4YHZH

Crystal structure of 304m3-b fab in complex with h3k4me3 peptide
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
223
structure length
219
Chain Sequence
EVQLVETGGGVVQPGRSLRLSCTASGFTFRDYWMSWVRQAPGKGLEWVADIHQDGQVRYYLDAVKGRFTISRDNAKSSLYLQMNSLGAEDTAVYYCARNFVRGFGWHFDLWGRGTLVTVSSASTKGPSVFPLAPSSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Fab Heavy Chain
publication title Antigen clasping by two antigen-binding sites of an exceptionally specific antibody for histone methylation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 48
structure length 219
sequence length 223
ec nomenclature
pdb deposition date 2015-02-27
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhzH02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yhzH01
2NY2D 4WJ5B 1H5BB 1L7TH 3QAZC 3RY6A 1A2YB 1MRCH 2DQGL 1EEQA 2YK1H 5BV7L 1PEZA 1XIWC 1NFIA 1ZT4A 1NGZB 1FZJB 2VLJB 3O11A 4QHLB 3QFJE 5ID0B 4D3CH 1YA5A 4WFGD 3N9GH 5ESVB 1XGRA 3KPSA 4HIXH 2BMKB 1R3HB 4Z9KB 3T2OA 2OQJB 3QHFL 5FOJA 1IM9A 3OB0H 5C0CA 4KH2A 4J3VA 3TP4A 4OZFG 3ZSSA 3RWHB 4MJID 4I9WD 4R97C 4WFFD 4PLNC 1Q72H 4I18C 4ONHA 1Z0MA 3EFFA 4XZUA 5I1IL 4NN7B 3VGAC 5I1EL 1MQKH 4P23D 1WT5C 4ZFGH 3T0XA 1ETZA 2J2ZA 2YPVL 4L5FH 4GKZB 1MHHA 2GJZB 1UB6A 4LRIC 4NC1E 4Z7NF 2VR4A 2A9NL 3P9LB 3N1QC 1MCHA 5EOCJ 3U9UB 2AEQH 4N8VA 1MCLA 1FPTH 4X98A 3U0WL 4K7PX 5IB2A 1ACYH 4LASH 1MJ7H 5CUSH 4Y4FA 3BAEL 1U93B 3K7UA 5E0QA 4A6YB 2BY0A 1ZGLP 3SE9H 2O5YH 3SDCA 5L9DL 1VENA 4KTDH 2ZNWA 1EHAA 4HC1A 4JZNB 1UJ3C 4Y4HA 1FNHA 5BRZA 4EBQL 1EEZA 1NGWB 4IMKC 4NBYB 1UM6L 4Y5VA 3RZCC 1H8NA 4UB0H 4YAQB 2BC4A 4PREA 3VFTB 2GSGA 3Q1SL 4RFEA 5MP6L 3S37X 4OCRH 1A4KB 4PR5A 2WIIB 4NQEA 2AJ3B 4TUOB 4H26A 4WVRA 4QRPD 2F8OA 1W0WB 4PYHA 1BAFL 2X10A 2ZCHH 3SGJC 5EO0B 1OW0C 4OTXL 2OBGA 3DHMA 3QQ3A 4X9HA 1A1NA 1I4FA 3KJ6L 4L8DA 4YO0B 2LVCA 3REVA 1VGEH 4PLKC 2L7UA 4XPTH 1MFEH 3K8MA 4XVTH 1WISA 1I9IL 3HLAA 3X3GH 5HGHB 5GGTA 4H1LB 2AEPH 5EBWA 3TBVB 1PAMA 1YDPA 4ZOAA 2ZJSL 5T3XL 3CU7A 5I1KL 2JIXD 2ZUWA 3QPQD 5JW4M 4C57C 4ZUSA 1OD9A 1X5LA 1OPGH 2X4NB 2RHEA 4P2RE 4BFIA 5CD3A 5IG7B 1QSFD 5A2LH 5GGUB 4POZC 3RVWD 5JW5B 3WXVL 3OKYA 4KRMB 4QXGH 3H3PL 2JJWA 4XVSL 3UYPA 4JQVC 4OFDA 4JPVH 1EFXA 3QCVL 1BFOA 2P8PA 4Q6YA 2N56A 2VIRA 2E5EA 3C5JA 2EDWA 3MBED 1AQDB 1BIIB 4JY5L 1TQBB 5C2UB 2UVFA 3ARVA 1NGQH 2F15A 3O3EA 2O26U 1IAKB 5L2KD 4UOW1 4ZSOB 3WUZA 4D0CB 1ZT7B 3BN3B 4Q2ZA 5KS9B 4FNLL 4NZRH 4E41A 4B0MM 5HHQA 3DARA 1KJ3L 4W6XB 1XGUB 3RY6C 2PW1B 4UIMB 5GJSH 1RMFH 1JRHI 5DJDB 3TZVB 1YY9C 3NBNA 1CLOH 3C5ZB 4KHXH 4QY8A 4P57B 4TN9A 3HHRB 3GSVB 4JDVB 1WUNT 1FL6B 4YHPB 3D25B 4C55A 3K3QA 2XZAH 1A7OH 5D5MA 5A16B 3VXSE 1CXHA 1U8MA 3AXLB 1EEUA 1MFBL 2A38A 5DRZA 3ZT7A 1NCDL 3QI9B 4WWKA 1TZHB 5HYJD 2A6KB 3NABL 2D3VA 4JR9H 3RL1A 2ICWA 3BD5A 1ZAGA 1JE6A 3WNNA 3RKPA 5FV1L 1U8HB 4FQ1L 3ULVC 3HRZA 3E6HB 5IF0B 1EHLL 2FDBP 4JEGB 4LCUA 3OSKA 4HGWA 1YMMB 4Q58C 3QUZD 2EZ0D 3RU8H 4MNQE 1GVIA 3RHWK 3MRIB 5DT1H 3QO1A 1N5YH 5CINL 4Y4FC 4OCYL 4NDMA 2D9CA 4XCYB 4TUKL 1MI5B 5T3XE 3EOTH 1DUYB 4HEPG 5CJOL 2IADB 4WDIB 3SDCC 3I85A 4N8PA 4XP4H 3WFDL 5L7XL 5ISZE 4P46B 3V0AC 2V9RA 1NDGB 4KDVA 4Y4HC 3UBXI 2QSTA 2E8ZA 3N1FC 1CFSB 3MA9L 3JTTA 1LO0H 3MRNB 3IRZA 1WIOA 5KVMC 4ENEC 3OJ2C 1XR8B 2ICEB 3EIFA 2YPKA 1AGCA 5DEGA 1NCNA 1AE6L 1P9MA 3MV7D 4HAFA 1EAPB 2DLHA 3MPCA 5DDHA 3LHPL 3KPMB 1PD6A 4TTDC 5JW3L 4R2GB 3VFVB 3PABA 4HIHB 4KKAC 3A6BL 2PKDA 1GJIA 2ITCA 5TDNA 5DURD 1BOGA 1UM4H 2C3XA 4RMVA 5CJXA 3BOVA 2J3SA 3VGHA 1T6VN 5C0FB 3QUMH 4P2QE 2QQKH 2W9EH 2FATL 1JFQL 3T8XB 1PKQE 3LIZH 1G9NC 2D0HA 1FG2A 3VWKA 1D3CA 5F1IB 3GIVA 5JXEC 2G75B 2NZIA 1I1AC 3RKDD 2Y6SC 1AIFB 1U6AH 3OKOA 3KXFD 4HUVA 4M48H 2OR9H 1BFVL 1UXSA 3DOSA 4JM2C 2VDKL 2C7UB 3ORJA 2Y5EA 3GSNA 3N06B 3DGCR 5E56A 4AEHH 3CFJA 3QZWG 3O3AA 4KWUA 2UVEA 2FEDC 1U3HD 2DQHL 2F19L 2E9IA 4PBXA 1RZFL 3VD3A 4WW2B 1HQ4A 5FO9B 4Z7UA 1TZGL 1MFCL 1CFTB 3BZ4B 2XQBL 4OQ1A 4B53A 4QOKB 3V6ZA 1G7PA 1OHQA 4OZHF 4FTVE 2JKXA 2ADIA 2BNQD 5FGCB 1DQLL 1YN6A 1NBVH 2LFGA 2XQYK 4LIQL 4UV7H 3BDXA 3RPIB 1D6EA 3JV0A 5GGQH 5FOBA 5E70A 5F7WC 5DK2B 1CGUA 5IHUL 1N5AB 3ARDB 4MJ6B 2PCPA 5F9WC 5JO5B 5GGVY 4FXGB 4MJIA 4JCLA 1J86A 1GIGH 4NQDD 3BPCA 3BJLA 1PY4A 4U3CA 1UCBL 1JHLH 5E6IA 4L29A 4P23A 4D94A 4E5XB 1I7RB 2A6IB 3PWPB 4NFBA 4UT9L 4PJEA 2B1HH 3ES6A 1AI1L 1U8OB 4AIZB 3ZKXB 4MA8H 3UDWC 2XXCB 1NBZB 2ZOLA 4J1UB 4CNIB 3OX8B 3QIUD 3U4BH 4EDXB 1U36A 1A6AB 1VB9A 4I1NB 2VO5A 2WINA 4NFDA 4FQHA 5KSAD 1KTDB 1MVUB 3O6ML 3ARXA 4PRPB 5GQBA 3VFGH 3H7LA 2FJHB 5TE4H 5EORH 1JWSA 1OAUH 3KYNB 4XI5D 4G8GE 2WUCH 4XCCH 4L8CB 1HINH 4WUKH 3Q0HA 1T0NA 3QPXH 2ZSWB 1N0LA 3OAUL 4ODWB 5C0BE 1ZHLA 5ITFB 4Y4KA 5KOMC 1VACB 5GGVH 3DXAD 1ZLWH 3WS6C 4G8EA 4PJFA 2Z4QB 4LPXA 2MPAL 2Z91A 5FDWA 3L3JA 5D4QA 3C9NA 3HB3C 1ZHKB 5K9KA 1SEBA 1R3IH 1D6VH 4DGVL 5A2KH 3QNYA 4WHCA 2YA2A 3E2HB 3U6RB 1K5NB 4H8WH 3RHWF 3RP1A 1I3UA 3CLEL 2AJZA 1HHKA 5DHYA 1R6VA 1PW3A 3P4LA 5JUEL 3LKQB 2MCPH 1Q9OB 1S7QA 4GKNB 1RUKH 3ARTA 3VFNB 5LXGL 1U8LB 2PTUA 3PQYE 5M94B 3GI9L 2H9GA 2L7JA 2VAAB 3SGDI 3TIEB 4MCZA 1VKXA 5D7JA 1HXMA 5T5FL 3B5TA 1EO5A 3X14A 4HWZA 4N1HB 