4YHZH

Crystal structure of 304m3-b fab in complex with h3k4me3 peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
219
Chain Sequence
EVQLVETGGGVVQPGRSLRLSCTASGFTFRDYWMSWVRQAPGKGLEWVADIHQDGQVRYYLDAVKGRFTISRDNAKSSLYLQMNSLGAEDTAVYYCARNFVRGFGWHFDLWGRGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antigen clasping by two antigen-binding sites of an exceptionally specific antibody for histone methylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab Heavy Chain
total genus 48
structure length 219
sequence length 223
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhzH01
3RVTC 3IU4L 5E1AA 1CICA 4C56D 4R0LA 4QCIB 1KT2B 5TDNA 4Y16D 3WFDH 4YO0A 2PR4L 3F7YA 3HNVH 2ZSWA 3IDIA 4NQED 5I1EL 3G5YB 1ZHLA 4M6NH 3TP4A 3C60A 1IGMH 1WTLA 1XCTB 5IB4B 2DYPB 1YMHA 3QDHA 3QFDB 3RKDD 5C0GA 2AABL 3SGJC 5EO1A 1I3UA 3MXWH 5JORA 4FQQB 2UWEF 5JPMB 4WI5A 1CBVL 1MJUH 1H5BC 1IKNC 3DUUA 4CDHA 3CFEB 1X4ZA 1A7RH 4XMLL 3VFSA 1G7JB 4DFHA 3QUML 1KGCE 1RHHA 3IETB 4Q58C 4HIHA 3M07A 2X4QA 3JBG7 1KYOJ 4WJ5B 4WTXA 3ZKSD 5DK2A 4DVBA 4AEEA 1YYML 2R15A 4R0LC 3D85D 1MLCB 2Y06H 4OGXL 1BF2A 3TFKC 2E6PA 4YQXH 5GZNC 4RMWA 1I85A 4YDLC 2YBRA 3W9EA 2V7HA 2OM5A 1WGOA 5HY9A 1A3RL 3UX9B 5F9WB 3I6KB 4KTYA 3PL6A 2AEQL 4XNMB 5DURB 4JFQB 3IXAB 3EOTH 3CFCH 5D2LB 4OLYH 5ICXB 4TRPL 5C1MB 1H15B 5DD1H 2P24B 4NM8L 4JZNB 3WD5L 1MFCL 3CDCA 1CVSC 3ARTA 3OPZL 5DO2C 5EZOH 1IKNA 3IXTA 4YHPA 1H3UA 1D6VL 2NY4B 1NMAL 1WBXB 3VD4A 3KPMA 3RZWA 3G6JF 1TQBB 1CFQA 3U7AA 1X5HA 5AD0A 2JB5L 1SJEA 1WUNT 4FQIL 4PGEA 5D1XD 4JRYD 3SDDD 2VQ1B 4GAJH 1BJ8A 1U3HA 4HEME 4Y4HC 2X89A 3TYGH 5CBAA 3HG1B 5LJYH 4FXKB 2NXZB 4LPUA 3PP4H 5E56A 1J18A 4M93B 3MJGX 4P49A 4DKDC 1ITCA 4YWGL 4QRRB 4Y19B 1NMCB 1YEGL 2Z92B 4ZOEA 2ZUXA 3OB0H 3BPOC 1G6RL 4PRNB 1T21A 1IAOB 1Q94B 2AV1B 3FB7A 5DTFB 1FGVH 4IOIB 2MHAA 1CGSH 4FP8L 5T5NG 1BEYL 1NBVH 3CIQA 4G80A 1AO7D 5AWNH 4Z7NF 2WUCH 2EH8H 4LIQL 4KJQD 3TCLA 1YEJL 4XNUL 1NBZB 3RGVC 5GZOC 2H8PB 3DV4B 3B8YA 4FG6C 3RWIB 1MAKA 3GSOB 4P2QB 1KB9J 3MLTB 2GFBA 3QZWA 1SM3H 4YR6A 3S37H 4IRJA 3RX8A 3A67H 2GYSA 5D6DA 3MOQA 5FCSH 4XNUH 3RBSA 3TBYB 5L2KE 1ORSA 5LXGL 2ICCA 4PFEA 5GRYA 2X4OA 4R2GC 4H8WH 4RFOL 2VRAA 1BFSA 2HJFA 4JO2H 1UKQA 1HQRA 4NBXB 5LQBH 3LS4L 1I9RH 2ZUWA 3E8UL 3VRIB 4KVCH 3QIUB 4Y5VC 1WVZA 1C8PA 4HUKB 2COQA 2UWEA 3QDME 1S5HA 1TZIA 3LKRB 4NGHH 3C5ZA 4JRYA 3SDDA 3U2SB 4Z77A 1UB5A 3EYOA 3BT2L 4C83B 4AL8L 4JQVA 3O9WD 3NCYP 3D0LA 2FLRT 1F3DH 2X4SB 5EULV 2Q3ZA 4A6YA 3MV9D 1IFHL 3CLEH 5DJYB 3VFMA 2CGRL 2VAAA 4QXUH 3MBXH 3QT2A 1WF5A 4U1KB 1IEAA 4WW2F 2FZ3A 2NY0C 2IJ0C 1BAFH 3DI3B 2JJSC 1A1OB 1XH3A 5IBLC 4P9HC 3JWDH 4RZCA 5HBBA 2NTSP 3BHBA 3P0YL 4G43B 1ADQH 1ZSDA 2J8HA 2QADB 3BI9X 1JHLH 4EQ3A 5JXED 1AY1L 2X4UB 4BKLB 3UO1L 2WV3A 3F62A 4R4FH 2CIKB 2YOCA 4E5XB 5IFHL 1L9NA 1JNHA 3DTXA 3CD4A 3DWTA 4QTIH 3IFLL 3X14A 1OOAA 2DQEH 3MLRL 4NZTL 4ZFOL 1H0DB 4XBPA 1S9KC 4PLJC 5AUMA 3EOYG 2Y4SA 2EIZB 4R96B 4OFKA 3BWAB 4IJ3C 5HI3D 4AH2B 4WFGE 1NAKL 4WFHD 3O2VH 5C0CE 3FRUB 1JZ2A 2Q6WA 3FT2B 1FDLH 3EFDL 1N5YL 4KJPD 4JDVA 1OAQL 3PP3H 1KEMH 2YPLE 1CYGA 2YN3A 4DUWA 3IJYA 2P5ED 1JL8A 3TYFB 3T2NH 3ULVD 4QHLA 3TBSA 1A6AB 3O11B 5HJ3A 2Y72A 3LRSA 5HHME 1KT2A 3QIWB 4HXAH 1X4YA 4P4KA 2V2TB 4FNLH 3N1MC 4YLQT 2AABH 1RIUH 1EH9A 1ZGLB 3OKDA 5INCA 3GJFA 5CWSA 5TDOA 1CE1L 3MRKA 3MLRH 4XP4L 3B3IB 3MA7A 4PD4K 4NO0A 3SGKA 4R7NB 1GOGA 2ARWA 3QWOB 3SEPA 4LSRH 3QR2A 3BUYA 4OLYL 4HV8A 1CQKA 2CO7B 2ICWI 3UZQA 3TJEH 1IARB 2C4FU 4OZGB 3C87A 2YD8A 5EZLA 4AYFA 5K9KA 1CGYA 4XWGL 1PQZA 3TBWB 4QRPE 4G42A 4M7LL 3X17A 3FL7A 3VI3F 2N7AA 4RWYH 3T2NL 1NC2A 1FFQA 2J4WL 2AI0H 3DI2B 1KTKE 3GRWH 3C6SA 2MFNA 3DO3A 3QI9C 5KW9L 4PB9L 5I73B 2A6IB 4YXLL 3QO1B 4YWGH 3H3KA 3P40A 1OAXH 2VABB 4NNYB 1I1YB 4PY8I 2PCPA 5FOJA 2BVUA 5ITBL 1OTTC 1BHGA 2QHLA 3V0WL 2XZAL 4H20H 4OF7A 4G8IB 5KSVB 3U9PH 1IBGL 3EFFB 3C6LD 3ECBB 4LKCA 1U8OB 4X4YA 3GFUA 3D5OF 4LCCB 4WO4D 4EQ2A 5CCKH 1CD9B 1T89C 4LLWA 1VESA 3QHFH 5IMKB 2LV4A 5JZ7D 1PEZA 4E42B 4YAQA 1QFWL 1SJEB 1XGUA 4F7PA 1SHMA 5K9JL 3K4AA 1JMZA 1FP5A 1T0MA 2JLLA 3MREA 1MHPL 3WUZA 3CK0L 1YECL 2BC4A 5C7XH 3RJQB 1NAMB 4I77H 3MV8A 1SJXA 2CR6A 3QA3B 4K94C 3RVTD 2DIBA 1JGUL 1QR4A 2ZUQB 1I7RA 1HDMB 2H32B 1Z9OA 5H35A 5D2LF 5HVFB 2BCKA 4KKLC 4BYHA 2BDNL 3OKEA 1DCLA 2R39A 5HYIA 1JGUH 3WJJC 2X6MA 3BQUB 3FO2B 2DM3A 4P46C 4KWUA 1UM5L 3J7HA 1EJOL 4X5LA 4WNQA 2DWDA 1ONQB 5I9QB 1NGWA 5FGRA 5D8JL 4XAKD 3DV6B 2YD1A 1HI6A 5B39G 5CFHA 3DURA 4X5WA 1VFOA 3CPLA 5B8CA 5GIRA 3A6BL 3ELAT 4P5TB 2HT4D 3ZSTA 4ISVB 1ZANL 3EW3B 5DGRA 3HMXL 4PJAB 1FC1A 3DLQR 1I7ZB 4K3EL 2VXSH 3U0WH 2X4PB 4PJGA 3PWPA 4Z7WE 4FQXD 4X99A 1S7XA 4V2BA 3LEVH 3QIUA 5IW1A 3NCBB 2IQ9L 4MD0A 5JHDE 1R3KB 5I1EH 2V9TA 1OCWL 3V4PH 1PBYA 1FZOA 1WWBX 4LP4A 3QDJA 2KUTA 4BZ2L 3IFPA 1ADQA 2ZKHH 4JFZL 3M1BB 1Q8MA 2H3NB 4LSTL 3LV3A 5D70L 5IROA 2DBLH 2XKSA 5HHVH 5I6XC 2VWEE 2ERJC 1CGVA 1PZ5A 5DVNA 2VB5A 4OSUL 2J8UE 4X7FC 4JFZH 4GRLB 5F8RC 3QDJE 4QRRE 5HSFA 2O5YL 3E2HB 4HIXH 1NC2D 4S1DD 4P23A 5KVFH 3IDMB 5J6GB 4PJ8B 2NZIA 4F58L 4RX4D 3N0PB 3PABB 5ICXA 3RL1B 2ICWJ 1BOGA 4KMTL 4L4TE 5DD5H 