4YIFA

Crystal structure of rv0880
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
140
structure length
140
Chain Sequence
b'SDARLASDLSLAVMRLSRQLRFRNPSSPVSLSQLSALTTLANEGAMTPGALAIRERVRPPSMTRVIASLADMGFVDRAPHPIDGRQVLVSVSESGAELVKAARRARQEWLAERLATLNRSERDILRSAADLMLALVDESP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MarR family protein Rv0880
publication title Structure of the MarR family protein Rv0880 from Mycobacterium tuberculosis
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 49
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4yifA00
5LEJA 3L09A 1HSJA 1LDKB 3BROA 1K7AA 4PZJA 3HRMA 1ONVA 3F8MA 1Q1HA 2NRAC 3NRVA 5D6EA 2DK8A 1CF7A 4YFNF 5LRRA 2L01A 1F4KA 3P9CA 4FX4A 2GAUA 1DDNA 4WF2A 1G6NA 2YU3A 5E17F 2EJRA 2HYGD 1XGMA 4KNYA 2PEXA 2W84A 4PGHA 2LSOA 2Q2EA 4MEXF 1OYYA 4KICA 3ERED 4A5MA 3I0TA 5EEGA 4EJOA 4EM2A 1F9NA 2OBPA 4G6DA 4M9ZA 5H20A 1FBUA 1XCVA 3IHUA 5E8IA 1IUYA 1IXSB 5HOOA 4RB0A 4ZH4F 4ZYHA 3GXOA 2D1VA 2FBHA 2G7HA 1W5SA 2EK5A 5FD6A 1KGSA 3BY6A 1O7LA 4HF0A 3TO9A 3ZMZA 4F7ZA 3WU0A 1IRGA 3CUQB 4P9FA 3JSOA 2DU9A 3I58A 4EM1A 3G73A 4EMSA 2MA3A 1SD4A 3ZMSA 5AIPA 1IRFA 3RDIA 5JVTA 4FX0A 5DCFA 2NAZA 5KVRA 2OAZA 4U7BA 5D8LB 4KUMA 5IT9K 1DPUA 3QU3A 1WWXA 1Z05A 3DV8A 3KZYA 4CZZA 1U2WA 2VBZA 4ON0A 2ADUA 1GHCA 3HUGA 5ICCA 4CICA 2HTSA 2ZO4A 2XIGA 4Y13A 3K0LA 3DQVC 3FXQA 4U0VA 1HW1A 2ZKZA 4ZZDA 2HTJA 3N4MA 2HQNA 1IF1A 4HX4A 2A69F 3HRUA 1MZBA 2XUBA 2QBYA 1Z7UA 1B4AA 4O6JA 3V8JA 1W5TA 1IW7F 1ZREA 2STWA 2O0YA 3F6VA 4M71A 2E7XA 1TTYA 2F5CA 2FA5A 4CHUA 2P5VA 2IA2A 4PDKA 4HDUA 3H3UA 3PQJA 3J80K 2UXNA 1BC8C 3KP7A 2QLZA 2AS5F 4P55A 3FHZA 1A04A 1YW8A 4ESFA 2KRFA 1E2XA 4HX8A 2V79A 4K2EA 2PN6A 2IA1A 4ESJA 5DD4A 2W57A 2JSCA 2Y0MA 2IW5A 4XLPF 2FQ3A 1WRJA 2XAJA 4L9VA 4RGRA 1MDMB 2WWYA 2XAQA 2VOPA 1ZYRF 2XASA 3F8NA 1TW3A 3E6DA 4I0AA 5L3GA 2WC2A 2G9WA 2Q8KA 1I1SA 3C1DA 3WG9A 4XLNF 3MFKA 3V8KA 3DPTA 4XBFA 3LAPA 1ODDA 1ZRDA 5E1ZB 4MQ9F 4IXAA 4A5NA 2L4MA 3BWGA 4QLCU 1HXDA 3F72A 4A0YA 5FLXK 2DQLA 3K1NA 2XVCA 1XDUA 1K6OA 3K69A 4ETSA 1MJ9A 5DV5A 4A0ZA 1UCRA 1ZHFA 3ZN1A 3I4PA 2DLLA 1KU9A 3R0AA 3Q9VA 3GFMA 1TQMA 5DD8A 1REPC 5L3DA 3P7NA 1F1ZA 2L4AA 1I5ZA 3KCCA 2NNNA 2OD5A 1G4DA 2QENA 1FPQA 2VE8A 1UFMA 2XAFA 2JT1A 4HQEA 4A0XA 3SZTA 2GA1A 5HVQC 1USSA 2EV5A 1IN6A 3SZPA 1PUEE 1BBYA 1XSDA 1O3SA 2Y75A 4HLXA 3LA3A 3I54A 3KE2A 3TO7A 3V7SA 3U2RA 3W6KB 1DP7P 3BDDA 4DNCA 1HSTA 3ZP5A 3IWZA 5HDNA 1IN5A 2P7CB 3E5UA 1KU7A 3LA7A 1K78B 3GLXA 2ESNA 2Z99A 1QZYA 4RB1A 3IKTA 5H6QA 5LHGA 5FB2A 3VFZA 2HDCA 1J5YA 2JRTA 4L9JA 4YIFA 3WTSC 4XSZF 4L18B 3WE3A 4RAYA 4U0YA 5HS7A 3J81K 2O03A 3ISPA 3RJPA 3L7WA 1TNSA 5DDGA 5IT9Z 4GYIA 1MJAA 4BH9A 1QBJA 1FSHA 4WXHA 3FF5A 3DP7A 4G6QA 2CWEA 1JGSA 2HGCA 1XD7A 4AIKA 4GXOA 4KN4X 5D4SA 1BIAA 1T39A 3OOPA 2IPQX 1U8RA 5CJ9A 1PP7U 3HSFA 4OU0A 2P7VB 1YTYA 4M73A 2HS5A 2E1NA 5DYMA 5CVUA 2ESHA 3E3VA 2TDXA 1I6XA 4LB5A 1U5TA 3CDHA 1R23A 4GCVA 4CDGA 3MEXA 1T6SA 2D1HA 4HLYA 4YG2F 1BC7C 1LEBA 1I1GA 3WE2A 1ULYA 3QU6A 1ZAOA 5HS8A 1WI9A 1R5GA 2NNYA 1KYWA 4L0ZB 1J7KA 3I59A 3I53A 3J80Z 5TRDA 2DBBA 1XB4A 4AWXB 5LBQA 2LDUA 5FFXA 3GZ6A 1NHAA 1Z9CA 3DXJF 4ZYGA 2L02A 2ZXJA 2FE3A 6PAXA 1FLIA 2OU2A 3KLOA 3IRQA 3VEPA 2AXLA 1EH7A 3F6OA 1FNNA 5H6RA 3T8TA 2HEOA 3BOQA 1HKSA 1IN8A 3EDPA 2JZYA 4P5OA 4UVAA 1STZA 5CVJA 4RB3C 5HLGA 3RI4A 3BPXA 3DF8A 3WODF 1YS6A 2K4BA 3V7CA 2W25A 1S8NA 5K5QA 4HA8A 3DKWA 2DPUA 2KJBA 1EV7A 3RKWA 1SMYF 4UVBA 2QQ9A 4KMUX 1FBQA 2GQQA 2HKOA 2BE5F 3SFZA 5E8GA 3FM5A 2PI0A 3DPLC 4ESBA 3CTAA 4A6DA 3VODA 4LG0A 4KYWA 2COMA 1U3EM 1LDDA 2MD5A 4R1HA 4I2OA 2ISZA 1GVJA 2J5OA 3BZ6A 3CO7C 1D8JA 3M8EA 3TKYA 3WU1B 2J5PA 1D8KA 2PFBA 4BAYA 1O57A 1TBXA 5L3FA 4KT5C 3JAMZ 4N9IA 1FY7A 3BJAA 2QYOA 2L3DA 2M8EA 2A07F 3SQNA 3ZMTA 1O3QA 5D5VB 4OMYA 3ML6A 4EJWA 2K02A 2MC3A 4QWQA 3WTYC 2P8TA 3RKYA 1ON2A 4E70A 1XSXA 1B59A 3HRSA 5D5XB 5E1XA 3K1PA 3E6CC 3LQRA 3J81Z 3HOSA 2OQRA 3GFLA 1FX7A 3K9TA 2X0LA 4IPAA 4AD9A 1FT9A 3FXRA 3IKVA 1XSVA 3ZMUA 4G7HF 3S2WA 2EA2A 4XSXF 1JHFA 3TQNA 2K86A 4B8XA 5K5RA 1IZ1A 2ZMEA 1Z1DA 4EV0A 2LNBA 3G3ZA 2DAOA 4OIRF 4R79A 2F5DA 2YR2A 3M1EA 4YFXF 5JI6A 4IRGA 2OQGA 1RNLA 2RVCA 3V4GA 2KKOA 5BS6A 1J75A 1SD5A 4NHJA 4LGWA 1V3FA 2VT2A 1KU2A 1FYKA 1FOKA 1KU3A 1R7JA 3IWFA 1MJBA 1MGTA 3KEQA 4AVPA 2LF8A 3F23A 2KIUA 2XKPA 5BPIA 3I5UA 1G3SA 3ZPLA 2EWNA 4BYYA 4ASNA 3FMSA 4UHTA 4G7OF 4WWCA 2LF7A 1YLFA 3WTWC 1WKMA 2RQPA 2ZJ2A 4U7DA 3T0YA 5LGNA 3R0JA 1ZGAA 4HF2A 4A12A 4P9UA 5ICGA 4JK1X 1P4XA 3R4KA 4I0BA 1BIBA 5HDGA 3D0SA 3RYPA 4EJUA 3JTHA 3VOEA 2RN7A 3E6MA 4HZFA 2QZ8A 4S04A 3LQQA 1BOAA 3GZ5A 2HFHA 5LRSA 1XCBA 1OPCA 5A2QK 3GO5A 3B02A 3BJ6A 3EYIA 2EFOA 1RUNA 2GWRA 2K27A 3HRTA 4I09A 1SD7A 4HV5A 2CG4A 1FP1D 1W7PB 4HAMA 2Y48A 2STTA 4OMZA 3KP4A 2P4WA 2M5WA 2ISYA 1O3RA 2XHKA 3K1MA 1Z91A 1OMIA 4M74A 1P92A 4UXNA 3M9AA 4L9TA 4EQQA 3GFIA 1Z6RA 1XGOA 2KIMA 2PMUA 5HLIA 2QVOA 1O3TA 2G7UA 3KP5A 4RGUA 2V1XA 1TQPA 2RKHA 2V1DA 4HV6A 5HS9A 3DFGA 2Z5UA 1W7PD 3Q9SA 1RIOH 2DQRA 2FF4A 4FHTA 4EJVA 2EFNA 4G7ZF 3TOAA 2CSOA 2Q0OA 5IT3A 3CUQA 3KP2A 3L2CA 1R00A 5E18F 3MZYA 2K7LA 1PP8F 5DCMB 3F8FA 4RAZA 5F1RA 3F22A 3QOPA 4I7HA 1CGPA 3KEOA 4I98B 1KQ8A 4LFUA 3BP8A 3OV8A 2DPDA 3H92A 5ICFA 2H27A 2BYVE 2VOOA 2VBXA 1YO5C 4CYDA 4BXUA 4D0PA 4RGXA 4EGYA 2OZUA 4ZZLA 3M7GA 2UWMA 4KN7X 4LK1F 1T38A 3EYYA 1CF7B 2QQBA 1RZ4A 1HBXG 1XMAA 1QQIA 5F64A 1DPRA 2VONA 2QM3A 4ZYDA 3R60A 2R7DA 2ETHA 3GW2A 3O3KA 3JW4A 5D4RA 4IHSA 2PMHA 4MTDA 2Z33A 4WXDA 2A3SA 3R6SA 3EUHA 4LB6B 2UXXA 2NS0A 1P4WA 5LHIA 2BGCA 3WGGA 4KDPA 4OIQF 3HSRA 1FP2A 1H9TA 3REOA 3Q5FA 1YFHA 2H09A 3CJNA 1K79A 2VBWA 3WGIA 2D45A 1BI2A 2GIVA 1ZG3A 2XKOA 1IXRC 2RC4A 2ZNZA 1XDSA 4WX9A 1YIOA 1FSEA 2FBIA 4RB2C 1RI7A 2VC1A 3FX3A 3QPTA 1MDMA 1BI3A 2OA4A 2VT3A 4LJZF 1LB2A 4U0WA 1S7OA 3FM3A 3WGHA 5FD5A 4XRFA 3GUDA 4L5IA 1EH8A 3HYIA 4LLLA 4FT8A 2F5EA 1B1BA 3HSEA 4NB5A 4GO1A 3TOBA 2VBYA 1R1UA 1Z6TA 3RPUA 2YPRA 2PQ8A 3TDUC 5D8KB 1R1TA 2GZWA 4Q47A 4CO8A 5A2QZ 1XGNA 3B73A 4G94A 3EETA 2ELHA 1WSUA 3BJOA 3F21A 1U5TC 3O2PE 4G8XA 2BBYA 1ZN2A 1HQCA 1USTA 2R3SA 3J7AO 5JFRA 4N0BA 1OKRA 1G3YA 1ZLKA 2P6TA 3N97A 2ZCWA 3I71A 2XGXA 2QBYB 2IVMA 1B6AA 1LDJA 5FLXZ 3V7RA 5LHHA 4UV8A 2EFPA 4LLNA 5ED4A 3IC7A 2MH2A 4HOBA 1D5VA 2L54A 3E97A 3PFIA 3T1BA 5BQTA 3QRFF 2IT0A 1ON1A 1ZG1A 4BHPA 4MNUA 1FWZA 2JTVA 1R22A 4Q48A 4KFCA 2QUFA 1SMTA 5TJJA 4RS8A 3K2ZA 3H3ZA 4JQFA 2H6CA 4B09A 1GXQA 2M1BA 3MWMA 2O3FA 2VC0A 2RV8A 1T98A 1BJAA 4LLGF 3IL2A 3ELKA 1QNTA 2W85A 4I01A 2EFWA 1K78A 