4YHZH

Crystal structure of 304m3-b fab in complex with h3k4me3 peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
219
Chain Sequence
EVQLVETGGGVVQPGRSLRLSCTASGFTFRDYWMSWVRQAPGKGLEWVADIHQDGQVRYYLDAVKGRFTISRDNAKSSLYLQMNSLGAEDTAVYYCARNFVRGFGWHFDLWGRGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Antigen clasping by two antigen-binding sites of an exceptionally specific antibody for histone methylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Fab Heavy Chain
total genus 48
structure length 219
sequence length 223
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhzH01
4ORZC 4XNXH 2Q7NA 2ICWJ 2VDKL 1XGTA 5D96B 3MCLH 4K7FA 3RA7L 2V9QA 1JPGB 3ARPA 1GVIA 4ZPVB 4KVNH 1A7PH 3C8DA 1BIIA 2BDNH 1UZ6E 4HUKB 3I50L 4NZUH 1A7RH 1AD0A 2EYTA 1UM4H 1HH9A 3B9KB 4JZNA 5K9JH 2AXFB 1RUAL 1UM6L 1S7XA 4LVNB 3NTCH 5KVMC 4JO2H 4MA8H 4ZTOH 2OSLB 3CDYA 2C1OB 3RKPA 1NBZB 1VPOH 2QADC 5FA4B 5GS1A 5MENB 1FC2D 4UV4H 1C1EH 3L7FB 4S1SL 5DJ0B 1QR1B 3ULSA 2NY5H 2ZWLT 5IV2A 2ZSVB 4HIIB 1MVUB 1R3KA 3L7EB 4WU7B 4I1NB 2JELL 3R06B 1ZT7B 1N64H 5CILL 4X4XB 4M3KB 4X8JA 2AXGB 5K9KA 1TVBA 4UOW0 4A6YL 1DBAL 1QR1A 1B0GA 3GRWA 5FUZH 5FIEA 1U8NA 3ARFD 3GNML 3EHBD 1FFPB 4Y5YC 4YAQA 2ICWI 3RZCA 4XCNA 4OIIH 4KK8D 2N4IA 1ZT1B 2HJKA 5DVLA 5HHMB 3KPLB 5JPMB 4YC2B 2DQGH 5KSBE 1H0DA 1PY4A 4IRSB 3I75A 1OAYL 3WIHA 1DE4B 5HDBF 1X5GA 3TH4T 1FCGA 2V2XB 3WV0A 1U95A 2EICA 5CJQL 3L3HA 2Q3ZA 4LSRL 1OCWL 1XGRA 5F3HA 3VXQB 4M8QA 3MRDA 3BP6A 5D7IE 5JXED 3R8BB 3KPPB 5FDYA 2FX9L 3K0WA 1OVZA 3DNKA 2B0SH 4FA8A 1EVUA 2GTZA 1HQ4A 2PTUA 5GSVB 2DQFA 4FQPA 3ISWA 1BIHA 1T83A 5EOQL 4EIZC 4HPYL 5H8DA 2OK0L 5I1GL 3PGDA 1RK0B 2Z31C 4FFWD 4LNRA 4M7LT 2RJMA 2VLJA 1O5DT 3MRIB 2VOTA 4K9EL 4DQOH 1PKQB 2QJDA 4ISVB 4QRPA 4EXKA 1EHAA 3T0BA 4PJIE 3NZ8A 2CDEB 1FC1A 2BOBB 2NX5D 2EIBA 2OJEB 3VD9A 1SHMA 3UBXA 4HKZB 5IMKA 5B3NA 5F72S 5DUML 1FYHB 4GAJL 2H3NA 1IGMH 4NNYA 2N7AA 3EDFA 1PDKA 4RNRB 3TIDB 4RRPA 3GHBH 1BJ1H 3H9SA 3MFFA 3EFDL 4JKPH 3NIDE 2UZYB 2ENSA 2YPKB 4HIJB 5EUKB 4OV5A 2MNUA 3EO0A 5D4QA 5DMGD 1FE8L 2BSRB 4JO3L 4JY5H 3U82B 5I8EA 4UV7L 4NZUL 1KB9J 3AS2A 2DKSA 1CFTB 2XZAH 3SHSA 4X83A 3BPNC 5T5NF 4GUPA 3RWDB 4MCZB 1DFBL 3ARDC 3QJFB 4JRYA 4Z7UA 3CFKB 4U05A 1AIFB 3MV8A 4Z5RA 1MIML 2AKRB 1YDPA 2AI0L 3MRFA 1FAKT 4RMTA 1A2YB 4POZC 5C0AD 4HGMA 4U3XA 4Z76B 5FECA 2Q7YA 2FATH 3TFKC 1YN7B 4OZHB 4WNQB 5EU6D 2BY1A 4RSVA 2DIBA 1CE1H 5T1KA 2V17L 4PGDA 1FNEA 2J8UA 1UENA 1GPOL 2ATPB 1TQCB 1MF2L 3P0YL 4I0CC 4K3EH 4F58L 4UNVA 5AZ2L 3AU1B 3VXUE 1MH5B 3CX5J 5AAWA 4P59L 2J88H 3MJ9A 4XMLH 4C57C 4TN9A 4CN4A 1I8MB 1NLBH 4LGRB 4RFOH 4ZOEA 1T04B 5IM7A 4U33A 2NY6B 3O4LE 3MJ7A 4C56E 4Z9KB 2BCKB 1OP9A 3UTSA 2AK4D 2RFXB 3ZE2E 3EYOA 1MI5B 2PUQT 1CN4A 2B5IC 5DA4A 3U0TB 4DN4L 7CGTA 3G6DL 1U3JA 5IB1A 1WEJL 2VERN 5HPMB 5CMAB 3WN5B 1QPXA 3S3JA 5EBWA 5A2KH 2DWEA 2EDKA 3BRFA 4ELKA 5E8OA 1B6UA 2IAMA 4FABL 5CGMA 1KXTB 4HS3B 4I4WA 1SMAA 4U6VL 2MWCA 4KK6C 1QFWI 4O51A 3GSNL 5C6TH 3GMNA 1NMBL 1D6VH 5H35A 3OF6A 3BWAB 3ZMRA 5IW1B 3A0OA 1BD2A 2OXHA 4HX1A 1DSFH 2XWTB 3P11L 5DEGA 3RUGF 1K9TA 4L8DA 2I9LA 1UVQB 1GAFH 3A6BH 2DLFH 3UJJL 1P5UA 3DVFA 4MD5A 2DAVA 4TQEL 4M5ZH 4OZIA 5IBUB 2GW5A 4MQTB 2CLZA 3JV5A 4N5ED 5T1LB 3IDIB 4X6CF 2E7BA 3RL2B 5EIQA 3KXFD 2VC2H 3GMLB 4G6AC 1QYGH 3MLZH 4KRMB 3O41B 2C4FU 5DO2D 5C0EB 4OD2B 4MDJB 2D7OA 4XWGL 4FFYH 3EFFB 3OZ9H 5DK0A 5IVXA 3SO3B 3VMPA 4F7EB 4V1DB 3HB3C 4XRCB 4WDIB 2FR4B 1KENH 2X4NA 3W9DA 1V3LA 4TUJA 4N0UE 4UNUA 1NCUA 2P8PA 3N85L 4Z7VB 5F9WB 4NZTH 3IJHB 1F4XH 3KYMA 3HE7C 3IF1B 3CDCA 3ELAT 2NY3D 4XP6H 3KYOA 2EXYC 1QRNE 5HYJE 3CSYB 3U36A 1TZIB 4NGHL 4R3SB 4K3DL 4NHCH 3QHTC 5DD5H 1R3LA 4Y0GA 5GISH 3OPZL 1FPTH 4DVBB 4L3EB 4LCWE 1FNFA 1PQZB 2H41A 4KROC 4IRJA 3NCCB 4XXCA 3T09A 2C4XA 5F3HB 3QXAB 1DN0A 4WVRA 1Q1JH 3D18A 3DRTB 1TNMA 4EZMA 1ZEAH 3GSOB 2DLEA 5GRZA 2C3XA 5MEPA 3D0LB 1KJVB 4PJGB 3A6CH 1JF5A 5C86A 5BV7C 4JRWA 3S5LG 4FQXB 4C83A 3ARFA 1LGVA 5EFIB 1TMCB 1AGFB 2HT4C 3FN0L 1ZWIB 1EZVX 3EO0B 3IU3A 4X7EC 1NUDA 5CEXB 4B0MM 4OLZL 4NO3A 5F7LB 3PJSB 5DD1H 3R1GL 1Q9OA 3W11D 3HPJA 4RMWA 1FNEB 3O8XA 5JXEA 5IMLB 1BBJA 2Q20A 5FO8A 3GJEA 4XNUH 2HT3C 2ICEA 5ANMA 4PJCE 2GK0A 4UQ3A 5E6IB 2P8LB 1JWSB 2F58H 1K3ZA 1YDPB 2F8OA 5MP6H 3Q6FB 4PV8B 4JFDA 5MEOA 1BFTA 2BVPA 4Y2DC 1QRNA 4G8FB 4OCRL 4EIGB 5E03A 3RWHB 3RL1B 5KVDH 2V7NB 3GJFK 3L5XL 3EFFA 1A1OB 1N7ML 1NMBH 1K4CB 4YDLB 1MCPH 4LVOB 4V1DA 4XRCA 1J1XL 2HRLA 3T4YA 4QRTA 4XC1H 4P2OA 3DV6A 1OTTC 1ZT4B 5DJ2A 4D0CB 4Y88A 2BSRA 1WK0A 3U9UB 1HXMB 4G7YH 2B1AH 2ESVD 1GAFL 5HTSA 1SQ2N 4RBPH 3QWRA 4P5TA 2AV7B 2HWZH 4NDMA 4HIEA 5CJXC 1ZKAA 2NX5A 3C5ZA 1IAMA 1NBYB 5A16B 3AREA 2QBWA 3DI2B 5AG8A 4PRHB 3LRSA 4AMKH 2FECL 1I8KB 4HG4J 3ULVH 3AB0B 2AV7A 5GRUH 2W0LA 1YEKL 1ACYH 5EUOA 3IJSA 2YPLE 3O3UN 3RU8H 3V79C 4X5LA 4ZO8A 4RMQA 1EJ6A 1NBVH 3VRLE 2IADA 2ZSWB 1A9EB 1IC1A 1RUKL 3V52H 1KIUA 1BFVH 3HLAA 4XCCL 5E8NB 4FXGB 2F8XC 1MFAH 3F58H 1ZHNB 4OM1H 4YAQB 4XGZB 2ADJB 1KCLA 3TWCH 1FLRL 4UT9H 1XIWD 5LVEA 5D93B 3BKJL 4OI9A 1PVHA 1XR8B 2GTZB 4WUKH 5IW6A 3T0AA 4LLUB 2APWA 5DUBB 3KYKH 1JWMA 2IBZX 4JREB 1S9WA 