 2P55A 2WMUA 3IW5A 3MI9A 5CAUA 1U54B 4G6NA 2JDRA 4BCJA 2OZAB 5IPJA 3M42A 4CFXA 5AUYA 3M11A 5KBRA 4AN2A 3ZS5A 3UPZA 5KMKA 3IK3A 5LWNA 3PJ1A 2F7XE 2R2PA 3Q4ZA 1RQQA 1SNUA 4OAUC 1TVOA 4GYIA 3DLZA 4S32A 3D4QA 5AP5A 3W33A 4C4GA 2ETKA 2W17A 3FE3A 2UZTA 3EQCA 1PXIA 3PPZA 1M2PA 2HWOA 5H8EA 4K8AA 3RKBA 3VNTA 5AAGA 2B0QA 3OWJA 3KREA 3KIOC 1S9IA 1GIHA 4LL0A 4RJ5A 5EYMA 2PVYA 3NNUA 3QQGA 5CI7A 2GDOA 3UNZA 2YACA 3CY2A 5AP2A 3NR9A 2QLQA 3L1SA 4E4XA 4PWNA 2BALA 3GC8A 2G9XA 3NW7A 2BFYA 1CMKE 3GCSA 4YLKA 2H9VA 3CPCA 4GU9A 3ZXTA 3KB7A 4BICA 4MD8E 4G31A 3LXPA 3UOKA 5EW9A 4YSJA 2C6MA 3TMOA 4XV1A 1PY5A 3R8PA 1OL5A 3QHRA 5H3QA 3P1AA 1I44A 3NVKI 2ACXA 4MQ2A 4JAJA 4I4EA 3OBGA 4TNBA 3N4UA 1MP8A 4KB8A 4L7SA 5IMXA 4JQ7A 3BV2A 2W5HA 4EYMA 4AGDA 4AW0A 3E7OA 4RFZA 2C0TA 4I5MA 2R3MA 5HE0A 3SOCA 3P78A 3KULB 3GB2A 4G3GA 3WARA 3DAEA 3PJ2A 5HG9A 4HVIA 2PULA 4R3RA 4C3PA 4A9TA 4C4IA 3UIBA 3KXHA 4NM3A 4BF2A 2VO7A 5HCZA 5E8XA 4FGBA 2QKRA 4QP9A 4XS2A 2CGXA 3KU2A 4YHTA 1X8BA 1XHAA 5H9BA 2J0JA 3PXYA 4OTRA 4G6OA 2WQMA 2WTKC 4PDOA 2B7AA 2OIBA 4RA4A 2UZLA 4E93A 5LMKA 3CKXA 1ND4A 4K77A 3AKJA 3POZA 4BDGA 1JVPP 3IDPA 4FIIA 4I20A 4IFCA 4R78A 4KRCA 4FKQA 3F3TA 4YZBA 5A4LA 4AG8A 1XJDA 4O84A 4WUAA 2WFYA 5GIOE 3TUDA 3C5UA 3F6XA 4RIOA 5KO1A 3FMLA 1W8CA 4FTQA 3F66A 3S4QA 4Z55A 3KRXA 4BCMA 3UVQA 3H9OA 3OBJA 3ROYA 3KRJA 4ASXA 3PRFA 4I3ZA 4I93A 3KKVA 4GL9A 4JBPA 4TY1A 2YJRA 2W05A 2WB8A 5I9UA 3VF9A 4AACA 2I40A 4DTAA 4TYEA 5FXQA 4EZ3A 4DE4A 4WRSA 4ANOA 3CD3A 4DHIB 3LLAA 3EHAA 3Q4UA 4XP2A 4HNFA 4DC2A 3AT2A 1ZYDA 2GQGA 3CEKA 5CEMA 4QP8A 3NNWA 2WO6A 4FUYA 2WQOA 3BWFA 3I7CA 4S2ZA 4IZYA 4EH6A 4W4VA 4RC3A 