1BI0A 3KFWX 2VN2A 4Z2YA 2QQAA 3ULQB 5L3BA 2V9VA 4M6YA 1ZRCA 4R8HA 4Y15A 1I27A 1ZLJA 5ICEA 3T5XA 3JTGA 4YFKF 5CVIA 5D5UB 3V8LA 4EGZA 3TDZC 5BMZA 1C0WA 3WTUC 1FYLA 3F8BA 4IRHA 2IRFG 1ZARA 2F2EA 2WV0A 1YW9A 3HHGA 5J8CA 3LAJA 3KETA 1YS7A 4WK8F 2Z3YA 3FWEA 2M45A 3QAHA 5K1YA 1AWCA 1H9GA 4U88A 4S05A 2A61A 2A6HF 4O3MA 5AONA 1ZGJA 3GEZA 1X3UA 2MH9A 1ZRFA 3PQKA 4ENJA 5ILVA 4HW0A 3RTRA 1IXCA 1YG2A 5LLQA 2RGVA 3ECHA 2XAHA 2P5LC 2ACJA 3NQOA 1S6LA 2V1UA 2FEZA 3QPHA 1U6GA 2CQKA 3M8FA 4P96A 2DW4A 2F5FA 4M9SA 2GXBA 3ZN0A 3AAFA 2DK5A 2DTRA 4UVCA 3KLNA 1JXSA 3FZVA 3F3XA 2B0LA 1L0OC 4L0YB 2MBFA 1TW2A 3RKXA 1W4MA 1YW7A 2BEOA 1JHHA 1PDNC 1BI1A 2A68F 2PBIA 2WTEA 5HDKA 3NEUA 2X4HA 3GYHX 2HYFA 1FBSA 4IJAA 4JBAA 4GYGA 4Q4ZF 2XV4S 5E1WA 3C3WA 1L3LA 5AIQA 2CGPA 4HDVA 3L9FA 2DO7A 3TGNA 1SFXA 1OR7A 2KJCA 3WTTC 1SFUA 5FGMA 3HTUA 2MLGA 4M9XA 3I64A 4Q5SF 1SD6A 3BPVA 1R1VA 4OINF 5E20A 3MZHA 5KK1A 4PGGA 2FU4A 4KIGA 1SFEA 2YX4A 2R7FA 3RYRA 4IF4A 3QP5A 3KP6A 1D3YA 3SXYA 2FBKA 3LSTA 5L3CA 5J8FA 4UNOA 1R5HA 1XMKA 2HWVA 1MD0A 4OOIA 4MEYF 1F5TA 2CO5A 2EA4A 4Y17A 1YYVA 3F8CA 2CYYA 3ABUA 1J9IA 1BM9A 5LGUA 3P9KA 4UUVA 3E5QA 3MCZA 1U5TB 4NQWA 4M72A 3WTXC 4EM0B 3RPQA 1XN7A 5D5WB 3ABTA 4KIFA 1QZZA 2DI3A 2HR3A 2P5KA 1B9NA 4LD5A 4CXFA 3CLOA 4DQ2A 4H0EA 5J6XA 1HW2A 4YIIA 1XGSA 1KYZA 4A6EA 4EVIA 3FMRA 2EB7A 2YSRA 2LKPA 2PJPA 3U1DA 3I59B 2HQRA 2Z9OA 2PG4A 2H6BA 1R58A 4CGZA 4HX7A 5BPDA 2DFIA 2BV6A 4O5VA 3CO6C 1J0RA 1IAWA 3W6JB 3RIRA 3LFKA 5D6FA 2ZNYA 3KP3A 1S3JA 1P2FA 2UZKA 5CLSA 1UB9A 3TO6A 2O61A 4L5JA 4AIHA 5CVVA 2JPBA 3DEUA 2E7WA 5LEKA 3ZMDA 3LA2A 3ECOA 5F6FA 4KMFA 2IA0A 3HHHA 2XROA 1S29A 1FC3A 5DUIA 3HOTA 2M30A 2PLYA 1FZPB 4HF1A 1TQIA 4BHCA 1U78A 2ZFWA 3GWZA 1GXPA 1J59A 1IN4A 1G3WA 3FMQA 4OIPF 1EH6A 1FYMA 1E17A 3KZZA 3MQ0A 2RNJA 4LK0F 4BHBA 1OYIA 3JAMK 2JPCA 1V4RA 5K5OA 1T0FA 2GXGA 4LG0B 3ZMVA 2FMYA 2CFXA 5ILSA 1QO0D 1LEAA 5DEQA 3GFJA 3P9IA 3E6BA 1LQ1A 3JSPA 3GVAA 2OZ6A 1S7AA 3T8RA 4KA4A 1LNWA 2IJLA 2HOEA 1UHMA 4IHTA 1Y0UA 2EFQA 3FXUA 4EJTA 3HIFA 1P6RA 1ZH5A 4HYEA 3CUQC 1MKMA 1G3TA 1H0MA 1OYWA 1TLHB 4ENNA 1KQ9A 2XRNA 4BNCA 3QP6A 2O6GE 1HW5A 5ILUA 2FOKA 1LJ9A 2W24A 2H94A 1KQ0A 2QWWA 4MQVA 2EV0A 2O8XA 3CUOA 4PCQA 2IP2A 2FNAA 1BN5A 2A5YB 2KIFA 5CYVA 2NYXA 1TNTA 1IN7A 2DT5A 2VE9A 2FNPA 1RUOA 3WTZA 5HLHA 3U9GA 1P4AA 2HKXA 2FRHA 3WTVC 5FO5A 2FMLA 4LMYA 1YQAA 3MAJA 5ERIA 4A2UA 4ZYEA 4M6XA 2M87A 4KIBA 4MHGA 1WQ2A 2ZMEB 2RDPA 1HKQA 2V6CA 4UV9A 3COAC 1VTNC 3IRRA 1W7PA 2VODA 2A6EF 4IRIA 3O6BB 3HTSB 5CVRA 2CW0F 1J2XA 5LGTA 2GA2A 5BOXA 4GGGA 5JR3A 4AIJA 2E1CA 2C6YA 4HBLA 4IVNA 2HZTA 4TV7A 3ROUA 3LWFA 4HQMA 3E5XA 2FSWA 4G9YA 4RGSA 5EEHA 1O7FA 3EQLF 4ENKA 4ENMA 2FXAA 1DUXC 4N9HA 2ZBKA 2XAGA 4MGRA 2P6SA 1KA8A 4BQAA 3C7JA 3GX4X 1SAXA 5L3EA 4I02A 3C18A 1B9MA 1AOYA 2K4JA 4MTEA 2EV6A 5FFZA 2YX7A 4WXCA 2VXZA 3ZQ7A 1JE8A 4OIOF 5JHUA 5DUKA 5DCMA 1T2KA 2D2WA 3R61A 3VB2A 1HKTA 1R36A 3D5LA 3SHFA 2MLKA 1QPMA 3GF2A 4L9NA 3L00A 1LVAA 1ZG5A 1UHWA 4WCGA 1QGPA
chains in the Genus database with same CATH superfamily
3M8JA 5LEJA 3QYBA 3DTKA 1HSJA 3L09A 2DA3A 4Y4RA 1FIAA 4E7LA 1S9HA 1LDKB 3BROA 3E0JB 1K7AA 2W7NA 4PZJA 1MNDA 3HRMA 5K7FA 1ONVA 4MO7A 3F8MA 1Q1HA 2NRAC 3NRVA 3QOEA 2R7UA 1TWCJ 5D6EA 2DK8A 3CJRB 1CF7A 4YFNF 5E3OA 5LRRA 3JRDA 2HPIA 2L01A 1F4KA 4G6TB 2EH3A 5J4YA 2IGOA 3P9CA 3MKYB 4FX4A 2GAUA 2EIJH 1DDNA 2VKVA 4WF2A 1NTCA 1QZEA 4IOCF 1G6NA 2BY2A 2YU3A 4HSTA 5JVGF 5E17F 1G2HA 2JA8J 2EJRA 2HYGD 1XGMA 2DOAA 2JVGA 4KNYA 2PEXA 2W84A 4PGHA 4LIVA 2LSOA 2DODA 4ZTJA 2JUGA 2Q2EA 4MEXF 1O4XA 1OYYA 4KICA 3ERED 1VQ6I 1SFKA 2V4JC 5E3LA 4A5MA 2JA2A 3I0TA 5EEGA 4EJOA 4EM2A 1F9NA 2OBPA 4G6DA 4M9ZA 1VQMI 3OR1C 2R5YA 3OS2A 5H20A 1FBUA 1F36A 1XCVA 4D7NA 3IHUA 3AL0C 5E8IA 4HG2A 4M3BA 3BR0A 1IUYA 2X9DA 1IXSB 5HOOA 4MFDA 2LLKA 4RB0A 4ZH4F 3PUBA 2MSYA 3GXOA 4ZYHA 2D1VA 1W5CC 2FBHA 3H5AA 1PYVA 1FMWA 2G7HA 1W5SA 2EK5A 1S7EA 5FD6A 3L2UA 1KGSA 3BY6A 1O7LA 5E3NA 1D1CA 4HF0A 3TO9A 3ZMZA 4F7ZA 2M0CA 2XB0X 3LFUA 3WU0A 1ITYA 1IRGA 2VB6A 4AM3A 3ZQIA 2P81A 1Z7LA 5TISC 3CUQB 2X48A 4P9FA 2YS9A 4BBRJ 3JSOA 2DU9A 2DXIA 3I58A 4EM1A 3G73A 4EMSA 3CCJI 2MA3A 2DMUA 3PL8A 1SD4A 1IO2A 2ZJPF 2PMZN 3ZMSA 5AIPA 2H1KA 2XGDA 1IRFA 2MD0A 3A4CA 1X4PA 1RC9A 3MZ8A 3RDIA 5JVTA 4FX0A 2L7KA 3M3YJ 3QWLA 5DCFA 2NAZA 3FKJA 3FXLA 5KVRA 2VIXA 2OAZA 2XB5A 4U7BA 2R4GA 1W36C 5D8LB 4KUMA 5IT9K 5F08A 2L5QA 4CCKA 2R92J 1DPUA 3H5NA 2B63J 2JRMA 2R7SA 3QU3A 1WWXA 1Z05A 1Z21A 3DV8A 3KZYA 4CZZA 1U2WA 3GTLJ 3HOWJ 2VBZA 4ON0A 2UUZA 2ADUA 1ETYA 2WV1A 1GHCA 2VPRA 2DTZA 3HUGA 4E7ZA 5ICCA 1YHQI 2N8GA 3HJEA 4CICA 2HTSA 2ZO4A 2XIGA 2WBMA 4Y13A 2GM4A 1VQ7I 4V2FA 3BG3A 3K0LA 4A3GJ 4CCJA 3O8HA 3DQVC 3FXQA 4U0VA 1HW1A 5B1BH 2ZKZA 4ZZDA 4RA2A 2HTJA 5KAIC 3N4MA 2HQNA 1IF1A 1IJWC 1TL8A 2MABA 4HX4A 2A69F 3HRUA 2K9QA 1R9TJ 1OQYA 4RMNA 1MZBA 2XUBA 3DWLE 1Z7UA 3OIOA 2QBYA 1B4AA 2F6CA 1ZELA 4O6JA 3V8JA 2M9HA 5J4VA 3PUFA 1W5TA 4E6KG 2VJJA 1IW7F 1ZREA 1MBHA 1TWGJ 2STWA 2ID6A 2AQFA 2O0YA 4A3BJ 4KISA 3F6VA 3TMOA 2LY2A 1A6IA 2RAEA 3OYLA 4M71A 2E7XA 3FIWA 1TTYA 2W00A 2F5CA 2FA5A 3OIPA 4E4HA 4CHUA 1BA5A 3CP2A 2P5VA 4F3QA 2IA2A 1WVRA 4PDKA 4HDUA 1IRZA 3H3UA 3I56I 3PQJA 5FKNA 2IGKA 2IBDA 2CUFA 3J80K 3S93A 2UXNA 1BC8C 3KP7A 2QLZA 2AS5F 4P55A 3FHZA 1A04A 1YW8A 2LY1A 2KRFA 2RQQA 4ESFA 1E2XA 2ID3A 3ABLH 2V79A 3DTEA 4HX8A 1OFCX 1EJ9A 1LFBA 4K2EA 2PN6A 1ZGWA 5M5YJ 2IA1A 4ESJA 2KRCA 5DD4A 3K6GA 2DA7A 1U0JA 1OR7C 5EEAA 2W57A 2JSCA 2Y0MA 2IW5A 4XLPF 2FQ3A 3CJTB 1WRJA 1ETKA 2XAJA 2Y30A 4L9VA 4KITB 4RGRA 1MDMB 4IEJA 5B1AH 2WWYA 1RKTA 2XAQA 2VOPA 1ZYRF 1JTXA 2XASA 1B72B 3F8NA 1TW3A 3E6DA 2IGMA 4C2UA 3VSLA 4I0AA 5L3GA 3EUKL 5EJCA 3RQ4A 3DBRB 2LKXA 2WC2A 2G9WA 2Q8KA 2QSGX 3L2VA 1I1SA 3C1DA 3HPGA 2R7OA 3WG9A 2R7QA 4XLNF 3MFKA 3OYCA 2DN0A 3V8KA 3ASNH 3DPTA 4XBFA 3LAPA 4BJ6C 1ODDA 4XLCA 1ZRDA 5E1ZB 4MQ9F 4IXAA 3CCSI 4UY8I 4A5NA 2L4MA 3BWGA 4QLCU 1HXDA 1XC5A 3WHBA 5JHFA 3FHNA 3F72A 3KIOA 4A0YA 3RZOJ 1FJLA 2DQLA 4BJTA 3K1NA 5FLXK 2XSDC 2XVCA 2DMPA 1XDUA 1K6OA 4RM2A 3DEEA 4NC7A 3CF5F 3GTMJ 1D1BA 2B9SA 2HDWA 2HXOA 3FXMA 3K69A 1IC8A 4ETSA 1MJ9A 1OCOH 5DV5A 3HOXJ 3TBIA 2KT0A 4A0ZA 3BZCA 4C9YA 1UCRA 1ZHFA 3ZN1A 2G0EA 3I4PA 3IUOA 1I39A 5CQGA 2DLLA 2LKSA 1KU9A 4JX6A 5C4JJ 4J19A 3A01B 4F93B 1UHSA 1RESA 1LUJB 5EZHA 3R0AA 2ZXIA 3Q9VA 3GFMA 4B47A 2M0MA 3S3OA 3OYFA 1ETXA 2PMZA 3VWBA 3BQYA 1TQMA 4XLEA 3GZNB 5DD8A 1REPC 5L3DA 1T56A 4AYBN 3P7NA 2LC2A 3KX2A 1RR8C 1F1ZA 4BDYA 2L4AA 1HDPA 1I5ZA 4OAZA 3KCCA 2ZFUA 2NNNA 1V55H 