4YHZH

Crystal structure of 304m3-b fab in complex with h3k4me3 peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
219
Chain Sequence
EVQLVETGGGVVQPGRSLRLSCTASGFTFRDYWMSWVRQAPGKGLEWVADIHQDGQVRYYLDAVKGRFTISRDNAKSSLYLQMNSLGAEDTAVYYCARNFVRGFGWHFDLWGRGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Antigen clasping by two antigen-binding sites of an exceptionally specific antibody for histone methylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 219
sequence length 223
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhzH01
4GAFB 2EXYD 4U6XB 1J0ZA 3OGCB 3I6LE 2WW8A 4G8GE 4JPIA 3H7BB 3BIAX 3H9HB 4PJCF 1BVKA 5IP4A 3SDCC 4N68A 1T20B 4QXUH 1A4JB 4PJGB 3TYFB 1TITA 3B9KB 3RZCA 2BVTA 4UINH 4F37F 3V7AG 3V5KB 4NN7B 4XPFL 1P5UA 3LKNA 5C2UB 1IE5A 2XZQH 3V7MA 1B88A 1HQ4B 2RIKA 4TSBL 3VXUD 5EU6B 5B39A 5D7JC 3ZMRA 4G7YH 3VFOA 4JY5H 3FO9A 1HYRC 1KB5H 4ZUSA 3BGMA 4JM2A 4F7MB 1T5XA 4MMXC 1YY8B 2YK1H 3WFBL 4U49A 1L7TL 1RUAH 2BK8A 3ZE2F 2F5BL 2UZXB 4I2XA 2VDNL 3F65A 1KLFA 3DUSB 2GIYA 3OF6A 4X4ZA 2ED9A 3GM8A 2R0WH 3UZEA 2V5RA 2ESVD 5B3NA 3GRWH 4O02L 2HFGH 2YUXA 4FQ1L 5JZ7D 2DI8A 4HS6B 4LLUB 1JGEB 2VTFA 3CFJA 4NQDA 3ZT7A 3LEVL 1U36A 5I74B 5C0CE 3NCJL 1FV1A 4RRPG 5EOCH 4YHZH 4NZRL 1FH5L 5E6YA 5SV4A 4ODXA 1VA9A 2JLLA 3GI9L 2V9RA 3QUZC 3BYTA 2LVEA 4OKVB 3MLVL 5HGGS 2CRMA 3EO1A 4L4TE 2K3TA 4GH7B 4AM0B 4QNPE 3EW3B 4RMWA 4X83A 3P11L 3BEVA 4LP5A 2EYTA 3OL2A 1AP2B 3W2DL 1NLBL 1JIBA 1SYVB 2PXYB 5DVLA 3FAWA 3QIWD 1EPFA 3JTSA 1MAML 4F57H 5GZOD 1BGXH 3UPAA 5ICZB 5IG7A 2BHUA 1L0XA 2G75B 5J8OA 2R56H 4WI3A 5MENA 1HYSD 1CTNA 1Y18B 4Z18A 1S9XB 3D3VD 2H45A 3MO1A 4MJ5A 2WLZA 1M7IA 4PJ8D 3WE6B 3C6LB 4S10A 3MRFA 5EOQL 2NLJA 2ZOKA 4OGXL 3ZDZF 3HNVL 1NGYB 3FRPG 2V7HB 3U4BH 3O4OB 5MEOA 4GSDH 4LNRA 2DMKA 2IPKA 2X4OA 4OI8A 1CDIA 2ZSVB 2VZ1A 1NUDA 3OAZH 5E8EB 1U6AH 1QSZA 3ILQD 2E7BA 3N9GL 2HG5A 4QNPF 4DTGL 1T1ZB 2OJZH 2OTWA 4BZYA 1J10A 3CVIL 2XQBL 2AJSL 2KDGA 1ROWA 4PRBA 2YXMA 3U7WH 1LDSA 2D7TL 4Y19D 1CD8A 1ZHNA 5GGTL 2BNUB 4ALAH 4PLNC 3G5XA 4Y5VA 3MXVL 3VGAC 5IF0A 3BPLC 2WANA 3SGDI 5J11B 2B2XH 5SWZE 2F54E 1M6OB 4K55A 4X6BB 3QFDB 4WI2A 1FYTE 4EVNB 3KXFB 1BEYH 2AEPH 2Q8AL 1F90L 1JK8B 4FQJL 4ERSH 1D5BB 4G3YL 4Q9BA 4W6XB 4P2OB 1RHHB 3QFJE 5I1KH 1J1XL 3QUML 4LPUA 3C60D 2D7MA 3L3IB 2WIIB 4D0DB 2AEIT 2BY1A 3QZWB 2APXA 3VFVA 4KKCD 5J56B 4JQVA 5IVXB 3WUWB 5CP7B 4L9LC 3O41A 5E2VL 4Y88A 4V1DB 2VO5A 3PWLB 4XRCB 1Q0YL 1UKSA 5D6CA 3QG7H 5GGVY 1KN2H 3PNWB 4N0RA 4X7FC 4DUXA 4Y4FD 2MJWA 2QSVA 4WV1C 3DVGA 3EDEA 3CFKB 1NL0L 4TSCL 1CL7L 3VWKB 4OGYL 4OV6F 1S9VB 25C8H 4LBEB 1KB9J 1HKLH 2YD5A 1Q1JH 3MODL 4WUKL 4KVCH 1A14L 2V2WA 5I1LB 1QUNA 5I8OH 4Z7WE 3D87B 1JN6B 2CK2A 5EO0B 4YXHH 1LO3L 1CTOA 1NAML 2P24A 4X5WA 2FJGB 4R2GC 4C83A 2VYRE 2Y6SC 2RCSH 1R3IH 1MCSA 3MRCB 2A83B 3VGHA 1DBKH 2APVA 1NMCB 1YY9D 2I5YL 3JWDC 1L7IL 3UZQA 1RZKL 2A6KB 1C08B 2D0FA 4MXWH 5C0BE 4DGVL 2EH8H 4F9LA 3O8XA 4KJWD 1D9KC 4WTZA 4U31A 5I76A 3U36A 3GMRA 2JIXA 4XP6H 5EFIA 1KJ2H 1T6WA 5F6IC 3QDGD 3QDMA 3BGFC 1FFQA 3K2UH 4O2FB 2WWMD 3VGFA 5C7XL 4I4WB 1ND0B 4N1CA 3V5HB 5DC4B 5E2WL 3CFCL 3A67H 4W70A 4CNIB 3VXUB 5C70A 5HVWA 3SE4A 5HHNB 4YPGB 3WHXA 4Q9RL 5FEBA 2F58L 4LLVA 2DQFB 4JHAH 1RQ5A 2EZ0D 3UTSE 3ZHLA 3L7FA 2F19H 4PRIA 4X6EA 4Z7WF 1QR4A 4LCYB 1H3VA 3BKMH 4XMKL 1U8LA 4OCXL 1KYOJ 1NGXA 3WFCL 1HH9A 1R3HA 2AK4D 4QY8B 4EN3D 3LQAL 3KHQA 4N1HB 3KYKH 4LSVH 5CEZH 5IB5A 4X4ME 1BFTA 4U1LA 4RFEA 5FK9A 3SGDH 5F7KC 3TJHC 4OFDA 3ZKMD 4DW2L 1AQDB 5KAQF 3E2HB 4WW2C 1S7UA 4AEEA 5FYKL 5DJAA 1MFAL 1X5GA 4Q97A 1BAFH 3CVHL 1VEOA 5D7IB 2VN7A 2AXFB 1F4YH 1DANU 2OMBA 4BSVB 3ZKNC 1YEFH 4G6JH 4R26L 4NYLB 4LCCC 3O11B 1CK0L 4HCRH 3VH8A 2JKXA 4CU6A 1KC5L 5F1NA 2OL3B 4WNQA 5KBNC 2GITA 1MI5A 4PV8A 1U42A 1CDBA 2FO4B 2X7LB 4D0CB 1KNOB 1OGAA 1J11A 4QHNB 5EWIH 4G9FE 4DZ8B 1N6QH 4TSAL 4XHQA 2GTWB 3SDYL 3HR6A 3ARFA 3V7AE 2DMBA 4JFYB 1PSKH 4MAUH 4YHIB 2VITB 4I3RL 3LIZL 5DD3H 2DM7A 2IALA 2JB5L 3DECA 1ZT7B 3N1QC 5FOJA 3KLSA 1RZJH 4KZEH 2A38A 2IAND 2VXVL 4M1DL 1J8HE 4KAQH 4AEHH 3Q6GL 3O6FC 3QULB 5E1AB 3JWOC 1C5BL 1LO4H 2Z8WC 4OZFG 2WWKT 5E4IA 1FGNL 1TVDA 5ETUB 1TVHB 1IAOB 1HN1A 1CN4A 1RURL 1Q9LB 5HGHA 2FIRT 4BZ1L 1KPUB 4PP1D 3HZYA 4WY7L 4N0CD 3DYMA 2IH3A 4MAYC 5KS9B 2ADJA 2CIIA 1KEGL 4JR9H 5LAXA 4YZFE 3KPSD 2A74A 2HRPL 5JXED 4HJGA 2YRZA 3SDCA 1B90A 3V52H 1RFDH 4P4RB 1PG7X 4N0UB 2PYED 3MRIB 6FABL 1D5XB 3T2NH 3VRLF 3UMTA 3E8UL 4Y19B 3ZKND 2AS5M 5DJXB 2XWBB 3EFDL 3VA2C 4KGJA 2ZUVA 3WD5H 2AJXL 3VXQA 1Y6MR 3PGCB 1W72B 2PTTA 2F9BT 2EKJA 1MJ7H 4CJ0A 4RGNB 4DUVA 1EEYB 3LAFA 1E6JL 4TN9A 1CF8H 1E28B 2V5MA 3GBML 5IOPA 3MR9B 2VAJA 2VQ1B 3ME0A 4F2MB 4C4KT 4WHYG 4YGVA 2J6EL 2YD8A 2YSSA 3NZHL 4PREB 3M1BB 1UM6L 1I1AD 3I75A 1JWUB 2CKBH 2GCYA 4P2QA 1FZKB 3RVTD 4K3DL 1IEBB 4I9WD 5DMYA 5CJ8A 1G7MB 4WTXA 4TVPH 3O6FD 4JJHA 4YZFF 3KPRA 3D25A 1DLHA 3TT3H 4QXTB 2DQUL 3WIIL 1X5ZA 4NM8H 1I7RB 5E9DA 4KJPD 5EO9A 1KBGH 1MCEA 3HNSL 3RA7H 4IOIA 2RFXA 3H9SE 5EC1B 1RI8A 2WBKA 1T2QH 5HD8C 3BRDA 1DQLL 4K8RH 4Y4FB 1RJLB 4HUWA 3QUZA 4OF0A 3VXOA 1I7UB 3FO0H 3PWPE 1D5ZA 4BFIA 3DX7A 5GGSY 3EYFA 