4YIFA

Crystal structure of rv0880
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
140
structure length
140
Chain Sequence
SDARLASDLSLAVMRLSRQLRFRNPSSPVSLSQLSALTTLANEGAMTPGALAIRERVRPPSMTRVIASLADMGFVDRAPHPIDGRQVLVSVSESGAELVKAARRARQEWLAERLATLNRSERDILRSAADLMLALVDESP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MarR family protein Rv0880
publication title Structure of the MarR family protein Rv0880 from Mycobacterium tuberculosis
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 49
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4yifA00
4LMYA 4NB5A 4UVCA 3HSEA 3HRSA 1Z91A 3ERED 1U2WA 3TDUC 2KJCA 1J9IA 1SFXA 4HX4A 1YS7A 5BOXA 1MDMA 1NHAA 4UNOA 3LFKA 3JAMZ 4AIKA 1D3YA 1S6LA 5AIPA 3PFIA 4LB6B 4IXAA 2XVCA 3H3ZA 4KIBA 1B4AA 1C0WA 2KKOA 1FOKA 2ZNYA 3HTUA 2Z33A 4TV7A 1HKSA 3QP6A 3T8RA 2H6BA 2VODA 4U7DA 4HYEA 4RGUA 3F8MA 5D8KB 2L01A 5BS6A 5K1YA 4YIFA 5HS8A 5H6QA 1HXDA 2CW0F 4F7ZA 3F8BA 5LRRA 1BI3A 1BN5A 3RI4A 1S29A 2P7VB 1USSA 3LWFA 5JVTA 3WTSC 2A07F 3TO7A 5FFZA 1U8RA 2MLGA 1R1UA 3D5LA 3FM5A 3GEZA 3OV8A 1REPC 2UZKA 1RZ4A 3RPQA 1QGPA 5D4SA 1E17A 2HWVA 1LVAA 1G3WA 1ZG3A 1FT9A 3J7AO 1AWCA 4HLXA 1IZ1A 3L09A 2W85A 4B09A 2FU4A 4BNCA 2HZTA 3E3VA 2QQAA 2UXXA 2YU3A 2Y0MA 4R8HA 4OIRF 3BJOA 3IHUA 3U1DA 1TLHB 1UCRA 5TJJA 1XD7A 4G7OF 2COMA 3FX3A 4L9NA 1KU3A 1G3YA 3BZ6A 4MEXF 1G6NA 3F8FA 3P7NA 4KIGA 3NRVA 2MLKA 4G7HF 2YX4A 4G9YA 2G7UA 2RDPA 3M9AA 3ZMSA 2BE5F 2A6HF 1CGPA 5JI6A 3WTYC 1TTYA 2MH9A 4PGHA 3LA3A 1EH7A 4ENJA 3EDPA 1T0FA 1QQIA 3JTGA 4RAYA 1MGTA 1TW3A 4PGGA 3KE2A 5F6FA 4HDUA 1BM9A 3SZTA 3E5QA 4IHTA 4L18B 5JHUA 1R5GA 4Q5SF 2KJBA 2O8XA 1LJ9A 4KMFA 3QPHA 1R23A 2D1VA 2V1XA 4ZZDA 2CFXA 3KP6A 4HF0A 2WC2A 2OQGA 2XRNA 3COAC 1FSHA 5CJ9A 2K86A 4EJOA 3BJ6A 3GXOA 2HEOA 2K4JA 4UVBA 5HOOA 2W24A 2XGXA 2IVMA 3F8CA 1KQ8A 1O7FA 2FA5A 4JQFA 5BPIA 4KA4A 5LGNA 3L2CA 1FP2A 2YX7A 3WTVC 2PLYA 1YS6A 1ONVA 2BBYA 4O3MA 4IJAA 2EFNA 5CLSA 4A6EA 3QRFF 4XLNF 2LSOA 1BIAA 3J80K 3I58A 2GQQA 1BBYA 4OOIA 1RUNA 4L0YB 1HKQA 5L3EA 3K1MA 2M5WA 4O5VA 1K79A 1KQ9A 4I02A 5IT9Z 1FBUA 5H6RA 3KFWX 1XSXA 4I09A 1QO0D 5L3FA 5E8GA 2EFWA 4WX9A 2R7FA 1BI2A 3I53A 1ZREA 1DUXC 1K7AA 3HSFA 5FGMA 3MZYA 4RGXA 4WXHA 4ZYDA 2JPBA 3K1NA 4Y17A 5LGUA 2DK5A 2IW5A 4PDKA 2LF8A 2GWRA 3GZ5A 4LFUA 4EJTA 3J81Z 4ZZLA 4KNYA 4EJVA 2IT0A 1J59A 5D5VB 2NYXA 2ZMEB 3L00A 2FBIA 5CYVA 3E6DA 1CF7B 3F6VA 4I7HA 3V8LA 1TW2A 1BI1A 1U78A 2M8EA 2ZXJA 4FT8A 2V79A 3EQLF 4M6YA 4A5MA 2OAZA 2A3SA 3F23A 2P7CB 4OMYA 2IA0A 4GGGA 5K5OA 5E1XA 2HKXA 3N4MA 2PMHA 1HSTA 4BAYA 1ZG5A 2L54A 2J5PA 2CWEA 3IKTA 4OIOF 1MD0A 5LGTA 4AVPA 1LQ1A 2PBIA 1ZRDA 4ESBA 2PQ8A 3P9IA 1T39A 4BH9A 2FMYA 4ESFA 1PP7U 2QM3A 3WGIA 4OIPF 2ISZA 1IRGA 4IRIA 4EV0A 1IXSB 1R5HA 4MGRA 3F8NA 1FBQA 4XSZF 1Z1DA 3V7SA 3AAFA 3HRMA 5E8IA 1J5YA 3V4GA 1SMYF 1XCVA 4P9FA 1IN7A 3Q9SA 2D45A 1UB9A 3MEXA 2RGVA 2NAZA 1UHMA 3GFMA 1XSVA 1P92A 3BDDA 1J0RA 1LEAA 1HQCA 1FWZA 3GZ6A 2FNAA 4LK0F 1E2XA 4RGRA 2FE3A 4RB3C 1T98A 2EFQA 3KP3A 5J8CA 2BGCA 5HLGA 2XUBA 4XSXF 2BEOA 5HS7A 4LLLA 1YLFA 5D5XB 1FZPB 3O3KA 2QBYA 3U9GA 1OYWA 3WU0A 1QBJA 1PUEE 3LAJA 2DO7A 1XCBA 3K9TA 4EJUA 2FXAA 4A2UA 1U5TC 3CTAA 4CDGA 4S05A 3CO6C 1U5TA 2E1CA 1IN6A 3RKXA 2R3SA 1GVJA 3H3UA 4CXFA 2VBYA 5F1RA 2O6GE 2XAGA 5CVUA 2M30A 2RKHA 2EB7A 3T8TA 2CO5A 3E6CC 3M8FA 5CVRA 2ELHA 4KUMA 3E6MA 2ZCWA 3ELKA 2CGPA 4EQQA 2FNPA 5DDGA 2NS0A 1B9NA 2JPCA 1FP1D 4A0XA 5L3BA 1SD4A 1Z9CA 2EK5A 1R1TA 1BC7C 1D8JA 5DCFA 1O3RA 2P6TA 2CG4A 2Z99A 1R58A 2PI0A 5DUKA 4GXOA 3C1DA 3L7WA 1BI0A 2IP2A 1ZGAA 3RTRA 1XSDA 3BY6A 2O3FA 1W7PA 3HHGA 2XV4S 4L9VA 1JHFA 2QZ8A 2Q0OA 4CGZA 4A5NA 3CJNA 1T2KA 3HIFA 2MC3A 2HDCA 3MFKA 4CO8A 3DF8A 2G9WA 2K7LA 1FYMA 4O6JA 3VODA 1YFHA 3WODF 4LG0B 4GCVA 1HBXG 1TNTA 2XKOA 3B02A 5L3DA 5ILSA 2L4MA 4ZYHA 2HR3A 4I01A 2HYFA 1ON1A 4K2EA 2FF4A 2IA2A 1YW8A 2XAHA 4WXDA 4KMUX 1KQ0A 2Y75A 3G3ZA 2JTVA 1S7AA 5DCMA 5A2QK 4BYYA 4CYDA 4A6DA 2E1NA 5IT3A 2D1HA 2LKPA 3ULQB 4M9XA 3BJAA 3ZN1A 1P4WA 2ZO4A 2IA1A 2O0YA 1WSUA 1ZRCA 3HSRA 2E7XA 2DQLA 3GF2A 4GO1A 1G4DA 2EA2A 3HOTA 3ZN0A 4ZH4F 1BOAA 4ASNA 2QLZA 2O61A 2DI3A 1JXSA 1WI9A 4ETSA 1FLIA 2DK8A 3E97A 2A5YB 4U0VA 1TQMA 2VXZA 5LHHA 3FMQA 1K78A 4M9SA 2MH2A 1F4KA 2KRFA 4EM2A 4G94A 1EV7A 1U6GA 2F5DA 1IW7F 5DD4A 1V3FA 4HW0A 1MJAA 3B73A 4KICA 3GWZA 2PFBA 4R1HA 1DP7P 2DQRA 4HAMA 1SD5A 5LEJA 1IF1A 2VBWA 2FEZA 1J75A 4UV8A 5AIQA 3GFLA 3IKVA 1AOYA 5ICCA 4OINF 2FBKA 1FYLA 2DFIA 4E70A 1FNNA 3DKWA 1KA8A 4RS8A 3T5XA 3WGHA 4KIFA 4JBAA 3K0LA 3I4PA 1IUYA 2HGCA 3D0SA 5D4RA 5LEKA 1W5TA 2EV5A 3GFJA 4H0EA 2OA4A 3DP7A 5J6XA 4MQ9F 2HOEA 2L3DA 2AS5F 2DAOA 2VT2A 5LHGA 1ZARA 5EEGA 1SD6A 5FO5A 1LDDA 1LNWA 4EGZA 4YG2F 3FXQA 1HSJA 4RB0A 3ZQ7A 4MNUA 5KK1A 3EETA 2C6YA 1O3SA 3TDZC 3HRTA 3E5UA 4Y13A 3QOPA 2F5EA 3JSPA 4LB5A 3F21A 4FHTA 4LGWA 2RV8A 1RUOA 2DPUA 2OZUA 5ED4A 4P96A 3DEUA 3LQRA 2HQNA 1IN4A 4Q4ZF 4RB1A 2P5VA 3G73A 4WXCA 3F72A 3K1PA 1T6SA 1SD7A 2OQRA 4M6XA 2ADUA 2L4AA 3EYYA 5DYMA 3QU3A 3LA7A 4HLYA 4IHSA 1P2FA 1YO5C 3BPXA 3DQVC 2NNYA 1IXCA 1Z6RA 4CICA 2ISYA 2KIMA 2O03A 3WTWC 4EVIA 5K5RA 1FX7A 4WCGA 2PG4A 5JR3A 3FWEA 1H9GA 4YFNF 4NQWA 2DPDA 2GA2A 3DPLC 3MAJA 1V4RA 3C18A 3BPVA 1K6OA 4HF1A 1ZYRF 5AONA 4ENKA 3ZMVA 2X0LA 2Y48A 2HFHA 2G7HA 3RKWA 3C7JA 1ULYA 4HZFA 4M74A 1MKMA 2R7DA 2VN2A 1RIOH 4CHUA 1JHHA 2QWWA 2Q8KA 3JSOA 3R61A 2ZNZA 1B59A 3ABUA 1WRJA 1ZN2A 2QQ9A 4MTEA 3GW2A 1KU9A 1T38A 1RNLA 4N9HA 2F5CA 4HOBA 2LF7A 2FBHA 2P8TA 5K5QA 4BHBA 1FY7A 2GIVA 4DNCA 2H6CA 3R6SA 2OZ6A 5F64A 5KVRA 5HLHA 4UXNA 5CVVA 3RIRA 3GVAA 2JT1A 2EA4A 5HLIA 1I5ZA 2LNBA 3H92A 3P9CA 1TQIA 3QPTA 4MTDA 4YIIA 4KYWA 3I54A 2P4WA 3ZPLA 1R1VA 1DDNA 2K4BA 2OU2A 1BC8C 2FOKA 4OU0A 1GXPA 2K02A 4QLCU 1U5TB 3FXRA 4LLGF 4D0PA 4HQMA 1EH8A 5DD8A 1R36A 3GUDA 1ZRFA 3R0AA 5H20A 1IAWA 4S04A 2ETHA 5FB2A 4IRHA 2HTJA 6PAXA 4IPAA 2CSOA 2VONA 3J80Z 4ESJA 2OD5A 3F6OA 3TGNA 2STTA 2PN6A 3LQQA 1F9NA 3JAMK 1W5SA 1IRFA 4IF4A 1YG2A 1LDKB 3FZVA 3GYHX 2V6CA 1OYYA 3S2WA 3R60A 3V7RA 4A0YA 5BMZA 1SAXA 2QQBA 4L9JA 3VEPA 4BHCA 3CLOA 1VTNC 1D5VA 1I1SA 2Q2EA 3IRRA 3FF5A 2E7WA 1MJBA 1TBXA 1Z05A 1I6XA 3TOAA 5L3CA 1MDMB 4KT5C 3LA2A 4A12A 3I64A 3BROA 4LK1F 2NNNA 2Z3YA 2ZMEA 2XAFA 3DXJF 3ROUA 4U7BA 5FD6A 1HW5A 4PZJA 3HUGA 1SMTA 2ZJ2A 4HA8A 1D8KA 1HW1A 3I5UA 4Q48A 3KLNA 1ZLKA 1UHWA 1KU2A 2WTEA 5JFRA 2CYYA 2V1DA 5EEHA 3CUQC 3WTTC 5ICGA 1S7OA 4RAZA 3CUQA 3EUHA 1TQPA 3W6JB 4DQ2A 1ZHFA 3MQ0A 3R4KA 3NEUA 2M1BA 3FM3A 4P9UA 5CVJA 3TKYA 1GXQA 1YW9A 1H0MA 1ZG1A 4L0ZB 5ERIA 3TQNA 2RN7A 2ZFWA 3KP4A 1BIBA 1Z6TA 2HKOA 3MZHA 2FMLA 5HDGA 4R79A 1LDJA 4LJZF 1ZGJA 1F5TA 1QPMA 2QYOA 4HX7A 3I0TA 4U0WA 3FXUA 2WWYA 2HTSA 3KP2A 2IJLA 5HVQC 2ESHA 4EM0B 3QAHA 1XGSA 1F1ZA 1FC3A 4KN4X 4P55A 3TO6A 3MWMA 1TNSA 5HDKA 1O57A 4BHPA 5ILVA 4HX8A 4OIQF 1W7PD 3CO7C 2VT3A 2A69F 4XBFA 3MCZA 5DEQA 3TO9A 4L5IA 4HBLA 2H94A 3K2ZA 3DFGA 5D8LB 3F3XA 3WE2A 3SHFA 2H09A 2CQKA 3L9FA 4UHTA 2JRTA 3P9KA 4MQVA 3REOA 4M72A 3I59A 2QENA 2BYVE 4I98B 3GO5A 5E18F 1P4XA 1SFUA 1FYKA 2KIUA 3V7CA 4WWCA 4EJWA 2W25A 4WK8F 4Q47A 3HRUA 2J5OA 1G3SA 1ODDA 3N97A 5LHIA 4KN7X 2HS5A 5IT9K 3GLXA 1QNTA 5ILUA 1OPCA 5LRSA 4JK1X 4IVNA 2NRAC 4ENNA 4HF2A 4Y15A 4UUVA 4AIHA 2P5LC 2P5KA 4MHGA 1I1GA 2XROA 3QP5A 5J8FA 1J2XA 2P6SA 1KGSA 4XRFA 2ACJA 2DBBA 3O6BB 3BP8A 2OBPA 4XLPF 2L02A 3HYIA 2YR2A 3BWGA 4UV9A 2DLLA 2XAJA 4I0BA 1SFEA 3KZZA 3CUOA 3J81K 1R7JA 3JTHA 4LD5A 2QVOA 3M1EA 1WKMA 3WTUC 5E1ZB 3DPTA 3NQOA 3RDIA 3QU6A 1OR7A 2VE9A 3KETA 1S3JA 2UXNA 1O7LA 5LLQA 4IRGA 2GAUA 3WU1B 3K69A 2XAQA 3C3WA 4NHJA 2ESNA 1FSEA 1XGNA 1X3UA 4LG0A 2RNJA 2A6EF 1RI7A 4G6QA 4FX4A 2K27A 3M8EA 4EM1A 5BPDA 3SXYA 1Q1HA 4FX0A 3BOQA 2MD5A 1J7KA 1MZBA 4HV5A 3IRQA 3HOSA 2WV0A 5DUIA 2W57A 4U0YA 3KEQA 3DV8A 4G7ZF 4BQAA 3FMSA 3EYIA 1YIOA 5HS9A 2H27A 1JGSA 1H9TA 1UFMA 1A04A 1ZLJA 2IPQX 3RYRA 4I2OA 5FFXA 5LBQA 5A2QZ 5FLXK 2EV0A 2PMUA 3Q9VA 4B8XA 2V9VA 4HQEA 5L3GA 3KCCA 1YTYA 5D6EA 3IWZA 5D5UB 1BJAA 1YW7A 5DV5A 2BV6A 2VOPA 3PQKA 3ZP5A 1LB2A 2EV6A 1XGOA 2W84A 4YFKF 3WTXC 2DU9A 1IXRC 1S8NA 2RC4A 1IN5A 3RPUA 4G6DA 4I0AA 2D2WA 1XDUA 2ZKZA 2GA1A 3Q5FA 2EJRA 4MEYF 2F2EA 4QWQA 2RVCA 3SZPA 1WWXA 1XMKA 3IWFA 1HKTA 3LAPA 4KFCA 1OKRA 2MBFA 1Y0UA 3T0YA 2JSCA 1XN7A 4M71A 1I27A 5E17F 2EWNA 3GFIA 3CDHA 2XKPA 2EFOA 4EMSA 1R22A 2B0LA 1KU7A 5E1WA 4YFXF 3VB2A 2QBYB 3SQNA 5BQTA 1WQ2A 3WGGA 1O3TA 1IN8A 3ISPA 3R0JA 2AXLA 1ZAOA 2IRFG 5E20A 1R00A 3KP5A 3O2PE 4G8XA 3VFZA 1DPRA 3PQJA 4L5JA 4A0ZA 4EGYA 4BXUA 2V1UA 3ZMUA 5CVIA 1B1BA 3VOEA 3KLOA 2VC0A 4CZZA 2DW4A 3CUQB 1XDSA 4PCQA 3ZMZA 2F5FA 2X4HA 1L0OC 3LSTA 4KDPA 1USTA 1XMAA 1PP8F 3FHZA 2XIGA 1ON2A 1YYVA 2A61A 2KIFA 3ABTA 4ON0A 1W4MA 2ZBKA 4AWXB 1P4AA 2FSWA 2EFPA 4ENMA 5ICFA 1G3TA 3ZMDA 1O3QA 1DPUA 2TDXA 2QUFA 5FLXZ 2PEXA 1QZZA 3GX4X 4GYIA 5FD5A 4Z2YA 1B6AA 2VBZA 3OOPA 5HDNA 4M9ZA 1HW2A 3IL2A 1QZYA 3V8KA 3JW4A 2VC1A 3IC7A 1B9MA 4LLNA 2FQ3A 2DTRA 1W7PB 1KYZA 3RJPA 3TOBA 1OMIA 3SFZA 1FPQA 2MA3A 4WF2A 3KZYA 2LDUA 3RKYA 3E6BA 2GXBA 1LEBA 1Z7UA 2FRHA 4RB2C 4P5OA 3ECHA 3KEOA 2STWA 4ZYEA 5D5WB 1CF7A 4AIJA 3ML6A 3U2RA 1PDNC 2VE8A 1KYWA 5TRDA 3I71A 3V8JA 3ZMTA 4AD9A 1P6RA 2YSRA 1XGMA 2Z9OA 2DT5A 5DCMB 3I59B 4M73A 2VOOA 2GZWA 2PJPA 1ZH5A 3F22A 1EH6A 2HYGD 3WTZA 1MJ9A 4HV6A 3ECOA 2UWMA 1OYIA 2RQPA 3E5XA 3FMRA 3HTSB 4RGSA 2XASA 2JZYA 1U3EM 3RYPA 1JE8A 5ICEA 5D6FA 4HDVA 2M87A 3WG9A 4GYGA 2Z5UA 4ZYGA 3KP7A 4UVAA 1L3LA 3W6KB 2A68F 1K78B 4N0BA 1STZA 2GXGA 3M7GA 2XHKA 3WE3A 1YQAA 2M45A 2HQRA 2YPRA 4U88A 3HHHA 1XB4A 3T1BA 4OMZA 4L9TA 4N9IA 2VBXA 1GHCA 1FBSA
chains in the Genus database with same CATH superfamily
2EZHA 4LMYA 5B3SH 3MKLA 4NB5A 5F27A 1ZR4A 4UVCA 4IEJA 1WH5A 3HSEA 2X9DA 2CRGA 3HRSA 2LLKA 1Z91A 5GTIC 3CESA 1WFXA 4PSWA 3ERED 2RREA 1U2WA 3OYKA 3TDUC 2Z1DA 2WY8Q 2QA4I 3VYUB 2KJCA 2E5ZA 1J9IA 1SFXA 4HX4A 1YS7A 5BOXA 1MDMA 1S5LC 1NHAA 2DMTA 1XTAA 3N05A 1Z77A 4UNOA 3LFKA 1U0JA 3JAMZ 2H8WA 4AIKA 3SEZA 1D3YA 3FXJA 5EGOA 4D1QA 1S6LA 3MN2A 5AIPA 3PFIA 4LB6B 2R93J 4IXAA 4RA2A 2XVCA 1LKXA 3H3ZA 4KIBA 3S8PA 1B4AA 4CCMA 2ZJPF 2ME0A 4CCJA 3FHNA 1C0WA 3VYTB 2KKOA 1FOKA 3K7AJ 4ZJZA 2ZNYA 3HTUA 2Z33A 2HDWA 1HKSA 4TV7A 1R71A 3QP6A 1OCZH 2BHZA 3T8RA 2H6BA 2E35A 2VODA 4U7DA 4HYEA 4RGUA 3F8MA 1Y0NA 1QRYA 3W2AA 1ZTRA 5D8KB 2L01A 5BS6A 5K1YA 4YIFA 5HS8A 5H6QA 3DTKA 1HXDA 3KYCB 2CW0F 4F7ZA 2ZC2A 1MNDA 3OSFA 1MBKA 3F8BA 5LRRA 1BI3A 1BN5A 3RI4A 1S29A 2P7VB 2N8GA 4W1UA 3WG7H 1USSA 4E7JA 1QPIA 3LWFA 5JVTA 4PJMA 3WTSC 2A07F 3TO7A 3BQZA 5FFZA 1U8RA 2MLGA 4Z6YA 2JA7J 1R1UA 2AQFA 3W2VA 3IV5A 3GTKJ 3D5LA 1IDZA 1A6QA 2QCOA 2IS6A 1S7EA 3FM5A 3GEZA 3OV8A 1REPC 2UZKA 1LE8A 1HDDC 3VPRA 1RZ4A 1BR1A 3RPQA 3AG1H 1QGPA 3LSKA 5D4SA 1E17A 2HWVA 3DBLB 2WBMA 4M3BA 5FRNA 1LVAA 1G3WA 1ZG3A 1FT9A 3HJEA 3J7AO 1AWCA 4HLXA 2IXSA 1IZ1A 3L09A 2W85A 4B09A 3OYIA 2CH0A 2FU4A 4XRSG 3PSFA 5IP9J 4Y4RA 4BNCA 2HZTA 3E3VA 2QQAA 1BJZA 2UXXA 2YU3A 2ZXHA 4BUPA 2Y0MA 3OWTA 4R8HA 4OIRF 3BJOA 3IHUA 3A0BC 2DFFA 1IRZA 3U1DA 4IOCF 2BVLA 2R5ZA 4B1RA 2R7UA 5GADJ 3Q0VA 1TLHB 1VQOI 1UCRA 5TJJA 1XD7A 3WHBA 2COMA 3DU6A 3QQAA 4G7OF 3FX3A 2ECCA 3ESWB 4MLOA 5FLMJ 3K2AA 4L9NA 1KU3A 1G3YA 3BZ6A 4E7ZA 3CCEI 1YHQI 4GDFA 4MEXF 1G6NA 3MVPA 4JX6A 5KNLA 3F8FA 3P7NA 2VQGA 4NQWB 3BR6A 4KIGA 5IYCJ 3NRVA 2MLKA 4G7HF 2YX4A 1UG2A 2K3PA 3ASNH 4G9YA 2G7UA 2V6EA 2RDPA 3M9AA 3ZMSA 3PFYA 1DP3A 1OCPA 2VL8A 3JRAA 2BE5F 2A6HF 2ELKA 5JI6A 2VJ4A 1CQTA 1CGPA 4C3JJ 1E3HA 5F0HA 3WTYC 1TTYA 4BBRJ 2MH9A 4PGHA 1WVRA 3LA3A 2E2HJ 1E3PA 1XC5A 2XGCA 3EPZA 4RMNA 3ZQQA 1EH7A 4ENJA 5TISC 5EZHA 2EH3A 1T0FA 3EDPA 1QQIA 1WGXA 3OIQA 3JRIA 2TCTA 3JTGA 4RAYA 1MGTA 1TW3A 2DDAA 3A01B 4PGGA 3M07A 1P7IA 3KE2A 5F6FA 4HDUA 1BM9A 3BG5A 3E5QA 3SZTA 2PMZA 4IHTA 1Q1VA 4L18B 4A3LJ 