4RBOA 2OD5A 3I4MJ 1G4DA 2QENA 3BTIA 3KEYA 1FPQA 2JK3A 2M4KA 2VE8A 1UFMA 3ABKH 3AG3H 3OYBA 2V9PA 2XAFA 1WFXA 2JT1A 3CP8A 4HQEA 3J7AY 1XS9A 5FRNA 1TWHJ 4A0XA 4DZJA 4J00A 3CZ6A 2GA1A 2LR8A 3SZTA 5HVQC 1USSA 2EV5A 1HF0A 1MSEC 3K4CA 2HVSA 1IN6A 3SZPA 5TGTA 5B5EC 1PUEE 1Z3YA 1BBYA 2HVRA 1XSDA 3G71I 1O3SA 2OC6A 5M5XJ 2Y75A 4HLXA 3LA3A 2AXTC 2Y0SN 3I54A 3HL2A 3KE2A 3TO7A 3V7SA 3ZQFA 3K4NA 3U2RA 3W6KB 1DP7P 3BDDA 1XTAA 4DNCA 4OAYA 1I6HJ 2A6TA 4FETA 1HSTA 5F04A 3ZP5A 3AL0B 3IWZA 5HDNA 1IN5A 3ZQGA 2P7CB 2LVSA 3E5UA 2M7AA 1KU7A 1YJNI 2DYSH 4I6ZA 3LA7A 1K78B 2F4MB 3GLXA 2ESNA 2Z99A 4B48A 2L9NA 1QZYA 3LSHA 1B8IA 4RB1A 2VJ4A 3OYJA 5H6QA 3IKTA 1Y8QB 1T08B 5LHGA 2CFOA 1JJ8C 2DOEA 5FB2A 3VFZA 2HDCA 1J5YA 2O9LA 2OCCH 2JRTA 1TWFJ 2VQLA 3SEZA 3GTOJ 1EKEA 4L9JA 4FISA 5GPCA 1X2NA 4YIFA 5DM6F 4XSZF 3WTSC 1IV6A 4L18B 3MKWB 3WE3A 4RAYA 4U0YA 2L7FP 5HS7A 2VASA 3J81K 2O03A 3ISPA 5F0CA 3RJPA 1N25A 1DP3A 2OV7A 3CESA 3L7WA 4XMYA 3BT9A 1TNSA 5DDGA 5IT9Z 1XMXA 4GYIA 1MJAA 4BH9A 3G1MA 1QBJA 1FSHA 2CQNA 2EZHA 3P5JA 3FF5A 4WXHA 3DP7A 4G6QA 4ZDLA 3S1RJ 2CWEA 3H1CA 4CZCA 1JGSA 2HGCA 2IS6A 2K9SA 1XD7A 4AIKA 2X6WA 2DDAA 1WH5A 4GXOA 5J1YA 1VQ4I 4ZDPA 4KN4X 5D4SA 1BIAA 1TZLA 1T39A 3OOPA 4A69C 2IPQX 1U8RA 5CJ9A 1PP7U 4IHWA 3HSFA 4OU0A 1T0FC 2BVMA 2P7VB 3VYTB 1YTYA 4M73A 2HS5A 4RDUA 4BE0A 5C3EJ 2E1NA 5DYMA 5CVUA 2ESHA 1Q1VA 3C2GA 1IUFA 3E3VA 5IYDJ 2TDXA 1I6XA 4DIQA 1WZ2A 2L7ZA 4LB5A 3IH2A 1U5TA 4E7HA 4RAFA 3D5SC 3CDHA 3Q0UA 3QYEA 3RSNA 1R23A 4GCVA 2DYRH 4CDGA 3LNQA 2Y9ZA 5CPRB 4ZTFA 2XGEA 3MEXA 2KL4A 2CH0A 4XRSG 1T6SA 2D1HA 2MC4A 1D0ZA 4HLYA 3SJMA 3TW7A 4YG2F 1BC7C 1YOVB 1LEBA 1D1AA 1I1GA 3WE2A 2IXSA 2XPWA 4ZJZA 1ULYA 2LTPA 3QU6A 3OYEA 3OSGA 3CCEI 1OCPA 1ZAOA 5HS8A 1GT0C 1WI9A 2LD5A 1MIJA 1R5GA 3G1OA 2NNYA 3CMMA 1KYWA 1I3QJ 4L0ZB 1J7KA 3CDLA 4PJJA 1W36D 1K4SA 3OYAA 5HNHA 1PJRA 3UKGA 3I59A 1LE8A 1R6RA 5GAGJ 3FXJA 3I53A 3J80Z 1BOBA 2R7WA 2FD5A 2DBBA 1XB4A 5TRDA 1PUFA 2ZSHB 4AWXB 3CCUI 2QQ8A 3SDGA 5LBQA 2LDUA 2VJ5A 3CCMI 4EEFG 5FFXA 4X0GA 3GZ6A 2GIZA 1NHAA 1Z9CA 5IOZA 4F92B 3MKLA 3DXJF 4ZYGA 3CMYA 3A2KA 2L02A 2ZXJA 1H8AC 3H0GJ 2FE3A 2DT7B 2KDZA 6PAXA 1FLIA 4KT6A 2OU2A 3KLOA 3IRQA 2HOTA 3KYCB 3VEPA 2AXLA 2KLOA 2X6XA 1EH7A 3EUAA 3F6OA 3VDXA 3HKZN 1FNNA 5H6RA 3I3LA 3T8TA 2HEOA 3BOQA 2BY1A 1HOMA 4HRIA 4CYCB 1HKSA 1IN8A 3EDPA 2B7EA 3IV5A 4FCYA 2JZYA 4C3IJ 4P5OA 1IRXA 3MMYB 2QCOA 4UVAA 3OYNA 1STZA 5CVJA 3FBIB 2DDBA 4RB3C 2KISA 5HLGA 3RI4A 1ORKA 3BPXA 2CV2A 2Y0SA 2BXZA 1VQ8I 3AG2H 2A05A 3DF8A 1MMDA 2V1NA 1OISA 3RCOA 3WODF 1YS6A 1ETQA 2K4BA 3V7CA 4E7JA 2XC7A 1Y56A 2R7ZJ 2W25A 1S8NA 5K5QA 4HA8A 3DKWA 2DPUA 2HDDA 2TRTA 3LSIA 3GTPJ 1K83J 2KJBA 1EV7A 1LFUP 3RKWA 1SMYF 1ERDA 2CRGA 4UVBA 2QQ9A 2LBFB 4KMUX 1WJCA 2JN6A 1FBQA 2GQQA 2HKOA 4NQWB 2BE5F 2R7RA 3SFZA 1NG6A 4IKFA 5E8GA 3K4LA 4IOAF 3FM5A 2PI0A 3DPLC 4ESBA 1MMNA 3HXLA 3CTAA 4BDZA 3FKIJ 4A6DA 3VODA 5EZGA 3CCLI 2PJRB 2KDOA 4LG0A 2E71A 5EG0B 4KYWA 2COMA 5E79C 2V9KA 1U3EM 2WAQA 1R4NB 4HEA2 1LDDA 2MD5A 3DLLF 3GTJJ 4B4CA 4R1HA 4I2OA 2ISZA 1GVJA 2J5OA 3BZ6A 4YRVA 3CO7C 1D8JA 3S14J 3S1MJ 3M8EA 3TKYA 4PSXA 1YX3A 4P1WA 4A3JJ 2HVQA 3WU1B 1Y1VJ 1N75A 2J5PA 3ZCOA 2VQCA 3QPLA 3OS0A 1NH3A 5B66C 1D8KA 2PFBA 4II3A 4DZPA 3EPZA 1JT6A 1X1BA 1AU7A 4BAYA 1O57A 4IZZA 2CW8A 1TBXA 1X2MA 5L3FA 5J1UA 4KT5C 2R7VA 3JAMZ 5EGOB 4N9IA 1FY7A 3JRCA 1WJFA 3B6CA 2IGNA 2CQ7A 3BJAA 2QYOA 1U8BA 2L3DA 3A0BC 3H0DA 5EDNA 2M8EA 3FK6A 3PFYA 2A07F 3GTKJ 3SQNA 2OUMA 3ZMTA 2EZLA 1O3QA 3J7ZI 3VPRA 3D1NI 2KZVA 2IS4A 3I4NJ 5D5VB 4OMYA 2M4GA 3ML6A 4EJWA 3OYIA 1JTYA 4FASD 3SZGA 2K02A 2MC3A 1WHUA 2TCTA 3I9V2 4QWQA 4IO9F 2E1MC 2XF5A 3HOYJ 4M3GA 1T8IA 1R4MB 5KAFC 3WTYC 5KHDA 2P8TA 3RKYA 2CUZA 1JUSA 2HPMA 1ON2A 2IS2A 4E70A 1XSXA 1B59A 3HRSA 5D5XB 5E1XA 3BTLA 3K1PA 3E6CC 3LQRA 3AFHA 4RM3A 3J81Z 1MBEA 2OQRA 3HOSA 5F0FA 2CMPA 2NVXJ 2R5ZA 1D5YA 2Q1ZB 3GFLA 1FX7A 3GBGA 3K9TA 2X0LA 4XK4A 4JX5A 4CCLA 5GTIC 4IPAA 1RRJA 4AD9A 1W0TA 1FT9A 2LK2A 3FXRA 3IKVA 4QPQA 1XSVA 3ZMUA 4G7HF 2MFZA 4A3LJ 3S2WA 3HDDA 2EA2A 4XSXF 3FBNB 5GPAA 4B43A 1JHFA 1ZTRA 3TQNA 2EPFA 3TW6A 2K86A 4B8XA 5K5RA 1WPKA 1FOXA 2FOWA 1IZ1A 2ZMEA 1Z1DA 1OJLA 4BEHB 4EV0A 2LNBA 2MG4A 3G3ZA 2DAOA 4OIRF 2EQRA 2F5DA 4R79A 2YR2A 3DCFA 2WY7Q 3DBLB 3M1EA 4YFXF 4DJAA 5JI6A 4IRGA 2LH9A 2OQGA 3QYFA 1RNLA 2RVCA 1AKHB 4BKXA 2VLAA 2K9NA 5GP9A 2V6EA 3V4GA 2KKOA 5BS6A 2JA7J 1Z3XA 3VYSB 4EATA 1J75A 4BS9A 1QA6A 1SD5A 4NHJA 3IH3A 2JMWA 4LGWA 2H8WA 1V3FA 2VKHA 2VT2A 1KU2A 3CCVI 1FYKA 2WB1N 1FOKA 1KU3A 2ZJRF 1R7JA 2LYCA 3IWFA 1MJBA 3U1KA 1V5EA 1MW7A 1MGTA 4X6AJ 1WJBA 1KZHA 3KEQA 3CC7I 4AVPA 2LF8A 4UUTA 4X1EA 3F23A 4GRIA 4BE2A 2KIUA 1D0XA 2XKPA 5BPIA 3I5UA 2O8KA 1G3SA 4DYQA 3ZPLA 1IDYA 4JOMA 2E35A 2EWNA 3M1CA 2LMDA 4BYYA 4ASNA 3FMSA 4UHTA 4G7OF 3WHCA 4WWCA 2LF7A 1YLFA 2XRLA 4I76A 3WTWC 1WKMA 1MBJA 2RQPA 2ZJ2A 4U7DA 3T0YA 3S1NJ 5LGNA 2OF7A 3R0JA 1VQ5I 3E7LA 1ZGAA 4HF2A 4XN3A 4A12A 2BZTA 2Z1DA 2HQ5A 4P9UA 3ABMH 5ICGA 1Y6IA 4JK1X 2BY0A 4C30A 1YRNB 1P4XA 3R4KA 4BJ5C 2CS3A 1ETOA 3MKZA 4I0BA 4XNFA 3S1QJ 1BIBA 5HDGA 4ZYAA 3ZQLA 3D0SA 3RYPA 4EJUA 3JTHA 3VOEA 5J47A 2M8GX 2RN7A 3NAUA 3HZJA 2EBIA 4BGDA 3E6MA 3UR3C 2ME6A 1IGNA 4HZFA 1FOWA 2QZ8A 4S04A 4D5FA 3LQQA 3JRIA 1BOAA 3GZ5A 3KZIC 4A3MJ 1X1CA 2HFHA 5LRSA 3NWTA 1XCBA 2CJJA 4CA0A 1OPCA 3TP0A 5A2QK 2JUCA 2ME0A 2JJ7A 5FKOA 3GO5A 2FUG2 1LKXA 3B02A 3BJ6A 3EYIA 2EFOA 2R0QC 2ZC2A 1RUNA 2GWRA 1HLVA 3CC2I 1ACIA 4CCOA 3OYGA 2K27A 2BW3B 3HRTA 4I09A 1R49A 1SD7A 3OL4A 1HCRA 2WAFA 5J40A 4HV5A 2ELKA 2CG4A 5KCMA 1FP1D 1W7PB 4HAMA 4XLHA 1G59A 2Y48A 2STTA 2E60A 4OMZA 3KP4A 2IEKA 1AA7A 3ESWB 2P4WA 1FMVA 3UNGC 1VNDA 4B3AA 2FJ1A 2M5WA 4E7IA 2ISYA 1O3RA 1T33A 2L9VA 2XHKA 3K1MA 4G12A 1Z91A 1OMIA 3PO2J 1WJ5A 1S5LC 2PX9A 4M74A 2VQGA 3OYDA 4IL6C 1P92A 4UXNA 1UZCA 3H9GA 3M9AA 4L9TA 4EQQA 1TP4A 3GFIA 1POGA 1SVLA 4XL9A 1Z6RA 4UUSB 1XGOA 2KIMA 5FROA 1UAAA 2PMUA 5HLIA 1NG7A 2QVOA 3ZQHA 1O3TA 1X1DA 2G7UA 2K5CA 2NVTJ 2E5NA 1SVOA 5DM7F 4M3FA 2JA5J 3H3VK 2E34A 2E5ZA 3KP5A 3Q0VA 4RGUA 4ZDOA 1GVDA 3CCQI 5IOYA 2V1XA 1OLTA 3KYDB 3PIPF 1TQPA 3IH4A 4CCNA 2RKHA 2V1DA 4HV6A 3X2QH 2CU7A 5HS9A 3TEDA 4BY7J 1MNEA 1OCZH 1MBKA 3DFGA 2Z5UA 1JKPC 1KONA 1W7PD 2Y31A 5LD2C 3Q9SA 5K7ZA 3LL7A 1RIOH 4AC0A 2DQRA 2FF4A 2KFDA 2NXNB 4FHTA 3BG7A 4B44A 4EJVA 1GDTA 1F43A 3RPUD 1EA3A 4PJLA 4BBSJ 2EFNA 4G7ZF 1DGWY 5B3SH 3TOAA 2CSOA 2UV1A 3PNVA 2Q0OA 5IT3A 3CUQA 1M1EB 3J7YJ 2Y69H 2A5WA 3KP2A 4XM3A 1R00A 5EF6A 3L2CA 4B1RA 2D5VA 5E18F 4RLQA 3MZYA 2K7LA 4YELA 1PP8F 5DCMB 