3QIBC 4WUUD 2XY2A 1L9NA 3Q2CA 2C4FU 3IU3A 1A2YA 1PQZA 3FQUB 3SGJC 3QPQC 5IT2L 4N8PA 4DVRL 3T4AA 5JTWA 3PQYE 4U2YA 4K94C 4JHWL 4DKEH 4HUUA 2VERN 5LWYH 2W0FA 4E42B 5IFHH 2VUYA 3INUL 2H2PC 1IL1A 1UYWL 4MNQD 2QHRL 1F3DJ 1XAUA 3DSNA 1K8IA 3MLZH 2NX5A 1S9WA 4J8RB 2AJVL 3T8XB 3STLA 4GBXD 3N50A 5E95B 5CEXA 1CLCA 2APTA 4RGMC 4O5LL 4OCSH 3IDMB 3QDJD 1G6VK 3ZTNL 3U2SB 3TPUB 3RI5F 2NXYD 1HXMA 5EBWA 4XNXL 1G7PB 2QSCL 2FO1A 1TETH 1GOHA 3GBNL 4OZIB 4PRPD 4WRLA 2WP3T 4ZUTB 4NUGH 5H2BB 2M2DA 3ISWA 5SX4I 2L0DA 2EO1A 4WU7A 2IBZX 1IAIL 3IDYB 4MX7B 4UV4H 3U30C 1HHIB 5ISZE 5D72H 3ULSB 5E2TH 5DJ6A 2AABH 3LOWA 4FQLL 1NC2D 4Q6IC 4HWBL 3W0WA 5C9JA 4HUVB 4P3CH 1X3DA 4KROD 2JJVA 3AFLA 2BC4B 4LSUL 1EIBA 2AKRA 4X6CE 4X8JB 5JDJA 2R8SL 2GJ6D 1T03H 1KV3A 4WEMB 4X5XB 1FPTL 2ARJB 3DGCR 1IKFL 2OQJA 4QRPE 1RZGB 1R3JA 4JO4L 4U1GC 1KN4H 2ENSA 2AXHA 2Z0BA 4QHMA 4LSQL 2JJTC 2MTPA 2WZPD 4HBCH 2OSLA 4KKAD 4FFZL 4OLZH 1F8TL 3MV8A 4P3DB 3I2CL 2XKNB 1FVEA 4ZTOL 1QA9A 1W0WB 4XNQA 4P5KB 5HI3C 3CSBA 1OSPL 4H88L 3MUY1 3SJVE 1FG2B 4S2SB 3AGVA 4MZ2A 1BBJB 1QP1A 3OX8B 4L9LA 5J6GA 4XPTL 3RIFF 5A43C 1IGTA 5C08D 4F7EB 3O4LE 2X4PB 5J6HA 2DN7A 3QXAB 4FQXC 3P4LA 1TENA 4QHUA 4HG4K 2P44B 1A0QH 2VDOH 4WV1A 1S7VA 3RIAF 5CUSL 4X98A 1JCKA 3EGSA 2BRRH 1BQHG 2ICWJ 4P59H 4P9HC 3C8DA 4G9DB 4AEFA 2B4CL 5F7DB 3NN8A 3SKJH 4JQIL 4L4VD 4X6CF 4OZHF 2FHFA 1F4XL 4W6WB 3WLWD 4I0PD 3V0AC 3CAFA 2ZUWA 4F7PB 3MYJB 4UMGA 1I7ZB 5E5MB 2Q3ZA 3I6LD 3WS6C 4G8GD 1CE1L 2EDDA 4TYUA 1WC7B 1DL7L 3BVNA 3VXPA 1IMHC 4UV7L 3TLRA 1XGUB 2CH8A 3KPSB 4M7JH 1WCBB 1XF4A 4YDKH 3M07A 1ZHBA 1D9KA 3IDJB 2FWOA 4JRYB 3QUKA 3CMOH 2PYEB 4YHLH 2YPLD 3RL1B 4YBHA 3KPPB 1HHGA 1LO5B 1T7XA 2CLVA 1SJHB 3CSPA 4UQ2B 1WTGT 5JO5A 3FB5B 1VGEH 2VC2H 1PKQA 2P42B 3NA9H 3GSQA 1KT2A 5SX4H 2BVPA 4AT6A 1YEEH 2AJUL 3RPIB 3T4YA 3TT1L 4WJ5B 1GHFH 4OIIL 4GMTH 2D03L 1PYWA 4X7SH 5DURD 4YX2H 4M62H 2A77L 5CGYC 2GKIA 3G5ZA 4PD4K 2BY2A 3IJYA 1WITA 3BYYA 3ULUL 5JIPA 1QEWA 1T0PB 1XZ0B 5F96H 5ADOL 1ZEAL 1I1AB 1YYMH 4O9HH 5IB4B 4YDJB 3ZHKA 1ZGLM 1I8LC 5IROA 5KSAC 4FQCH 4MQ7A 5CZXD 1A9EA 5FYKE 3AC0A 3QAZC 3MRQB 4OF3A 5C0CD 5I75B 4F7CB 4JCMA 3IFOB 4B5EA 4LVHB 5HHQA 4QHKJ 3P30H 1P4BL 1X6NA 2DKSA 2NY2B 5HYJB 1BWWA 4L4TD 4LCCA 4KTYA 4Y1AE 3S4SB 4EUPA 2EDQA 3RWCB 1QZ1A 4GKZA 4HJJL 1CU4L 3FHQA 3BD5A 2OJEB 4NP4H 3S97C 2LAGB 3FQTA 4HMCA 3VD7A 2ZNWA 3KJ6H 3JV4B 4WUUB 3EYQD 3EYUL 4UT9L 3B9KC 3SQOH 5IR1B 1MRFH 4EIZC 5ILTH 4L1DA 2W92A 4BK4A 4J7RA 5CFHA 4I5BB 3PWNA 3TNMA 4L8BB 5D5ME 5EZIH 1JPFB 4X0KB 2ADIB 4OTXL 3LKQB 1RHFA 2XZAH 1KTDA 2HN7A 5AWNL 4IHOA 3O45A 3F12B 2P45B 3HG1E 5T33H 3PGDB 1HHJB 1K8DA 1MAJA 1S7SA 4WCYL 2YOCA 4ETQA 3REWB 1UJ3B 5E0QA 1U8IB 1ZLVK 4MNQB 1CBVH 1JNLH 4UOW0 1U2HA 1J1PL 1C1EH 1N64L 2VLKE 1NBVL 3HS0A 3RX7A 4GBXB 3VXSE 2EDWA 4GG8A 4KJQC 1FLTX 3V2AR 4NO3B 1NJ9B 3PJSB 3QDJB 1IKNC 2MWCA 2IBGA 2BVOA 5DQDH 5DTFB 3RY5A 2NXYB 5BV7L 2VDML 4JFOA 5GGVH 4PRPB 5D2NB 1EAJA 3OPZL 4KKLC 2R1WB 5I74C 4MJIE 1NBYA 4BUGA 1VACB 1OGTB 5ANME 2DB8A 2I60H 3IJSA 5EUOB 1DQQB 5D5MF 1JZ8A 1H15A 1FNSH 2FLRT 1MY5A 1TCRA 1JPTH 1Q0XH 4OD3L 5F7FA 1TNMA 4ZXBC 5SWZD 2F54D 5CGMA 1FYTD 3S36X 2VOTA 1G7QB 4UBDD 3G6AB 5ACZB 4KQ3H 5D96B 1HCFX 2GJ6B 1EMTL 3CUPB 4D0BB 5IMLB 1VKXA 4PRHE 4XWGL 2PXYC 5IV2B 3PL6B 3QFJD 3ARGC 1OP9A 5TFSH 4IS6A 4O4YL 1A6VL 1P7KB 4EDXA 3B9AA 1MPAH 4AEIH 2XN9A 3ET9F 1KIRA 2EYSB 2I9LA 4XVTL 5LXGH 3WFDH 3NFPA 4WDIA 4NQCA 2OBGA 2C1PA 3LPGA 1OTSD 5JHDE 3KPOA 1ZS8A 5HDQL 2ZUYA 1MFEH 1DN0B 4OUUA 2HWZH 3ELAT 3L3GB 5EZLA 5JDSB 5C08B 1G6RH 3LKPA 1D5IH 3BO8B 4L5FH 3IKCB 1BLNB 3GIVA 4PUBL 4XPBH 4C58B 4YBLB 4L3AA 5TDPA 4JJ5B 3BWAB 4CGTA 4TQEL 5BRZE 3O3EA 3QCTL 2EDFA 1U3ZA 1CLZL 2DWDB 2ZUQB 5FKAA 4PBWD 2WBJD 5J1SC 3QIBA 4YDVB 5D2LE 4L4VB 2UZYB 5HBBA 3QHZL 4XVJH 3AXLA 4JFDA 1XT5A 1TJGL 5FYLL 4H1LH 5TF1L 4JRXD 4OD1H 3DX8B 1XH3A 4HF5H 2ERJB 4I0PB 3SGJA 3V6FA 4MA3B 4ZQKA 4J2XA 4ZFFB 1IC7H 4G8GB 1CFTB 5C0BD 1JWMA 1PG7H 2AXGB 3CDGA 4R96B 3LPWA 5C07A 5D1ZA 1EDQA 4ZPVB 1G7IB 3QEGL 1JRHI 1V3MA 3PIQA 4Z7NF 4JKPL 4OM0H 1RZ8A 3R8QA 2XNAA 4DQOH 5H35A 5ICYB 2CUHA 3VFPA 3QNZA 5DQ9B 2YPLB 2NNAA 3GSXB 3OKEB 1NFKA 1OAXL 5GHWL 2NR6C 4XP9L 2HAZA 2Y36L 3T77B 3BP7B 1HDMA 2ICEB 1E4XL 4MA7L 4I3SL 5H37H 3UTSD 4D94A 2W60B 4GRMB 1JYNA 1IGFH 3Q6FA 1QLFA 2F8VA 4UT7L 1AR2A 1FLRH 2IADA 4IMKA 5D2LF 5EBLB 1N5YL 4PJFB 5MEPA 4HAFA 4ZUWB 2A0LC 4P2RD 3GSVB 1DBMH 3EYOA 1A1NB 3CFEB 4YBQD 4NQVB 2BOBB 5DVMA 3HB3D 4W4NA 4XP4H 5DYOA 1AI1H 3VWKC 4Q6IA 4FG6D 1U8OA 1FZMB 4FP8H 5DHVB 1Y0LB 3LS5H 4FOMA 4ZNEA 1J1OL 1UM5H 1EA9C 4PLKD 2SEBA 3OKKA 1IZJA 1DE4B 3BSZH 2IAMD 3PABB 2APWA 2V9TA 1UT9A 4HDIB 2P46B 3F7VB 2VDQH 5DVKA 1CFQB 2HTLC 1DBJL 5AD0A 3KS0H 5DEGA 3SE8L 1NBZB 1DFBL 3RVVC 5GS0D 2Q8BL 2ZWLT 4NCC2 4L3EA 4HKZB 3U4EB 4G9FD 1T21A 2DQTH 1C5CH 3PDOB 3PF2A 3QEQE 1U8QB 4GXVH 3P9LA 4BFBD 2CRZA 4G7YL 4JY5L 4UT6H 4IMLB 2FATL 2JK5B 1AH1A 3QXWA 1ONQA 4EDWH 4KMQA 1INQA 5CILH 1KJ3L 2YK1L 2YA2A 2BNRE 3D2UB 1J8HD 1N2RA 5GJSL 5F3BB 3OG6B 4FQXA 1LNUB 3V6OC 1NFDE 2AK1L 4E41A 1MFDL 5A2LH 3D85B 4CMMA 4NQXA 5JIIA 4HPYL 2VRAA 1AD0A 1RU9L 3D9AH 4FQ2H 