3AG4H 5JHUA 1R5GA 4A3BJ 4Q5SF 4B4CA 1QHHD 2KJBA 2DTZA 2Y0SA 2O8XA 4F52A 1LJ9A 5HNHA 4KMFA 2QSFX 3HC7A 3QPHA 3H0GJ 1R23A 2D1VA 2V1XA 3HGGA 4ZZDA 2VQHA 2CFXA 3BG7A 3KP6A 4HF0A 2WC2A 3BR1A 1MMSA 3LSMA 2EPFA 4N4OB 3ZR8X 2OQGA 2XRNA 3COAC 3OYBA 1JKRC 1FSHA 1OCOH 2HDDA 1ZKGA 5CJ9A 2K86A 2QF7A 4EJOA 3BJ6A 3GXOA 1XPXA 1FMWA 3GLLA 4CZCA 1GLNA 3L2WA 3LSHA 2E5NA 2HEOA 2K4JA 2QQ8A 2KZGA 4UVBA 2VQCA 1WJEA 2E1MB 3DBRB 5FROA 5HOOA 3CP2A 2W24A 2XGXA 3IAM2 4HRIA 2IVMA 3L2VA 4DBQA 2B9SA 3F8CA 1KQ8A 5JLXA 1O7FA 1LVKA 2FA5A 4JQFA 2GLOA 5BPIA 4KA4A 5LGNA 3L2CA 1FP2A 2YX7A 4AIDA 3WTVC 1YS6A 5CPRB 2PLYA 1ONVA 2BBYA 4O3MA 2ZJQF 4IJAA 4OAYA 5B66C 2EFNA 3VWBA 3G1LA 5CLSA 3KIOA 4A6EA 3QRFF 4XLNF 2LSOA 1BIAA 3J80K 2E19A 3JREA 3I58A 2GQQA 1BBYA 3FXKA 2YS9A 1ETXA 3FIWA 2CV0A 4OOIA 1Y6IA 4AU7A 4IKFA 3OIOA 1RUNA 3CDIA 4L0YB 1T95A 1HKQA 1BR2A 3RCOA 4B3AA 3M3YJ 5L3EA 1HCRA 3BQYA 2L7KA 3K1MA 2V1NA 3S1RJ 3OS2A 2M5WA 4O5VA 1K79A 3H3VK 1X3WB 2DA3A 1KQ9A 4I02A 2X6OA 5IT9Z 1ZELA 1FBUA 1OCCH 4ZDPA 3IUOA 1JKPC 5H6RA 3KFWX 3O8HA 1XSXA 4I09A 1QO0D 2HOAA 5IYBJ 5E8GA 5L3FA 1I3AA 4XL9A 2EFWA 4WX9A 2K9NA 2R7FA 1BI2A 2VJJA 4QPOA 3I53A 2V7FA 3RPUD 1ZREA 3ZQIA 5FKKA 1R9TJ 2L7ZA 1DUXC 1K7AA 3AG2H 3HSFA 5FGMA 3A2KA 2HPMA 3BTJA 3MZYA 2JMWA 4E7IA 3QOEA 1V5EA 3OIPA 3RKQA 4RGXA 2AO9A 4WXHA 4ZYDA 2W1OA 4NUBA 2JPBA 3K1NA 5EG0B 4Y17A 3ZQHA 5LGUA 2JVGA 4Y7NJ 2DK5A 2IW5A 3CF2A 1A5JA 2KQRA 3PJRA 4PDKA 2LF8A 2GWRA 2DDBA 2ICWG 2Q2EB 3GZ5A 4UUSB 3BR3A 4LFUA 2E2JJ 4EJTA 3J81Z 4ZZLA 4KNYA 3GCMA 2HXIA 3L2RA 3D1NI 4EJVA 1ETQA 1RETA 2DJNA 2D5VA 3BG6A 2IT0A 4MFDA 3F0CA 1J59A 5D5VB 2NYXA 2ZMEB 2XB5A 3L00A 5FKOA 2FBIA 2HI3A 1WHUA 2XC7A 5CYVA 3E6DA 4BXXJ 1CF7B 2JVHA 4BU2A 2QKLB 3HPHA 3QYFA 2IS4A 3F6VA 2OPTA 4I7HA 3V8LA 1I3QJ 2HZDA 1TW2A 1BI1A 1FMVA 1U78A 1X2NA 2M8EA 2UUZA 2ZXJA 2V9KA 3FBIB 4FT8A 5EEAA 4RAFA 4NC7A 3DLLF 2V79A 3EQLF 4M6YA 4IZZA 4JP0A 4A5MA 1DQUA 2OAZA 2A3SA 3F23A 2P7CB 4OMYA 2IA0A 4GGGA 5K5OA 5E1XA 1QVUA 2HKXA 3GTQJ 1ETWA 1JT6A 3N4MA 2PMHA 1HSTA 4BAYA 1WJDA 2NVXJ 1ZG5A 2F4MB 2L54A 4II2A 2J5PA 2K3FA 1DGRM 2CWEA 3NAUA 4D7MA 3IKTA 3LL7A 4OIOF 3S15J 2MW8A 1MD0A 1PUFB 4CH7A 5LGTA 4AVPA 3L1PA 1LQ1A 2PBIA 1ZRDA 4ESBA 3D5RC 2PQ8A 3P9IA 1T39A 3PUBA 4BH9A 2R7OA 1JI8A 1YX5A 5FKLA 2DJIA 2FMYA 4Y52J 3LSJA 3TL4X 4ESFA 1PP7U 2QM3A 3WGIA 4OIPF 2ISZA 3HOUJ 1IRGA 4IRIA 4EV0A 1JUSA 1IXSB 1R5HA 3MKYB 5GAGJ 4M3FA 4MGRA 2IS2A 3F8NA 1FBQA 4I99C 3ABMH 3HOXJ 4XSZF 1Z1DA 3V7SA 1TWFJ 5DM7F 3AAFA 3HRMA 4A3CJ 5E8IA 4BJ5C 1V5FA 2LBFB 1VNDA 5E3OA 1J5YA 3V4GA 3RZDJ 1SMYF 3LMMA 2K9LA 1XCVA 2EIKH 3G1MA 3V42A 5TGTA 3LNQA 4P9FA 1IN7A 1ETYA 3Q9SA 2D45A 2E36A 2KMUA 1YI2I 2EZLA 1IDYA 2BY1A 4BKXA 1UB9A 3MEXA 2RGVA 3JRGA 1X58A 2NAZA 1UHMA 3FDYA 2DMPA 2VXDA 3GFMA 1X19A 1XSVA 1X4PA 1P92A 3BDDA 1W36C 1J0RA 1LEAA 1HQCA 1FWZA 3GZ6A 4J01A 4NBQA 4FQGA 2FNAA 4LK0F 1RR8C 1E2XA 1SANA 2JUCA 2JA2A 4RGRA 3AKZA 2FE3A 4B3XA 3OYLA 4PSXA 4RB3C 3VSLA 3H0DA 1T98A 2VJ5A 4HNTA 2EFQA 3KP3A 1JT0A 5J8CA 1V54H 2BGCA 2X6WA 1MW7A 5HLGA 2XUBA 5F0CA 3H5NA 3IH3A 1VQNI 5F1JA 1RR7A 4XSXF 2BEOA 2WAFA 1MBFA 4CYCA 1IUFA 5HS7A 1TP4A 2X6XA 4LLLA 1GV5A 1YLFA 5D5XB 1Z21A 1FZPB 2AQEA 4DBRA 3O3KA 2EINH 3S3NA 2QKMB 3C2BA 3RSNA 3M1CA 3S93A 2QBYA 5CQEA 3U9GA 4BACA 1MSFC 4HSRA 2LY9A 2CMPA 4XN0A 4UB6C 4A69C 4F55A 1EA3A 1FTTA 3PM1A 4M3EA 3PO3J 1OYWA 1VF9A 4DYQA 3OYHA 4DIQA 3WU0A 1QBJA 1PUEE 4AYBN 3ZRGA 1HDPA 2QGUA 4M3DA 3LAJA 2DO7A 4LIVA 5EDNA 1XCBA 3K9TA 2OTLI 1TT0A 4EJUA 2FXAA 4A2UA 2LOOA 1U5TC 2V9PA 3CTAA 4FE4A 4U87A 4CDGA 4S05A 3TW6A 3CO6C 3OR2C 1U5TA 2E1CA 1IN6A 3RKXA 2R3SA 1GVJA 1YX3A 1Y8QB 4DOZA 4DZPA 3H3UA 4CXFA 3ZQLA 2VBYA 5F1RA 1XX5A 5IOZA 2O6GE 2XAGA 5J1UA 5CVUA 2ZXWH 3IH4A 2M30A 2LYCA 2RKHA 2EB7A 3T8TA 2CO5A 3E6CC 4XK4A 3M8FA 5CVRA 2ZJRF 2ELHA 4KUMA 2KFDA 4NDLA 1TZLA 3IP4B 3E6MA 1F36A 1GUUA 2ZCWA 3ELKA 2BY2A 2CGPA 3ZCOA 2Y30A 4EQQA 2FNPA 5DDGA 1SFKA 2NS0A 2FX0A 2OCCH 1N75A 1B9NA 3BR0A 1QVTA 2XPWA 2JPCA 3KYLA 4KT6A 1FP1D 4A0XA 5L3BA 1VQMI 2O5RA 1O4XA 5FLVA 2HQAA 1SD4A 1Z9CA 1FOYA 2EK5A 1R1TA 1BC7C 4IHWA 1D8JA 5DCFA 5GPAA 1O3RA 2P6TA 4F3QA 2CG4A 2Z99A 4UB8C 1R58A 3A0HC 5IPAA 3I3LA 4BE1A 1RC9A 4BE0A 2PI0A 5DUKA 4UUTA 2L9SA 1BOBA 2O7OA 4GXOA 3FXOA 3C1DA 1YIJI 3D5SC 4KISA 5EZGA 3KPHA 3RQIA 2OUMA 4CCNA 3L7WA 1HLVA 4C3HJ 1BI0A 2IP2A 2LVSA 4C2UA 1ZGAA 3RTRA 1B72B 1XSDA 3BY6A 2O3FA 5IP7J 1W7PA 3HHGA 3CLQA 2BZTA 1D0ZA 2R5YA 2XV4S 4XORA 4L9VA 1JHFA 2QZ8A 3BTIA 2Q0OA 4XNFA 4AUXA 4CGZA 4A5NA 3IAS2 2DT6A 3CJNA 5HODA 3I4NJ 2H1LA 1T2KA 3HIFA 2MC3A 2HU9A 2HDCA 3MFKA 4CO8A 3DF8A 2R7WA 2MGQA 2L2OA 2G9WA 2K7LA 2OV7A 2VPLA 1FYMA 1X1CA 4O6JA 3VODA 1YFHA 3WODF 4LG0B 1UELB 4GCVA 1HBXG 1TNTA 2XKOA 3B02A 3OL4A 4XKBA 5L3DA 5ILSA 1AKHB 2L4MA 2F48A 4ZYHA 2R92J 3OL3A 2R7TA 2H8RA 5EYRA 2HR3A 4I01A 3WHCA 2HYFA 4IQ4A 1ON1A 3HPGA 4IHVA 4K2EA 3S16J 2FF4A 2IA2A 3OYGA 2KRCA 1RKWA 1YW8A 2XAHA 4WXDA 4KMUX 1KQ0A 2Y75A 3G3ZA 2KDZA 1GDTA 2JTVA 3JRFA 1S7AA 5DCMA 3FKJA 5A2QK 2MABA 4BYYA 4CYDA 1P9QC 3K4BA 4A6DA 2E1NA 2KL4A 5IT3A 2D1HA 5C4XJ 2LKPA 2AXTC 4MFEA 3ULQB 3EUKL 2XRLA 5M3FJ 1WJCA 4IHYA 4M9XA 2M0MA 3DPUA 1UHSA 3BJAA 3ZN1A 1P4WA 2JRMA 2ZO4A 2IA1A 2O0YA 1WSUA 1ZRCA 2HQ5A 3HSRA 2LC2A 2M7AA 2E7XA 3VYSB 1JJ6C 2DQLA 3GF2A 1RPWA 1H88C 4GO1A 3A4CA 1G4DA 2KZVA 2EA2A 3HOTA 3ZN0A 2LKSA 1BOAA 4ZH4F 4ASNA 4IX7A 1DGWY 2QLZA 2O61A 2DI3A 1JXSA 1WI9A 4ETSA 1FLIA 1P7JA 2DK8A 3AG3H 3E97A 1V5GA 1EKEA 2A5YB 4U0VA 4ABZA 1TQMA 2VXZA 5LHHA 3FMQA 1JKQC 4M9SA 2MH2A 1K78A 1F4KA 2K40A 2KRFA 1MMGA 4EM2A 4G94A 1WJ5A 1EV7A 1U6GA 2LR8A 3SDBA 2F5DA 1IW7F 1YOVB 5DD4A 4QSHA 5K7ZA 1V3FA 4HW0A 5IY5H 3DKYA 4HNUA 1MJAA 3B73A 4KICA 3GWZA 1OISA 3AL0B 2WAEA 5IYDJ 2PFBA 3G71I 1MNMC 2PX9A 4R1HA 4BEHA 4Y33A 2DA7A 4JX4A 1S72I 2JJ7A 3PL8A 1TWHJ 3HKZN 1DP7P 2DQRA 4HAMA 1SD5A 5LEJA 1IF1A 2VBWA 3GTJJ 2FEZA 1I6HJ 1J75A 4UV8A 5AIQA 3GFLA 3IKVA 4QTRA 3JRHA 1AOYA 3FISA 5ICCA 4OINF 2FBKA 1VQPI 4AYBA 3K4KA 1FYLA 2DFIA 4E70A 1FNNA 3DKWA 1T0FC 2VKDA 1KA8A 4RS8A 3T5XA 4CCLA 4B44A 3MKZA 2L9VA 3WGHA 4KIFA 1ETKA 3PIOF 2VI6A 4JBAA 3K0LA 3I4PA 1WJFA 1IUYA 2HGCA 1ZQ3P 3D0SA 2BY0A 1Y56A 2BVMA 5LEKA 5D4RA 5M5WJ 1W5TA 2EV5A 2DOAA 3GFJA 3G1OA 2DMUA 4H0EA 2OA4A 3DP7A 5J6XA 5JHFA 4MQ9F 2HOEA 2L3DA 2AS5F 2DAOA 2VT2A 5LHGA 1W1WE 4M6VA 1X1BA 1ZARA 5EEGA 1SD6A 1JGGA 2CUFA 4PJNA 5FO5A 2E60A 2CQNA 1LDDA 3H35A 1LNWA 3G6EI 4EGZA 4YG2F 4A3DJ 2CFOA 3DBHB 3W2WA 3EUAA 4KITB 4QIWN 4NNJA 2X6YA 3CCVI 2DT7B 3HOWJ 4XICA 3FXQA 3ZQFA 4XIDA 3VYRB 3UKGA 1HSJA 4RB0A 3ZQ7A 2B7EA 4MNUA 5KK1A 3EETA 2C6YA 1O3SA 1RKTA 3TDZC 3HRTA 3E5UA 4Y13A 3QOPA 3BR5A 1LFUP 2F5EA 3JSPA 1BR4A 4LB5A 2CUEA 3F21A 4FHTA 1K83J 4LGWA 2RV8A 1RUOA 3OYJA 2DPUA 2NOGA 5EF6A 4V2GA 2OZUA 2KIQA 3BG3A 5ED4A 1XG1A 1UMQA 4P96A 5FJ8J 2W7NA 1T08B 1RRJA 1AHDP 3DEUA 3LQRA 4FTHA 2HQNA 1IN4A 4Q4ZF 2NOJB 3CCSI 4RB1A 3HBLA 2P5VA 1DU0A 3E1SA 3HOYJ 3G73A 4L5EA 3OR1C 3PNYA 4WXCA 5KAIC 3F72A 3K1PA 1T6SA 1Y1WJ 3FK7A 1SD7A 2OQRA 2CQ7A 4M6XA 2ADUA 2L4AA 3EYYA 5DYMA 2JA6J 2BY3A 2YUSA 2CU7A 3QU3A 1U8BA 3LA7A 4HLYA 4IHSA 1P2FA 2JN6A 3BPXA 3DQVC 1YO5C 2VQLA 3ZOBA 2PJRB 2L7FP 2NNYA 1IXCA 1Z6RA 3FXMA 4CICA 2ISYA 2KIMA 2O03A 3WTWC 4EVIA 5K5RA 1FX7A 2XF5A 4C30A 1K4SA 3GTMJ 3H5AA 1UG0A 1HC8A 4WCGA 3SJMA 1X1PA 2PG4A 5JR3A 3FWEA 1WJBA 4ZDLA 3CJRB 1H9GA 4YFNF 4NQWA 2DPDA 2GA2A 3DPLC 3MAJA 3OYFA 4E7HA 1V4RA 2L7MP 3C18A 3BPVA 1VQ6I 1K6OA 4HF1A 1QHGA 1ZYRF 5J47A 4C2MJ 5AONA 1SFOJ 3J7AY 1PJRA 3ZMVA 2VLAA 2K9SA 2X0LA 4ENKA 1H8AC 2F4OB 2Y48A 1HOMA 1Y1VJ 2K5CA 2HFHA 1IRXA 2A6TA 2G7HA 3RKWA 5GP9A 2DA4A 3C7JA 1K6YA 2X1CA 1ULYA 4HZFA 4M74A 1S9HA 3HB9A 1MKMA 2R7DA 2VN2A 1WH7A 3H9GA 1RIOH 3VSKA 4CHUA 2DCEA 1JHHA 2QWWA 1UJ8A 4XLCA 1X1AA 3A01A 4ANJA 2Q8KA 1TWAJ 3QPLA 2DOEA 3R61A 2ZNZA 3JSOA 1B59A 3ABUA 1WRJA 3H9QA 1ZN2A 2QQ9A 2WAQN 4MTEA 1B8IA 3GTOJ 1BL0A 3GW2A 1KU9A 4G12A 2CV2A 1T38A 1D1CA 1RNLA 4N9HA 2F5CA 4HOBA 4F93B 2LF7A 2JSPA 2FBHA 2P8TA 5K5QA 4BHBA 1FY7A 2GIVA 4F91B 3GTLJ 4B43A 4DNCA 5C4JJ 2H6CA 3R6SA 2OZ6A 5F64A 5KVRA 1N25A 3ONQA 4RBOA 4CYCB 5HLHA 4UXNA 2R7ZJ 1BW5A 5CVVA 3RIRA 3GVAA 3CF5F 2JT1A 3HOVJ 1MBHA 2EA4A 1I5ZA 2K9QA 2LNBA 2VKHA 3H92A 5F04A 5HLIA 5J40A 3P9CA 1TQIA 3QPTA 4MTDA 1I50J 2BXZA 2EIMH 4YIIA 1VQLI 4KYWA 3I54A 1YJWI 3ZQGA 2P4WA 3ZPLA 1R1VA 2DFHA 1DDNA 2VIXA 4E6KG 4UY8I 3MKWB 2K4BA 1D5YA 2EZIA 3HG9A 2EQRA 3PNVA 3VDXA 2OU2A 4IO9F 2VKVA 1BC8C 1IGNA 2FOKA 4OU0A 2QEXI 1GXPA 3PUFA 1QU3A 1KONA 2K02A 2E71A 2L9NA 1TC3C 2DA5A 4QLCU 1K4TA 1U5TB 3FXRA 4LLGF 5B5EC 3I56I 2W82A 4D0PA 4HQMA 3I9V2 3BCBA 1EH8A 5DD8A 2GOXB 2WB1N 2OCEA 1R36A 2DFEA 2HYJA 4YELA 2JA5J 2JA8J 2DA6A 3GUDA 4FCYA 1ZRFA 3R0AA 2YU9J 5H20A 2M3AA 4BL0B 2TRTA 5E3NA 1IAWA 4S04A 3DTIA 2ETHA 2VB6A 4CA0A 5FB2A 3QWLA 5M3MJ 1POGA 1MNEA 3MZ8A 4IRHA 3W3CA 2HTJA 1X2MA 6PAXA 4IPAA 3J7YJ 2VPRA 4BQNA 3PIPF 2CSOA 2WADA 3K4MA 4II3A 4D5CA 5CQGA 2VONA 2V4JC 1FJLA 2LKXA 4EEFG 1A6IA 3J80Z 3A03A 1TT5B 4ESJA 1SEUA 2OD5A 3F6OA 3TGNA 2STTA 1NG7A 2PN6A 3LQQA 1F9NA 5GAEJ 2W48A 4CSWA 3S2DJ 1OCTC 2LG4A 3DKXA 1MH4A 3JAMK 1VQKI 1W5SA 1IRFA 3BTLA 4IF4A 1YG2A 3CZ6A 1DU6A 1LDKB 3FZVA 1W36D 4BJ6C 3GYHX 4XKWA 2FQ4A 2XPVA 1JJ8C 2V6CA 1OYYA 3S2WA 3R60A 3V7RA 4A0YA 5B1AH 5BMZA 1SAXA 2MD0A 2QQBA 4L9JA 3VEPA 4BHCA 3CLOA 1VTNC 1D5VA 4J19A 2IS1A 4BJTA 1A31A 1I1SA 2Q2EA 4UUSA 2O8KA 3IRRA 3FF5A 2E7WA 1MJBA 4XOPA 2ZB9A 1TBXA 1Z05A 1I6XA 3TOAA 5L3CA 1MDMB 3O8GA 4KT5C 2R5YB 3LA2A 4A12A 3I64A 3BROA 1FOXA 4LK1F 4GFBA 2ZMEC 2NNNA 2Z3YA 2NVYJ 5GAHJ 2Y9ZA 2EILH 2ZMEA 2XAFA 4DW6A 4XRMA 1R49A 5EGOB 3NWSA 3DXJF 3ROUA 4U7BA 5FD6A 4XKCA 1HW5A 5M5YJ 4S0HB 2I10A 4PZJA 2Z16A 2R7VA 3HUGA 1SMTA 2NXNB 3LFUA 3S32A 2ZJ2A 3OYDA 2LH9A 2COBA 4HA8A 1D8KA 1JTXA 1MSEC 5IP6A 1HW1A 3I5UA 2O9LA 2L9RA 4Q48A 4BS9A 3KLNA 3ZGKA 1ZLKA 2Y69H 3QODA 1UHWA 1W0UA 1KU2A 2V26A 2IGKA 3OYEA 2WTEA 3S2HJ 5JFRA 3I55I 1VQ7I 5F08A 2CYYA 2V1DA 5EEHA 3CUQC 1AA7A 3EUHC 3FKIJ 1S7OA 5ICGA 3WTTC 3A1YA 4RAZA 3CUQA 4AC0A 3W6VA 3EUHA 4I6ZA 1TQPA 3W6JB 3JCUC 1BW6A 2DN0A 4DQ2A 1ZHFA 3MQ0A 3R4KA 1LFPA 3KEYA 1G8XA 3NEUA 1YRNA 2M1BA 2XGDA 3FM3A 4P9UA 1PUFA 2R7RA 5CVJA 3TKYA 4X0GA 1GXQA 3M8JA 1YW9A 2G0EA 2KISA 1H0MA 1ETVA 1ZG1A 4L0ZB 3P5JA 3GMEA 3CMMA 4JYKA 5ERIA 1LE8B 3TQNA 1JTYA 2RN7A 2ZFWA 3MMYB 5JVGF 3KP4A 1PYVA 1BIBA 1Z6TA 2HKOA 3MZHA 2FMLA 4Y3OA 5HDGA 4R79A 1LDJA 4GRIA 3OOUA 4LJZF 4J00A 1ZGJA 4X6AJ 3OMYA 1F5TA 4C2TA 2WAQA 1QPMA 2QYOA 1X1DA 4B47A 1OFCX 3HGYA 4HX7A 2LBFA 1BA5A 3I0TA 3SFIA 2CQXA 4U0WA 3FXUA 2CUZA 2WWYA 2IGOA 2HTSA 3KP2A 3DEWA 2R5ZB 2IJLA 1Z3XA 3FK6A 5HVQC 4RDUA 5K7HA 2ESHA 5J4YA 4EM0B 3OYMA 3QAHA 1XGSA 1D0YA 1F1ZA 1FC3A 3MD2A 4KN4X 4P55A 4D5FA 3TO6A 3MWMA 2DYRH 3CDLA 1TNSA 5HDKA 2M9HA 1O57A 2XAUA 2WV1A 1WPKA 4C3IJ 4BHPA 5ILVA 4HX8A 4OIQF 2OTJI 1W7PD 3CCRI 1Z3YA 4KJZA 3CO7C 2BW3A 3OYCA 2VT3A 4RLQA 1YJ9I 3H5RA 1FTZA 3C2HA 2M34A 3CC4I 1VQ4I 2A69F 1UZCA 4XBFA 5J1RA 3E0JB 1SVMA 3MCZA 2XPUA 1OCRH 5LFAA 1OLTA 2XF7A 2K85A 5DEQA 3TO9A 4L5IA 3UR3C 4HBLA 4D7NA 4IQJA 1QZEA 2H94A 3CJTB 1W0TA 4AM3A 2OF7A 3TW7A 3K2ZA 1GT0C 5C3EJ 3DFGA 2M4KA 1NG6A 5D8LB 3FBNB 3F3XA 4XR6A 3WE2A 3CMAI 4NC8A 3G2BA 2WB1A 4P1WA 4ZTFA 1GV2A 3HOZJ 1ERDA 3SHFA 4JOMA 3H36A 2FUG2 2H09A 2CQKA 3L9FA 4UHTA 2JRTA 2OJED 3S17J 1VFCA 3P9KA 4MQVA 3REOA 1FIPA 4M72A 3IH2A 4DZJA 3I59A 3K4CA 4C9YA 2QENA 2BYVE 1IJWC 3TP0A 4I98B 1VQ5I 4BGDA 4OWRB 3CC7I 3GO5A 5E18F 4PJJA 1P4XA 4FETA 1SFUA 3S3OA 1R5ID 3FXLA 1FYKA 4EATA 1R4MB 9ANTA 2KIUA 3V7CA 4WWCA 1SC7A 4EJWA 2W25A 4WK8F 3S1NJ 2LFBA 2GBYA 4Q47A 3HRUA 2CJJA 4LG3A 3K10A 2J5OA 2XSDC 4XM3A 3CCLI 4X1EA 2LY1A 3ZXSA 3HZJA 1G3SA 1OQYA 1ODDA 3N97A 5LHIA 1QA6A 3CCUI 4KN7X 1ITYA 3HDDA 2HS5A 5IT9K 3GLXA 1QNTA 4E4HA 5ILUA 4RAGA 2ECBA 1OPCA 4FASD 3OS0A 1IO2A 