3F8FA 4RAZA 3DEWA 2RREA 5F1RA 3F22A 1U9NA 2WB1A 1YJWI 3QOPA 2JA6J 4I7HA 1CGPA 1PVEA 3L2RA 3KEOA 4I98B 2CQXA 1E3OC 1KQ8A 3TL4X 4LFUA 3BP8A 1RR7A 1WJEA 2CUJA 3OV8A 4FQGA 2NOJB 4CSWA 2DPDA 3H92A 5ICFA 2H27A 4CH7A 1ZQ3P 2BYVE 4YEJA 4FE7A 4V19K 2VOOA 2VBXA 5E3MA 1YO5C 3ONQA 3Q3SA 3A1YA 2E1MB 4CYDA 4OWRB 5J3LA 4BXUA 3S2DJ 5EYRA 3GTQJ 2VI6A 4D0PA 2K85A 3H5RA 4RGXA 4EGYA 2OZUA 1IDZA 4PUSA 4ZZLA 3M7GA 2UWMA 2X51A 4KN7X 4LK1F 4BACA 1X1PA 1T38A 3EYYA 2VQHA 3SFIA 1CF7B 2QQBA 1NK2P 2QEXI 2ZXHA 1BW6A 1RZ4A 3LOCA 4U87A 1HBXG 1XMAA 1QQIA 3C2BA 2E1OA 5F64A 4A3IJ 1DPRA 2VONA 2QM3A 1Y8RB 3OL3A 4ZYDA 1QHGA 5FLMJ 3HOVJ 2X1CA 3R60A 3WG7H 4F55A 2R7DA 2F5VA 3ZQQA 2ETHA 3GW2A 3O3KA 2AO9A 3JW4A 3S16J 4C2TA 4L5EA 4XLFA 4LIUA 4BE1A 1J09A 5D4RA 2KIQA 4IHSA 2WY8Q 2PMHA 4MTDA 2QSHX 2Z33A 2Q2EB 4WXDA 2A3SA 3R6SA 3EUHA 1SAUA 1A36A 4LB6B 2UXXA 4IHYA 2DMQA 1MMAA 2NS0A 4ITVA 2DA1A 1P4WA 5LHIA 2MYSA 2F4IA 4KJZA 2BGCA 3BR5A 4IQ4A 3WGGA 4GFBA 4KDPA 2WA0A 5FKKA 2EILH 4ANJA 2R5YB 4OIQF 3HSRA 4Y33A 1FP2A 2GOMA 3BR3A 1H9TA 5HNFA 3REOA 2ZJQF 3Q5FA 3IAS2 1YFHA 1HC8A 2H09A 3CJNA 3OIQA 2DT6A 1K79A 2VBWA 3WGIA 2HXIA 2F4OB 3G1LA 2D45A 1BI2A 2GIVA 1ZG3A 3SDBA 4CUGA 2XKOA 1IXRC 2RC4A 2ZNZA 4DYCA 3QQAA 2HI3A 1XDSA 1A5JA 4AUXA 4WX9A 4NC6A 1YIOA 1FSEA 3CF2A 2FBIA 4RB2C 1RI7A 2VC1A 3FX3A 3PNTA 3QPTA 4HNTA 3K2AA 2XPUA 1MDMA 1BI3A 2BXYA 2OA4A 3L2WA 2VT3A 2LRDA 2BVLA 2QKMB 3MN2A 4LJZF 3RQIA 1LB2A 3NARA 4U0WA 3LSGA 1B72A 1S7OA 4NNJA 2OTLI 3PM1A 4UB6C 3FM3A 2Z2SB 3K10A 3WGHA 5FD5A 5HLTA 4XRFA 3GUDA 4L5IA 3HEFA 1EH8A 3HYIA 4LLLA 2BHYA 5HODA 1WJAA 2DMNA 4FT8A 5GAHJ 2COBA 2CUEA 4PSWA 1VQ9I 2F5EA 1B1BA 2DA2A 3HSEA 3S3NA 3SYTA 4NB5A 4GO1A 3TOBA 3W2VA 2VBYA 4HSRA 5DTDA 1R1UA 2K9MA 4D9JA 1Z6TA 3RPUA 2YPRA 2PQ8A 4XLAA 3TDUC 5D8KB 1R1TA 2GZWA 4Q47A 3PNYA 1FTTA 4CO8A 3JR9A 3CMAI 5A2QZ 4AYBA 4A3EJ 4E7KA 1XGNA 3HUGB 1LVKA 3OWTA 5IY5H 1YJ9I 4IHXA 3B73A 4G94A 3EETA 1ZKGA 2W82A 2ELHA 5JLXA 2W48A 3OYKA 1WSUA 3BJOA 3F21A 4XONA 1U5TC 4Y52J 2VXDA 4MLOA 1MNMC 3O2PE 4G8XA 2BBYA 1ZN2A 1HQCA 1USTA 2R3SA 3J7AO 1GV5A 1UJ8A 2XF7A 3A01A 3B6AA 1VI0A 4PJ0C 4N0BA 5JFRA 4PFPA 3ZQCA 3JRAA 4DGWB 1OKRA 1G3YA 2HQAA 5C44J 1ZLKA 2K9LA 2P6TA 1ETVA 1K6YA 2ZCWA 3I71A 3N97A 2HOSA 2XGXA 2QBYB 1QHHD 2IVMA 3PO3J 4W1UA 4A3CJ 1TT5B 1B6AA 1LDJA 5FLXZ 3V7RA 2IAIA 1S72I 1TWAJ 2QF7A 4XKVA 5IYBJ 5LHHA 3K70C 4UV8A 2EFPA 2VKEA 2DJIA 4LLNA 5ED4A 3G2BA 2CQQA 3IC7A 4NUBA 4XQFA 2MH2A 4HOBA 1D5VA 2L54A 2L9RA 3E97A 2MGQA 3PFIA 3T1BA 4HNUA 5FLVA 5BQTA 2XF6A 3QRFF 5DS9A 3BTCA 2IT0A 1ON1A 1ZG1A 4W97A 3BG9A 3GLLA 3DKXA 4BHPA 3PJRA 4MNUA 1FWZA 2JTVA 3LSRA 1R22A 4Q48A 4KFCA 2QUFA 1SMTA 1VQLI 3CDIA 3ASOH 5TJJA 3OR2C 4RS8A 3K2ZA 1DGRM 1R71A 3H3ZA 4JX4A 2ECCA 3C2HA 3BR6A 2H6CA 4JQFA 4B09A 1GXQA 2M1BA 3MWMA 2O3FA 2VC0A 2RV8A 3S3MA 3V42A 2DA5A 4M6VA 3OOUA 3OS1A 1GUUA 1DQUA 1T98A 1BJAA 4LLGF 3IL2A 3ELKA 3JREA 4IHVA 2VKDA 1QNTA 2W85A 2DFEA 4I01A 2EFWA 1RETA 1K78A 1BI0A 2GLOA 1R5ID 2E19A 3KFWX 4PJNA 2QKLB 2VN2A 3K7AJ 3FDYA 4Z2YA 4IX7A 4NC8A 2QQAA 3ULQB 5L3BA 3HB9A 3JRHA 1BW5A 2V9VA 5GAEJ 2QA4I 4M6YA 1ZRCA 4R8HA 4Y15A 1I27A 3BCBA 2X1DA 1ZLJA 5KNLA 3AG1H 5ICEA 3T5XA 3JTGA 4YFKF 4IQJA 5CVIA 3HOZJ 1APLC 4A3KJ 5D5UB 3A0HC 5F1JA 3V8LA 4EGZA 3TDZC 5BMZA 1Y0NA 4BXXJ 2L7MP 1C0WA 3FXKA 3WTUC 1CQTA 5H2FC 1X58A 3LSPA 3HGYA 3F8BA 4IRHA 1FYLA 2IRFG 4C3HJ 1ZARA 2F2EA 2WV0A 4Y7NJ 1YW9A 3HHGA 5J8CA 3LAJA 3KETA 1FTZA 4F52A 2KZGA 1YS7A 4WK8F 2Z3YA 3FWEA 1RKWA 1QPIA 2M45A 3BTJA 3VYRB 3CQZJ 3QAHA 5K1YA 1AWCA 1H9GA 4II2A 4U88A 4QIWN 4HPQA 3DLAA 3CCRI 4S05A 2A61A 3GMEA 2E2HJ 2A6HF 4GDFA 1MBGA 4O3MA 5AONA 3BR2A 9ANTA 1ZGJA 3GEZA 1X3UA 1P7JA 2MH9A 1ZRFA 2Y2ZA 2MW8A 4UB8C 3TP3A 5F27A 3PQKA 2LOOA 4DYRA 4ENJA 3L2QA 2LG4A 3BR1A 4XN0A 4HW0A 5ILVA 3RTRA 2EIKH 3QPSA 1IXCA 1YG2A 1JGGA 3IP4B 5LLQA 2RGVA 4D5CA 1YITI 3ECHA 3BG6A 2XAHA 2L9SA 2P5LC 1VQOI 2ACJA 2AHQA 3NQOA 1S6LA 4D7MA 2V1UA 4A3DJ 2FEZA 3QPHA 1E3PA 1U6GA 1FEXA 2CQKA 3M8FA 4P96A 1N77A 2DCEA 4PK4A 4A3FJ 4QPOA 2DW4A 3NWSA 2F5FA 4M9SA 2GXBA 3FISA 3PIOF 4C2MJ 3ZN0A 3AAFA 3BLYA 4DOZA 2DK5A 2M7BA 3H36A 2DTRA 4UVCA 3KLNA 2YUSA 1ZR2A 3KPHA 2NS8A 2HYJA 1JXSA 4J01A 3FZVA 3F3XA 2B0LA 1L0OC 1WI3A 4L0YB 2MBFA 1TW2A 3RKXA 1W4MA 2DMTA 1YW7A 3DTIA 5C4XJ 1JT0A 3HKZA 2EINH 2BEOA 3DBHB 1JHHA 1PDNC 1BI1A 3GCMA 2A68F 2DFHA 3K4JA 2HOAA 2PBIA 2WTEA 2LP0A 1XPXA 5HDKA 2VL8A 3W6VA 3NEUA 2X4HA 3GYHX 5FRMA 1YE9A 2HYFA 5FJ8J 3SEQA 1FBSA 4IJAA 4JBAA 3AKZA 4GYGA 4Q4ZF 1MH4A 2XV4S 5E1WA 4Z6YA 1B8IB 1QU3A 3C3WA 5IP7J 1L3LA 5AIQA 1MSFC 1HDDC 2DA6A 2CGPA 1RPWA 1MBFA 4HDVA 3L9FA 2DO7A 3TGNA 3OY9A 4PJMA 4BQNA 2OCEA 3HGGA 1SFXA 1OR7A 2KJCA 5FKMA 2ECBA 3WTTC 1SFUA 5FGMA 1FOYA 2L2OA 3HTUA 2MLGA 4M9XA 3I64A 2NVQJ 4Q5SF 1SD6A 3BPVA 1R1VA 3K4KA 4OINF 4FTHA 5E20A 4CYCA 5KK1A 3MZHA 1Y1WJ 5FKLA 4PGGA 2FU4A 2CW7A 4KIGA 3U21A 1SFEA 2YX4A 2ZB9A 2R7FA 3HOUJ 1BR2A 3RYRA 2NVUB 3BQZA 3K4MA 1X3ZB 1WH7A 2ZMEC 4IF4A 2LREA 3QP5A 4XKWA 4DW6A 3GTGJ 3KP6A 1D3YA 3SXYA 2FBKA 3LSTA 2W4SA 2V7FA 4NDLA 5L3CA 5J8FA 1FIPA 4UNOA 1R5HA 4S0HB 1XMKA 2HWVA 1MD0A 2Z16A 1MMSA 2QGUA 4XRMA 4OOIA 4MEYF 1F5TA 2CO5A 3CLQA 2EA4A 3PSIA 4Y17A 2E36A 4BY1J 2HZDA 3ZOBA 1YYVA 2X85A 3F8CA 1ENHA 2CYYA 3ABUA 2O5RA 1J9IA 1BM9A 5LGUA 2X6OA 1HA8A 3P9KA 3ZGKA 1OCTC 2LBFA 4UUVA 3E5QA 3MCZA 2GXAA 2HNHA 1U5TB 2R93J 2WADA 1GLNA 4NQWA 3N05A 1SFOJ 1K61A 4M72A 3AG4H 3CJQB 3WTXC 3CD6I 4BU2A 3JRFA 1JJ6C 1YX5A 3ZRGA 3FXOA 4EM0B 2XSJC 2BY3A 1XN7A 3W3CA 3RPQA 5D5WB 3ABTA 4KIFA 1QZZA 2DI3A 2HR3A 3DKYA 2PJRA 2P5KA 1B9NA 1XX5A 3LSKA 1WJDA 4LD5A 5EG0A 4CXFA 2K3FA 3CLOA 3A03A 2M2EA 4DQ2A 1E0EA 4DBRA 4H0EA 5J6XA 2GOXB 2KHMA 3DU5A 1HW2A 4YIIA 1VF9A 1XGSA 1KYZA 1X3WB 4PFOA 3S8PA 4A6EA 4XOPA 4EVIA 3FMRA 2EB7A 2YSRA 2LKPA 2PJPA 3U1DA 3I59B 5GTHC 1LE8B 2HQRA 2XPVA 4LITA 3W2WA 2KQRA 2Z9OA 1Y39A 2PG4A 3H35A 1ZR4A 1PUFB 2JSPA 1UG0A 5EGOA 2H6BA 3Q0WA 1R58A 4CGZA 1ETWA 4HX7A 5BPDA 1EF4A 5GADJ 2DFIA 2GBYA 2BV6A 1JKRC 1A35A 3A02A 2H8RA 4O5VA 1G8XA 3CO6C 1J0RA 1IAWA 1IV8A 3W6JB 4BQOA 1ZK8A 3BG5A 3RIRA 3LFKA 5D6FA 2ZNYA 3KP3A 1S3JA 3OSFA 1P2FA 5IYCJ 3OYMA 3IAM2 2UZKA 5CLSA 1UB9A 2AQEA 4M3EA 3TO6A 2O61A 1H89C 1TT0A 4L5JA 2XDVA 1XG1A 4XICA 5IP6A 2DOFA 3ERMA 2CV1A 4AIHA 4XIDA 5CVVA 2FQ4A 2JPBA 3E1SA 3DEUA 2BHZA 1VFCA 1BR4A 4I99C 4B3XA 3K70D 2E7WA 1AHDP 4XORA 3BC8A 5LEKA 4XKCA 2KPMA 1E3HA 2ELJA 2XGCA 3H9JA 1DU0A 1GV2A 3BCAA 3ZMDA 2K40A 3L1PA 2K3PA 3LA2A 3ECOA 3HM5A 5F6FA 2L0KA 4KMFA 1D0YA 2IA0A 1YIJI 3HHHA 2BOLA 2XROA 1S29A 1FC3A 4A93J 3F0CA 