3ZRLA 4LMUA 5E8WA 5AAEA 5CF5A 4CYJA 4NIFB 1RDQE 2UW7A 2J5EA 2UW9A 1Q4LA 3IW8A 4I6HA 4X2KA 3R28A 4MD9E 5ETFA 5LVLA 3GU7A 3H30A 2XBAA 3QTXA 4IWQA 1APME 4IDTA 4AAAA 3ET7A 3ZDIA 4NM0A 4CLIA 3LE6A 4PDPA 4A4XA 3ZYAA 4X3FA 5I9VA 4QMVA 3QC9A 4ACHA 2WMWA 4BKYA 4JL9A 1VJYA 4JXFA 2E9VA 4W8EA 4JLCA 4QP3A 5HI2A 4CT1A 3VAPA 5DLSA 4F08A 3UZRA 3WOWA 2W0JA 5KKRC 2OGVA 2WMAA 5BYLA 4YPDA 3DFCB 3GOKA 3H4JA 3KY2A 4EZ5A 4BDAA 5CSXA 4F0FA 4PRJA 2JAVA 3COIA 4DBXA 3QZHA 4GVJA 2J9MA 2OJGA 1H24A 4MK0A 5CSHA 3AQVA 2WU6A 3O7LB 5EDQA 4MYGA 5AR8A 1OPLA 3HV7A 4Y85A 3VHKA 4HYIA 2BRNA 4W9WA 3R01A 3BLAA 4WG3A 2VWIA 4YZNA 3IQ7A 3BE2A 3LQ5A 1FOTA 4M12A 4TWCA 4FV5A 5JGAA 3DT1A 3R7OA 3B2WA 4FG9A 3VUKA 5CI6A 3OCGA 3PSCA 3QXPA 4C8BA 3JR1A 1VEBA 4FZ7A 5LCJA 4DGMA 4BCOA 5CF4A 3QD0A 5ANDA 3PLAE 2YA9A 4O7SA 1AGWA 2DQ7X 3UPXA 4FKLA 1IRKA 4QMXA 2OF2A 5DNRA 5M4UA 4PL4A 4NJDA 4S31A 4GK2A 3P5JC 1Q3DA 3VULA 4DFZE 3AMYA 2UV2A 3MY0A 1Z9XA 3HMNA 3AMAA 4QP7A 3PDTA 1ZYCA 4HPUE 3VS1A 4BKZA 3QYWA 4G2FA 5AMNA 5E8SA 3TIZA 2J0MB 3TDVA 4FNYA 1G8JA 3LCSA 2OJ9A 1SNXA 5HE3A 4U42A 3V5QA 3U87A 3ATSA 2HXQA 4GG5A 3R02A 3HKOA 4FT9A 5EOBA 2QO9A 2YCFA 3R8LA 4C38A 1WVXA 2XAMA 1ZY5A 2PMNX 3EYHA 3F88A 5DT3A 1U4DA 2X4FA 3MY1A 5FEEA 4FEQA 4CFWA 3L9LA 1H1WA 2DWBA 4DLJA 4ARKA 2AC3A 4I92A 3QA0A 5KMMA 4BCKA 5GZ8A 3DKGA 4I21A 4UXQA 4L53A 4U5JA 4ANQA 4E5AX 3FJQE 2HOGA 3F5UA 3PFQA 1TZDA 3PY0A 4FC0A 5AX9A 4ACMA 3MH1A 2Z8CA 3NUUA 2WTKB 5IQHA 2R3FA 2WMXA 5D12A 1E1XA 4D9TA 4B9DA 2C5XA 4EBVA 3R73A 4YTIA 2XARA 5T3QA 1M52A 3QTSA 4C7TA 2Z7RA 4OTPA 4RIYB 3PXZA 4DEIA 3VBWA 3U9NA 4IZ7A 2IZTA 5T68A 4IC7A 4KA3A 4MWHA 1TQPA 1ZYLA 2Z2WA 