1FNEB 5IM7A 5HY9A 2R0WL 4HFUL 3JSSA 1MF2H 4YC2B 1DUYA 3VFSA 5HI5D 3FN0H 4P49A 1FGVL 3EOTH 2IH1A 2DTMH 4PJXE 1BD2D 4A6YA 2CGRH 5L8JB 3F6LA 2B5IC 1QFUH 1P2CB 5BO1H 3V8CA 1JRHH 4U05A 4WWID 1CICB 4NNPH 3FCTA 2W9EH 4YHZL 1FP5A 3E2HC 2QSQA 15C8L 5ESAB 3MRRA 3BT2H 3ZL4H 4RAUA 4GG6A 1ZLUH 3EHBD 1KCRL 5MI0C 3QWOB 2JJWA 5GJTL 1A7BA 4NZDA 4PRAA 4LSPH 4EBQH 3CFDB 4G8FB 3C2AH 1NFDF 3MV11 4JY6A 3MRBB 1WWWX 4FN0A 2JELL 1IJ9A 2MHAB 2H6PB 4GRLA 3V0VA 1LD9A 2O93L 3NA4A 1H8SA 1FYTB 4MSWA 4OGAC 1MWAB 2R56L 3ULUE 3AS0A 3EDFA 5I1EH 4ZDHB 1R5VB 4XCNA 1H0DB 5E99H 1ZXQA 5LGHH 3C87A 4BH8A 1A8JH 1XGPB 2ICES 3MROB 1X5IA 2Y23A 3S35L 2D31A 1KEML 5SWQB 2Z91B 3BQUA 1YQ2A 1F4WL 1MY7A 1I8LA 2KZWA 4UUJA 5FO7A 3NCYP 1R24A 4GSDL 4HKJA 5KSAA 1BIIB 2FBOJ 1RMFH 2BCKA 4RMRA 1IGYB 3H9SD 1U6AL 1CLOH 3FTGA 5C71A 4R4NC 2DQGH 5KVEL 1LHZA 4WWKD 4YO0B 1JGLH 3W5MA 1I85C 2C3VB 1S5HB 3KLAB 1OVZA 3BN9C 1BOYA 2X1XR 4O58H 3IU4L 3PWPD 1I8MB 4U6XA 3ZKQD 5D7KE 3VG9C 3BZDA 2N7AA 3OGCA 3M8OL 4YAQA 4M7LL 2XTJE 4TOYL 1U91A 3HC0B 3H7BA 3P77B 4JFEE 4TNWF 1T20A 2WBJB 1A4JA 1AJ7H 3DO3A 4YH6A 4PJGA 3SCMD 3ULUF 2IFFH 3TYFA 3B9KA 3PQYD 3VFUB 4P9ML 2DJ4A 4PJIE 3R1GL 3LVEA 1YEKL 2LQRA 4JRXB 2G5BA 3V5KA 4YLQT 2HFTA 4HWZB 1MJ8L 5SWSE 1HNFA 3TIEB 1HQ4A 4KK6D 5E8NB 3T0XA 1BEYL 2AEPL 1YEDB 3RHWK 5EU6A 1UCBH 4F7MA 1YY8A 1SBSL 1ZSDA 1WCQA 4JFFA 4HWEL 4PG9B 4C57C 5GSRB 4Z78B 4PJBE 2CO6B 4UILH 2AI0H 1U3JA 1S7QB 1OP3K 1GC1H 2Q87A 4IDJH 5D4QA 4Z5RB 4YUEH 3OAYK 2ITDB 1WEJH 3DUSA 3MUGB 4JZOA 3FN9A 4Q6YA 3RX8A 3B5TA 3HMXL 4WW1B 5DFVD 1HI6A 1KN2L 1FO0H 1IKNA 3D69B 2EDOA 3DNKA 3AS3A 4XB7A 1D7FA 5EA0L 5ESQB 4HS6A 4LLUA 5FHAH 1JGEA 3RWGB 5I1CH 2EO9A 2NY1C 25C8L 4KMTL 5DRXA 3NFSH 4PJIF 4M5YH 4P2RB 3T65B 1SEBA 4H0HB 5I8OL 4CW1B 4IEFB 4WTWA 1FZOB 4NBXB 2QADC 4OKVA 1SJEB 4KUZH 4ZXBA 1WVZA 5IFAH 5IQ7L 4AM0A 2IG2L 5CJ5A 5H94B 4QRPD 1CFVL 3WN5C 1FNGB 1AXTL 4WHTA 4S0SD 1AP2A 4M6AA 5E7FA 2EH8L 4ZO7A 1SYVA 1QR1B 2IAMB 2PXYA 4PR5B 3WIFB 1ZGLB 1WZKA 3ARGA 3ARUA 3V4UH 2R0KH 4XP6L 1KJ2L 2X5PA 4ODHL 3KPMB 2G75A 2NTSP 3EJZC 4W81A 1RUKH 1VGKB 3WDJA 5HI4D 4NO0D 1CR9H 1W8OA 3SJVD 1Y18A 4G9FB 1S9XA 4LRIC 5MHSE 1I4FA 5F7WC 3FO2B 3T1FB 4HC1H 1BHGA 1TQBC 3LKOB 4NO2B 3G9AB 3O4LD 1I8KA 3C6LA 1MNUL 1FZJB 2DYPD 5A40E 3FQXB 3HLAA 5I16B 4TVSa 3O2WL 1NGYA 4PJHA 2V7HA 1CZ8L 2NY7L 3G08B 3GSRB 4LLAA 3G5YB 3IXTB 4LDEB 3BKML 3OAYH 2ZSVA 5GRJH 1NDMB 4P23C 2Q86B 3N85H 5E8EA 4AH2B 4DCQA 4UNTA 4LSVL 3DRQB 1M7DB 1BZ7B 3TN0B 3VMOA 3BEWB 1T1ZA 5FYLE 4RNRB 1CQYA 1DBBH 3U82B 4Z0XA 2VZSA 4R0LC 4WU5A 4Y4HC 3MLRL 3QI9C 3VGBA 3K81A 2BNUA 5DSCB 2K7PA 1BD2B 2BHYA 2VXSH 1ETZA 3QWQB 4A2MA 2AJZB 4ETYA 1BAFL 1J9CT 2R69L 3BKJL 3HAEH 5C9KA 3FMGH 5DUBB 3D0VB 5LGKA 2D7OA 1GGIL 4JO2L 4X6BA 4EVNA 4LARH 1K3ZA 3AB0B 3U1SH 1JK8A 2EDLA 4Q74A 5K59F 2AQ3A 5F9WB 4TNVF 4XNUL 3S36H 1G7LB 3TBWB 4EQ2A 1JTPA 1RHHA 1WJ3A 3W9DB 3MV9E 4LL9A 3ABZA 1LK2B 3EDJA 3EJZD 3L3IA 2WIIA 3U6RB 4D0DA 3LY6A 3QZWA 5DD3L 1KCKA 3EOAA 4GO6B 4OLYL 3C5ZB 3SDDD 2DJSA 5IVXA 1UZ8B 2NY6B 4LSRH 5F1SA 5CP7A 5IMKB 4YPJA 3HCVA 3E6FA 4V1DA 4N8VA 5IESL 1MFBH 4XRCA 1LO4L 2BSED 3JWNC 5DMGC 2R4SL 3E3QC 5J89A 3CK0H 4XNYH 3CFKA 1QSFA 5FYKD 2P4AB 3VWKA 3BPNC 1S9VA 1U95B 4LBEA 2EIZB 4HAGA 1I9IL 4M3KB 3K74B 4R90H 4ONHA 1T3FA 2VISB 3KVQA 5I1LA 2VR9A 1DQMH 3HRPA 1JN6A 4OCYH 1MQ8A 2N4IA 4K7PY 1RIVH 4XPAL 1KPVB 3DTXB 1P7HL 4CADB 5IBLC 1DQDH 4Y1AD 4QTHB 3ARXA 3VXRA 3JTTB 3W82A 2FJGA 4FZEH 5FCSH 3LEYH 3H0TA 3H7LA 1T7ZA 3MCG1 2GK2A 3PWPB 3ZKSD 5DMKB 2A83A 5EIIB 3T2NL 1QRNE 5T1DH 1I3UA 2A6KA 5FV1L 1C08A 4L9DA 4MDJA 4Z7QE 3DXAE 3UC0H 2VDRH 12E8H 1YNTB 3HC4L 4OM1H 5JW4N 5FHBH 3SCMB 4R6UA 4NFBA 1MCWW 4O2FA 5BS0E 1CLYH 4XCCH 4PG2A 4O51B 3HG1D 3G6DH 4PJEE 4I4WA 4BH7B 4HPOH 3V5HA 2HKFH 1D6EB 4AK1A 4JO1H 1IVLA 5CBAB 4CNIA 3VXUA 2BVUA 3V6OA 2EDYA 2EIDA 3LSOB 5CJQL 4YPGA 5HHNA 5HGDB 3ZKXC 4ZAKD 2J8OA 2GY7B 1UQSB 5A2JH 5C8JB 5F3HB 3IVKB 1ZVYA 4LCYA 2FL5B 2H26A 4TVPL 3MLUL 5BZDB 3G6JB 3SKOB 1DQJB 1C7TA 1JTTA 3AMKA 2CQVA 4OBRA 3DIFB 4ONFH 1YEHL 4NM8L 1G84A 3GGWB 1JHLH 1MCNA 1HWHB 3K8LA 5JXAH 3BX7C 5A3IC 1NDGB 1AQDA 1AR1D 1R5IB 1T2QL 4U4BA 4Z7QF 1A3LL 4XHJC 1Z0MA 5EU5A 1R5WA 4K8RL 4A6YH 5I75C 2DD8L 4Z0BH 2GTZA 1A47A 3LDBB 1OAZH 3MOQA 1LE5A 3LD8B 5D7IA 2AXFA 2DDQL 4XBPB 2NXZD 1JYXA 3CFBB 5B39G 4NQEE 4PJEF 4MNHB 3SO5A 2PO6B 2XA8L 3O11A 2ZJSL 5D7LB 2OL3A 3DPBA 2X44D 5AUMB 2YZ1A 5IW6B 5DA0B 4PRHD 2FO4A 2X7LA 2Z31B 4OZHB 5L2KB 4DZ8A 4LHQB 2GTWA 4HFWB 1RZFL 4N9GA 3QUMB 4HZAA 2X4UB 5KVDH 4HIEB 1PY4A 3TNNA 4JFYA 3DV4B 4YHIA 2FEEI 2VITA 5TQ2H 3FOMB 5J9PB 3C9NA 3MLZL 3MRLB 2WQRA 2J8UE 4LQFL 4JREB 2DKUA 2FHBA 1WV7T 1P9MA 5KVGL 1U3HD 3GDBA 3QULA 5JQ6L 5E1AA 5JLZB 4OLEA 1PAMA 1KCVH 3SKMA 4OCSL 5C09E 5CIPH 5ETUA 1TVHA 4R4BB 1UXSB 5FFLA 3VD4A 3O4LB 4YWGH 1FORH 2JJUA 4LNVA 1Q9LA 2Y25A 4ELMF 1IGJB 2W9DH 2WUCH 1I85A 1OSZB 5BRZD 1WZ1L 4PB9H 4YE4L 5DJZB 1BOGB 5KS9A 4UV4L 1TJHH 3SE3C 4IOFD 1AGEB 2DF3A 5E08H 4KRPB 4DOHE 4EKXA 5E2TL 4FZ8H 1BBDH 5CHNA 1NAMB 3PWVB 4APQD 4PP2B 2HT4D 4J1UB 1D5XA 5A2IH 3MRKB 2P49B 5TE4H 5DJXA 3RZWA 2XWBA 4PJDE 4NZTL 1QSEE 4NWUH 3UZVB 3E6HA 