5HBBA 4QT5B 3LEYH 4POUB 5IKCB 3V95A 3B9EA 4BK4A 3QULB 3HI1B 4ZFOB 5D6DC 3NCJL 4P9HC 2Y72A 3BUYB 2RHEA 1X5LA 5E7FA 4ODSL 5ADOL 2DTSA 1TIUA 5T1KD 3QI9B 1X5YA 1NFIB 3BN3B 5D7KE 3D5OF 3RZCB 3VD4A 4XPGL 4LU5L 4HWNA 5D8JL 3TCLA 4F7PB 3JTSB 4NIKB 3UC0L 4X4YB 5C0ND 1SVCP 2BVYA 1ZHLB 2DBLL 1FNSL 4LARL 2AJVH 2VXSL 3EZ8A 3S37L 4FQJH 1U8LA 4G9FE 4X8JB 5EULV 1N0LA 1U8JB 5CJ8A 3TZVC 5B39B 5D5ME 2DLTA 1H3VA 1PLGH 2BJMH 3PABB 4EXPX 2DYPA 4GXUM 3JV4A 2L7UA 3I02A 5GGQL 4WO4B 2AJSL 5EZIL 1IEBB 2XWJB 2AV1B 3VH8G 4KWUA 3PHQA 2AEWA 4IRJC 3VFNB 1TTGA 1V7NH 3SGEI 5B3JE 3CH1B 2Z8SA 3LS4H 4ELMA 3T0XA 5FKAA 2LU4A 3OHXB 3HKFA 1BFOB 2WBJC 3MV7A 2J4WH 4JN2A 1JYXA 4BQBA 3ECBB 1T2QH 5JTWA 5B8CB 4G9FD 1G7HA 1YA5A 4KKNA 4P2OC 4EUPA 4L8BA 1LP9E 1DBKL 3ROOA 3S35L 5C2UB 3V6ZB 5T1LD 1PG7W 1YNKL 3DMMC 4OQTL 3FOMB 3N06B 4HBCH 2AK4E 2C26A 3FONA 4Y4HD 4DVRH 1R0AH 3HC4L 3SGDH 4KKBC 4RNRA 3CLEH 1Y6KR 2OTWB 1QKZH 4F57H 3CK0H 3NH7L 3VXNA 3QZWB 2LU3A 4HIHA 3FL7A 1OP5H 3MRIA 5D5MA 3KPSB 4XNYL 3U4AA 3FFCB 3S98A 1I1AD 3QFDB 2OL3A 2CDEA 5HGGS 5D2NB 5E6ZA 3SGKC 2LABA 4OSUH 4PJ8D 3MV9A 3AAZB 3DRQA 3ZSTA 3OB0H 4X9FA 1EEZB 3FFCA 3JV6B 4M61B 3MJ8A 5DJAB 2A74B 4TTDC 5EUOB 2EKSB 4OGZA 1H3PH 1WV7T 4J8RA 4D3CL 3S88L 1IT9H 4PJ9A 5HI5C 1G7LB 2JIXB 5J1AA 2BCKA 3C2AL 1VFBA 5FYKH 1RZJL 3GB7A 4WEMB 4FTVB 4P9HH 4HIEB 1MCOH 4CKVX 3GMQA 5H94B 4JO4L 4I18C 4L3EE 2EH7H 4K3GA 4B7LA 4J6RH 2JCCA 4LOUC 5FM4A 2FJFB 2QKIA 5IFAL 2UWEE 4FHBD 4BUGA 2XPGB 4XX1G 1A7RL 1FG2B 5CWSB 3LN4B 4WCYL 5IROA 1UEYA 1DL7L 5L88H 1T21B 3FO2A 2FB4H 4HIXL 3J7HA 2PR4H 3OKDB 3MRLB 2NY5C 4FQCL 3QJHB 1QZ1A 1H3TA 3RQ3A 3L95A 4ZSOE 4F2MA 4LARH 4GG6B 3VG0H 4L3ED 3FB6B 2VIRB 1Q94B 4PR5A 4P2RA 2HYMA 2YA0A 4QY8A 4YGAB 1I7RB 1U8KA 2VLLB 1MVUA 4X80L 4DN3H 3IDXH 3CFDB 5KANI 1QRND 3F5WA 3QCVL 4WUUA 5D1XB 2CRIA 4CVXB 4OFKA 3BZFB 1E27A 4ODHH 4UOJA 1RVFH 4W81A 4XMKH 1DQMH 1DCLA 3B9KA 1P6FA 4LKXA 4ZFZA 3UROR 5T33L 1CFQA 3L5HA 2G75A 2A6KA 1Q8MA 3IDJB 4NN6C 4OIIL 3WS6C 2OZ4H 1FV1B 2OLDA 3AS0A 4JPKL 4PJIF 1KB5B 5I71B 3C60B 3GMPA 1L9NA 1QNZH 1MCLA 1UM6H 1NC4B 4M1GH 3WO4B 5FK9B 2YWYA 2IC2A 2ZKHH 4LAJH 2M26A 3OKEB 2WUCL 5F70A 1MWAA 2BX5A 2FLBT 4HK0A 3T3MF 1IGTA 4HK3N 4LBEB 4HUVB 4U2YA 4UIKL 3FRPA 3RVWC 5CZVL 5I2IA 4QHUA 3K1DA 1OPGL 1ND0A 5F97E 4PJ8B 2PW1B 1H9VA 3ABZA 2DQEL 3VXME 3KYOB 3SEPA 3WIIH 2WUBH 1MCRA 4RGMB 1UZ8A 4AG4L 1KN2L 2VR4A 1IZKA 1T66C 1CXKA 4QTIH 5KSVA 1CIDA 3VWJC 4YHZH 1C7SA 1JFQL 1RHHA 4FXGA 3T2OA 2JJSA 4DQOL 4DGVH 1V3KA 3QZWG 1PZ5B 2X44D 1JNHA 4PJBA 1JK8B 1XCTA 2V5SA 4JG1H 3OL2A 1OAUH 2E6JA 3EO1A 2OQJA 1K8IA 1OTUC 5GGTA 3VXMD 2BERA 3KVQA 5BO1H 3H2WA 4ODBD 2X7LA 4L4VB 5L2JA 1NDGB 2NR6D 4HWZB 5FFLA 5CBEB 5CJOH 5CJ5A 1I1AC 2DLHA 2NLJA 4D0BA 4U1IA 2NXZD 4XNXL 2HTLC 5CSZB 4WU5B 4HAFA 5CSBA 4JZJC 3MJ7B 3O2VH 4XPFL 5F96H 2X4PA 1JGEA 5CZKA 5FOBA 3ZO0A 4EI5C 5J7CC 2ZCHL 5D7LE 1I3GL 1F6AA 1Y0LB 4FQLH 2B8OT 1CFNB 3FQXB 5IB5A 5LG1A 3D3VE 3T2PA 1T3FA 1XAUA 4UV7H 1ZMYA 5D6CA 4U3CA 4MB3A 4WFHE 5J56B 4HUMB 4M03A 3HE6B 3HB3D 4JCMA 3RWHA 5GS0D 1RUAH 3U0PA 1B0GB 3SCMA 3VXTB 5A2FA 4FZ8H 5HGBA 3V6OA 3U4BL 2D2OA 1T89A 4M1CC 3MRJA 4RWYL 4O2EB 3SGJA 4RGNB 3QUYD 5HPOA 3OAYK 1A9BB 3EDDA 2Z91B 4LL9A 3ARDA 1RU9H 3SGJC 2LTQC 1HZHH 4N0FB 3HPJB 3G9VA 5I15H 4GLRH 3RVXD 2HLFC 4DK3A 1GL4B 1MI5A 3RVXC 4Z76A 5ISZE 1Y18A 5DURD 4U1GB 1KJ2H 3RWFB 3NN8B 4JQXA 3R8QA 4GQPH 4XMKL 1QFUH 3H9SD 2J8OA 1LK3L 1LO5B 2YHGA 4NQCE 1NMAL 3GNMH 4FNLL 4BKLB 1EO5A 1XR9A 4JPKH 4NPYB 2AQ2A 3EYSL 1RJYB 1GGUA 4FXKA 5HI4C 1A3RL 5DI8A 2JCCB 1S7RB 5J0BA 1MCWM 1PD6A 2H32H 4J4PA 5D7KD 3WSQH 4PY7B 5FUCE 3MCKB 5E5RB 2MQ3A 2ORBL 1NANI 3EYVB 4LSRH 2DTML 3O9WB 3CPLA 3GBNH 2R2CA 1P2CB 3G5ZA 2NLJB 3OJVC 4OF6A 4D2NA 1J8KA 3BQUB 5GGTL 1IGJA 2YD1A 1QVOA 2A74A 1KEGH 1Z3GL 3WIIL 2X4QB 1MJ7H 4JR9L 3V4VH 3GI8L 3FB6A 2BNQA 3C6LA 2E7CA 1EGJL 5ALCH 1K3IA 5IFJB 1NCDH 1QPPA 5KAQF 1AQDB 5GS3A 1D6VL 3SGDI 4X7DC 4MDJA 3CGTA 3MLRH 4MQ7B 5EB9A 2ZSWA 1T1YB 4QRPE 4LEXH 5TDOA 2IANE 1KFAH 1XT5A 1IE5A 2F54E 5IJVB 2VZ3A 3BPOB 3HZKB 3GSUB 3QEQA 1CLZH 1V7MH 4I3RH 2PYFB 2NY4C 5HJ3B 5DHYA 5C0CA 5J6GB 4MNQD 3RPIB 4Y8AA 5FF6A 4WFFE 1ORSA 4UILL 3G6AA 3KAAA 4KC3B 5E2TL 2P47B 4JFFA 1FLTX 4F7CB 1FVDB 1KCKA 2IH3B 4OCWL 3HNTH 1KIRB 4W70A 1J87A 1OP5K 3RWJA 2AERT 2E9JA 4LLYA 1AE6L 1I7TB 1KF9B 2F54D 3MYJB 2FX7H 3QIWA 2FJHB 2FGZA 4HEPG 4KK5C 5KTEL 4KHXL 4PJ5B 2KQMA 2WLYA 1G6RB 4QYOB 3A67H 4E0RB 5C07E 1FQ9C 4ORGB 5E70A 1GGTA 2XZAL 3MODL 4XNZB 2X1XR 3V4UL 3WYRA 3X11A 5KSVB 5C70A 4U3HA 4W6YB 3BP4A 5T5FH 5CSGA 1RHHB 4NZTL 1F4XL 3SE8L 4XH2B 3VGAB 1TJIH 5GGSB 1AGEB 1BD2D 5C92A 1KLGA 5E5UB 3DO7A 4JM2B 3D85A 3BQUA 1HYSD 2W9DH 2VXVH 3QUZC 3UJJH 5D7IF 4LSPL 3MOAL 3WDHA 5GRYA 4MNGA 3I6GA 5C71A 1ZA3A 3MUGA 5B22A 1CICB 1QYGL 1MFNA 4TNVF 1X6LA 5ABDE 4ONHB 4RGND 4RGNC 4UTBL 2YRZA 1EH9A 1I75A 5T3ZD 3BJ91 4I48B 3WFHB 1G6VK 3B9AA 3MNZB 3OR7B 4NNXA 2DQCH 2NZ9D 3RDTB 4Z6AT 3O6FC 4CDHA 4DCQB 5LAXB 4PGBB 4EBQL 1F3DH 4N9OB 3HAEG 3SCMC 3UYOD 1QFWL 3H9ZA 4NNPL 3HG1B 4U31A 5AAMA 4LFHD 3V4PH 1TENA 3CFCH 4JFHD 4X6DE 3UP1A 1CD1B 3JV4B 4TPRL 5HGDB 3TN0B 1T6VN 3BDXA 4KZEH 