5CAVA 4RIYA 4PPBA 5CU2A 5FP5A 5E8TA 4KBKA 5J9LA 3FLNC 3MVLA 2W1CA 4MWIA 3KCKA 2VNWA 4MBJA 4O0SA 3VO3A 1BUHA 3OWKA 4J8MA 4YHJA 3PG3A 5LQFA 5BMSA 3WZJA 2FSOX 2W5AA 4ID7A 5F4NA 4AAYA 3TNPC 2W7XA 3QXOA 4C3RA 4EH7A 3R71A 1Q97A 2BAQA 2J2IB 3PPKA 4U7ZA 3RPVA 4O1OA 3A2CA 3SC1A 5CAQA 3V5WA 3OTVA 4XP0A 5D7AA 4TT7A 4UMRA 5DH3A 3I79A 3QWJA 4AZVA 1U5QA 4B99A 3BGQA 3BPRA 3PG1A 4PNIA 3QALE 5CTPA 2XB7A 5L2IA 1XH7A 2UZWE 3FL4A 2UW3A 4IVCA 5C8NA 2VTOA 1PKGA 2HAKA 4XCUA 3BYMA 4X7QA 2XKFA 2JD5A 4MNEA 5AUXA 4IB5A 4IXPA 4ZTHA 2JITA 2YM5A 4KAOA 1J91A 2X0QA 4RVTA 4YNOA 2PVMA 4EHZA 4QMZA 5A4EA 5AV4A 4FTIA 5LARA 1Q5KA 3OW4A 3H0ZA 2QQ7A 2HWPA 4FOCA 5D7VA 2BAJA 2CCHA 4O0UA 2VTMA 4DFXE 4CCBA 2YITA 4BBEA 3PA3A 4EYJA 5I9YA 4AXAA 4FKOA 4II5A 4J8NA 5CWZA 3ZSIA 3FLZA 3ORLA 3QF9A 4S33A 4DFNA 4JRNA 2CJMA 3RP9A 3UG2A 2QHNA 1JLUE 1XH4A 3AG9A 5BVDA 2GNLA 4MTAA 4RZVA 3ORMA 3RMFA 1OIRA 2EB3A 3P7CA 4FV7A 2G2FA 2C1BA 2JIIA 4EQUA 3QQJA 2F9GA 4HNIA 5AV3A 3FY2A 1UV5A 3OHTA 3Q60A 3K3IA 3P7AA 3NYOA 4XOZA 2W9FB 4NSTA 4AXCA 3LXKA 5L2QA 2JKKA 2XNBA 4GJ3A 4JNWA 2OO8X 3OZ6A 1W7HA 3CPBA 3Q6UA 4AE9A 4XG6A 3BELA 5IG1A 1G8AA 2W4KA 3TV4A 2XP2A 1Y6BA 3I6UA 3DXNA 2R3RA 3PP0A 5EW8A 4B7TA 4MCVA 5AA8A 5HX8A 1Y57A 2PSQA 4GG7A 2ZM3A 4PP7A 4JRVA 3ENHA 3C51A 2BILB 4PL5A 2XCHA 5HGIA 4AW2A 1YVJA 5IISA 3DK6A 2X8DA 1CSNA 3NUSA 2J51A 2PU8A 3RI1A 2PVJA 3BEGA 5AIRA 2P2IA 3UO6A 2JKMA 3RPOA 3QRJA 2J6MA 3V8TA 3ANRA 1FQ1B 3Q9YA 4M14A 3U54A 2I0YA 2BTRA 3UGCA 5BV3A 3IGGA 1H4LA 2R4BA 4U97A 2F7EE 5AUVA 4E3CA 5HG8A 5T6KA 3GU8A 4YGAA 4CFNA 2PWLA 4QYYA 3BI6A 3DDPA 3EFJA 4M84A 5A54A 3TJDA 4BI2A 3ML1A 1Q61A 3G9LX 1O6YA 2WMBA 