5DUIA 3LSJA 3HOTA 2M30A 2PLYA 2X1EA 4NBQA 1FZPB 4HF1A 1TQIA 2RNGA 4BHCA 1U78A 4JYKA 2ZFWA 3GWZA 3RKQA 4BEHA 4YIRX 1J59A 1GXPA 1IN4A 4ZC3A 1G3WA 3MD2A 2E2JJ 3FMQA 4JP0A 2KP6A 4E7SA 1X19A 4OIPF 4QSHA 3VYUB 1EH6A 3MVPA 1JUMA 1FYMA 1E17A 1SVMA 3KZZA 3MQ0A 2RNJA 4LK0F 4BHBA 1OYIA 3JAMK 1UELB 2JPCA 1V4RA 1AKHA 1NK3P 5K5OA 1T0FA 2GXGA 1K4TA 4LG0B 3D5RC 3ZMVA 3JCUC 2FMYA 2CFXA 5ILSA 1QO0D 1LEAA 5DEQA 3GFJA 3P9IA 3E6BA 3HG9A 3VSKA 5F0HA 1LQ1A 1DU6A 3JSPA 3GVAA 2OZ6A 1OCRH 1VQNI 4F91B 1YI2I 1S7AA 3HC7A 4ABZA 4C3JJ 5M5WJ 3T8RA 4KA4A 1LNWA 3CMEI 2KMUA 2IJLA 2HOEA 1A31A 2VPLA 1UHMA 5BNGA 4IHTA 1JI8A 1Y0UA 3S15J 4AVZA 1UG2A 2OTJI 2EFQA 3FXUA 4EJTA 3HIFA 1P6RA 2XAUA 3OMYA 4HYEA 1ZH5A 3CUQC 2NOGA 2I10A 1MKMA 2W1OA 1G3TA 2LFBA 1H0MA 1BJZA 2EZKA 1W1WE 5IPAA 1OYWA 2CV0A 4HNVA 1TLHB 1V54H 2I8DA 3DPUA 3O8GA 4ENNA 1KQ9A 3CC4I 2WAQN 2XRNA 4BNCA 3QP6A 2O6GE 4H4KC 1HW5A 2NVYJ 5ILUA 1UMQA 2FOKA 1JKQC 3JRBA 4QTRA 2NS7A 1LJ9A 1X4OA 2W24A 1YRNA 2H94A 1KQ0A 4N4OB 2QWWA 4LOCA 2X6YA 2E2IJ 4MQVA 4DBQA 2EV0A 2O8XA 3CUOA 3PSFA 3HPHA 4PCQA 1SC7A 2IP2A 2FNAA 1BN5A 4AIDA 2A5YB 2KIFA 5CYVA 3QODA 1Z77A 1IG7A 2NYXA 1TNTA 1IN7A 3KYLA 1MMGA 1V5GA 2DT5A 2VE9A 2FNPA 1RUOA 3W2AA 4N4NB 3WTZA 2VJIA 2R5ZB 5HLHA 3U9GA 1P4AA 1BL0A 2HKXA 4FE4A 1LPQA 2FRHA 3WTVC 5FO5A 3ZR8X 2FMLA 4LMYA 4XKBA 4XR6A 5CKTA 1YQAA 2JVHA 3MAJA 3ZXSA 5ERIA 4A2UA 4ZYEA 1JUPA 2F48A 2V26A 3BZKA 4M6XA 1JKOC 2M87A 4KIBA 4MHGA 1QRYA 3G4SI 4V2GA 1H88C 1P9QC 1WQ2A 2YU9J 2R7XA 2M34A 1LFPA 2ZMEB 2ICWG 2ZXWH 1SEUA 2RDPA 2DA4A 1HKQA 3K4BA 2V6CA 4UV9A 2BW3A 3EUHC 2LY9A 3COAC 1VTNC 3IRRA 4BXFA 1WGXA 1W7PA 2VODA 2A6EF 1OCCH 4IRIA 3O6BB 3OYHA 3M07A 3HTSB 4XRSA 5CVRA 2CW0F 2HU9A 1J2XA 5LGTA 1TC3C 4M3DA 4RLFA 2GA2A 5BOXA 5CQEA 3I55I 2ZSIB 4GGGA 1BR1A 5JR3A 2QSFX 3S17J 4BUPA 4AIJA 3RZDJ 2OPTA 5LFAA 1Z0XA 2E1CA 2C6YA 1I3AA 4HBLA 2HZTA 4IVNA 4TV7A 1U9OA 1SANA 2EIMH 3H9QA 3ROUA 2EZIA 3F9KA 4UUSA 2H1LA 3LWFA 4HQMA 3E5XA 1V5FA 2FSWA 2R7TA 1QVUA 4G9YA 4RGSA 1MH3A 4LG3A 2DFFA 5EEHA 1O7FA 3EQLF 4ENKA 4ENMA 2FXAA 1I50J 1DUXC 1X1AA 4N9HA 2Y9YA 2I5UA 3CCYA 3JRGA 3M4OJ 2ZBKA 2P0WA 2XAGA 4MGRA 2JWTA 3S2HJ 2P6SA 3WU2C 3G6EI 5J1RA 1KA8A 4XOTA 4BQQA 5M3MJ 4MFEA 4D1QA 3HBLA 4Y3OA 3LMMA 4BQAA 3C7JA 5IP9J 5M3FJ 3FK7A 1W0UA 3GX4X 1SAXA 1Z67A 5K7HA 5L3EA 2OJED 1VZ0A 3C18A 4I02A 3S32A 1B9MA 2WAEA 2K4JA 1AOYA 4MTEA 2EV6A 5FFZA 3DU6A 2YX7A 4MIMA 1P7IA 4WXCA 2M3AA 2VXZA 3ZQ7A 5JLWA 1JE8A 1VQKI 4OIOF 2IS1A 5JHUA 5DUKA 2FX0A 2KRHA 5DCMA 4AU7A 1WCMJ 4RAGA 1T2KA 1A6QA 2D2WA 2O7OA 2VUMJ 3R61A 3LSMA 3VB2A 4CCMA 1N78A 1VQPI 1HKTA 1R36A 1T95A 1QVTA 3D5LA 3SHFA 4BL0B 2DJNA 2MLKA 2JQ7A 1QPMA 3GF2A 4L9NA 3L00A 1LVAA 1ZG5A 1UHWA 4WCGA 1QGPA
chains in the Genus database with same CATH topology
5LEJA 3L09A 1HSJA 1LDKB 3BROA 1K7AA 4PZJA 3HRMA 1ONVA 3F8MA 1Q1HA 2NRAC 3NRVA 5D6EA 2DK8A 1CF7A 4YFNF 5LRRA 2L01A 1F4KA 3P9CA 4FX4A 2GAUA 1DDNA 4WF2A 1G6NA 2YU3A 5E17F 2EJRA 2HYGD 1XGMA 4KNYA 2PEXA 2W84A 4PGHA 2LSOA 2Q2EA 4MEXF 1OYYA 4KICA 3ERED 4A5MA 3I0TA 5EEGA 4EJOA 4EM2A 1F9NA 2OBPA 4G6DA 4M9ZA 5H20A 1FBUA 1XCVA 3IHUA 5E8IA 1IUYA 1IXSB 5HOOA 4RB0A 4ZH4F 4ZYHA 3GXOA 2D1VA 2FBHA 2G7HA 1W5SA 2EK5A 5FD6A 1KGSA 3BY6A 1O7LA 4HF0A 3TO9A 3ZMZA 4F7ZA 3WU0A 1IRGA 3CUQB 4P9FA 3JSOA 2DU9A 3I58A 4EM1A 3G73A 4EMSA 2MA3A 1SD4A 3ZMSA 5AIPA 1IRFA 3RDIA 5JVTA 4FX0A 5DCFA 2NAZA 5KVRA 2OAZA 4U7BA 5D8LB 4KUMA 5IT9K 1DPUA 3QU3A 1WWXA 1Z05A 3DV8A 3KZYA 4CZZA 1U2WA 2VBZA 4ON0A 2ADUA 1GHCA 3HUGA 5ICCA 4CICA 2HTSA 2ZO4A 2XIGA 4Y13A 3K0LA 3DQVC 3FXQA 4U0VA 1HW1A 2ZKZA 4ZZDA 2HTJA 3N4MA 2HQNA 1IF1A 4HX4A 2A69F 3HRUA 1MZBA 2XUBA 2QBYA 1Z7UA 1B4AA 4O6JA 3V8JA 1W5TA 1IW7F 1ZREA 2STWA 2O0YA 3F6VA 4M71A 2E7XA 1TTYA 2F5CA 2FA5A 4CHUA 2P5VA 2IA2A 4PDKA 4HDUA 3H3UA 3PQJA 3J80K 2UXNA 1BC8C 3KP7A 2QLZA 2AS5F 4P55A 3FHZA 1A04A 1YW8A 4ESFA 2KRFA 1E2XA 4HX8A 2V79A 4K2EA 2PN6A 2IA1A 4ESJA 5DD4A 2W57A 2JSCA 2Y0MA 2IW5A 4XLPF 2FQ3A 1WRJA 2XAJA 4L9VA 4RGRA 1MDMB 2WWYA 2XAQA 2VOPA 1ZYRF 2XASA 3F8NA 1TW3A 3E6DA 4I0AA 5L3GA 2WC2A 2G9WA 2Q8KA 1I1SA 3C1DA 3WG9A 4XLNF 3MFKA 3V8KA 3DPTA 4XBFA 3LAPA 1ODDA 1ZRDA 5E1ZB 4MQ9F 4IXAA 4A5NA 2L4MA 3BWGA 4QLCU 1HXDA 3F72A 4A0YA 5FLXK 2DQLA 3K1NA 2XVCA 1XDUA 1K6OA 3K69A 4ETSA 1MJ9A 5DV5A 4A0ZA 1UCRA 1ZHFA 3ZN1A 3I4PA 2DLLA 1KU9A 3R0AA 3Q9VA 3GFMA 1TQMA 5DD8A 1REPC 5L3DA 3P7NA 1F1ZA 2L4AA 1I5ZA 3KCCA 2NNNA 2OD5A 1G4DA 2QENA 1FPQA 2VE8A 1UFMA 2XAFA 2JT1A 4HQEA 4A0XA 3SZTA 2GA1A 5HVQC 1USSA 2EV5A 1IN6A 3SZPA 1PUEE 1BBYA 1XSDA 1O3SA 2Y75A 4HLXA 3LA3A 3I54A 3KE2A 3TO7A 3V7SA 3U2RA 3W6KB 1DP7P 3BDDA 4DNCA 1HSTA 3ZP5A 3IWZA 5HDNA 1IN5A 2P7CB 3E5UA 1KU7A 3LA7A 1K78B 3GLXA 2ESNA 2Z99A 1QZYA 4RB1A 3IKTA 5H6QA 5LHGA 5FB2A 3VFZA 2HDCA 1J5YA 2JRTA 4L9JA 4YIFA 3WTSC 4XSZF 4L18B 3WE3A 4RAYA 4U0YA 5HS7A 3J81K 2O03A 3ISPA 3RJPA 3L7WA 1TNSA 5DDGA 5IT9Z 4GYIA 1MJAA 4BH9A 1QBJA 1FSHA 4WXHA 3FF5A 3DP7A 4G6QA 2CWEA 1JGSA 2HGCA 1XD7A 4AIKA 4GXOA 4KN4X 5D4SA 1BIAA 1T39A 3OOPA 2IPQX 1U8RA 5CJ9A 1PP7U 3HSFA 4OU0A 2P7VB 1YTYA 4M73A 2HS5A 2E1NA 5DYMA 5CVUA 2ESHA 3E3VA 2TDXA 1I6XA 4LB5A 1U5TA 3CDHA 1R23A 4GCVA 4CDGA 3MEXA 1T6SA 2D1HA 4HLYA 4YG2F 1BC7C 1LEBA 1I1GA 3WE2A 1ULYA 3QU6A 1ZAOA 5HS8A 1WI9A 1R5GA 2NNYA 1KYWA 4L0ZB 1J7KA 3I59A 3I53A 3J80Z 5TRDA 2DBBA 1XB4A 4AWXB 5LBQA 2LDUA 5FFXA 3GZ6A 1NHAA 1Z9CA 3DXJF 4ZYGA 2L02A 2ZXJA 2FE3A 6PAXA 1FLIA 2OU2A 3KLOA 3IRQA 3VEPA 2AXLA 1EH7A 3F6OA 1FNNA 5H6RA 3T8TA 2HEOA 3BOQA 1HKSA 1IN8A 3EDPA 2JZYA 4P5OA 4UVAA 1STZA 5CVJA 4RB3C 5HLGA 3RI4A 3BPXA 3DF8A 3WODF 1YS6A 2K4BA 3V7CA 2W25A 1S8NA 5K5QA 4HA8A 3DKWA 2DPUA 2KJBA 1EV7A 3RKWA 1SMYF 4UVBA 2QQ9A 4KMUX 1FBQA 2GQQA 2HKOA 2BE5F 3SFZA 5E8GA 3FM5A 2PI0A 3DPLC 4ESBA 3CTAA 4A6DA 3VODA 4LG0A 4KYWA 2COMA 1U3EM 1LDDA 2MD5A 4R1HA 4I2OA 2ISZA 1GVJA 2J5OA 3BZ6A 3CO7C 1D8JA 3M8EA 3TKYA 3WU1B 2J5PA 1D8KA 2PFBA 4BAYA 1O57A 1TBXA 5L3FA 4KT5C 3JAMZ 4N9IA 1FY7A 3BJAA 2QYOA 2L3DA 2M8EA 2A07F 3SQNA 3ZMTA 1O3QA 5D5VB 4OMYA 3ML6A 4EJWA 2K02A 2MC3A 4QWQA 3WTYC 2P8TA 3RKYA 1ON2A 4E70A 1XSXA 1B59A 3HRSA 5D5XB 5E1XA 3K1PA 3E6CC 3LQRA 3J81Z 3HOSA 2OQRA 3GFLA 1FX7A 3K9TA 2X0LA 4IPAA 4AD9A 1FT9A 3FXRA 3IKVA 1XSVA 3ZMUA 4G7HF 3S2WA 2EA2A 4XSXF 1JHFA 3TQNA 2K86A 4B8XA 5K5RA 1IZ1A 2ZMEA 1Z1DA 4EV0A 2LNBA 3G3ZA 2DAOA 4OIRF 4R79A 2F5DA 2YR2A 3M1EA 4YFXF 5JI6A 4IRGA 2OQGA 1RNLA 2RVCA 3V4GA 2KKOA 5BS6A 1J75A 1SD5A 4NHJA 4LGWA 1V3FA 2VT2A 1KU2A 1FYKA 1FOKA 1KU3A 1R7JA 3IWFA 1MJBA 1MGTA 3KEQA 4AVPA 2LF8A 3F23A 2KIUA 2XKPA 5BPIA 3I5UA 1G3SA 