5DFVD 3AXLA 2VAAA 4Y4KA 2APXA 2ATKA 4PJIB 5BZWB 4M62L 3EJZC 3VE0B 3EJZD 1ZGLA 2H2PD 5FDWA 3VA6A 1RULH 4ZNEE 5CBAA 2VH5L 1JNLH 2V7HB 3F7VB 1QLEH 2QLVB 4A2MA 4APQB 3F65A 5C09A 3RTQA 1J1XH 1NC4D 2EYTB 4N0YH 1YMMB 4KK8C 3O3AA 5GJSH 4Z0BH 3CZFB 3H7LA 4XP4L 4PRNA 4JFOB 5CZXD 1BMGA 3DMMA 4P99A 4AIXA 4K7FB 43CAA 4GT7A 3Q5OA 3QWOA 4D0BB 3QEHA 3F7YB 3IDNA 2CIKB 2NX5B 1ZLSL 1NGQH 2W1NA 4ONGH 4W4OA 3K4ZA 4AEIH 3P9LA 3OKOB 4QT5A 1QLRA 3ULVL 3MA7A 5L8LB 5JDJA 1G7LA 3BH8B 4MQXC 1MREH 2OR7A 1CZ8H 4H1LA 5E2WL 5E8EB 1OB1A 4GBXB 3S36H 2NY4D 4XCEA 4PJFE 2CK2A 5D2NA 3DUSB 4LSUH 3MBEC 3EUUA 5GRVK 3LKQA 1WZMA 2E9IA 5BQ7A 4JRXB 3QFJD 2Z8VC 3MQIA 4P5KB 4NJ9H 3P4MB 4QNPF 3QIWC 2XG5A 4OCMC 1UWXK 5E8NA 3VRLF 1CGYA 1FL6A 1SJEB 1IEBA 3W9EA 4RBPK 3KR3L 5ERWB 2AABH 4JFEA 1NLDL 4PJFF 3U2SA 4ETQA 1MHCA 1UZ8B 5HPMA 3QA3B 4CUCA 35C8H 5EBWB 3O11A 2FO4A 1XGRB 3KPMA 3MOBL 2NW3B 3O3BA 3VXQA 4TUOA 8FABB 2R0KL 5JR1H 4JGMA 1TLKA 2XKNA 2FHFA 4Q0XL 2DQIL 2JB6B 1GCFA 5FOJA 2BZDA 1SEQL 2W0KA 3L3GB 4F3FA 4UMGA 3KHOA 4HUVA 3CPLB 3GJFH 1YC7A 2JIXD 2MKLC 3QFJE 2YPLB 4LCIL 3W2DH 2HAZA 5D1QC 2UYLB 1T6WA 2OI9B 4FG6C 1DLHA 4IJ3C 4H5SB 2YR3A 4U7MA 4I0KA 3VFMA 1KIPB 3PE9A 2QV2A 5IROC 5MEND 2DI8A 3DO3A 1HI6A 1VKXB 1VA9A 2X4RA 5EN2A 5DI8B 3TLRA 1BBDL 1J8HB 3C08L 3CH1A 3H3PH 4Y16D 3STLB 8CGTA 4OM1L 3ARBB 5A40E 1DBJL 3MRQA 2RB8A 1QHOA 5F1NA 2V7NA 5HHVL 3QULA 1B4JH 3NA9L 1BLNA 1RIVL 1P4LA 3WNPA 5F9WC 5F6HJ 5FYJE 3DX7A 4I2XE 1G9ML 2PYEE 3EBAA 2BNQD 5DTFB 5EOCH 5DJ0A 4QHMA 3FB7B 4JFDE 2CSPA 3RA7H 1KSRA 3VFSA 3C09C 5A1AA 1JUFA 4S10A 2EDRA 4QXTB 4XBGA 1FH5L 2RIKA 1A4JB 3O2DL 3CMOH 1MY5A 1Z9LA 1HQRA 4IMKC 1RIUL 2AQ3A 1WZ1H 2EYSA 3LCYA 4ONHA 5K9JL 1UZ6F 1HK6A 1CLOH 3TNMA 4GAGH 5DHVH 3MREA 4EOWL 1I9JL 1QG3A 4XBEH 4CVZA 3MRMB 1NGWB 3U1SL 7FABL 3LIZL 3MRBA 4KRLB 5F1KC 3EJYD 1S78C 1C16B 2GT9A 4L8DB 1I9EA 5B4MC 1AFVL 4F57L 5HGHB 3CK0L 3MLYH 3GMMB 4JQVC 1KN4H 5JORB 2FIKA 4TSAH 1ONQA 2AJSH 5EZIH 4A6YH 1DBAH 4HZLA 2R0ZH 3BVNA 4OLWH 2H8PB 1FRGL 4PJ5A 2F19L 2BC4B 3DROB 4XNMA 2IJ0C 1RJZB 4R9HA 3OGOE 4EN3B 4QRRB 5DC0A 3IDYB 4NKQB 4PY8I 1V8HA 2ZNWA 4ALAL 3RTQC 1B2WH 4HS6B 4UBDC 4WHTB 1KPUB 1EHNA 32C2A 3SDXA 3BWUC 4XZUB 2VUYA 2NW2B 4HKXA 5CHNA 4PJ9C 3SDCA 4CADA 4JY6A 2NR6C 1UM5L 4YXHL 2V2WA 4OZHF 5C2BH 2W60B 1V05A 5KBNC 2APTA 5F89B 3O2DA 1OTUD 1INDH 1RZGA 4G9FB 1YJDC 3D85D 4Y19A 5MEQA 1MCDA 3H9HB 2IALB 4Y8DC 1PX4A 2OXGA 4CADB 4FMFA 5IJVA 1A3LH 3MMEA 1D5MB 3GIVA 4WFGE 3NZHL 1N4XL 3LSOB 3BKJH 3VA2C 3REWB 3B43A 1OAXL 2X4SA 2BSTB 1P7QB 3E3QE 5L88L 1HILB 3JWOC 4IRZH 3D18B 1AQDA 1F02I 3BXNA 5JOFA 2AXGA 3DVNA 1DVFD 5SX5H 1OGAA 3VWKB 4XVUC 1JTPA 3T1FB 3KPSD 3HFMH 1NCCH 1IC5H 5T1KB 3WE6B 1M6OA 3I6LD 2YK1L 2O61A 4MAUL 1KLFA 5KJRH 1JF6A 2NY5L 2IAMB 4PJAE 5CFHA 3S37H 1JV5A 1CICD 2GFBA 2FZ3B 3ZKSD 2M8XA 2I07A 2BDNL 5I6XB 4X80H 4DN3L 5DQJA 1IT9L 1Q9OB 1GC1L 3MRFB 1BVZA 2BFVH 1D5IH 4L29A 2W9EH 5EU3A 3WJLA 4F9LA 1V7NL 2HFTA 5EO0B 3MRQB 2CLRA 1PYWB 5JQ6L 1V3MA 3P4NA 2VAJA 1P4BL 2Q3AA 4KVNL 3KPSE 2ZUTA 2DQHL 1MUJA 5C08D 3T65A 5FM8A 1QSEE 3GRWH 1A4KA 5HGAB 4OF7A 4WCYH 1ZE3C 2WQ8A 5LBSL 3BHBB 1L0XA 1CT8A 4NYLA 3LHPH 1KCSL 1EDQA 1IAKA 5J1TC 5IEHB 1RPQA 4K3HA 1R3LB 1J5OH 2X4UB 1NDGA 2NY1B 4HUXA 1R0AL 4Y4FA 4NHUB 1AFVH 4PTTA 4Y4HC 1ZS8B 4Y1AB 3O3BB 3BDYH 3RAJH 3MRJB 1QSZA 3KG5A 4Y5VA 2H26A 1CDCA 3QRGL 1KULA 3GEWB 3BAEH 4UINL 4ONFH 4HAGA 3W9DB 3QXUA 1PG7H 3JUYA 2OJEA 2V17H 3V7MA 1D5XA 3CXDH 1ED3A 4UUJB 3WFBH 3DI3B 4S1QH 4JKKA 3RWCB 2A9MH 5DJYA 3TA3C 4MSWA 5SX4I 1KB5H 3WJJC 3WKMH 5DJXB 3AC0A 1T83C 1S9KC 4GW4A 4W68A 1IAOA 4XBPB 4U7KA 5ESAA 5C0JB 4WY7L 5FKPB 1GGCH 4H8WC 1WIOA 3VFVB 1I3RA 2QSTA 4UB0H 4M7ZB 2LVEA 4OLVL 3HZVA 5A3ID 5ID1A 5HGHA 3FFCE 3M1BA 3MXWH 5I1CL 1OGTB 4R97B 1WAAE 4NQTA 4YR6B 3BKML 3QHFL 1B90A 1WISA 1MNUL 5ILTL 5EOQH 5TDNB 1ZHKA 3FOMA 1UVQA 4ZAKA 4JE4B 3ZTNL 1J1PL 3BGFB 3BKYH 4YR6A 4Z7WB 3VXRB 4MHHG 2B0SL 2MQ0A 4NQEE 32C2B 3SDXB 4APQD 1LNUB 4PRIA 1NGPL 1D6EA 4M9PA 4X9HA 1LP9B 1WWAX 3HCVB 4GKNA 3SKOB 1MWAL 4QRTB 2PKDA 1IMHC 3SJVE 4U2ZA 2AQ1A 4ZFFB 2XFXA 2XRAL 5IESH 2BNQB 2VABB 4RA0C 5B8CC 5BS0B 4RZCB 4R4BB 5KJRL 4NKDA 4OZ4A 3RJQB 4L4JA 1CD0A 4J6RL 3P73A 5IB1B 3N50A 5IHZA 3CFBB 1DBBL 2XG4A 1JMXA 4EUPH 1J0HA 4M5ZL 4Y19E 1CFSB 2XZQL 2Z4QA 2R2BB 2UWEF 5FK9A 1D5IL 1ZHLA 2QL1A 4CMHC 5HHNB 2R0LL 2C1OA 2EDBA 2XIDA 5EBGA 3U30C 4BQ6A 4RGOH 1FFOB 3T0WA 1UH4A 4BZ1L 2G9HA 3E6FB 3OR7A 4NNXB 1EHLL 1BREA 4TVPL 5EBLB 3X3GL 2AXJA 3V9FA 3X17A 1YEHL 1I1CA 3FQUB 3LQAL 3JVGC 5F6IB 2NCMA 1UXWB 4FTVA 4DUWA 1VHPA 5C0BD 5HYFA 1DQML 2VWEC 4NUGH 4LLQB 3MLSL 4MLIA 4F58H 3E6HA 3BDYL 3RAJL 1ZXQA 5DMYA 3CFJA 3UX9B 4WJ5A 3FAXA 1CF8H 5FECB 2R56H 3KYAA 1K8DB 4OFIA 1EJOL 5GGSA 3O9WD 1T21A 3FO2B 2B2XL 3O6ML 1T1XB 4P2QA 4YXLH 1BPVA 4JPVL 3WJLC 3UPRA 5IUSA 2NXYD 2ADIB 1GGCL 1RUMH 5F7NC 2B4CC 5C3TA 1H3XA 2CRYA 2Y1VA 4U0QB 1H3GA 1G7QA 3ARGC 4J3WA 1HIMH 4X98B 5IK3A 5HDLA 5TQ2H 5EZOL 2CLVA 3ZDYE 1T0MA 2DI9A 1KIQB 5FCUL 1OARH 4IM8A 3NPSB 5CJOL 3UAJC 2W60A 3GO1L 2ZJSL 2BVOA 3EYFA 4WENB 4J3OC 5T1MA 4DZBB 3BPOC 4HV8A 4W6XB 2XWBA 4P5TB 1J1PH 2VE6B 4TUOB 1G6RH 5AD0B 4NM4L 