2CIKA 1QLRA 1BVZA 4KTDL 5C0AE 5F6IC 1GL4B 2GT9A 3MJ9A 1C08A 4WIQA 5MEOB 4YNYB 4Y4HD 4TYUA 3I6GA 2MTPA 4TOYH 1A3QA 4ZOCA 1FL5A 1T4KB 3CCHB 2BMKA 2QKIB 2EO9A 3V95A 1CDHA 1C5BL 4U1JB 3FN3A 3GB7A 4U7KA 3TIEB 5F7YC 5BVPL 3B2VH 3BH9B 1OAQH 1T04A 5KW9H 3WN5A 3ZT5A 1CFVH 3VFVA 3CX2A 3FQXB 4XI5C 2DKMA 4DWHA 1HN1A 4FN0A 1HHIA 4OZIB 1HSAA 2JB6A 1S9XA 1AHWA 3EGSA 4HG4J 3KPLB 4NQDD 3PWLA 2R2BA 4GS7C 4APQA 5J3HC 1C5CH 1KN2L 2AV1A 3FB7B 4ZTOL 4F80A 3ZYOA 5F89B 5SWZB 3BPLC 4LCYB 4XWGH 4FZ8H 1W0YT 1VACA 2X2YA 5F9OL 1H8SA 5CWSB 1RK0A 4E41E 4X6DE 4Z0BL 4PRAB 2F54B 4PGDB 3MLTA 5IMOA 3OR6A 4MXQD 3OR7A 2HTLC 3G5XB 1FBIH 3GMOA 32C2B 4M1DH 3LIZH 1SY6A 3ILQC 4PRDB 4XPGH 3AB0C 1Y18B 1LO5A 2GHWB 1EERB 1W72B 3SE9L 4QHMA 3LKSA 4JRXD 1YY9C 3AM8C 3VXNA 2DQFB 5BJTA 2X7LA 3BGAA 5I1LB 2DS4A 1J7VR 5DMKB 3G6DH 5H37H 4A6YB 4XNXL 4K9EC 2B1HL 2FL5A 1M05A 5K9JH 2BNRD 3QO1A 2W59A 2FJHA 4N9GB 4D94A 4Z18A 3L3JA 3P4LA 3U7WL 3NABH 4JQVC 4FZEH 5FYKL 4NZUL 4TNWK 1MQKL 4G8IA 4JDTL 3VXUD 2ARJB 2APXA 1C7SA 2DB8A 4X4YB 4LIQE 4PJCF 4X4XB 2E6QA 1C5DB 2QQNH 4P2RA 2YK1H 2IPUK 4ZFOA 4J8RA 6FABH 1VFBA 4ZO6A 1ZLVK 1E27A 2WBKA 1X3DA 4QCIA 4ENEC 2NY5L 1QRNE 3TN0A 1TITA 3WBDA 2GSGA 3BRDA 3A6CH 4HIJA 5C2BL 2E5EA 3GSRB 5D9SB 4F37K 4PJXA 3QAZB 3CVIH 4PTTB 5T1KA 2VZSA 2F15A 2GTZB 1ERNA 1NEZG 1JZ8A 1JPST 5ILTL 4I13B 2JF1A 5EU3B 5DC9B 3KPTA 3STLA 1D5MA 1PLGH 4HIIB 5I1HH 2NMSA 2DRUA 2C1PA 2VL5B 5ACMA 4P9HH 4HWZA 4OZGF 4PJ7B 1I85C 4S0TD 1MI5D 2JCCE 4HGWB 4O2FB 3FOMB 1AGBA 1NGXA 5IOPA 3GSNB 3FFCD 4QHLB 2PN5A 2WANA 5FDWA 4GQ9H 4MYWB 4CN6A 2LABA 4UIMB 4XNZC 3RWFB 4JQIL 5DK2B 3MRLA 2DAVA 4QO1A 5GGTA 3IVKB 1HXYB 2CJUH 2CKBH 4NKDB 1F6FB 3B3IA 3U83A 1IC7L 4PJCE 5IB1B 1KC5L 4UOJA 1XFPA 3HAEB 1R3LA 2GTWB 2YPVL 2NW2A 1OAZL 4QRSB 2CPCA 2X4RB 4JE4B 4LF3B 4KDVA 3CFKA 1N59B 4H25A 2EECA 2W9DH 1MAJA 5D2NC 3D48R 1A8JH 1H15A 1IGFH 3IDXL 1MCEA 1WK0A 1A3LL 3SPVA 3TEUA 1KCRH 1NDGA 4XT1C 3TBWA 3T4YA 2H45A 1S8DA 5FKPA 5FV2A 1TQCB 5FUOH 3FO0L 2XTJC 1SYVA 4R7DB 2BVPB 4LRNH 3NIFF 1J11A 2OSLB 4OLXH 4O5LH 4E41D 5EA0L 3V5DB 2HVJB 2DQGL 4XH2A 4ETQB 3B2UD 4KZDH 2XIDA 1MFNA 2KQMA 3DYPA 3QXWA 5I1CH 3OGCA 4FFYH 4FXKA 5MP6L 5GS1B 3PIQA 3FCTB 2EE6A 3WS6A 4LDOB 4K7FA 1HZHL 2PCPB 4FTVD 4JFED 4M62L 1IM9B 1CI5A 4M4RA 1I3GH 1YMME 3IDYC 2B1AL 3QDMA 2H41A 2DM7A 4F7CA 4Z7QE 3WYRA 3PWJB 5I1GL 4GBXA 1JIBA 1TNNA 1X5KA 4OTXH 2MHAB 4BFEA 2FLBT 3OKOA 4K7PY 1E6OL 3ARBD 3CK0H 3D6GA 4J6RL 4ZUUB 3V7AG 5TDNB 1KIUA 5SV4A 4LSUH 3VGAB 3VFRA 4HMDA 1DQJB 4F7PB 3KLHC 3WNMA 3ARPA 4XWOD 2FRGP 4GT7A 1BQLH 1FGNH 3JSSA 3VMPA 2ITDA 3KYOA 3TT3H 3BH9A 1FV1B 3ULUD 5ICYA 3D0VA 4UQ3B 4RIRA 2OL3B 4XXDA 1UKTA 5GS0L 1W0WA 3MLPA 3D18B 4FQQA 4FQXA 5GSRA 5E94A 3VRJB 1ZXQA 5DVLA 3DUUB 1CWVA 4C4KO 1G7JA 4LLVB 4NN5B 4C4KT 2QQLH 4FQJL 1D3CA 4HKJA 1UB5B 3IDYB 3VDBA 1MHPH 1SY6H 5F1SA 3SQBA 4G9DA 2IALB 4CADB 3TPUA 1PY4A 2ZUVA 3OAYK 2CRMA 4Y4FB 3QEQE 1UH4A 2DWEA 2YWYA 4L3ED 4MAYA 4PJFE 4Y19D 5ANMA 5HDLA 4HGMA 4ONGL 4P5TD 5E24E 4MA3A 1JWMB 1DBML 4YGVA 4CNIA 2VLLA 4NQSA 1KEGH 2P42B 4JPWH 4FQ1H 4HFUL 3HI6L 5FAAA 3NIDE 1YNKL 3QDGB 2XTJB 1ZLUH 4Y5VB 3ZYJA 4LNRA 5BVJB 3CSYA 7CGTA 1PKQE 2VXQH 4WI4A 4JPKH 1URLA 4AQ1B 1QBLH 3CLEL 2Z9TA 1A5FH 4F9PC 3G08A 5DHVA 5GISH 4X7SL 1OB1B 4IRJD 4Z8FL 3F7QA 4I48B 5DYOB 5F9AC 3WXVL 3LPWA 4IRSD 4KI5F 2IAMB 4J3TA 3IDJA 4KI5C 1I9RL 2CDEA 4QNPF 5JR1L 3MV7A 1GOHA 3B83A 4EN3B 4JY6A 4OLZH 3C08L 5HI5C 1JPTL 1VCAA 1RIHH 2BOBA 1V3MA 3U1SL 5I66A 1BOGB 3RPIB 4CMHB 1NMCC 1S7TA 2B7DT 2YN5A 1HYRC 1NMBH 1XGTB 3DMMA 3ZKND 3ARDA 1JN6B 3TBSB 5I1IL 3PGDB 3RQ3A 2GITB 2DBLL 4GW1B 2EYTA 3LRHA 4MA8H 3N50A 3T0EB 2QSTA 12E8L 1GJIA 1RULL 3RFZC 4LEOB 1T1ZB 1H3GA 4F7TA 3RNQA 3AS2A 5D9SA 4UT6H 1VGEL 5JHDD 5BCAA 4NPYB 5B4MD 3WUWG 3MUJA 2RGSA 1M4KA 2VLJB 3ARED 3KPSB 3TT1H 5EUOB 3SE4C 1BQHG 1J5OH 4M1GH 3VDCA 3ARBA 2YMXH 1KEML 1MLBA 4Z7UB 1WQVT 4IIQB 2E6JA 3DROA 1U92B 3QQNA 4POZC 4TNWF 4I0PB 2HJLA 4PJCB 1NSNL 2F8OA 2X42A 1DBJH 3MZTA 3NCYS 1RU9L 5EZJB 3NA9H 3NFNB 3I02B 4MNGE 4LDEB 5FHBH 3GSWB 1F11B 3GMRB 4YBHA 4XGZB 3LQZB 3X3FH 2CIIB 3JUYA 2P5EB 5E70A 4U2YA 3DXAA 1INEL 2FNBA 3L7EA 1NANH 2VXVL 4MLIA 5GRUL 2YD9A 4JFDE 3B6SB 1IQDB 5C6TH 4UV7H 1LGVA 1E4XH 2E7LC 2FX9L 2ZUQC 1QSEE 4ZD3L 3QIWD 3PG2A 1A3RH 2BHZA 4MD4A 5E8EA 1CFSA 4GG8A 1W72A 3C5JA 1LO3L 1L4IA 4LVNC 3REWB 1DJSA 3JTTA 1ZA6A 5D4QA 3T4AA 2X41A 1S78D 3GZKA 4BUGA 4I9WD 4QHNB 5DFVD 4EDXB 5CIPA 1LNUA 5BW7A 5F88B 5GJTH 1BQLL 4RRPG 3QUYD 1M1SA 3PUCA 1XCQA 3V6BR 1KLUB 4GXVL 2CLZB 2NX5E 3BWAA 1A47A 1RJLB 1JUFA 4FZEL 3VXUA 1KULA 2BK8A 1NUGA 4NNPH 2P8LA 2CMRL 4X6CA 4YXKH 4ZS7L 5D1QD 1DVFD 3PL6D 5IVNA 3ZT6A 3QDAA 4HXBH 2XZAH 4H20L 3W81A 1KTLB 5E08H 2ZP0T 1FO0A 4FFWC 1JZ7A 4MWFA 2OR9H 2G5BA 5E6ID 1NC4D 1FRGL 1IGJA 3OKEB 1V05A 5IESH 4HH9B 2F19H 2R1YB 1PY9A 4PJBB 3ARDD 4HD9A 2NY5H 5I73C 5DJDB 3GSNL 2VITB 1LP9E 5KVGL 2IANA 2UV3A 1VKXB 4LGRB 3MCG1 1SM3L 3EYVB 4HUXA 4NM4H 3KLSA 4EI5C 3O11A 4ZOAA 4KH2A 2XPGA 4U3HA 3VFRB 5I8OH 1EJOH 2X70B 4HWUA 4KRPD 2Z93B 5DJ6A 5MI0B 4W6WB 5CP3H 2APBA 3L95B 2HJKA 2JELL 2R29H 4JQXC 5E7FA 5BW7C 1MFAL 3VWKA 1CL7H 5KZCB 3MRMB 