3ZPLA 2EWNA 4BYYA 4ASNA 3FMSA 4UHTA 4G7OF 4WWCA 2LF7A 1YLFA 3WTWC 1WKMA 2RQPA 2ZJ2A 4U7DA 3T0YA 5LGNA 3R0JA 1ZGAA 4HF2A 4A12A 4P9UA 5ICGA 4JK1X 1P4XA 3R4KA 4I0BA 1BIBA 5HDGA 3D0SA 3RYPA 4EJUA 3JTHA 3VOEA 2RN7A 3E6MA 4HZFA 2QZ8A 4S04A 3LQQA 1BOAA 3GZ5A 2HFHA 5LRSA 1XCBA 1OPCA 5A2QK 3GO5A 3B02A 3BJ6A 3EYIA 2EFOA 1RUNA 2GWRA 2K27A 3HRTA 4I09A 1SD7A 4HV5A 2CG4A 1FP1D 1W7PB 4HAMA 2Y48A 2STTA 4OMZA 3KP4A 2P4WA 2M5WA 2ISYA 1O3RA 2XHKA 3K1MA 1Z91A 1OMIA 4M74A 1P92A 4UXNA 3M9AA 4L9TA 4EQQA 3GFIA 1Z6RA 1XGOA 2KIMA 2PMUA 5HLIA 2QVOA 1O3TA 2G7UA 3KP5A 4RGUA 2V1XA 1TQPA 2RKHA 2V1DA 4HV6A 5HS9A 3DFGA 2Z5UA 1W7PD 3Q9SA 1RIOH 2DQRA 2FF4A 4FHTA 4EJVA 2EFNA 4G7ZF 3TOAA 2CSOA 2Q0OA 5IT3A 3CUQA 3KP2A 3L2CA 1R00A 5E18F 3MZYA 2K7LA 1PP8F 5DCMB 3F8FA 4RAZA 5F1RA 3F22A 3QOPA 4I7HA 1CGPA 3KEOA 4I98B 1KQ8A 4LFUA 3BP8A 3OV8A 2DPDA 3H92A 5ICFA 2H27A 2BYVE 2VOOA 2VBXA 1YO5C 4CYDA 4BXUA 4D0PA 4RGXA 4EGYA 2OZUA 4ZZLA 3M7GA 2UWMA 4KN7X 4LK1F 1T38A 3EYYA 1CF7B 2QQBA 1RZ4A 1HBXG 1XMAA 1QQIA 5F64A 1DPRA 2VONA 2QM3A 4ZYDA 3R60A 2R7DA 2ETHA 3GW2A 3O3KA 3JW4A 5D4RA 4IHSA 2PMHA 4MTDA 2Z33A 4WXDA 2A3SA 3R6SA 3EUHA 4LB6B 2UXXA 2NS0A 1P4WA 5LHIA 2BGCA 3WGGA 4KDPA 4OIQF 3HSRA 1FP2A 1H9TA 3REOA 3Q5FA 1YFHA 2H09A 3CJNA 1K79A 2VBWA 3WGIA 2D45A 1BI2A 2GIVA 1ZG3A 2XKOA 1IXRC 2RC4A 2ZNZA 1XDSA 4WX9A 1YIOA 1FSEA 2FBIA 4RB2C 1RI7A 2VC1A 3FX3A 3QPTA 1MDMA 1BI3A 2OA4A 2VT3A 4LJZF 1LB2A 4U0WA 1S7OA 3FM3A 3WGHA 5FD5A 4XRFA 3GUDA 4L5IA 1EH8A 3HYIA 4LLLA 4FT8A 2F5EA 1B1BA 3HSEA 4NB5A 4GO1A 3TOBA 2VBYA 1R1UA 1Z6TA 3RPUA 2YPRA 2PQ8A 3TDUC 5D8KB 1R1TA 2GZWA 4Q47A 4CO8A 5A2QZ 1XGNA 3B73A 4G94A 3EETA 2ELHA 1WSUA 3BJOA 3F21A 1U5TC 3O2PE 4G8XA 2BBYA 1ZN2A 1HQCA 1USTA 2R3SA 3J7AO 5JFRA 4N0BA 1OKRA 1G3YA 1ZLKA 2P6TA 3N97A 2ZCWA 3I71A 2XGXA 2QBYB 2IVMA 1B6AA 1LDJA 5FLXZ 3V7RA 5LHHA 4UV8A 2EFPA 4LLNA 5ED4A 3IC7A 2MH2A 4HOBA 1D5VA 2L54A 3E97A 3PFIA 3T1BA 5BQTA 3QRFF 2IT0A 1ON1A 1ZG1A 4BHPA 4MNUA 1FWZA 2JTVA 1R22A 4Q48A 4KFCA 2QUFA 1SMTA 5TJJA 4RS8A 3K2ZA 3H3ZA 4JQFA 2H6CA 4B09A 1GXQA 2M1BA 3MWMA 2O3FA 2VC0A 2RV8A 1T98A 1BJAA 4LLGF 3IL2A 3ELKA 1QNTA 2W85A 4I01A 2EFWA 1K78A 1BI0A 3KFWX 2VN2A 4Z2YA 2QQAA 3ULQB 5L3BA 2V9VA 4M6YA 1ZRCA 4R8HA 4Y15A 1I27A 1ZLJA 5ICEA 3T5XA 3JTGA 4YFKF 5CVIA 5D5UB 3V8LA 4EGZA 3TDZC 5BMZA 1C0WA 3WTUC 1FYLA 3F8BA 4IRHA 2IRFG 1ZARA 2F2EA 2WV0A 1YW9A 3HHGA 5J8CA 3LAJA 3KETA 1YS7A 4WK8F 2Z3YA 3FWEA 2M45A 3QAHA 5K1YA 1AWCA 1H9GA 4U88A 4S05A 2A61A 2A6HF 4O3MA 5AONA 1ZGJA 3GEZA 1X3UA 2MH9A 1ZRFA 3PQKA 4ENJA 5ILVA 4HW0A 3RTRA 1IXCA 1YG2A 5LLQA 2RGVA 3ECHA 2XAHA 2P5LC 2ACJA 3NQOA 1S6LA 2V1UA 2FEZA 3QPHA 1U6GA 2CQKA 3M8FA 4P96A 2DW4A 2F5FA 4M9SA 2GXBA 3ZN0A 3AAFA 2DK5A 2DTRA 4UVCA 3KLNA 1JXSA 3FZVA 3F3XA 2B0LA 1L0OC 4L0YB 2MBFA 1TW2A 3RKXA 1W4MA 1YW7A 2BEOA 1JHHA 1PDNC 1BI1A 2A68F 2PBIA 2WTEA 5HDKA 3NEUA 2X4HA 3GYHX 2HYFA 1FBSA 4IJAA 4JBAA 4GYGA 4Q4ZF 2XV4S 5E1WA 3C3WA 1L3LA 5AIQA 2CGPA 4HDVA 3L9FA 2DO7A 3TGNA 1SFXA 1OR7A 2KJCA 3WTTC 1SFUA 5FGMA 3HTUA 2MLGA 4M9XA 3I64A 4Q5SF 1SD6A 3BPVA 1R1VA 4OINF 5E20A 3MZHA 5KK1A 4PGGA 2FU4A 4KIGA 1SFEA 2YX4A 2R7FA 3RYRA 4IF4A 3QP5A 3KP6A 1D3YA 3SXYA 2FBKA 3LSTA 5L3CA 5J8FA 4UNOA 1R5HA 1XMKA 2HWVA 1MD0A 4OOIA 4MEYF 1F5TA 2CO5A 2EA4A 4Y17A 1YYVA 3F8CA 2CYYA 3ABUA 1J9IA 1BM9A 5LGUA 3P9KA 4UUVA 3E5QA 3MCZA 1U5TB 4NQWA 4M72A 3WTXC 4EM0B 3RPQA 1XN7A 5D5WB 3ABTA 4KIFA 1QZZA 2DI3A 2HR3A 2P5KA 1B9NA 4LD5A 4CXFA 3CLOA 4DQ2A 4H0EA 5J6XA 1HW2A 4YIIA 1XGSA 1KYZA 4A6EA 4EVIA 3FMRA 2EB7A 2YSRA 2LKPA 2PJPA 3U1DA 3I59B 2HQRA 2Z9OA 2PG4A 2H6BA 1R58A 4CGZA 4HX7A 5BPDA 2DFIA 2BV6A 4O5VA 3CO6C 1J0RA 1IAWA 3W6JB 3RIRA 3LFKA 5D6FA 2ZNYA 3KP3A 1S3JA 1P2FA 2UZKA 5CLSA 1UB9A 3TO6A 2O61A 4L5JA 4AIHA 5CVVA 2JPBA 3DEUA 2E7WA 5LEKA 3ZMDA 3LA2A 3ECOA 5F6FA 4KMFA 2IA0A 3HHHA 2XROA 1S29A 1FC3A 5DUIA 3HOTA 2M30A 2PLYA 1FZPB 4HF1A 1TQIA 4BHCA 1U78A 2ZFWA 3GWZA 1GXPA 1J59A 1IN4A 1G3WA 3FMQA 4OIPF 1EH6A 1FYMA 1E17A 3KZZA 3MQ0A 2RNJA 4LK0F 4BHBA 1OYIA 3JAMK 2JPCA 1V4RA 5K5OA 1T0FA 2GXGA 4LG0B 3ZMVA 2FMYA 2CFXA 5ILSA 1QO0D 1LEAA 5DEQA 3GFJA 3P9IA 3E6BA 1LQ1A 3JSPA 3GVAA 2OZ6A 1S7AA 3T8RA 4KA4A 1LNWA 2IJLA 2HOEA 1UHMA 4IHTA 1Y0UA 2EFQA 3FXUA 4EJTA 3HIFA 1P6RA 1ZH5A 4HYEA 3CUQC 1MKMA 1G3TA 1H0MA 1OYWA 1TLHB 4ENNA 1KQ9A 2XRNA 4BNCA 3QP6A 2O6GE 1HW5A 5ILUA 2FOKA 1LJ9A 2W24A 2H94A 1KQ0A 2QWWA 4MQVA 2EV0A 2O8XA 3CUOA 4PCQA 2IP2A 2FNAA 1BN5A 2A5YB 2KIFA 5CYVA 2NYXA 1TNTA 1IN7A 2DT5A 2VE9A 2FNPA 1RUOA 3WTZA 5HLHA 3U9GA 1P4AA 2HKXA 2FRHA 3WTVC 5FO5A 2FMLA 4LMYA 1YQAA 3MAJA 5ERIA 4A2UA 4ZYEA 4M6XA 2M87A 4KIBA 4MHGA 1WQ2A 2ZMEB 2RDPA 1HKQA 2V6CA 4UV9A 3COAC 1VTNC 3IRRA 1W7PA 2VODA 2A6EF 4IRIA 3O6BB 3HTSB 5CVRA 2CW0F 1J2XA 5LGTA 2GA2A 5BOXA 4GGGA 5JR3A 4AIJA 2E1CA 2C6YA 4HBLA 4IVNA 2HZTA 4TV7A 3ROUA 3LWFA 4HQMA 3E5XA 2FSWA 4G9YA 4RGSA 5EEHA 1O7FA 3EQLF 4ENKA 4ENMA 2FXAA 1DUXC 4N9HA 2ZBKA 2XAGA 4MGRA 2P6SA 1KA8A 4BQAA 3C7JA 3GX4X 1SAXA 5L3EA 4I02A 3C18A 1B9MA 1AOYA 2K4JA 4MTEA 2EV6A 5FFZA 2YX7A 4WXCA 2VXZA 3ZQ7A 1JE8A 4OIOF 5JHUA 5DUKA 5DCMA 1T2KA 2D2WA 3R61A 3VB2A 1HKTA 1R36A 3D5LA 3SHFA 2MLKA 1QPMA 3GF2A 4L9NA 3L00A 1LVAA 1ZG5A 1UHWA 4WCGA 1QGPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5LEJ A;  3L09 A;  1HSJ A;  1LDK B;  3BRO A;  1K7A A;  4PZJ A;  3HRM A;  1ONV A;  3F8M A;  1Q1H A;  2NRA C;  3NRV A;  5D6E A;  2DK8 A;  1CF7 A;  4YFN F;  5LRR A;  2L01 A;  1F4K A;  3P9C A;  4FX4 A;  2GAU A;  1DDN A;  4WF2 A;  1G6N A;  2YU3 A;  5E17 F;  2EJR A;  2HYG D;  1XGM A;  4KNY A;  2PEX A;  2W84 A;  4PGH A;  2LSO A;  2Q2E A;  4MEX F;  1OYY A;  4KIC A;  3ERE D;  4A5M A;  3I0T A;  5EEG A;  4EJO A;  4EM2 A;  1F9N A;  2OBP A;  4G6D A;  4M9Z A;  5H20 A;  1FBU A;  1XCV A;  3IHU A;  5E8I A;  1IUY A;  1IXS B;  5HOO A;  4RB0 A;  4ZH4 F;  4ZYH A;  3GXO A;  2D1V A;  2FBH A;  2G7H A;  1W5S A;  2EK5 A;  5FD6 A;  1KGS A;  3BY6 A;  1O7L A;  4HF0 A;  3TO9 A;  3ZMZ A;  4F7Z A;  3WU0 A;  1IRG A;  3CUQ B;  4P9F A;  3JSO A;  2DU9 A;  3I58 A;  4EM1 A;  3G73 A;  4EMS A;  2MA3 A;  1SD4 A;  3ZMS A;  5AIP A;  1IRF A;  3RDI A;  5JVT A;  4FX0 A;  5DCF A;  2NAZ A;  5KVR A;  2OAZ A;  4U7B A;  5D8L B;  4KUM A;  5IT9 K;  1DPU A;  3QU3 A;  1WWX A;  1Z05 A;  3DV8 A;  3KZY A;  4CZZ A;  1U2W A;  2VBZ A;  4ON0 A;  2ADU A;  1GHC A;  3HUG A;  5ICC A;  4CIC A;  2HTS A;  2ZO4 A;  2XIG A;  4Y13 A;  3K0L A;  3DQV C;  3FXQ A;  4U0V A;  1HW1 A;  2ZKZ A;  4ZZD A;  2HTJ A;  3N4M A;  2HQN A;  1IF1 A;  4HX4 A;  2A69 F;  3HRU