4WI6A 3MLUH 1AE6H 1XGYL 1PEWA 5CCKH 5DEGB 2HN7A 4MQ7A 1ITCA 1MIEL 3KXFA 1YEFL 2IWGA 1QSFD 2IG2H 3OQ3B 2HFFB 2NY6D 2DLFL 2I27N 4OIAA 1D5XB 2XXMB 4QXWA 1DVFA 2A0LD 3O3EB 3U4BH 4OKDA 3VFPA 3ESUF 5E6ID 4E41B 1KACB 1QSFB 2DM4A 1XIWC 3BQUC 1ONQB 3BOVA 1QHPA 2FJGA 3LEXA 5TE4H 5TE7H 5D70H 3BIKA 5BCAA 3KLHD 2EIEA 4KI5C 2IH1B 4ZOCA 2QQQA 3P4OA 3L3HB 4UILH 2F74A 4ODUA 1M7IB 4N90D 5KOVC 5E2TH 4XVSL 3QEGH 5H2BB 4HGWA 3KPNB 3Q3GA 4G6FB 1BFSA 1CGSL 3FKUS 3L5JA 4AL8L 5IB4B 2W9LA 3WFEL 5HVHC 2FHCA 3ECBA 5C8JB 1ZEAL 3B6SA 4WW2C 1JZ4A 3DETC 3NA4A 4F7TB 3PQYA 4U6XA 2MHAA 5BS0E 1L0QA 5GGUB 1WT5A 4J3TA 1I8MA 1DN2A 3MR9A 2R2EB 3DV6B 4YK4B 3IDMA 2AI0H 2ADIA 3X3GH 4U6TA 1NC2D 1S9YA 2HFEB 3OZ9L 1HZHL 4I0PD 4NGHH 2OMBA 5DJYB 1A0QL 4YFEA 5C0DB 3HMXH 5FHAL 1NQBA 2BY2A 4MJIE 4PGDB 3OG6B 2BVPB 2OR9L 1ZT7A 2P5ED 4GRLA 4I77H 5C1MB 3HMWL 3DX7B 3DVGA 3DXAA 4XMPH 4HS8L 2X9YA 1I1FA 1NMAH 4XCYA 4MAYD 4MMZC 3QNZA 3V5DB 2IF7A 1CD1A 4U0RC 3DECA 4NKDB 4OZ4B 5GS0H 4NWUH 1JGUL 2EE2A 3O45B 3RI5K 1AKJA 2HJLB 4LHUA 1AIFA 3HE6C 2EEBA 3PJSA 5T3ZH 2VITB 5FHBL 3FQUA 5JXAH 1R3IH 1FJ1A 2YA1A 1FG2A 4JKLA 5EZJB 3QIUA 4QWWC 2IAMC 1RUML 4GRMB 1S5IH 2RCSL 5MEPB 3F6LA 3MROA 5D8JH 1BIIB 1I1AB 1ZGLP 3FMGH 1OARL 1X5ZA 1U58A 2VDPL 3MBEB 3NBNA 3RWFA 3RIFK 4Q7DA 1MRDL 1X4XA 5F3BB 1UWXH 3HI1A 4ZFOA 5IG7A 2LQRA 4J3VA 3VMOA 1J05B 3VFUB 1Q0YH 12E8H 4MJIA 3T8XB 4NJAH 3C87A 1JV5B 1ZOXA 1J11A 3P73B 4L4TE 1J86A 5L2JB 5I0DA 5DRXA 1YJDH 1PKOA 1BVKA 2VMFA 3I3DA 5DDHB 3IFOB 5SWSA 3MPCA 3MLPA 4Q97A 1LEIA 2FX7L 2ZNXA 4Z7QF 2OI9C 1OP3K 1XFPA 1ZTXL 2JF1A 4G9DB 4PJCB 2FO1A 3RL1A 5L8JB 1A6TA 2X09A 3MODH 2I9TA 4Y1AE 5C09D 3RTQD 5SWSB 1KLUA 1NLDH 2VZSA 4Y5VB 4L5FH 4HS3A 4I4WB 5E94A 5ISZA 4TNWK 1A6ZA 1A7NH 35C8L 5JA8B 1A02N 2EEDA 1OD7A 5HDQH 3TBTB 3MLZL 1BWWA 4YE4H 1QBBA 3SKNA 1ACYL 4NO0A 4QHUB 2BHUA 4AIZB 4EDWH 3KLHC 1OLZA 3SDYL 3BZ4A 2ITDA 4P5TC 4WO4D 2QQKH 2VLMD 3W0WD 2VQ1A 2XY1A 3HUJF 1DE4A 4AL8H 3GSVA 5GZOC 1N0XH 4ODTL 4YX2H 2VDQL 2V2XA 1NCAH 1YQ2A 3ALWA 4PRBA 5T5FL 4UT9L 2WBJB 3ARFB 4R97C 3NFSH 4JQIH 4HHAB 1MCBA 1I9RH 3E0GA 4XPHH 4UUJA 4B50A 3SE9L 5M7QA 2QHRH 2IQ9H 2G60L 2WMPA 3Q5TA 5DSCB 2DMBA 3THML 5CBAB 3FN3A 5HHVH 1HHKB 4JPIB 3U6RB 1TJGL 4OZHA 2ZUWA 4HSQA 1OTSC 1EXUB 4P4KD 2AJVL 1XF4B 2GJ6D 2VXSH 5IVZA 1EMTH 4TPRH 2DQTL 5BXFA 3PDOB 2M1KA 3TFKD 1FCCA 4HDIA 1H15B 1G9EA 2BRRH 2P5EA 1KJMB 4P2QD 4IOFC 5JO5A 3DGCR 2EYRA 4ZS6C 3RZCC 5F6IC 2AEPL 4ZNEA 15C8L 1FSKC 5DD1L 1K5NB 3ARBA 1WWWX 2YD9A 3O2DH 3PHSA 3RGHA 1L7IH 3V4PL 3BESR 1JVKA 1VEOA 1MLBB 3MJ9L 3PWVB 4JFFE 3B5TA 5FYLL 2AEQH 4NCC1 5EC1B 3U1SH 1X7QA 2IGFL 4JHZA 1YMME 4K2UL 4HJJL 1RULL 2VR5A 4Y4HA 2DBLH 3SDAA 1BVLA 4OQTH 2FYYA 4YHML 1BQHG 5I1JH 4OI8A 5FO7A 4LQ1A 3MLXL 5IHLB 3DIFA 4Z5RB 1LILA 4XC3L 4NSKB 4GKSA 1EEZA 3JV6A 5J06A 2B1AL 3IJYB 1KV3A 4XGZA 3ARVA 3IFNH 3H0TB 3REWA 1D6EB 4KKAD 4CVWA 4OLUL 5JZ7D 1WBXA 2QSQA 4MNHB 5ICXB 4TSBL 4UNTA 4LPCA 3KR3H 5TH2B 4DVRL 4JHBA 4R4FH 5L0QC 2XV6B 1I9IL 3K1KC 3BIAX 3MLVL 3PDDA 1P4IH 1EO8L 2YC1A 1JTOA 5CD5C 3HZMA 1RZ8B 3DGGA 1YYLH 1JYVA 4BFIB 3GMLA 3LIZH 1NAMH 5DJZB 2XY2A 1T4KB 1T2JA 2SEBA 4QRQA 5HYSA 3CH8A 1EK3A 3GIZH 2VDQH 3NIGF 1WGOA 3C60D 1NFDF 3HC4H 1W2KT 2DM7A 4IDLA 4D0DB 1KXVC 3HC0A 4KZDL 3BD3A 1P1ZA 1ULVA 4KHTL 3HE7D 5EU7E 4O58H 2M2DA 1KN2H 4HS6A 3EW3B 4YHKH 3C8HA 2GYSA 3AU1A 4XPHL 1KNOA 1U93A 2R0KH 4JFQB 4P2QB 5JR1L 5FYJU 1C12B 1NCBL 3T08A 5DMJB 4PRPB 3V6FA 1NC2A 2B39A 1OAUL 3G6JF 4MAUH 1AGDA 5C7XL 1FGVL 1DQDH 1ND0B 1HOCB 4GBXD 4HIIA 4G3YH 5ETUA 3O3DA 3ZYZA 4X9GA 5F7DB 3GBLA 4PJEB 3U0TA 4I2XA 5I1HL 3ULUE 3HS0B 2H6PB 1FL3B 3TH3T 1IL1A 1DP0A 3MREB 4LK4A 1YY8A 1U3HD 2HT4D 4EI6A 1IC7H 3HG1A 5DLML 2UY7A 3LKOA 1UJ3C 4DFHA 1A7QH 2Y06H 4QTHA 4PY7A 1YN6A 2JJWA 3LV3B 1CBVL 4UTAH 2H2SC 1VPOL 3KNBB 1PGRB 1ETZA 4P57B 5IFAH 3C5SB 3HMXA 5EN2B 1NJ9A 1MFBH 3MJGX 4OKVB 4X0KA 4X6BA 4YEFA 3LKOB 4NRZB 2C5DC 4QTHB 2Z8WC 1CLOL 3OAYH 2V7HA 5C9KA 4M1GL 4NQSA 3MRNB 4FZ8L 3O6FD 4D94A 2L0DA 2MJWA 4OFVA 1PY9A 2F53D 4C56A 4JVPA 1EAJA 5E56A 3BE1H 2XA8H 2XZCH 4MJID 5HYJD 3O2WH 3RNKB 2A6DB 2GKIA 3MGTA 3PL6C 4G7VH 4EI5B 3NAAL 3VWKC 3DJ9A 2R9HD 1XF4A 1E28B 4X4YA 4RZCA 4GAGL 1RZFH 4M7KL 5I30H 2Q86A 3QUZB 1I8IB 3CLFL 2BNUA 1X5AA 3MOQA 5KS9B 4KMTL 4LCCC 4OLUH 5IVXB 1FYTE 3QI9A 1BEYH 2H32B 4GKNB 3SKOA 1OW0A 4L8SA 1AXSB 4I9WD 4TRPL 5HDOA 2FX9H 4XCFH 3U4EA 2YRPA 2ITDB 4XPTH 2YD3A 1VFAB 4ZFOL 4OLWL 5HD8D 5FV1L 4PJEA 2VDML 4OFPA 4G6FD 4OZIE 1JFQH 3ZTNH 3G6DH 3QA3A 4MD0B 1NUGA 1KT2B 5K9QG 1E0OB 4EUPB 3I3BA 1ACZA 2OQJB 4IOIA 3H6JA 3U48A 2AJYL 2FH8A 4FQLL 5FB8A 3ZKNC 3NFPB 1EGJH 3O6LH 1BD2B 1W0VA 3FO0H 3V5HA 1X5FA 5K93A 2VLRD 5DJDB 1UQSB 3O3EA 1C8PA 3U79A 5KSUB 1PKQA 3GGWA 4X99A 3GM0A 4ELMB 4ZSOB 5IOPA 3QIWB 1NBQA 3C60C 3VXNB 3WUWG 3CD4A 1YY9C 1YEJH 1RZJH 4UB0L 3ZHDA 4HIHB 5IFHL 5DC9B 5DDHA 2RR3A 4MAYB 4D0DA 1MHEA 2DQFB 1QVOB 2A83B 3ARGB 4PJAA 3H42L 3TIEB 2EC9T 4G6MH 1I8LC 1X7QB 2CD0A 4KI1A 4U6YA 4NQEB 4K3JH 1IC7L 3G04B 4X98A 4HD9A 1UYWL 4PP2A 5JW4N 3EO9H 2D9QB 2VLME 3WNKA 3O6KH 2ZOLB 4FG6D 1UWEL 1YEGH 3IAPA 4NM8L 3S96A 4QLRA 5F9OL 3CVHB 3GMPB 3VGHA 4LLDB 1MIMH 