1SVLA 4XMYA 2GIZA 1XS9A 4HG2A 5LRSA 4JK1X 1U9NA 4IVNA 1HF0A 2Z2SB 2NRAC 3G4SI 1N78A 3UNGC 4ENNA 2F4IA 3HL2A 4XRSA 2F5VA 4HF2A 4MO7A 4Y15A 4UUVA 2KPMA 2M2EA 3E7LA 4BY1J 2KRHA 4AIHA 1D1BA 2P5KA 2P5LC 4MHGA 2VKEA 3CCJI 1I1GA 4A3GJ 2MSYA 1Z0XA 5KHDA 2XROA 1X3ZB 3QP5A 5J8FA 1J2XA 3L2UA 2P6SA 1KGSA 1NTCA 4H4KC 4XRFA 2ACJA 3K4NA 2ZSHB 1Y8RB 3OS1A 2DBBA 1T33A 3TMOA 4IOAF 1PVEA 3O6BB 3BP8A 2OBPA 4PJ0C 4XLPF 2X1EA 2L02A 3HYIA 2YR2A 3BWGA 3DEEA 1WI3A 4M3GA 4UV9A 4JX5A 1LFBA 1HA8A 2DLLA 2XAJA 5KCMA 5E3LA 4I0BA 1SFEA 1MMAA 2DMNA 1RESA 5K7FA 3KZZA 2DA1A 3CUOA 2GOMA 3J81K 1R7JA 3Q0WA 3JTHA 3S1MJ 5E79C 4LD5A 3I4MJ 2QVOA 3M1EA 1B72A 1WKMA 5J3LA 3WTUC 5E1ZB 3DPTA 1M1EB 3NQOA 2DXIA 2VUMJ 1OR7C 4DYRA 2DODA 3RDIA 4HEA2 3QU6A 1OR7A 2VE9A 5DTDA 1WCMJ 4XKVA 2CQQA 2GXAA 3KETA 1S3JA 1TWGJ 2IGNA 3U1KA 2UXNA 1O7LA 4V2FA 3SYTA 5LLQA 4IRGA 3KZIC 2GAUA 3WU1B 3K69A 2OC6A 2VASA 2XAQA 3OSGA 3C3WA 4NHJA 2ESNA 1FSEA 1FIAA 1XGNA 1X3UA 4LG0A 2RNJA 3H9JA 2QSGX 2A6EF 1AKHA 2NVQJ 3CD6I 1RI7A 1B8IB 4G6QA 4FX4A 2K27A 2XF6A 4BXFA 3S1QJ 2EBIA 3M8EA 4EM1A 3JR9A 5BPDA 2X1DA 3JRBA 3LSIA 3SXYA 2HVSA 5FKMA 1Q1HA 4FX0A 3BOQA 2MD5A 3AFHA 3DCFA 4E7LA 2R7XA 1J7KA 1MZBA 4HV5A 5FRMA 3IRQA 3RQ4A 3HOSA 2WV0A 2ME6A 5DUIA 2NS8A 2W57A 4U0YA 1VQ8I 2B63J 3KEQA 3ABLH 2DYSH 2E1OA 1LPQA 1KZHA 3DV8A 3QYEA 1MMDA 4G7ZF 4BQAA 3FMSA 3EYIA 5DS9A 3F9KA 1YIOA 5HS9A 1J09A 1JGSA 4A3EJ 2H27A 4ZDOA 1IV6A 1H9TA 1UFMA 3NWTA 1A04A 1ZLJA 2LY2A 4CCKA 2IPQX 3RYRA 2CV1A 2X48A 4HNVA 5LD2C 4W97A 2NVTJ 1ZGWA 3KYDB 3B6CA 4I2OA 2W4SA 5FFXA 3NARA 3QPSA 4MIMA 1ENHA 3Q0UA 5LBQA 5A2QZ 1IG7A 5FLXK 1V55H 2ID3A 2XDVA 2XSJC 4A3KJ 2WY7Q 2HNHA 2EV0A 2PMUA 4DJAA 1Z7LA 3Q9VA 1NH3A 4B8XA 1G59A 2BXYA 2V9VA 4HQEA 2LREA 5CKTA 5L3GA 1VI0A 3KCCA 1YTYA 2JK3A 5D6EA 2DA2A 2BOLA 3IWZA 4XLAA 5D5UB 3BZKA 2LD5A 4PFOA 1BJAA 1E3OC 1YW7A 4NC6A 3AL0C 5DV5A 2BV6A 2VOPA 3PQKA 3ZP5A 2NVUB 3BLYA 1LB2A 3TP3A 2EV6A 1XGOA 2W84A 3JRDA 4YFKF 3WTXC 1I39A 2DU9A 4A3IJ 3CP8A 2FD5A 1IXRC 4IL6C 1S8NA 3ASOH 2RC4A 2CW7A 1IN5A 1UAAA 5H2FC 3RPUA 4G6DA 4I0AA 2D2WA 2X85A 3K6GA 4LIUA 3CQZJ 3BT9A 1XDUA 4BE2A 3S3MA 1W5CC 3M4OJ 3A02A 3BTCA 4YRVA 2IBDA 4XOTA 2ZKZA 2GA1A 3Q5FA 2EJRA 1AU7A 4MEYF 2F2EA 1X4OA 4QWQA 3K70C 3SDGA 4FE7A 5J4VA 1YJNI 2JQ7A 2XGEA 4ZTJA 2RVCA 3K70D 3SZPA 2K9MA 4IHXA 2HXOA 2Y9YA 3SEQA 1WWXA 4A3FJ 1XMKA 1ACIA 3IWFA 1HKTA 3LAPA 4KFCA 3ZQCA 1OKRA 3HM5A 2MG4A 2MBFA 1Y0UA 3T0YA 2CUJA 2JSCA 1XN7A 3HXLA 1I27A 4M71A 4BQQA 4BBSJ 5E17F 1ZR2A 2EWNA 3GFIA 3CC2I 5FKNA 2LK2A 3CMYA 3CDHA 2XKPA 2EFOA 4EMSA 1R22A 1T8IA 1MBEA 2B0LA 2NS7A 2HOSA 4RLFA 1KU7A 4PUSA 4HPQA 5E1WA 4A3MJ 3PNTA 4YFXF 3VB2A 4A3JJ 2Q1ZB 2QBYB 3DU5A 3SQNA 5BQTA 1WQ2A 3WGGA 1T56A 2VJIA 5HLTA 1IN8A 3ISPA 2E1MC 3R0JA 2AXLA 1O3TA 3K4JA 3CMEI 2BHYA 3Q3SA 5EJCA 3LSRA 3HUGB 1ZAOA 5GTHC 2IRFG 5E20A 1R00A 3KP5A 3O2PE 4G8XA 3SZGA 1Y39A 2AHQA 3VFZA 5E3MA 3HKZA 1DPRA 2ELJA 3CCYA 2L0KA 3PQJA 3L2QA 4L5JA 2R4GA 4A0ZA 1D1AA 2CW8A 2L5QA 1K61A 4EGYA 1OJLA 4BXUA 4D9JA 2V1UA 2MFZA 1ETOA 1NK2P 2A05A 1U9OA 4BY7J 1YE9A 3ZMUA 3PSIA 2KLOA 3WU2C 4ZYAA 2FJ1A 2I8DA 5CVIA 2ZFUA 1B1BA 3VOEA 3KLOA 1EF4A 2VC0A 4CZZA 2DW4A 3CUQB 2HVRA 1XDSA 1R6RA 4LITA 2RAEA 1MBGA 1XMXA 4OAZA 4PCQA 4PK4A 1E0EA 3ZMZA 1YRNB 2KHMA 2JUGA 2ZXIA 4XN3A 2F5FA 2WA0A 2X4HA 1L0OC 3DLAA 3LSTA 4KDPA 1USTA 1XMAA 1PP8F 1JUMA 5DM6F 4XLHA 3FHZA 2XIGA 1ON2A 4ITVA 1YYVA 3LOCA 2A61A 1G2HA 2KIFA 2RNGA 2PJRA 5B1BH 3ABTA 1F43A 4ON0A 2HPIA 2M7BA 5J1YA 4YEJA 1W4MA 2ZBKA 4AWXB 1P4AA 4DYCA 2FSWA 2EFPA 3OY9A 5ICFA 4ENMA 1YITI 4RM2A 4RM3A 1EJ9A 1G3TA 3ZMDA 2LP0A 1O3QA 1DPUA 2P81A 2TDXA 5F0FA 3GTGJ 4PJLA 2QUFA 2Y2ZA 3ABKH 5FLXZ 1LUJB 2PEXA 2E34A 3ERMA 1ZK8A 1QZZA 3GX4X 4GYIA 5FD5A 4Z2YA 1B6AA 2EZKA 2VBZA 3TBIA 3OOPA 2GM4A 5HDNA 1FEXA 4M9ZA 1HW2A 4G6TB 3IL2A 1QZYA 5EG0A 2I5UA 3V8KA 3JW4A 2QSHX 3BG9A 1JUPA 5IOYA 3GTPJ 2HVQA 2VC1A 3IC7A 1APLC 1B9MA 2IAIA 2LRDA 5KAFC 4LLNA 1TWCJ 2FQ3A 2F6CA 5JLWA 5M5XJ 2DTRA 2KT0A 1JKOC 1W7PB 1KYZA 4LOCA 3RJPA 1Z67A 3TOBA 3CCMI 1OMIA 3SFZA 1FPQA 2MA3A 2RQQA 4WF2A 3KZYA 2BW3B 3GBGA 2LDUA 3RKYA 2LTPA 2R7QA 3E6BA 2GXBA 4XLFA 1LEBA 1Z7UA 2FRHA 4RB2C 4P5OA 1N77A 1SVOA 2E2IJ 3CCQI 1GVDA 3ECHA 3KEOA 3CJQB 2STWA 4ZYEA 1A35A 5D5WB 1CF7A 4AIJA 3ML6A 2IGMA 3U2RA 1MIJA 4XLEA 2H1KA 3BCAA 1PDNC 1FOWA 2VE8A 2LMDA 4CCOA 3JRCA 1KYWA 5TRDA 4I76A 2HOTA 2MYSA 2W00A 1MMNA 3QYBA 1TL8A 1D0XA 3I71A 4AVZA 1H89C 5C44J 2X51A 4V19K 3V8JA 4CUGA 3TEDA 2DOFA 3LSGA 2MC4A 3ZMTA 4AD9A 3B6AA 1P6RA 2YSRA 1XGMA 4YIRX 2Z9OA 4QPQA 4DGWB 1WJAA 2DT5A 3K4LA 5DCMB 3I59B 2IEKA 4M73A 2KDOA 3OYNA 2VOOA 2M4GA 2GZWA 2PJPA 1R4NB 3BC8A 3H1CA 1ZH5A 3F22A 1EH6A 2HYGD 1VZ0A 3KX2A 3DWLE 3WTZA 1MJ9A 3DTEA 2ZSIB 2XB0X 4HV6A 2M0CA 3HEFA 3ECOA 1NK3P 1MH3A 4F92B 2UWMA 3C2GA 1OYIA 2RQPA 3LSPA 2R0QC 3E5XA 3FMRA 1A36A 3HTSB 4RGSA 4E7SA 2XASA 3PO2J 2JZYA 4ZC3A 1U3EM 3RYPA 4PFPA 2PMZN 1JE8A 4FISA 2JWTA 1IV8A 5ICEA 1VQ9I 5D6FA 2P0WA 4HDVA 2Y0SN 4HSTA 4A93J 1MBJA 2M87A 4B48A 3WG9A 4GYGA 2Z5UA 4E7KA 1SAUA 2M8GX 2Y31A 4ZYGA 2R7SA 2DMQA 3J7ZI 3KP7A 4UVAA 1ORKA 4XQFA 3OYAA 3BR2A 1L3LA 3W6KB 2A68F 5BNGA 2CS3A 5GPCA 4BQOA 1K78B 3RZOJ 4N0BA 4XONA 1STZA 2GXGA 3X2QH 3GZNB 3M7GA 2XHKA 3WE3A 1YQAA 2M45A 2EIJH 3BZCA 4BDYA 1WZ2A 2KP6A 2HQRA 2YPRA 4U88A 3HHHA 4N4NB 1XB4A 4BDZA 3T1BA 2ID6A 2FOWA 4OMZA 2A5WA 3S14J 4L9TA 1IC8A 4N9IA 5HNFA 4BEHB 2UV1A 2VBXA 1GHCA 3U21A 1FBSA
chains in the Genus database with same CATH topology
4LMYA 4NB5A 4UVCA 3HSEA 3HRSA 1Z91A 3ERED 1U2WA 3TDUC 2KJCA 1J9IA 1SFXA 4HX4A 1YS7A 5BOXA 1MDMA 1NHAA 4UNOA 3LFKA 3JAMZ 4AIKA 1D3YA 1S6LA 5AIPA 3PFIA 4LB6B 4IXAA 2XVCA 3H3ZA 4KIBA 1B4AA 1C0WA 2KKOA 1FOKA 2ZNYA 3HTUA 2Z33A 4TV7A 1HKSA 3QP6A 3T8RA 2H6BA 2VODA 4U7DA 4HYEA 4RGUA 3F8MA 5D8KB 2L01A 5BS6A 5K1YA 4YIFA 5HS8A 5H6QA 1HXDA 2CW0F 4F7ZA 3F8BA 5LRRA 1BI3A 1BN5A 3RI4A 1S29A 2P7VB 1USSA 3LWFA 5JVTA 3WTSC 2A07F 3TO7A 5FFZA 1U8RA 2MLGA 1R1UA 3D5LA 3FM5A 3GEZA 3OV8A 1REPC 2UZKA 1RZ4A 3RPQA 1QGPA 5D4SA 1E17A 2HWVA 1LVAA 1G3WA 1ZG3A 1FT9A 3J7AO 1AWCA 4HLXA 1IZ1A 3L09A 2W85A 4B09A 2FU4A 4BNCA 2HZTA 3E3VA 2QQAA 2UXXA 2YU3A 2Y0MA 4R8HA 4OIRF 3BJOA 3IHUA 3U1DA 1TLHB 1UCRA 5TJJA 1XD7A 4G7OF 2COMA 3FX3A 4L9NA 1KU3A 1G3YA 3BZ6A 4MEXF 1G6NA 3F8FA 3P7NA 4KIGA 3NRVA 2MLKA 4G7HF 2YX4A 4G9YA 2G7UA 2RDPA 3M9AA 3ZMSA 2BE5F 2A6HF 1CGPA 5JI6A 3WTYC 1TTYA 2MH9A 4PGHA 3LA3A 1EH7A 4ENJA 3EDPA 1T0FA 1QQIA 3JTGA 4RAYA 1MGTA 1TW3A 4PGGA 3KE2A 5F6FA 4HDUA 1BM9A 3SZTA 3E5QA 4IHTA 4L18B 5JHUA 1R5GA 4Q5SF 2KJBA 2O8XA 1LJ9A 4KMFA 3QPHA 1R23A 2D1VA 2V1XA 4ZZDA 2CFXA 3KP6A 4HF0A 2WC2A 2OQGA 2XRNA 3COAC 1FSHA 5CJ9A 2K86A 4EJOA 3BJ6A 3GXOA 2HEOA 2K4JA 4UVBA 5HOOA 2W24A 2XGXA 2IVMA 3F8CA 1KQ8A 1O7FA 2FA5A 4JQFA 5BPIA 4KA4A 5LGNA 3L2CA 1FP2A 2YX7A 3WTVC 2PLYA 1YS6A 1ONVA 2BBYA 4O3MA 4IJAA 2EFNA 5CLSA 4A6EA 3QRFF 4XLNF 2LSOA 1BIAA 3J80K 3I58A 2GQQA 1BBYA 4OOIA 1RUNA 4L0YB 1HKQA 5L3EA 3K1MA 2M5WA 4O5VA 1K79A 1KQ9A 4I02A 5IT9Z 1FBUA 5H6RA 3KFWX 1XSXA 4I09A 1QO0D 5L3FA 5E8GA 2EFWA 4WX9A 2R7FA 1BI2A 3I53A 1ZREA 1DUXC 1K7AA 3HSFA 5FGMA 3MZYA 4RGXA 4WXHA 4ZYDA 2JPBA 3K1NA 4Y17A 5LGUA 2DK5A 2IW5A 4PDKA 2LF8A 2GWRA 3GZ5A 4LFUA 4EJTA 3J81Z 4ZZLA 4KNYA 4EJVA 2IT0A 1J59A 5D5VB 2NYXA 2ZMEB 3L00A 2FBIA 5CYVA 3E6DA 1CF7B 3F6VA 4I7HA 3V8LA 1TW2A 1BI1A 1U78A 2M8EA 2ZXJA 4FT8A 2V79A 3EQLF 4M6YA 4A5MA 2OAZA 2A3SA 3F23A 2P7CB 4OMYA 2IA0A 4GGGA 5K5OA 5E1XA 2HKXA 3N4MA 2PMHA 1HSTA 4BAYA 1ZG5A 2L54A 2J5PA 2CWEA 3IKTA 4OIOF 1MD0A 5LGTA 4AVPA 1LQ1A 2PBIA 1ZRDA 4ESBA 2PQ8A 3P9IA 1T39A 4BH9A 2FMYA 4ESFA 1PP7U 2QM3A 3WGIA 4OIPF 2ISZA 1IRGA 4IRIA 4EV0A 1IXSB 1R5HA 4MGRA 3F8NA 1FBQA 4XSZF 1Z1DA 3V7SA 3AAFA 3HRMA 5E8IA 1J5YA 3V4GA 1SMYF 1XCVA 4P9FA 1IN7A 3Q9SA 2D45A 1UB9A 3MEXA 2RGVA 2NAZA 1UHMA 3GFMA 1XSVA 1P92A 3BDDA 1J0RA 1LEAA 1HQCA 1FWZA 3GZ6A 2FNAA 4LK0F 1E2XA 4RGRA 2FE3A 4RB3C 1T98A 2EFQA 3KP3A 5J8CA 2BGCA 5HLGA 2XUBA 4XSXF 2BEOA 5HS7A 4LLLA 1YLFA 5D5XB 1FZPB 3O3KA 2QBYA 3U9GA 1OYWA 3WU0A 1QBJA 1PUEE 3LAJA 2DO7A 1XCBA 3K9TA 4EJUA 2FXAA 4A2UA 1U5TC 3CTAA 4CDGA 4S05A 3CO6C 1U5TA 2E1CA 1IN6A 3RKXA 2R3SA 1GVJA 3H3UA 4CXFA 2VBYA 5F1RA 2O6GE 2XAGA 5CVUA 2M30A 2RKHA 2EB7A 3T8TA 2CO5A 3E6CC 3M8FA 5CVRA 2ELHA 4KUMA 3E6MA 2ZCWA 3ELKA 2CGPA 4EQQA 2FNPA 5DDGA 2NS0A 1B9NA 2JPCA 1FP1D 4A0XA 5L3BA 1SD4A 1Z9CA 2EK5A 1R1TA 1BC7C 1D8JA 5DCFA 1O3RA 2P6TA 2CG4A 2Z99A 1R58A 2PI0A 5DUKA 4GXOA 3C1DA 3L7WA 1BI0A 2IP2A 1ZGAA 3RTRA 1XSDA 3BY6A 2O3FA 1W7PA 3HHGA 2XV4S 4L9VA 1JHFA 2QZ8A 2Q0OA 4CGZA 4A5NA 3CJNA 1T2KA 3HIFA 2MC3A 2HDCA 3MFKA 4CO8A 3DF8A 2G9WA 2K7LA 1FYMA 4O6JA 3VODA 1YFHA 3WODF 4LG0B 4GCVA 1HBXG 1TNTA 2XKOA 3B02A 5L3DA 5ILSA 2L4MA 4ZYHA 2HR3A 4I01A 2HYFA 1ON1A 4K2EA 2FF4A 2IA2A 1YW8A 2XAHA 4WXDA 4KMUX 1KQ0A 2Y75A 3G3ZA 2JTVA 1S7AA 5DCMA 5A2QK 4BYYA 4CYDA 4A6DA 2E1NA 5IT3A 2D1HA 2LKPA 3ULQB 4M9XA 3BJAA 3ZN1A 1P4WA 2ZO4A 2IA1A 2O0YA 1WSUA 1ZRCA 3HSRA 2E7XA 2DQLA 3GF2A 4GO1A 1G4DA 2EA2A 3HOTA 3ZN0A 4ZH4F 1BOAA 4ASNA 2QLZA 2O61A 2DI3A 1JXSA 1WI9A 4ETSA 1FLIA 2DK8A 3E97A 2A5YB 4U0VA 1TQMA 2VXZA 5LHHA 3FMQA 1K78A 4M9SA 2MH2A 1F4KA 2KRFA 4EM2A 4G94A 1EV7A 1U6GA 2F5DA 1IW7F 5DD4A 1V3FA 4HW0A 1MJAA 3B73A 4KICA 3GWZA 2PFBA 4R1HA 1DP7P 2DQRA 4HAMA 1SD5A 5LEJA 1IF1A 2VBWA 2FEZA 1J75A 4UV8A 5AIQA 3GFLA 3IKVA 1AOYA 5ICCA 4OINF 2FBKA 1FYLA 2DFIA 4E70A 1FNNA 3DKWA 1KA8A 4RS8A 3T5XA 3WGHA 4KIFA 4JBAA 3K0LA 3I4PA 1IUYA 2HGCA 3D0SA 5D4RA 5LEKA 1W5TA 2EV5A 3GFJA 4H0EA 2OA4A 3DP7A 5J6XA 4MQ9F 2HOEA 2L3DA 2AS5F 2DAOA 2VT2A 5LHGA 1ZARA 5EEGA 1SD6A 5FO5A 1LDDA 1LNWA 4EGZA 4YG2F 3FXQA 1HSJA 4RB0A 3ZQ7A 4MNUA 5KK1A 3EETA 2C6YA 1O3SA 3TDZC 3HRTA 3E5UA 4Y13A 3QOPA 2F5EA 3JSPA 4LB5A 3F21A 4FHTA 4LGWA 2RV8A 1RUOA 2DPUA 2OZUA 5ED4A 4P96A 3DEUA 3LQRA 2HQNA 1IN4A 4Q4ZF 4RB1A 2P5VA 3G73A 4WXCA 3F72A 3K1PA 1T6SA 1SD7A 2OQRA 4M6XA 2ADUA 2L4AA 3EYYA 5DYMA 3QU3A 3LA7A 4HLYA 4IHSA 1P2FA 1YO5C 3BPXA 3DQVC 2NNYA 1IXCA 1Z6RA 4CICA 2ISYA 2KIMA 2O03A 3WTWC 4EVIA 5K5RA 1FX7A 4WCGA 2PG4A 5JR3A 3FWEA 1H9GA 4YFNF 4NQWA 2DPDA 2GA2A 3DPLC 3MAJA 1V4RA 3C18A 3BPVA 1K6OA 4HF1A 1ZYRF 5AONA 4ENKA 3ZMVA 2X0LA 2Y48A 2HFHA 2G7HA 3RKWA 3C7JA 1ULYA 4HZFA 4M74A 1MKMA 2R7DA 2VN2A 1RIOH 4CHUA 1JHHA 2QWWA 2Q8KA 3JSOA 3R61A 2ZNZA 1B59A 3ABUA 1WRJA 1ZN2A 2QQ9A 4MTEA 3GW2A 1KU9A 1T38A 1RNLA 4N9HA 2F5CA 4HOBA 2LF7A 2FBHA 2P8TA 5K5QA 4BHBA 1FY7A 2GIVA 4DNCA 2H6CA 3R6SA 2OZ6A 5F64A 5KVRA 5HLHA 4UXNA 5CVVA 3RIRA 3GVAA 2JT1A 2EA4A 5HLIA 1I5ZA 2LNBA 3H92A 3P9CA 1TQIA 3QPTA 4MTDA 4YIIA 4KYWA 3I54A 2P4WA 3ZPLA 1R1VA 1DDNA 2K4BA 2OU2A 1BC8C 2FOKA 4OU0A 1GXPA 2K02A 4QLCU 1U5TB 3FXRA 4LLGF 4D0PA 4HQMA 1EH8A 5DD8A 1R36A 3GUDA 1ZRFA 3R0AA 5H20A 1IAWA 4S04A 2ETHA 5FB2A 4IRHA 2HTJA 6PAXA 4IPAA 2CSOA 2VONA 3J80Z 4ESJA 2OD5A 3F6OA 3TGNA 2STTA 2PN6A 3LQQA 1F9NA 3JAMK 1W5SA 1IRFA 4IF4A 1YG2A 1LDKB 3FZVA 3GYHX 2V6CA 1OYYA 3S2WA 3R60A 3V7RA 4A0YA 5BMZA 1SAXA 2QQBA 4L9JA 3VEPA 4BHCA 3CLOA 1VTNC 1D5VA 1I1SA 2Q2EA 3IRRA 3FF5A 2E7WA 1MJBA 1TBXA 1Z05A 1I6XA 3TOAA 5L3CA 1MDMB 4KT5C 3LA2A 4A12A 3I64A 3BROA 4LK1F 2NNNA 2Z3YA 2ZMEA 2XAFA 3DXJF 3ROUA 4U7BA 5FD6A 1HW5A 4PZJA 3HUGA 1SMTA 2ZJ2A 4HA8A 1D8KA 1HW1A 3I5UA 4Q48A 3KLNA 1ZLKA 1UHWA 1KU2A 2WTEA 5JFRA 2CYYA 2V1DA 5EEHA 3CUQC 3WTTC 5ICGA 1S7OA 4RAZA 3CUQA 3EUHA 1TQPA 3W6JB 4DQ2A 1ZHFA 3MQ0A 3R4KA 3NEUA 2M1BA 3FM3A 4P9UA 5CVJA 3TKYA 1GXQA 1YW9A 1H0MA 1ZG1A 4L0ZB 5ERIA 3TQNA 2RN7A 2ZFWA 3KP4A 1BIBA 1Z6TA 2HKOA 3MZHA 2FMLA 5HDGA 4R79A 1LDJA 4LJZF 1ZGJA 1F5TA 1QPMA 2QYOA 4HX7A 3I0TA 4U0WA 3FXUA 2WWYA 2HTSA 3KP2A 2IJLA 5HVQC 2ESHA 4EM0B 3QAHA 1XGSA 1F1ZA 1FC3A 4KN4X 4P55A 3TO6A 3MWMA 1TNSA 5HDKA 1O57A 4BHPA 5ILVA 4HX8A 4OIQF 1W7PD 3CO7C 2VT3A 2A69F 4XBFA 3MCZA 5DEQA 3TO9A 4L5IA 4HBLA 2H94A 