1LEWA 2XCKA 3KMUA 4F9WA 4AX8A 4M7IA 3W0PA 3C1XA 4NFNA 5HD7A 5E8YA 2JGZA 3GENA 1T45A 4YJUA 1CKIA 1OL2A 1UNGA 2GNHA 3VS4A 3ZLYA 5GIPE 2QOLA 4QYHA 1J1BA 2I6LA 4ANNA 3R7IA 2OZAA 4WOVA 1OL7A 2ITTA 3MJ1A 4YNEA 5DHJA 3UIUA 5IDPA 2LGCA 2VZ6A 3A4PA 2GQRA 1OKVA 4RMZA 3B8RA 1DS5A 3LMIA 5IEVA 2ZJWA 1M2RA 1O9UA 5FD2A 5K4JA 4OTGA 2BROA 4DDIA 1R0PA 5CQUA 3BU6A 4YLLA 4O83A 4QMWA 1ERKA 3QTIA 5I9ZA 4BBMA 4QP2A 2C5OA 5EI8A 4NWMA 3W0MA 2PE0A 2W96B 4QYEA 3QLFA 2UW6A 4DGOA 4MXAA 1YDSE 2PMIA 5M51A 2ITXA 2VTQA 5CENA 1JSTA 3TN8A 2OI4X 2R3IA 2XH5A 4CNHA 2C69A 2W4JA 4EOPA 3R9HA 4PDYA 2QKWB 3R30A 4WG5A 1BX6A 1R39A 3F82A 3NIZA 1UU3A 4AZSA 4CZUA 3NYXA 3DTCA 3NFFB 2XYNA 2JKOA 3UZTA 4WUNA 4FOBA 1GIJA 2VX3A 4X0MA 4CMOA 4RFMA 4YLJA 3R8ZA 4GCJA 1WBWA 3VN9A 3G9NA 4IJ9A 1OKZA 1PXJA 3SXSA 1UA2A 1YXXA 2AUHA 2X2KA 1QPEA 3OOGA 4FSZA 5AR2A 3MYGA 1QPCA 1URCA 3FWQA 2PZIA 4NKSA 5M57A 1OZ1A 1PXKA 2KULA 4EH5A 3BL9A 3ACJA 3P79A 2WIHA 4JX7A 1FBNA 3WF7A 5IQCA 4O0YA 3FQEA 5I9WA 3PXRA 4I4FA 4XG2A 4I22A 3VBYA 5I4NA 3KCFA 2X6DA 4MXXA 3FMKA 2FUMA 3NAXA 1H26A 3FQHA 3CQUA 3FBVA 3KRLA 1ZRZA 4EOQA 3O8TA 5CSPA 3R1NA 4LL5A 4CFVA 3BU5A 3NFGB 1Q8ZA 5EHOA 5JGBA 1OMWA 3R7VA 4KIOA 5JZJA 3W2OA 2FGIA 2JFLA 2ETMA 2OFUA 4H3PA 4G9CA 3PSDA 1PXOA 4FIGA 3ORNA 4IAZA 2XIZA 4W4XA 4HVSA 4NW6A 3MSSA 4A9YA 4EJNA 4K33A 4HYHA 1IAHA 3L8SA 4IJPA 3DXQA 4AN3A 4HGLA 3HVCA 3JXWA 3DDQA 1NA7A 2NO3A 3TACA 4HOKA 4AGUA 4TWOA 3LM5A 5HD4A 5IUHA 3TYKA 1YWVA 4AZEA 4HYUA 4G3CA 4D4SA 2BIYA 1NW1A 4EQMA 1ZWSA 3HRBA 1M7NA 2W5BA 2X7FA 5DT4A 2GU8A 3UYSA 5BVOA 3W8LA 2WEVA 4FG7A 4XG3A 3F7WA 4ZTNA 1BKXA 4QTCA 4AA0A 2XUUA 4R77A 2HELA 3FXXA 5DGZA 2WGJA 