3VFGH 2FD6L 4HXAH 3RAJL 1KN4L 1RD6A 3PGCA 1Q9OB 1W72A 4GQPH 1T1WB 4LMQE 1VFMA 3QJFA 5HHME 5D96C 4GQ9H 3WSQH 4M61A 3MGTB 4NCDA 3MR9A 4F2MA 5L0QC 4PREA 35C8L 1WLHA 3CC5A 4MWFB 1QBMH 1JWUA 4RSVA 1A3RL 1T89C 4DUWA 3OMZA 3O81A 2HTKC 3BUYA 2ZCKH 3VFMB 5JW4R 4QWWD 2V5TA 4MGXA 1NMAL 1MJUL 3KLHC 1E6OL 2QBWA 1OT1A 3CXHK 4QXTA 2ZCLL 2LVCA 1A0QL 1OD7A 2VDOL 4ZS6C 5KN5A 3F58L 2VXUH 3ILPB 3MPCA 4G42B 2R15A 3HNTL 1I7RA 4P59L 4JFHE 3X3FL 3OKLB 3SKJL 5K9QG 3AREC 3VI4E 1YJDH 1QFWL 2JF1A 4PJDF 4ZSOB 1JPSL 4Y4FA 2HRLA 1RJLA 5T3ZL 1QNZH 3NOIA 5I66A 5FECB 4R7NA 1I7UA 1MCBA 4W6YB 3ARDC 3PDDA 3CZFB 5FCUL 1GSMA 3U79A 3L6FB 2FEDC 4LHJB 3MLSH 2M1KA 4IRJC 3P0YL 4K2UH 2WWKO 3O3DB 3WN5A 4P4KD 3FQUA 2BZDA 1XGTA 2VXTH 4U3HA 4GAYB 4Y1AB 3HZVB 1AD9B 3TPKA 2P5EE 4MJ2A 2CKBB 3GSOB 3FQRA 5FM5M 1IFHH 4WIQA 4YHLL 5CP3A 2NTFB 2D7PA 4E42A 4LVOB 1KTRL 3QEQD 1FE8H 4S1DC 2FECI 4WFFE 1KUMA 4NNYB 4LRIA 1MCPH 2P7TB 3VXMD 1WZLA 4J8RA 1XIWB 3QUXD 2JJSC 3T8XA 5D5MB 2K7QA 2F5AH 3QO0B 4HIHA 1GHFL 2D7QA 4H5SA 4PGBB 4YX2L 1GZQB 1OF2A 3NGBC 4M62L 1YN6B 1OTTC 4FFYH 4LCIH 4P0DA 4LIQH 2D7NA 1XGYH 3IDMA 1NCTA 3HE6D 5IWLA 3U2SA 4P23A 3TPUA 2MCPH 3RVUC 3FHAA 3RWDB 1ZHLB 1G7PA 1IQWH 1J5OL 4RMVA 4OZIA 5C0RL 3UO1L 4Y2DD 1ZA6B 2P5WE 4FQCL 5B4MD 3NH7L 3RTQC 4MX7A 2NY4C 1HHIA 3TYGH 4BKLB 4C4KO 4Y4HA 5BVPH 3ARED 1I1YB 1OAQL 2V5SA 2R29L 1B6DA 4RAVB 1V3KA 4M7LT 3KGRA 1F42A 4HUVA 4G6MH 5KJRH 4ODSL 4JM4L 4QKXB 3RNQB 1OAUL 3EIFA 4WTZG 3NAAH 5JIKA 4U3XA 4U7SA 4X8JA 5C0AE 3GM0A 1IT9H 3SPVB 5J13B 4X5XA 1YPZE 2ARJA 2YMXH 5ANMB 2XRAL 5DEFA 3QUYD 1RZGA 4NP4L 4Z7UE 4ZTPH 5J12C 1H8NA 3ES6B 4JG0L 3UP1A 5ESVB 3FQWB 3KJ6L 2BMKB 2NXZB 2BHZA 4RDQG 4P3DA 5J1AB 2XKNA 3E1F1 2BOCA 1CG9B 1ACYH 2DQJL 4P5KA 1OD9A 2DTSA 1KIUA 5I8KH 3ULUD 3ULVC 4GKNA 5BMFH 3KAAA 1EAPB 4PRHB 3ARVA 3FOLB 5B22A 2CDFB 2F15A 1BBJA 5E8PB 3OX8A 3O6LL 1HINL 2GQHA 2RB8A 3U7YH 4F7EA 4HX1B 4J3VA 4NQUA 5E8OB 1CBVL 5BV7C 1PG7W 1IQDA 5GISH 3FT2A 4MB4A 2L7JA 5EU7C 4TULH 1U3HB 2F53B 3DOSA 4I18B 5F9OL 4G9DA 1OTUC 5F7DA 2B20A 4K9EL 5FYJL 4MJIA 5CJOL 4KK8C 3OKNB 3DUHA 1F4AA 5TDNB 5DQDL 3DUUA 3V5DB 4Z7UF 2X4QB 4OJFL 5D7KD 3RTQD 4RISL 3CX5K 3T0VA 3MYJA 3VH8G 4F7PA 5E5MA 5GGVL 1BPVA 3MLXH 3LB6C 2H9GB 2XTJD 3Q5TA 4XGZB 3RPKA 1RIHL 4XB8A 1CICC 3QYCA 1N59B 1WC7A 2I60L 3OBAA 1TVBB 1A5FH 4EI5C 4M8QB 4HLJA 1XGUA 2WBWB 3KPSA 2OI9B 5T5FH 2JB6B 2XXMB 3QQ9C 5JXEA 5LJYH 1WCBA 1XF2B 1L0YA 3IDJA 2VN4A 4G5ZH 3MCLL 5GRYA 4APQB 4JRYA 2WP3O 4MQSB 2ARWA 5F7HA 3KPPA 1N7ML 3FT3B 1NAKH 2CLRB 4HV8B 1LO5A 2YD1A 5DR5H 1SJHA 4UQ2A 5BZWB 3FB5A 5TFSL 1MCQA 3WKML 5B8CC 5CD3B 5D1QB 5JHDA 4I2XE 4TVPE 4PB0L 5D9SB 2R0LL 2VR5A 1ZA3B 5LXGL 2VZUA 3WFDL 1XZ0A 3O2DA 3ZE1F 4XVSL 1JZ7A 1C16B 5HHVL 5IB4A 4LCUB 3LRGA 1V5JA 4CN1A 2E7LC 2HWZL 1EBPA 4NQDE 4L5FL 3KYOB 5GGQH 2Q76B 4KV5E 3MRQA 5AAWA 3U0PB 1CIUA 2DRUA 4F7CA 4XVUC 3IFOA 3U48A 5FYKU 1GRWA 1B0WA 1JHTA 1QBLL 2C7UB 2Z92A 4FXKB 3WMSA 4EQ3A 5HYJA 1BQHB 4XVJL 5IW1B 4D3CH 3KYNB 3DSFH 1B0GB 4HF5L 2OJEA 2ORBL 1BFVH 5BQ7B 3JV4A 1JI2A 1I3RB 2DLEA 3SDXA 2OL3H 2AQ1A 1R6VA 4I5BA 5KSBF 2EYRA 4ISVB 5MENE 1JPFA 4P5TD 4OZGF 2G2RA 4QCIA 2ADIA 1O7VA 3LKQA 1MCOL 1FDLH 2HT3D 3FZUD 3F12A 1JZ3A 3PGDA 3HI5H 1HHJA 2GSIB 3HPJB 1UH4A 3BDXA 3QEQB 1RIUL 4HXBL 4KV5F 1UJ3A 1U8IA 1CT8A 3HMWH 4B50A 4YIQB 2H2SD 3VXMB 3QUXB 4CU8A 1FLRL 2QJDA 4FTVB 4DKFL 1NFDB 1X4ZA 4GBXA 4ODTH 1MCIA 2CUIA 2GYSA 3TH2T 5EIVA 3MBXL 3TO4D 5C6TL 1NJ9A 3PJSA 1MHPL 4NUJA 3HE6B 3QDJA 5FYLD 5ALCL 5DTFA 3SE3A 5F1OB 4XP4L 3RGHA 4XMPH 5ID1B 4PRPA 5D2NA 1LMKA 4UTBH 3Q3GB 2V17L 4Y2DB 4CL7A 4FP8L 5ADPH 3MFFA 2OZ4H 2W0PA 5EZJB 3OAUL 2IJ0C 3LS5L 3RUGB 1VACA 1UM5L 1HEZB 1CGSL 4DEPB 5EUOA 3VD9A 3BD3A 1FNAA 3T09A 5I73B 1EFXA 1A6UL 4MDIB 2FBJH 3A6OA 3MRNB 3CH8A 3MA9H 4QRRA 5E2JA 2A1WL 1KENH 2QEJA 4K7PH 3QBTB 3LN9A 2XOTA 1G7QA 1O5DT 5H37G 5J0BA 5ACZA 3QHTC 2GJ6A 3CUPA 1ED3B 2KQNA 5DUML 4D0BA 5IMLA 3MREA 1KB9K 1RK0B 3DLQR 1W72H 3PL6A 3QUYB 4U1JB 3MV9D 1QQDB 3B9DA 3QHFH 2PCPB 1P7KA 4GXVL 4UT6L 5JIHA 3UYRL 3HE7D 4DZBB 3GNMH 1T5WB 2DKMA 3ARSA 1T89A 4EDWL 1H3PL 2EYSA 5DMIL 3JVGC 1GCFA 3VFTB 2BP3A 5KZCD 5C0ND 5IBUG 5J1TC 2YXFA 4NKMB 2DIAA 3WO4C 4EJ1C 3IF1B 2Y5TA 1DN0A 1JPGA 3L3GA 2J5LB 5C08A 3D9AL 5T3ZE 5DQJB 2C26A 5DHXB 3BO8A 3IKCA 1BLNA 1KPRB 1MF2L 4M6NL 4JJ5A 3FN0L 43CAA 5DGQA 3ARDA 5D70H 3EO0A 3TN0C 2V2TB 4K3HA 1QFUL 4LGRB 1MFCH 4YDVA 2VWEC 2E7HA 4L4VA 2ENYA 5E5UB 4DGYH 1IARB 2W9EL 4HGKC 3UTTB 1SVZA 5EN2B 3DX8A 3OJDB 1YECL 3B43A 4MA3A 3RP1A 5LKNA 5DLMH 4ZFFA 1YNKH 4KH2A 4WO4C 3O9WD 3GMNB 1CFTA 3FB7A 4R96A 3DXAD 5F9DC 3JWDL 2Q7YA 1NEZB 1XGQA 4ZPVA 2EEAA 4XAKE 3C2AL 4KZDL 1CGXA 3CLFH 2PW1B 3QDME 3RDTD 4PJIB 4CUCA 2X4SB 2VZVA 3AB0C 2P8PB 1X9QA 1UWEH 5BS0D 3GJFB 5ICYA 5IHUH 5C2BH 1CDUA 4TPRH 2C9AA 2JJSA 1L9MA 2YPLA 3OKEA 1S7WB 1T66D 1G6RB 5I1EL 4E0RA 3T77A 5AG8A 3BP7A 3K8KA 2ICEA 4JB9H 4QRQB 4PRIE 3NTCL 2W60A 5LGHL 3K4AA 5I18H 1RJYB 2NY6C 1F11A 5EBLA 2UWEE 4PJFA 4M7ZB 2YS4A 2KQMA 4XTRC 4ZUWA 2VDKL 4H1LB 3GSVA 3GB7B 1RMFL 4M5ZH 1A1NA 3CFEA 2WUBH 1Q94B 1U92B 3LRSB 2BOBA 3EAKA 4DVBB 1HWGB 3BFOA 3EYSH 1CLOL 1DANT 2BJML 