3K2ZA 3DFGA 5D8LB 3F3XA 3WE2A 3SHFA 2H09A 2CQKA 3L9FA 4UHTA 2JRTA 3P9KA 4MQVA 3REOA 4M72A 3I59A 2QENA 2BYVE 4I98B 3GO5A 5E18F 1P4XA 1SFUA 1FYKA 2KIUA 3V7CA 4WWCA 4EJWA 2W25A 4WK8F 4Q47A 3HRUA 2J5OA 1G3SA 1ODDA 3N97A 5LHIA 4KN7X 2HS5A 5IT9K 3GLXA 1QNTA 5ILUA 1OPCA 5LRSA 4JK1X 4IVNA 2NRAC 4ENNA 4HF2A 4Y15A 4UUVA 4AIHA 2P5LC 2P5KA 4MHGA 1I1GA 2XROA 3QP5A 5J8FA 1J2XA 2P6SA 1KGSA 4XRFA 2ACJA 2DBBA 3O6BB 3BP8A 2OBPA 4XLPF 2L02A 3HYIA 2YR2A 3BWGA 4UV9A 2DLLA 2XAJA 4I0BA 1SFEA 3KZZA 3CUOA 3J81K 1R7JA 3JTHA 4LD5A 2QVOA 3M1EA 1WKMA 3WTUC 5E1ZB 3DPTA 3NQOA 3RDIA 3QU6A 1OR7A 2VE9A 3KETA 1S3JA 2UXNA 1O7LA 5LLQA 4IRGA 2GAUA 3WU1B 3K69A 2XAQA 3C3WA 4NHJA 2ESNA 1FSEA 1XGNA 1X3UA 4LG0A 2RNJA 2A6EF 1RI7A 4G6QA 4FX4A 2K27A 3M8EA 4EM1A 5BPDA 3SXYA 1Q1HA 4FX0A 3BOQA 2MD5A 1J7KA 1MZBA 4HV5A 3IRQA 3HOSA 2WV0A 5DUIA 2W57A 4U0YA 3KEQA 3DV8A 4G7ZF 4BQAA 3FMSA 3EYIA 1YIOA 5HS9A 2H27A 1JGSA 1H9TA 1UFMA 1A04A 1ZLJA 2IPQX 3RYRA 4I2OA 5FFXA 5LBQA 5A2QZ 5FLXK 2EV0A 2PMUA 3Q9VA 4B8XA 2V9VA 4HQEA 5L3GA 3KCCA 1YTYA 5D6EA 3IWZA 5D5UB 1BJAA 1YW7A 5DV5A 2BV6A 2VOPA 3PQKA 3ZP5A 1LB2A 2EV6A 1XGOA 2W84A 4YFKF 3WTXC 2DU9A 1IXRC 1S8NA 2RC4A 1IN5A 3RPUA 4G6DA 4I0AA 2D2WA 1XDUA 2ZKZA 2GA1A 3Q5FA 2EJRA 4MEYF 2F2EA 4QWQA 2RVCA 3SZPA 1WWXA 1XMKA 3IWFA 1HKTA 3LAPA 4KFCA 1OKRA 2MBFA 1Y0UA 3T0YA 2JSCA 1XN7A 4M71A 1I27A 5E17F 2EWNA 3GFIA 3CDHA 2XKPA 2EFOA 4EMSA 1R22A 2B0LA 1KU7A 5E1WA 4YFXF 3VB2A 2QBYB 3SQNA 5BQTA 1WQ2A 3WGGA 1O3TA 1IN8A 3ISPA 3R0JA 2AXLA 1ZAOA 2IRFG 5E20A 1R00A 3KP5A 3O2PE 4G8XA 3VFZA 1DPRA 3PQJA 4L5JA 4A0ZA 4EGYA 4BXUA 2V1UA 3ZMUA 5CVIA 1B1BA 3VOEA 3KLOA 2VC0A 4CZZA 2DW4A 3CUQB 1XDSA 4PCQA 3ZMZA 2F5FA 2X4HA 1L0OC 3LSTA 4KDPA 1USTA 1XMAA 1PP8F 3FHZA 2XIGA 1ON2A 1YYVA 2A61A 2KIFA 3ABTA 4ON0A 1W4MA 2ZBKA 4AWXB 1P4AA 2FSWA 2EFPA 4ENMA 5ICFA 1G3TA 3ZMDA 1O3QA 1DPUA 2TDXA 2QUFA 5FLXZ 2PEXA 1QZZA 3GX4X 4GYIA 5FD5A 4Z2YA 1B6AA 2VBZA 3OOPA 5HDNA 4M9ZA 1HW2A 3IL2A 1QZYA 3V8KA 3JW4A 2VC1A 3IC7A 1B9MA 4LLNA 2FQ3A 2DTRA 1W7PB 1KYZA 3RJPA 3TOBA 1OMIA 3SFZA 1FPQA 2MA3A 4WF2A 3KZYA 2LDUA 3RKYA 3E6BA 2GXBA 1LEBA 1Z7UA 2FRHA 4RB2C 4P5OA 3ECHA 3KEOA 2STWA 4ZYEA 5D5WB 1CF7A 4AIJA 3ML6A 3U2RA 1PDNC 2VE8A 1KYWA 5TRDA 3I71A 3V8JA 3ZMTA 4AD9A 1P6RA 2YSRA 1XGMA 2Z9OA 2DT5A 5DCMB 3I59B 4M73A 2VOOA 2GZWA 2PJPA 1ZH5A 3F22A 1EH6A 2HYGD 3WTZA 1MJ9A 4HV6A 3ECOA 2UWMA 1OYIA 2RQPA 3E5XA 3FMRA 3HTSB 4RGSA 2XASA 2JZYA 1U3EM 3RYPA 1JE8A 5ICEA 5D6FA 4HDVA 2M87A 3WG9A 4GYGA 2Z5UA 4ZYGA 3KP7A 4UVAA 1L3LA 3W6KB 2A68F 1K78B 4N0BA 1STZA 2GXGA 3M7GA 2XHKA 3WE3A 1YQAA 2M45A 2HQRA 2YPRA 4U88A 3HHHA 1XB4A 3T1BA 4OMZA 4L9TA 4N9IA 2VBXA 1GHCA 1FBSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4LMY A;  4NB5 A;  4UVC A;  3HSE A;  3HRS A;  1Z91 A;  3ERE D;  1U2W A;  3TDU C;  2KJC A;  1J9I A;  1SFX A;  4HX4 A;  1YS7 A;  5BOX A;  1MDM A;  1NHA A;  4UNO A;  3LFK A;  3JAM Z;  4AIK A;  1D3Y A;  1S6L A;  5AIP A;  3PFI A;  4LB6 B;  4IXA A;  2XVC A;  3H3Z A;  4KIB A;  1B4A A;  1C0W A;  2KKO A;  1FOK A;  2ZNY A;  3HTU A;  2Z33 A;  4TV7 A;  1HKS A;  3QP6 A;  3T8R A;  2H6B A;  2VOD A;  4U7D A;  4HYE A;  4RGU A;  3F8M A;  5D8K B;  2L01 A;  5BS6 A;  5K1Y A;  4YIF A;  5HS8 A;  5H6Q A;  1HXD A;  2CW0 F;  4F7Z A;  3F8B A;  5LRR A;  1BI3 A;  1BN5 A;  3RI4 A;  1S29 A;  2P7V B;  1USS A;  3LWF A;  5JVT A;  3WTS C;  2A07 F;  3TO7 A;  5FFZ A;  1U8R A;  2MLG A;  1R1U A;  3D5L A;  3FM5 A;  3GEZ A;  3OV8 A;  1REP C;  2UZK A;  1RZ4 A;  3RPQ A;  1QGP A;  5D4S A;  1E17 A;  2HWV A;  1LVA A;  1G3W A;  1ZG3 A;  1FT9 A;  3J7A O;  1AWC A;  4HLX A;  1IZ1 A;  3L09 A;  2W85 A;  4B09 A;  2FU4 A;  4BNC A;  2HZT A;  3E3V A;  2QQA A;  2UXX A;  2YU3 A;  2Y0M A;  4R8H A;  4OIR F;  3BJO A;  3IHU A;  3U1D A;  1TLH B;  1UCR A;  5TJJ A;  1XD7 A;  4G7O F;  2COM A;  3FX3 A;  4L9N A;  1KU3 A;  1G3Y A;  3BZ6 A;  4MEX F;  1G6N A;  3F8F A;  3P7N A;  4KIG A;  3NRV A;  2MLK A;  4G7H F;  2YX4 A;  4G9Y A;  2G7U A;  2RDP A;  3M9A A;  3ZMS A;  2BE5 F;  2A6H F;  1CGP A;  5JI6 A;  3WTY C;  1TTY A;  2MH9 A;  4PGH A;  3LA3 A;  1EH7 A;  4ENJ A;  3EDP A;  1T0F A;  1QQI A;  3JTG A;  4RAY A;  1MGT A;  1TW3 A;  4PGG A;  3KE2 A;  5F6F A;  4HDU A;  1BM9 A;  3SZT A;  3E5Q A;  4IHT A;  4L18 B;  5JHU A;  1R5G A;  4Q5S F;  2KJB A;  2O8X A;  1LJ9 A;  4KMF A;  3QPH A;  1R23 A;  2D1V A;  2V1X A;  4ZZD A;  2CFX A;  3KP6 A;  4HF0 A;  2WC2 A;  2OQG A;  2XRN A;  3COA C;  1FSH A;  5CJ9 A;  2K86 A;  4EJO A;  3BJ6 A;  3GXO A;  2HEO A;  2K4J A;  4UVB A;  5HOO A;  2W24 A;  2XGX A;  2IVM A;  3F8C A;  1KQ8 A;  1O7F A;  2FA5 A;  4JQF A;  5BPI A;  4KA4 A;  5LGN A;  3L2C A;  1FP2 A;  2YX7 A;  3WTV C;  2PLY A;  1YS6 A;  1ONV A;  2BBY A;  4O3M A;  4IJA A;  2EFN A;  5CLS A;  4A6E A;  3QRF F;  4XLN F;  2LSO A;  1BIA A;  3J80 K;  3I58 A;  2GQQ A;  1BBY A;  4OOI A;  1RUN A;  4L0Y B;  1HKQ A;  5L3E A;  3K1M A;  2M5W A;  4O5V A;  1K79 A;  1KQ9 A;  4I02 A;  5IT9 Z;  1FBU A;  5H6R A;  3KFW X;  1XSX A;  4I09 A;  1QO0 D;  5L3F A;  5E8G A;  2EFW A;  4WX9 A;  2R7F A;  1BI2 A;  3I53 A;  1ZRE A;  1DUX C;  1K7A A;  3HSF A;  5FGM A;  3MZY A;  4RGX A;  4WXH A;  4ZYD A;  2JPB A;  3K1N A;  4Y17 A;  5LGU A;  2DK5 A;  2IW5 A;  4PDK A;  2LF8 A;  2GWR A;  3GZ5 A;  4LFU A;  4EJT A;  3J81 Z;  4ZZL A;  4KNY A;  4EJV A;  2IT0 A;  1J59 A;  5D5V B;  2NYX A;  2ZME B;  3L00 A;  2FBI A;  5CYV A;  3E6D A;  1CF7 B;  3F6V A;  4I7H A;  3V8L A;  1TW2 A;  1BI1 A;  1U78 A;  2M8E A;  2ZXJ A;  4FT8 A;  2V79 A;  3EQL F;  4M6Y A;  4A5M A;  2OAZ A;  2A3S A;  3F23 A;  2P7C B;  4OMY A;  2IA0 A;  4GGG A;  5K5O A;  5E1X A;  2HKX A;  3N4M A;  2PMH A;  1HST A;  4BAY A;  1ZG5 A;  2L54 A;  2J5P A;  2CWE A;  3IKT A;  4OIO F;  1MD0 A;  5LGT A;  4AVP A;  1LQ1 A;  2PBI A;  1ZRD A;  4ESB A;  2PQ8 A;  3P9I A;  1T39 A;  4BH9 A;  2FMY A;  4ESF A;  1PP7 U;  2QM3 A;  3WGI A;  4OIP F;  2ISZ A;  1IRG A;  4IRI A;  4EV0 A;  1IXS B;  1R5H A;  4MGR A;  3F8N A;  1FBQ A;  4XSZ F;  1Z1D A;  3V7S A;  3AAF A;  3HRM A;  5E8I A;  1J5Y A;  3V4G A;  1SMY F;  1XCV A;  4P9F A;  1IN7 A;  3Q9S A;  2D45 A;  1UB9 A;  3MEX A;  2RGV A;  2NAZ A;  1UHM A;  3GFM A;  1XSV A;  1P92 A;  3BDD A;  1J0R A;  1LEA A;  1HQC A;  1FWZ A;  3GZ6 A;  2FNA A;  4LK0 F;  1E2X A;  4RGR A;  2FE3 A;  4RB3 C;  1T98 A;  2EFQ A;  3KP3 A;  5J8C A;  2BGC A;  5HLG A;  2XUB A;  4XSX F;  2BEO A;  5HS7 A;  4LLL A;  1YLF A;  5D5X B;  1FZP B;  3O3K A;  2QBY A;  3U9G A;  1OYW A;  3WU0 A;  1QBJ A;  1PUE E;  3LAJ A;  2DO7 A;  1XCB A;  3K9T A;  4EJU A;  2FXA A;  4A2U A;  1U5T C;  3CTA A;  4CDG A;  4S05 A;  3CO6 C;  1U5T A;  2E1C A;  1IN6 A;  3RKX A;  2R3S A;  1GVJ A;  3H3U A;  4CXF A;  2VBY A;  5F1R A;  2O6G E;  2XAG A;  5CVU A;  2M30 A;  2RKH A;  2EB7 A;  3T8T A;  2CO5 A;  3E6C C;  3M8F A;  5CVR A;  2ELH A;  4KUM A;  3E6M A;  2ZCW A;  3ELK A;  2CGP A;  4EQQ A;  2FNP A;  5DDG A;  2NS0 A;  1B9N A;  2JPC A;  1FP1 D;  4A0X A;  5L3B A;  1SD4 A;  1Z9C A;  2EK5 A;  1R1T A;  1BC7 C;  1D8J A;  5DCF A;  1O3R A;  2P6T A;  2CG4 A;  2Z99 A;  1R58 A;  2PI0 A;  5DUK A;  4GXO A;  3C1D A;  3L7W A;  1BI0 A;  2IP2 A;  1ZGA A;  3RTR A;  1XSD A;  3BY6 A;  2O3F A;  1W7P A;  3HHG A;  2XV4 S;  4L9V A;  1JHF A;  2QZ8 A;  2Q0O A;  4CGZ A;  4A5N A;  3CJN A;  1T2K A;  3HIF A;  2MC3 A;  2HDC A;  3MFK A;  4CO8 A;  3DF8 A;  2G9W A;  2K7L A;  1FYM A;  4O6J A;  3VOD A;  1YFH A;  3WOD F;  4LG0 B;  4GCV A;  1HBX G;  1TNT A;  2XKO A;  3B02 A;  5L3D A;  5ILS A;  2L4M A;  4ZYH A;  2HR3 A;  4I01 A;  2HYF A;  1ON1 A;  4K2E A;  2FF4 A;  2IA2 A;  1YW8 A;  2XAH A;  4WXD A;  4KMU X;  1KQ0 A;  2Y75 A;  3G3Z A;  2JTV A;  1S7A A;  5DCM A;  5A2Q K;  4BYY A;  4CYD A;  4A6D A;  2E1N A;  5IT3 A;  2D1H A;  2LKP A;  3ULQ B;  4M9X A;  3BJA A;  3ZN1 A;  1P4W A;  2ZO4 A;  2IA1 A;  2O0Y A;  1WSU A;  1ZRC A;  3HSR A;  2E7X A;  2DQL A;  3GF2 A;  4GO1 A;  1G4D A;  2EA2 A;  3HOT A;  3ZN0 A;  4ZH4 F;  1BOA A;  4ASN A;  2QLZ A;  2O61 A;  2DI3 A;  1JXS A;  1WI9 A;  4ETS A;  1FLI A;  2DK8 A;  3E97 A;  2A5Y B;  4U0V A;  1TQM A;  2VXZ A;  5LHH A;  3FMQ A;  1K78 A;  4M9S A;  2MH2 A;  1F4K A;  2KRF A;  4EM2 A;  4G94 A;  1EV7 A;  1U6G A;  2F5D A;  1IW7 F;  5DD4 A;  1V3F A;  4HW0 A;  1MJA A;  3B73 A;  4KIC A;  3GWZ A;  2PFB A;  4R1H A;  1DP7 P;  2DQR A;  4HAM A;  1SD5 A;  5LEJ A;  1IF1 A;  2VBW A;  2FEZ A;  1J75 A;  4UV8 A;  5AIQ A;  3GFL A;  3IKV A;  1AOY A;  5ICC A;  4OIN F;  2FBK A;  1FYL A;  2DFI A;  4E70 A;  1FNN A;  3DKW A;  1KA8 A;  4RS8 A;  3T5X A;  3WGH A;  4KIF A;  4JBA A;  3K0L A;  3I4P A;  1IUY A;  2HGC A;  3D0S A;  5D4R A;  5LEK A;  1W5T A;  2EV5 A;  3GFJ A;  4H0E A;  2OA4 A;  3DP7 A;  5J6X A;  4MQ9 F;  2HOE A;  2L3D A;  2AS5 F;  2DAO A;  2VT2 A;  5LHG A;  1ZAR A;  5EEG A;  1SD6 A;  5FO5 A;  1LDD A;  1LNW A;  4EGZ A;  4YG2 F;  3FXQ A;  1HSJ A;  4RB0 A;  3ZQ7 A;  4MNU A;  5KK1 A;  3EET A;  2C6Y A;  1O3S A;  3TDZ C;  3HRT A;  3E5U A;  4Y13 A;  3QOP A;  2F5E A;  3JSP A;  4LB5 A;  3F21 A;  4FHT A;  4LGW A;  2RV8 A;  1RUO A;  2DPU A;  2OZU A;  5ED4 A;  4P96 A;  3DEU A;  3LQR A;  2HQN A;  1IN4 A;  4Q4Z F;  4RB1 A;  2P5V A;  3G73 A;  4WXC A;  3F72 A;  3K1P A;  1T6S A;  1SD7 A;  2OQR A;  4M6X A;  2ADU A;  2L4A A;  3EYY A;  5DYM A;  3QU3 A;  3LA7 A;  4HLY A;  4IHS A;  1P2F A;  1YO5 C;  3BPX A;  3DQV C;  2NNY A;  1IXC A;  1Z6R A;  4CIC A;  2ISY A;  2KIM A;  2O03 A;  3WTW C;  4EVI A;  5K5R A;  1FX7 A;  4WCG A;  2PG4 A;  5JR3 A;  3FWE A;  1H9G A;  4YFN F;  4NQW A;  2DPD A;  2GA2 A;  3DPL C;  3MAJ A;  1V4R A;  3C18 A;  3BPV A;  1K6O A;  4HF1 A;  1ZYR F;  5AON A;  4ENK A;  3ZMV A;  2X0L A;  2Y48 A;  2HFH A;  2G7H A;  3RKW A;  3C7J A;  1ULY A;  4HZF A;  4M74 A;  1MKM A;  2R7D A;  2VN2 A;  1RIO H;  4CHU A;  1JHH A;  2QWW A;  2Q8K A;  3JSO A;  3R61 A;  2ZNZ A;  1B59 A;  3ABU A;  1WRJ A;  1ZN2 A;  2QQ9 A;  4MTE A;  3GW2 A;  1KU9 A;  1T38 A;  1RNL A;  4N9H A;  2F5C A;  4HOB A;  2LF7 A;  2FBH A;  2P8T A;  5K5Q A;  4BHB A;  1FY7 A;  2GIV A;  4DNC A;  2H6C A;  3R6S A;  2OZ6 A;  5F64 A;  5KVR A;  5HLH A;  4UXN A;  5CVV A;  3RIR A;  3GVA A;  2JT1 A;  2EA4 A;  5HLI A;  1I5Z A;  2LNB A;  3H92 A;  3P9C A;  1TQI A;  3QPT A;  4MTD A;  4YII A;  4KYW A;  3I54 A;  2P4W A;  3ZPL A;  1R1V A;  1DDN A;  2K4B A;  2OU2 A;  1BC8 C;  2FOK A;  4OU0 A;  1GXP A;  2K02 A;  4QLC U;  1U5T B;  3FXR A;  4LLG F;  4D0P A;  4HQM A;  1EH8 A;  5DD8 A;  1R36 A;  3GUD A;  1ZRF A;  3R0A A;  5H20 A;  1IAW A;  4S04 A;  2ETH A;  5FB2 A;  4IRH A;  2HTJ A;  6PAX A;  4IPA A;  2CSO A;  2VON A;  3J80 Z;  4ESJ A;  2OD5 A;  3F6O A;  3TGN A;  2STT A;  2PN6 A;  3LQQ A;  1F9N A;  3JAM K;  1W5S A;  1IRF A;  4IF4 A;  1YG2 A;  1LDK B;  3FZV A;  3GYH X;  2V6C A;  1OYY A;  3S2W A;  3R60 A;  3V7R A;  4A0Y A;  5BMZ A;  1SAX A;  2QQB A;  4L9J A;  3VEP A;  4BHC A;  3CLO A;  1VTN C;  1D5V A;  1I1S A;  2Q2E A;  3IRR A;  3FF5 A;  2E7W A;  1MJB A;  1TBX A;  1Z05 A;  1I6X A;  3TOA A;  5L3C A;  1MDM B;  4KT5 C;  3LA2 A;  4A12 A;  3I64 A;  3BRO A;  4LK1 F;  2NNN A;  2Z3Y A;  2ZME A;  2XAF A;  3DXJ F;  3ROU A;  4U7B A;  5FD6 A;  1HW5 A;  4PZJ A;  3HUG A;  1SMT A;  2ZJ2 A;  4HA8 A;  1D8K A;  1HW1 A;  3I5U A;  4Q48 A;  3KLN A;  1ZLK A;  1UHW A;  1KU2 A;  2WTE A;  5JFR A;  2CYY A;  2V1D A;  5EEH A;  3CUQ C;  3WTT C;  5ICG A;  1S7O A;  4RAZ A;  3CUQ A;  3EUH A;  1TQP A;  3W6J B;  4DQ2 A;  1ZHF A;  3MQ0 A;  3R4K A;  3NEU A;  2M1B A;  3FM3 A;  4P9U A;  5CVJ A;  3TKY A;  1GXQ A;  1YW9 A;  1H0M A;  1ZG1 A;  4L0Z B;  5ERI A;  3TQN A;  2RN7 A;  2ZFW A;  3KP4 A;  1BIB A;  1Z6T A;  2HKO A;  3MZH A;  2FML A;  5HDG A;  4R79 