4KKHA 4YPSA 5JN2A 4OAVB 3BE9A 4DFLA 2YM3A 3HEGA 4BI0A 2R3JA 4HGTA 2VNYA 4QQ5A 2AC5A 4GRBA 4FRFA 4MAOA 4W9XA 4APPA 4L43A 5KCVA 3UOJA 5M06A 1OBDA 2YLEA 4RJ6A 3EFWA 2OF4A 4W4WA 3NAYA 3WILA 4L9IA 3LFSA 5BX0A 4QYFA 5EQPA 1M17A 5E8ZA 4HPTE 4FT0A 4XH6A 4Y8DA 3EN7A 4S30A 4WKQA 2OK1A 4FV4A 3D5VA 1DAWA 3BHHA 1GY3A 1BYGA 4IX6A 4O38A 1ZMVA 2HYYA 4LRJA 3RAKA 1VYZA 4FTCA 3BHUA 3L8PA 4E1ZA 3Q53A 1SVGA 4UV0A 3EL8A 3FPQA 3MW1A 2FA2A 2WQNA 1KSWA 4GV1A 3MFRA 2R3QA 4WNMA 5CNNA 1NVSA 3D2KA 4I1ZA 4DG3E 5A4QA 2Y8OA 5CQWA 3CLYA 3ZLWA 2CNVA 2PZRA 3PY1A 5A4CA 4WNPA 4IX3A 4MNFA 4NZWB 3ZO3A 1WBNA 2JBOA 4BWPA 5KX8A 4ZLYA 4A07A 3HA8A 5JK3A 1K3AA 4QQJA 4FG8A 2OSCA 1QPJA 4M15A 4M0YA 3SAYA 4FV6A 3KVWA 4BHZA 1W84A 5CAPA 3TTIA 2DYLA 5KZIA 2X6EA 3EQIA 4ZSAA 1MQ4A 5HVJA 4EUTA 5EI6A 3KVXA 2CCIA 4FV9A 3VBQA 3LPBA 3AC5A 5CVGA 4YC3A 4RWIA 5FQDC 5ICPA 2XAOA 2UZEA 3NUAA 4F70A 3CR0A 4RC2A 3A7IA 4OBOA 2XF0A 2ONLA 4Z9LA 3W0QA 4FKJA 5A3XA 3P9JA 1XH8A 5IA1A 3DOGA 4GKHA 3HRCA 1Q8WA 3ZOSA 3UP2A 3DBFA 4A4OA 1UU9A 1UKIA 1E1VA 2PYWA 4IB3A 4GEOA 2Z02A 3WZKA 3DPKA 5I3RA 1WMKA 4FL2A 3IPHA 3QZFA 3RZBA 1SYKA 4A9UA 4FUXA 2VTJA 3GCQA 4BHNA 2QD9A 2WKMA 3A7GA 4NYEA 2XNNA 4BCFA 1YI3A 3QLGA 2BIKB 1R0EA 3A62A 3BL7A 4CXAA 1GJOA 4NT4A 5A46A 4PTEA 2R7BA 4YO4A 4C37A 2UVXA 1H00A 1YOJA 4ITHA 2A98A 4U9AA 5FTQA 1YXVA 2X7OA 2IF8A 3C4CA 3RHKA 4AQKA 1UVRA 2YDJA 4C35A 4E4NA 3G33A 4AP7A 3LCDA 2GFCA 1JSUA 2PHKA 4QPSA 5FM3A 2G15A 2YEXA 3E8CA 4GUEA 2ZOQA 3V6SA 5M44A 3PJ8A 3RPSA 5LOHA 2YERA 5IUIA 3C4ZA 3MPTA 3HUBA 4E5WA 4EOIA 1YI6A 3LXNA 5GHVA 1W0XC 5TE0A 3PIYA 4C4EA 4LOQA 4KKEA 5HICA 1GZOA 4FSMA 3C4XA 1W2DA 3D7TB 3QCQA 