2ZUUA 2DQGL 4K7FB 4PGCB 4POZC 5CZVH 2EDRA 4QHLB 3MOAH 3L95B 5DHVA 3VFNB 1CGUA 3CZJA 5T1KB 4OQ1A 1V7NL 2LE9A 2CKNA 1JUFB 4HIJB 2FRGP 5F93C 2DQIL 4KDTC 5FB8B 3BKCH 4GAJL 1DE4A 4NQED 3GSWB 4HDIA 5IB1A 1B2WH 3F7VA 4NN6C 1AJ7L 1CFQA 2IFFL 1MI5E 5GZND 1NBZA 3SOBH 1OGAE 2OTUB 3DHJA 3FAXA 4HKZA 2XZCH 3U4EA 4K71B 3RU8H 1NCAL 3OSKA 3PGFL 4H8WH 1T04B 4PJBA 4JPKH 1U8QA 3O3BB 4HSQA 5F8RC 4NPYA 3SE9H 1DBAH 3IGAB 4IMLA 4NKOB 1JNNL 1ZT4B 2JK5A 3CNKA 4URTB 1JHKH 3FQNA 1UCBL 1MVUB 3D2UA 2WQ8A 1CFNB 5F3BA 1LNUA 4MJ6B 4UILL 4PJAB 2AI0L 4HK3N 1E27B 5E6ID 5IEKB 5HXMA 4EEEA 3ARBB 5C09D 2VABA 5FYJE 1IM3B 4R97C 3JWOL 1J05A 2JCCA 3D85A 1A7PL 1WEJL 4QGYA 2J88H 1DSFH 4IJ3B 5HHPB 1FNEA 4I48B 3SO3B 5T1LB 1OARH 1J0JA 3FT4B 2PNDA 1HOCB 4JQXC 2LFGA 4EUPG 3W81A 5IVZB 1JPST 5T3XL 3KR3L 1P2CA 1RUMH 4POZD 1OP5H 1A1OB 1JFQL 4CKVX 1CICA 3NIGE 1X6LA 5ESAA 2ILLA 4JZJB 4LLMB 3LDBC 1A21A 3S3JA 4X4XB 1ORSA 4AG4L 3LD8C 4KUZL 3SDAC 5IFAL 3S96A 1WGOA 1QSED 5BW7A 3QWOA 4LKCB 4BELD 2PO6C 1U8HB 1Y6NR 3GJEB 2ED8A 3P4OB 5D8JH 2CMRL 5IB3B 4U1NB 5HHMD 2NYYD 3MRBA 4I77H 4U1SA 2Z31C 5JOEA 2MHAA 2H6PA 4OIBA 4PGDB 4Y0GA 5B8CA 1V3JA 3IDXL 3MLWL 3DETC 1Z9LA 4XPHH 2EE6A 3TZVB 2AGJL 5GSVB 2EEDA 4ZDHA 1R5VA 4HKXB 4GW1A 4X4YB 1H0DA 3U9PH 4P2QE 4FFWD 1XGPA 3MROA 8CGTA 4JREC 5CKAA 1KCLA 1OAYH 3KPRE 3RKDC 2Z91A 5TH2A 2E7LA 1AC6A 1MRDH 3NIGF 4GMSH 3TGXA 5D93B 1BIIA 1QBBA 5E9DE 4N8CL 4Y16D 4MA1C 5KZCB 3B9EA 2VLRB 1IGYA 3BP6B 1QVOB 1LP9B 1Z9MA 3QDHA 1NMBH 4F80A 1BWMA 4YO0A 4NKIL 2C4FT 2O5ZL 2C3VA 1MQKH 1S5HA 2ATKB 1D6VL 1A7RH 1I8MA 3P4NB 2D9CA 3L5HA 1XFPA 1Z3GH 4KRPC 1Z5LB 3HC0A 4H0GA 3FRUA 1H5BB 4DK6A 1E0OB 3NIFE 9CGTA 1HH6A 3MRJB 5KVFL 2DLFL 1YMMD 5E03A 4JRXA 1NGQH 3BOVA 5DFWH 3WS3B 3NACH 4K94L 1YZZA 1DVFD 3TA3D 4LARL 3O9WB 1RZJC 4WFFD 5E8NA 2QLVB 4GUPA 1YEDA 3IDNB 3MRGB 4U1MB 3DXAB 3PP4L 3UAJC 3KPQB 3SY0B 4FXGB 4AY0A 4FQQB 3IETB 1MHHB 4U7KA 2X89D 2VKXA 3RDTB 3F7PC 1B4JH 2EIEA 4PG9A 5GSRA 4GW5B 2OTPA 3UBXA 1S7QA 3WNPA 1EEZA 2ICWI 1B0RB 1XR9B 2DLTA 2ITDA 1FIGH 4GW4B 2E6QA 1IAMA 4WW1A 3K4ZA 2P5WD 4GXUN 3ROOB 5L8LB 1JL8A 5IMOB 3MGAA 3RWGA 3GSUB 4OAWB 3S5LB 3NIFF 1EO7A 5GPRA 4NJAH 3N1PC 1JF1B 1UB6A 2YD7A 1H9VA 2R2HB 4M6OL 2DQDL 4P2RA 3T65A 1F3DH 4R90L 3W0WE 2IF7A 1VEPA 1X5XA 4LASH 4CW1A 1RSFA 2OP4H 4NHCH 1FZOA 3VDBA 1YUHB 5C0AD 1SJEA 2XQYK 3LEYL 1KLUB 4XBEH 2X4NB 5LCVH 2VUOA 2A9ML 4ZUUA 2EE3A 4ELMB 1FNGA 5ITBH 4G6AC 1QR1A 1A22B 1ZGLA 4HIIB 3UC0L 2XIDA 3HZKA 1WT5C 3MV8E 4JM2C 4X99B 2J4WH 5IMMB 5FHBL 4YDIH 4MS8C 1IC4H 1A6WH 1NEUA 1LEIB 5KOMC 3KPMA 2Z8RA 1NC4A 2IQAB 1A6ZB 5ERWB 3RVXD 1VGKA 2UV3A 4KI5C 1NGPH 1CLYL 1YEGL 3ARRA 4XCCL 3I50H 1FO0B 4QEGA 3GRWA 1FAKT 3JVGA 4HPOL 2HKFL 2AV1B 4X80H 3FO2A 3T1FA 3WDHA 1INDL 1XIWC 4F7TB 3LKOA 4KRMB 4NO2A 4Q0XH 1FZJA 1P1ZB 1WZMA 3CDCA 1NPUA 2A6JB 1ZVSB 2ZUXA 3G08A 1EHLL 3GSRA 1OL0A 2NMSA 3G5YA 4TUJB 3IXTA 3RVWC 4K8RC 5E24E 2I07B 1F6FB 1NDMA 1N5AB 1CGYA 2Q86A 5JORB 4IRSC 4JGJA 4P9HL 2GK0B 3L9RA 2HLFC 1CDJA 1K2DB 2CDEB 3DRQA 4FMKA 1K85A 4XAWL 4QHKI 4HUXB 3TN0A 3S8WA 5JXAL 1WICA 4RNRA 3RL2A 4PLJC 3M45A 4F9PC 4A6YL 4Z0BL 3BH8B 5DSCA 5EDXA 4WI6A 3TH3T 1FFPB 4AIZB 1BD2A 3ZT5A 1G9MH 4WO4A 3LEXB 2NY0C 2AJZA 5DRZB 8FABB 2XICA 3RZCD 1FHGA 4U6HB 3VCLB 2OK0H 1SJVA 1N6VA 5DUBA 1PFCA 2X10A 1BJ1J 1AHWB 2R9HC 1S8DB 3MXWH 5F7NC 4X9HA 2UZIH 5FM8A 1I9RL 5E6ZA 5F44A 5D6DC 2NW3B 4PJDB 1NCCH 3OKMB 1CE6B 5F9JA 3DVNA 4M48L 2UYLB 2VB5A 2YPKB 1G7LA 4WGVB 1BIHA 1PKQE 3TBWA 3UPCA 4NKDB 5DJ2B 3R06B 3W9DA 5ACLA 1LK2A 4ENEC 4MS8D 4ZFZB 3OHXB 4TVPD 3U6RA 1IC5H 3QIUB 1BQSA 2UVFA 3C5ZA 4MXQD 4HKBB 3UROR 3C5JB 2B1HH 1HHKB 5IMKA 1EUTA 3PHOB 1UJTA 4H20H 3ZDYF 2R23B 5LGJB 2E8YA 3T2QA 2NZ9D 2BNQD 2PTUA 3DV6B 3ARYA 3D18A 1EO5A 5DD5H 3HAEB 1U95A 3P9MB 5GIRA 2EIZA 1JF6A 2HLFD 4P57A 3DRTB 4GOSA 2VISA 2IPTH 4Y16B 1T2XA 4HJ0D 5FF6A 5L88L 2CR3A 4YHMH 5SX5K 1EBAA 4KDTA 1KPVA 3DTXA 4CADA 5DHVH 5FM4A 1ZTXH 1FL5B 3NVQA 1HILB 3JTTA 2I9TB 2DIBA 2Y06H 1CI5A 1KTKE 5DMKA 5EIIA 4K23H 3PV6A 5JA9A 1WFUA 2OI9C 3T3ME 3QCUH 2R9HD 5DO2D 5I15H 1YNTA 3SCMA 3UYOD 4OFVA 4LKXA 3BPOB 1LO2L 2B0SH 3EJYC 3QH3B 4G7VH 5HHOA 1YMMB 1YDPB 4GQ9L 3RRQA 3WSQL 4O51A 1Z0NA 3WNLA 1FVCA 4ZYKB 4AL8H 4BH7A 1AXSB 1D6EA 5GXBB 5DT1H 2ZZUT 5CBAA 4XP5H 4XXDB 1NH6A 3BUTA 5C0IA 4WW2F 3LSOA 5D1QC 1J87A 5HGDA 4YQXH 1PBYA 2GUOB 1QBML 1UQSA 5IK3B 5C8JA 1A6TB 4KK9C 5F3HA 3IVKA 3WYRA 2ZCKL 2FL5A 2CJUL 4H26B 5BZDA 3G6JA 5T3XE 3SKOA 1CD1B 4FNLH 2Z35B 4JQXA 3Q5YA 5FKPA 3DIFA 3W11C 3GGWA 5GS3A 1RULH 4IOSD 4XNMB 2EDXA 1RAMA 1NDGA 5I71C 1R5IA 3G5VB 2OR7A 3MACH 5DXWA 1K6QH 3MOBH 4YHNB 1ZT1B 4ESKA 1GOGA 4ORGB 3X3GH 1SY6H 4KK5D 4GRWF 4U33A 3DGGB 3SDAA 4F9LC 5BVJB 3MLSL 4XBPA 3O8XC 3ROLB 1F5WA 3O2VH 2FEEL 2C1OB 2X9WA 1UM4H 4MNHA 5B38B 2PO6A 4K2UL 4OQTH 5D7LA 3UTPE 1W0YT 3TVMB 1BQLL 2VXTL 4KKBC 4OB5L 2CUMA 5AUMA 2F8OA 2BY3A 1JP5A 4L8CB 5C0AB 2Z31A 4OZHA 4LPYA 1IFHL 2C4XA 5L2KA 1U8MB 2BRQA 4M1CD 3QT2A 2APFA 3CLEH 4HFWA 2X4UA 4QXGH 5CLWA 3DV4A 3D39D 2XN9E 1AGBA 1R3KB 1MWAH 4G8EB 4XI5C 5E8DL 2CXKA 1DZBA 3VJ6B 4MB5A 1PGRB 5JHLL 5JLZA 4MVBD 1MHCB 1ZLSL 1S7TA 4FFYL 4LCIL 1TTGA 