A;  1LDJ A;  4LJZ F;  1ZGJ A;  1F5T A;  1QPM A;  2QYO A;  4HX7 A;  3I0T A;  4U0W A;  3FXU A;  2WWY A;  2HTS A;  3KP2 A;  2IJL A;  5HVQ C;  2ESH A;  4EM0 B;  3QAH A;  1XGS A;  1F1Z A;  1FC3 A;  4KN4 X;  4P55 A;  3TO6 A;  3MWM A;  1TNS A;  5HDK A;  1O57 A;  4BHP A;  5ILV A;  4HX8 A;  4OIQ F;  1W7P D;  3CO7 C;  2VT3 A;  2A69 F;  4XBF A;  3MCZ A;  5DEQ A;  3TO9 A;  4L5I A;  4HBL A;  2H94 A;  3K2Z A;  3DFG A;  5D8L B;  3F3X A;  3WE2 A;  3SHF A;  2H09 A;  2CQK A;  3L9F A;  4UHT A;  2JRT A;  3P9K A;  4MQV A;  3REO A;  4M72 A;  3I59 A;  2QEN A;  2BYV E;  4I98 B;  3GO5 A;  5E18 F;  1P4X A;  1SFU A;  1FYK A;  2KIU A;  3V7C A;  4WWC A;  4EJW A;  2W25 A;  4WK8 F;  4Q47 A;  3HRU A;  2J5O A;  1G3S A;  1ODD A;  3N97 A;  5LHI A;  4KN7 X;  2HS5 A;  5IT9 K;  3GLX A;  1QNT A;  5ILU A;  1OPC A;  5LRS A;  4JK1 X;  4IVN A;  2NRA C;  4ENN A;  4HF2 A;  4Y15 A;  4UUV A;  4AIH A;  2P5L C;  2P5K A;  4MHG A;  1I1G A;  2XRO A;  3QP5 A;  5J8F A;  1J2X A;  2P6S A;  1KGS A;  4XRF A;  2ACJ A;  2DBB A;  3O6B B;  3BP8 A;  2OBP A;  4XLP F;  2L02 A;  3HYI A;  2YR2 A;  3BWG A;  4UV9 A;  2DLL A;  2XAJ A;  4I0B A;  1SFE A;  3KZZ A;  3CUO A;  3J81 K;  1R7J A;  3JTH A;  4LD5 A;  2QVO A;  3M1E A;  1WKM A;  3WTU C;  5E1Z B;  3DPT A;  3NQO A;  3RDI A;  3QU6 A;  1OR7 A;  2VE9 A;  3KET A;  1S3J A;  2UXN A;  1O7L A;  5LLQ A;  4IRG A;  2GAU A;  3WU1 B;  3K69 A;  2XAQ A;  3C3W A;  4NHJ A;  2ESN A;  1FSE A;  1XGN A;  1X3U A;  4LG0 A;  2RNJ A;  2A6E F;  1RI7 A;  4G6Q A;  4FX4 A;  2K27 A;  3M8E A;  4EM1 A;  5BPD A;  3SXY A;  1Q1H A;  4FX0 A;  3BOQ A;  2MD5 A;  1J7K A;  1MZB A;  4HV5 A;  3IRQ A;  3HOS A;  2WV0 A;  5DUI A;  2W57 A;  4U0Y A;  3KEQ A;  3DV8 A;  4G7Z F;  4BQA A;  3FMS A;  3EYI A;  1YIO A;  5HS9 A;  2H27 A;  1JGS A;  1H9T A;  1UFM A;  1A04 A;  1ZLJ A;  2IPQ X;  3RYR A;  4I2O A;  5FFX A;  5LBQ A;  5A2Q Z;  5FLX K;  2EV0 A;  2PMU A;  3Q9V A;  4B8X A;  2V9V A;  4HQE A;  5L3G A;  3KCC A;  1YTY A;  5D6E A;  3IWZ A;  5D5U B;  1BJA A;  1YW7 A;  5DV5 A;  2BV6 A;  2VOP A;  3PQK A;  3ZP5 A;  1LB2 A;  2EV6 A;  1XGO A;  2W84 A;  4YFK F;  3WTX C;  2DU9 A;  1IXR C;  1S8N A;  2RC4 A;  1IN5 A;  3RPU A;  4G6D A;  4I0A A;  2D2W A;  1XDU A;  2ZKZ A;  2GA1 A;  3Q5F A;  2EJR A;  4MEY F;  2F2E A;  4QWQ A;  2RVC A;  3SZP A;  1WWX A;  1XMK A;  3IWF A;  1HKT A;  3LAP A;  4KFC A;  1OKR A;  2MBF A;  1Y0U A;  3T0Y A;  2JSC A;  1XN7 A;  4M71 A;  1I27 A;  5E17 F;  2EWN A;  3GFI A;  3CDH A;  2XKP A;  2EFO A;  4EMS A;  1R22 A;  2B0L A;  1KU7 A;  5E1W A;  4YFX F;  3VB2 A;  2QBY B;  3SQN A;  5BQT A;  1WQ2 A;  3WGG A;  1O3T A;  1IN8 A;  3ISP A;  3R0J A;  2AXL A;  1ZAO A;  2IRF G;  5E20 A;  1R00 A;  3KP5 A;  3O2P E;  4G8X A;  3VFZ A;  1DPR A;  3PQJ A;  4L5J A;  4A0Z A;  4EGY A;  4BXU A;  2V1U A;  3ZMU A;  5CVI A;  1B1B A;  3VOE A;  3KLO A;  2VC0 A;  4CZZ A;  2DW4 A;  3CUQ B;  1XDS A;  4PCQ A;  3ZMZ A;  2F5F A;  2X4H A;  1L0O C;  3LST A;  4KDP A;  1UST A;  1XMA A;  1PP8 F;  3FHZ A;  2XIG A;  1ON2 A;  1YYV A;  2A61 A;  2KIF A;  3ABT A;  4ON0 A;  1W4M A;  2ZBK A;  4AWX B;  1P4A A;  2FSW A;  2EFP A;  4ENM A;  5ICF A;  1G3T A;  3ZMD A;  1O3Q A;  1DPU A;  2TDX A;  2QUF A;  5FLX Z;  2PEX A;  1QZZ A;  3GX4 X;  4GYI A;  5FD5 A;  4Z2Y A;  1B6A A;  2VBZ A;  3OOP A;  5HDN A;  4M9Z A;  1HW2 A;  3IL2 A;  1QZY A;  3V8K A;  3JW4 A;  2VC1 A;  3IC7 A;  1B9M A;  4LLN A;  2FQ3 A;  2DTR A;  1W7P B;  1KYZ A;  3RJP A;  3TOB A;  1OMI A;  3SFZ A;  1FPQ A;  2MA3 A;  4WF2 A;  3KZY A;  2LDU A;  3RKY A;  3E6B A;  2GXB A;  1LEB A;  1Z7U A;  2FRH A;  4RB2 C;  4P5O A;  3ECH A;  3KEO A;  2STW A;  4ZYE A;  5D5W B;  1CF7 A;  4AIJ A;  3ML6 A;  3U2R A;  1PDN C;  2VE8 A;  1KYW A;  5TRD A;  3I71 A;  3V8J A;  3ZMT A;  4AD9 A;  1P6R A;  2YSR A;  1XGM A;  2Z9O A;  2DT5 A;  5DCM B;  3I59 B;  4M73 A;  2VOO A;  2GZW A;  2PJP A;  1ZH5 A;  3F22 A;  1EH6 A;  2HYG D;  3WTZ A;  1MJ9 A;  4HV6 A;  3ECO A;  2UWM A;  1OYI A;  2RQP A;  3E5X A;  3FMR A;  3HTS B;  4RGS A;  2XAS A;  2JZY A;  1U3E M;  3RYP A;  1JE8 A;  5ICE A;  5D6F A;  4HDV A;  2M87 A;  3WG9 A;  4GYG A;  2Z5U A;  4ZYG A;  3KP7 A;  4UVA A;  1L3L A;  3W6K B;  2A68 F;  1K78 B;  4N0B A;  1STZ A;  2GXG A;  3M7G A;  2XHK A;  3WE3 A;  1YQA A;  2M45 A;  2HQR A;  2YPR A;  4U88 A;  3HHH A;  1XB4 A;  3T1B A;  4OMZ A;  4L9T A;  4N9I A;  2VBX A;  1GHC A;  1FBS A; 
#chains in the Genus database with same CATH topology
 2EZH A;  4LMY A;  5B3S H;  3MKL A;  4NB5 A;  5F27 A;  1ZR4 A;  4UVC A;  4IEJ A;  1WH5 A;  3HSE A;  2X9D A;  2CRG A;  3HRS A;  2LLK A;  1Z91 A;  5GTI C;  3CES A;  1WFX A;  4PSW A;  3ERE D;  2RRE A;  1U2W A;  3OYK A;  3TDU C;  2Z1D A;  2WY8 Q;  2QA4 I;  3VYU B;  2KJC A;  2E5Z A;  1J9I A;  1SFX A;  4HX4 A;  1YS7 A;  5BOX A;  1MDM A;  1S5L C;  1NHA A;  2DMT A;  1XTA A;  3N05 A;  1Z77 A;  4UNO A;  3LFK A;  1U0J A;  3JAM Z;  2H8W A;  4AIK A;  3SEZ A;  1D3Y A;  3FXJ A;  5EGO A;  4D1Q A;  1S6L A;  3MN2 A;  5AIP A;  3PFI A;  4LB6 B;  2R93 J;  4IXA A;  4RA2 A;  2XVC A;  1LKX A;  3H3Z A;  4KIB A;  3S8P A;  1B4A A;  4CCM A;  2ZJP F;  2ME0 A;  4CCJ A;  3FHN A;  1C0W A;  3VYT B;  2KKO A;  1FOK A;  3K7A J;  4ZJZ A;  2ZNY A;  3HTU A;  2Z33 A;  2HDW A;  1HKS A;  4TV7 A;  1R71 A;  3QP6 A;  1OCZ H;  2BHZ A;  3T8R A;  2H6B A;  2E35 A;  2VOD A;  4U7D A;  4HYE A;  4RGU A;  3F8M A;  1Y0N A;  1QRY A;  3W2A A;  1ZTR A;  5D8K B;  2L01 A;  5BS6 A;  5K1Y A;  4YIF A;  5HS8 A;  5H6Q A;  3DTK A;  1HXD A;  3KYC B;  2CW0 F;  4F7Z A;  2ZC2 A;  1MND A;  3OSF A;  1MBK A;  3F8B A;  5LRR A;  1BI3 A;  1BN5 A;  3RI4 A;  1S29 A;  2P7V B;  2N8G A;  4W1U A;  3WG7 H;  1USS A;  4E7J A;  1QPI A;  3LWF A;  5JVT A;  4PJM A;  3WTS C;  2A07 F;  3TO7 A;  3BQZ A;  5FFZ A;  1U8R A;  2MLG A;  4Z6Y A;  2JA7 J;  1R1U A;  2AQF A;  3W2V A;  3IV5 A;  3GTK J;  3D5L A;  1IDZ A;  1A6Q A;  2QCO A;  2IS6 A;  1S7E A;  3FM5 A;  3GEZ A;  3OV8 A;  1REP C;  2UZK A;  1LE8 A;  1HDD C;  3VPR A;  1RZ4 A;  1BR1 A;  3RPQ A;  3AG1 H;  1QGP A;  3LSK A;  5D4S A;  1E17 A;  2HWV A;  3DBL B;  2WBM A;  4M3B A;  5FRN A;  1LVA A;  1G3W A;  1ZG3 A;  1FT9 A;  3HJE A;  3J7A O;  1AWC A;  4HLX A;  2IXS A;  1IZ1 A;  3L09 A;  2W85 A;  4B09 A;  3OYI A;  2CH0 A;  2FU4 A;  4XRS G;  3PSF A;  5IP9 J;  4Y4R A;  4BNC A;  2HZT A;  3E3V A;  2QQA A;  1BJZ A;  2UXX A;  2YU3 A;  2ZXH A;  4BUP A;  2Y0M A;  3OWT A;  4R8H A;  4OIR F;  3BJO A;  3IHU A;  3A0B C;  2DFF A;  1IRZ A;  3U1D A;  4IOC F;  2BVL A;  2R5Z A;  4B1R A;  2R7U A;  5GAD J;  3Q0V A;  1TLH B;  1VQO I;  1UCR A;  5TJJ A;  1XD7 A;  3WHB A;  2COM A;  3DU6 A;  3QQA A;  4G7O F;  3FX3 A;  2ECC A;  3ESW B;  4MLO A;  5FLM J;  3K2A A;  4L9N A;  1KU3 A;  1G3Y A;  3BZ6 A;  4E7Z A;  3CCE I;  1YHQ I;  4GDF A;  4MEX F;  1G6N A;  3MVP A;  4JX6 A;  5KNL A;  3F8F A;  3P7N A;  2VQG A;  4NQW B;  3BR6 A;  4KIG A;  5IYC J;  3NRV A;  2MLK A;  4G7H F;  2YX4 A;  1UG2 A;  2K3P A;  3ASN H;  4G9Y A;  2G7U A;  2V6E A;  2RDP A;  3M9A A;  3ZMS A;  3PFY A;  1DP3 A;  1OCP A;  2VL8 A;  3JRA A;  2BE5 F;  2A6H F;  2ELK A;  5JI6 A;  2VJ4 A;  1CQT A;  1CGP A;  4C3J J;  1E3H A;  5F0H A;  3WTY C;  1TTY A;  4BBR J;  2MH9 A;  4PGH A;  1WVR A;  3LA3 A;  2E2H J;  1E3P A;  1XC5 A;  2XGC A;  3EPZ A;  4RMN A;  3ZQQ A;  1EH7 A;  4ENJ A;  5TIS C;  5EZH A;  2EH3 A;  1T0F A;  3EDP A;  1QQI A;  1WGX A;  3OIQ A;  3JRI A;  2TCT A;  3JTG A;  4RAY A;  1MGT A;  1TW3 A;  2DDA A;  3A01 B;  4PGG A;  3M07 A;  1P7I A;  3KE2 A;  5F6F A;  4HDU A;  1BM9 A;  3BG5 A;  3E5Q A;  3SZT A;  2PMZ A;  4IHT A;  1Q1V A;  4L18 B;  4A3L J;  3AG4 H;  5JHU A;  1R5G A;  4A3B J;  4Q5S F;  4B4C A;  1QHH D;  2KJB A;  2DTZ A;  2Y0S A;  2O8X A;  4F52 A;  1LJ9 A;  5HNH A;  4KMF A;  2QSF X;  3HC7 A;  3QPH A;  3H0G J;  1R23 A;  2D1V A;  2V1X A;  3HGG A;  4ZZD A;  2VQH A;  2CFX A;  3BG7 A;  3KP6 A;  4HF0 A;  2WC2 A;  3BR1 A;  1MMS A;  3LSM A;  2EPF A;  4N4O B;  3ZR8 X;  2OQG A;  2XRN A;  3COA C;  3OYB A;  1JKR C;  1FSH A;  1OCO H;  2HDD A;  1ZKG A;  5CJ9 A;  2K86 A;  2QF7 A;  4EJO A;  3BJ6 A;  3GXO A;  1XPX A;  1FMW A;  3GLL A;  4CZC A;  1GLN A;  3L2W A;  3LSH A;  2E5N A;  2HEO A;  2K4J A;  2QQ8 A;  2KZG A;  4UVB A;  2VQC A;  1WJE A;  2E1M B;  3DBR B;  5FRO A;  5HOO A;  3CP2 A;  2W24 A;  2XGX A;  3IAM 2;  4HRI A;  2IVM A;  3L2V A;  4DBQ A;  2B9S A;  3F8C A;  1KQ8 A;  5JLX A;  1O7F A;  1LVK A;  2FA5 A;  4JQF A;  2GLO A;  5BPI A;  4KA4 A;  5LGN A;  3L2C A;  1FP2 A;  2YX7 A;  4AID A;  3WTV C;  1YS6 A;  5CPR B;  2PLY A;  1ONV A;  2BBY A;  4O3M A;  2ZJQ F;  4IJA A;  4OAY A;  5B66 C;  2EFN A;  3VWB A;  3G1L A;  5CLS A;  3KIO A;  4A6E A;  3QRF F;  4XLN F;  2LSO A;  1BIA A;  3J80 K;  2E19 A;  3JRE A;  3I58 A;  2GQQ A;  1BBY A;  3FXK A;  2YS9 A;  1ETX A;  3FIW A;  2CV0 A;  4OOI A;  1Y6I A;  4AU7 A;  4IKF A;  3OIO A;  1RUN A;  3CDI A;  4L0Y B;  1T95 A;  1HKQ A;  1BR2 A;  3RCO A;  4B3A A;  3M3Y J;  5L3E A;  1HCR A;  3BQY A;  2L7K A;  3K1M A;  2V1N A;  3S1R J;  3OS2 A;  2M5W A;  4O5V A;  1K79 A;  3H3V K;  1X3W B;  2DA3 A;  1KQ9 A;  4I02 A;  2X6O A;  5IT9 Z;  1ZEL A;  1FBU A;  1OCC H;  4ZDP A;  3IUO A;  1JKP C;  5H6R A;  3KFW X;  3O8H A;  1XSX A;  4I09 A;  1QO0 D;  2HOA A;  5IYB J;  5E8G A;  5L3F A;  1I3A A;  4XL9 A;  2EFW A;  4WX9 A;  2K9N A;  2R7F A;  1BI2 A;  2VJJ A;  4QPO A;  3I53 A;  2V7F A;  3RPU D;  1ZRE A;  3ZQI A;  5FKK A;  1R9T J;  2L7Z A;  1DUX C;  1K7A A;  3AG2 H;  3HSF A;  5FGM A;  3A2K A;  2HPM A;  3BTJ A;  3MZY A;  2JMW A;  4E7I A;  3QOE A;  1V5E A;  3OIP A;  3RKQ A;  4RGX A;  2AO9 A;  4WXH A;  4ZYD A;  2W1O A;  4NUB A;  2JPB A;  3K1N A;  5EG0 B;  4Y17 A;  3ZQH A;  5LGU A;  2JVG A;  4Y7N J;  2DK5 A;  2IW5 A;  3CF2 A;  1A5J A;  2KQR A;  3PJR A;  4PDK A;  2LF8 A;  2GWR A;  2DDB A;  2ICW G;  2Q2E B;  3GZ5 A;  4UUS B;  3BR3 A;  4LFU A;  2E2J J;  4EJT A;  3J81 Z;  4ZZL A;  4KNY A;  3GCM A;  2HXI A;  3L2R A;  3D1N I;  4EJV A;  1ETQ A;  1RET A;  2DJN A;  2D5V A;  3BG6 A;  2IT0 A;  4MFD A;  3F0C A;  1J59 A;  5D5V B;  2NYX A;  2ZME B;  2XB5 A;  3L00 A;  5FKO A;  2FBI A;  2HI3 A;  1WHU A;  2XC7 A;  5CYV A;  3E6D A;  4BXX J;  1CF7 B;  2JVH A;  4BU2 A;  2QKL B;  3HPH A;  3QYF A;  2IS4 A;  3F6V A;  2OPT A;  4I7H A;  3V8L A;  1I3Q J;  2HZD A;  1TW2 A;  1BI1 A;  1FMV A;  1U78 A;  1X2N A;  2M8E A;  2UUZ A;  2ZXJ A;  2V9K A;  3FBI B;  4FT8 A;  5EEA A;  4RAF A;  4NC7 A;  3DLL F;  2V79 A;  3EQL F;  4M6Y A;  4IZZ A;  4JP0 A;  4A5M A;  1DQU A;  2OAZ A;  2A3S A;  3F23 A;  2P7C B;  4OMY A;  2IA0 A;  4GGG A;  5K5O A;  5E1X A;  1QVU A;  2HKX A;  3GTQ J;  1ETW A;  1JT6 A;  3N4M A;  2PMH A;  1HST A;  4BAY A;  1WJD A;  2NVX J;  1ZG5 A;  2F4M B;  2L54 A;  4II2 A;  2J5P A;  2K3F A;  1DGR M;  2CWE A;  3NAU A;  4D7M A;  3IKT A;  3LL7 A;  4OIO F;  3S15 J;  2MW8 A;  1MD0 A;  1PUF B;  4CH7 A;  5LGT A;  4AVP A;  3L1P A;  1LQ1 A;  2PBI A;  1ZRD A;  4ESB A;  3D5R C;  2PQ8 A;  3P9I A;  1T39 A;  3PUB A;  4BH9 A;  2R7O A;  1JI8 A;  1YX5 A;  5FKL A;  2DJI A;  2FMY A;  4Y52 J;  3LSJ A;  3TL4 X;  4ESF A;  1PP7 U;  2QM3 A;  3WGI A;  4OIP F;  2ISZ A;  3HOU J;  1IRG A;  4IRI A;  4EV0 A;  1JUS A;  1IXS B;  1R5H A;  3MKY B;  5GAG J;  4M3F A;  4MGR A;  2IS2 A;  3F8N A;  1FBQ A;  4I99 C;  3ABM H;  3HOX J;  4XSZ F;  1Z1D A;  3V7S A;  1TWF J;  5DM7 F;  3AAF A;  3HRM A;  4A3C J;  5E8I A;  4BJ5 C;  1V5F A;  2LBF B;  1VND A;  5E3O A;  1J5Y A;  3V4G A;  3RZD J;  1SMY F;  3LMM A;  2K9L A;  1XCV A;  2EIK H;  3G1M A;  3V42 A;  5TGT A;  3LNQ A;  4P9F A;  1IN7 A;  1ETY A;  3Q9S A;  2D45 A;  2E36 A;  2KMU A;  1YI2 I;  2EZL A;  1IDY A;  2BY1 