4OAWB 4XWGH 2G9HB 4NN5C 1OAQL 5CUSL 3TZVB 2G2RA 1GIGL 4KDTC 1FFPA 3N1PC 3KLAA 2F8VA 2VSCA 1FL3A 1E27B 2XRAH 1AO7D 1S7SB 4KDTA 4ODVH 2XOTA 4FFZL 2NMSA 1UKTA 2NYYD 3VE0A 1JZ2A 1MFDL 1EAPB 3UCRA 3QPQC 5CINH 4BZ2L 1KJ2B 2A6IB 4I18B 4KRPD 4NC1E 1CGXA 4X4XA 1AC0A 3C6LC 3MNWA 4GOSA 2XQYK 2AJZA 3GHEH 3ARDB 3HUJB 2R56L 1W8OA 3QNYB 4QOKB 3VXSE 4D8PA 3WFBL 3ESVF 4GUPB 1NCDL 2GCYB 4R0LA 5JOFB 4NRXA 3WUWA 4RGOL 1G6RA 4QYOA 3SDXE 1JYNA 2CDGB 4IIQC 4BZ1H 1E4KA 3FQWA 3HI5H 2W92A 3HC0B 4DKDC 4XAWL 3D39B 5EU4B 3VWJA 3NACL 4QF1B 1TDQA 3HC3L 5CIPA 3VXOB 4O9HH 3EHBC 3EYQC 2D31B 3OB0K 1IAII 3B9DA 1PG7L 5CGYD 1HWHB 3RIFF 3TV3L 1ZANH 4S1QL 3UYRH 2XTJB 5BJTB 2I25N 2PW2B 4NO0B 3ME0A 4WHDA 2NY2D 2Q8BH 3P4OB 4K7PY 2P5WA 4R4ND 3QQ4A 5IVXE 3HZKA 4M5YL 5IBLC 5EIIB 4C58B 3G5YA 3U9UA 1L7TL 1YECH 5ERWA 1OT1A 3T4AB 1IKNA 4N0UA 2IG2L 4YXLL 1MHHB 4RQQA 4MSWB 3VGEA 4M02A 1MCPL 5EIIA 1AR2A 1HDMA 3MRKA 1CWVA 2ICCA 3RWJB 1GGBL 1BZ9B 1Y0LA 3PWJA 1I7TA 3BQUD 3C8KB 3MRDB 3REVB 1T0NA 4XB8A 3Q48A 5M95B 2EXYD 2E5EA 1I3VA 3TH2T 1IGTB 2ERJB 2NY6C 1EEYA 3HNVH 3B5GA 5I2IB 3EOAA 1Q9KA 3BEWA 3VU2A 4EVNB 1HQRB 1HSBA 1YYMH 5TH2A 1S9VB 4KKLD 1RFDH 5HHOE 5BOPA 4LF3B 4KFZC 4S1RH 5CCKL 5J9PA 1A5FH 3HZYA 1DUYA 1MIEH 4WFFD 3WCYA 2WV3A 3CZFA 1FBIH 4JFPB 5CP3A 3OB8A 1GZQA 3A67L 4HJ0D 5EO0A 5EU6B 3ZDXF 1GSMA 1D9KA 5GS2D 2GJZB 4WEBH 1QR4A 5J57B 2OR9H 2ADGB 4L3AA 1FLRH 5E8DH 2KUTA 3MXVH 3QDAA 1MVFA 2O5YL 3SE4A 4XMPL 1WFUA 3QH3A 3IU4H 1G7MA 1RZKC 1TZIA 3QUYB 2RBLA 4BUHA 2ICEB 4PJ7E 4Q0XH 3BX7C 5C07D 3JWDH 3EYOB 1TXKA 5DD0L 1TZHB 3ULUD 3KLAB 3KWWB 4PFEA 4HC1A 4NC2B 1OAKH 3WLBB 3TCLB 1AD0B 1X4ZA 3RDTC 2F54B 1K6QL 2DBJA 2BSTA 2VLKE 1MLBA 4ELME 4GAFB 1AD9A 2W0FB 4KROB 4ONOA 1WAAA 5GRJH 4P5MA 3T2QA 1WT5C 4WV1B 4XP4H 5LWYH 4HF5H 2NY7H 3PF2A 4JB9H 3S97C 1P5VA 2QHLA 5EZOH 1CG9B 4U1NB 1E4JA 4LMQI 8FABA 2EDXA 4QHKI 1T0NB 3DVIA 3UC0H 3ZHLA 4WTZG 2ZJSH 1XGTB 4WNQA 1JNLL 1KYOJ 1JPSH 4U6HA 3UEZA 2O5ZL 3DWTA 1QLEL 5HHQB 4WWID 1U3HB 1MHEB 4QXUL 4E41A 5DUBA 4YHOL 4AK1A 2XI9A 3ZDZF 3VGDA 4XXDB 1R6VA 4M5YH 1R3HB 3VFRB 2XZZA 3CSPA 1G0DA 3LEXB 2Q6WB 4X6FA 3V0WH 3QJFA 3U2SB 5DT1H 3BEVB 1HIML 4PJ7A 4E0RA 1JGVH 3TBYB 5H35B 2J1KA 1QO3B 1N8ZA 1TJHL 1CIUA 1TPXC 4NKOB 1LO2H 3MZTA 4L4TA 4LSSL 5CWSA 2DMKA 2X70A 2Q6WA 5JZ7C 3VFTB 1ZLSH 1ZHBB 2XT1B 2PN5A 3VFWA 3QNXA 4R4NC 3WHE0 2CRMA 1FYTD 2VL5B 5FGCE 3ZKND 4DGIH 2UYLA 5GRUL 4P3DB 1DLFH 1F4YL 4MJIB 4A6YA 4XHJC 3BP6B 1T4KA 1W0WB 4H0IA 2ZOKB 2CLZB 1UJTA 1MAJA 1NBVL 3K2UL 3NCMA 4F15C 3VH8A 1RUKH 4RAUA 1N0XL 5ESQA 1BFVL 5C0GA 1CXIA 5E6IC 1UB5B 5BRZA 4LEOB 4GMTH 1YJDL 1A1NB 4F80A 1BZ9A 4Z0XB 1G7QB 2F54A 2R0ZL 5I8OL 1U42A 3CSGA 2X40A 5CD3A 3QAZC 5GJTH 2LU7A 3QO1B 2B5IB 3DX6A 1UGNA 4LPVA 3HMXL 3OJMB 4U1JB 2VITA 1CDJA 2N7BA 1TVBB 1JHTA 4G8EB 1JRHL 1IZJA 3C2SA 4XP5L 5LXGH 5E8OB 3ZTJH 4Y16A 5C0AB 1AP2B 4R7NA 3PG2A 4YH6A 4UDUA 4P46C 3FTGA 2X5PA 4U6HB 4QXGL 3L6FA 1X3DA 1AGCA 25C8H 2YD8A 3O0RL 5C2BL 4M7ZC 5F88A 4MB4A 1BVLB 2C3WA 5INDA 3C2AH 4XNQA 4DCQA 5T3ZL 1CFBA 1N5YL 1ZSDB 4ZS6D 2CXKA 1S7RA 3TO4B 2C9AA 1NEUA 2H2PC 3B83A 2BXZA 1MLCB 1WTLA 5GGUA 3ZYOA 3HE7B 2WW8A 1IM3A 4ZD3L 3NVQA 3MV7B 1YQVH 4KXZH 4AENA 5ACLA 1E6OL 3GKZA 2AS5M 3QIUC 2QHRL 3G04A 5I71C 5EOCL 4U1GC 4Q9RL 4CN1A 4M62H 4HC1H 4PB0H 4QGTA 4IBLT 2QEJA 3CVIH 5TJWK 2VYRE 1R3KB 5KVEL 4LPXA 4O2EA 1CL7H 5GJSL 5HHXH 3BP5B 3ZZ1A 1AGDB 3Q0HA 4LCYA 1FL5B 1MHHA 2OJZL 4NQCD 4RQQB 5JW5B 5EO1A 1F11A 4Y2DA 3VXSD 4NQXB 4U1KB 1LEGB 4J23A 4F37K 3ARBD 2IPKB 2OS7A 3M17B 4NWTL 4E42A 5D7LD 5C6WH 4PLJC 2QKIB 1JF1A 1I1YA 5JIKA 2WBJA 1SYSA 1INEL 3E2HB 2CJUH 3MMEB 1QKZL 4H8WL 1CZ8L 4NQDB 3NH7H 4FQ2H 3IXTB 2EDTA 1A64A 1CU4H 2ZCLL 4MHHI 4HJJH 3WNLA 5MERA 4HPOH 5F1IA 1F45A 4GRWF 5DRNA 1TCRA 1SYSB 1RUQH 4QHNA 1S7WA 4YHMH 3GI9L 5B3JF 1SJVA 4OT1L 4YNYB 3QIBA 4ONFL 4HXBH 2VL5A 4XHJD 4D9RD 3MRHB 4U1MB 5IJKC 1JL8A 4ETYA 2F19H 4PLKD 2B1HH 4Z7OE 4R2GB 5CAYB 3DLQR 3QISA 4DUVA 4DGVL 4CU6A 1KB9K 2QQKL 4U49A 3QDGA 5E8EA 5ESVB 2PF6A 4CAGA 1TNNA 3T77A 4XCEB 1T5XA 3L3DA 3TBVB 1MCOL 3G5YB 3VXPA 1MRCL 2E27L 1QEWB 5GXBB 2EH7L 2GJ6B 4NFDA 5A43C 4NRYB 5I73C 3B5HA 3QUMB 1JE6A 3FO1A 2R0WL 3NFSL 4JQIL 3GSNA 5ACMA 2WLZA 1P6AB 5JHDA 4PJFA 1S7VB 1ERNA 3M45A 3LY6A 5DJCB 3WO4C 3BO8A 3L9RA 1MWAB 5EOCJ 4M6AA 4ODWA 4PP1C 4TUKH 1JP5A 4OFYD 2G60H 4CW1B 4HULB 1HYSC 4I48A 3SCMD 2DB8A 4F37F 5D9SB 3T0ED 2GHWB 4XI5C 1GYAA 5FUOL 1DJSA 1R5WA 4M93C 4YEEA 3WUWB 5F8QC 1LD9A 1KJVA 4RISH 1U8NB 3OXSB 1QSEB 4UDTA 5EU3B 1OLLA 2OL3L 2VN4A 4M6OH 1XH3A 2NQCA 1CFVH 1ADQL 5I1LA 2H6PA 5CJBA 5IKCA 2VAAB 4Y4KB 3BISA 1UXSB 1PQZA 2P49B 2KL6A 5F7HA 1IQDB 5D72L 3G5VB 1Z5LA 3OSKA 5EU6A 4O4YH 3PWPA 4C59B 4QCIA 4KJYB 5DR5L 4WI9A 4DTGL 2AEQL 4TUJB 4KMTH 3KPOA 2D9CA 2DIAA 4M48L 1A1NA 1A14L 3DOSA 4W4NA 3W81A 3EYSH 2YKLH 3TO4A 3OXRB 2IANA 1T3FB 3WBDA 1LE9A 1CS6A 1SM3H 4Y5XA 4Z7WA 2VO5A 3MFFB 4R90H 3HAEA 1KJ3L 3M8OL 3UTSD 4CRPA 4V2CB 1CFSA 3C8KA 2J12B 2XA8L 1CI5A 4Y5XB 3FRUB 4M9OA 4PRPD 1U41A 4O02H 5EA0H 1T7ZA 4N5EC 4OLYH 3VCLB 3VFVA 4KJWD 4YPGB 1RK1A 1NMCB 2J8HA 3CX5K 3IJHA 3KYMB 1VGKB 5TDOB 4KHTH 2PXYD 4RAVB 4ZS7H 3TYGL 