2V9QA 3R1GL 4JHWH 5ALBL 2PXYD 4AL8L 2P8LB 5IBLD 2IALB 1A47A 2MQ0A 1KNOB 1T2JA 2X4QB 1VFBB 2P5WE 5GISH 4ZD3H 1E0OB 2VLKA 3IDMB 3VWKC 4QHUB 5DS8B 3Q6FB 4X4XA 4U1SA 4PGBA 3D85D 3DRTA 1TVHB 3SDXA 2CK0H 3K81A 1C08B 5D1ZA 4PB0L 4CU8A 3IS0X 1IL1A 4GMSH 1GGUA 4PJCF 1K8DB 4KKNA 1ACZA 3D0LB 1NMBH 3DPBA 3KHQA 4MD0B 4RQQB 5D2NC 1QR1A 3MJ7A 2GUOB 1YPZB 4YIQA 1RZGA 2NY2C 2BOBB 4FHBD 2V7NB 5IHZB 2QSCH 2YRZA 3UTZA 4FXLA 5CWSB 5J1AB 3V6FA 4AMKL 3HC3H 1G7JA 2X9YA 5LWYH 1AFVH 4NC2B 1EEYB 5SWQA 2H8PB 3IDNA 2NXYB 5JIIA 1FSKB 5LGKA 2FH6A 1D9KA 1D5ZA 4M4RA 2WP3O 1MWAL 4J3WA 3NIDE 4HWBA 4QCIA 2FL5B 3I2CH 1WWWX 5I18L 4P3WA 3PWUB 3T0DA 2VZUA 2YD4A 5F7KC 4M1GH 2DQFA 3VXUE 1NAKH 1C5CL 3EYSL 4YK4B 3QUMA 1U8QB 4P23C 2XY2A 1U8PB 2ED7A 2C3VA 3G6JA 3MRMA 3PL6D 2DD8L 3OPZH 4JPIA 4KI5E 3CDGB 1BJ1H 4LARL 1JN6A 1GZPB 1KTRL 5J1TC 4XB7A 2HMID 5EUOA 4RAUA 1MY7A 3QSKB 3LQMA 1ZTXH 4RGNB 3IJYA 1HSBB 4DAGL 3ALXA 5IB3B 1LEGB 2YN3A 5FA3B 4WENB 1DUZA 1Q94B 4Q9RH 4NQCD 4JFXA 4M6NL 5CEXA 3ZKMC 1BVLB 2Y5TA 4ODSL 1JUFB 3IXTA 2DTML 1WTGT 8FABB 4HH9A 5I74C 4F33B 3MUGB 2DM4A 4YDKH 2R69L 2VLRE 2Y7QB 4IRSD 1ZLSL 3CUPB 5E94A 1KB9K 1T5XB 3JWDC 4GRWH 4TVPL 5GRJL 1JI2A 2SEBB 2COQA 3CFCL 5E5MA 5ADPH 3GMRA 1ZE3C 1C5BH 4RRPG 1N6QH 2A73A 1S3KH 3BP6A 3VGDA 1DBKH 1KLFA 4JRXA 1HOCB 4U1MB 4N1EA 3NTCH 4O51B 5F6IC 3BP7B 3BPNC 3PGCB 3SN6N 1MAML 3QFJB 1FP5A 2G5RA 5K9JH 4H88L 3ZKQD 3BIBX 1MJUH 3MRCA 4Y89A 1AGDB 5DVOA 5L88H 3QIBD 3F7YA 5LQBH 5IB5A 1QPXA 5AZEH 5DD1L 3UX9B 4GXVL 3MLTB 2EO1A 1TJIL 2CJUH 1A14L 2KBGA 1OB1A 5IEHB 1RJYA 2YPLE 1LO5B 1LP9F 4R7NB 3QHTC 3EJJX 4OGXL 1VFAB 1YYLH 2YZ1A 3C08H 1P7HL 4XGZA 1QACA 5FYLE 4WY7L 3TWCH 1F4WL 2BJML 3MJ8A 4O9HL 5F3BB 5FKPB 1ZHBB 4XP6L 4JB9L 2I5YL 3RVWC 7FABL 2IG2H 1I8IA 4KAQL 3S96A 4DKEH 2G5BB 3CSYA 5ELIA 3KPRD 3QG7L 3U7AA 3RIFK 4ALAH 5CJBA 1OAXL 3QUYD 2J4WL 3VFWA 5SX4I 3WNOA 4OT1L 4NBZB 1YEFH 5C0AE 3TIDB 2DI9A 3OR7A 5DD0L 4QXUH 1T1WB 4NT6B 4K94L 2X89A 2ADGB 5IIEB 4RWYH 4RAVB 1BQLH 5C8JB 4JQIL 5DRWA 4HPYH 2GK0A 1U58A 1WBYA 3WFZA 3DYMA 3BMVA 3U4AA 3UROR 5E00B 1D5XB 5CP7A 3QWQB 2QEJA 3BVNA 4X6DF 1S7TB 4C56D 3GMOA 3DUSA 1HEZA 1IT9H 2BSSA 5HI4D 4F8QA 2VDLH 4M5YH 4YDIH 5DI8A 3MO1A 1RHFA 4XNXL 1NJ9A 5IM7B 3W39B 1WBZA 4PRHA 3QISA 5AWNL 1RY7B 4ZAKD 4GBXA 4ODHL 5J7CC 3FQUB 2QADB 1RK1B 5DVLA 3V95A 4P5MA 1RU9H 2PYED 3WEXA 3KR3L 5I8CB 2VZVA 1FGNH 2FX8L 5EU4B 1DLFH 3PHQA 3HG1D 3V9FA 5BV7B 4JO3L 2B0SH 5C0IB 1DLHB 1YEIH 4U6XA 1J0KA 4OGYL 1NC2D 1LGVA 2DB8A 1HWGB 5HGDA 1MCIA 1IKFH 4EI5A 2IBZY 2EDOA 3DETD 3D39E 4JFOA 3KJ4B 5CIPH 4QRQB 4DUWA 3QUZC 4P99A 4KU1A 4K3JH 2EZ0C 4EVNA 4X4YB 1UB5A 3FB8B 4P3CL 1G0XA 3O6FA 2C4FU 3ULUE 1A3QA 4RFOH 1YNLL 2RBLA 4YHML 5JHDB 4M7LH 5KVEH 2NY6B 4OD2B 3L5XL 3UBXB 1NCWH 5AD0B 1FZOA 1DBMH 1R3LB 1ZA3B 4NKQB 5HGGS 4J8RB 3MNVA 3CVIH 5DTFA 1I9RH 2DMCA 4G7YL 1CK0L 1X6LA 5JA9A 3BP5A 3FOLB 1TJGL 3I75B 2VLME 4XCFL 5GRWA 4F2MA 3I3BA 3VW3L 2J8HA 3JV4B 5MERB 1NBYA 3O0RL 3NPSC 5ESQB 1AP2B 4GKOA 5E2VH 4FP8L 4W70A 1S7UA 2V17H 1GGBL 4IMLB 2MHAB 4JRWA 1YEDB 2NTFB 1UKQA 4PJ8D 2PXYA 5CEZH 1CYGA 2BNRD 3GIZH 1GRWA 1E28B 4ZUUB 2WMPA 2QJDA 3LB6C 3PP3H 3T77A 3MLXH 3PWVB 5FECA 2ZCLL 2Q76B 5D6CB 4OZIF 3C60A 3CNKA 1SM3H 1DVFA 3RKDC 3D85A 4ZNEA 3M45A 3RVXD 3VXTB 1INDH 5EU7E 3WIIL 5D70H 5I6XB 2HKFH 2OL3A 4TNVF 5GGSY 3C87A 3S4SB 5E08L 4FQCL 1JTPA 1A9EB 2D31B 3S3SA 3WIHL 4LVHB 4NN6C 3CSGA 3G6AA 5FF6B 2UZYB 4GAFB 2NY7H 4MNQB 2R56L 3WFBH 3HE7D 1U3HC 4ZNCD 1IRAY 3L3KA 4RZCA 4DCQB 2AJVL 4IRZH 2NX5E 3FQRB 4M43H 4NN5B 2L4OA 5D1XB 1Q0YL 1S7RB 1X4ZA 1XT5A 2EEAA 4Q9BA 4KJYB 3GSOA 1KN4H 1MELA 1EX0A 4KJPD 1BJ1J 3VI3E 5BJTB 3DRQB 2QKIA 4LLQB 3O4LE 4GAJL 4OZHB 4YDVA 1F13A 1KB9J 4KQ3L 3DO7A 3HMXL 1RJLA 2H1PH 3X3FL 3L5WA 1RAMA 3RPKA 1X5HA 3W0WD 2G60L 1PZ5A 3L1OL 5KSVB 1UH3A 4IS6A 3FTGA 1XCTB 2IANB 3KPQB 1Y0LB 3LV3A 4KMTL 4ONOA 1AJ7L 3ULVH 2GSIA 2IQAB 3MRGB 5DYOA 5EOCL 3PL6A 4LVNC 3X13A 3OJVC 4JFHE 5I17A 3QIUC 4MXWL 3NFNB 4LF3A 1U91B 5KSAC 4NQCA 4RMTA 4FFVD 4Z78B 1FYTE 3GEWB 3ZE2F 5IFJA 4OLWH 3UJJH 3RNKA 3CZFB 4XI5C 2M2DA 3MLUH 4MB4A 1EERB 5D2LE 2BRRH 1J7VR 1NANH 1IGMH 3INUH 5DGRA 1BLNA 1KSRA 1BZ9B 1K9TA 2YA0A 3LEYL 1HH9B 3L95A 4KI1A 2ZG3A 4NO2B 2AK4B 4NYLA 2JCCF 3EJZD 3T1WA 1NLBH 3IJSB 4BSWB 3DX9A 2RFXA 1FVEA 2WW8A 1B0GB 3OXSB 1YYML 1S8DA 4L8BB 1H15A 4HF5H 1P4LB 1UYWH 2IPTL 4OIIL 5IJVB 2Z93B 3BRDA 4KY1H 1W0VB 2QR0B 2R2BA 1YEHL 3RWDB 2X7LA 4L3EE 1FVCA 2EDFA 2V2TB 1A6TB 2R1XA 4DK6A 1X7QB 3H2WA 2GAZA 4LCIL 2BSRA 5E2UL 2AI0L 4BSVB 3BD3A 3I3DA 4GH7B 2F5BL 1KCUL 2F54A 1P69B 3STBA 5D8JL 1SJVA 5C71A 5EG6C 3GMMA 5IWLA 4S1QH 4PJ7E 3FT2B 1HH6B 4BH8B 1E4WH 1S7WA 1UEYA 1JZ3A 1YEKL 3VRIA 3EYFB 1ZT1B 1NAML 1DCLA 2PXYC 2ZUXA 1F5WA 1RZJH 4P4RB 4P9HL 5KN5B 1QFWL 1CG9A 3QUYA 5K9QG 3R06A 4TQEL 1AC0A 1DTUA 2R1WB 1MHPH 1N26A 1I9JH 2HJFB 3HC4L 1HHJB 4NZTL 4YE4H 3C60C 3TCXA 1OWRM 4H1LG 4HIEB 3QULA 5HDLA 4YQXL 2HVKB 5DJCA 2R1YB 4AH2B 1C12B 3AS2A 1AO7A 2UV3A 4F58H 3KPSE 2ZG2A 4WU7A 5TGBA 1S7VA 1T7VA 1FN4B 2DYPA 5FYKL 2IQ9H 5FHAH 3CMOH 3OWEA 1ORQA 5C0CE 3MR9A 4PJCB 2FYYA 3QRGH 1MIEH 1OM3L 1BMGA 3TBSA 4EN3B 4G3YH 5I1GH 2H32B 1MH5B 4ELMA 4HUUA 