A;  1MZB A;  2XUB A;  2QBY A;  1Z7U A;  1B4A A;  4O6J A;  3V8J A;  1W5T A;  1IW7 F;  1ZRE A;  2STW A;  2O0Y A;  3F6V A;  4M71 A;  2E7X A;  1TTY A;  2F5C A;  2FA5 A;  4CHU A;  2P5V A;  2IA2 A;  4PDK A;  4HDU A;  3H3U A;  3PQJ A;  3J80 K;  2UXN A;  1BC8 C;  3KP7 A;  2QLZ A;  2AS5 F;  4P55 A;  3FHZ A;  1A04 A;  1YW8 A;  4ESF A;  2KRF A;  1E2X A;  4HX8 A;  2V79 A;  4K2E A;  2PN6 A;  2IA1 A;  4ESJ A;  5DD4 A;  2W57 A;  2JSC A;  2Y0M A;  2IW5 A;  4XLP F;  2FQ3 A;  1WRJ A;  2XAJ A;  4L9V A;  4RGR A;  1MDM B;  2WWY A;  2XAQ A;  2VOP A;  1ZYR F;  2XAS A;  3F8N A;  1TW3 A;  3E6D A;  4I0A A;  5L3G A;  2WC2 A;  2G9W A;  2Q8K A;  1I1S A;  3C1D A;  3WG9 A;  4XLN F;  3MFK A;  3V8K A;  3DPT A;  4XBF A;  3LAP A;  1ODD A;  1ZRD A;  5E1Z B;  4MQ9 F;  4IXA A;  4A5N A;  2L4M A;  3BWG A;  4QLC U;  1HXD A;  3F72 A;  4A0Y A;  5FLX K;  2DQL A;  3K1N A;  2XVC A;  1XDU A;  1K6O A;  3K69 A;  4ETS A;  1MJ9 A;  5DV5 A;  4A0Z A;  1UCR A;  1ZHF A;  3ZN1 A;  3I4P A;  2DLL A;  1KU9 A;  3R0A A;  3Q9V A;  3GFM A;  1TQM A;  5DD8 A;  1REP C;  5L3D A;  3P7N A;  1F1Z A;  2L4A A;  1I5Z A;  3KCC A;  2NNN A;  2OD5 A;  1G4D A;  2QEN A;  1FPQ A;  2VE8 A;  1UFM A;  2XAF A;  2JT1 A;  4HQE A;  4A0X A;  3SZT A;  2GA1 A;  5HVQ C;  1USS A;  2EV5 A;  1IN6 A;  3SZP A;  1PUE E;  1BBY A;  1XSD A;  1O3S A;  2Y75 A;  4HLX A;  3LA3 A;  3I54 A;  3KE2 A;  3TO7 A;  3V7S A;  3U2R A;  3W6K B;  1DP7 P;  3BDD A;  4DNC A;  1HST A;  3ZP5 A;  3IWZ A;  5HDN A;  1IN5 A;  2P7C B;  3E5U A;  1KU7 A;  3LA7 A;  1K78 B;  3GLX A;  2ESN A;  2Z99 A;  1QZY A;  4RB1 A;  3IKT A;  5H6Q A;  5LHG A;  5FB2 A;  3VFZ A;  2HDC A;  1J5Y A;  2JRT A;  4L9J A;  4YIF A;  3WTS C;  4XSZ F;  4L18 B;  3WE3 A;  4RAY A;  4U0Y A;  5HS7 A;  3J81 K;  2O03 A;  3ISP A;  3RJP A;  3L7W A;  1TNS A;  5DDG A;  5IT9 Z;  4GYI A;  1MJA A;  4BH9 A;  1QBJ A;  1FSH A;  4WXH A;  3FF5 A;  3DP7 A;  4G6Q A;  2CWE A;  1JGS A;  2HGC A;  1XD7 A;  4AIK A;  4GXO A;  4KN4 X;  5D4S A;  1BIA A;  1T39 A;  3OOP A;  2IPQ X;  1U8R A;  5CJ9 A;  1PP7 U;  3HSF A;  4OU0 A;  2P7V B;  1YTY A;  4M73 A;  2HS5 A;  2E1N A;  5DYM A;  5CVU A;  2ESH A;  3E3V A;  2TDX A;  1I6X A;  4LB5 A;  1U5T A;  3CDH A;  1R23 A;  4GCV A;  4CDG A;  3MEX A;  1T6S A;  2D1H A;  4HLY A;  4YG2 F;  1BC7 C;  1LEB A;  1I1G A;  3WE2 A;  1ULY A;  3QU6 A;  1ZAO A;  5HS8 A;  1WI9 A;  1R5G A;  2NNY A;  1KYW A;  4L0Z B;  1J7K A;  3I59 A;  3I53 A;  3J80 Z;  5TRD A;  2DBB A;  1XB4 A;  4AWX B;  5LBQ A;  2LDU A;  5FFX A;  3GZ6 A;  1NHA A;  1Z9C A;  3DXJ F;  4ZYG A;  2L02 A;  2ZXJ A;  2FE3 A;  6PAX A;  1FLI A;  2OU2 A;  3KLO A;  3IRQ A;  3VEP A;  2AXL A;  1EH7 A;  3F6O A;  1FNN A;  5H6R A;  3T8T A;  2HEO A;  3BOQ A;  1HKS A;  1IN8 A;  3EDP A;  2JZY A;  4P5O A;  4UVA A;  1STZ A;  5CVJ A;  4RB3 C;  5HLG A;  3RI4 A;  3BPX A;  3DF8 A;  3WOD F;  1YS6 A;  2K4B A;  3V7C A;  2W25 A;  1S8N A;  5K5Q A;  4HA8 A;  3DKW A;  2DPU A;  2KJB A;  1EV7 A;  3RKW A;  1SMY F;  4UVB A;  2QQ9 A;  4KMU X;  1FBQ A;  2GQQ A;  2HKO A;  2BE5 F;  3SFZ A;  5E8G A;  3FM5 A;  2PI0 A;  3DPL C;  4ESB A;  3CTA A;  4A6D A;  3VOD A;  4LG0 A;  4KYW A;  2COM A;  1U3E M;  1LDD A;  2MD5 A;  4R1H A;  4I2O A;  2ISZ A;  1GVJ A;  2J5O A;  3BZ6 A;  3CO7 C;  1D8J A;  3M8E A;  3TKY A;  3WU1 B;  2J5P A;  1D8K A;  2PFB A;  4BAY A;  1O57 A;  1TBX A;  5L3F A;  4KT5 C;  3JAM Z;  4N9I A;  1FY7 A;  3BJA A;  2QYO A;  2L3D A;  2M8E A;  2A07 F;  3SQN A;  3ZMT A;  1O3Q A;  5D5V B;  4OMY A;  3ML6 A;  4EJW A;  2K02 A;  2MC3 A;  4QWQ A;  3WTY C;  2P8T A;  3RKY A;  1ON2 A;  4E70 A;  1XSX A;  1B59 A;  3HRS A;  5D5X B;  5E1X A;  3K1P A;  3E6C C;  3LQR A;  3J81 Z;  3HOS A;  2OQR A;  3GFL A;  1FX7 A;  3K9T A;  2X0L A;  4IPA A;  4AD9 A;  1FT9 A;  3FXR A;  3IKV A;  1XSV A;  3ZMU A;  4G7H F;  3S2W A;  2EA2 A;  4XSX F;  1JHF A;  3TQN A;  2K86 A;  4B8X A;  5K5R A;  1IZ1 A;  2ZME A;  1Z1D A;  4EV0 A;  2LNB A;  3G3Z A;  2DAO A;  4OIR F;  4R79 A;  2F5D A;  2YR2 A;  3M1E A;  4YFX F;  5JI6 A;  4IRG A;  2OQG A;  1RNL A;  2RVC A;  3V4G A;  2KKO A;  5BS6 A;  1J75 A;  1SD5 A;  4NHJ A;  4LGW A;  1V3F A;  2VT2 A;  1KU2 A;  1FYK A;  1FOK A;  1KU3 A;  1R7J A;  3IWF A;  1MJB A;  1MGT A;  3KEQ A;  4AVP A;  2LF8 A;  3F23 A;  2KIU A;  2XKP A;  5BPI A;  3I5U A;  1G3S A;  3ZPL A;  2EWN A;  4BYY A;  4ASN A;  3FMS A;  4UHT A;  4G7O F;  4WWC A;  2LF7 A;  1YLF A;  3WTW C;  1WKM A;  2RQP A;  2ZJ2 A;  4U7D A;  3T0Y A;  5LGN A;  3R0J A;  1ZGA A;  4HF2 A;  4A12 A;  4P9U A;  5ICG A;  4JK1 X;  1P4X A;  3R4K A;  4I0B A;  1BIB A;  5HDG A;  3D0S A;  3RYP A;  4EJU A;  3JTH A;  3VOE A;  2RN7 A;  3E6M A;  4HZF A;  2QZ8 A;  4S04 A;  3LQQ A;  1BOA A;  3GZ5 A;  2HFH A;  5LRS A;  1XCB A;  1OPC A;  5A2Q K;  3GO5 A;  3B02 A;  3BJ6 A;  3EYI A;  2EFO A;  1RUN A;  2GWR A;  2K27 A;  3HRT A;  4I09 A;  1SD7 A;  4HV5 A;  2CG4 A;  1FP1 D;  1W7P B;  4HAM A;  2Y48 A;  2STT A;  4OMZ A;  3KP4 A;  2P4W A;  2M5W A;  2ISY A;  1O3R A;  2XHK A;  3K1M A;  1Z91 A;  1OMI A;  4M74 A;  1P92 A;  4UXN A;  3M9A A;  4L9T A;  4EQQ A;  3GFI A;  1Z6R A;  1XGO A;  2KIM A;  2PMU A;  5HLI A;  2QVO A;  1O3T A;  2G7U A;  3KP5 A;  4RGU A;  2V1X A;  1TQP A;  2RKH A;  2V1D A;  4HV6 A;  5HS9 A;  3DFG A;  2Z5U A;  1W7P D;  3Q9S A;  1RIO H;  2DQR A;  2FF4 A;  4FHT A;  4EJV A;  2EFN A;  4G7Z F;  3TOA A;  2CSO A;  2Q0O A;  5IT3 A;  3CUQ A;  3KP2 A;  3L2C A;  1R00 A;  5E18 F;  3MZY A;  2K7L A;  1PP8 F;  5DCM B;  3F8F A;  4RAZ A;  5F1R A;  3F22 A;  3QOP A;  4I7H A;  1CGP A;  3KEO A;  4I98 B;  1KQ8 A;  4LFU A;  3BP8 A;  3OV8 A;  2DPD A;  3H92 A;  5ICF A;  2H27 A;  2BYV E;  2VOO A;  2VBX A;  1YO5 C;  4CYD A;  4BXU A;  4D0P A;  4RGX A;  4EGY A;  2OZU A;  4ZZL A;  3M7G A;  2UWM A;  4KN7 X;  4LK1 F;  1T38 A;  3EYY A;  1CF7 B;  2QQB A;  1RZ4 A;  1HBX G;  1XMA A;  1QQI A;  5F64 A;  1DPR A;  2VON A;  2QM3 A;  4ZYD A;  3R60 A;  2R7D A;  2ETH A;  3GW2 A;  3O3K A;  3JW4 A;  5D4R A;  4IHS A;  2PMH A;  4MTD A;  2Z33 A;  4WXD A;  2A3S A;  3R6S A;  3EUH A;  4LB6 B;  2UXX A;  2NS0 A;  1P4W A;  5LHI A;  2BGC A;  3WGG A;  4KDP A;  4OIQ F;  3HSR A;  1FP2 A;  1H9T A;  3REO A;  3Q5F A;  1YFH A;  2H09 A;  3CJN A;  1K79 A;  2VBW A;  3WGI A;  2D45 A;  1BI2 A;  2GIV A;  1ZG3 A;  2XKO A;  1IXR C;  2RC4 A;  2ZNZ A;  1XDS A;  4WX9 A;  1YIO A;  1FSE A;  2FBI A;  4RB2 C;  1RI7 A;  2VC1 A;  3FX3 A;  3QPT A;  1MDM A;  1BI3 A;  2OA4 A;  2VT3 A;  4LJZ F;  1LB2 A;  4U0W A;  1S7O