4LCWB 3MTRA 3F7YB 4RGOH 4S1SH 4R4BA 1UXSA 5C0DB 2MCPL 5T3ZD 3HN3A 2DM3A 5I0DA 1IGJA 2DBJA 2C3WA 1GXEA 3FB8B 2UVEA 4KI1A 1OSZA 5I1HL 3C6SB 4HCRA 5DI8A 5DJZA 4Z7VF 1BOGA 2HMIC 4RFNC 1UH3A 3TYGL 1NANI 3ECBB 1AGEA 2VH5L 1MVFA 1YPZA 3BDYH 1XF3B 3BESR 4ODVH 4U1HB 4JFDE 2AV7A 1WBYA 3QISA 3PWVA 2EKSB 4PP2A 2BFVH 4NO5B 5IEHA 3JV6B 1D5MB 4J1UA 4XC3H 4DN4H 3MRKA 3UJJL 1CXHA 1Q72H 5C07E 3L3DB 1QYGH 2FB4H 2JIXD 2AEWA 4ZTPL 1AGFB 3CU1A 3KWWB 3ARFC 4C56B 1Q9OA 2PR4H 3QDMD 2P48B 4UB0L 1TTUA 3WXVH 1T1WA 5L9DH 4G6FD 4NRYB 3MGTA 5ID0B 2I26N 5FUOL 1ACYL 1MRCH 2OR9H 5B39B 4OLXH 2VDPL 3VFOB 3FO9B 4MWFA 3BGMB 3DMMC 2X6MA 4PRID 5D1XB 1ERNA 3IFNL 1K4CB 1PY9A 5IHBA 3U7YL 1W0VB 5DD1L 3GMPB 4DAGL 1NGZA 3BH9B 1MH5B 1PEZA 4PJ5B 5KSBB 3ILPA 1K5NB 1U58B 4G42A 3ZSSA 3EDKA 4PJ7F 5CD5C 3OKLA 5F88A 4OZGB 2FIKA 3MBED 3MRMB 2HT2D 3B83A 4PRNB 2YEZB 4ZSOA 3O6KH 2BNQB 5DK0B 2CK0L 4LVEA 1UWGL 1GPOH 4ZNEE 5FECA 3H9ZA 4Q9QH 3CZFA 1KELH 4LRNH 2VLJB 3QB7C 4DN3H 5FAAA 1VADA 4ZUVB 2HVJB 5MP6H 4BQCA 1OB1B 3GIZH 1A7QL 5AG9A 2FGZA 2V5YA 4Z95L 3L1OL 2VZOA 3IAGC 3O3DA 1I1FB 4HGMA 1MI5D 3THML 2RJMA 5K9KB 2X2YA 4GAYA 3I9GL 4P99A 5T5FL 4MA8H 1OGAD 1WT5A 4AENB 1J0IA 4WFHE 1AD9A 3PE9A 2NY5H 4L3EE 2CKBA 1NSNH 3GSOA 3QZWG 1YEJL 2A73A 2NTFA 3NPSB 5MERB 5C3LD 3ARFD 4CN4A 2A9NH 3MCKB 4ZFOB 2WINB 1LK3H 4UQ3A 5DR5L 4NNYA 1NCDH 7FABL 1I7TA 4FQIH 4N8VG 2P7TA 5IG7B 1F97A 1XIWA 4TUKL 3GMOB 5GS0H 3WKNA 3KG5A 3OAZK 3QO0A 5GRWA 2R2EA 1JZ6A 4C59B 2FX9H 4JPWL 4PGBA 3OZ9L 1NANH 5D7SH 3RWJB 1LWRA 1GZQA 4E41E 5L8KB 5HPMA 1YN6A 5FYJD 1OQOA 1QG3A 3GI8H 3QRGH 5EC2A 2NLJB 4IRSA 3RWDA 2ZOKB 1CGTA 3WHE1 2IPKB 3Q1SL 1UA6L 1ZA6A 2QR0B 3B9VA 5INCB 4YFDB 4KTDH 1I3GL 4BKLA 1I1YA 1C7SA 4F9PA 1V3LA 2O5XL 3SDCD 4RAVA 3TJEH 3P4MB 5KTEL 2Y5EA 3RNQA 3HI1B 1TLKA 4GG6E 1AE6L 1ZHNB 2H1PL 2FSEB 3DSFL 3K0WA 1GGBH 3RI5K 4JHBA 2IEPA 5AZ2L 1BFVL 3MJ8B 5D7JD 4WI5A 1FQ9C 4JCLA 5IF0B 5D6DA 5ESVA 3FQWA 2BMKA 4HLZG 4XPFH 4ZFGL 3LS4H 2OL3L 4Y4KB 4TSBH 1CG9A 1EUUA 2Q20A 3RX5A 1EAPA 1RUQH 3FOLA 1YN7B 4P2QD 5L2JB 1P4LB 2CDFA 4UAOB 4LLDB 4AJ0A 5FO9B 5JUEL 2ITCB 5E8PA 1DDHB 3MJGX 4NRZB 1L7TH 5DJDB 2ZSWA 2F5BH 4HX1A 5E8OA 4OBSA 4NC1C 3D39B 2C5DC 4Y5YC 2VDNH 5JR1L 5CINL 5E9DD 3D6GA 3QG6B 1MHEB 5E5RB 3ARBC 3O41B 1U3HA 2F53A 2NY3C 4I18A 1IAKB 4FFVC 4GG6F 5D6CB 3V0WH 4ODTL 5FGBA 2E27L 4HH9B 3SO3C 1AY1H 2O5YH 5K9JL 1JE6A 4FQ1H 3DVGB 3OKNA 4U1IB 4KY1L 3QUZD 3S3SA 5TDNA 2X4QA 3BMVA 3LEVH 4ODWA 2X4RB 3NCJH 2H9GA 4UTBL 2XTLA 1LO0L 4XGZA 4NZRH 1FH5H 5TE7L 3RIFK 1I75A 2VZ3A 1N59A 5HYSA 1VERA 4PJGE 4M8QA 4JN1L 3MLVH 4XCFH 3T0EC 2JB6A 4C83B 1CL7I 1BX2A 4APQA 4PJ9B 3MA9L 1FVDB 4JFPB 4WI9A 4K7PL 4WEBL 2VDLH 4M1GH 3MLPA 3FT3A 3W2DH 5EU6E 3IXAB 2CLRA 4HV8A 5IIEB 5EORH 1IILE 2NX5D 4O2CA 1W72L 5BZWA 5C92A 1TDQA 4XWOC 4U6TA 2QKIA 2PYFB 4JFFE 5D1QA 2X42A 4YGAB 4G6FB 3VFRB 3TZVC 5D9SA 4HK3J 4ORZC 2WM0A 2XWTB 1ZA3A 2VQTA 3L5XH 4N0FB 1PDKA 5EOQH 2BDNL 3R0NA 3H8NA 3HNVH 1C16A 4R4FL 4JO3L 4LCUA 3L7FB 2Q1EA 2YBRB 1EHAA 3GMMB 4P46B 1AIFB 1Q8MA 3AVEA 1A6PA 4PJGF 3P3YA 1MCCA 1VFAB 4E5XA 1YNLH 1HH9B 3KYOA 3V4VL 3L7EB 4HK0B 4RMQA 4UZGA 4UDUB 4PS4H 3N9GH 3W0WD 1A6AB 4XXCC 5D70L 1BM3L 3TC9A 3VD3A 4BYHA 3REVB 2IPUK 3CVIH 1O7SA 2AJSH 1GAFL 1MFCL 2C7UA 2D7TH 3MBEB 2DS4A 4FXKA 5GGTH 5C3TA 4DGYL 1HZHH 2HFEA 1YEIL 4NHUA 3MFGB 2DOCA 3KYNA 4X6FB 1B0GA 2E3VA 4PFEA 4CAGA 4UIKL 5DLML 5DDHA 4RMUA 5BQ7A 4Y8DC 1Q38A 3B8YA 5F6HJ 1EJOL 1S5IL 3MV8D 2DQHL 3VH8B 4F15B 1JYVA 5L6YL 1O0VA 5TJWK 1IBGL 4ISVA 1F90H 4O2EB 2RGSA 2R1YB 4G3YH 4JKLA 5C2BL 1ZANH 5I8CA 3MUHL 1ZKAA 1J1XH 4XWOD 3QUMH 1GGYA 3WXWL 2UWEA 2GSIA 3HPJA 2X05A 4BSWA 4KTEH 2I27N 4UDTB 1KIQB 4Q2ZB 4GKSB 1G7JA 4YIQA 4PJHE 3VXMA 4JB9L 5IROC 2J3SA 3QUXA 5I18L 3T0WA 4FTVA 2ESVB 1DN2A 3GUTA 2X1WL 3LHPH 5CKGA 1N0LA 3U0WL 1KTLB 3GHEL 4OT1H 3HE6A 4LPCA 3VWJC 1NL0H 4TSCH 1CL7H 4OGYH 2XI9A 4CMHB 4ZD3L 1S9KC 5ID1A 4M00A 4M43L 4R2GD 3GHBH 2YZ8A 4N1EA 3T1WA 2Y6SD 4M3JA 3Q3GA 4NC2B 4WUKH 2YRLA 5CZVL 1JGDB 3MOAL 4LVNB 5EZJA 1OCWL 1ZWIB 3LKRB 3RUGA 1HEZA 1NLDH 1U8PA 1LO3H 5J3HC 3NCYS 1NAMH 3AU1B 1D9KD 4Q7DA 4MDIA 3KPNB 1Q9KB 2FX8L 5HDLA 4I8DA 3D0LA 3ZZ1A 4NFDA 2I5YH 2H41A 1L7IH 5DGRA 5BOZG 1RZKH 3MLYL 3QIWB 3SOBL 1Z6JT 3DO7A 1Y6KR 5DJCB 4PJHF 4PV9B 3ZT6A 1CXKA 4YEFA 1EERB 1OAKH 1A9BA 2G9HB 1GC1C 4U1JA 2PTTB 5D7JB 3MV7D 2PCPA 3D3VB 5C7XH 5J7CC 2D2OA 3DMMA 3GK8H 43C9B 3S37L 4DZBA 5KW9H 1T5WA 1HIML 4X7CC 4PJ8B 1CXLA 3CU7A 4D8PB 5E2WH 3CFCH 5IVXE 2FZ3B 2YSSB 3VFTA 2COQA 3PWJB 3L3JB 4V1DE 4NN5B 1EVUA 4P2QB 4NKMA 2HYMA 3IF1A 2Q3AA 4UIMA 1FFOB 4XMKH 3TJHD 4D9RE 2J88L 1DSFL 4OCXH 1QSFE 4JG1H 3RWEB 3CSYB 1QSVA 5DQJA 3WFCH 1OARL 3LQAH 1KPRA 1FNHA 3TFKC 3TM6A 5GS2D 1NUFA 4Z7OE 1FG9C 2V2TA 5HGAB 1NKRA 3OR7B 2A6DA 3L3HB 3VXRE 3C2SA 3UTTA 3BIKA 5FYKH 1OPGL 4MNGB 4OZFH 2QQQA 3B3IB 5TGBA 3DX7B 3J8F7 3EYFB 3GMNA 1SJXA 4R26H 3RGVC 1ZVHA 2XT1B 1NEZA 4QRUB 5IVXF 1KC5H 1WBXB 4FABL 1SYSA 5I6XB 3T4AB 1BZQK 3WJJA 1G9NH 2PW1A 4U0RC 2X4SA 3PG2A 1MUJA 3GJFA 2E9WA 3VRJB 4TSAH 2W0FB 4YHOL 4TUOA 3C60B 4RQQB 1S7WA 3VXUE 1UEMA 3V6OE 1G6RA 2M26A 2IBZY 4I3RH 3LIZH 4N0YH 2ARJQ 2JB5H 