4XPGL 5GZOD 4ZAKA 1ROWA 4X7SH 4LDEB 5F9JB 5FB8B 3FO1A 1HN1A 1CLCA 5TF0A 4ZFOA 2OTWA 2FSEB 2NLJA 3LKOB 5FYJL 4M6AA 4Y88A 2PO6B 1X4YA 1ONQA 3GBMH 5MHSE 5E2WL 1MRFH 3H42H 4L4JA 4JFEA 2DQCL 3ZT6A 5AUMB 4ZFFA 1WAAF 3C6LA 5E5RB 5GGRY 2AV1B 3S5LB 2YD1A 1S9KC 3MRKB 5BRZE 2WIMA 3A67H 4LFHG 3BWAB 3PL6C 3H9YA 3MYJB 1NGPL 3FRPG 1N2RA 4LFHD 3TZVD 2QQNH 1OAQH 3C5ZD 2HMIC 5DMIH 5B8CA 2P5WB 1QSVA 1I8LC 2BVOB 4NQEE 1XCQB 4FABH 3ILPB 4QXTA 5BVPL 1TFHA 2I60H 3VWJB 3MNWB 4Y1AA 2ZP0T 1JZ2A 3H9HA 4QTIH 5HDOA 1EUTA 5IHBA 4I48B 5DHXB 2YKLH 2YSSB 4HKBA 2FH8A 4OZGA 3QI9D 4CW1B 3PDDA 1LD9A 2R0ZL 15C8H 4AQ1B 1NUGA 4G6FB 3TO4B 1OARH 4X99B 3BSZL 1YMMD 3DUUA 3PWLB 2CDGB 2AXHA 4Q6IC 1A8JH 1QBLL 1KJVA 4OQTA 4JZOB 2ZPKL 2BNRA 1KCRH 2C4FT 1MI5D 3QEGH 1MRCL 3O2VH 2GEEA 3I6KB 2YK1L 4P4KA 5EOQL 3QIBC 1EA9C 4CMMB 3U36B 1BEYH 1PJ9A 4OJFH 5HHOA 1HNGA 4P46D 4HXBH 3VXQA 4XBGB 1Z6JT 3HMWH 5FEBA 4D3CL 5CBEB 3N9GL 2Q1EA 2H2SD 1IZJA 4OLEA 4WV1A 4HIXL 3RWEA 3WS3A 4BZYA 3O45B 3BW9B 3CVHH 3DVFA 1LP9B 4O58H 4YNYB 5I1AA 3L3HB 1HSAB 3OB0K 4R2GD 4OZ4A 2BP3A 3QRFM 4KKCD 2A6JB 4WTXA 2X4RB 3MRDB 3G5VB 4E41E 4ZFGL 3V0VA 4L5FL 2XFXB 2Z8WC 2PW2A 1B0RA 2HKHH 3QUYC 3SDYH 3AROA 4PV9B 2AEQL 4IIQA 1FPTL 4I4WA 2V5RA 4PRAB 2DBLH 1ACYL 3HN3A 4CBPA 4LASL 1MJ7L 2E7MA 5CUSL 5E7FA 3TBWA 2P5EB 1KV3A 4TSCH 4OI9A 4NKOA 4UNUA 5D7KE 1S5HB 3LDBB 3FFCE 3SE9L 2O5YL 1F58H 3W0WA 3IFOA 3TNNA 3HNSH 4KTDL 5D5ME 3F8UB 1SBSH 3FZUD 4G80A 4RMRA 5HYEA 2B4CC 2F53A 3FT3A 1V05A 4WNQA 1A4JB 3ILQD 5ETUB 5C0DB 5HI4C 4X6DB 4TRPH 4F9PA 4K23H 1ZHNA 3BRGC 1QFWI 4M8QA 1J12A 1LNUA 4UB0L 1A2YA 4R0LB 4ZAKC 1PX3A 4OCRL 4I5BB 5IVXA 4QOKD 3LKSB 1G84A 2QLVB 1NGZA 4J3UA 2VLJA 4QHLA 2ZCHL 5A43C 4QRSB 1NH6A 3BI9X 3VMOA 2Y72A 2YD2A 5ESVA 3ZHKA 4MXVF 2BMKA 3ZYZA 1R3HA 1CDJA 1JNNL 2YPLB 3IB4A 2I26N 3IVKA 3ARDD 5IGXL 2OQJA 1VGEL 2F5AH 3GGWB 4ZPVB 4XPTL 1MFEL 4KMQA 4XVTL 1M7DB 3GMQA 4FQXA 3X3GL 4U31A 3DUHA 5ILTH 2WBJB 2AEPL 4YXKL 1F4HA 3GJEA 3K0WA 4RFNC 3DETC 4L4VA 1DQJB 3SOBH 4CN4A 3IXAA 5C3LD 3PWPD 2J8UF 4OGZA 4V2CB 4Y16B 1OPGL 3P9LA 1XF2B 2OJEB 4FXKB 1TZIB 2ZUQB 5B8CC 2EXYD 3T4YB 4DFIA 2A1WH 2DLIA 1DQQA 2F74A 3ETBF 1XGYL 5D9SB 1U93A 4YBLC 5F6HI 3IF1B 1RJCA 4PRPD 3NVQA 4QXGL 2BRQA 4MD5A 4M7ZB 5KSBA 1B2WH 4JPVL 4JZNA 5ICXB 3O3DB 1Q9LB 1RVFH 1U8KB 4Z7OF 5MENB 4G8FA 3VXMA 1NGWA 3QUXA 4AT6B 2CLZB 4M61B 3RI5F 5DMKB 3FKUS 4QF1B 4YAQA 2DIBA 2ESVA 5I15H 1VESA 1ED3B 3RWFB 1BIHA 5FGSA 4LNVA 1A4KA 5JOPD 2VABA 4LHUA 4TUOA 3P0VH 1OAKH 4I8DA 3UJIH 3EZJB 3LN4B 3RWGB 1FIEA 2W92A 3KYOA 4NZRL 4PJ8C 2DLFH 3UPAA 1EH9A 3T65A 5C0RH 5GJSL 1RMFL 3HZYB 4KHXL 4JG0H 4Z7UE 2DIJA 3KS0J 3PNWB 3JUZA 3VFSB 5I1CH 4M6ML 4PGEB 4Z76B 5JLZA 3V4UL 4OB5H 2JB6A 3FHAA 3SE4A 3TBVA 2XZAL 4WV1C 2NY3D 2OXHA 1CF8H 1TVDA 3EOBB 2FR4B 5MEOB 3U46B 5F88A 2X4NA 4JVPA 2H41A 3BQUB 3V6BR 2Y4SA 1CCZA 4R4FL 1S9WB 1DANU 3HE7C 4MJIE 1J5OH 1V3MA 3MCG1 3GSQB 4UILH 5L2JA 2JJSA 3ZE0E 1PFCA 4LOUD 4MYWB 3TO2B 3T04D 2XRAL 3MRJA 4IIQC 4PJEE 3RU8L 1KJMA 5D7LD 3NIFF 4HULB 4KJPC 5DT1L 2DDQH 2DL2A 2EXWD 4PJAA 4IEFB 5FK9B 4PJXF 3Q6GH 1GZQA 1AD9A 3SHSA 2FEEL 5K93A 3EOTL 3LPWA 2AQ1A 2XZZA 1BM3H 1GGCH 1IAKA 2EDBA 3TBYA 4XP4L 4ZSOA 3NOIA 1BQSA 4D0CA 5FM5M 4OV5A 3W9DB 3LS4L 5INDB 4XMKH 2LQRA 3MYZA 4YHYC 1O0VA 3VFPB 2VITA 1XEDA 4DKFH 1H5BC 1NPUA 4UIMA 5DJDA 1M71B 3TZVA 2DWDB 4F7MB 3BPLB 2HG5A 4BH7A 3F58H 4XCEB 4P57A 4AM0B 2AVGA 3GSVA 1XZ0B 4JDVA 1F02I 3VU2A 4E0RB 4FFVC 4PJFE 1YNKH 5HVHB 3KLHD 3CSPA 1JPGB 1UM4L 1Q0XH 2NXYD 4YHPA 2L0DA 4EOWH 2FO4A 3CVHA 3BKJH 5E1HB 1AGEB 3MUZ1 1RJZA 3QUML 2QQKL 2W9EL 4MAYB 4WEBH 4PJDA 5BOPA 4EUPB 3AXLA 3MLZH 4LCYA 1J0JA 2P46B 3ALWA 3RGVB 3DECA 4L9LA 4EQ2A 4ODUA 1WZ1H 3Q5OA 2EYSB 4YHZH 4ZPTB 1WIPA 1U92B 1U8HA 3PJSB 1U6AL 1GC1H 5B21A 3UTQB 3E6HA 2OR9L 5IFHH 4WU5B 5JPMB 2AEWA 1YMMA 2PYFB 4NRXA 4AEEA 3F7RA 3MCKA 3HAEH 4YGVA 5KG9A 3TCLB 5FYKU 3MRIA 3OAZH 3U0PB 2R2CA 4AEHL 4RGND 3I9GL 3RY4A 3BYTA 4AEIH 3O3BB 5FKAB 3GSUB 2AK1H 4XCYA 4YPGB 2IH3A 2FLBT 3O4LB 4KROB 3DX7A 1DUYA 4LBEB 4WDIA 4PJIF 4O2EB 5GS1C 1A0QH 4NWTL 3E1F1 1YQ2A 4QRRB 3MRFA 1DN0B 3C2SA 3U4EB 4KFZC 4WHTB 3VMPA 1PVHA 5JW4Q 2VLKE 1YMHB 1CFSA 3MRNA 1NBVL 4NHUA 4UV7L 1IMHC 5JW4R 5GGQL 2ICEA 1XR9A 5FYJU 4K8RD 5JMRA 1EAPA 1INEH 3VE0A 3SDXE 5I73B 2P48B 5L2KE 1UWEH 1L4IA 3IFPB 3PGDB 1GIGL 3P73A 1Z2KA 1JHLL 4PG2A 2RB8A 3SPVA 3U2SA 2H3NB 3QFJD 5ENWB 1BQHB 4BK5A 3OGCB 1TLKA 2ZSVB 3T8XA 4CDGC 2B1HL 1DEEA 4MA8L 5D2LB 2YEZA 4LLDA 5DMYA 3PWJB 3U4BL 3OMZA 1KGCD 4KPHH 3UPCA 1DBBH 4CVWA 3TJHC 1J0YA 5I1LA 4FA8A 4L8SB 5J9PB 1U2CA 3G5ZA 3SE4C 1AIFA 1MLCB 3QEUA 3VFGL 1WFUA 1WBXB 5EORL 5EC2A 1OAUL 3JXAA 2WUCL 1H3PH 1HINL 3FQTA 3LPGA 3RIAF 1OTUD 1FNGA 1UZ8B 2FX9L 4RAHA 1RIUH 3W2DH 1RURH 1N7MH 1A7RH 3WE6B 3MZTA 3PV6B 1Y6KR 3MRQB 3RJDA 3FMGH 2QSVA 1QZ1A 1JGEA 1HQRA 5GZOC 4U6YB 1CFTA 2FBJH 4JY6B 5GGVL 3RGHA 2BHZA 2A9MH 3G6JE 4M62H 3ARFB 2WZPD 4L3EB 5KSUB 3GB7B 3WLWD 5EUOE 4ZTOH 4X0KB 4P3DB 4YEEA 1R3IL 3RPIA 1D6VL 4WO4B 4PY7A 4F7CB 4IOSD 3ARDA 4MJ6A 3L7FA 1CLZH 1CE1H 3JZ7A 2HTLD 4H8WL 5F8QC 4QXWA 4RA3A 1YEEH 4PJBA 1CTOA 3NCYP 4NNXB 1SJEB 2MCPL 1W0YT 3QWRD 3WJLA 4R4BA 4LEOA 4U1IA 