5C0CD 1JGEB 3K1DA 5E03A 4ZUTB 4KDTC 3ZYZA 4N8VB 5D71L 4QHUB 1J8HB 4R6UA 1F6AA 3G6JA 4OT1H 5ESQA 4XVUC 3GMMA 5KS9F 1IEHA 4UIMA 4U33A 3GIZL 1NGZA 4OAWB 3RZCC 3H3PH 4R97B 4BK5A 3S35X 3L5JA 1X5JA 4N0FB 2ENSA 4S1QH 4PB0H 4JDZB 4K7PL 4OF0A 4YXHH 4NCC2 3PNWA 3WIFB 1IGFL 2XFXB 1HWHB 5FV1L 2B5IB 2FR4A 3QDGD 4QLRA 2YMXL 3DX7A 3P3YA 4CU8A 3ULVL 5FYKH 3ECBA 5D7LE 5T1MB 2OTWB 3IDGA 4LU5L 4YDKL 1CE1H 1QFUH 3MBED 5BRZD 5MEOA 3D3VE 3MRIA 4PYGA 2R9HC 2WIIA 1EEZB 5CZXC 4H0GA 2J2ZA 4QXWA 4PV9A 1DN0B 1OLZA 2Q86B 2HVJA 4YAQB 5EU6A 5TF1L 4LLYA 4S10A 4ZNEE 1XGQB 2V5SA 3EYSL 4JFOA 3GI8H 4P59L 5L8JB 4MJ4A 2IGFL 2FGZA 4UNUA 2VSDA 4JM2B 1MFEH 4W4NA 3ARFD 1YMMD 5BMFL 1CGWA 4GMSH 4AG4H 3W5NA 1AHWB 3EGSB 4KK5D 4FA8A 3TV3L 3U0TB 1LEGB 2BOCA 4HCRH 4NO0D 4Y1AE 2OK0L 3DIFA 3MCKB 1IGML 4Y1AA 2EXWC 5GXBB 5I74B 1WLHA 1MRCL 1TVBB 1IAKA 5ACZA 3QWRA 2NXYD 5HHOE 3U9UB 2DQEL 3V5KB 1T5WA 3SKJL 2OL3L 4EBQH 3CVHA 3P73B 3VU2A 2Y5TA 5JIHA 2O5YH 4OCRH 4U1IB 1QPPA 4PG9B 3WLWD 4KQ3H 3BH8B 3PHOB 3K2MC 1KBGL 1CGTA 4R2GB 1UENA 4Y5XB 3ZE2F 4IIQA 1CZ8H 5D2NB 3E6FB 4RWYL 3GHEL 2HLFC 4I0PA 1UVQA 3O3EA 4O4YH 4OM1H 3HZMB 4EUPG 4GBXD 3PF2A 4MNHA 2R8SH 4L3CB 4NOFA 3UJIL 4W6XB 4ZFFB 1FG2B 3WLBB 3O81A 3BN9C 2AK4A 3MCLH 5GGUB 1UZ6F 1KJVA 2H3NA 4M1CC 3EJYC 3GDBA 4M7LT 1NANI 3ALWA 3FTGB 2A9MH 1UCBL 4ZPVB 4J7RA 1PGRB 3O6LL 4CW1B 4PJ7F 5DUBB 4ZS7H 3P0VH 4M93C 5J6HA 2GY7B 4UOW1 2NXZC 1YEGH 3RTQC 4LNRB 3BVNA 1HZHH 3RL1A 3REWA 1RZFH 3GMLB 3MPCA 1VFBB 5DJCA 4JN1L 1U91B 4ODWB 4X7CC 1Y6KR 3V6OA 1MCIA 4GAJL 3QAZC 1BD2D 2XXMB 2X9YA 4LIQH 4YDJA 4MS8C 1TJIL 4G6FD 4UAOC 5A2IH 2APWA 4P4RB 1P84K 5JO5B 4I48A 5EUOE 5D1XC 4PTTA 5T1KB 4Y5YC 4UILH 2BSRA 2RCSL 4Y16B 3SDXE 1TJIH 4X6BB 4NQCE 3QSKB 4U1LA 4LQFH 4WCYL 4HH8A 4UIKH 4CVWA 2FH6A 1E4WH 2FB4H 3RPIA 1A4JA 4N0CC 3DGCR 3MV8E 3V52L 2R2BB 1AHWC 1YNKH 3ARDB 1P9MA 3AMLA 4GRMB 4R0LB 3RDTD 1UM6L 4X8JA 5EOQH 2EYTB 3BRGC 2BFVL 1KPUB 2CDFA 4XCYB 3LQAC 2E7BA 3I6LE 4K7PH 4JKPH 1CFBA 5EUKB 3D39B 1XZ0B 4IJ3B 4URTB 5LWYL 3V0VB 3OR7B 1T2XA 5EO1B 4KTDH 4FQXC 4QRSA 4KHXH 5SWZD 5E6IB 5ENWB 1CT8B 4Z7UA 3IRZA 2AXFB 5DC4B 3RY6C 5IW6A 3TJHC 5F1IA 1JGEA 3KXFD 4QTIL 3VA6A 2MKWA 3PQYE 3LKQB 5I15L 1MCLA 4KFZC 1N26A 1A6ZB 4N1EA 5HHVL 2PXYA 4D9QE 3TV3H 4RGNB 1ETZB 1KNOA 2AK4D 5IEHA 3QBTB 1SBSH 1NMBL 2M1KA 3CSGA 1MLCA 5TDPA 3IFNL 2A74A 5D1ZB 1CFVL 5HHPA 4FS0A 1E4XL 2NY0B 4HZLB 3SY0A 3CXHJ 3FFDB 4WW2B 3DVGA 5DEZA 4YIQB 1AP2A 4ZAKB 2XN9E 1VDGA 5K9QG 4XNMA 5B21A 4GS7B 1KXVC 1RJCA 4AZ8A 3P30H 1QOKA 5D96C 1OTSC 1EGJA 1TZHA 5C09D 2C1OA 4GBXB 2NXZD 4MLSA 2IH3B 2VLRB 2B0SH 3QIUC 5GGQH 4WEBL 1H3WM 1R5WA 5GRVK 3QUZC 4PUBH 1Z0NA 1CFQB 1RUMH 1DVFA 2AK1H 1DVFC 1MUJA 1OAKH 1CFNB 3NN8A 4YHNA 3QXDB 5B8CC 4M6MH 4OZGE 1XCQB 4HKZA 3TBYA 4OBRA 2A73B 2Y36L 2WAHA 3SE9H 4EJ1C 2H1PH 1R5IA 1YEDB 1QKZH 2Z92A 1KF9B 4EI5B 4RGMB 1U8NB 1UM4H 2ADGA 2Y07L 2XQYG 4PRNA 5F3BB 4PJ9C 5KSBA 3MOAH 1RIVL 2L7UA 2R0LH 5H94A 3U0TA 1IAOA 1Q94A 4AEFA 5FYJL 4GRLC 4N0CD 1YEIL 1JWSA 2W07A 4LLUA 4LGPB 2DQDH 3TPUB 5IT2L 3ARGB 1DUYA 1S7QA 4OKVA 3ZKMD 2BVOA 3OAUH 5KSAA 3CGTA 4NYLA 3UBXB 3KPQB 3BN3B 1U95B 2A6KA 5BOPA 5I1KH 2VDMH 5DHVH 3QFDA 2EDYA 1BOYA 4Q9RH 3MV7E 4QTHA 3UTTD 1WZ1H 2WBJB 1IT9L 3C5SA 4NKIH 4WHTA 4O4YL 2NY5C 4D0CB 2HJFB 4HWBA 1T89A 2ED7A 4IS6B 1U8PB 5I1KL 2B20A 4GRWH 3ARZA 4L29A 4YEFA 1V7MH 5JXEA 3RAJL 4ZUTA 1HYSC 3HE7C 5EC2B 1Q1JL 2ESVD 1RHHB 4ETYA 2WWMC 1JPSL 4DCQA 4FQJH 3WFBH 1GZQA 3WS3A 4R7DA 3ARSA 3ME0A 2CK0H 1KJVB 4NQXA 2CO6B 1LO0H 1P9MC 4QOKD 4M48H 5DDHB 4JDZA 2NX5D 1GAFH 3NZHH 3DVIA 4OZHE 4XBGB 2IAMA 3AUVA 3LKPB 4MZ2A 1CXHA 3BQUC 3WIFA 5DA4A 1TJHH 1B3JA 4JY6B 1AIFB 5FUCE 3BEVA 3O4OB 3QNYB 5MENA 1ZAGA 4WCYH 1YEHL 2UVEA 3MRQA 1ES0A 3C08H 5DD3L 1N3NB 3Q5YA 2C4XA 4WFFD 4HBQA 4NT6B 3EYSH 3ZHDA 1A4KB 2LVCA 1FIGL 1UYWL 5I75C 3T3PF 4Q9QH 1ZHBB 4V1DE 4XPHL 5C0DA 3JV5A 4KZEH 2NY0D 3KPRB 5IHUL 4PRIB 2AQ1A 2YUWA 1SEBB 2DBJA 5CEZE 1F97A 3OWEA 2OBGA 4LCCC 1QA9B 5C0IB 2OJZL 2A77L 3BZEB 4OFYD 1B0RA 1NGQL 5FGBC 1FNAA 2AVGA 2VISA 5EO0B 1T3FB 5BS0B 1CXFA 4LSQL 4UQ2A 4Y7MA 5MEQA 1MNUH 5D5MF 2OR8A 4HDIA 1BPVA 4G42B 3PQYD 4OLEA 2HFGH 4OJFL 5E6ZA 3OKMB 4P0DA 3THMH 1OQOA 4ZUVA 1RZKC 4LSTH 2IAMD 1GGCH 3CX5K 2R9HD 1A7QL 4XZUA 3T0DA 3SDXA 5F7DB 1I9JL 4DUVA 4MDIA 4OCSL 2F58L 4L4TB 3CVHB 3GIZH 3MA7B 3V0VA 3O2DH 5MERB 4R7NA 3JV6A 5LGKA 3QCTH 2IQ9H 3OKYA 3KJ6L 5HI4D 3VXSD 2E9IA 3WDJA 3QEQD 1FJ1A 4POUB 5ERWB 3OZ9L 3QO0B 1K3IA 2Z31B 3VXMA 2NY3D 1F13A 3HN3A 3OQ3B 5IMMB 3JTTB 2HT2D 4QRRD 5CINL 4P3DB 2VLKD 4AIZB 1AD0B 5H2BB 5DJAB 3ZDZE 1ETZA 4I18B 4H1LH 3TT3L 3WIHH 3I50H 3F12A 3MRGB 4I3SL 3ZE1E 2DQIL 3QWRD 3GM8A 5TQ0H 4ZTPL 1MRDL 3K8KA 1RZIB 3MUGA 2IH1A 3MRHB 4TSAH 1KCUL 5H35B 3EOAB 4P3CL 4DW2H 1BZ9A 4NNYA 2KZWA 4YFEA 3PXHA 3OAZK 5CJ8A 4ODHL 5GJSL 3L3OA 2VDOL 2W92A 4FFZL 1Z5LB 2BNQE 3BVNB 3F7PC 4PJIF 2ZWLT 1AXIB 2XKNA 3L6FB 1JNHB 3DTXB 5C6PB 5KS9E 2Y9RT 3U6RA 5CJXC 3WDIA 3DV6A 3WN5C 1IGTB 2X70A 1E4XI 4G8GB 3DRQA 5GJTL 4F2MA 3HMWL 2MQ3A 3LKNB 4PRBB 2VXTH 5LBSL 3BD4A 4AMKL 2AP2A 3D9AH 3IGAA 4XMKL 2EKSB 1OSPL 1QFWI 3ZT7A 2BSRB 4ODXB 5EOCJ 4D9LH 5E00A 4M4PA 