A;  4BKX A;  1UB9 A;  3MEX A;  2RGV A;  3JRG A;  1X58 A;  2NAZ A;  1UHM A;  3FDY A;  2DMP A;  2VXD A;  3GFM A;  1X19 A;  1XSV A;  1X4P A;  1P92 A;  3BDD A;  1W36 C;  1J0R A;  1LEA A;  1HQC A;  1FWZ A;  3GZ6 A;  4J01 A;  4NBQ A;  4FQG A;  2FNA A;  4LK0 F;  1RR8 C;  1E2X A;  1SAN A;  2JUC A;  2JA2 A;  4RGR A;  3AKZ A;  2FE3 A;  4B3X A;  3OYL A;  4PSX A;  4RB3 C;  3VSL A;  3H0D A;  1T98 A;  2VJ5 A;  4HNT A;  2EFQ A;  3KP3 A;  1JT0 A;  5J8C A;  1V54 H;  2BGC A;  2X6W A;  1MW7 A;  5HLG A;  2XUB A;  5F0C A;  3H5N A;  3IH3 A;  1VQN I;  5F1J A;  1RR7 A;  4XSX F;  2BEO A;  2WAF A;  1MBF A;  4CYC A;  1IUF A;  5HS7 A;  1TP4 A;  2X6X A;  4LLL A;  1GV5 A;  1YLF A;  5D5X B;  1Z21 A;  1FZP B;  2AQE A;  4DBR A;  3O3K A;  2EIN H;  3S3N A;  2QKM B;  3C2B A;  3RSN A;  3M1C A;  3S93 A;  2QBY A;  5CQE A;  3U9G A;  4BAC A;  1MSF C;  4HSR A;  2LY9 A;  2CMP A;  4XN0 A;  4UB6 C;  4A69 C;  4F55 A;  1EA3 A;  1FTT A;  3PM1 A;  4M3E A;  3PO3 J;  1OYW A;  1VF9 A;  4DYQ A;  3OYH A;  4DIQ A;  3WU0 A;  1QBJ A;  1PUE E;  4AYB N;  3ZRG A;  1HDP A;  2QGU A;  4M3D A;  3LAJ A;  2DO7 A;  4LIV A;  5EDN A;  1XCB A;  3K9T A;  2OTL I;  1TT0 A;  4EJU A;  2FXA A;  4A2U A;  2LOO A;  1U5T C;  2V9P A;  3CTA A;  4FE4 A;  4U87 A;  4CDG A;  4S05 A;  3TW6 A;  3CO6 C;  3OR2 C;  1U5T A;  2E1C A;  1IN6 A;  3RKX A;  2R3S A;  1GVJ A;  1YX3 A;  1Y8Q B;  4DOZ A;  4DZP A;  3H3U A;  4CXF A;  3ZQL A;  2VBY A;  5F1R A;  1XX5 A;  5IOZ A;  2O6G E;  2XAG A;  5J1U A;  5CVU A;  2ZXW H;  3IH4 A;  2M30 A;  2LYC A;  2RKH A;  2EB7 A;  3T8T A;  2CO5 A;  3E6C C;  4XK4 A;  3M8F A;  5CVR A;  2ZJR F;  2ELH A;  4KUM A;  2KFD A;  4NDL A;  1TZL A;  3IP4 B;  3E6M A;  1F36 A;  1GUU A;  2ZCW A;  3ELK A;  2BY2 A;  2CGP A;  3ZCO A;  2Y30 A;  4EQQ A;  2FNP A;  5DDG A;  1SFK A;  2NS0 A;  2FX0 A;  2OCC H;  1N75 A;  1B9N A;  3BR0 A;  1QVT A;  2XPW A;  2JPC A;  3KYL A;  4KT6 A;  1FP1 D;  4A0X A;  5L3B A;  1VQM I;  2O5R A;  1O4X A;  5FLV A;  2HQA A;  1SD4 A;  1Z9C A;  1FOY A;  2EK5 A;  1R1T A;  1BC7 C;  4IHW A;  1D8J A;  5DCF A;  5GPA A;  1O3R A;  2P6T A;  4F3Q A;  2CG4 A;  2Z99 A;  4UB8 C;  1R58 A;  3A0H C;  5IPA A;  3I3L A;  4BE1 A;  1RC9 A;  4BE0 A;  2PI0 A;  5DUK A;  4UUT A;  2L9S A;  1BOB A;  2O7O A;  4GXO A;  3FXO A;  3C1D A;  1YIJ I;  3D5S C;  4KIS A;  5EZG A;  3KPH A;  3RQI A;  2OUM A;  4CCN A;  3L7W A;  1HLV A;  4C3H J;  1BI0 A;  2IP2 A;  2LVS A;  4C2U A;  1ZGA A;  3RTR A;  1B72 B;  1XSD A;  3BY6 A;  2O3F A;  5IP7 J;  1W7P A;  3HHG A;  3CLQ A;  2BZT A;  1D0Z A;  2R5Y A;  2XV4 S;  4XOR A;  4L9V A;  1JHF A;  2QZ8 A;  3BTI A;  2Q0O A;  4XNF A;  4AUX A;  4CGZ A;  4A5N A;  3IAS 2;  2DT6 A;  3CJN A;  5HOD A;  3I4N J;  2H1L A;  1T2K A;  3HIF A;  2MC3 A;  2HU9 A;  2HDC A;  3MFK A;  4CO8 A;  3DF8 A;  2R7W A;  2MGQ A;  2L2O A;  2G9W A;  2K7L A;  2OV7 A;  2VPL A;  1FYM A;  1X1C A;  4O6J A;  3VOD A;  1YFH A;  3WOD F;  4LG0 B;  1UEL B;  4GCV A;  1HBX G;  1TNT A;  2XKO A;  3B02 A;  3OL4 A;  4XKB A;  5L3D A;  5ILS A;  1AKH B;  2L4M A;  2F48 A;  4ZYH A;  2R92 J;  3OL3 A;  2R7T A;  2H8R A;  5EYR A;  2HR3 A;  4I01 A;  3WHC A;  2HYF A;  4IQ4 A;  1ON1 A;  3HPG A;  4IHV A;  4K2E A;  3S16 J;  2FF4 A;  2IA2 A;  3OYG A;  2KRC A;  1RKW A;  1YW8 A;  2XAH A;  4WXD A;  4KMU X;  1KQ0 A;  2Y75 A;  3G3Z A;  2KDZ A;  1GDT A;  2JTV A;  3JRF A;  1S7A A;  5DCM A;  3FKJ A;  5A2Q K;  2MAB A;  4BYY A;  4CYD A;  1P9Q C;  3K4B A;  4A6D A;  2E1N A;  2KL4 A;  5IT3 A;  2D1H A;  5C4X J;  2LKP A;  2AXT C;  4MFE A;  3ULQ B;  3EUK L;  2XRL A;  5M3F J;  1WJC A;  4IHY A;  4M9X A;  2M0M A;  3DPU A;  1UHS A;  3BJA A;  3ZN1 A;  1P4W A;  2JRM A;  2ZO4 A;  2IA1 A;  2O0Y A;  1WSU A;  1ZRC A;  2HQ5 A;  3HSR A;  2LC2 A;  2M7A A;  2E7X A;  3VYS B;  1JJ6 C;  2DQL A;  3GF2 A;  1RPW A;  1H88 C;  4GO1 A;  3A4C A;  1G4D A;  2KZV A;  2EA2 A;  3HOT A;  3ZN0 A;  2LKS A;  1BOA A;  4ZH4 F;  4ASN A;  4IX7 A;  1DGW Y;  2QLZ A;  2O61 A;  2DI3 A;  1JXS A;  1WI9 A;  4ETS A;  1FLI A;  1P7J A;  2DK8 A;  3AG3 H;  3E97 A;  1V5G A;  1EKE A;  2A5Y B;  4U0V A;  4ABZ A;  1TQM A;  2VXZ A;  5LHH A;  3FMQ A;  1JKQ C;  4M9S A;  2MH2 A;  1K78 A;  1F4K A;  2K40 A;  2KRF A;  1MMG A;  4EM2 A;  4G94 A;  1WJ5 A;  1EV7 A;  1U6G A;  2LR8 A;  3SDB A;  2F5D A;  1IW7 F;  1YOV B;  5DD4 A;  4QSH A;  5K7Z A;  1V3F A;  4HW0 A;  5IY5 H;  3DKY A;  4HNU A;  1MJA A;  3B73 A;  4KIC A;  3GWZ A;  1OIS A;  3AL0 B;  2WAE A;  5IYD J;  2PFB A;  3G71 I;  1MNM C;  2PX9 A;  4R1H A;  4BEH A;  4Y33 A;  2DA7 A;  4JX4 A;  1S72 I;  2JJ7 A;  3PL8 A;  1TWH J;  3HKZ N;  1DP7 P;  2DQR A;  4HAM A;  1SD5 A;  5LEJ A;  1IF1 A;  2VBW A;  3GTJ J;  2FEZ A;  1I6H J;  1J75 A;  4UV8 A;  5AIQ A;  3GFL A;  3IKV A;  4QTR A;  3JRH A;  1AOY A;  3FIS A;  5ICC A;  4OIN F;  2FBK A;  1VQP I;  4AYB A;  3K4K A;  1FYL A;  2DFI A;  4E70 A;  1FNN A;  3DKW A;  1T0F C;  2VKD A;  1KA8 A;  4RS8 A;  3T5X A;  4CCL A;  4B44 A;  3MKZ A;  2L9V A;  3WGH A;  4KIF A;  1ETK A;  3PIO F;  2VI6 A;  4JBA A;  3K0L A;  3I4P A;  1WJF A;  1IUY A;  2HGC A;  1ZQ3 P;  3D0S A;  2BY0 A;  1Y56 A;  2BVM A;  5LEK A;  5D4R A;  5M5W J;  1W5T A;  2EV5 A;  2DOA A;  3GFJ A;  3G1O A;  2DMU A;  4H0E A;  2OA4 A;  3DP7 A;  5J6X A;  5JHF A;  4MQ9 F;  2HOE A;  2L3D A;  2AS5 F;  2DAO A;  2VT2 A;  5LHG A;  1W1W E;  4M6V A;  1X1B A;  1ZAR A;  5EEG A;  1SD6 A;  1JGG A;  2CUF A;  4PJN A;  5FO5 A;  2E60 A;  2CQN A;  1LDD A;  3H35 A;  1LNW A;  3G6E I;  4EGZ A;  4YG2 F;  4A3D J;  2CFO A;  3DBH B;  3W2W A;  3EUA A;  4KIT B;  4QIW N;  4NNJ A;  2X6Y A;  3CCV I;  2DT7 B;  3HOW J;  4XIC A;  3FXQ A;  3ZQF A;  4XID A;  3VYR B;  3UKG A;  1HSJ A;  4RB0 A;  3ZQ7 A;  2B7E A;  4MNU A;  5KK1 A;  3EET A;  2C6Y A;  1O3S A;  1RKT A;  3TDZ C;  3HRT A;  3E5U A;  4Y13 A;  3QOP A;  3BR5 A;  1LFU P;  2F5E A;  3JSP A;  1BR4 A;  4LB5 A;  2CUE A;  3F21 A;  4FHT A;  1K83 J;  4LGW A;  2RV8 A;  1RUO A;  3OYJ A;  2DPU A;  2NOG A;  5EF6 A;  4V2G A;  2OZU A;  2KIQ A;  3BG3 A;  5ED4 A;  1XG1 A;  1UMQ A;  4P96 A;  5FJ8 J;  2W7N A;  1T08 B;  1RRJ A;  1AHD P;  3DEU A;  3LQR A;  4FTH A;  2HQN A;  1IN4 A;  4Q4Z F;  2NOJ B;  3CCS I;  4RB1 A;  3HBL A;  2P5V A;  1DU0 A;  3E1S A;  3HOY J;  3G73 A;  4L5E A;  3OR1 C;  3PNY A;  4WXC A;  5KAI C;  3F72 A;  3K1P A;  1T6S A;  1Y1W J;  3FK7 A;  1SD7 A;  2OQR A;  2CQ7 A;  4M6X A;  2ADU A;  2L4A A;  3EYY A;  5DYM A;  2JA6 J;  2BY3 A;  2YUS A;  2CU7 A;  3QU3 A;  1U8B A;  3LA7 A;  4HLY A;  4IHS A;  1P2F A;  2JN6 A;  3BPX A;  3DQV C;  1YO5 C;  2VQL A;  3ZOB A;  2PJR B;  2L7F P;  2NNY A;  1IXC A;  1Z6R A;  3FXM A;  4CIC A;  2ISY A;  2KIM A;  2O03 A;  3WTW C;  4EVI A;  5K5R A;  1FX7 A;  2XF5 A;  4C30 A;  1K4S A;  3GTM J;  3H5A A;  1UG0 A;  1HC8 A;  4WCG A;  3SJM A;  1X1P A;  2PG4 A;  5JR3 A;  3FWE A;  1WJB A;  4ZDL A;  3CJR B;  1H9G A;  4YFN F;  4NQW A;  2DPD A;  2GA2 A;  3DPL C;  3MAJ A;  3OYF A;  4E7H A;  1V4R A;  2L7M P;  3C18 A;  3BPV A;  1VQ6 I;  1K6O A;  4HF1 A;  1QHG A;  1ZYR F;  5J47 A;  4C2M J;  5AON A;  1SFO J;  3J7A Y;  1PJR A;  3ZMV A;  2VLA A;  2K9S A;  2X0L A;  4ENK A;  1H8A C;  2F4O B;  2Y48 A;  1HOM A;  1Y1V J;  2K5C A;  2HFH A;  1IRX A;  2A6T A;  2G7H A;  3RKW A;  5GP9 A;  2DA4 A;  3C7J A;  1K6Y A;  2X1C A;  1ULY A;  4HZF A;  4M74 A;  1S9H A;  3HB9 A;  1MKM A;  2R7D A;  2VN2 A;  1WH7 A;  3H9G A;  1RIO H;  3VSK A;  4CHU A;  2DCE A;  1JHH A;  2QWW A;  1UJ8 A;  4XLC A;  1X1A A;  3A01 A;  4ANJ A;  2Q8K A;  1TWA J;  3QPL A;  2DOE A;  3R61 A;  2ZNZ A;  3JSO A;  1B59 A;  3ABU A;  1WRJ A;  3H9Q A;  1ZN2 A;  2QQ9 A;  2WAQ N;  4MTE A;  1B8I A;  3GTO J;  1BL0 A;  3GW2 A;  1KU9 A;  4G12 A;  2CV2 A;  1T38 A;  1D1C A;  1RNL A;  4N9H A;  2F5C A;  4HOB A;  4F93 B;  2LF7 A;  2JSP A;  2FBH A;  2P8T A;  5K5Q A;  4BHB A;  1FY7 A;  2GIV A;  4F91 B;  3GTL J;  4B43 A;  4DNC A;  5C4J J;  2H6C A;  3R6S A;  2OZ6 A;  5F64 A;  5KVR A;  1N25 A;  3ONQ A;  4RBO A;  4CYC B;  5HLH A;  4UXN A;  2R7Z J;  1BW5 A;  5CVV A;  3RIR A;  3GVA A;  3CF5 F;  2JT1 A;  3HOV J;  1MBH A;  2EA4 A;  1I5Z A;  2K9Q A;  2LNB A;  2VKH A;  3H92 A;  5F04 A;  5HLI A;  5J40 A;  3P9C A;  1TQI A;  3QPT A;  4MTD A;  1I50 J;  2BXZ A;  2EIM H;  4YII A;  1VQL I;  4KYW A;  3I54 A;  1YJW I;  3ZQG A;  2P4W A;  3ZPL A;  1R1V A;  2DFH A;  1DDN A;  2VIX A;  4E6K G;  4UY8 I;  3MKW B;  2K4B A;  1D5Y A;  2EZI A;  3HG9 A;  2EQR A;  3PNV A;  3VDX A;  2OU2 A;  4IO9 F;  2VKV A;  1BC8 C;  1IGN A;  2FOK A;  4OU0 A;  2QEX I;  1GXP A;  3PUF A;  1QU3 A;  1KON A;  2K02 A;  2E71 A;  2L9N A;  1TC3 C;  2DA5 A;  4QLC U;  1K4T A;  1U5T B;  3FXR A;  4LLG F;  5B5E C;  3I56 I;  2W82 A;  4D0P A;  4HQM A;  3I9V 2;  3BCB A;  1EH8 A;  5DD8 A;  2GOX B;  2WB1 N;  2OCE A;  1R36 A;  2DFE A;  2HYJ A;  4YEL A;  2JA5 J;  2JA8 J;  2DA6 A;  3GUD A;  4FCY A;  1ZRF A;  3R0A A;  2YU9 J;  5H20 A;  2M3A A;  4BL0 B;  2TRT A;  5E3N A;  1IAW A;  4S04 A;  3DTI A;  2ETH A;  2VB6 A;  4CA0 A;  5FB2 A;  3QWL A;  5M3M J;  1POG A;  1MNE A;  3MZ8 A;  4IRH A;  3W3C A;  2HTJ A;  1X2M A;  6PAX A;  4IPA A;  3J7Y J;  2VPR A;  4BQN A;  3PIP F;  2CSO A;  2WAD A;  3K4M A;  4II3 A;  4D5C A;  5CQG A;  2VON A;  2V4J C;  1FJL A;  2LKX A;  4EEF G;  1A6I A;  3J80 Z;  3A03 A;  1TT5 B;  4ESJ A;  1SEU A;  2OD5 A;  3F6O A;  3TGN A;  2STT A;  1NG7 A;  2PN6 A;  3LQQ A;  1F9N A;  5GAE J;  2W48 A;  4CSW A;  3S2D J;  1OCT C;  2LG4 A;  3DKX A;  1MH4 A;  3JAM K;  1VQK I;  1W5S A;  1IRF A;  3BTL A;  4IF4 A;  1YG2 A;  3CZ6 A;  1DU6 A;  1LDK B;  3FZV A;  1W36 D;  4BJ6 C;  3GYH X;  4XKW A;  2FQ4 A;  2XPV A;  1JJ8 C;  2V6C A;  1OYY A;  3S2W A;  3R60 A;  3V7R A;  4A0Y A;  5B1A H;  5BMZ A;  1SAX A;  2MD0 A;  2QQB A;  4L9J A;  3VEP A;  4BHC A;  3CLO A;  1VTN C;  1D5V A;  4J19 A;  2IS1 A;  4BJT A;  1A31 A;  1I1S A;  2Q2E A;  4UUS A;  2O8K A;  3IRR A;  3FF5 A;  2E7W A;  1MJB A;  4XOP A;  2ZB9 A;  1TBX A;  1Z05 A;  1I6X A;  3TOA A;  5L3C A;  1MDM B;  3O8G A;  4KT5 C;  2R5Y B;  3LA2 A;  4A12 A;  3I64 A;  3BRO A;  1FOX A;  4LK1 F;  4GFB A;  2ZME C;  2NNN A;  2Z3Y A;  2NVY J;  5GAH J;  2Y9Z A;  2EIL H;  2ZME A;  2XAF A;  4DW6 A;  4XRM A;  1R49 A;  5EGO B;  3NWS A;  3DXJ F;  3ROU A;  4U7B A;  5FD6 A;  4XKC A;  1HW5 A;  5M5Y J;  4S0H B;  2I10 A;  4PZJ A;  2Z16 A;  2R7V A;  3HUG A;  1SMT A;  2NXN B;  3LFU A;  3S32 A;  2ZJ2 A;  3OYD A;  2LH9 A;  2COB A;  4HA8 A;  1D8K A;  1JTX A;  1MSE C;  5IP6 A;  1HW1 A;  3I5U A;  2O9L A;  2L9R A;  4Q48 A;  4BS9 A;  3KLN A;  3ZGK A;  1ZLK A;  2Y69 H;  3QOD A;  1UHW A;  1W0U A;  1KU2 A;  2V26 A;  2IGK A;  3OYE A;  2WTE A;  3S2H J;  5JFR A;  3I55 I;  1VQ7 I;  5F08 A;  2CYY A;  2V1D A;  5EEH A;  3CUQ C;  1AA7 A;  3EUH C;  3FKI J;  1S7O A;  5ICG A;  3WTT C;  3A1Y A;  4RAZ A;  3CUQ A;  4AC0 A;  3W6V A;  3EUH A;  4I6Z A;  1TQP A;  3W6J B;  3JCU C;  1BW6 A;  2DN0 A;  4DQ2 A;  1ZHF A;  3MQ0 A;  3R4K A;  1LFP A;  3KEY A;  1G8X A;  3NEU A;  1YRN A;  2M1B A;  2XGD A;  3FM3 A;  4P9U A;  1PUF A;  2R7R A;  5CVJ A;  3TKY A;  4X0G A;  1GXQ A;  3M8J A;  1YW9 A;  2G0E A;  2KIS A;  1H0M A;  1ETV A;  1ZG1 A;  4L0Z B;  3P5J A;  3GME A;  3CMM A;  4JYK A;  5ERI A;  1LE8 B;  3TQN A;  1JTY A;  2RN7 A;  2ZFW A;  3MMY B;  5JVG F;  3KP4 A;  1PYV A;  1BIB A;  1Z6T A;  2HKO A;  3MZH A;  2FML A;  4Y3O A;  5HDG A;  4R79 A;  1LDJ A;  4GRI A;  3OOU A;  4LJZ F;  4J00 A;  1ZGJ A;  4X6A J;  3OMY A;  1F5T A;  4C2T A;  2WAQ A;  1QPM A;  2QYO A;  1X1D A;  4B47 A;  1OFC X;  3HGY A;  4HX7 A;  2LBF A;  1BA5 A;  3I0T A;  3SFI A;  2CQX A;  4U0W A;  3FXU A;  2CUZ A;  2WWY A;  2IGO A;  2HTS A;  3KP2 A;  3DEW A;  2R5Z