4KKLD 1GL4B 2ATPB 2VZTA 3PWPA 4NNPH 2EH8H 4LPUA 3TZVC 1J1OH 3MV7E 4G9FA 4WW1A 1Y6MR 3C5ZC 2W9LA 4RBPH 4J1UA 3T0WA 2QADD 2E7CA 2OI9B 2FEEI 4Y2OA 2DQIH 4DN4L 4JRXE 5FIEA 4JHWL 4OFIA 1KTDA 1LMKA 1MVUA 4PRPA 2KKQA 4G6KL 1NFIB 2FJHA 3O11B 2VWEE 2Y23A 3LMJL 3JSSA 4M1CD 2J7LA 4K07A 5HDBF 4KK8D 3V4VH 4GRLB 5GISL 4ZD3L 4L8CA 1HYRC 1OT2A 1XGRB 3KPSB 3AGVA 3QI9C 5I30H 4UBDD 2ZSWA 5DJ6A 4K3HA 4GAGL 4ODWA 1IM9B 5C0CB 2WBKA 5ITFA 3VD7A 4J2XA 2CK0L 4N0RA 3EFFB 3PDOB 4XZUB 1VACA 3ARPA 4GMSL 5J4MA 2NY1D 1NMBL 1MHHB 3EO9H 1IZKA 2CIIB 1ZHKA 4N8VB 1JWMB 2X9WA 4X98B 2NW2A 1IM3A 1IEBA 5GJTH 5JHDD 3UBXG 2NY6D 4OCSH 2QSCL 5GS0D 4XX1G 3JWOH 4CVZA 5CS7A 5IB4B 3PP4L 1A7PH 3HC3L 5LWYL 1AFVL 4LGRB 1FO0L 4P46C 4Z77A 4OF8A 1Z3GH 4S2SB 1OAYH 1HILA 3LKQA 4HKZA 3MROB 2ENYA 1IGYA 2H2SC 4NQSA 3VFNA 1H3GA 1U8LA 1EJOH 2XOTA 3D69B 5F96H 4GW4A 3FT4A 3I2CL 5TE7H 1T83A 3TIEA 4Y5VB 3LSOA 1V3JA 4WI8A 4OFYD 4R2GC 3ZDXE 4M1GL 4KKCC 1NAKL 1S7SA 4M5ZL 2GSGB 4LSUH 4RFEB 3NCMA 4PR5B 4NQEB 4GQPH 2D9QB 3MCLH 1NUNB 3KGRA 1KNOA 3BN9D 3OPZL 5I0DA 2X4QA 2WAHA 1VFBA 3QQ3B 3VXSD 1UM5H 4MX7B 4PRHE 1A5FH 1JV5A 1A1NB 3BHBB 3IDMA 4QHUA 5KBNC 1W2KT 4AYFA 1ZTXL 3Q6FA 4L8DB 3MLPA 2IPKB 4DGYH 4JGUA 2NYYD 4G6JH 3REVB 2XY1A 4Q9RL 3VA2C 1NAMB 2FJGB 3S4SG 2FZ3A 3HAEA 3BRFA 3FZUC 1YDPB 4TULH 4IHOA 5D1QA 1WEJH 5BW7C 4ZUSB 2YPVH 4XBEH 3ILQC 3D0LA 4MD0A 4M7JH 1BWMA 1YPZA 1Z9OA 4MNQD 2IAMA 4BFIB 4MJ5B 2XA3A 3NIGF 1DANT 1T21A 2V7NA 5ADPL 4S11A 4WW2C 1C5BL 1E4JA 3BAEH 5T3XD 1N6QL 5J1AA 5D1XD 1S3KL 1DBKL 1RV6X 1WWBX 3DXAE 3H9ZA 4HUXB 3NTCL 5BCAA 2H8PA 3H7BB 2W0KA 4ISVA 3EO0A 1EFXB 2AERT 4MNGB 5K9JL 1BFOB 2P8PB 1A7BA 1H3UA 1MJUL 1CGWA 3C5JB 2CXKA 5L88L 3VH8A 3ARDC 3LAFA 3UCRA 3WN5A 3PWUA 5ITBH 5LQBL 5LAXA 5AZEL 1LK2B 2BFVH 4OLYH 3JV6B 4B7LA 4OM0H 3RAJH 1I3VA 4LQFH 4D9RD 2CJUL 5KANI 1DL7H 4Q2ZB 5EIIB 1YYLL 2Q86B 4ZYKB 3C08L 4P2QD 1GZPA 4XC1H 3DX8B 4MD4A 3ZKXC 2EXYC 2HFGH 4Q97A 2J8UB 4HXAH 5JDSB 5CLWA 1IEAB 1HSBA 1Q94A 2IG2L 4QY8B 5C86A 4DKEL 1BVLA 4Z6AT 4ALAL 5HGAA 1C1EH 3P4NB 1CFBA 1JUFA 1KIRA 3VRJB 1UWXK 5JQ6H 1OD7A 2E9JA 3MUGA 1YEFL 5EWIH 4ZODA 1JGLH 1IILE 4QXUL 4RMSA 5DRZB 3REWA 4RWYL 1BQLL 2AK4D 4ETQA 3F6LA 4ZNEE 1T5XA 4HPYL 4QHKJ 4WWKB 5DHVB 3VG0H 4LSDA 5DWUH 2SEBA 2Y06H 3CXHJ 4OM1L 3RL1B 2ICWB 3L3GB 2DQDH 32C2A 4JHAH 2A83A 3PHOB 4PJ5A 5IQ7H 5DVNA 4XP1H 3HRZB 3BEVA 3H3PH 4XVSH 3PG2A 4LCUB 4PBWD 4QYOA 4HGWB 5L0QC 4R4ND 4CVXB 2VDLL 2DAVA 3BYYA 1A1OB 4FTVD 2BVQA 3O4OB 4FQJH 4YDIL 1LHZA 1OP9A 5IKCA 1J0HA 1AGDA 3P2TA 2AQ2A 3E2HC 2IFGA 2V5TA 4JFPA 1MRDH 4UI2A 5ACLA 1CU4H 3IFNH 1TVBA 4FOMA 1RU9L 2OSLA 3TESA 4HUKB 2NY3C 1YQVH 2DQEH 4FNLH 1WZLA 3HPJA 2GY5A 1DLFL 4H0GA 1YUHA 2B0SL 1E4XH 1BOYA 5DEGB 1YEIL 5F3BA 1VSCA 2BY3A 5FKPA 2ADJB 2R0KH 3DNKA 1IKFL 3PABB 3LKRA 4LSVH 2G5BA 1T7XA 4HT1H 2ITCB 2CGRH 4LOUC 2AEIT 1BOGB 4BFEA 3OQ3B 4K3JL 3AS1A 1HK6A 4NQVB 3TIDA 1JPFA 1NC4D 1E27A 2ZUTA 2AW2A 2EXWC 1T1WA 3UTOA 4LPWA 5DLML 2ADGA 2GYSA 3RTQD 4RFOL 4R8WH 1FG2B 1XF4B 4XWGL 4M7LL 5ID1A 1EO8H 3GIVB 4AY0A 5KVEL 1FFNB 4NQCE 5C0BD 1DSFL 4N0CD 5ALCH 1NCWL 1IQWH 1D5XA 1DBML 3H3KA 3U7WH 5DSCB 2XYCA 4HUVB 3CVIL 1I9RL 3BT2H 1UXSB 2ED9A 4W81A 1NFKA 4HG4K 2YD3A 3O2DH 1OSPL 2FECI 1KB5H 4EN3D 4KGJA 1C16B 1FFOB 4X6CF 3CFJB 2DI8A 1PEWA 3GI8H 4I0PA 4OCYH 5E99H 5IM7A 3VFUA 2X1OA 3MJ9A 4TUKH 4GQ9H 1HQ4B 2V17L 1RK1A 2IMMA 4Z7UB 1F3RB 4XPBH 4LSPH 3VFMB 5C0JA 5HYQA 3KLHC 1CGYA 3EDEA 2HT2D 4GRWF 3QNZB 2NXYC 5CEZL 1G7PB 1FSKC 1J1PH 3GIZL 3OG6B 4MA3A 1WFNA 2ADIB 4K71C 3WFCH 3SCMD 5EU4A 1YN6B 2PO6D 3MLXL 4K2UH 5IROA 1D6EB 4MQTB 2DLGA 2CIKA 4LMQE 4UIKH 4X8XA 1YJDH 4YK4C 5JW3H 4C58B 2F58H 5D70L 2XQYG 2HKFL 4HBQA 1DFBH 5I1HL 3A6BH 1JZ6A 2F54E 5EO1B 3KYAA 1LO4H 5E6IB 2EDDA 3JTSB 2EECA 3B6SB 1X5GA 2NY7L 2P5WD 3FB8A 3FQWA 4PJEB 4RGNC 5IMLB 1CXIA 4PLOB 3WFBL 1EAJA 1G7IB 1KCSH 3QG6A 5JHDA 2ZOLB 1YN7A 3IDJA 2JELH 4IRZL 2QHLA 3IDYB 3VWJD 4CKVX 5J8OA 2WINB 4M43L 5EOTB 1CVRA 5AD0A 4QTHB 4EQ3A 1U8NA 3CFBB 5I19H 1QBMH 3MV9A 1AGFA 5DZNA 3ZTNH 1KN4L 1JWSB 3O8XA 3EBAA 4LSQH 5I1DB 1TDQA 1CWVA 3I75A 3QJFA 3MZGB 4DEPB 3QDJA 4K8RC 3K2UL 3LD8B 1Q8MA 3JV4A 3MRPB 4G6FD 2H1PL 2YXMA 3TO4D 3SQBA 1ZHLB 5ESQA 2DQHH 1AO7E 4PFEA 4QRUA 4Y4KB 4IMLA 1OGTB 1TZGH 2MHAA 1ZGLM 3V5DA 2VUOA 2VL4A 3ULVL 4PJFB 1NUDA 4CJ0A 5E8EA 3D0VB 2Z91B 5FDWB 1G9MH 3C9NB 1IQDA 3CD4A 1S9XB 3PWVA 3BKCH 1B88A 4ELME 2Q76A 5D6CA 3B3IB 3K80A 2Z8SA 3BDBA 3QNYB 3BE1L 5A2IH 4KZEH 2AJZB 1HHKB 5DHYB 4OLWL 5IT2H 4FFWD 3UJJL 1VFMA 3MLUL 4XNUH 2BRRL 1A9EA 1IGML 3INUL 1J8HB 4FZ8H 4HS6B 3UEZA 5KVGH 4NC1C 1OTUC 2Y07H 5FF6A 1KLGB 4JFEE 4KI5D 1KCLA 2C1PA 1NLBL 1VKXB 1AI1H 5D7JB 1HXMB 3M8OH 3X14B 4HWZB 4MXQD 4OKDA 2HYMA 3RUGF 5GS3A 4C4KT 1S7RA 3OJDA 4ORGA 1KOAA 4MVBD 2EE9A 3HUJF 5LBSH 5C08B 4HF5L 5T1LB 1UYWL 4GW5A 4OZHA 2P5ED 5DC0A 2VLKB 4KY1L 4Z7VF 4D0BB 2DKUA 4DZBA 1G9EA 4PGBB 4RMWA 4Y1AE 2HTLC 3STLB 4X6FB 1KIUA 5EZLB 3SDXB 5CHNA 5D1ZB 2IANA 4OZGE 1Y0LA 1S7XA 3S36H 2P44B 4KKLC 2LAAA 4K3GA 3FO9A 1QR1B 1IGCH 2APVA 2R8SL 1Z9MA 4YIQB 4S1QL 4DGVH 1J9CT 1MCCA 2WWKT 1E4WL 2QADC 3UTZB 3T09A 3V6FB 1U91A 4TSBH 3GHEH 1VERA 4XH2B 1G7JB 6CGTA 5EO9B 1RZJL 