4Q9RL 3LIZL 2L0DA 5IBLD 2VR5A 3JZ7A 5JORB 4QY8A 1EO7A 3VD3A 5SX5K 2VKXA 4XI5D 3TZVC 4F8QA 3DGGA 2R2EB 5CZVL 5JQ6H 1ZT4A 4BZYA 3CFEA 3VRLF 1LO4L 3GMPA 2C3HA 2JIXD 1BGXH 1F6AB 5CP7A 3QIBB 4JCLA 2PO6A 1A9BB 3K46A 5CEYB 4V2CB 5EU7C 1CG9B 3W9DB 4H1LG 1MCWM 1PZ5B 2VSCA 5INCB 4JR9L 2QHRH 5J9PA 3DURB 5I1JH 3O9WA 4XPGL 1NFDB 5BO1L 3S34H 1DE4B 1IGYA 1RMFH 4ELMF 2DQCH 1UWEL 3MJ7A 5IM7B 2XZQL 1OP5K 1FFRA 4NQCD 5BS0D 5I8CB 4ZMAT 4G6JL 4HV8B 1IMHC 4OIIH 1RY7B 4DZBB 5T3XE 1MH5B 5CEXB 4YH6A 2PXYC 1R3KA 2WZPD 3W2DL 1ZWIA 4JHAH 1RJZB 4RQQA 4HS3A 4I3RL 3UYRL 4CUCA 5TGBB 2FHCA 5HHPB 3FT4A 3IU3A 1F4WH 4PJEB 4UINL 3WJLC 2CLZA 1KN4L 2GUOA 4LEXH 3EBAA 5DK3A 4ORZC 4HF5L 5DMIL 1X5AA 3NCEB 5CBAB 1NL0H 4HBCH 3HHRB 5EC1A 3MJ6A 3FO1A 4JM2A 2VJXA 2I27N 4HWEH 4U1GB 1CDBA 3X11A 3KPLA 2YK1L 1B88A 5EU7E 4RFEA 1MY7A 2J8OA 5JOEA 4HF5H 1AGFA 1RUML 2AK1L 1N3NA 4P9MH 4P57B 3SDCA 4IOIA 1VACB 2IH3A 2VLRA 4GO6B 2DMKA 3I6GB 5KVDH 2HFFA 4OF6A 5LGJA 3MACL 2LE9A 4U0QB 5E2UL 2H2PC 3VWKD 1SEQH 1FFOA 3V4PL 2H8PA 3DV4A 5I2IA 4F58H 4QGYA 1OAUL 1V7NH 1IZKA 1WEJH 3L95A 3FQNB 1ZHKA 1DL7L 3QDGE 1GZPA 3DJ9A 5IG7B 1HDMA 4XB8A 4HZAA 1VPOL 1HSAB 2EYSB 1AQDA 1AJ7L 5A2KH 1LMKA 3MROB 2XZZA 1PG7X 5C9JA 1PKQB 3LEXA 2D4DA 3L5WB 4Z7QF 4WW1A 3OKNB 1A3LH 1DQTA 1MCRA 1PJ9A 2ED9A 3TO2B 3MLXL 3EUUA 1I1AD 4MA7L 1A7RL 4YFDB 1I8MB 4PJ8D 5I15H 1OCWH 4OF3A 5E99H 5F7DA 3OXSB 2X4SA 4OKVB 5F44A 4K8RC 4L4TA 4N9GA 4WO4B 4NQDE 1R5VB 2RFXA 5MHSD 5BOZG 3IAGC 1P53A 2V7NA 2Y07H 5E2UH 1AGCB 4X5WB 1UH3A 1UC6A 1P7KB 1JVKA 4EN3D 1QYGL 1F90L 2Q76B 1QR1B 4ZTOH 5DHXB 2Y06L 1G7QA 5FYJU 5D70H 3D9AL 4PRPB 3GHEH 4PJAA 4F9PA 3BWUC 5D7JD 4DN3H 4I18C 3QUYA 1UEMA 3TVMD 4I8DA 2B4CH 2Z4QB 4XX1E 2YUZA 1HOCA 2FSEB 3RBGA 4I5BA 1DTUA 1MFBH 1QHOA 3LB6C 3D1MC 1RFDH 3VXNB 4MAUH 1DBBL 5HDOA 4O51A 4KKCD 4BH8A 5C8JB 4N0RA 4NN7C 4CDGC 5ID1B 3QUYC 4EBQL 5HI3C 3MRCA 4NFCA 4XTRC 3SKMA 4HWBL 1HHKB 3BAEL 4JO3H 5DRXA 1BZ7B 3QQ3B 4NJ9L 1DN0A 1W2KT 2Q86A 1HILB 4EKXA 3N1GC 3RL2B 3QRGH 3QDJD 1X5XA 3CZJA 5I1GH 5ADOH 1GHFL 3CMOH 2JJVA 1BWWA 2HRLA 4O2CA 3G6DL 2JJSA 1J12A 3PGCA 1F58L 4WFFE 1ES0B 2Y23A 5FA4A 3RI5K 3O6ML 3HE7D 4M6OH 4YFLF 1GGIH 5CCKL 3HAEG 4P5MA 15C8L 3B5TA 1CLOH 1FE8H 1RI8A 3C60B 2VDKL 3IF1B 5BXFA 5AZEL 5I1JL 1U8IB 4B7LA 5C0DB 1IAKB 3Q5OA 2A0LC 3R1GH 4XC3H 2XWTA 3K0WA 3KPRA 4GMTH 4LAJH 1PG7L 4D0BB 5HHXL 5L2JB 4RBPK 3K4DA 3BT2H 3FN9A 5KANI 4R4BB 1G7MA 1G9ML 4QHKI 3UPRA 1RSFA 3H9HA 1JNLL 2WWKT 3GSNA 4JO2L 3BJ91 5JOFA 1I9JH 2DTSA 1IJ9A 2ESVE 4NUJB 5CMAB 4KDWA 5ID0A 3V79C 4DVRL 2VZVA 2O26U 1N6QH 3DRTA 3QEHB 3RNKA 3TBTB 1AE6H 2GJ6B 2XN9B 3JWDC 3OX8B 4LPVA 1MNUL 4YIQA 1A7OH 3GSQA 3MLYL 4OM0L 2J5LB 4OI9A 1AC0A 4EIZC 1B6DA 4D9RE 1NCAH 3DSFH 3ZTNL 3K1KC 5JR1H 5F1NA 4H25B 1LE9B 2EXYC 1CR9L 4PJHB 2OR7A 2V5TA 3SJVD 4OF5A 4ZO9A 2VC2L 3DVNB 5JZ7C 3VFPB 1ZWIB 2G9HA 2OQJA 3VXQB 3V2AR 5IQ7L 4UB0H 4XNYH 1D5ZB 4UNVA 2E27H 4HUVB 3PV6B 1OF2B 1RV6X 3WKML 4W81A 1HH9B 3TH4T 1I9IL 4XTRD 1J05A 4HWNA 4LCIL 5C92A 2CR3A 5IVXB 4BSJA 4EOWL 3QHZH 5HYSB 3O6KH 3QUZD 5EC1B 2F8XC 4U31A 4GQPH 4LVHB 5FUOL 5F7MC 2CLVB 1T66D 4P46B 4HKJB 1N64H 3BEWA 1AKJB 3NH7L 5H94B 4G80B 5IBUB 2IANE 2K7QA 3B43A 3V5HB 1GPOL 5LGHL 2DD8H 4HAFA 3T0XA 4PB9H 5ESAB 1SJVA 5TF0A 4HJJL 4FFYL 5F7UA 2Z91B 3B2UC 4MAUL 3MLXH 4F9LC 4UNTA 1WZMA 1H3PL 4G8GA 1JWMA 2D03H 4RBPH 5KOVC 4JKWA 1NAML 4OLXL 5EUOF 2YEZB 1HQRB 3IJHB 4P4KD 4HT1H 4L8SB 5I8EA 2XTLA 1JV5B 4KRNA 4WHTB 2N4IA 3DX8B 1KJ3H 1FG9C 5DRWA 1AQDB 3QHZL 3BFOA 2VL5A 3JTSB 3IYLW 3LKQA 3S3SA 3ALPA 3G5VB 2PO6B 4G3YH 3D3VB 4EIGB 5JW4Q 3QYCA 2NY6C 5CJBA 3WS6C 1S7UA 4NO2A 5DWUH 5C0RH 4JGMA 4PGCB 3MGTA 4JFFA 2E7LA 1F4YL 2FJGA 4I4WB 4JFDA 3NFSL 1ZVSB 2NCMA 4JPVL 3MLSL 1CXIA 3ESUF 2CK0L 1MCBA 4GAYA 3C09B 2H6PA 3HPLA 1QLEL 1LD9A 4NJAH 5D5MB 1E0OB 2VDNL 3QDGA 4JEGB 3RTQD 2VXTL 4FFVC 5LBSH 1KJ2B 3Q6FB 3U4EA 1G9NH 1JN6A 1QFWH 1WCBA 4AEHL 2XA3A 2R0ZL 4M5ZL 2CRIA 2FSEA 4OLUL 2FECL 3PJSB 5C86A 4WI2A 4DQOH 5FKPB 4DKFL 5C9KA 1C08B 2N56A 3GI9H 5J13B 5CIPH 1R5WB 4EXPX 4OCLC 3G5ZA 3HMXH 5I17B 4PRIE 4Y2DC 3ET9F 1F45A 5C2BH 3O9WC 1J0YA 3B9VA 3ARBB 5DWUL 5C0RL 4TTDD 3OHXB 3RDTA 4WEMB 5GS1A 5E9DD 3CZFA 4LLMA 1U92A 3WO4C 2VISB 3NACL 5TH2A 3MRFB 3PGFH 1CD0A 4U0RC 3OKLA 2PF6A 1S9XB 2A38A 1AFVL 1MIEH 1EK3A 4GG6A 3HI6H 5DT1H 3ARDC 4LHUA 2V2TA 1J0KA 4DVBB 1O7SA 3RA7H 2BDNH 3BPNC 1XF4A 5GGVY 4U0RB 2XTJD 3H0TB 1L0QA 3DSNA 2D0FA 4JG0H 2MNUA 3CLFL 1U6AL 2EDEA 3HLAA 3RNQB 5AEAA 3W2DH 1MCSA 1S7QB 4GKNA 5SWSB 4LAQH 3L7EB 4M7JL 1HE7A 4X9BA 1EBPA 3LQAH 1Q0XH 2A6KB 4KUCF 4PY7B 1JPGB 3BP5A 4NUGH 5D2LA 5IGXH 1S5IL 2AEPH 3O2DL 9CGTA 3BDXA 4Y89A 1CFTA 3E3QE 1DLHB 1OTUC 5LWYH 2XT1B 1GOFA 4YDKH 1RUAH 3IDUA 2VLRD 4GFTB 5IR1B 1DP0A 1PKQA 5EC2A 4JO4H 5BV7C 4D2NA 4AEIL 1UADC 3T1WA 1E28A 3RWHA 3GSWA 4B5EA 4PGBB 3B2VL 4X6EB 3UYOD 3C9NB 4WHYH 3QHTC 1G6RB 3FAXA 4L4VB 4P59H 4ZODA 3ABZA 4BFGA 5ANMB 5IV2A 1NGQH 1MF2H 3SQOH 3K7UA 3V4UL 2K3TA 4DN3L 4TUOB 3QUKB 4NZJA 2HFTA 1YEFH 2DI8A 4OCXH 3VJ6B 3ULUC 4OF8A 1T21B 1IGCL 1DDHB 2XWJA 4I2XE 5A2FA 1S5IH 1Z5LA 2WIMA 4BQ9A 4J3VA 4HPYH 4HWBH 2C7UB 3VD9A 2IAND 3QQ9C 4P2OB 3MV9A 