3V6OE 1L6XA 2YPVL 1FL6B 1SJEA 3CIQA 4R8WL 3VI4E 3O4LA 1HDMB 2J2ZA 2ZUQC 1PZ5A 3CUPB 5ICYB 1MQKH 2VLRB 3FQNB 4W4OC 3IETA 1M7XA 1XIWA 3V8OA 2V9TA 5D71H 4EEEA 5IESL 2A73A 1Q72L 4XXDA 1ZV5A 4JAMA 4HZLB 5BMFL 4OLVH 2HMIC 2GK0B 4UQ3B 1MELA 1FO0L 3MC0A 1KT2A 3MYZA 1I8KA 2A1WL 4BFIA 2BK8A 3GO1H 1WBYA 4NO2A 5CP7B 4NQSB 3X12B 3LD8B 1UH2A 3DMMB 4TUKL 2NY2B 1UYWH 5F71A 3C5JB 3EDEA 3BI9X 3L5WB 4ZODA 1T5WB 4HXAH 5ICXA 4FN0A 4GG8B 1K8IB 4P2OB 1C7TA 1Z9MA 2GEEA 2GTWA 2CMRH 5I74B 4GBXC 2EDJA 1GIGH 3LH2L 1YMMA 2V9RA 2BVQA 4M1CD 4V1DE 2VDLL 5HI4D 3FO9B 5DQ9B 3B9VA 3GSQB 4HH8A 3GSRB 3QDJE 3LMJL 4JJ5A 2HA1A 5D1QA 3BSZH 1QFUL 1BOGA 1I4FB 1ZS8A 4Y1AA 1NH6A 3HRZA 2ARJA 1A7PL 4DK6A 3L3DB 5DJ6A 1XGQB 5J6HA 5I8KL 2VQTA 4YC2C 5HVWA 2ITCB 3W5NA 1RUPL 4LBEA 2PTVA 4Z7UE 3ZE0E 4JLRB 3ZKMD 2XZQH 1LD9B 4JKWA 1KCUH 4V1DD 1U93B 4JFQA 4R26L 5HGBB 5C0FB 2HRPL 2DYPD 1G0YR 4P2CG 5I1AA 1UWEH 1S9XB 1KCVL 2FWOA 5D7JD 3S8WA 3FHQA 5F9OH 3Q6GH 1BOYA 5E24E 3LQAC 5CS7A 2AGJH 1VACA 4P2YA 1BQHA 3QQ9D 4EVNA 4MA1B 2R2HA 3RJDA 5SX5K 1HWGB 3K3QA 5DEZA 1RZ7L 1MJ7L 4N9GB 1ZSDA 3LQAH 4JR9H 3QB7C 3V4VL 3VXUA 5FYJL 1T66D 4ODUB 3MJ6A 4YWGL 2ADFL 4YBLC 2Q7YB 2DL2A 2AJUH 2X7LB 1KB5L 2DWDB 1W72B 5D93C 3VI3F 2XWTA 2A6JA 4PLJD 4KZEL 4WY7H 1AI1H 5I6XC 2YZ8A 4YDKL 5HHPA 1S7QA 1EFQA 2X4NB 3WXVL 3EOYG 5TQ2L 5FHBH 3CU1A 4I5BB 2EE3A 2D4DA 1D3CA 1DQJA 2CUHA 4PJDF 2F5BH 4HK3J 3HZYB 1MNUH 5D5MB 3VD3A 5ILTH 2XQYG 3OAZK 4N0YL 5BZDB 4QRUB 3S34H 3O41A 1YEJL 1F5WA 2V5MA 3WDJA 3HA0A 2FX8H 3FQRB 3SDDB 4OCWH 3BT2L 3VWJD 3MA7B 4O9HL 2RAMA 3LZFH 4WI4A 4Y19B 2DLGA 4BFBD 3U7AA 3QWRD 4PJ8A 3AB0C 3GUTB 4TULH 1J9CT 5E5MA 1S8DA 3GDBA 1VFAA 4S0SD 1T20B 4QRSB 3SDDD 5A3IC 3PV7A 4KHXH 4J8RB 3QXWA 4B41A 3H9SE 1B0WA 1FNGA 3QFJA 1VFMA 2VLJD 4JFYA 5AWNL 3NABL 5JPNB 2WZPD 5EPMB 1BFOA 1JN6A 2XTLA 1RY7B 3GSUA 4JN2B 3KS0H 3BPLC 1CDHA 4GRMA 1CDBA 3H0TA 1JK8A 1XCTB 3OV6A 4LSUL 3WLBA 2JCCF 1IKNC 2PO6A 3MGOA 4YFLI 3QNYA 4QOKA 4Y2DB 5DURB 5F8RC 43C9A 3O45A 3SBWA 1H15A 2XWJA 4X6FB 4K3JL 3BSZL 4FFZH 4LHUB 4M7LL 4UI2A 1GGBH 1E4XI 3CU7A 1AGCB 3IVKB 4MA1C 4JO2L 4MA8L 2R0LH 3T0EC 5C0IA 1UJ3B 5DA0B 1X5HA 1FE8H 4JO3H 2VZ1A 4JY5L 4LLMA 4X5XA 4JRXE 2DJUA 3MUY1 4AZ8A 3LRGA 5HHOB 3QEGL 1CXFA 2W0PA 5I76A 4LCIH 4PBWD 1UXWA 3HE6D 1EIBA 5CGTA 5D7JB 5GS2H 1RJYA 4LLDA 4NNPH 5IHUL 4BH7A 1T5WA 1IGCH 5KVGH 4N8CH 4NUJA 2X9WA 3BO8B 5D7JA 4MNQE 1MFEL 4DWHA 5FYJH 1INQB 1I7RA 1U8KB 1IGIL 1Z9SA 5J13C 3HTLX 4LIQE 1Y18B 3IU4L 4KUZH 1XF5A 3P0YH 3VXPB 4JFEB 12E8L 1R24B 3UMTA 5LKNA 2DRUA 4XCYB 1PKQE 3GZKA 3IFPA 2O61B 3HLAB 4GKZB 2YN5A 1AP2A 1L7TH 1YECL 4PRPA 3MRGB 4RFOL 2HFFA 4KQ3H 5LAXA 1OSPL 1P53A 2NXYC 2AEPH 15C8H 1MOEA 4JRXA 4N68A 3RY5A 1E4WH 3FCTB 1T2XA 3LKPA 3BP7A 1QRKA 4Z7NF 3MRHA 3G5XB 1QQDA 2XTJC 3TBWA 2Q8BL 4F15B 1WF5A 3IJSB 1SBSH 4JB9L 1UACH 5HHQA 1DLFL 1F4YH 4ZPTA 4X9BA 1MREL 4BQ8A 4OFDA 4LIQL 5L2KA 1PEZA 1F8TH 3E1F1 1U58B 4KKBD 3W39A 4IRSD 1VEPA 4HCRL 3AMLA 4LQFH 2I9LB 1CK0L 2CO6B 2MCPL 2QR0B 3ZKQD 5IEKA 5BW7C 5JW4R 4G42A 3OXRA 4WUUE 2AAVA 3AREC 5IBTL 3VGBA 4PRNB 3ARYA 1VENA 3DTXB 4GS7C 3GSWB 2HVKB 3SDDA 4DZ8A 4JEGB 4YIQB 1RJLB 1G1YA 5INCA 4PV9B 3P4MA 2GI7A 4JO1H 4YHIA 1S7QB 1EEUA 2JJTC 5BRZE 2A77L 5A2JH 1ZTXH 4FQIL 3D6GA 3THMH 3S35X 4ZO9A 1VGEL 3LS5H 1YPZF 5E8DL 3PHOA 4H1LB 3SDAB 1Q9LB 4OCYL 3HRZB 2PO6D 3S5LB 4WUUD 4ZUSA 3QQ4B 5GZND 1DFBH 4KTEH 1FVDA 2QSVA 1XF5B 1KPVA 5FO7B 5I1LB 5IEHA 1YYLL 3OKLA 3G6JA 3UTQA 2X1QA 4MCYA 4Y1AD 1INDL 4YDJB 2IQ9L 3OKNA 1VERA 3OKEA 1ZWIA 2G5RA 5HYJB 3SQOH 4KZDH 5CEXA 2BNRA 4Y4KC 4P46D 3MX0A 5IHUH 3MV9E 1YQVL 2Q76B 1FNLA 3WNNA 1UKQA 3SKMB 3MV11 3CFIC 3OKNB 1UCBL 1MJJA 2EDQA 1KJMA 4P4RB 3CC5B 3SO5A 1Z9OA 4YXKH 3WMSA 1E28A 1U8IA 4Q9BA 1F42A 3KPQB 3SBWC 1HNGA 3PL6A 4JPWL 1IC5L 1Q1JL 2P43B 3I9GL 5GGSY 1T80A 4Y16C 3U6RA 1IVLA 4J3UA 4U1LB 5H37G 2VIRA 3PQYE 5BS0A 3C6LD 2W65B 1HEZA 3KGRA 2MPAL 1S5IL 3GSQA 3X11B 4CU7A 2EECA 3RDTD 4JG0H 3FN0H 2IMNA 5DT1L 2DJSA 2O26U 1JGVL 3U0PB 2UZXB 3ZL4H 4ELMF 4G43A 4EQ2A 3SCMB 4QRRE 1DQLL 5TE6H 3TA3D 3HCVA 4FFVD 7FABH 4YGVA 1J0JA 2DQUL 3VJ6B 4LEOA 1FZKA 1DEEB 4NQED 3IT8D 1MFCL 4R2GD 1P7QD 4R2GC 3T1WA 5F44A 4UT7L 3ULUH 5I1DB 5F7UA 4JM4H 4PP2B 5C0BE 5KZCB 2YWZA 3TIDA 4FQHB 4KY1L 1T20A 4QRSA 4E5XA 3GSVB 1CXHA 3MO1A 4LASL 4H88L 4NO5B 3CVIL 4G7VL 4ZUUA 4OF8A 3B8YA 3W0WB 3ZDXE 5DJAA 4XBPA 4JFFD 1ADQA 1U8QA 1LEGA 4XTRC 4XC3H 5DD3L 3NIGE 3DARA 4YHKL 3IETB 4DGIL 4HLJA 1YZZA 3TBYA 5I30L 1NGZB 4ERSH 2A73B 2G5BB 4NKOA 3E2HC 4YE4L 2A77H 2R23B 1J0KA 1F3DJ 2BSSB 3IFNL 4JDVB 4NBYB 3VXSA 4NBXB 1NAML 1H3WM 4QCIB 3TESA 3MRCA 4XAKE 2HLAB 1LHZA 4PGCA 5LXGL 2VZTA 4OI7A 1FIEA 1QBMH 5D1ZB 1IGJB 4HKJA 1HINH 3VXMA 1I9IH 5EBMA 1S7WB 1N6QH 3IRPX 3MBEA 2ZOKA 4KU1A 1GOFA 5I1HH 3QDGE 1U95B 3UTSB 2W07A 3MRPA 1CT8B 3N1GC 5J89A 2IANB 1RUQL 5KG9A 5C0AE 3D39A 5EU4A 3CCHB 5IVXF 2AJYH 1LEKB 1JRHH 4XP5H 3P4LA 4DKEL 2DDQH 4HXBL 1VEMA 3BMWA 4KAQL 4PLOB 1EGJA 1AR1C 2FWOB 2JTDA 3BZFA 4GRWH 3EOTH 4HJ0C 1JUFB 4XBGB 5TFSL 2KZ1B 3HUJA 3C6LB 4RFNB 4X6CA 4WW2B 5E2VL 5E7BA 2GFBB 1CGUA 5HVHB 4P4KA 2HJLA 1FGVH 1DQDL 1CBVH 3R1GH 4Z7VE 1KC5H 2HTKC 4HUXB 