2BNRE 5SX4H 5SWQB 3MJGX 3IDNB 5B38A 4KK8C 5IROC 1D9KB 2YPLD 1D5ZB 1BZQK 1MHPL 3C8DA 4YPJA 3S97C 5D6DA 5BV7C 1ZVSA 5FUZH 4UBDC 5EBGA 4YE4L 1FAKT 2HFTA 4LLYA 5FYLD 2MFNA 2AK4A 5HHOE 4P59H 2WBJD 3WO4B 2C3WA 4MHHG 3MOBL 4F58L 1B0GA 5HVWA 3OXSA 3QUMB 3KJ4C 4Y16D 2NY1C 5CCKH 4KVCL 2C3VB 3G6JB 4ZOBA 2IQ9L 3CMOL 5IFAH 3MLSL 3CZJA 3SE3A 1EVUA 3QRGL 1MIEL 3WCYA 2W65B 2NY6C 5A2FA 3BEWA 2QR0A 4G3YL 3IJYB 5GS0C 5I1GL 3RWDA 1UZ6E 3O9WD 4JRYA 4KVNL 4X7SL 1XF5B 1F2XK 4JFXB 2NY0B 3BJ91 3RVUD 3IXTB 3QIWB 1KB5A 4BSVA 5MEND 4HG4J 4F9LC 3HI1A 1KLUA 5F7EL 1ZSDA 1MRFL 3H42L 3WKMH 1HH6A 2FB4H 4BH8A 3W0WE 5E5MB 4ZUWA 4J6RL 3WJJC 4YHKH 3QO0A 3DJ9A 2F53E 1ZT1A 3BP6B 5DFVD 4JRXB 3AS0A 2APTA 5TJWK 4P4RA 3A67L 3BN9C 4TVPD 1RIVH 2QQNL 3BMWA 1OAQL 3MA7B 4H25B 1MWAH 5DMIL 1HHJA 1MOEA 1BX2B 3I6GB 5E8DH 3VXOA 3OHXA 1XGTA 3LPFA 4FABL 2EKJA 5F9OL 3ULVF 2W0PA 4HIEA 1N6VA 2I60L 2VLJE 5IB5B 1D5IH 5I6XC 2X41A 1C5CH 2R1YA 1VFUA 2LE9A 1C12A 1R0AH 4M93B 3GM0A 4OF7A 1XAUA 4QTIL 3GJFH 3SE8H 1OB1B 2YKLL 2FGWH 4LVHC 1RJYB 1SY6H 1X5IA 4GUPA 5BVJA 1N0XH 3BQUD 4R96A 1DR9A 1N59A 4MGXA 3RDTA 4XGZB 4MNHB 1JHTA 3MJ8B 2ADFH 2R29L 4D9QE 1BHGA 3ULUD 2H32A 3C8KA 3F7QA 4NN5C 1I8IB 5D1XC 5F9JA 3CSYB 4J4PA 3QNXA 4LGPB 3VXPB 4IBLT 4NM8H 2DTMH 3VFWB 1XMWA 3GMPA 2C3GA 2R69H 3OR7B 5FO8A 3LKOA 2IBZX 2VLMD 3O2VL 2H2PD 4X9GA 5IBUB 1FFPA 3WHXA 5KSBE 2BSED 5AUMA 1BEYL 1U58B 4OJFL 3BX7C 4HXBL 5CP7B 3TT3H 3HMWL 2AV1A 3LRHA 3S5LA 1MQ8A 3J7HA 3WYRA 3BVNB 3AAZA 1KYOK 3V4PH 5F93C 3VXME 3DUSB 3GMOB 2V2WA 3QXUA 4XB8A 3MYJA 3CVHL 3CMGA 5DI8B 4W68A 1RZKH 4O58L 2ESVE 4JDTL 3MO1B 5IVXF 1NJ9B 3DROA 1WBZB 4PRHB 4QNPF 4H5SA 4DFHA 4GBXB 2HFEA 3PIQA 3DO3A 4GFTB 4JM2F 5DD1H 3ARBA 4RNRA 4KUZH 4MAYD 4EUPG 2HKHL 1P6AB 1TJIH 3SDYL 4I48A 1G7MA 5D6DC 2DBLL 3RGVD 4CW1A 3S88H 4TSCL 4K9EH 4WY7H 2BJMH 3NH7H 2AAVA 4LPVA 4U6XB 2Z92A 4KK6D 1JYXA 1F58L 3NA4A 7FABH 3HNSL 5HGDB 2CUMA 3EYUH 5C0GB 1SBSL 4KJQD 4EI5B 3PWLA 1JPTH 2CDGA 4F37K 3G9VA 3HCVB 3CU1A 1OAXH 4JFOB 1T2QH 4UQ3A 4R4NC 4TRPL 1QRKA 4OT1H 1JGDA 5FUOL 3SE3C 1T0MA 4EVNB 1UB5B 4KROD 3O4LD 4NOFA 3O6FB 4DJMA 4KK5D 2PR4H 1NCAH 3U36A 3D18B 4QRRD 1V3KA 1FZOB 3LKNA 4DK3A 5CBEA 4PJAE 3W11D 4PJ9D 3BWUC 3QB7C 4KGLA 3BP5B 4PRNB 3B2UD 1S9YB 4F2MB 4XXCA 1LP9A 4YNYA 3L3HA 2APBA 3W82A 1NBYB 1MCQA 2HAZA 4ZSOE 4OAWB 4WGWB 1TTFA 3ZYIA 4JFHD 2A6JA 2EE3A 5ILTL 5J12B 1S7UB 5KS9E 3SOBL 1BQHG 3S8WA 2DTSA 4E9LA 3LZFH 5J11B 1GHFH 5H35A 4ZS6C 1F4XH 1IAIH 4RDQF 2FX8H 3W9EA 5EN2B 2A1WL 1WV7T 4PTUA 3T77B 2P5EA 3IGAA 1I7ZA 1S5HA 1DVFB 4N0CC 4TSAH 1B2WL 2YC1B 3CFIC 4PJDE 3SBWA 3QWOA 1V7ML 1A4JA 4X6BA 4OBSA 4X6DA 4G8IA 2HN7B 4JQXA 5CP3H 3MACH 4HUNB 1IGTB 3AREA 4EXPX 4EN3C 5I15L 3ARWA 3D1MC 5J13B 4JO4H 4RZCB 4L3CB 4J4PC 5K59E 1BF2A 2W60B 1YMME 3LKSA 1OAKL 1OGAB 3P0VL 3UJIL 4C83A 1QP1A 4DQOH 3ARFD 2ARJA 4K7PY 4L3ED 2HT2C 1FL5A 3Q48A 1KT2B 2DLFL 2W0FA 1RZIB 2FJFA 1JWUA 3GSOB 5C0RL 5GRXG 2XZQH 3K4ZA 4WO4D 2QKIB 4GRWB 2AABH 2PO6C 4PB9H 4YDVB 1FZKA 4JG0L 3DO7B 3GGWA 1GPOH 1RJLB 2HFFB 2V6HA 4NFCA 5I1CL 3LQAC 3HC0A 3LEXB 4UDTA 2JJTC 4D8PA 3CDFA 4CMHB 2WM0A 4HLZG 1DQJA 2AP2A 4IS6B 1CF8L 3FTGB 1PKOA 1MWAA 4QGTA 1ULVA 3EAKA 2GSIB 2OJEA 5EULV 1TZIA 5DYOB 2EIZB 1NFDF 2VKXA 1YY9D 3X13B 1Q1JH 2ZCLH 1J5OL 5D9SA 3OAYH 5I17B 3F7PC 2VISA 4UILL 3IF1A 5I8OH 3VWJC 3QCTH 4NJAL 3GJFA 4Z7WF 4XBPB 1SY6A 2VXSL 3MRLA 4HHAA 4J23A 3S34H 3T3MF 5ICXA 1FNLA 2R2EA 4YZFE 3RNKB 3KPSD 2DDQL 1U8KA 3MLWH 1IGFH 4YHOH 1NL0H 5LCVL 1BLNB 3Q6GL 7CGTA 3Q3GA 5MENA 3SY0A 4IOIA 4M61A 1IM9D 1QBBA 4JFYB 5C0CD 3C8HA 3HS0A 3TO4C 3ZDZE 3DVIA 1NBQA 4J12A 1BM3L 1ED3A 3RWFA 3SKOB 2RQ8A 4PGDB 3DX9B 2QBWA 2DM3A 1WC7B 2VDNL 1TPXB 3F65A 3V6OA 3LN4A 3T3PE 3SGEI 1S8DB 2J6EL 4XMKL 4N8VG 4TNWF 5ERWA 4R3SA 1H15B 2CLRB 3VA6A 5JHLL 4DKFL 1J0IA 1L0QA 3EDJA 3HZYA 4TUJA 1JBJA 1AHWA 3AVEA 3F58L 3IAQA 2ZUVA 3Q2CA 3OBAA 5MHSD 5DRNA 4UQ2B 4RMUA 1QD0A 4G5ZH 1YNKL 2X7LB 1MFAL 4GXUN 4Z76A 1Q0XL 2G60H 1FVCB 4OZIA 1CS6A 4PS4H 5JMOC 2R1XB 4EOWL 3BKJL 1JZ5A 3ZE1E 4NNYA 3ZYOA 2GAZB 3MBXL 4TOYH 2BSRB 4PY8I 4WEBL 2FR4A 3MLZL 3U46A 1OAZH 4LRNH 3ET9F 5T5NG 5IEKB 5EOCH 1P7QB 4KI5C 4BJLA 1WZ1L 3DSFH 2E27H 1S9WA 1B6DA 3GMMB 4P5KA 4PJBE 4YHZL 2UUDK 2XNAB 4MXQC 4NQED 5E4IA 1S7WB 2EDEA 3EYQD 5IFHL 3VRIB 3P40A 3EKCA 1H8SA 3PWPE 4UU9B 4MVBC 4BYHA 2JLLA 3MRBA 4G9FE 1CG9B 3OAZK 3R06B 1T7WA 5J56B 4AEIL 5T33L 4I3RH 2ZOKA 3HUJB 2AK1L 4UINH 4X8JA 4AZ8A 5FGBA 3TVMB 4PRPE 1WK0A 2RGSA 3UC0H 4Z7VB 4X7EC 1FV1B 5CIPB 4HV8B 4GT7A 5DJCB 3W9DA 2CLVB 2WUBH 1AO7B 2DJUA 4P2YA 4YC2B 4JFDB 3GO1H 3ZT5A 2AKRA 3ECBA 4LP5A 4JQXC 3N85H 5EC1A 1PSKH 2B1AH 3MREA 1ORQB 1FL3A 1INEL 1M71A 2DWDA 4R0LC 2FWOB 2GITB 5C7XH 2FYYB 2FEDD 5HPMB 1JNHA 5DJ0A 4AM0A 1UWEL 1XZ0A 4E0RA 1JPGA 3QEHA 1IC7H 3D9AH 6FABH 1EFXD 1AGEA 2WWMC 4MAYA 2HWZH 2VN4A 4JPWH 4ZFOB 3OKKA 2OTWB 2NLJB 3OKMA 2WNGA 4GKSA 3H8NA 4KPHL 1ONQB 1DBBL 4JFEB 2GT9A 1Q9KB 2WBJC 3MXWH 4ZPTA 4ZFFB 3P9MA 3C6LB 5BO1H 1U92A 4S0TD 3PJSA 4UDUA 2JCCA 5ANMB 1YEKH 5JPMA 5T1KB 3BZEB 5FYJD 4Y16C 1H3PL 1MF2H 2ZUQC 4Q9CA 1RIUL 3U0PA 4V1DA 3T0EA 1RURL 1N7ML 3GSUA 1A7RL 1FNAA 2CH8A 5IK3A 3UTSB 3FMGL 4NZTH 3X12B 