3HE7A 2I60L 4FTVA 4JFEA 3IAQA 5EG6C 3NPZB 4M7ZB 3T04D 4NKOA 2ATKB 2Z93A 3HUJF 4YR6B 5KS9A 1OARL 4OLWH 5M94B 1AXTL 2UYLB 1CGUA 1IVLA 3MSPA 1X44A 2P7TB 3O41A 3CMOL 4YC2B 5KSUA 1KTRL 4PUBL 3QEUB 2FX7H 4R3SA 1UXWA 5JPNA 2O5ZL 3E6HB 1TJGL 2DMBA 2GTZA 4W6YB 3WD5H 5GS2H 3RVWD 3V6ZA 1D5BB 3RGVB 6CGTA 5KSAC 4NO3B 5C0IA 4DW2L 1DQMH 4Y4KA 1XF1A 4MX7A 1VA9A 1L7IH 2A6JA 4AK1A 1WEJL 1FLRL 3SO3B 2IFFL 1TVHB 3L7FA 1FNGA 2R2EA 3RZCD 2AJZB 1A6UH 4LSPH 3GSXB 3GMPB 1KPRA 2BY2A 4P46D 3U30B 2BVYA 3I50L 1OAYL 1MAMH 2M8XA 3NVQA 3BISA 4PJ9A 4GW1A 1CVRA 1WAAA 4JY5L 4ERSH 1C16B 3EYFA 5I18H 4KQ4H 1FZKA 5EBGA 3C2AL 4KKBD 1RU9H 1YYLL 3G5YA 3CPLB 1RPQA 4C57C 5HVWA 1JFQL 4GUPA 4JM2C 3VH8G 3TZVB 2ICWB 2YEZA 3IJHA 4KQ4L 1OARH 2EDJA 4OLWL 3U82B 3I75B 4UUJA 2ZOLB 3WLWC 3NFPB 5DQ9B 5IM7A 1XIWC 4H26B 3S7GA 3LHPH 4F3FA 4O9HL 3DX7B 5IBUG 5IB5A 3B5GA 3ES6B 1TCMA 4L5FL 1BGXL 5HGAB 1FJ1B 3MRMA 1J1PL 1B6UA 2HLFD 4U6VH 1OTUD 1V3JA 3GJEA 4TSBH 1JYVA 3ARFA 5IJKC 4Z76B 4R96A 4P23C 5GS0D 1K9TA 2BXZA 4NRXB 4X0KB 3RWDA 3VH8A 1OSPH 4MMZC 5FXCH 1CXEA 3DPBA 5JW4M 4TSBL 2EIBA 3BPNB 2P47B 3IKKA 4YHYB 4ZQKA 5E4EC 1VGKA 1OM3L 2H6PB 1CLOL 1FE8L 1OLLA 3QI9A 5T3XL 4G6JH 3UTSD 4JDVB 5GS3A 3MQIA 2ADIB 5EIIA 4P2OD 1Y0LA 3DUHA 3KPNB 5E8DH 2DQCL 4S1DC 1RZFL 4O2EA 4NQEE 1YDPA 1IAMA 3PQYB 4XNYL 1U2HA 2GT9B 3ZYIA 3VFTA 3INUL 3BZ4A 4G6ML 1LEKB 3I3BA 3GIVA 4OZFG 5HHNB 4RGOL 2APTA 3HE6C 1CDGA 3MRIB 5J57B 4KVCL 4YHPB 4KU1A 5DR5H 3O2VL 4WU5B 3OKOB 1QO3A 4X6CE 3QQ9D 3KPMB 1QBLL 3B4NA 5FM8A 5C7XL 5GGVL 3VXUE 3BIKB 5D7SH 5HGBA 1NCAL 3DSFL 5FYKU 3ZTJG 1MSPA 4MB3A 5TQ2L 5HHQB 4ZXBC 3QWOA 2VQUA 4HWEL 1RVFL 4JCMA 4NWTL 1B9ZA 1AD9A 1WTGT 3CX5J 4GSDH 3NH7H 3D0VB 3QEQB 1U93B 1ZV5A 1XT5A 2H26A 2BSTA 4FQLH 2R2HB 4PP2B 2IPTL 5EU6D 1HKFA 4G7VH 4QY8B 1MHCA 2PW1A 3S5LB 4UI2A 5JHLH 1FYTE 1K5NA 4GG6B 1EHAA 4GSDL 5J56B 4HH9A 1I7UA 5DQJA 2NY1D 4HW6A 4KY1H 4YK4C 1DEEB 1EAJA 3MRJA 2YKLL 4KK6C 3EYVA 1RK0B 3KYKL 1NBZA 2F54A 4ZNEA 1Q0XL 3U9UA 4WHYG 3TIDA 3SKNA 4IRZH 5DR5L 4GRWB 2P8PA 2ZNWA 5DQDL 4ZOBA 2MMXA 5HI4C 1AR1D 4ODHH 3UZVB 3W39A 2G2RB 3N06B 1H3VA 2GCYA 4IOFD 5HYJD 4OFYA 5FEBA 4HPOH 1TJGH 4E0RB 3VW3L 1U8OA 1DBJL 3RIAF 3L5XL 4NN7B 2WUBL 4XHJC 5CEZD 1ZLWK 5BVJA 2D03L 5FOBA 1IL1A 4LVNB 5DK0B 1M7IA 4F8TA 4OZFH 1P7HL 3IFNH 3RVVC 1U58A 4X5XB 5CEZH 3NMEA 1OAUH 3TT1L 1UFUA 5I19L 1UH2A 2M2DA 2H2SD 5DJYA 5GGUA 3UTOA 4FFVD 1EVUA 4L4VE 5TGBA 5DD0H 4N0FA 4NRZA 2ADJB 2FZ3B 1TTUA 2AS5M 5DMGC 1CU4H 1Q9WB 4YHMH 1WWAX 5SWQB 2BJMH 4S1SH 5I19H 4HAGA 5E9DA 2Y36H 1OW0A 3SHSA 3ZL4L 4G3YL 3X11B 4KK8C 1FAIH 2VLJE 3KPSE 4YGAB 4YPJA 1FL3B 2VL4A 2R0WL 3BGFB 3HCVB 2QQQA 2HT3D 4I0PC 2VUOA 1QBML 3K8LA 4TTDC 1X6LA 4ENED 3ZHLA 4ZFZB 4XCFL 3X13A 1TIUA 5EU5A 1S9VA 4GKSB 4IIQC 2DM2A 5I18L 1K85A 3K8MA 4X7EC 3Q2CA 5EU4A 4NO0B 3V0WH 3GO1L 4KGJA 2F53D 5CSGA 3D87B 4MNGB 3L5HA 2FECI 2OJEB 1ZS8B 5H8DA 1A0QH 2AJVL 4POZD 4LGSB 5IW1B 5JUEH 4KMLB 5CSZA 3VXPB 3MFFA 4U6XB 4K94L 4JPKL 3KYMA 4K55A 4ONOA 3EZ8A 4LSRL 3SJVE 2DOCA 4R4BA 5KVGH 3D39D 3U36A 2AJZA 4XP5L 3T09A 1CK0L 1PQZB 5TJWK 4R2GD 3KLDA 5F7LB 1BBJA 3MRLB 4X6FA 1SJHA 5EZJA 3MV11 1AGEB 4N90E 1RMFL 3UMTA 4YDIL 1DQQA 2CMRH 3KXFB 3A67L 2DYPD 3BUTA 3OF6A 4L8CB 3QFJE 4XVSH 5ANME 3TBTA 3HAEA 4X6DB 3HKFA 2J8UA 4NO5B 4LK4A 2RBLA 4J2XA 4PG9A 1F3JB 1JPGA 3BP5B 1DFBH 3BUYB 2J6EL 3C60D 4Y2DA 3LN5B 3QNZB 4RMTA 4OV6F 1CIUA 1CFTB 2I25N 5F1IB 2EDOA 43CAA 1MFAH 5E2TH 2F53A 3KYAA 1NLBH 3DVNA 2X1PA 3KWWA 4UT6L 3ARFB 3A6CL 4UDTB 3C8DA 3Q6GL 3IDNB 3N1FC 1E28B 4OQTL 5A1AA 3D69B 5C8JA 3WIIL 4OD1H 1JNJA 4Z7WA 1QVOA 3B5HA 4U1MA 2AXJA 4Z5RA 5D1ZA 4AQOA 5GPRA 1VGKB 4YHOL 2VQTA 3QA3A 5CGYD 3VDAA 1TJHL 4HEPG 4HQQL 1JHLL 3BP4B 5IB2A 3TNMB 3JXAA 3MRBA 4QRQA 4JB9L 1Z6JT 2NY7L 3H9SB 2H9GA 5FA3B 1JE6A 4MWFB 4CN4A 4XBEH 2JJWA 3OV6A 5C07D 4JAMA 4HUMB 4FXLA 4OGAC 4ZS6C 1MCPH 5IROC 4XC1H 5IQ9A 4RGNC 5K59E 1U91A 4ODWA 3HNTH 2VXVH 5L0QB 5BV7B 2Z91A 2YKLH 1JRHH 1JF6A 1WAAF 5C0FB 1KIPB 3FKUS 1XGPB 3HUJA 2ZUUA 3X3GH 4C56A 3DUSA 1U8IA 3MMEB 5AZ2L 3FHQA 2ZG2A 2WSKA 2DQGH 5DJ6B 5KSUB 1UM4L 2XG5A 4RIRB 2E8YA 1SBSL 2IPTH 3NCJL 1WC7B 3MRPA 2IG2L 1D5BA 3RGVA 3V8CA 5A40E 2HKFH 5BMFH 4YBLC 3FQUA 4Q6YA 5GQBA 3WUWA 1TXKA 4LMQE 5A2LH 1FNGB 4RSVA 3UJJH 1CD8A 5A16A 3UPRB 3BKJL 3VMOA 1CBVH 3FO9A 3G5VA 4Y4FA 4ZAKD 5CSBA 3C8KB 4OV5A 4KV5E 1L6ZA 1JPFA 4XC1L 3NGBC 4WI6A 4XCYA 3W0WD 5HHOA 3TNNA 4YEEA 4P3CH 5EUKA 3RJDA 5J4MA 1T7WA 3QFJA 3W39B 1MRDH 2WQ8A 1CL7I 4P23B 3ESVF 2YD2A 3D2UA 5L7XH 1GIGH 4P2CG 3TO4D 5KSAD 1KJ2A 1M6OB 2HP4A 3MRQB 4PLKD 5JQHC 1T6WA 3EYUL 4MNQD 4U49A 3M17A 1FVCB 5I8OL 5LKNA 3L3GA 2MWCA 4J6RH 2N7BA 3L3HA 3ILPB 3ULUE 1SMOA 5DJ2A 3WNLA 1ZHBA 4HK3N 1F4YH 3H9YA 3NAAH 3RY6A 3R8BB 1OF2A 5I17A 1KCUH 4PV9B 5L8LB 1OSZA 2OR9L 1YNLL 2JTDA 1G6RH 3DXAD 1LHZA 5EU3A 4GAGH 3HE6A 3FOLB 3S97C 5FM4A 2IPKB 3LAFA 1AP2B 4ZAKA 5HYSA 2EDNA 4TVPL 2W60A 4RAUB 4V1DD 3NZ8B 4JHWH 1E6JL 1MJ7H 4PJ8A 2XZQH 1HKLH 4XNZB 2GITA 5EWIH 1I1AB 1J87A 3SO3C 3GI9L 3RWFA 3UTTB 2ZSWB 2VE6B 5FGCE 3WE6A 4TN9A 4CMMA 1XR8B 1L9MA 3SDXB 1BP3B 3U7YL 2ICEB 4GW4A 4U6YB 3S3PA 1J8KA 2VLKB 4JHAL 1JHTA 1G0XA 