3LMHA 4I5PA 5CVHA 4BDKA 2C3JA 5KHXA 2YN8A 1CKPA 2EVAA 4EK8A 1W2CA 3FZ1A 4LUDA 4V01A 4P5QA 2IW9A 1J7LA 4IMYA 4QMOA 4NKAA 4O7VA 5H8GA 4F1OA 5ANGA 2XKEA 1YKRA 2B4SB 3C0HA 4YJRA 4EWQA 3E92A 5AUZA 2YM4A 4IANA 4KIQA 4Z3VA 5J1WA 3UTOA 4GH2A 4PQNA 5LJJA 5CU3A 2QU6A 2A27A 2QR8A 4QMNA 3DJ6A 1Y8GA 3V01A 3KXMA 4L67A 4ZLOA 1JPAA 4GU6A 1IR3A 4JBQA 5BYZA 3FZOA 2ZV7A 4AW1A 2ITQA 3CXWA 3FMMA 3DQXA 3LVPA 4PP9A 3RWPA 4D5KA 2A4LA 5L2WA 2UZNA 3VUHA 3F9NA 4ZTRA 3R9OA 2IVUA 2VGOA 3FLYA 4FX3A 4JG6A 4Y72A 1CM8A 4O0XA 5KMOA 3N4TA 3DJ7A 3MB6A 1J3HA 2WTVA 4FT3A 5IQGA 1ZOGA 3AGMA 4FIHA 3WBLA 4AT3A 4DAWA 3PZEA 4AT4A 2OICA 3PUPA 2XM8A 4MD7E 2GNIA 4QPAA 3RAHA 5ACBC 2RF9A 3MDYA 3V5PA 1YDTE 4M97A 4QP1A 5K3YA 4ACCA 4BIBA 1NT2A 5C4LA 4DH1A 3SW4A 4XLVA 4U3ZA 5IUGA 3ALNA 3ANQA 1I09A 4IBMA 3I1AA 4OBPA 4BTJA 3MTLA 5BNJA 3MH2A 2R3HA 2B9HA 2IW8A 3OCSA 5IH6A 1A48A 4RJ8A 4RWKA 3Q6WA 2VWXA 3U9CA 4YURA 4BR3A 2PE2A 1B38A 1Y6AA 4GIHA 2VWVA 1UWJA 2C0OA 2YCRA 5AIKA 5C8MA 4F6SA 3GCVA 3OOMA 3I4BA 1NVRA 4FTRA 2XJ1A 3TUCA 3A99A 4XV3A 4YHFA 3HV5A 2OIQA 5FBOA 3HX4A 3HV3A 3VIDA 3CCNA 4FICA 2PZ5A 3HP2A 3AC4A 3KXGA 3UMXA 4BBFA 4F9CA 2G01A 4J95A 3MVJA 4B8MA 4Y5QA 5M4FA 5C4KA 5EQEA 1VYWA 4G3EA 2FH9A 3TWJA 4WSYA 3PPJA 3KXNA 3TNIA 3HUCA 2FSMX 4MBLA 3Q5IA 1OUKA 2V5QA 3NW5A 4BYJA 1JOWB 1YXSA 3D15A 3E5AA 3E62A 4CMUA 4ASZA 4CRLA 2I7QA 2BR1A 3FI2A 5L6PA 3F3WA 1KWPA 4HGSA 4O4FA 3WZEA 4DHZA 2QI8A 3R9NA 3ZCLA 5HG5A 4A4LA 5F94A 4D5HA 4PMPA 5IA0A 5DEWA 5AR4A 3O0GA 5F95A 4MNEB 3QAME 2C3LA 3QTQA 4XRLA 4IAYA 4DH3A 4FKTA 5FG8A 5LMKC 2R3LA 5IQIA 4IACA 4F7LA 1V0PA 3CC6A 2HENA 3JYAA 2C6LA 3F5XA 1DAYA 5JQ8A 4QQCA 1O6KA 