2NX5B 1S9WB 4HW6A 4KPHH 3QIUC 4Z7OF 2VXVH 4I13B 3Q6GH 4ZS7L 1AO7A 1I1CA 3LMJH 3UTQB 1RJYA 1WF5A 1HXYB 4OFYA 5JNYB 1RZIB 2Y7QB 1X5FA 1C5BH 1K9TA 3B6SA 5T3XD 4LFHG 5F72S 1FGNH 4MAYD 3O2DL 4H1LA 1RURH 3GB7A 3LRSA 4BZ1H 3WL9B 4DVBA 3TV3L 3BP4B 4HZLB 1MREH 2XV6B 4NOFA 4PGCA 4K7FA 4B7LA 1LE9B 1NMBL 4WY7H 1FSKC 4Z6AT 4WU7B 4KHXH 5IBUB 4QHLA 3LN5A 1ZGLP 3SKNB 3L95A 1MCJA 3VFNA 4NBZB 3WLBB 1KEGH 5T1KA 4QOKD 1A7RL 5D7IE 3I6KB 5DUPL 4N5EC 1JUFA 4HIJA 2HRPH 2OXGA 3NFNA 3GMQA 1Z3GL 3W0WB 4LLWB 5D1ZC 5I1AA 3GSWA 3UTPD 3VGAB 1EK3A 2YPVH 3E8UH 1F00I 1KJMB 1BJMA 3KPLB 2Z4QB 4JE4B 3EFDH 2HP4A 3AAZB 4M6ML 1IAII 5BCAA 2OTUA 2AJXH 1LILA 3NACL 3QDGB 3HC3L 3DROA 1T04A 1BF8A 4RX4D 2OSLB 3TWCL 3O3BA 2AJ3A 3BPOC 2E9IA 3IGAA 4NKOA 1ZT4A 1QA9B 3TO2B 2J6EH 3QQ3B 4IMKC 1MVUA 4NQCD 3NZHH 5IHZB 1OM3L 4MJ6A 4Y5YA 4PJAA 1E27A 5IEKA 4J3UA 2ADGB 4Q58C 2VIRB 4K3DH 3ARBA 4L9LB 1IM3A 2BERA 3KYMB 1CDGA 5T1MB 5AYUL 2AK4B 4EN3B 5D7IF 5HD8D 5HHPA 3PHQB 4I48A 3QWRA 5T1LA 2DQUH 5FYJU 1S7VB 3FT4A 1IEHA 1HOCA 3GBLA 3HNSH 5KS9E 5LQBL 3QIBD 4POYA 2EECA 1XF5A 1T7YA 2EDBA 2QQNL 4HS8H 4JFDD 1A1OA 3B2VL 3AMLA 3QPXL 2CDGB 3QPQD 4LASL 4G43B 4OV5B 3KDMB 4LLMA 4NHCL 3T0EA 4X4XA 2FGWH 5E1HB 3NCFB 1L6XA 3QJHA 2B7DT 5C07D 1F45A 2Y4SA 3BVNB 4LKCA 5FUCC 2H2PD 3RBGA 1U8HA 3GJEA 4DVRH 3TVMC 1KCSH 3P4OA 1UVQB 4RGNE 1D9KB 4U1NA 1P4IL 2FWOB 2PF6A 4KMLB 1DEDA 5DK2B 1HNGA 4KQ4L 2J4WL 3CH1B 4PGDA 5INDB 4GJTB 5GRUL 3BGFB 4XZUB 1HSBA 5E4EC 1HHGB 4YHYC 3TZVA 4NNXA 2QHRH 1HQRB 5JO5B 4R9HA 1NGPL 4H25B 4HKXA 4X4YA 2LU3A 2DMCA 2IANB 1PKQB 2AJVH 3GSQB 2VXQL 1QD0A 4AT6B 2ZKHL 5KS9F 2PKDA 3MV7B 2AQ2A 1LEGB 1CD0A 4ODUB 3IJYB 5IW3A 1IGML 2CO7B 1QBAA 4JFZH 3ZTNH 2LTQB 3B4NA 5HGBB 5IBTL 1QLEL 2VLRA 3BP6A 1QVOA 3GBNH 1LP9A 4BZ2L 4JAMA 2MPAL 1BFSA 4XCEB 2MCG1 4XXCA 1IAIH 3MNVB 1QLRB 2VAAA 5GGSA 4WW2B 5IB2B 2ZG1A 3K7UA 5LBSL 2HH0H 3OV6A 4FQLH 4NSKB 1PLGH 3BP5B 1Z5LA 4YXKH 1J0YA 2K9UA 1H5BA 3SBWA 1ZHKA 3H42H 1V8HA 2FX7L 4LCCB 2R8SH 1F3JB 3MRJA 3HUJB 4L3ED 1FPTH 1J7VR 4X6DB 4GRLC 3ARTA 5HI3D 5C6PB 4JO4H 4LU5H 5FV2A 2UZIL 3O9WA 4LSQH 2ADFH 3HR5B 5DD0L 3IDNA 3MRGA 1T1XB 4U1MA 2RHEA 4FFZH 3TIDB 4Z77B 4JPVL 2J1KA 1N6UA 2YD6A 3WNKA 3KPQA 4ZTOH 5HDBE 2DBLH 3BAEL 3C08L 4FQQA 3IETA 1MHHA 4GRWB 4FQXD 1N4XL 3BQUC 4GW5A 1N26A 1KTDB 2HN7B 3S35X 4E41D 2GT9A 4YHPB 5CS7A 1S78C 4KVNL 5I9QC 3O6FB 4X8XA 4XPTH 2M8XA 4OLWL 1XR9A 1KOAA 3QA3B 4W4OC 4QGTA 4NJ9H 4L8DB 4GW4A 4O00A 2XG5A 4OZIE 4HIXH 4LHUA 3VWJA 5CUSH 2PW2B 4E9LA 3ROOA 2B4CH 5IMOA 1PW3A 3GSUA 4OAWA 4JQIH 3S5LA 2XQYG 2YHGA 3BRGC 1HCVA 2YWZA 1JF1A 3A6BL 2R2HA 4MAYB 1F4XH 4HQQH 4MCZB 3TBYB 2DQEH 4JFOB 4M4RA 4OCWL 1YUHA 4NN7C 3QEUB 1OLLA 1KLUA 5HDBF 5IGXL 2X4NA 1DL7H 1X5YA 4OFIA 4QOKB 4UV7H 1TCRB 3MRDB 4ELMA 4K23L 3X13A 3F7QA 1H8OA 3IFLL 4HIIA 4GRLD 4L4JA 2WIMA 4X99A 5I15L 4Z7VB 5FXCH 4HEPG 5IMMA 1LEIA 1FL6B 5CGYD 3GJFK 5IQ9B 1A6ZA 5ERWA 4OZIF 1VKXB 1EVTC 1MEXL 1BZ9B 1F2QA 1KIPB 3ULVL 1ADQA 1FO0A 3QEHA 2AV1A 4IS6B 1WUNT 5DT1L 4EDXB 2AJUH 1R3LB 2D03H 2QQKH 1U41A 4Z8FL 3BQUD 1P1ZA 2WMPA 2A77H 4BFGA 1KIRB 1ZVSA 2A6JA 4BUHA 5KSAD 3E3QE 2I9LB 4L8SB 5ITFB 1YJDC 3ULUH 1M05A 4TUJA 4WDIB 2IQ9L 4NQCB 4JZNA 3WHE0 4NM4L 2I07A 5ADOH 1N5AA 1C12B 3LN4A 1MIMH 4RZCB 5A16B 5JORA 3BE1L 4EOWH 2CDEA 2N56A 4OUUB 4NGHL 5CBEB 1ACZA 5EZLB 3KJ4B 4HUXA 3P0GB 1RULL 1NC2B 4LOUC 1KCUL 4P2YA 5TDPB 3G04B 3I6GB 4RWYL 5KSVB 4U6VH 1FBIH 3MOBL 4KROB 3BH8A 1QO3B 4AIZA 1FFPA 2C3HA 3MLTB 3WNMA 3ZTJG 4LK4A 3X3GL 3B9KD 3KPSE 3RGVA 4U6HA 3VCLA 2NW2B 3O2VL 3GO1L 1XH3B 1AHWA 4HJJH 1CU4H 5F71A 4ZQKB 1S8DA 4JRYE 2YA1A 3VRIB 4EI6B 4HC1A 2HKHH 4PJ7B 3CJJA 2DLGA 1P53A 5EU6D 4PJCB 3EYUH 4UT9H 2BSTB 2NW3A 5C07B 1CE6A 3WEXA 1NCUA 2UYLA 2YPKA 3A0OA 2AJYL 2BVQB 4NKDA 5DJ2A 4JFFD 3EO9L 3C6LC 2XNAB 4J4PA 3GJFH 5H35B 4YHKH 3SKUD 3VFPB 3O4OC 3QIUA 2G60H 3QNZB 2WSKA 5MEQB 5GRXG 4HKBA 4UAOC 1FN4B 3C5JA 1HHHB 3NMEA 1HHKA 4KJQD 3ZYJA 2PTVA 1BECA 4XPGL 1HDMB 2QQLH 3PHOA 2WV3A 1J1PH 2R23A 1N64H 4IRZH 3ESVF 1A3QA 4CVZB 3MNWB 4TTDC 5MEPB 4KKLD 4TNVK 4MCYB 3HAEA 3P9MA 3QR2A 1RVFH 3DRTA 1UZ6E 3UX9B 4Y16A 3IDUA 2ZCHL 3I3DA 1KFAH 4HUNB 5DYOB 2ICWB 2VDMH 1BF2A 4Q6IB 1UKTA 3OPZH 4ZXBD 5HYJE 4ODVL 1FL5A 1HILA 1DLFH 5J11C 1C5DA 5KSUB 4Y8AA 2I9TA 4MD5A 4LEOA 3FFCA 4DN4L 2Q7NA 4QRSB 2PXYD 1ZMYA 3ARGD 1GVIA 1EHXA 3SDXE 5DHYB 4U1GB 4P2OC 5DEGB 4R7DB 4PJ9C 1FAIL 2EH7L 3WXVL 1KG0A 1EMTH 3QH3A 2FR4B 1UXWB 3U0TA 1YMMA 1YDPA 2BXYA 1SEQL 4ZYKA 4B53A 1QHPA 1WWCA 1AXSA 1A6VH 5DURB 2OR9L 5BJTB 2X09A 3P9LB 1EXUB 4ZO9A 4P2CG 4MB3A 1ONQB 2GUOA 4G6KH 5IK3A 1A6TA 4XVTH 1N2RB 2H3NB 1EGJA 2X89A 2YUWA 2DL2A 1BVLB 4HT1H 5AZEL 1CD1A 3UJIL 3GEWB 3VG0H 2Z35A 1GGCH 4YNYB 4CMMB 3QDJE 5C0CB 4P46C 4TTDD 5HY9B 5TQ0H 2CPCA 5HTSA 4PUBH 4PY8J 4FS0A 1ZLUK 4PRPE 1DUYB 3BHBB 4KRLB 5D2NE 3DBXA 4TQEH 3G5VA 1GGTA 3SDXF 1AQKH 1S7RB 3O6KL 4QXUL 1CLZH 4YHNA 5IKCB 1ZT1A 2EXYC 2A6IA 2BVEA 3NCCB 4ORGA 5EUOE 1NMCC 4DKAA 4L4TB 4UINL 3QHZH 3DGGA 1QPXA 2R2CA 1X5JA 3GIZL 4ODBD 3MGOB 1TJGH 4PRDB 5TF1H 3ROLA 2XZQL 2OYPA 1IM9A 2C1OA 5B38A 5I2IB 4QRRE 1OQXA 2KPNA 3QXVA 2X70B 3TVMA 3KLDA 3EOYG 2EDNA 