3ILQD 1MY5A 1Q72L 2BMKB 2GJZA 5D7JA 4YC2C 1GGUA 2D2OA 4K8RH 4U1JA 5FYJD 1KFAH 1P7QA 2VDNH 4RMUA 4PJAE 1SEBA 1VERA 4LQFL 4PY7A 1ZVHA 4Y5XC 1DBKL 5C6WH 2AXGB 1EIBA 3ZTJH 4JO1L 1HNFA 4P2OC 4WI9A 5T3XD 4DTGH 4HIHB 5C0BE 3S36L 1ZLSL 4NQVB 3X12A 5KSBB 1NPUA 2X4QB 3CFIC 5KVEH 4RFOH 3SGKC 1CICD 1F4XH 3OKMA 5SWZA 1BBDL 1IC5H 4FOMA 3BESR 5J7CC 5I74C 1B2WL 2C9AA 4MNHB 2HFEA 1P4LA 3RKDC 3VWJC 3MGAA 3KXFA 4QXGL 2A77H 3LDBB 4M6OL 4TVPE 1MFEL 2EDTA 5IMLA 5DMIH 4X6DA 5C3LD 1CGXA 1JHKL 1KLFA 5ALCL 2X10A 2P8PB 4G7YH 3KPQA 5F97E 5L2KD 1ZVSA 3QIBC 1UACL 3S88L 1WIOA 3JWNC 3GMOB 4XPHH 4D9RD 1UJ3A 3KPOA 4QYOA 3VJ6A 3ROLA 1CLZL 1NH6A 4GW5B 3SCMC 3RVVD 1BFOB 2A9NL 4NOBA 4JFPB 5HHOD 1WWWX 4ZG1A 2F53E 3GSVA 3VGHA 3H42L 4KMTH 5DD5L 1X5LA 3BOVA 3HNVL 5FGSA 4FQLL 5IMMA 1FZMA 2YRPA 1E4KC 1IC4H 2D7QA 3PJSA 3TN0B 2X4TA 5ICZB 3L3IB 4I18A 1ZTXH 3UPAA 3WS3B 1MJJB 1FFPA 1AH1A 3U46A 3SCMA 4JKLA 5ICYB 4M7KH 3QRFM 1D7FA 2LFGA 2IG2H 4OD2A 3BP4A 1RK1A 3A6OA 4ODUB 2DL2A 2O5XH 3G9VA 3N9GH 5E94B 3VRJA 5DJZB 2C1PB 5AYUL 3ZDXF 2H9GB 5C0AA 2A6JB 3BXNB 5DEGA 1PD6A 4JRXE 3VCLB 4TULH 4LCWB 3H7BA 2FD6L 5B39A 3SKJH 1R24A 4OUOA 4L9LC 4Z0XB 4Z7VE 1KACB 2KKQA 4DGVL 1K8DA 2WWMD 4LHUB 3B9DA 4LMQI 3GO1H 2Q8AL 3GSOA 4YQXL 4RGMC 4N5ED 1JK8B 2NR6D 2BY3A 1YQVL 3NIDF 3NTCL 4KY1L 3DRQB 2CKNA 3S35L 5IWLA 3LKNA 2P45B 2H2SC 1U3HD 4Z78B 1G7LA 1X4XA 5CEZL 4MNGA 2FX9H 1YQVH 2AJUH 5FHAL 2XTJE 5BQ7B 1F90H 4NQCA 4M1CD 3V4VL 4UMGA 2BNUA 1N5AA 5HYJE 1S5HB 1YUHB 4LSVH 2IGFH 2ZCKH 2W0FA 4NQDB 1DLHA 4KRMB 1ZT4B 4S1SL 5EZIL 3X3FL 1W8OA 3FMGH 1I1RA 1DUZA 3WHXB 5L2KB 4KI5E 4YDVB 1MREL 4ELKA 4K71B 2VDQL 4JFXB 4LOUD 4I0PD 2HT3C 35C8H 3MUY1 5J1AB 1DQQB 4Q9CA 3QJHB 3FB5B 3C9NA 3SE8L 1FNEB 1HXYA 4L4VA 1UXSB 1D9KA 3TA3A 2XFXA 5IV2B 1IGYB 3VXRD 4MSWA 5I6XB 5I0DA 3GRWL 1AXSA 1NCUA 5I66B 1YPZB 1XGTA 1Q0YL 1MRFL 2BJML 4FMFA 3STZA 2W1NA 2F19L 15C8H 2Z8SA 2QHRL 1HIML 3KWWB 4IM8A 4Z8FH 3F7VA 4FP8H 1U8KB 3EDDA 2PYFB 3RWGA 4ZXBB 3O6MH 2YD3A 1QO3B 2VO5A 3AAZA 4KHTH 4OTXL 1RAMA 1FBIL 3BIKA 2YZ8A 4NC1C 5IGXL 4KHXL 4J4PA 2NLJB 5DJ0A 5IJVA 4NKQB 2Z35B 1OHQA 3HE6B 4DEPC 1JPTH 2G75A 4NQTA 4JVPA 5FUCC 4PJHF 4HS6B 3OGCB 3T2PA 2F74B 5F9JB 3TO4B 4XXDB 4JM4L 3TNMA 5TE7H 4P2YA 3IJYB 2BSTB 1CXLA 1ED3B 4L4TD 4G6MH 4PJIB 3L5WA 5EIVA 3UYRH 1TVHA 1D6EA 3VXRA 5I1AB 5F96H 5DQJB 5B3JF 3TCLB 1D9KD 1S7RA 3X3GL 5ACZB 1KCSL 3ROOB 2VLKA 3U6RB 2VXQL 3RGVD 4M1GL 2BVOB 2V7NB 5KSBE 4KHTL 4HJGA 4Y5YB 3GMQA 4BK4A 4E9LA 3CLFH 5HXMA 3R0NA 5DLML 3T8XA 4MJIE 3O2WL 3VRIA 1ZHNA 4LVOB 1OQXA 5K9OA 3NA9L 5DRZB 5DMJB 2EE2A 1P4BH 3SGEH 4HQQH 3LRGA 5E99L 5IK3B 4ZSOB 1A9EB 2D0GA 1JBJA 4U7MA 5CIPB 3LEXB 2VKWA 2HTLD 5DK0A 1HNGA 2LVEA 4UU9B 3AVEA 1RIHL 1BM3L 1LK3L 3FT3A 4RGND 1SBBA 1PX4A 3BYYA 1OB1A 1J5OL 2E27L 3HPJB 4X4ME 1RZ7H 3GI8L 2K1MA 4JG1H 4YE4L 5C09A 2NZ9C 3NTCH 1P5UA 2VZ3A 4ZQKB 4P3WA 2FBJH 4OZFA 3KR3H 3ULSB 4PP1D 5J6HB 1JWUB 3ROLB 1CLYL 1I3VA 4UTBH 1M7DA 1BFOA 2QEJA 1Y0LB 1OP3H 4P2QD 4A6YL 1CICB 1MH5A 2BRRL 2HLAB 3GBMH 4PJ5A 5DMGD 5T3ZD 4QHKJ 3LZFH 4Z7OF 4UT9L 4X7TB 4FQ2L 1D5IH 5B3NA 3RUGF 2BY1A 1AJ7H 1NCCH 1T0MB 3B9EA 2XWBA 1HQ4B 5DO2D 5C0CA 4OBSA 2BC4B 4GKSA 4TSCH 2B0SL 5GGQL 3G6JE 2XKUA 1OSZB 5E08L 4TOYL 3BPCA 5DYOA 3F6IA 2W0KA 3RL2A 1R6VA 3VWKB 3GMNB 3UC0L 3O8XA 1N0LA 1AI1L 2FATH 3FB6B 3U36B 2NNAA 4X8JB 1UA6H 4ODTH 3UTSB 3NFNA 3DMMB 4OI7A 1KPUA 1EBAA 4BFBD 1Q9KB 4LPCA 1ZMYA 1UWGH 4P5MB 5D1ZC 2CUMA 5T1DL 4HSQA 5BXFB 1QBMH 4F7TB 5FYJE 4RNRA 3EIFA 5D7JB 2V7HB 2RAMA 4Z78A 3Q0HA 1BIIA 5LAXA 2J8UB 2Y6SC 5DURD 1DSFH 5C0JA 1S7XB 2Q20A 4OT1L 1S78C 2JJTC 2EH8L 2GCYB 3JWOL 2HTKC 4R4NC 2QQLL 1KXQE 1OGTB 3GSUB 4XB7A 2F53B 1NEUA 2E9BA 1P7QD 3RVWC 2O61A 2NX5A 3TC9A 2L4OA 4QHNA 5DD1L 5F88A 4MNQA 1HH9A 4Z7WB 5EOQL 4XGZA 4HZLA 3SY0B 3F58H 1DBBH 3GRWA 5CHNA 1JPSH 4Z5RB 2A6IA 5D8JH 1KENH 1AGDB 4H8WC 1U8HA 3NGBB 5JDJA 1T66C 1UWEH 4MB5A 3HR6A 2J7LA 2RIKA 4R26L 2XY1A 3VD5A 3HFMH 5FM5O 3RGHA 3VFNB 1G7QB 2YPLB 4L3EE 3RZCB 4C59B 1AQKL 3BEWB 2R1YA 1YC7A 4QWWD 2VITA 3NACH 4LCCA 3T2QA 2NW3A 3O4LE 2CXGA 5HHMB 4H5SB 3F7VB 3TBVB 5IEKB 2CDGB 2QKIA 1XGUB 5I1IH 1JF5A 1TZGL 1YECH 1BECA 3IDIB 2OCFD 1LNUB 4ZXBD 4ZO7A 4LRIA 1NL0L 5DRXB 1YMHB 1NGPL 1KLUA 1JV5A 5F9JA 4Y5XA 5JHLL 1NCDH 1XGRA 1GVIA 2EYRB 4M5YL 5IUSA 2HN7A 1CDUA 2MCPL 3SCMD 5J1SC 2FEDC 3LS5H 3HI1A 3G6JB 5ESQB 3ZE2E 1OPGL 4ZFGH 4U4BA 4A6YH 2GJ6D 3C09C 4XMLH 3IU4H 5AYQA 4GRLD 3QIBA 4P9HL 4NO2B 2XACC 4C58B 5ESAA 4LAQL 2QR0B 3H9SD 4OV5B 4PRAA 2YZ1A 5LCVL 1XF2B 4NC0B 5JHDB 3MA9H 3MV8D 2YBRB 4ISVA 3E0GA 1N6QL 1YN7B 3KPPA 3QNXA 4L8BA 3C5SB 4OCXL 3AROA 3PL6B 1NFDA 3CUPB 4NO5A 1IC1A 3IS1X 1ZGLP 5C07B 1J10A 4ODBD 3TGXA 4X99B 3EHBD 4RAVB 5FK9B 2QL1A 3OAZH 1WCBB 1N5AB 4HIXL 2XQBL 3LN9A 3OB8A 3GMLA 2UZIL 3CFJB 3JTSA 1YEKH 3BP7A 1JP5A 4TUJB 4GH7B 1J8HA 2BNQA 2YRLA 3QDJB 2AV7B 4LASL 1OAKL 1MVFA 3HS0A 3RHWF 4H88L 1RJZA 1B0GA 4PRHD 1MI5E 4J3OC 3HB3D 4JFFB 1A02N 1QYGH 3NAAL 4NSKB 2P1YA 2BSED 4N0YH 2GEEA 1JTTA 2GJ6A 3ZO0A 5GRJL 5F9WC 5B38B 3KPRD 1DBAL 2R0KH 1JWUA 3GSQB 3BSZL 3VFOB 4U1NA 4DGIL 4Z95H 2X44D 1G6VK 5T5NF 1V3KA 3AXLA 1MFBL 1YJDH 4LSUL 2E8ZA 3RU8H 