4JHZA 5D7KD 4LBEA 5CJQH 2FBJL 2Q8BH 4YQXH 1MCSA 2A9ML 3RVUC 3TC9A 4QRRA 4M62L 4Y1AB 3U4EA 3PWNA 4WHTA 5CP3A 4ZTPH 3TN0B 4ZTOL 1YMHA 3H9HB 3C5SB 2YUVA 3RZWA 4GG6F 5FYKH 4WWKD 4NCC1 1LD9B 2HRPH 4KXZH 3STZB 5ESAB 1CLZL 1CE1L 3L3IB 2ILLA 1RULH 2YWZA 1OM3H 1YEEL 4HJJH 2PTVA 4IRJA 2EEBA 4X4MA 3PGDA 3V6OC 1MCEA 2BVEA 5KAQG 1A9BB 1UEMA 3WNMA 5DFVC 5JNYA 1VCAA 5C07B 1YPZE 4DUVA 4Z5RA 4NNPL 1KJVB 3R8BB 3NA9H 3PWJA 4RBPK 3VMNA 4N9GB 2NY4B 4GS7C 4P4KB 2AS5M 3ZDYF 2DQIL 3KPLB 4L8SA 4ELKB 2X70A 5J9PA 2BX5A 5HHOB 1MLCA 3MOAH 4KV5F 2B8OT 5H2BA 1HZHH 5GGSB 4NO0A 5DVKA 3MMEA 3RL2A 5T1DH 1UA6H 3BQUC 3WS3B 5I30L 5INCA 3WUWB 1C7TA 1QVOB 4ZXBB 3H9SB 2UY7A 5I1AB 2P1YA 4L4TA 1NDMA 4JY6A 1CGVA 2CRMA 4HZAA 1RSFA 1QO3B 3V0VB 3WIHA 4OI8A 1P4BH 3SO5A 3GB7A 3EO9L 4KDTA 2QQLH 3TH2T 4KRPB 1KG0B 5GRVL 1GGIH 4P3DA 1LEKB 5GRVK 4I4WB 4RGNE 4Z7NE 5IP4A 5GJTL 2YBRA 3BP4A 1MFNA 3TBWB 2HT4D 2H2PC 2BY1A 3IS1X 3RJQB 4NKOB 2R0ZH 3QR2A 1FORH 3BFOA 3HE6B 2Z0BA 1RQ5A 3IFOB 1OAYL 3BSZH 1SJEA 4H0IA 1WAAA 1B90A 3B2VH 2F53B 5F70A 2DKSA 2Y25A 1EJOL 5F96L 4BK4A 3HMXA 5TE7L 2BCKB 3B9KA 4M8QB 4HDIA 1LNUB 2P43B 4I3GA 3BPLC 4PGCA 4PJ5E 4RMQA 2ID5A 1K8IA 4LSUL 1MHEA 1I1AB 5EOQH 1HIMH 5HVHC 4G6ML 5IVXB 2M26A 2CR6A 5KVFH 3MCLL 4N0FA 4MDIB 5EU7C 4MAYC 2Z9TA 1UM5L 4GRLA 2VKWA 1A5FL 3RX7A 4JCMA 3RGVC 1T1YA 3J8F7 4DGYL 1MCWM 1KGCE 4G6JL 3IVKB 1BJMA 5HJ3A 1NMAH 1IGIL 1MJ8H 2KQMA 3GMQB 2Q3ZA 4FQXB 1C5DB 4KK6C 5E03A 1EGJH 2D2OA 4M00A 2OZ4H 4KJQC 4TULL 1MCFA 3GJEB 3PDOA 5E6ID 1WEJL 4L4VB 1VEMA 2E6QA 3IXAB 4M3JA 4XBEL 1FZMB 4M7JL 1P4IH 2CIIA 3LKPA 1JWMA 2DM7A 1F3JB 4KROC 1AD0A 1DQQB 2F74B 4KK5C 1DJSA 3CGTA 1R3JB 4UNVA 4TYUA 5GXBB 3K1KC 5IB4A 3U7YH 2BY2A 4C54A 1OVZA 3D87B 4LPTA 4MD5B 2XT1B 3ZKMD 4FZEH 5KSBB 3QA3A 3AY4C 4OGAD 4S2SA 3WL9B 5GIRA 5I2IA 3MROA 3W11C 1DQDH 2NNAB 4LLVB 4PJ9C 3SGKA 4RA0C 4BA8A 4KK9D 3D69A 5SX5H 2G2RA 3NZHH 4G8FB 3VXMB 1J0ZA 3B2UC 3QUXB 5GHWH 1RHHA 5ITBL 5I73C 5F1NB 1AGBB 2BFVL 2ESVB 4OLYL 4UT7H 4Y4KD 3DLQR 3X11A 1GAFH 4OM0L 5C6WH 3ROLA 3RAJL 4LQFL 2OJZL 3QHZH 1F4YL 2Z31A 3CX5K 2VABB 1DL7L 4LHUB 4HBCH 3KYOB 3QP3A 2FBOJ 5CGYD 3IU4H 4XCNB 5TF1H 4LCCA 4XC1L 3T65B 4MX7A 2HFGL 3BHBA 4HXAL 2LU4A 4WTZA 1WJ3A 4CL7A 1JNNH 4NUJB 4GMTH 2IPKA 3HFMH 2VLLA 5IGXH 4WFHD 4L8SC 3GNMH 5BQ7A 3ZSTA 1NAMA 2FJGA 1C1EL 3DVNB 5JLZB 4YHLH 5HXMA 2JB6B 4YXKH 1N3NB 2HVJA 2P42B 1GOHA 3L3OB 5JQ6L 4YHNB 5EWIL 1W72H 1JGLL 3SQOH 4CRPA 3BPOB 3WDIA 5F88B 1U3JA 4MJ5A 5D7JD 3VG0L 4BFGA 3WIFB 4FQQB 3TPUB 5DWUL 2Y06L 3MQIA 2DQDL 1LILA 1XGYH 4JHAL 2NR6D 5F9DC 1KFAH 5IQ7L 4RISH 3G04B 4PJGF 4XP1L 1A7QH 5L2JB 3ARFC 4HUXA 5C08D 2YD5A 3H7BA 3MRJB 4Z7QF 3D2UA 4MNGA 4FQJL 1KJMB 2GJ6B 4WO4C 2VLKD 3G08A 4FN0A 4OUUB 4PJAB 5JHDE 2EYTB 4OD1H 1MCOH 1GZQB 1AD9B 5JQHC 1MRDL 4XX1E 1CU4L 2E9WA 3IFNL 1B0WA 1LK2A 4B7IA 1F2QA 4WFEE 3JV6A 3MV9E 3TBYB 5GGRB 5D1ZD 4WIQA 4OV5B 1YQVL 2DQEL 3BGFB 3PDGA 1VGKA 5EIIA 2Q86A 3QDJE 4ZYKA 2VITB 3DX8A 1EHXA 1E4XL 1QOKA 1RUQH 2J8UA 4UNTA 5JDSA 3OF6A 2VXUH 4Z8FH 1IEAA 4NZJA 2R0KL 5FA4B 2OI9C 3QDMA 1NFDB 1BFTA 2DQTH 2HG5B 4BH7B 5J1SC 2ED8A 4LSVL 3SDAA 4UAOB 4HT1L 5EZJA 3P4NA 2CGRL 4M6MH 3V4UH 4HWNA 3VRJA 5DRXA 2FO4B 2X4TA 3CVHB 1D9KD 1RJZB 3KNBA 3DIFB 1IKNA 3OKDA 2XN9B 1ZA6B 4PJDB 2CR3A 4LCYB 1R3KA 4R8WL 3U83A 2ERJB 1EO8L 5FUCE 4L9LB 2ZUUA 5DHVA 4ODUB 4R4FH 5ALCL 3RY5A 4LSSL 2IWGA 1IQWL 4P5TA 3L3GA 3MGTA 3PHOA 4ZUTA 3IETB 3U7WL 5CBAA 3PGFH 3QQNA 1J11A 1RUMH 3BT2L 5DJ2B 4BFBD 4NRXB 3B9DA 2P49B 2XRAH 3MCKB 4CVXA 4YGVB 1A1OA 5E1AB 5KG9B 4Y0GA 3O2DL 3CPLB 1KB5L 1YZZA 1CLYH 3GI8L 5E99L 1AXTH 4JO1H 2IH3B 5H94A 1S78D 1JNJA 3DX7B 2GJJA 4GQ9L 2C26A 1REIA 4BQ9A 4XPBL 4LSPL 1EXUA 3RWJB 3QIWD 3MRFB 5KTEH 1J1PL 5HYSB 5IMMB 3LS4H 1OP3H 4OZHE 3WFCL 5IJKA 1PBYA 4HJGB 4K2UL 4NHUB 3NACH 4Y5VC 3ZL4H 1XR9B 4ZUVA 4OCLC 4YFLF 4UIKL 4JG1H 1SYSB 2GI7A 2ADJA 5GZND 3VE0B 1YJDL 3P4MA 4Q74A 4GLRH 2F58L 2FNBA 4D9RE 3ZMRA 3QJHB 4JRXD 3EYQC 1DFBL 2IANE 1GGYA 2FHFA 3VFRB 2ARJQ 3P73B 3HZKA 1LO4L 5DMGC 3SPVB 3U2SB 3CK0H 4YFLI 3DI2B 4NQVA 4OCWH 3U30B 5KOVC 4NSKB 3LB6D 4DN3L 4HLJA 1DEEB 3SKMA 1KCSL 1M1SA 1XF4A 2YEZB 4LLDB 2CKBH 3S9DB 2OZ4A 1FFNA 2JELL 1IJ9A 3NAAH 4PJXA 5I1LB 1N4XH 2VQ1B 5EA0H 3MODL 4P9HC 1B3JA 4XAKD 3G5ZB 5TPWH 2VB5A 5I19L 3QEUB 1QBML 2BXZA 5DSCA 3ZTNL 5EC2B 4MLIA 4QRPB 3LQAH 4LSQL 3FQTB 2QQQA 3CFDB 4XHQA 2AK4E 2MMXA 1EZVY 1FNGB 3E0GA 4U7SA 4RGOH 1C16A 1FFOA 1XH3B 3I9GH 3WD5H 3FOMA 2XTLA 4TTGA 4N90E 1JGEB 2MQCA 1HQRB 3VFMA 2HRLA 2VL5A 5F89B 1U8IB 4NWTH 4XPHL 4JGJA 3QNZA 1UACL 3HRPA 1QEWB 1G9ML 4LK4A 5F9AC 4LSTL 1OSZA 2X89D 5KANG 5IBUG 5CD5D 2XWTB 4Y5YB 3BKCL 4PY7B 4JRYE 2IF7A 3EDKA 2B39A 3N1GC 3L7FB 4KZEL 2GCYA 4JO2H 3FL7A 4PJBB 3UTPE 5IT2L 5MEPA 2RCSH 3ULSB 5EO1A 4XNUL 4FZ8L 4LDOB 4LEOB 4R4BB 3JTSA 4U1IB 4WHYG 5KVGL 2Y07L 3B6SA 1BBJA 4Y19A 4YFEA 3DYPA 5IMLA 4G9FB 4WW1B 4PRHD 3MBEB 3MRHA 1G7IA 3M8OL 4GBXD 3KHOA 1EJ6A 3ALPA 4Z0XB 4U2YA 3MXVH 5EOTA 4QTHA 2FHCA 3CFBA 4S10A 2AV7A 2KZWA 5LBSL 1IKNC 4PJIA 1LE9A 4F8TA 4OCNC 5I1DA 1BBDH 2YRLA 5M7QA 2IFFH 4XWOC 4PJHF 4WWKC 5H37H 2FX9H 3CXDH 5DJ6B 3RWCA 3MRPA 1I3RA 1E4XI 2VDOH 4EI5D 1P84K 1OGTA 1CGXA 