B;  2IJL A;  1Z3X A;  3FK6 A;  5HVQ C;  4RDU A;  5K7H A;  2ESH A;  5J4Y A;  4EM0 B;  3OYM A;  3QAH A;  1XGS A;  1D0Y A;  1F1Z A;  1FC3 A;  3MD2 A;  4KN4 X;  4P55 A;  4D5F A;  3TO6 A;  3MWM A;  2DYR H;  3CDL A;  1TNS A;  5HDK A;  2M9H A;  1O57 A;  2XAU A;  2WV1 A;  1WPK A;  4C3I J;  4BHP A;  5ILV A;  4HX8 A;  4OIQ F;  2OTJ I;  1W7P D;  3CCR I;  1Z3Y A;  4KJZ A;  3CO7 C;  2BW3 A;  3OYC A;  2VT3 A;  4RLQ A;  1YJ9 I;  3H5R A;  1FTZ A;  3C2H A;  2M34 A;  3CC4 I;  1VQ4 I;  2A69 F;  1UZC A;  4XBF A;  5J1R A;  3E0J B;  1SVM A;  3MCZ A;  2XPU A;  1OCR H;  5LFA A;  1OLT A;  2XF7 A;  2K85 A;  5DEQ A;  3TO9 A;  4L5I A;  3UR3 C;  4HBL A;  4D7N A;  4IQJ A;  1QZE A;  2H94 A;  3CJT B;  1W0T A;  4AM3 A;  2OF7 A;  3TW7 A;  3K2Z A;  1GT0 C;  5C3E J;  3DFG A;  2M4K A;  1NG6 A;  5D8L B;  3FBN B;  3F3X A;  4XR6 A;  3WE2 A;  3CMA I;  4NC8 A;  3G2B A;  2WB1 A;  4P1W A;  4ZTF A;  1GV2 A;  3HOZ J;  1ERD A;  3SHF A;  4JOM A;  3H36 A;  2FUG 2;  2H09 A;  2CQK A;  3L9F A;  4UHT A;  2JRT A;  2OJE D;  3S17 J;  1VFC A;  3P9K A;  4MQV A;  3REO A;  1FIP A;  4M72 A;  3IH2 A;  4DZJ A;  3I59 A;  3K4C A;  4C9Y A;  2QEN A;  2BYV E;  1IJW C;  3TP0 A;  4I98 B;  1VQ5 I;  4BGD A;  4OWR B;  3CC7 I;  3GO5 A;  5E18 F;  4PJJ A;  1P4X A;  4FET A;  1SFU A;  3S3O A;  1R5I D;  3FXL A;  1FYK A;  4EAT A;  1R4M B;  9ANT A;  2KIU A;  3V7C A;  4WWC A;  1SC7 A;  4EJW A;  2W25 A;  4WK8 F;  3S1N J;  2LFB A;  2GBY A;  4Q47 A;  3HRU A;  2CJJ A;  4LG3 A;  3K10 A;  2J5O A;  2XSD C;  4XM3 A;  3CCL I;  4X1E A;  2LY1 A;  3ZXS A;  3HZJ A;  1G3S A;  1OQY A;  1ODD A;  3N97 A;  5LHI A;  1QA6 A;  3CCU I;  4KN7 X;  1ITY A;  3HDD A;  2HS5 A;  5IT9 K;  3GLX A;  1QNT A;  4E4H A;  5ILU A;  4RAG A;  2ECB A;  1OPC A;  4FAS D;  3OS0 A;  1IO2 A;  1SVL A;  4XMY A;  2GIZ A;  1XS9 A;  4HG2 A;  5LRS A;  4JK1 X;  1U9N A;  4IVN A;  1HF0 A;  2Z2S B;  2NRA C;  3G4S I;  1N78 A;  3UNG C;  4ENN A;  2F4I A;  3HL2 A;  4XRS A;  2F5V A;  4HF2 A;  4MO7 A;  4Y15 A;  4UUV A;  2KPM A;  2M2E A;  3E7L A;  4BY1 J;  2KRH A;  4AIH A;  1D1B A;  2P5K A;  2P5L C;  4MHG A;  2VKE A;  3CCJ I;  1I1G A;  4A3G J;  2MSY A;  1Z0X A;  5KHD A;  2XRO A;  1X3Z B;  3QP5 A;  5J8F A;  1J2X A;  3L2U A;  2P6S A;  1KGS A;  1NTC A;  4H4K C;  4XRF A;  2ACJ A;  3K4N A;  2ZSH B;  1Y8R B;  3OS1 A;  2DBB A;  1T33 A;  3TMO A;  4IOA F;  1PVE A;  3O6B B;  3BP8 A;  2OBP A;  4PJ0 C;  4XLP F;  2X1E A;  2L02 A;  3HYI A;  2YR2 A;  3BWG A;  3DEE A;  1WI3 A;  4M3G A;  4UV9 A;  4JX5 A;  1LFB A;  1HA8 A;  2DLL A;  2XAJ A;  5KCM A;  5E3L A;  4I0B A;  1SFE A;  1MMA A;  2DMN A;  1RES A;  5K7F A;  3KZZ A;  2DA1 A;  3CUO A;  2GOM A;  3J81 K;  1R7J A;  3Q0W A;  3JTH A;  3S1M J;  5E79 C;  4LD5 A;  3I4M J;  2QVO A;  3M1E A;  1B72 A;  1WKM A;  5J3L A;  3WTU C;  5E1Z B;  3DPT A;  1M1E B;  3NQO A;  2DXI A;  2VUM J;  1OR7 C;  4DYR A;  2DOD A;  3RDI A;  4HEA 2;  3QU6 A;  1OR7 A;  2VE9 A;  5DTD A;  1WCM J;  4XKV A;  2CQQ A;  2GXA A;  3KET A;  1S3J A;  1TWG J;  2IGN A;  3U1K A;  2UXN A;  1O7L A;  4V2F A;  3SYT A;  5LLQ A;  4IRG A;  3KZI C;  2GAU A;  3WU1 B;  3K69 A;  2OC6 A;  2VAS A;  2XAQ A;  3OSG A;  3C3W A;  4NHJ A;  2ESN A;  1FSE A;  1FIA A;  1XGN A;  1X3U A;  4LG0 A;  2RNJ A;  3H9J A;  2QSG X;  2A6E F;  1AKH A;  2NVQ J;  3CD6 I;  1RI7 A;  1B8I B;  4G6Q A;  4FX4 A;  2K27 A;  2XF6 A;  4BXF A;  3S1Q J;  2EBI A;  3M8E A;  4EM1 A;  3JR9 A;  5BPD A;  2X1D A;  3JRB A;  3LSI A;  3SXY A;  2HVS A;  5FKM A;  1Q1H A;  4FX0 A;  3BOQ A;  2MD5 A;  3AFH A;  3DCF A;  4E7L A;  2R7X A;  1J7K A;  1MZB A;  4HV5 A;  5FRM A;  3IRQ A;  3RQ4 A;  3HOS A;  2WV0 A;  2ME6 A;  5DUI A;  2NS8 A;  2W57 A;  4U0Y A;  1VQ8 I;  2B63 J;  3KEQ A;  3ABL H;  2DYS H;  2E1O A;  1LPQ A;  1KZH A;  3DV8 A;  3QYE A;  1MMD A;  4G7Z F;  4BQA A;  3FMS A;  3EYI A;  5DS9 A;  3F9K A;  1YIO A;  5HS9 A;  1J09 A;  1JGS A;  4A3E J;  2H27 A;  4ZDO A;  1IV6 A;  1H9T A;  1UFM A;  3NWT A;  1A04 A;  1ZLJ A;  2LY2 A;  4CCK A;  2IPQ X;  3RYR A;  2CV1 A;  2X48 A;  4HNV A;  5LD2 C;  4W97 A;  2NVT J;  1ZGW A;  3KYD B;  3B6C A;  4I2O A;  2W4S A;  5FFX A;  3NAR A;  3QPS A;  4MIM A;  1ENH A;  3Q0U A;  5LBQ A;  5A2Q Z;  1IG7 A;  5FLX K;  1V55 H;  2ID3 A;  2XDV A;  2XSJ C;  4A3K J;  2WY7 Q;  2HNH A;  2EV0 A;  2PMU A;  4DJA A;  1Z7L A;  3Q9V A;  1NH3 A;  4B8X A;  1G59 A;  2BXY A;  2V9V A;  4HQE A;  2LRE A;  5CKT A;  5L3G A;  1VI0 A;  3KCC A;  1YTY A;  2JK3 A;  5D6E A;  2DA2 A;  2BOL A;  3IWZ A;  4XLA A;  5D5U B;  3BZK A;  2LD5 A;  4PFO A;  1BJA A;  1E3O C;  1YW7 A;  4NC6 A;  3AL0 C;  5DV5 A;  2BV6 A;  2VOP A;  3PQK A;  3ZP5 A;  2NVU B;  3BLY A;  1LB2 A;  3TP3 A;  2EV6 A;  1XGO A;  2W84 A;  3JRD A;  4YFK F;  3WTX C;  1I39 A;  2DU9 A;  4A3I J;  3CP8 A;  2FD5 A;  1IXR C;  4IL6 C;  1S8N A;  3ASO H;  2RC4 A;  2CW7 A;  1IN5 A;  1UAA A;  5H2F C;  3RPU A;  4G6D A;  4I0A A;  2D2W A;  2X85 A;  3K6G A;  4LIU A;  3CQZ J;  3BT9 A;  1XDU A;  4BE2 A;  3S3M A;  1W5C C;  3M4O J;  3A02 A;  3BTC A;  4YRV A;  2IBD A;  4XOT A;  2ZKZ A;  2GA1 A;  3Q5F A;  2EJR A;  1AU7 A;  4MEY F;  2F2E A;  1X4O A;  4QWQ A;  3K70 C;  3SDG A;  4FE7 A;  5J4V A;  1YJN I;  2JQ7 A;  2XGE A;  4ZTJ A;  2RVC A;  3K70 D;  3SZP A;  2K9M A;  4IHX A;  2HXO A;  2Y9Y A;  3SEQ A;  1WWX A;  4A3F J;  1XMK A;  1ACI A;  3IWF A;  1HKT A;  3LAP A;  4KFC A;  3ZQC A;  1OKR A;  3HM5 A;  2MG4 A;  2MBF A;  1Y0U A;  3T0Y A;  2CUJ A;  2JSC A;  1XN7 A;  3HXL A;  1I27 A;  4M71 A;  4BQQ A;  4BBS J;  5E17 F;  1ZR2 A;  2EWN A;  3GFI A;  3CC2 I;  5FKN A;  2LK2 A;  3CMY A;  3CDH A;  2XKP A;  2EFO A;  4EMS A;  1R22 A;  1T8I A;  1MBE A;  2B0L A;  2NS7 A;  2HOS A;  4RLF A;  1KU7 A;  4PUS A;  4HPQ A;  5E1W A;  4A3M J;  3PNT A;  4YFX F;  3VB2 A;  4A3J J;  2Q1Z B;  2QBY B;  3DU5 A;  3SQN A;  5BQT A;  1WQ2 A;  3WGG A;  1T56 A;  2VJI A;  5HLT A;  1IN8 A;  3ISP A;  2E1M C;  3R0J A;  2AXL A;  1O3T A;  3K4J A;  3CME I;  2BHY A;  3Q3S A;  5EJC A;  3LSR A;  3HUG B;  1ZAO A;  5GTH C;  2IRF G;  5E20 A;  1R00 A;  3KP5 A;  3O2P E;  4G8X A;  3SZG A;  1Y39 A;  2AHQ A;  3VFZ A;  5E3M A;  3HKZ A;  1DPR A;  2ELJ A;  3CCY A;  2L0K A;  3PQJ A;  3L2Q A;  4L5J A;  2R4G A;  4A0Z A;  1D1A A;  2CW8 A;  2L5Q A;  1K61 A;  4EGY A;  1OJL A;  4BXU A;  4D9J A;  2V1U A;  2MFZ A;  1ETO A;  1NK2 P;  2A05 A;  1U9O A;  4BY7 J;  1YE9 A;  3ZMU A;  3PSI A;  2KLO A;  3WU2 C;  4ZYA A;  2FJ1 A;  2I8D A;  5CVI A;  2ZFU A;  1B1B A;  3VOE A;  3KLO A;  1EF4 A;  2VC0 A;  4CZZ A;  2DW4 A;  3CUQ B;  2HVR A;  1XDS A;  1R6R A;  4LIT A;  2RAE A;  1MBG A;  1XMX A;  4OAZ A;  4PCQ A;  4PK4 A;  1E0E A;  3ZMZ A;  1YRN B;  2KHM A;  2JUG A;  2ZXI A;  4XN3 A;  2F5F A;  2WA0 A;  2X4H A;  1L0O C;  3DLA A;  3LST A;  4KDP A;  1UST A;  1XMA A;  1PP8 F;  1JUM A;  5DM6 F;  4XLH A;  3FHZ A;  2XIG A;  1ON2 A;  4ITV A;  1YYV A;  3LOC A;  2A61 A;  1G2H A;  2KIF A;  2RNG A;  2PJR A;  5B1B H;  3ABT A;  1F43 A;  4ON0 A;  2HPI A;  2M7B A;  5J1Y A;  4YEJ A;  1W4M A;  2ZBK A;  4AWX B;  1P4A A;  4DYC A;  2FSW A;  2EFP A;  3OY9 A;  5ICF A;  4ENM A;  1YIT I;  4RM2 A;  4RM3 A;  1EJ9 A;  1G3T A;  3ZMD A;  2LP0 A;  1O3Q A;  1DPU A;  2P81 A;  2TDX A;  5F0F A;  3GTG J;  4PJL A;  2QUF A;  2Y2Z A;  3ABK H;  5FLX Z;  1LUJ B;  2PEX A;  2E34 A;  3ERM A;  1ZK8 A;  1QZZ A;  3GX4 X;  4GYI A;  5FD5 A;  4Z2Y A;  1B6A A;  2EZK A;  2VBZ A;  3TBI A;  3OOP A;  2GM4 A;  5HDN A;  1FEX A;  4M9Z A;  1HW2 A;  4G6T B;  3IL2 A;  1QZY A;  5EG0 A;  2I5U A;  3V8K A;  3JW4 A;  2QSH X;  3BG9 A;  1JUP A;  5IOY A;  3GTP J;  2HVQ A;  2VC1 A;  3IC7 A;  1APL C;  1B9M A;  2IAI A;  2LRD A;  5KAF C;  4LLN A;  1TWC J;  2FQ3 A;  2F6C A;  5JLW A;  5M5X J;  2DTR A;  2KT0 A;  1JKO C;  1W7P B;  1KYZ A;  4LOC A;  3RJP A;  1Z67 A;  3TOB A;  3CCM I;  1OMI A;  3SFZ A;  1FPQ A;  2MA3 A;  2RQQ A;  4WF2 A;  3KZY A;  2BW3 B;  3GBG A;  2LDU A;  3RKY A;  2LTP A;  2R7Q A;  3E6B A;  2GXB A;  4XLF A;  1LEB A;  1Z7U A;  2FRH A;  4RB2 C;  4P5O A;  1N77 A;  1SVO A;  2E2I J;  3CCQ I;  1GVD A;  3ECH A;  3KEO A;  3CJQ B;  2STW A;  4ZYE A;  1A35 A;  5D5W B;  1CF7 A;  4AIJ A;  3ML6 A;  2IGM A;  3U2R A;  1MIJ A;  4XLE A;  2H1K A;  3BCA A;  1PDN C;  1FOW A;  2VE8 A;  2LMD A;  4CCO A;  3JRC A;  1KYW A;  5TRD A;  4I76 A;  2HOT A;  2MYS A;  2W00 A;  1MMN A;  3QYB A;  1TL8 A;  1D0X A;  3I71 A;  4AVZ A;  1H89 C;  5C44 J;  2X51 A;  4V19 K;  3V8J A;  4CUG A;  3TED A;  2DOF A;  3LSG A;  2MC4 A;  3ZMT A;  4AD9 A;  3B6A A;  1P6R A;  2YSR A;  1XGM A;  4YIR X;  2Z9O A;  4QPQ A;  4DGW B;  1WJA A;  2DT5 A;  3K4L A;  5DCM B;  3I59 B;  2IEK A;  4M73 A;  2KDO A;  3OYN A;  2VOO A;  2M4G A;  2GZW A;  2PJP A;  1R4N B;  3BC8 A;  3H1C A;  1ZH5 A;  3F22 A;  1EH6 A;  2HYG D;  1VZ0 A;  3KX2 A;  3DWL E;  3WTZ A;  1MJ9 A;  3DTE A;  2ZSI B;  2XB0 X;  4HV6 A;  2M0C A;  3HEF A;  3ECO A;  1NK3 P;  1MH3 A;  4F92 B;  2UWM A;  3C2G A;  1OYI A;  2RQP A;  3LSP A;  2R0Q C;  3E5X A;  3FMR A;  1A36 A;  3HTS B;  4RGS A;  4E7S A;  2XAS A;  3PO2 J;  2JZY A;  4ZC3 A;  1U3E M;  3RYP A;  4PFP A;  2PMZ N;  1JE8 A;  4FIS A;  2JWT A;  1IV8 A;  5ICE A;  1VQ9 I;  5D6F A;  2P0W A;  4HDV A;  2Y0S N;  4HST A;  4A93 J;  1MBJ A;  2M87 A;  4B48 A;  3WG9 A;  4GYG A;  2Z5U A;  4E7K A;  1SAU A;  2M8G X;  2Y31 A;  4ZYG A;  2R7S A;  2DMQ A;  3J7Z I;  3KP7 A;  4UVA A;  1ORK A;  4XQF A;  3OYA A;  3BR2 A;  1L3L A;  3W6K B;  2A68 F;  5BNG A;  2CS3 A;  5GPC A;  4BQO A;  1K78 B;  3RZO J;  4N0B A;  4XON A;  1STZ A;  2GXG A;  3X2Q H;  3GZN B;  3M7G A;  2XHK A;  3WE3 A;  1YQA A;  2M45 A;  2EIJ H;  3BZC A;  4BDY A;  1WZ2 A;  2KP6 A;  2HQR A;  2YPR A;  4U88 A;  3HHH A;  4N4N B;  1XB4 A;  4BDZ A;  3T1B A;  2ID6 A;  2FOW A;  4OMZ A;  2A5W A;  3S14 J;  4L9T A;  1IC8 A;  4N9I A;  5HNF A;  4BEH B;  2UV1 A;  2VBX A;  1GHC A;  3U21 A;  1FBS A; 
#chains in the Genus database with same CATH homology