1UB6B 4X98B 5DUPL 2JB5H 4P5KA 3IDGB 1D5XB 4MMXC 4ZXBA 1WT5A 1NMAH 4JY5H 4LOUC 5HDQH 4LP5A 3CFCL 3AY4C 3WMSA 5IVZA 4Y2OA 3EDFA 5CZVH 2DQTH 4L4VD 8CGTA 3OJDB 2ZCLL 3D3VD 5ENWA 5EO0A 2KZ1B 1XF5B 4NQEB 2JB6B 2YC1A 2D7NA 1JJUA 3SKOA 3BGFC 3VXSB 4APQB 4WHCA 1QBAA 3QPXH 5HYSG 4WV1B 5F89A 1A6ZA 1VEPA 4FQCH 3QCVH 4P46A 4Z77B 1AQKH 1HEZB 3I85A 4ZUVB 5A16B 3AREC 5HPOA 5I1AA 1TLKA 3ZKQD 3EJJX 3ARGC 4IHOA 3INUH 3F7RA 1BQHB 3WLBA 2F5BH 4YHOH 2A74B 2V2XB 4M5ZH 3ROOA 3BPLB 3UPCA 2NY2D 1KSRA 1FVDA 1T5XA 3QHFL 4ZUSA 2X5PA 3TNNB 1E4WL 4JGUA 4MGXA 1GAFL 3NZHL 5IESL 4CGTA 5I71C 3JWOC 4GW5A 5K9OB 1FNLA 1IRAY 2FWOA 4Q0XH 4U1SA 3TA3D 5ESVB 3SJVA 4XMPH 1N8ZB 2GJ6E 1XIWA 1A7BA 1Y6NR 3DMMD 5D93C 4E5XA 4JKPL 4WVRA 2DQFA 2IWGA 1U3JA 5BJTB 1ORQB 1A9EA 3L3GB 3OMZA 4WDIA 4CJ1A 1UKSA 3EO9L 2VTFA 4XAWH 2P43B 1VENA 5ISZB 3I6LD 2UYLA 1ZKAA 3LEYL 2BHUA 1QFOA 5FM5M 3WL9A 1S7VA 4P23D 2Y6SD 5T3XH 1I4FA 1U8HB 4PJDB 1CLYH 3E6HA 3CSBA 4K2UH 1F3RB 5EOTA 2X1WL 1JF1A 3KNBA 1VFAA 3QG6B 1RUAL 2H32A 3FOLA 5DEFA 3E2HC 2HTKD 3ULSA 4U1LB 1I7TB 4N8PA 5HGGS 3L7FB 2ARJA 3GJFK 3DNKA 5DEGB 4PLOB 4LCWA 3HG1D 3TPKA 2R1WA 3LRSB 3QPQC 1YEKL 3VA2C 5HHMD 5GGSY 2JIXB 3NBNA 3MXVL 5KN5A 1YA5A 4WI7A 3OKDB 5GGRA 3P9MA 3W0WB 3EZJB 5IW3A 1QFWM 2NY6D 4JO4L 4LPXA 4HS8H 3R8QA 3T77B 3KPRE 1LVEA 3P0YH 1FNSH 3B9KB 4PV8A 2ZOLA 3VFUB 8FABA 2OL3A 5DS8A 3EDJA 5ADPH 2IBBA 5ALBH 3UJTH 1BFVL 1VHPA 4FQXB 1MFCH 5GSRB 4EOWH 1EV2E 2Q3AA 4FRWA 4HWZB 4P5TC 2DL9A 4OZGA 1HH6B 1M71B 5CGYC 4O2FA 4RMQA 4QRTA 5C0BD 4B53A 3QXAA 2NNAB 4DGVH 1O0VA 1FZOB 2AJYH 3ZHKA 3O4OC 3C2SA 4CADA 3DX9B 4YZFE 4NHCL 1A14H 5CEYA 1MCHA 2LU7A 2XZCL 5CKAA 1YNLH 1NC4A 4F33B 1EFXA 1QRNA 3NPSB 4GKOA 4R8WL 2JCCB 5J9PB 1WZ1L 2H1PL 4DAGH 1R0AH 5IB1A 4UBDC 1OWWA 2VZTA 5GS1C 5IIEA 3TA3B 1PEWA 3P9LA 5C07A 5CLTA 3I75A 3MRNA 2QJDA 4M6ML 5MENB 3LKOA 4F3FB 2D3VA 1C1EL 2MPAH 4IOFC 5D1XB 5ADPL 2C1OB 5FGBA 3ZL4H 3DVFA 1T1XB 5F9OH 3RWJA 5F7FA 4WRLA 4KK5C 5HYEA 4FFZH 2BVPA 1QSFB 1IGCH 5EORL 3VMNA 4G5ZL 1L0XA 4KXZI 2PYFA 3VGBA 2C5DC 1EAPA 3RWCB 4DKFH 1TMCB 4AMKH 1MI5B 2W65A 3ZKNC 4CVZB 4O9HH 1N0XL 2VH5H 3PL6C 3RVUC 3HZVB 1YEEH 3ETBF 3DVGB 3FCTA 1AO7B 1Q1JH 2F74A 5GGRY 3ZKXC 4M43L 2P44B 4PP2A 1L7TL 1JFQH 3KPNA 3TYGL 4PJIE 1FL6B 4FQCL 4J4PD 4QNPE 5EFIB 4WWKC 2BVQB 3VXTA 1EVTC 2VDRH 4WUKH 3CSPA 1CLCA 3VFTB 1DDHA 43C9B 5C08A 1MREH 3SDDC 3U9PL 2EDKA 4I1NB 4OUUA 4Y4HA 4LLUB 4MA1B 4WI3A 4WNQB 4XPFH 5JNYA 1MIEL 2E9JA 4PRHB 3SBWC 1DUYB 3I9GL 3BDYL 2E9WA 3MNZA 5EZOL 3MLWH 4NDMB 3SKNB 4JN2B 2OJZH 2ADFL 3OR6B 4KK9C 5SX4I 1I8KB 5J89A 4ELMA 3BDYH 3I9GH 2I07B 2VN4A 2A9NH 2ORBL 1T7VA 4AENA 3MUZ1 1G7LB 5EN2A 3MZGB 1I7ZA 3REVB 5D6CB 4NQEA 4RGOH 3R1GL 1F2QA 1U8PA 4XCEB 5ISZE 5GGSB 1QSEB 1LO2H 2DLGA 4HIEA 2PTTB 5GRXG 3BKYH 4W4OA 3LKSB 4HFWB 3H3PL 3HE6D 5JDSA 3MBXL 3HFML 1AD0A 2WLYA 5H2BA 3U1SH 2Y7QB 1AFVH 2KDGA 5DSCB 2HA1A 5I76A 4UU9A 3QIWC 5JA8B 4MJID 3T0WA 1RJYA 4LCUA 5GSVA 1NEZB 3ZDYE 3DO7B 1IQDA 3LVEA 3S36X 3D25A 3T0ED 4JG1L 4QRUA 4YE4H 1ZLWH 5E2TL 4UUJB 2CH8A 3MR9A 5JMRA 1FZJB 2P49B 3CC5B 3DHJA 4U05A 5EBWB 3VE0B 4I5BB 1CS6A 1NCBL 2DDQH 1U8QB 3PV7A 2HKFL 1KCSH 2AKRA 4KJPC 1LP9F 2DQIH 2IBZY 3SGDI 3U48A 1NJ9B 1P2CB 1A4KA 2GSGB 1WBZB 4G8EA 2V17L 5ISZA 1EHLL 4KRLB 5EU4B 4OSUH 4NRXA 2DIAA 3FN0L 3GB7B 2VUYA 1AR1C 1CF8L 1UYWH 1MEXL 3IDXH 2Z35A 2GK0A 3I2CH 1B0RB 2AK4E 4IRZL 2RB8A 2YXFA 4PJGE 3P4MB 1R3JA 4R90H 5KBNC 2BX5A 4M9OA 3KVQA 4PJ7A 4XHJD 4BSVA 1IQWH 3QH3B 5GGTH 1B4JL 4JKKA 1EHNA 2E7HA 1EPFA 1L7IL 5MHSE 1RQ5A 3KG5A 1OGAD 3IT8D 4WTWA 3BZ4B 4JPIA 2ZG3A 4HUUB 1YQ2A 3IF1A 1K8IA 4PGJA 1T22A 1D5XA 5FHBL 5HDBE 4ONFH 2AQ3A 2I5YH 5EBMB 3IVKA 2XWTB 4RCAA 4JREB 1UWGL 2DKSA 2EE3A 3H7LA 5JW5B 8FABB 3MJ7B 1BIIB 4M00A 4CAGA 2VIRA 1GIGL 1CK0H 3WNNA 2R0WH 3LN5A 3QNZA 4Y5YA 4LF3A 5J13C 3CFBA 1QA9A 2ENYA 3DETC 3N1PC 2OX5A 2BRRH 3NCMA 3VFSB 5C0AD 3B8SA 4B50A 1HWGB 3T0AA 2W9EH 4XVJL 4RQQB 1YYMH 1K6QH 1WJ3A 4PG2A 1NFKA 1F11A 3GMRA 4I3GA 4ZSOA 2ITCB 5L9DL 5EB9A 4MA1C 3P4OB 4P2RE 2VDML 2GY5A 3K3QA 3TIDB 3IFOA 4PRID 4U1HA 5CD5C 4KJYA 5L7XL 3PIQB 5FO7B 2FIKA 2VR4A 4JJHA 1F4AA 4GAGL 4M61B 5K33A 1S7WA 3O3AA 3NFSH 3WFZA 5C0BB 1XAUA 1KPVB 2FWOB 4GG8B 3QO0A 3QULB 5DI8B 2ARJQ 2OP4H 3QI9D 2WIIB 3GBNH 3SDXF 2HFFB 5LGJB 1E27B 4JO3L 1TQBC 1FFOB 3E1F1 2JJUA 4MJ2A 1UQSB 1I8IB 3HUJB 1LO4H 3WFBL 4BSWA 5T33H 2Z0BA 4XPBL 5HTSA 2VXSL 3U0WL 1SY6L 1FYHB 1FN4B 4M9PA 1RURH 2R69H 4K23L 5E4IA 5JIPA 2P7TA 2AI0L 3O41B 3RIAK 3LS4H 4PB0L 1GZPB 5IG7A 3HA0A 3KDMB 2O93L 1U0QA 1XGRB 5BS0E 5CUSL 2EEAA 2EYSA 1WZKA 3RTQA 1TNMA 4BZ2H 2YPKA 3EYQC 1HHGB 4JJ5B 1GGIL 4HGWA 3VWJA 2R23A 1VKXA 1I9EA 3MXVH 4ODSL 2IALA 1KPRB 2MKLC 2YUVA 2AERT 3F7YB 3MOBL 3H42H 4PRHE 3MLZH 2QR0A 1Q9KA 5IHUH 1A6WL 1ZHLB 4PD4J 1JI2A 5SWSD 5C0FA 1HXMB 1J1XL 4NKDA 1T1YB 4H1LA 1HHJB 2Q76A 5IF0A 2V5YA 3SDYH 4PLJD 4PRPE 1UACH 4ODXA 4LCIH 5DRWB 1BF8A 4OM0H 4XVTL 3NFPA 5DQ9A 4WWKD 4F7EA 4L3AA 3LZFL 3B9KC 5CEXA 3Q1SL 5CILH 3ZKMC 5BV7H 1SQ2N 5KTEL 1HOCB 4HFWA 3CFJA 3M45A 4JM4H 2XG4A 5C08E 3S5LG 4KTEL 4DKEH 3QZWG 3VW3H 3V7AE 2B5IC 5BRZE 1BX2B 4FXGA 4MXWH 5T5FL 3OL2A 5TQ2H 2IBGA 