2GJ6E 1KB5L 2NY5L 4PG2C 5JW5B 3EYVB 3UBXG 3MA7B 3GSNB 2NR6D 1RUAL 1U8MA 4F15C 1I9JH 2R2BB 2W91A 1PD6A 4JY6B 4X9FA 1LK3L 1JBJA 5EO1B 3EJJX 4MQXC 1LD9B 3OXSB 3S9DB 2W65B 1R3KA 1OAXH 5GHWH 1XEDA 4AQ1B 5GS0L 2KH2B 3VJ6A 4BSJA 1T22A 4NIKB 2Y36H 4V1DD 2ZOLB 5EPMA 3GRWL 2A0LD 2HFGL 5GRVK 1MHCA 4I3SH 5T5NG 5CSGA 4LCWA 4UNVA 4UT7H 4RFOH 3F7YA 3GI8L 4D9RD 4CBPA 1QSFD 5C08E 3VWKD 5C0DA 1QFHA 3GFUA 4JHZA 4ONOA 5EOCL 1AKJA 1MSPA 5KSAB 5JZ7C 3C6SA 3QAZB 1S7XB 1WWAX 2EEBA 4NOBA 3ZE2E 4L4VE 3DI3B 3VXRD 3MNZB 4YFLF 2HVKA 2HTLD 2EKSA 1J1OH 4LVNC 5IFJB 4NO5A 3RVVD 3JV6A 4CU7A 1D5MA 4YAQB 1REIA 1U91B 5SWZB 2F54B 4F57L 1Z9OA 2W9LA 1BGXL 2GY5A 1GGBL 3L3DA 1DBJH 1QHOA 1AGFA 3KWWA 3SE8H 4C56A 1DFBH 4QT5B 4WGWB 2Q8BH 3FB6B 3QIWC 3QFJB 2G5BB 3W9EB 3LS4L 5GZOC 4NRYA 4PJXF 1U2CA 5ID0A 5CIPA 2YPLE 1P9MC 5JOPE 4OI9A 1VSCA 1HYSC 3U4BL 5IJVB 1RUQL 5J4MA 2FATH 4KDVA 4MQXD 3AROA 5D1XA 1KJ3H 3CX5J 4PJ8C 1K4CA 1ZSDB 4JFFB 4W4OA 5GJSH 4RIRA 5GGUA 5TDOB 1W0VA 4PJFE 2E5EA 3GMPA 2AK1H 3QP3A 3QQNA 3BH9A 4M7KH 3QRFM 1MFDH 1J8KA 1MH5A 4NN5C 2OJZL 5JA8B 4PJ5A 1P7QD 3MJ7B 5KSBA 1K5NA 1CGVA 1U58A 3H3BC 4HPYH 4JZOB 1RU9H 4UOW1 3U7WL 3K1KC 4HFUH 3V0WL 3ILQC 1JYWA 1HI6B 3H9HA 4KU1A 1AY1L 4OZGA 4ALAL 3MRMA 2O5YL 4Z7WB 1LGVA 4PRNA 1FGVH 2YEZA 4LMQI 5DFTA 5F1KC 2BNQA 5DK0A 3R8BB 5DRXB 2VLJA 4XH2B 3ZDZE 4ZUVA 1QACA 2HVJA 1SEBB 3S6CA 2B2XL 1OB1A 1LEKB 15C8H 1TZGH 3HFMH 5C0BB 1PZUB 5IJKC 1I1FA 4ERSL 5K9KA 4XCFL 5EUKB 4ZXBB 4RGNC 3RWIB 4NZUH 4AENA 3KNBB 1KCRH 4NC0B 4XMLH 5I1KL 5GJTH 4OGAD 1UG9A 3ULVE 5MERA 1ZV5A 2VDLL 4M1GL 4WHTB 1N8ZB 3MCKA 4PJFF 4S0TD 4ZFOA 3NCMA 2WINA 5I6XC 3ARGB 5EORL 6CGTA 3FFDB 2JELH 4MZ3A 3QO1B 4GT7A 3GMOA 5ECJE 3C60C 3MX0A 3JXAA 3QG7L 3UTSB 1ADQH 2XWJB 4KKCC 3RWJA 1I4FB 5EU7E 1N0XH 2JCCE 3L5XL 3S35H 5ISZD 1UGNA 1I8KB 1KEMH 4X9BA 4RA0C 4R4ND 1HKLL 3HLAB 5I30H 1Q1JL 5CWSB 4JLRB 1F4WH 4PJHB 4KVCL 1F6LL 3BN9D 4Y4FC 4LLYB 2QR0A 5INCA 1BQUA 3EUUA 5K93A 3VFWB 4YXHL 1MCWM 1YNLL 4DCQB 5KVEH 3X14B 2RCSL 2R0ZH 4FXLA 4PS4L 4RMTA 1R3IL 4XNZB 1ES0B 1DBKL 4HBQA 3P4MA 3UTOA 3IU4H 4D2NA 3ULVF 3AM8C 4MXWL 4PJBF 4Z0XB 4WU5B 5FGSA 5C0JB 3M8OH 3ZYIA 3HI1A 4M7LH 2ATPB 5F70A 4TOYH 1JTOA 1HZHL 3QCVH 5ICZA 1ETZB 2FSEA 2G5RA 1YY9C 3MJ8A 3QNXB 3K2UL 2N1KA 4RGND 4P9MH 4XCYB 3R1GH 4G80B 1YEKH 4KJWC 4P5MB 4K07A 3A67L 1MJ8H 4Y4KA 3WE6A 2JCCF 1AXIB 3BD4A 3V8OA 1URLA 4JHAL 1TZIB 2WWMC 3C8KB 4JKKA 2F19L 3X11B 1ZANL 4YXLH 2DM2A 1UC6A 1YN7A 5L2JA 1J8HB 1P4LA 2AEQH 4NQSB 5DJ0B 4B7IA 4LF3B 4LLDA 5FO9A 5IWLC 1SBSH 2ITCA 1DDHA 4NRZA 4KTEL 4HWEH 4GS7B 5DJDA 4LP4A 3KYKL 3EOAB 5CEZL 2EZ0C 2PN5A 3D39A 2X1PA 3UTZB 1DJSA 2X4TB 3V6ZB 2CLZB 1DTUA 3QG6A 3IDYC 1MHEA 2NY1D 4JEGB 3HCVB 1IAKA 2P1YA 3E6FB 1VDGA 4N8VB 2HJFB 3HMXH 4Q9CA 4EN3C 3LHPL 4HH9A 2OX5A 5E94B 4JFXB 4OT1L 1D3CA 1GYAA 3IRPX 4U1IA 1NUGA 2X1OA 1QSFB 5EA0H 1H3XA 3N06B 2QADD 1F4YL 3ZKMC 1YEFL 4KMTH 4G6JL 2X4RA 3GHBL 3U83A 1CD9B 4ONHB 1T3FB 4HCRL 3UPRB 1M6OA 3AS1A 5FA4B 3QFDA 4PGJA 3KXFA 5DRNB 1IAIM 1NLDL 3DURB 3T0AA 4H8WC 4QYOB 1D5BA 3VXRB 5EWIL 1N6QL 3H0TB 4MYWB 4P2OA 5IQ7H 1PX3A 2IG2H 3K3QA 4JRXE 4RBPK 4PJ9A 1Z2KA 1FVDA 4JFPA 1CFVH 4MAUL 1PSKL 1B6UA 1AXTH 4QF1B 4MDJB 3IXAA 3LQMA 4UTAH 4JFQB 5IIEA 1FIEA 4W68A 1RZJL 5CEYB 4K3EH 4KZEL 1OAKL 4YK4B 3WUWA 4KAQL 4AEHL 2PYFA 4ODHH 2DI7A 3PWLA 4MXVE 3VFRA 3PNWA 3GK8L 2MOVA 5KW9L 1GJIA 2Y07H 1TIUA 1EJ6A 2XWTA 4P23D 4KFZC 3VE0B 4N0FA 4ONGH 5F7LB 4JGMA 1MNUH 3V6BR 3O2WH 2VJXA 1CZ8H 2NY7H 3L5JA 2IPUG 4WFGE 1EGJH 2YBRA 1S9YB 2ED7A 3VGEA 2H26B 4JR9L 3GMMA 4P46A 3H9SB 1AIFA 2GJZB 2LTQC 4JG1L 5EO0A 2EIBA 4WWKB 1VFAA 4Y4HD 1X7QB 3QI9D 3V52L 3L7EA 4PP1C 1RFDL 4HK0A 4N0CC 4P2RE 4UDUA 1P7QB 3MRCA 1FCCA 2B5IB 3LH2H 1A6AA 5HVFB 4KDWA 3REVA 2HFFB 4YFEA 5JXEC 3MBEA 3MLRH 1E4JA 4QRTB 1AGDB 5EU5B 1R5WB 3WD5L 2GTZB 4XX1G 4X6FA 3PQYB 1MJ7L 1LE5B 2R69H 3BKJH 2VLME 1ZK9A 5TE6H 4MXVF 5K33A 1CF8L 5MI0B 5JMRA 1ND0A 1KF9B 4RBPH 1GGUA 5DEZA 1GGIH 4JO2H 1XR8B 5KG9B 4C54A 1IRAY 1G9NL 2DQFA 2FH6A 2CKBL 3IRZA 3QNYB 1VFUA 2L7UA 3MJ9A 4O2EA 4XNUH 2R1YA 2VLKD 4HD9A 3BGAA 3VXSD 4N9GB 3VRLE 2QHLA 3TT3L 5EBGA 5HPOA 5C0GB 3TNNB 4QY8A 5T5NF 3CFIC 1GL4B 4N0YL 4UDTA 2AP2A 1I1AC 1KIQA 3C9NB 4OLYH 3WIHA 4Q2ZA 5DMGD 4GKSA 3RVTC 4KPHL 1KBGL 2W59A 3RA7L 3H3KA 3LMJL 4AIXA 3SQBA 4LPWA 2ESVA 4HEME 5IESH 4MJID 3SKMB 3PHSA 4LVHC 3FO0L 2X9YA 1KTLA 2R4SH 4KJPC 5ISZB 2IWGA 3ZLQC 2VWEE 1TMCB 5IBLD 4LFHD 4BSVA 2NY2C 1MREL 2XY1A 4KUCD 1I9IH 4NYLA 1TZHB 2FYYB 5GS1B 4KHXL 4I3GA 1JGDA 2OLDA 2D4FA 3VG9B 1BD2E 1ZWIA 3LKRA 4X6CB 5AEAA 4XPAH 4D0CA 4DKEL 3FN3A 1KNOA 2CSPA 5LWYL 4QHNA 4QRPB 3UYPA 3AU1A 5CHNB 3MRPB 5FGCE 4JRYD 5IFHL 3KPNA 1Q9KA 2YPVL 5EU3B 3QIWA 1H3UA 1ZT7A 3BZ4B 1WAAA 5DJCA 4OF6A 1MIEH 2FNBA 4PV9A 3E6HB 3V4PH 1ITCA 1T4KB 3CDFA 3HC4H 2KUTA 2G9HA 4JN2B 3OQ3B 4CRPA 5D7JA 2EDHA 4I0CC 5JHDD 1IGCH 3SJVB 4NO0B 1UJ3C 5I17B 3QJFB 3D3VA 1JI1A 4M61B 1X5HA 43C9A 1I9EA 2VL5B 1IAOA 4WVRA 4PJ8A 3L5WB 4D8PA 3BN3B 1VEMA 4HGWB 2DYPB 5C6WH 2FZ3A 1LDPH 1TETL 3PWJA 4GBXC 5CJQH 1KPUA 3L3JA 3P0VH 3CC5B 5K9QI 4NUGL 1TJIH 5F1IB 2OZ4A 1BJ1H 1HSAB 2HLAB 3BUYB 1A4KB 4L8SC 1FFOA