2PVFA 4L3JA 3RGFA 5AA9A 4HGEA 3GGFA 1PYXA 4F6WA 1TFFA 4I94A 3DK7A 2UVZA 2WELA 5EHLA 4H1MA 4JQ8A 1ZZ2A 2O64A 4XP3A 4QMUA 2WD1A 1JWHA 3UMWA 3LCOA 5H2UA 4CD0A 5G6VA 4PNKA 4K11A 4RZWA 5IU2A 3HDMA 3UIXA 2ETRA 2XNPA 4J96A 3ZO2A 4BJJB 4O7RA 4HCVA 1OL6A 5AP0A 1R78A 1SVHA 3C9WA 3CQWA 5B2MA 2YIYA 3NPCA 3TI1A 4QMQA 3ATTA 3GEQA 3QBNA 4OGRA 3V6RA 5FEQA 3IW7A 4U79A 1Q8YA 4IX5A 5KMLA 1W98A 5C27A 4E7WA 5IF1A 5GJGA 3JVRA 1AD5A 4R3PA 4DFUA 3DNEA 4WNKA 3ZUVA 4K9YA 4Z7HA 1ZOHA 3CTQA 4MXOA 3UIMA 4YBKA 2BKKA 3SW7A 3ZFXA 4UMQA 5M4IA 2XZSA 4A06A 2O2UA 4G9RA 4QDEA 2PVKA 2A19B 3UC3A 2XK7A 4KUJA 1V1KA 4FSUA 5JEBA 5IQEA 2DS1A 4ITJA 5CANA 5GJDA 2WOTA 2HW7A 4KIKB 3SHEA 2R3OA 4X3FC 3HMPA 3R1QA 4KNBA 3PIZA 5AP3A 2GNJA 3DA6A 3BYVA 3FC1X 3FZRA 3ODZX 5I9XA 1V0OA 1QCFA 3R8VA 3Q4TA 3Q9XA 2VN9A 4NCTA 4ZJVA 4U40A 3AKKA 5CVFA 4FZ6A 3F5PA 3THBA 2X39A 3O23A 2Y4IC 3V8WA 4BCQA 4FV2A 5GJFA 2H8HA 3OWLA 1KE8A 2BHEA 2Z7QA 4YZMA 3EQPA 3U6JA 4BDDA 4U81A 5C26A 4O81A 2ESMA 5HBJA 1WBVA 4C58A 4QPMA 4Y83A 4BWKA 3PVWA 2X2LA 4IE9A 3W2QA 3ZXZA 3Q3BA 4BDCA 1TQIA 4U3YA 3DNDA 4QD6A 2HXLA 5IEYA 3EKNA 3TM0A 5HNBA 3RCJA 2XYUA 2XJ0A 4FVRA 4L68A 4NM5A 4JIKA 3VUGA 3NZ0A 3W32A 2UZBA 2O3PA 4GKIA 2YCQA 4J98A 2EWAA 2V22A 4R6VA 1RW8A 2YIRA 4CRSA 3SV0A 4D4YA 2Y6MA 3S2PA 4AF3A 3Q5ZA 5IH4A 4D1ZA 2PZYA 3O51A 4YJSA 4RIXB 3SX9A 1AQ1A 2CKOA 3H10A 3GC9A 2IVSA 1MRUA 1W82A 4TKSA 4EK3A 2CNQA 3KRWA 2CDZA 4QEBA 3R8MA 4XV9A 4RRVA 5IQFA 1LR4A 3GU5A 4HJOA 1WAKA 3FI4A 1YRPA 3R1YA 3NRMA 4I41A 3VRYA 2F57A 3ZFYA 2X8EA 1XWSA 3EFLA 5HHWA 4R7HA 5L6OA 3I60A 4QOXA 3IECA 4R1YA 5BUJA 5DT0A 2OW3A 3LXLA 3MIAA 3NYVA 4XUFA 1F5QA 3F2AA 4F7NA</