3U0TB 5EU3A 1CR9H 1NMCB 2P24B 3ZKND 4P2OA 3S36L 3V52H 3O4OC 2O61A 3D0VA 1T1XA 1IGCL 4PJCE 1KIPA 3EOYG 3O6FD 2R0LH 1RZ8A 1FCCA 1S9XA 3EO1B 4X83A 2NW2B 1IM3B 1IEBB 4F15B 3LN5A 3B3IA 3UZVB 4AIXA 5HYJB 4CVZB 1UG9A 4TSBL 3GHEL 2KDGA 3EW3B 3NN8A 4HWEH 1V7NH 3B9AA 4Z77B 3OXRB 5IJKC 1HILB 4HKZB 1LWRA 1IGYB 4NQSB 1QQDB 1J8HA 1K4DA 4KQ4H 4HS6A 5FUZL 2VXQH 1KLGA 4Y5XA 4GW4B 1P9MC 3FT4B 1VADB 3LSOB 4P59L 2QTEA 1RI8A 2E9BA 1JCKA 1S7SB 1CDGA 3NCEB 4DN4H 4UZGA 3OR6B 4LIQE 3BUYA 3BKYH 3KVQA 4HS8H 5CJXC 4G6KH 1H3WM 3MNZB 1RK0A 5CCKL 1BWWA 5C08A 3DTXB 3LMJH 5T1LA 5IFAL 2NY5H 1JV5B 5CKGA 4D0BA 2GIYA 3C60D 5IR1B 2HT4C 1DVFD 4GAGH 4O2CA 4G42B 4M7KH 3STLA 1G6RH 4X6FA 2N7BA 3F7VB 4Y2DA 2FZ3B 5EZLA 5FYLH 3HAEB 1JJUA 4GG8A 1RFDH 5EU5A 3OL2A 2WV3A 3SJVA 4IHOB 5D1QB 2YMXH 4HFUH 3OKEA 3FO2B 5DEZA 4Q0XL 2QV2A 4XHJD 3HR6A 2EE6A 3TLRA 4G8GA 2IAMB 1T21B 4PUBL 5F72S 2FB4L 3WKML 3OKLA 3WNLA 1HI6A 2UWEF 4YHKL 3TF7C 4LL9A 4E42A 4JPKH 3V5KB 4BZ2H 1EK3A 2VDPH 3PP4H 5HHME 4XH2A 5BZWA 5EO9A 1A6WH 1FO0H 4ISVB 1RIVL 3EO0B 1U8JA 3MUY1 1ORSA 2VDQH 4O2FA 1VFOA 1TETH 5IB1B 1H3VA 1NCTA 5E8DL 2CUIA 3VH8B 4JLRB 1GOGA 1QFUL 3WN5B 2WQ8A 5LAXB 3QZWB 1D5IL 4HCRH 4HX1A 4M5ZH 4PP2B 1FAIH 1G7HA 4MA1B 1R0AL 1UVQA 5E6IC 4YH6A 5B3JF 3GJFK 3SE8L 2FGWL 1SY6L 3P11H 4JANA 1N0XL 4QHMA 1LP9E 5BS0A 1CIDA 4Z95H 4MD4B 2XIDA 3A0OA 2ADFL 2W65A 5EUKB 3PQYA 1V3LA 2OXGA 3IDYC 4L9DA 4UTBH 1XF5A 4MMXC 5HGAB 3VXRA 4NM8L 5C09B 4OGAC 1GOFA 1KIRB 2OK0H 3QIWA 4BSJA 1X5ZA 1LVEA 4F7TB 2P5EE 4KK9C 4DEPC 3LD8C 5ICYA 3REWB 4NP4H 1KJ2H 1NQBA 4ETQB 4X5XA 1CZ8H 4RIRA 5I76B 4Y4KC 32C2B 3TT3L 2A83B 2DMBA 4PJ5B 2KL6A 5BXFA 4MAUH 3BEVB 4X6DE 3QQ4A 3V4PL 3ULUH 2O5XL 1MLBA 1A7NH 3DMMA 4QYOB 1JTTA 5CGYC 5FAAA 4H25A 2BVQB 3MA7A 1RZKL 5IKCB 1QSEA 1INQA 3IDUA 3I6GA 1BX2A 4YFDB 4TNVK 2ZZUT 3CFEA 4JFPB 3CX2A 4FMKA 2X4SA 1PQZB 1TVBB 4HW6A 4JKKA 5GS2H 5K9OB 3QCUL 1BD2A 1MIMH 2OTUB 4KUZL 1KF9B 4O4YH 1IC5L 1ZWIA 4HK3J 3K2MC 2OSLB 3G6DH 4Z0BH 3TFKD 1G1CA 2F54D 1NLDL 4RWHA 2YUZA 5B4MD 1P7QD 3HPJB 1WICA 5EB9A 5JR1H 1OQXA 3S88L 4K9EL 3V7MA 1FLTX 1YUHB 5HHPA 1P5UA 4MNHA 5D7JC 1N8ZA 3NH7L 2JK5B 2W1NA 1ZKAA 4FMFA 2IC2A 2NR6C 3RNQB 3TA3A 3EYUL 1JPTL 3LKRB 4DKAA 1OL0A 1A6ZA 3UAJC 3VXPA 1M4KA 1T2QL 4XAWL 1JPFB 3HI6H 4U6HB 1E27B 1LO2H 1VPOH 1CD9B 2Q8AH 3TVMD 2X44D 2PR4L 5ID1B 2DKMA 4LNRA 5CILL 1NCAL 5TQ0H 1P84J 4OM1H 4Y7MA 3UMTA 1MVFA 1AO7D 2E6JA 5D1ZC 4JFDD 1YY8A 5FXCH 5JIHA 5MENE 2DYPD 4NQXA 4UMGA 4A2LA 2RJMA 2FD6H 3NPZB 4HIJB 3I6LE 5I71B 2A77H 1NKRA 1KPUA 5BZDB 4I0PB 3VFUB 1Q38A 4UUJA 1MEXH 4QT5A 3VGFA 3V6OE 1ZANL 2EDYA 5K9QI 4YXLH 5C0JB 4U3HA 3C09B 1JPST 5HYQB 2K9UA 1H3XA 3GFUA 3LZFL 1J8KA 2MJWA 1JYNA 1GHFL 4TVPE 1D9KC 1AR1D 5DO2D 4MA3B 5AAMA 1F4XL 1IAIL 1TJHH 5GRUL 1MUJA 3GKWH 4NM4H 5IVOA 3VI4F 4D9LH 4JFED 5DZOA 2CIKB 3WO4C 1Z0NA 3C6LD 1L0YA 3DV4A 4OZIE 1A1MB 5CEZD 4TSAL 4ZG1A 4PRDB 5C0GA 1P7KB 4I13B 3F12A 3UTTA 3HCVA 4APQA 5DK3A 4AG4H 3MACL 3MV8B 3B8YA 3S36X 3FQWB 3AS3A 3ARUA 4MJ2A 1TCRB 5DLMH 2Q6WB 1OQOA 4XWGH 3QG6B 1E6OH 1S78C 4JO4L 1YN7B 2EDLA 3IDJB 3W81A 3D18A 3HA0A 1DSFH 1FYHB 4DQOL 4Y1AD 5GRZA 2EDRA 3TN0D 3QIWC 1U8NB 1CBVH 3MV9B 1AGFB 1KIQA 1CTNA 5SWZA 5ECJE 3ZHLA 2CUHA 3Q5TA 2XZQL 3O8XB 3I50H 2AABL 2R4SL 1FNEA 3LEVH 4PB9L 4PRNA 5FO7A 1S9YA 3EDDA 3QJFB 2AXGA 3SKNA 3QDJB 1OSPH 1GPOL 2YZ8A 5CEYA 5F21B 4OAWA 5D71H 2HA1A 4MLSA 5GZNC 1FO0A 4QRTA 2WK2A 4OF0A 4QRUB 1J05A 3OKNB 1CXKA 3VD5A 3V0WH 3V5DB 1HWHB 2DWEA 4JM4H 3L6FA 2VWEC 5E8EB 5CLTA 5EU6B 5EN2A 1IQDB 2NY4D 1Q1JL 4P4KD 3DSNA 4IRSB 2BVYA 5I8OL 3QCTL 1QYGL 5HHOD 2B2XH 4WI7A 1P1ZA 1T89A 4M93C 3S34L 2YC1A 2C5DC 1FC1A 5I1HH 3ZE2E 4K7PL 4FQPA 3S3JA 4PP1D 3MLWL 1IGFL 4YHOL 1NL0L 5DGQA 2HN7A 3H9SD 1IGTA 1DE4A 2C1PB 1BREA 2ZG1A 1JZ8A 2JCCE 2HLFD 4L3CA 1ZLUH 5DR5L 3GK8L 5IW3A 4X6CA 2W60A 1OGAA 1F3DJ 4OLUH 4WEMB 4HK3N 1PY9A 2JJVA 2LU7A 1KT2A 3OJDB 4ORGB 4KRPD 5JIKA 1RZIA 4OFKA 4V1DE 1KJ2A 3OB8A 3D39A 4I3SH 4X4ZA 4ZOCA 2B20A 5CD5C 4GW5B 1FNSH 1KUMA 4JZJB 2XACC 1S5IH 5DF0A 3IU3B 3K2UH 4X9BA 4DZBB 4UTAH 1UQSB 3HE6D 2HFFA 4QRRE 5D7IF 4G5ZL 3LEXA 3CFKA 3P0GB 4W4NA 4PS4L 1JK8A 4CADA 2WBWB 5CHNB 2F53D 4TOYL 2WQRA 4JREB 5J6HB 1QRNB 1MCJA 1S7XB 4ONGH 1OAZL 4LCWA 4LRNL 3FO9B 3V2AR 1F6AB 2EIZA 4H8WC 1OTTD 3DSFL 1FDLH 4U6VH 2E27L 3DWTA 2ZCKH 3LH2L 4X4ME 4GBXC 3O41A 3R8QA 4JFZH 3V7AE 2C1OB 3BE1H 2VLJD 2X4UB 4XBPA 5LVEA 2MKWA 1KACB 5FHBH 3NCJH 3T0AA 3B9VA 5B38B 1F8TH 4J3TA 4I3RL 5F7DB 4RX4A 4HC1H 4UINL 4WW2F 1ZVSB 4JFYA 4LLYB 3F5WA 4WEUD 4FQXD 2LVEA 3UC0L 2XWBA 4D9QD 3SKOA 4PGDA 4PJHB 3MFFA 4EI5C 4N68A 5C9JB 4L4VD 1WC7A 2WUBL 3BESR 1XIWA 3GO1L 3MSPA 2DRUA 3ZKNC 2A74A 4JFFA 2CLRA 2PYEB 3N85L 3GUTA 2AGJH 2XPGA 1PSKL 2B1AL 3ARGB 1BGXH 4NWUH 3O6FC 1IAII 4L4TE 4KHTH 4U49A 3L7EB 5C7XL 1NCCH 35C8H 3BEWB 5LGHH 1NGYB 1Z9SA 4JRYB 4UQ2A 4XNQA 1NC2B 1G9NH 1IC7L 3D9AL 4JJ5B 4I18A 6FABL 2YHGA 3MLYH 2R39A 2HWZL 1WT5A 2BHYA 5GGTH 1KB5B 4JPWL 3VXMD 3HI1B 3QUXD 4LRIA 4XT1C 1KLUB 3HPLB 3P3YA 3HKFA 5IEKA 1P7QA 5SWSA 1G0DA 1ZSDB 1P5VA 3GMLB 2R8SH 2ESVD 1BZ7A 3U82B 1E4KA 5J12C 3MXWL 5BO1L 2XNAA 4LHUG 4ZUWB 4K8RL 4LHUD 1WAAE 4YBLB 4DOHE 3QO0B 2ITDB 