4HS3B 4PGCA 1BZ7A 3QQ3A 1EFXB 1QRNB 3GK8L 3V5DA 3BX7C 3WSQH 2FJGB 5GSVB 4YHKL 5DQDH 2JCCA 3FTGA 1KCVH 2YWZA 4KVNH 4CMHC 1NCWH 3P11L 4ZPVA 1Z9LA 4WWID 4PJ5D 1N6UA 1ULVA 1BZQK 4M7KL 4M6NL 1QNZH 5T1LB 2ZOKA 4M8QB 4PJEF 4K7FB 3QI9B 3FQRB 4QEGA 3WJLA 3G6AA 4XPAL 1MCDA 2QLVB 3HB3C 1OPGH 2ADIA 1AGFB 3IFLH 3VFGH 5I8CA 3SDAA 4HBCL 3RZCA 4IMKA 2BNRE 4DZBA 2DQUL 3ZMRA 4PY8J 3SE3A 1JMXA 3CFDA 4ZDHA 2BVEA 3TJHD 1FFNA 3OGOE 1IAII 3FO0H 1VEOA 2V5MA 4H0HB 4DN4L 1H5BA 2A6DA 4HJ0C 4TRPH 5EUOA 5MEPA 1KELL 1X5FA 4DGIH 3FZUD 4U3CA 5GGTL 2AXGA 2CD0A 2Y25A 4UQ3A 4Q2ZB 4RAUA 3VXSE 5KZCD 1G84A 2FJFA 4PJ8C 4RFEB 3KXFE 5TPWL 2JK5B 2VDKH 5C9JB 3BAEH 1A22B 1KJ2L 4LLVA 4WTZG 5E5MB 4Y4FC 1I7UB 1A6VH 4PREB 1DR9A 1NBYA 4KV5F 3U4BH 2OTPA 1T5WB 4NN5C 5DD6A 3JV0A 3CMGA 4UTAL 3QZWB 1XGPA 4LKXA 1KYOK 1EA9C 4C56B 2XNAB 3SE8H 2AJVH 1ACZA 1QR1A 2VLLB 1GGYA 2RHEA 4DAGL 1R0AL 5F71A 1CT8A 3DYMA 1LK2B 3MX0A 2WUCL 4ZNCD 1MCCA 1INDL 4KGLA 3S3JA 5HYQB 1FYTB 2G60H 3TN0C 2AJ3B 1N8ZA 4G9FA 4DGYH 3WEXA 5EO9B 3RWHB 2VYRE 3BP7B 2B1HH 5IP4A 3LHPL 1C1EH 1ND0B 3MJ8A 1EEYA 3L3IA 3SBWA 3OKNA 4PJ9D 1M7IB 4G7YL 5F9DC 4X4ZA 1P4LB 2ZZUT 5CKGA 3SCMB 2YHGA 4Y88A 1RZGB 3JWDL 4UV4H 1QLEH 5F8QC 3FRPG 1EZVX 1TFHA 4JHBA 2E3VA 5GS0H 4I0CC 4FQIH 2VDLL 5DUBA 4ZYKB 4Z7NE 3KLAA 1ZT7A 1JNNL 3KPOB 4QYOB 1Q9WA 1FPTH 3LDBC 4G43A 3P9WB 1WFUA 3S8WA 2XWJB 1KPVA 5C70A 3PP3K 3VCLA 4NZTH 4O2CB 4PJBA 2AJSH 3U0PB 1R24B 3VE0A 2IANB 4Y16C 1K8DB 3M17B 3PGDA 5IKCA 1W72L 3MLZL 3TH2T 3O45B 4HK3J 1J1PH 3HC3L 4EUPA 1TQCC 3AS3A 1BD2E 4HKZB 4JG0L 5JO5A 3BKML 4R3SB 3U7YH 2HJKB 5F1OB 1G1CA 4OD2B 4J3WA 1OTTD 3KDMA 4QXUL 2BNUB 3CDGB 1V7NL 4KKAC 1QFUL 3T0EC 2DTMH 2F5AL 4H0IA 2F54D 5FKAA 1GGBL 4JFYB 4MJ6A 1JGVL 1EJ6A 4WV1A 3H7BB 1AC6A 1W8NA 2F58H 4ZUWB 2OL3H 1C16A 3EYFB 3UJJL 2J6EA 4Q6IC 1K2DB 2FIRT 1Z0MA 3H9SE 4YHKH 1MEXH 3PHSA 3O6FB 5HGHB 3A6BH 2GSIB 5EBMA 3PHQA 4U6YA 1MIMH 1ZVYA 1A21A 3ZKXB 3TZVD 1NCCL 3FFCB 4WY7H 1J0HA 1EUUA 1REIA 4P5TA 3WIHA 5JA9A 4B41A 3QXUA 5C0NC 4OZHB 1HSBB 1U2CA 2A2QT 5KTEH 4IS6A 4ONHB 1NGPH 5KAQG 1QSVA 1PYWB 2HYMA 3ES6A 5HGAA 2OI9B 3GUTA 2I9LB 5EA0H 1CFSB 2NY4C 4JZNA 4KPHL 2IBZX 5E8OA 2V9QA 4HUVA 1EEZA 3ARYA 3GNMH 3G5ZB 4YX2L 3GKZA 1TENA 1GC1H 1IGIH 1OAXL 1CE6A 4CVZA 2KPNA 4ELME 1S9YB 1II4E 2VERN 3F65A 2V17H 4K94H 3HG1A 1I4FB 2BHYA 1MRCH 2P8LB 4GXVH 4HUWB 4UTAH 1JF1B 3KNBB 4LLMB 4MSWB 1T1WA 4Y19A 1YDPB 3O3AB 2B4CL 4O58H 4OGAD 5F1NB 1LE9A 3DBXA 4KMQA 5E7BA 3EFFA 4LKCB 2OMNA 1X7QA 4WU5A 3L3DA 4K3DL 3QP3A 5IMKA 1INQA 1J0ZA 1T4KA 3CCHA 4U6VL 2NXYB 4Z0BH 3BZFA 3BW9A 4D8PB 2FCBA 3AFLA 2A6DB 2UWEE 1DFBL 3P9MB 4HJJH 1TVDA 3HNSL 1YC8A 5MEPB 3Q5TA 1ODAA 4PYHA 4I2XA 4HS6A 1RUQH 4DUXA 5I8EB 1OL0A 2VZ1A 4LLDB 1R5IB 1INDH 4D0DB 2VAJA 2ZPKL 5MEQB 3MRPB 1WC7A 3E6FA 1U8NA 2J12B 1IT9H 5JPMA 3VI3E 2PW2B 5DJZA 2J3SA 4MB4A 4MVBD 4H8WL 4NIKB 1A6TA 3QCUH 3OF6D 4NRYB 3FQUB 1HH6A 4LCYA 3BQUA 3IRPX 4NNXB 4PJ5E 5GHWH 4LHJB 3ARVA 3T0EE 3VXRB 1F58H 3F5WA 2XRAL 4PJXF 3L9RA 1S7RB 2N1KA 4ORGA 3QCUL 1HCFX 4MAYC 1QD0A 4N8CL 5D1ZD 1UWXH 2W0PA 3ORJA 3ULVE 1S3KL 3FZUC 1J9CT 3JV6B 5IIEB 1KLGB 4MQ7A 4DOHB 1EDQA 5E9DE 4E0RA 4K3JL 4WUKL 1SYSA 2A9ML 3BO8B 4WUUD 4X8XA 1FZJA 1A5FL 3RX7A 5JW4R 4PTUB 1QP1A 4HMEA 5I1DA 1WIPA 2DLFL 1CL7L 1ZK9A 3O4LA 1YJDC 3KS0J 3VGGA 1T1XA 1FYTD 4AIOA 1IKFH 4L1DA 3UO1H 5T1MA 1FVCA 2ATKA 1EGJL 1NJ9A 1P2CA 3IFPB 1F6LL 4DK6A 3VD7A 1XF3B 3MFGB 1AE6L 1IC5L 4S1QL 5F6HI 5EDXA 1EO8L 1LE5A 3OXRB 5I71B 3QQ4A 5DHYB 4RX4A 5F6IB 5J1AA 4A2LA 5T3ZE 5T1KD 2W65B 2BXYA 4I4WA 4JFDB 3BKMH 1EXUB 3MA9L 1OP3K 3L3JB 3O6FC 1D9KB 2ZCHL 4GAYB 1EX0A 3PWUB 4MX7B 2IPKA 4M8QA 2EDXA 3HPLB 2VLKE 5D71H 4QXTA 1QQDB 1QSFD 3K81A 3MRFA 4MQXD 3LQAL 2B4CC 1W72H 3ULUL 3DOSA 3EJZC 5EOCL 1FIGH 3FQTB 4OLZL 1PVHA 4ZPTB 3ARXA 1GGTA 1LDSA 2YUXA 1I1AA 4OUUB 4Y4HB 1T22B 4HGKC 2CJUL 2CKBL 2PXYD 3KHQA 4Y0GA 4GLRH 2O5ZH 4GKZB 2XWBB 4PRBA 3BN9D 1MCOL 4GUPB 3V5KA 4CN1A 2UZYB 5JW3L 7FABL 5LAXB 1XZ0A 2RR3A 5HI5D 2GFBB 1KIRB 4JGJA 2R2CA 4PBVC 3P77A 4ESKA 1QG3A 2W9LA 2X9WA 5DJ0B 5I75B 1ZA3A 3EYUH 1T04B 4Z7VB 3MFFB 3H6JA 2AJYL 4HIIA 1BFTA 1JGLL 3TO4A 3DGGB 1FDLL 3S4SA 3SDYL 5GGSA 3FFCE 1KXTB 3PWLB 5FO9A 2BY0A 2UWEB 4HIEB 1BFVH 3K2UH 1FSKC 2XA8L 1OD7A 3DETD 3VG0L 4K8RD 5I76B 1FG2A 3EDKA 4BFIB 5CHNB 5TDPB 2HMID 4OGZA 3HLAB 3DHMA 1JCKA 4EDWH 2GAZA 4X9FA 4U1HB 1F3JA 1NEZA 2GK2A 3EO0A 1G7HB 3MBEA 4G8FB 5BRZA 3T0VA 1A1OA 1KJ3L 1HSBA 5C0JB 1C5BH 2FO4B 1YY8A 1PYWA 3PQYA 1FAIL 3ZDZF 1B0WA 1BEYH 1HHHA 1NBVL 3FONA 3T8XB 3BHBB 1NCNA 3HRPA 1IAIL 5D1QC 4LRIC 3SPVB 1LEIA 2ZPKH 5KAQF 1K6QL 3C2AH 5ACLA 2C7UA 1U8LB 2CUHA 2CDGA 1YJDL 1QUNA 1SYVB 2NY3C 3GSVB 3E3QC 4ZTPH 4LLQB 1R3IL 5L6YH 5JW4N 1A6UL 4LSPL 5AUMB 5FYJH 4X9HA 4YDJB 4CKVX 1MJJA 2Q7NA 4MA7H 1AD9B 3MV8B 4OB5L 1U93A 3U4BL 2VDRL 4DN4H 3PXJA 2R2HA 4MXVF 3S96B 4Y2DD 1NLDH 3UAJD 2ATPB 5EPMA 4WWKA 4EN3C 3RIFF 4JAMB 1G9EA 5E8PB 3PGFL 3L6FA 3S37L 3WKNA 4CVXA 1BQUA 4FQPA 1UZ6E 2DLFH 3MCLL 3RUGB 4JM2D 4Z0XA 4X7TA 2UVFA 4K9EH 4L5FH 1WAAE 1BD2A 1UZ8B 3GSNH 2AQ2A 1L6XA 1MWAA 4G6KH 2B8OT 2BP3A 2QSCL 1OY3B 2EEDA 2X1QA 1U95A 5C0CB 5AWNL 2P5EE 2ITDB 3GJFB