 4LMY A;  4NB5 A;  4UVC A;  3HSE A;  3HRS A;  1Z91 A;  3ERE D;  1U2W A;  3TDU C;  2KJC A;  1J9I A;  1SFX A;  4HX4 A;  1YS7 A;  5BOX A;  1MDM A;  1NHA A;  4UNO A;  3LFK A;  3JAM Z;  4AIK A;  1D3Y A;  1S6L A;  5AIP A;  3PFI A;  4LB6 B;  4IXA A;  2XVC A;  3H3Z A;  4KIB A;  1B4A A;  1C0W A;  2KKO A;  1FOK A;  2ZNY A;  3HTU A;  2Z33 A;  4TV7 A;  1HKS A;  3QP6 A;  3T8R A;  2H6B A;  2VOD A;  4U7D A;  4HYE A;  4RGU A;  3F8M A;  5D8K B;  2L01 A;  5BS6 A;  5K1Y A;  4YIF A;  5HS8 A;  5H6Q A;  1HXD A;  2CW0 F;  4F7Z A;  3F8B A;  5LRR A;  1BI3 A;  1BN5 A;  3RI4 A;  1S29 A;  2P7V B;  1USS A;  3LWF A;  5JVT A;  3WTS C;  2A07 F;  3TO7 A;  5FFZ A;  1U8R A;  2MLG A;  1R1U A;  3D5L A;  3FM5 A;  3GEZ A;  3OV8 A;  1REP C;  2UZK A;  1RZ4 A;  3RPQ A;  1QGP A;  5D4S A;  1E17 A;  2HWV A;  1LVA A;  1G3W A;  1ZG3 A;  1FT9 A;  3J7A O;  1AWC A;  4HLX A;  1IZ1 A;  3L09 A;  2W85 A;  4B09 A;  2FU4 A;  4BNC A;  2HZT A;  3E3V A;  2QQA A;  2UXX A;  2YU3 A;  2Y0M A;  4R8H A;  4OIR F;  3BJO A;  3IHU A;  3U1D A;  1TLH B;  1UCR A;  5TJJ A;  1XD7 A;  4G7O F;  2COM A;  3FX3 A;  4L9N A;  1KU3 A;  1G3Y A;  3BZ6 A;  4MEX F;  1G6N A;  3F8F A;  3P7N A;  4KIG A;  3NRV A;  2MLK A;  4G7H F;  2YX4 A;  4G9Y A;  2G7U A;  2RDP A;  3M9A A;  3ZMS A;  2BE5 F;  2A6H F;  1CGP A;  5JI6 A;  3WTY C;  1TTY A;  2MH9 A;  4PGH A;  3LA3 A;  1EH7 A;  4ENJ A;  3EDP A;  1T0F A;  1QQI A;  3JTG A;  4RAY A;  1MGT A;  1TW3 A;  4PGG A;  3KE2 A;  5F6F A;  4HDU A;  1BM9 A;  3SZT A;  3E5Q A;  4IHT A;  4L18 B;  5JHU A;  1R5G A;  4Q5S F;  2KJB A;  2O8X A;  1LJ9 A;  4KMF A;  3QPH A;  1R23 A;  2D1V A;  2V1X A;  4ZZD A;  2CFX A;  3KP6 A;  4HF0 A;  2WC2 A;  2OQG A;  2XRN A;  3COA C;  1FSH A;  5CJ9 A;  2K86 A;  4EJO A;  3BJ6 A;  3GXO A;  2HEO A;  2K4J A;  4UVB A;  5HOO A;  2W24 A;  2XGX A;  2IVM A;  3F8C A;  1KQ8 A;  1O7F A;  2FA5 A;  4JQF A;  5BPI A;  4KA4 A;  5LGN A;  3L2C A;  1FP2 A;  2YX7 A;  3WTV C;  2PLY A;  1YS6 A;  1ONV A;  2BBY A;  4O3M A;  4IJA A;  2EFN A;  5CLS A;  4A6E A;  3QRF F;  4XLN F;  2LSO A;  1BIA A;  3J80 K;  3I58 A;  2GQQ A;  1BBY A;  4OOI A;  1RUN A;  4L0Y B;  1HKQ A;  5L3E A;  3K1M A;  2M5W A;  4O5V A;  1K79 A;  1KQ9 A;  4I02 A;  5IT9 Z;  1FBU A;  5H6R A;  3KFW X;  1XSX A;  4I09 A;  1QO0 D;  5L3F A;  5E8G A;  2EFW A;  4WX9 A;  2R7F A;  1BI2 A;  3I53 A;  1ZRE A;  1DUX C;  1K7A A;  3HSF A;  5FGM A;  3MZY A;  4RGX A;  4WXH A;  4ZYD A;  2JPB A;  3K1N A;  4Y17 A;  5LGU A;  2DK5 A;  2IW5 A;  4PDK A;  2LF8 A;  2GWR A;  3GZ5 A;  4LFU A;  4EJT A;  3J81 Z;  4ZZL A;  4KNY A;  4EJV A;  2IT0 A;  1J59 A;  5D5V B;  2NYX A;  2ZME B;  3L00 A;  2FBI A;  5CYV A;  3E6D A;  1CF7 B;  3F6V A;  4I7H A;  3V8L A;  1TW2 A;  1BI1 A;  1U78 A;  2M8E A;  2ZXJ A;  4FT8 A;  2V79 A;  3EQL F;  4M6Y A;  4A5M A;  2OAZ A;  2A3S A;  3F23 A;  2P7C B;  4OMY A;  2IA0 A;  4GGG A;  5K5O A;  5E1X A;  2HKX A;  3N4M A;  2PMH A;  1HST A;  4BAY A;  1ZG5 A;  2L54 A;  2J5P A;  2CWE A;  3IKT A;  4OIO F;  1MD0 A;  5LGT A;  4AVP A;  1LQ1 A;  2PBI A;  1ZRD A;  4ESB A;  2PQ8 A;  3P9I A;  1T39 A;  4BH9 A;  2FMY A;  4ESF A;  1PP7 U;  2QM3 A;  3WGI A;  4OIP F;  2ISZ A;  1IRG A;  4IRI A;  4EV0 A;  1IXS B;  1R5H A;  4MGR A;  3F8N A;  1FBQ A;  4XSZ F;  1Z1D A;  3V7S A;  3AAF A;  3HRM A;  5E8I A;  1J5Y A;  3V4G A;  1SMY F;  1XCV A;  4P9F A;  1IN7 A;  3Q9S A;  2D45 A;  1UB9 A;  3MEX A;  2RGV A;  2NAZ A;  1UHM A;  3GFM A;  1XSV A;  1P92 A;  3BDD A;  1J0R A;  1LEA A;  1HQC A;  1FWZ A;  3GZ6 A;  2FNA A;  4LK0 F;  1E2X A;  4RGR A;  2FE3 A;  4RB3 C;  1T98 A;  2EFQ A;  3KP3 A;  5J8C A;  2BGC A;  5HLG A;  2XUB A;  4XSX F;  2BEO A;  5HS7 A;  4LLL A;  1YLF A;  5D5X B;  1FZP B;  3O3K A;  2QBY A;  3U9G A;  1OYW A;  3WU0 A;  1QBJ A;  1PUE E;  3LAJ A;  2DO7 A;  1XCB A;  3K9T A;  4EJU A;  2FXA A;  4A2U A;  1U5T C;  3CTA A;  4CDG A;  4S05 A;  3CO6 C;  1U5T A;  2E1C A;  1IN6 A;  3RKX A;  2R3S A;  1GVJ A;  3H3U A;  4CXF A;  2VBY A;  5F1R A;  2O6G E;  2XAG A;  5CVU A;  2M30 A;  2RKH A;  2EB7 A;  3T8T A;  2CO5 A;  3E6C C;  3M8F A;  5CVR A;  2ELH A;  4KUM A;  3E6M A;  2ZCW A;  3ELK A;  2CGP A;  4EQQ A;  2FNP A;  5DDG A;  2NS0 A;  1B9N A;  2JPC A;  1FP1 D;  4A0X A;  5L3B A;  1SD4 A;  1Z9C A;  2EK5 A;  1R1T A;  1BC7 C;  1D8J A;  5DCF A;  1O3R A;  2P6T A;  2CG4 A;  2Z99 A;  1R58 A;  2PI0 A;  5DUK A;  4GXO A;  3C1D A;  3L7W A;  1BI0 A;  2IP2 A;  1ZGA A;  3RTR A;  1XSD A;  3BY6 A;  2O3F A;  1W7P A;  3HHG A;  2XV4 S;  4L9V A;  1JHF A;  2QZ8 A;  2Q0O A;  4CGZ A;  4A5N A;  3CJN A;  1T2K A;  3HIF A;  2MC3 A;  2HDC A;  3MFK A;  4CO8 A;  3DF8 A;  2G9W A;  2K7L A;  1FYM A;  4O6J A;  3VOD A;  1YFH A;  3WOD F;  4LG0 B;  4GCV A;  1HBX G;  1TNT A;  2XKO A;  3B02 A;  5L3D A;  5ILS A;  2L4M A;  4ZYH A;  2HR3 A;  4I01 A;  2HYF A;  1ON1 A;  4K2E A;  2FF4 A;  2IA2 A;  1YW8 A;  2XAH A;  4WXD A;  4KMU X;  1KQ0 A;  2Y75 A;  3G3Z A;  2JTV A;  1S7A A;  5DCM A;  5A2Q K;  4BYY A;  4CYD A;  4A6D A;  2E1N A;  5IT3 A;  2D1H A;  2LKP A;  3ULQ B;  4M9X A;  3BJA A;  3ZN1 A;  1P4W A;  2ZO4 A;  2IA1 A;  2O0Y A;  1WSU A;  1ZRC A;  3HSR A;  2E7X A;  2DQL A;  3GF2 A;  4GO1 A;  1G4D A;  2EA2 A;  3HOT A;  3ZN0 A;  4ZH4 F;  1BOA A;  4ASN A;  2QLZ A;  2O61 A;  2DI3 A;  1JXS A;  1WI9 A;  4ETS A;  1FLI A;  2DK8 A;  3E97 A;  2A5Y B;  4U0V A;  1TQM A;  2VXZ A;  5LHH A;  3FMQ A;  1K78 A;  4M9S A;  2MH2 A;  1F4K A;  2KRF A;  4EM2 A;  4G94 A;  1EV7 A;  1U6G A;  2F5D A;  1IW7 F;  5DD4 A;  1V3F A;  4HW0 A;  1MJA A;  3B73 A;  4KIC A;  3GWZ A;  2PFB A;  4R1H A;  1DP7 P;  2DQR A;  4HAM A;  1SD5 A;  5LEJ A;  1IF1 A;  2VBW A;  2FEZ A;  1J75 A;  4UV8 A;  5AIQ A;  3GFL A;  3IKV A;  1AOY A;  5ICC A;  4OIN F;  2FBK A;  1FYL A;  2DFI A;  4E70 A;  1FNN A;  3DKW A;  1KA8 A;  4RS8 A;  3T5X A;  3WGH A;  4KIF A;  4JBA A;  3K0L A;  3I4P A;  1IUY A;  2HGC A;  3D0S A;  5D4R A;  5LEK A;  1W5T A;  2EV5 A;  3GFJ A;  4H0E A;  2OA4 A;  3DP7 A;  5J6X A;  4MQ9 F;  2HOE A;  2L3D A;  2AS5 F;  2DAO A;  2VT2 A;  5LHG A;  1ZAR A;  5EEG A;  1SD6 A;  5FO5 A;  1LDD A;  1LNW A;  4EGZ A;  4YG2 F;  3FXQ A;  1HSJ A;  4RB0 A;  3ZQ7 A;  4MNU A;  5KK1 A;  3EET A;  2C6Y A;  1O3S A;  3TDZ C;  3HRT A;  3E5U A;  4Y13 A;  3QOP A;  2F5E A;  3JSP A;  4LB5 A;  3F21 A;  4FHT A;  4LGW A;  2RV8 A;  1RUO A;  2DPU A;  2OZU A;  5ED4 A;  4P96 A;  3DEU A;  3LQR A;  2HQN A;  1IN4 A;  4Q4Z F;  4RB1 A;  2P5V A;  3G73 A;  4WXC A;  3F72 A;  3K1P A;  1T6S A;  1SD7 A;  2OQR A;  4M6X A;  2ADU A;  2L4A A;  3EYY A;  5DYM A;  3QU3 A;  3LA7 A;  4HLY A;  4IHS A;  1P2F A;  1YO5 C;  3BPX A;  3DQV C;  2NNY A;  1IXC A;  1Z6R A;  4CIC A;  2ISY A;  2KIM A;  2O03 A;  3WTW C;  4EVI A;  5K5R A;  1FX7 A;  4WCG A;  2PG4 A;  5JR3 A;  3FWE A;  1H9G A;  4YFN F;  4NQW A;  2DPD A;  2GA2 A;  3DPL C;  3MAJ A;  1V4R A;  3C18 A;  3BPV A;  1K6O A;  4HF1 A;  1ZYR F;  5AON A;  4ENK A;  3ZMV A;  2X0L A;  2Y48 A;  2HFH A;  2G7H A;  3RKW A;  3C7J A;  1ULY A;  4HZF A;  4M74 A;  1MKM A;  2R7D A;  2VN2 A;  1RIO H;  4CHU A;  1JHH A;  2QWW A;  2Q8K A;  3JSO A;  3R61 A;  2ZNZ A;  1B59 A;  3ABU A;  1WRJ A;  1ZN2 A;  2QQ9 A;  4MTE A;  3GW2 A;  1KU9 A;  1T38 A;  1RNL A;  4N9H A;  2F5C A;  4HOB A;  2LF7 A;  2FBH A;  2P8T A;  5K5Q A;  4BHB A;  1FY7 A;  2GIV A;  4DNC A;  2H6C A;  3R6S A;  2OZ6 A;  5F64 A;  5KVR A;  5HLH A;  4UXN A;  5CVV A;  3RIR A;  3GVA A;  2JT1 A;  2EA4 A;  5HLI A;  1I5Z A;  2LNB A;  3H92 A;  3P9C A;  1TQI A;  3QPT A;  4MTD A;  4YII A;  4KYW A;  3I54 A;  2P4W A;  3ZPL A;  1R1V A;  1DDN A;  2K4B A;  2OU2 A;  1BC8 C;  2FOK A;  4OU0 A;  1GXP A;  2K02 A;  4QLC U;  1U5T B;  3FXR A;  4LLG F;  4D0P A;  4HQM A;  1EH8 A;  5DD8 A;  1R36 A;  3GUD A;  1ZRF A;  3R0A A;  5H20 A;  1IAW A;  4S04 A;  2ETH A;  5FB2 A;  4IRH A;  2HTJ A;  6PAX A;  4IPA A;  2CSO A;  2VON A;  3J80 Z;  4ESJ A;  2OD5 A;  3F6O A;  3TGN A;  2STT A;  2PN6 A;  3LQQ A;  1F9N A;  3JAM K;  1W5S A;  1IRF A;  4IF4 A;  1YG2 A;  1LDK B;  3FZV A;  3GYH X;  2V6C A;  1OYY A;  3S2W A;  3R60 A;  3V7R A;  4A0Y A;  5BMZ A;  1SAX A;  2QQB A;  4L9J A;  3VEP A;  4BHC A;  3CLO A;  1VTN C;  1D5V A;  1I1S A;  2Q2E A;  3IRR A;  3FF5 A;  2E7W A;  1MJB A;  1TBX A;  1Z05 A;  1I6X A;  3TOA A;  5L3C A;  1MDM B;  4KT5 C;  3LA2 A;  4A12 A;  3I64 A;  3BRO A;  4LK1 F;  2NNN A;  2Z3Y A;  2ZME A;  2XAF A;  3DXJ F;  3ROU A;  4U7B A;  5FD6 A;  1HW5 A;  4PZJ A;  3HUG A;  1SMT A;  2ZJ2 A;  4HA8 A;  1D8K A;  1HW1 A;  3I5U A;  4Q48 A;  3KLN A;  1ZLK A;  1UHW A;  1KU2 A;  2WTE A;  5JFR A;  2CYY A;  2V1D A;  5EEH A;  3CUQ C;  3WTT C;  5ICG A;  1S7O A;  4RAZ A;  3CUQ A;  3EUH A;  1TQP A;  3W6J B;  4DQ2 A;  1ZHF A;  3MQ0 A;  3R4K A;  3NEU A;  2M1B A;  3FM3 A;  4P9U A;  5CVJ A;  3TKY A;  1GXQ A;  1YW9 A;  1H0M A;  1ZG1 A;  4L0Z B;  5ERI A;  3TQN A;  2RN7 A;  2ZFW A;  3KP4 A;  1BIB A;  1Z6T A;  2HKO A;  3MZH A;  2FML A;  5HDG A;  4R79 A;  1LDJ A;  4LJZ F;  1ZGJ A;  1F5T A;  1QPM A;  2QYO A;  4HX7 A;  3I0T A;  4U0W A;  3FXU A;  2WWY A;  2HTS A;  3KP2 A;  2IJL A;  5HVQ C;  2ESH A;  4EM0 B;  3QAH A;  1XGS A;  1F1Z A;  1FC3 A;  4KN4 X;  4P55 A;  3TO6 A;  3MWM A;  1TNS A;  5HDK A;  1O57 A;  4BHP A;  5ILV A;  4HX8 A;  4OIQ F;  1W7P D;  3CO7 C;  2VT3 A;  2A69 F;  4XBF A;  3MCZ A;  5DEQ A;  3TO9 A;  4L5I A;  4HBL A;  2H94 A;  3K2Z A;  3DFG A;  5D8L B;  3F3X A;  3WE2 A;  3SHF A;  2H09 A;  2CQK A;  3L9F A;  4UHT A;  2JRT A;  3P9K A;  4MQV A;  3REO A;  4M72 A;  3I59 A;  2QEN A;  2BYV E;  4I98 B;  3GO5 A;  5E18 F;  1P4X A;  1SFU A;  1FYK A;  2KIU A;  3V7C A;  4WWC A;  4EJW A;  2W25 A;  4WK8 F;  4Q47 A;  3HRU A;  2J5O A;  1G3S A;  1ODD A;  3N97 A;  5LHI A;  4KN7 X;  2HS5 A;  5IT9 K;  3GLX A;  1QNT A;  5ILU A;  1OPC A;  5LRS A;  4JK1 X;  4IVN A;  2NRA C;  4ENN A;  4HF2 A;  4Y15 A;  4UUV A;  4AIH A;  2P5L C;  2P5K A;  4MHG A;  1I1G A;  2XRO A;  3QP5 A;  5J8F A;  1J2X A;  2P6S A;  1KGS A;  4XRF A;  2ACJ A;  2DBB A;  3O6B B;  3BP8 A;  2OBP A;  4XLP F;  2L02 A;  3HYI A;  2YR2 A;  3BWG A;  4UV9 A;  2DLL A;  2XAJ A;  4I0B A;  1SFE A;  3KZZ A;  3CUO A;  3J81 K;  1R7J A;  3JTH A;  4LD5 A;  2QVO A;  3M1E A;  1WKM A;  3WTU C;  5E1Z B;  3DPT A;  3NQO A;  3RDI A;  3QU6 A;  1OR7 A;  2VE9 A;  3KET A;  1S3J A;  2UXN A;  1O7L A;  5LLQ A;  4IRG A;  2GAU A;  3WU1 B;  3K69 A;  2XAQ A;  3C3W A;  4NHJ A;  2ESN A;  1FSE A;  1XGN A;  1X3U A;  4LG0 A;  2RNJ A;  2A6E F;  1RI7 A;  4G6Q A;  4FX4 A;  2K27 A;  3M8E A;  4EM1 A;  5BPD A;  3SXY A;  1Q1H A;  4FX0 A;  3BOQ A;  2MD5 A;  1J7K A;  1MZB A;  4HV5 A;  3IRQ A;  3HOS A;  2WV0 A;  5DUI A;  2W57 A;  4U0Y A;  3KEQ A;  3DV8 A;  4G7Z F;  4BQA A;  3FMS A;  3EYI A;  1YIO A;  5HS9 A;  2H27 A;  1JGS A;  1H9T A;  1UFM A;  1A04 A;  1ZLJ A;  2IPQ X;  3RYR A;  4I2O A;  5FFX A;  5LBQ A;  5A2Q Z;  5FLX K;  2EV0 A;  2PMU A;  3Q9V A;  4B8X A;  2V9V A;  4HQE A;  5L3G A;  3KCC A;  1YTY A;  5D6E A;  3IWZ A;  5D5U B;  1BJA A;  1YW7 A;  5DV5 A;  2BV6 A;  2VOP A;  3PQK A;  3ZP5 A;  1LB2 A;  2EV6 A;  1XGO A;  2W84 A;  4YFK F;  3WTX C;  2DU9 A;  1IXR C;  1S8N A;  2RC4 A;  1IN5 A;  3RPU A;  4G6D A;  4I0A A;  2D2W A;  1XDU A;  2ZKZ A;  2GA1 A;  3Q5F A;  2EJR A;  4MEY F;  2F2E A;  4QWQ A;  2RVC A;  3SZP A;  1WWX A;  1XMK A;  3IWF A;  1HKT A;  3LAP A;  4KFC A;  1OKR A;  2MBF A;  1Y0U A;  3T0Y A;  2JSC A;  1XN7 A;  4M71 A;  1I27 A;  5E17 F;  2EWN A;  3GFI A;  3CDH A;  2XKP A;  2EFO A;  4EMS A;  1R22 A;  2B0L A;  1KU7 A;  5E1W A;  4YFX F;  3VB2 A;  2QBY B;  3SQN A;  5BQT A;  1WQ2 A;  3WGG A;  1O3T A;  1IN8 A;  3ISP A;  3R0J A;  2AXL A;  1ZAO A;  2IRF G;  5E20 A;  1R00 A;  3KP5 A;  3O2P E;  4G8X A;  3VFZ A;  1DPR A;  3PQJ A;  4L5J A;  4A0Z A;  4EGY A;  4BXU A;  2V1U A;  3ZMU A;  5CVI A;  1B1B A;  3VOE A;  3KLO A;  2VC0 A;  4CZZ A;  2DW4 A;  3CUQ B;  1XDS A;  4PCQ A;  3ZMZ A;  2F5F A;  2X4H A;  1L0O C;  3LST A;  4KDP A;  1UST A;  1XMA A;  1PP8 F;  3FHZ A;  2XIG A;  1ON2 A;  1YYV A;  2A61 A;  2KIF A;  3ABT A;  4ON0 A;  1W4M A;  2ZBK A;  4AWX B;  1P4A A;  2FSW A;  2EFP A;  4ENM A;  5ICF A;  1G3T A;  3ZMD A;  1O3Q A;  1DPU A;  2TDX A;  2QUF A;  5FLX Z;  2PEX A;  1QZZ A;  3GX4 X;  4GYI A;  5FD5 A;  4Z2Y A;  1B6A A;  2VBZ A;  3OOP A;  5HDN A;  4M9Z A;  1HW2 A;  3IL2 A;  1QZY A;  3V8K A;  3JW4 A;  2VC1 A;  3IC7 A;  1B9M A;  4LLN A;  2FQ3 A;  2DTR A;  1W7P B;  1KYZ A;  3RJP A;  3TOB A;  1OMI A;  3SFZ A;  1FPQ A;  2MA3 A;  4WF2 A;  3KZY A;  2LDU A;  3RKY A;  3E6B A;  2GXB A;  1LEB A;  1Z7U A;  2FRH A;  4RB2 C;  4P5O A;  3ECH A;  3KEO A;  2STW A;  4ZYE A;  5D5W B;  1CF7 A;  4AIJ A;  3ML6 A;  3U2R A;  1PDN C;  2VE8 A;  1KYW A;  5TRD A;  3I71 A;  3V8J A;  3ZMT A;  4AD9 A;  1P6R A;  2YSR A;  1XGM A;  2Z9O A;  2DT5 A;  5DCM B;  3I59 B;  4M73 A;  2VOO A;  2GZW A;  2PJP A;  1ZH5 A;  3F22 A;  1EH6 A;  2HYG D;  3WTZ A;  1MJ9 A;  4HV6 A;  3ECO A;  2UWM A;  1OYI A;  2RQP A;  3E5X A;  3FMR A;  3HTS B;  4RGS A;  2XAS A;  2JZY A;  1U3E M;  3RYP A;  1JE8 A;  5ICE A;  5D6F A;  4HDV A;  2M87 A;  3WG9 A;  4GYG A;  2Z5U A;  4ZYG A;  3KP7 A;  4UVA A;  1L3L A;  3W6K B;  2A68 F;  1K78 B;  4N0B A;  1STZ A;  2GXG A;  3M7G A;  2XHK A;  3WE3 A;  1YQA A;  2M45 A;  2HQR A;  2YPR A;  4U88 A;  3HHH A;  1XB4 A;  3T1B A;  4OMZ A;  4L9T A;  4N9I A;  2VBX A;  1GHC A;  1FBS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...