1CE6A 5F7NC 1HCFX 1XF3B 4POUB 4UU9A 5J11C 4HMEA 4MA7H 3SKJH 1MF2L 3RUGA 5IOPB 3QXDA 4EI6A 2X4OA 5CJ5A 4I2XB 3GSRA 3HUJA 2OP4H 5DZLA 3VXOB 3TVMA 3OHXB 1DVFC 3D5OF 1XGTB 3LRSA 3TJHD 5CJQL 2Q8BL 1T89C 1TTGA 4Z7VA 1FV1A 5C2BH 5CIPA 3OG4B 4N0UA 4HV8A 2Q7YB 3MOBH 3WKNA 2VDMH 2CLVA 5C6TH 4ZTPL 4YGAB 2QSQA 1BF8A 1A3RH 1ZK9A 4JFDA 3NCCB 4L1HA 3SGJA 1OW0A 4TPRH 3TPKA 4GUPB 5BVJB 4R96B 4KVCH 1A02N 4XHJC 4GAYB 5E4EB 2W0LA 1N59B 3MLSH 3RDTB 2HRPL 3E6FB 2FWOA 4FQ2H 3GBLA 2GITA 1JHTB 5J13C 1RULL 1Z9LA 1ZS8A 4HJJL 5HPMA 1BVKA 3TYGH 3KS0H 3C8KB 4KVNH 2Q7NA 2IEPA 3PHSA 1N64H 2UWEB 3QNXB 1WZKA 2R2HA 4XXDA 4S1DD 2CQVA 3T2PA 5FCUH 3FN9A 1L6XA 3HZVB 2GTWA 3GMPB 5FO8B 3NA9L 5FDYA 3H0TB 5F7EH 2R9HD 4XPFH 1FFPB 1Q9KA 3WHXB 3HE7B 43CAA 4HPOH 1F00I 1I3GL 3MOAL 4J6RH 1CFQA 4CMHC 4KTEH 1HZHL 5ANMA 4D0DB 5T1KA 3BZEA 4JQVA 5T1DL 3AAZB 1L9MA 3HR5B 2B5IB 1UA6L 2V2WB 5KW9H 4A2MA 3FQXB 1LDPH 2BSTB 4LGSB 1A3LH 1MCNA 4PTTA 1Q9WB 5CZXD 1WVZA 3FO0H 2DIAA 1MFDH 3ZLQC 3DROB 3UTSA 3X12A 4H5SB 5F9OH 1U2HA 3DI3B 1KTLA 2HFEB 3LCYA 4OKVA 3PIQB 5KJRH 3WMSA 3CH8A 3ARBB 1P4BL 4RNRB 4S1RL 3RI5K 2XICA 3TN0A 4DW2H 2QQLL 1DBAH 3C5SA 1GGIL 1G7MB 5FGRA 3STZA 2VYRE 5ESAA 3L3IA 1FORL 2R29H 1NEZA 2Z92B 2PUQT 1TPXC 1A9BA 1HHGB 5T3ZH 3B2VL 3CSBA 3VDBA 2JF1A 1H0DB 3MLVH 5HHMB 5C07A 1YEGH 1K3ZA 4YDJB 4UQ3B 3QXAA 4ODXA 1JGDB 3IYLW 4XRCB 2I24N 1EPFA 1T0MB 3BZFA 3M07A 3KPOA 4U0QB 3GSWA 4N9GA 2X6MA 1UC6A 3C2AH 3MFGB 1KTKE 5TDPA 3KPLA 1HIML 3MGAA 3ME0A 4ELKA 5DFTA 5HYSG 5KVFL 3U1SH 2J12B 1JNLH 5FYKE 5GS0L 1TNMA 4MNGE 3LKNB 1FJ1A 5GGSA 5DQDH 4R6UA 5IW1A 1DBJH 3TFKC 5B4MC 3WUWA 4MXVE 1QVOA 1ODAA 4OCXH 4ZXBA 3H9SA 5IWLC 3ARQA 1E4KC 1NMAL 4JDTH 1IC1A 4R9HA 4XNMA 1MJ8L 3GSNH 1MHCA 4HKXB 2VQTA 1EGJL 5B39A 2OZ4L 5GS1B 3SGEH 5FYJE 4YUEH 1QO3A 1W8NA 3AFLA 5J89A 4EIZC 1P4IL 4FFZH 2J8UE 2ZWLT 1KG0A 5H35B 1LEKA 3ROOB 2BVPA 3QDME 3W9EB 4K7FB 5F7MC 3TVMC 4PTUB 1CI5A 4AIOA 3GM8A 3IGAB 3U7YL 1I7ZB 2VOTA 3EYVB 3HE6A 4FZEL 4YC2C 1CFVL 1F6LL 3MJ6A 3QWOB 1DQDL 4U33A 4YJZL 4OZFH 4DVRH 4X6BB 5SX5K 1F97A 3NZHL 3NCFB 1CT8A 4G8IB 2CSPA 4Z7OE 1H3TA 5FUOH 2BCKA 5GHWL 4U1JB 3AREB 4WI6A 5EPMB 4Z18A 1OP5H 4UT7L 5I8KH 5JXEA 1GAFL 1I1AA 3QH3B 3QHZL 3M1BB 3FB5B 2XI9A 4HBCL 4C83B 4MDIA 2ARJB 1FL5B 5ABDE 3IU4L 3P30H 2W0FB 2FJFB 1JWUB 5TF1L 1AR1C 5DO2C 4JM2A 4MMZC 4GMTL 3HFML 1FZKB 3QDGB 3GNML 3BIAX 3C6LC 4KXZI 2VZ1A 1M05A 2IH1A 1C5DA 2K3TA 3HC0B 4YHLL 4UDTB 1FG9C 4D8PB 2I9TA 4NPYB 1QG3A 3JWDH 4FRWA 1W72L 4OBRA 1MJJB 2ATKB 3SQOL 2IGFH 1MWAB 1FZMA 2VE6B 2LTQB 1KXVC 4G9FD 1I8KA 3WLBB 2VAJA 1AKJA 1F3JA 4WRLA 3FN0H 2VN7A 1R3JA 3WFHA 5E2JA 3S98A 1KFAL 4RISL 2VISB 5I75B 1A7QL 1FH5H 2EDJA 3GJFB 1V8HA 3TN0C 3MRLB 4HHAB 3WL9A 2P47B 5DQ9A 3X17A 3VG9B 2R2EB 2NNAA 3IDXH 4LLVA 3NIFE 1V7MH 1L9NA 4X7CC 4OD1L 1MCOL 3Q3GB 3SY0B 4IOIB 4PJXE 3HS0B 5F1NA 1AGBA 3UDWA 3NMEA 1JGVH 5DJYA 4QLRA 4IOFD 3WDJA 3D48R 2IPUK 3FFCA 3ZZ1A 3U9PH 4LLUA 4QEGA 4XCNA 5ERWB 1J10A 4R3SB 4MDJB 1NSNL 1RUPL 1F90H 1RUQL 4Z8FL 3RA7L 2VXUL 3I84A 2NZ9C 2NY4C 4BM7A 4NUJA 5F6HJ 4P4KC 3EYOB 4TUJB 4HSQA 2FRGP 1AHWB 2P4AB 2DQTL 5DRNB 1CXFA 3RIAK 3DVNA 4OZIB 2GTZB 1N3NA 3L3OA 4YHNA 3ARZA 2W38A 4NNYB 3WS6A 3TT1H 1HNFA 4PP1C 1S9VA 3AU1B 4ZXBC 3WIFA 4FQQA 3TPUA 3N1PC 5JXAH 4P5KB 4NCC2 1ZVHA 2HLFC 4WUUA 2R4RH 3PGFL 3G04A 2ICWJ 4BUHA 4NJAH 1RUML 4I0CC 3EJYD 3RWIB 2VXSH 4PLJD 4Y19E 3QEQB 4KRPC 5JORA 3MRBB 1A6VH 2GJ6A 4IDLA 1CLYL 1I7UA 4OUUA 4X5LA 3BO8A 2EYTA 5LCVH 2ZOKB 1KPRA 4X8JB 1AXTL 4JO1L 1IAMA 3I02A 1TNNA 2NTSP 3TH4T 4HWBH 3HAEG 3HE6C 5GGRA 5LGJA 4PJIE 5KTEL 3QUKA 5D1QD 2VDNH 5D7IB 4I77H 1OP3K 2AKRB 2J6EH 3ECBB 2Y1VA 4F9PC 3NACL 2IAMD 3ZL4L 2YOCA 3EOAA 5EC1B 5JHLH 1OTTC 3MREB 2VC2H 5DJXB 4JG1L 4ERSH 1FL3B 1CQKA 1I1RA 5FA4A 1NFDA 1JNHB 5DJ0B 4DZ8B 4AK1A 5E9DB 1EVTC 2R0WH 4JKPH 1MFAH 2WSKA 4K3DH 5JPNA 3ARRA 3QEHB 3CK0L 2E7LA 4Z7WA 4RSVA 4OCWL 3DIFA 3BUTA 3MBXH 5IMKB 5TDOB 2XN9A 1ZA6A 3VH8G 3MV01 1JZ4A 3OKKB 4WGVB 3OKMB 5D2NA 1IFHH 2Z35B 4GKSB 2CKBL 4WFHE 3NAAL 4FQXC 1N4XL 1VEPA 2FLRT 1DQTA 3DVGA 1RZJC 1UADC 2GT9B 5EA0L 5TPWL 3P9MB 3IETA 4UDUB 4NN7C 3S6CA 2JCCB 5I16B 3ARSA 2D7TH 1J8HE 3DGGB 3LQAL 5DJ2A 2AJSL 5E1AA 3SO3B 5D93B 3CPLA 3VDAA 5HGBA 5IUSA 4RGOL 4V1DB 5GRYA 3WD5L 3T0EB 5T33H 5D96B 4XMPH 5IK3B 5I66A 1FRGH 4ODTH 5C09D 3P4OA 3MGOA 3RWJA 4OZFA 2DF3A 5C08E 2X5PA 5HYSA 3PWNB 5IMMA 2XKNA 3QFDA 4K55A 2OYPA 2AXFA 4HJGA 3QUXC 4IJ3B 1LO3H 2F8XC 5EFIA 4YBQD 25C8H 4MCYA 1SYSA 1LEIA 1NKOA 1F6FB 5F7LB 4PJ5D 4JO2L 4XPAL 4IRJB 4AENB 3TV3H 3QJHA 1CICB 4P48A 3SJVE 2RCSL 3PUCA 3VFRA 1ZGLB 1PYWB 5JNYB 1HHIA 4Z5RB 1G0YR 4NSKA 1DDHB 4ETYA 3KPPA 2P45B 1LE5A 1TQCB 2ZNXA 4C59B 2YUWA 1T5WA 3GHBH 3MXVL 4LPYA 2VQ1A 2X70B 2HTKD 4UV4H 5L8JB 5DVMA 5F8RC 4HK0B 4EXKA 3JUYA 2CDFA 4HS3A 2VZSA 5H2BB 2CXGA 4QRPA 4NO0B 4ODVH 3MMEB 3BPOC 3RL2B 5L0QB 1BBDL 5HDBE 3KYMB 2IFFL 3CFDA 5INCB 3CXDL 4F3FA 5ACMA 1XH3A 4XNYH 4NQUA 3BGMA 4M6OH 1I8MA 3KDMA 2VDOL 4L4TB 4WHYH 1GYAA 1NDMB 4PRIB 2JJSC 1T6WA 1CR9L 2DLEA 1U8IA 5F89A 4ODBD 1ZLWK 3V52L 4UT6H 2VJXA 5BS0E 1QEWA 2JIXA 4S1DC 1D5MA 2NY3B 2R0LL 1C8PA 1WFOA 1UWGH 1TIUA 2XWTA 4Y5YA 1ZEAL 1TQBC 1HHHB