1ZLUH 5KVEH 1RURL 3PHOB 5BVPH 1NGYB 1UB6B 1L7IL 3QUXC 4O4YL 5DSCA 4K8RC 2EDFA 2CQVA 1NL0H 3PWVA 3MRNA 4TVPE 4JRXD 4NO3B 3BYYA 4JDZA 5KSUA 2YMXH 5CEZE 4GW5B 1MCQA 4TSCH 1H5BB 1MUJB 3MNZA 5B21A 1IM3B 4BKLA 3DTXA 4HHAA 4MJ4A 2ZUVA 4NPYA 1EHLH 1T1WA 4PY8J 4OLXL 2WWMC 3GBML 3C5JA 3RZCD 3OG4B 4MD0A 5T1DL 4TRPH 2CIIA 5L2KD 3QI9D 3VI3E 4NKMA 2FEEL 2AVGA 1QSFE 3QDMB 2RQ8A 3K74B 5EZLA 5D96C 5FUZL 3RP1A 4NQEA 2IH1A 4HKXB 5CHNB 4NQCA 3PXJA 4GMSL 3S5LA 2ZUYA 4R4BA 1E4XH 3I2CH 3MRRA 3ULVC 4UBDD 5F9JA 4OB5H 1T7XA 1QEWA 4CDGC 1IQWL 4M43L 2A2QT 2VLJB 4ZUVA 1HYRC 1DQJB 1SJXA 1ES0A 3FO0L 5INCB 4N0CD 2CJUL 4F7EA 2FR4A 3OAZH 4QRRA 1C08A 2AK1H 1N2RA 2JE8A 5KN5B 1MEXL 1FZJA 1KPRB 1TCMA 4JVUA 2Y07L 1OAZH 2VDMH 2GUOB 1CGWA 5D7SL 3WJJA 4WWKA 2O5XH 4IOIB 5IB5B 4HKBA 5IFHH 3NFPA 4KKLC 3IS1X 3NIFF 5H94A 5C0CD 2GJJA 4G8GA 3LDBB 3OKOA 3P0VH 3IXTA 3O6LL 2R0WH 4Z7VF 1RZGB 2Y25A 4ZAKB 1WTGT 5FF6B 1FYTB 2JB5L 1TCRB 3WO3B 1I1AA 3D9AL 5SWQA 3RRQA 4NM4H 1CD8A 1F6FB 5CD5D 1YEGL 2FGWH 1NJ9B 2V6HA 3D25B 2IMMA 4G6KH 3AFLA 2HKHH 1BGXH 4MVBD 2PO6C 1I1YB 1J0ZA 3QEQE 3PP4L 3QIUB 4FTVE 5I17A 1YEFH 3IJYA 2VDLH 5GGRA 4D3CH 1CDUA 4KGLA 1FNHA 3GMNB 1A1OA 1PG7X 3QUML 3ZDYF 3SE4C 5HHPB 2OP4H 4YBHA 4OUUB 1MY7A 4M4RA 3VRIA 1TQBB 1N5AB 5FGSA 2PW2A 4WV1C 1I4FA 4NM8H 2P8LA 5F3BA 1KELH 4ZXBC 1HSAA 2C7UB 5FUOH 1ORQA 4WU7A 3V6FB 5ADPL 3D0VA 3FT3A 1JIBA 2UZIH 5DMKB 3PUCA 3VXOA 1JTTA 4RISL 5CILH 2JK5A 1WVZA 1QTYT 1I7ZA 2F5AL 3E6FA 2AJ3A 2R4SL 3ZT7A 1D5BA 4S1RL 3H3KA 3T65B 4FQQA 5FYLE 2W91A 5J4MA 3N1QC 4LDLB 1AO7B 1EUUA 3O2WL 1DUZA 5GQBA 5DMKA 3U7YH 3WKNA 4EI6B 4HMEA 3SN6N 4UAOC 1MCNA 3ZKMC 2Z4QB 2JLLA 4NP4L 5D72H 3QXAA 5C6PB 4RAUB 1YN6B 4XPAH 4RFNC 2CKBA 3QO0A 4IS6B 5DQJB 1FFQA 1OWRM 2D0FA 2VTFA 1OAYH 3HMWH 3UYRL 3BGMA 4O5LH 5F88B 4OUOA 2BP3A 3PV6B 4F2MB 4JAMB 1NCNA 3CSYA 4KI5F 3U36B 1IEAB 4HUWB 4Z77A 3BRGC 4MCZA 1ZHBA 1AJ7H 4XMLL 1T0PB 3WXVH 3MCG1 3KYNB 3VWKA 3RVTC 3FFDA 3EJYC 5F7FA 4U1SA 1KCVH 5FCUH 4WFEE 1MCEA 2WAHA 5CLTA 5I8CA 1U92A 1ZANL 1CTNA 3T3ME 5IT2L 1A21A 4HF5L 4LAQL 1RZKH 4H5SA 4ZUTA 4YFLF 1F58L 4K7PH 2A1WH 1ZHKB 5T1MB 4DZBA 4QKXB 4Y19D 1IAIH 4KI5D 4WWKD 3QEHB 4L8BB 5F21B 4A6YB 2V2WB 1AXSA 4NQDD 2Z31B 4KV5E 1G9MC 3K8LA 3IKKA 3P77A 3ZLQC 1A5FL 3VFOB 3QEUB 3MCLL 1KLUB 2A9NL 5EO1B 1U3ZA 3TVMD 4JQXC 2P45B 1D9KD 1I8IA 5FM5O 5FGRA 1T7WA 1U8HB 3DXAE 4WEBL 3DX9A 4GKSB 3HNVL 2OZ4A 1KTLA 3S34L 1CGTA 4KH2A 2H26B 1BM3L 2NPLX 3D3VB 3TN0A 3EFDH 4JKPL 5DD6B 4I18A 3MSPA 3QO0B 5EU6E 5DRWA 1NCWH 4OZHE 3UZEA 3WFEH 5F9AC 5CEYB 2N1KA 2H2SD 3AS1A 1NMCC 5C07A 3FJTA 4DFIA 1W8NA 2PW1A 4I3GA 1CDIA 4FFYL 3V6ZA 4J2XA 3IKCB 3K2UH 1FZOA 1P7KA 3W82A 1L6ZA 3DETD 4JM2F 1YMMD 4ODTH 5CKGA 2ZUUA 3P9MA 3UTTA 2ED8A 1MCIA 2GY5A 1U0QA 2P8MB 4JDTL 5DWUL 4OD3H 1FSKB 2CDFA 1KIPA 3WD5H 1N59B 1MF2H 1I9RL 4G43B 5DZNA 1K4CA 2D7QA 3QXVA 2NY7L 1ORQB 4OBSA 2OZ4L 3V0VB 3OPZH 4Q9QL 1HXYB 5ACZA 3RY6C 1RUPH 1TZHA 4GG6E 1JGUH 3RY4A 4Z78A 4CVXA 4NO2B 2ARJQ 3KWWA 2I07B 4X7TB 3D1MC 4U1LA 1D7FA 1TJGH 4IMLB 2ADFH 3ILPA 2ZKHL 2ZSVA 3UBXI 1SYVB 5IMMB 4LLUA 1WFNA 3VXMB 1FG9C 3QH3B 3TYFB 4MS8C 4G6JH 1MJUH 4XAWH 1HKLH 5DK2B 4KVCH 2VABA 4CMMB 5HYEA 2BVQB 4KQ3L 3K80A 4HGKC 2BOCB 1BX2A 4L9LB 1A6PA 5ID0A 4J4PD 1H8SA 3HE6A 4NT6B 4P0DA 5B4MD 1FNGB 4QTIL 4ZTPL 3IDYC 3SDCD 3NOIA 3EJJX 3UTTE 1JN6B 5ESQB 4I3SL 4LPTA 1SEBB 4RMSA 4LMQE 4GSDL 3WIHH 5IQ7H 2AW2A 1OGAE 4NZRH 4Y2OA 3VGFA 5IGXH 5ALCL 1FYTA 2IGFH 2VLKD 3GB7B 3VXRD 5KVDL 4LCCA 1N5AA 2DM3A 5CIPB 5DHYB 1M05B 4QXUH 4ZDHB 2YSSB 5IBUG 3U9PH 5ESVA 1MCCA 1F3JA 1UC6A 4G7YL 3GKWL 4KK5D 2HKFH 5EWIL 4OGXH 4AM0B 5GGRY 1IAOB 4I3RL 3MA9L 4JDVA 3LN9A 2D3VA 2ADJA 4A2LA 2ZG2A 2GCYA 1NEZB 5HDQL 3DROA 4XNMB 3U83A 2P5WB 2VKWA 5E08H 2IFFH 1QRNB 5I16A 1IQDA 1NAKL 1M7DA 3EGSA 1SBSL 1NAMB 4YX2L 3BZEA 1MAKA 4Y89A 4YBQC 4PRHD 3EZJB 4HV8B 4OCLC 2KPNA 3AGVA 5E2UL 1PZUB 1S8DB 1KCRL 2FLRT 2ARWA 4NKMB 1QSVA 3HPLB 5L9DH 2X42A 4ZUTB 1FZMA 2IPUK 3DX8A 1OF2B 4IOFD 3TZVA 3T3PE 2E9WA 1IAIM 4YFDB 1OTSD 3VG9B 4D9LL 3MXVL 5LCVH 3QCUL 1I3UA 4PRHE 1H5BA 4FNLH 5HYSG 1AR1D 1XZ0A 3OHXA 1WQVT 3N0PB 3O0RH 5EZJA 1X6NA 4FTVD 1ITBB 3VFSB 1W72H 5C0NC 4KJYA 2J88L 1VGEH 3BN9D 5IHZB 5JA9A 1U3HA 2EKJA 4OLZH 3QPQD 3RWGA 4R7NB 1WIUA 4N8VG 4I9WE 3WXWL 3B2VL 4J7RA 4KK9C 4LLQA 2IPTH 5E4IA 4DJMA 1AY1H 3X14B 3OWEA 4X4MA 2VDRH 5JHLL 3SKMA 2OJZH 1A7OH 5EFIA 4ESKA 2VXUH 4UIMA 1CCZA 4PJDE 4BSWA 4FABH 2AK4A 3VWKD 4Z7QE 1KUMA 1U8OB 3D25A 3ILQC 1XMWA 1MLCA 2FJFA 3MRPB 3L5XH 4MS8D 2X05A 1CDYA 1MFBL 4PJAF 4H25A 3RPKA 5C0EA 3BZDA 3KPNA 5FYLD 1JZ3A 4PRDA 3H9SB 3C5ZD 1R5VA 3E8UL 2EE6A 1RHFA 1IRAY 1KOAA 5MP6L 2YPKA 5F7MC 3V0WL 1AXIB 1G7JA 4HFWB 1S7UA 3HZMB 4KJQD 4LSVL 5D1ZA 1N26A 1CQKA 2WBJD 3L3IA 1EX0A 1JCKA 4WHYG 3MJ8B 5EBMB 1T0MB 1TFHA 5TF0A 1A6ZB 5DD6A 1G7MB 3QDJA 1KEML 3HAEH 1CK0H 3SKNB 3FQNA 2NTFB 4UQ2A 4LSSH 4PYGA 2J7LA 1ZA6A 4P23A 1T2QL 3GSRA 3KPRA 5GGVL 2OL3B 3NIDF 4JG0L 3RWDA 4PJGF 2X1OA 3RVVD 1WC7B 4P3CH 3MLVH 4G9DA 3EIFA 4DTGH 5CJXA 3UJTL 1NGZA 3CLFH 4YLQT 1YMHA 3TBSB 2N56A 1OT2A 3LB6C 4P23B 4HPOL 4EJ1C 5KTEH 4LCCB 1D5MA 3GIVB 1L9MA 3V52L 4HUWA 4Z77B 5EG6C 4JFZL 3MO1B 3JBG7 1KIRA 3Q1SH 4NO5A 3QXDB 3EOAB 2ESVE 1N6QL 1INEH 4M1DL 1XGUA 4P5TD 1TETH 2EDDA 1PX3A 1BZQK 1N3NB 1KTKE 2Z8RA 2YZ1A 2CKBB 4YUEL 5FV2A 3G6JE 3ARED 1ZVSA 4XP6L 43CAB 3STZB 3JWOL 2HJKB 1BQHB 3RWEB 3G5XA 3TNNA 3NCJH 3K8KA 4C55A 4NQDE 1QQDB 1MAMH 1MCHA 3BD4A 3VXSB 4APQA 1F00I 3RBSA 3KNBA 1FHGA 3TYGH 4NRXB 3FT4B 4EKXA 3ARUA 5CKAA 1S7TA 3QCUH 2E6PA 4MD4B 1I7ZB 3O3AB 1PSKH 2G75B 4ODSH 4HUUB 4YHYC 1B0RA 2DQJH 2AP2A 1DBML 4I0PC 4HWBL 2C4FT 1Z5LB 5HDBE 1KG0B 1Q72H 1RQ5A 4PP1D 5FGBA 4OQ1A 3DXAD 2X41A 2A6JB 1Q94A 4PR5B 1SYVA 5IMMA 4F9PC 2Y06L 1B3JA 5D2LF 3GM8A 2X4QA 4GRLB 4MGXA 1NUFA 2XICA 4GAYA 4HK0B 3RUGA 3DXAB 4POYA 5MENA 1WITA 3I50H 1JHTB 3ULSB 1FIGL 3VXTA 4XNUL 2FNBA 2RFXA 4MA3B 3PWNB 5I75C 3BIBX 1E4KC 1HCFX 5D2LE 4OZGF 1ETZB 1KB5A 5I8EB 3ZTJG 5E00B 4DKFL 1DUZB 9CGTA 1J0IA 4OKVA 4X0KB 3TO4C 3TO4D 3O8XC 1OF2A 2EIZA 1ZA3B 3MUGB 1C1EL 4S1SH 2NZ9C 5E8PB 4CNIA 4LHQB 1OAQH 2ERJC 3AUVA 5SWQB 4JHAL 1FZOB 2WBWB 1H5BC 1N64L 5L6YL 5TQ0L 4XX1E 1J1OL 2NW3A 3QNZB 5GSRB 2UWEB 5BXFB 3IXAA 1A1MB 4LRNH 2CUIA 2V5YA 3MRCB 2HWZL 3ILQD 2CK0H 4PJDB 1LO4L 3HZVB 3ARFC 2NY2C 4P2OD 4X6DB 4BELD 3QJHA 1QSFA 4M43H 5D1ZD 5GGVH 3L95B 1WZ1L 4B53A 3QUXA 4PS4L 2X10A 3RNQB 1MFCH 4ZS7L 3WLWC 2YPVH 4R8WH 1NEZA 5DS8A 3FT4A 5FA3A 4UZGA 1J8HA 4U4BA 4RAHA 2AXFA 1DBKH 3UJIL 4WWKC 1XGPB 1OAZL 2FIKB 4RMRA 4OD2A 4MJ6A 3RGVB 3DHJA 4X7FC 1W0YT 1QBML 3MNVB 3D2UB 3QFJB 2WK2A 2IALA 5TGBA 1SM3L 5EUKA 1DR9A 2FYYB 3RVVC 4PJBF 4K8RL 4G80B 3RGVD 1IAKB 1YEEL 2R4RH 3TIEA 3RWIA 5HYSB 1GHFH 3D2UA 2AJUL 3U7WH 2MKWA 3CX2A 3LEYL 2PXYB 3T77B 1SEQH 3D39E 1B2WL 3WIFB 2DDQL 1Y6NR 4O2FB 3F7RA 3RWCA 4KAQH 3UYPA 3PP4H 5LJYH 3P40A 5DUMH 1XF1A 2G5BA 1I7UA 2FEDD 3ULVF 4PBXA 1H3PL 4WRLA 2P48B 1IGML 3F7VA 4M6ML 3HUJE 5E6IA 4LRIC 4XPGH 5SWZD 3IFPB 2DD8H 5DMGC 3CFJB 4JFDB 3EO9L 2H45A 4NCC2 3D39D 2NY3B 3UZVB 3BW9B 5JIPA 2XKSA 1B9ZA 5FUCC 1FNSH 3DVNB 4HG4K 1NCTA 2ZCKL 5ALBL 1MCJA 5CUSH 2UZIL 3AY4C 1A4KB 1H0DB 2JJUA 5HGAA 5IM7B 3SE3A 2E8ZA 5KSAC 5EC2A 2HRPH 1MI5D 2PTTB 5AWNH 2NYYC 4TSCL 2AK4B 3UXFA 4Q58C 4U0RB 4CVUA 3ZYIA 2UUDK 4F7TA 2AJ3B 5I76B 4ZXBD 1JHKH 4L29B 3OKKB 1LWRA 2Q86B 2HVJB 4ODWB 3QQ9C 3QDHA 4JLRA 5B39G 5K9KB 2W38A 3P4NB 1RZ7H 2IEPA 4D9QD 5HY9B 1NFDE 1X4YA 3QCVH 1IKFH 1LO3H 4KV5F 1J1OH 5D1XD 4ZUSB 4M93B 3CFDA 4LLVB 5DHXB 4P4KB 2P5EB 5EIVA 3BUTA 2WUCH 1AGEA 4L3EA 3WS6A 4U1JA 3BZEB 5B39A 4GMSH 1QLFB 3PWJB 4JM2A 4P2RD 4RFEB 4GXVL 4M48H 1JPST 1KTLB 2PETA 3SDAD 4Y16B 1AJ7L 4UDTB 1NDMB 3JWDL 3H7BB 1NC2B 3NACH 2VLRE 1KBGH 5ICYA 5HVGB 5T3XL 2FHBA 5BQ7B 3B9KD 4U7SA 3P77B 4D9QE 4P23D 3MACH 1KJ3H 3M8OH 3KJ6L 3QEUA 1HILA 4R0LC 5CEZL 1U8QB 2UVEA 1J5OL 4LF3A 5J9PB 2WIMA 4GKOA 1RK1B 3TPUA 4K9EH 2BNRE 4P2RE 1C5DB 2EXWC 4JQVA 4WHCA 4YDJA 1F58H 3LEVH 1U6AL 1N3NA 2BMKA 5F6HI 5IQ9A 4F7CA 4GW1B 3KDMA 2EC8A 4L4VA 5HYIA 4B7IA 2L7JA 3QXTA 3PXHA 2VDOH 5A2IH 4U1IB 1FN4B 3T04D 3S88H 4L4TB 1VADA 1JNNH 3RGVA 3FQRA 3VDCA 4EN3C 3WDIA 2Z9TA 1KFAL 2QQNL 2D7MA 4HMDA 4PJBB 5KS9A 3BT2H 2CUMA 4X6CE 1AXTL 3MXWL 2DMCA 3IDGA 3IDUA 5JDSB 2CGRL 2OMNA 4M6MH 2LE9A 1CR9L 5TPWH 2YUVA 3DSNA 5DGRA 1LO2L 4DZ8B 1AO7E 4ZAKC 2JB5H 3SOBH 2BC4A 2GIYA 5IT2H 2Y36H 2XYCA 2W65A 3ZKXB 4J3XA 3V5DA 5F1SA 4C4KO 2Z93B 1CXLA 4PRAA 4GS7B 1BQUA 6FABL 2VN7A 4M6NL 2VC2L 4R7DA 1A6WL 1Q0XH 2GSGA 4HXAL 3LZFL 1DANT 4R6UA 3V6OC 3AREB 5I1EH 4ZOAA 3O4OB 2A0LC 2BVOB 3LRSB 1F8TL 1M71A 4KUCD 4CVZB 1S7UB 3MRBB 5K9QI 3DSFL 4DKAA 4AH2B 3SPVB 3RX5A 2PYED 5B8CA 3QUMH 2BFVL 2OP4L 4LPYA 1CICC 1URLA 5JLZB 1FDLL 3N85H 3C09B 1X9QA 5DHVA 2BOCA 5A2LH 3VD5A 1HH6A 4JRYE 2HTKD 4R96B 5T33H 4AH2A 5HHNA 1RU9L 3RVUD 4NQVA 3PHQB 3BEVA 1AC6A 2YUZA 3IGAA 4JDZB 1HEZB 3RZWA 1DQTA 2LV4A 1ZLUK 4WJ5B 4G8FA 3G5VA 3QUYA 3WSQL 3MBXL 3TN0D 4JVWA 2EZ0D 3O6FA 2R4SH 3MV8B 4LCWB 2ORBH 3IVKA 4KTEL 5IVZB 2YXFA 2VLLA 5DFVC 1F4HA 1ZVYA 3PL6B 4UIKH 5CZVH 5IMLA 5C9JA 5I17B 1BZ7B 4JJ5B 1GZQB 2HVJA 4PGZA 2VZOA 1KEGL 4BFEA 1YEHH 4OAWA 1FFNA 2IAMD 3MRLA 4HZAA 4WDIA 3T0EE 3OX8B 2VKXA 1R3JA 5D7IA 3IDMB 1S9YB 1Z6JT 4NC1C 1EA9C 1REIA 1PYWA 5D2NC 3OR6B 4O5LL 1IGCL 3RL2A 5IEKB 2WIIB 2R1YA 2VE6A 5E5MB 4D9RE 1WCQA 4R7DB 1TITA 2P44B 1M7DB 3EGSB 1OSPH 3QAZB 3CFBA 3RPIA 4HC1L 5I1CH 3CVHL 4WWKB 4LDOB 2DIJA 1TJHH 4QRUA 4IHOB 1UWGH 1N6UA 4Z7WE 4MA7H 2E7LC 1IEHA 3EYQD 1MJ8L 4K07A 3TBWB 2EKSA 2P46B 2QQNH 4PBVC 1FO0B 5DF0A 2HLAA 2K9UA 2VLRA 4PGCB 4L8CA 3VFPB 4Z7VA 1M4KA 1XR8A 5IW6B 3C6SB 4H0HB 2FBJL 1MCFA 1UACL 4U1HA 4IEFB 4U1SB 4NOBA 2HG5B 5DZOA 1OOAA 4WFGD 3G08B 4PPTA 2VZUA 4O51B 3LB6D 2IFFL 2ZUSA 1NGQL 3NPZB 1AHWA 1HQ4B 3BGMB 3BYTA 3LPGA 5JORA 3TO2B 5IB3B 1QFPA 1U9KA 2YN3A 3QDMA 3X12A 3I3EA 4URTB 2GSIB 4N9GA 2NXZC 4L9DA 5KW9H 2FIRT 2XNAB 1TJIL 3JWDC 4JFED 3KJ4B 4KY1H 4LIQH 4NN7B 4PJBE 4Z95L 3QIBD 5JHDE 3TA3B 2JJSC 3UTPD 5L2KB 2L4OA 4JFOA 4HQQL 3X13A 4MXWH 2CR6A 1DBBH 4QF1A 2BRQA 1MFAL 3C60A 3F58L 3ZYJA 1G7HB 4LLWA 4BH7B 1BM3H 5DD3H 1LK2A 2HKFL 3HE7A 5EWIH 4XB7A 3MA9H 3I6KB 2HLFD 5KVFL 3FT3B 2WNGA 4QEGA 3ORJA 1FVCA 5DS8B 2W9DL 4LKXB 1GXEA 4F33A 1VGKA 2LTQB 2DYPB 3L3OA 4TVPH 3RI5F 5E08L 4OGYH 3Q6FA 5KSBA 3U30B 3A6OA 4GAYB 4Y4KD