A;  3FM3 A;  3WGH A;  5FD5 A;  4XRF A;  3GUD A;  4L5I A;  1EH8 A;  3HYI A;  4LLL A;  4FT8 A;  2F5E A;  1B1B A;  3HSE A;  4NB5 A;  4GO1 A;  3TOB A;  2VBY A;  1R1U A;  1Z6T A;  3RPU A;  2YPR A;  2PQ8 A;  3TDU C;  5D8K B;  1R1T A;  2GZW A;  4Q47 A;  4CO8 A;  5A2Q Z;  1XGN A;  3B73 A;  4G94 A;  3EET A;  2ELH A;  1WSU A;  3BJO A;  3F21 A;  1U5T C;  3O2P E;  4G8X A;  2BBY A;  1ZN2 A;  1HQC A;  1UST A;  2R3S A;  3J7A O;  5JFR A;  4N0B A;  1OKR A;  1G3Y A;  1ZLK A;  2P6T A;  3N97 A;  2ZCW A;  3I71 A;  2XGX A;  2QBY B;  2IVM A;  1B6A A;  1LDJ A;  5FLX Z;  3V7R A;  5LHH A;  4UV8 A;  2EFP A;  4LLN A;  5ED4 A;  3IC7 A;  2MH2 A;  4HOB A;  1D5V A;  2L54 A;  3E97 A;  3PFI A;  3T1B A;  5BQT A;  3QRF F;  2IT0 A;  1ON1 A;  1ZG1 A;  4BHP A;  4MNU A;  1FWZ A;  2JTV A;  1R22 A;  4Q48 A;  4KFC A;  2QUF A;  1SMT A;  5TJJ A;  4RS8 A;  3K2Z A;  3H3Z A;  4JQF A;  2H6C A;  4B09 A;  1GXQ A;  2M1B A;  3MWM A;  2O3F A;  2VC0 A;  2RV8 A;  1T98 A;  1BJA A;  4LLG F;  3IL2 A;  3ELK A;  1QNT A;  2W85 A;  4I01 A;  2EFW A;  1K78 A;  1BI0 A;  3KFW X;  2VN2 A;  4Z2Y A;  2QQA A;  3ULQ B;  5L3B A;  2V9V A;  4M6Y A;  1ZRC A;  4R8H A;  4Y15 A;  1I27 A;  1ZLJ A;  5ICE A;  3T5X A;  3JTG A;  4YFK F;  5CVI A;  5D5U B;  3V8L A;  4EGZ A;  3TDZ C;  5BMZ A;  1C0W A;  3WTU C;  1FYL A;  3F8B A;  4IRH A;  2IRF G;  1ZAR A;  2F2E A;  2WV0 A;  1YW9 A;  3HHG A;  5J8C A;  3LAJ A;  3KET A;  1YS7 A;  4WK8 F;  2Z3Y A;  3FWE A;  2M45 A;  3QAH A;  5K1Y A;  1AWC A;  1H9G A;  4U88 A;  4S05 A;  2A61 A;  2A6H F;  4O3M A;  5AON A;  1ZGJ A;  3GEZ A;  1X3U A;  2MH9 A;  1ZRF A;  3PQK A;  4ENJ A;  5ILV A;  4HW0 A;  3RTR A;  1IXC A;  1YG2 A;  5LLQ A;  2RGV A;  3ECH A;  2XAH A;  2P5L C;  2ACJ A;  3NQO A;  1S6L A;  2V1U A;  2FEZ A;  3QPH A;  1U6G A;  2CQK A;  3M8F A;  4P96 A;  2DW4 A;  2F5F A;  4M9S A;  2GXB A;  3ZN0 A;  3AAF A;  2DK5 A;  2DTR A;  4UVC A;  3KLN A;  1JXS A;  3FZV A;  3F3X A;  2B0L A;  1L0O C;  4L0Y B;  2MBF A;  1TW2 A;  3RKX A;  1W4M A;  1YW7 A;  2BEO A;  1JHH A;  1PDN C;  1BI1 A;  2A68 F;  2PBI A;  2WTE A;  5HDK A;  3NEU A;  2X4H A;  3GYH X;  2HYF A;  1FBS A;  4IJA A;  4JBA A;  4GYG A;  4Q4Z F;  2XV4 S;  5E1W A;  3C3W A;  1L3L A;  5AIQ A;  2CGP A;  4HDV A;  3L9F A;  2DO7 A;  3TGN A;  1SFX A;  1OR7 A;  2KJC A;  3WTT C;  1SFU A;  5FGM A;  3HTU A;  2MLG A;  4M9X A;  3I64 A;  4Q5S F;  1SD6 A;  3BPV A;  1R1V A;  4OIN F;  5E20 A;  3MZH A;  5KK1 A;  4PGG A;  2FU4 A;  4KIG A;  1SFE A;  2YX4 A;  2R7F A;  3RYR A;  4IF4 A;  3QP5 A;  3KP6 A;  1D3Y A;  3SXY A;  2FBK A;  3LST A;  5L3C A;  5J8F A;  4UNO A;  1R5H A;  1XMK A;  2HWV A;  1MD0 A;  4OOI A;  4MEY F;  1F5T A;  2CO5 A;  2EA4 A;  4Y17 A;  1YYV A;  3F8C A;  2CYY A;  3ABU A;  1J9I A;  1BM9 A;  5LGU A;  3P9K A;  4UUV A;  3E5Q A;  3MCZ A;  1U5T B;  4NQW A;  4M72 A;  3WTX C;  4EM0 B;  3RPQ A;  1XN7 A;  5D5W B;  3ABT A;  4KIF A;  1QZZ A;  2DI3 A;  2HR3 A;  2P5K A;  1B9N A;  4LD5 A;  4CXF A;  3CLO A;  4DQ2 A;  4H0E A;  5J6X A;  1HW2 A;  4YII A;  1XGS A;  1KYZ A;  4A6E A;  4EVI A;  3FMR A;  2EB7 A;  2YSR A;  2LKP A;  2PJP A;  3U1D A;  3I59 B;  2HQR A;  2Z9O A;  2PG4 A;  2H6B A;  1R58 A;  4CGZ A;  4HX7 A;  5BPD A;  2DFI A;  2BV6 A;  4O5V A;  3CO6 C;  1J0R A;  1IAW A;  3W6J B;  3RIR A;  3LFK A;  5D6F A;  2ZNY A;  3KP3 A;  1S3J A;  1P2F A;  2UZK A;  5CLS A;  1UB9 A;  3TO6 A;  2O61 A;  4L5J A;  4AIH A;  5CVV A;  2JPB A;  3DEU A;  2E7W A;  5LEK A;  3ZMD A;  3LA2 A;  3ECO A;  5F6F A;  4KMF A;  2IA0 A;  3HHH A;  2XRO A;  1S29 A;  1FC3 A;  5DUI A;  3HOT A;  2M30 A;  2PLY A;  1FZP B;  4HF1 A;  1TQI A;  4BHC A;  1U78 A;  2ZFW A;  3GWZ A;  1GXP A;  1J59 A;  1IN4 A;  1G3W A;  3FMQ A;  4OIP F;  1EH6 A;  1FYM A;  1E17 A;  3KZZ A;  3MQ0 A;  2RNJ A;  4LK0 F;  4BHB A;  1OYI A;  3JAM K;  2JPC A;  1V4R A;  5K5O A;  1T0F A;  2GXG A;  4LG0 B;  3ZMV A;  2FMY A;  2CFX A;  5ILS A;  1QO0 D;  1LEA A;  5DEQ A;  3GFJ A;  3P9I A;  3E6B A;  1LQ1 A;  3JSP A;  3GVA A;  2OZ6 A;  1S7A A;  3T8R A;  4KA4 A;  1LNW A;  2IJL A;  2HOE A;  1UHM A;  4IHT A;  1Y0U A;  2EFQ A;  3FXU A;  4EJT A;  3HIF A;  1P6R A;  1ZH5 A;  4HYE A;  3CUQ C;  1MKM A;  1G3T A;  1H0M A;  1OYW A;  1TLH B;  4ENN A;  1KQ9 A;  2XRN A;  4BNC A;  3QP6 A;  2O6G E;  1HW5 A;  5ILU A;  2FOK A;  1LJ9 A;  2W24 A;  2H94 A;  1KQ0 A;  2QWW A;  4MQV A;  2EV0 A;  2O8X A;  3CUO A;  4PCQ A;  2IP2 A;  2FNA A;  1BN5 A;  2A5Y B;  2KIF A;  5CYV A;  2NYX A;  1TNT A;  1IN7 A;  2DT5 A;  2VE9 A;  2FNP A;  1RUO A;  3WTZ A;  5HLH A;  3U9G A;  1P4A A;  2HKX A;  2FRH A;  3WTV C;  5FO5 A;  2FML A;  4LMY A;  1YQA A;  3MAJ A;  5ERI A;  4A2U A;  4ZYE A;  4M6X A;  2M87 A;  4KIB A;  4MHG A;  1WQ2 A;  2ZME B;  2RDP A;  1HKQ A;  2V6C A;  4UV9 A;  3COA C;  1VTN C;  3IRR A;  1W7P A;  2VOD A;  2A6E F;  4IRI A;  3O6B B;  3HTS B;  5CVR A;  2CW0 F;  1J2X A;  5LGT A;  2GA2 A;  5BOX A;  4GGG A;  5JR3 A;  4AIJ A;  2E1C A;  2C6Y A;  4HBL A;  4IVN A;  2HZT A;  4TV7 A;  3ROU A;  3LWF A;  4HQM A;  3E5X A;  2FSW A;  4G9Y A;  4RGS A;  5EEH A;  1O7F A;  3EQL F;  4ENK A;  4ENM A;  2FXA A;  1DUX C;  4N9H A;  2ZBK A;  2XAG A;  4MGR A;  2P6S A;  1KA8 A;  4BQA A;  3C7J A;  3GX4 X;  1SAX A;  5L3E A;  4I02 A;  3C18 A;  1B9M A;  1AOY A;  2K4J A;  4MTE A;  2EV6 A;  5FFZ A;  2YX7 A;  4WXC A;  2VXZ A;  3ZQ7 A;  1JE8 A;  4OIO F;  5JHU A;  5DUK A;  5DCM A;  1T2K A;  2D2W A;  3R61 A;  3VB2 A;  1HKT A;  1R36 A;  3D5L A;  3SHF A;  2MLK A;  1QPM A;  3GF2 A;  4L9N A;  3L00 A;  1LVA A;  1ZG5 A;  1UHW A;  4WCG A;  1QGP A; 
#chains in the Genus database with same CATH topology
 3M8J A;  5LEJ A;  3QYB A;  3DTK A;  1HSJ A;  3L09 A;  2DA3 A;  4Y4R A;  1FIA A;  4E7L A;  1S9H A;  1LDK B;  3BRO A;  3E0J B;  1K7A A;  2W7N A;  4PZJ A;  1MND A;  3HRM A;  5K7F A;  1ONV A;  4MO7 A;  3F8M A;  1Q1H A;  2NRA C;  3NRV A;  3QOE A;  2R7U A;  1TWC J;  5D6E A;  2DK8 A;  3CJR B;  1CF7 A;  4YFN F;  5E3O A;  5LRR A;  3JRD A;  2HPI A;  2L01 A;  1F4K A;  4G6T B;  2EH3 A;  5J4Y A;  2IGO A;  3P9C A;  3MKY B;  4FX4 A;  2GAU A;  2EIJ H;  1DDN A;  2VKV A;  4WF2 A;  1NTC A;  1QZE A;  4IOC F;  1G6N A;  2BY2 A;  2YU3 A;  4HST A;  5JVG F;  5E17 F;  1G2H A;  2JA8 J;  2EJR A;  2HYG D;  1XGM A;  2DOA A;  2JVG A;  4KNY A;  2PEX A;  2W84 A;  4PGH A;  4LIV A;  2LSO A;  2DOD A;  4ZTJ A;  2JUG A;  2Q2E A;  4MEX F;  1O4X A;  1OYY A;  4KIC A;  3ERE D;  1VQ6 I;  1SFK A;  2V4J C;  5E3L A;  4A5M A;  2JA2 A;  3I0T A;  5EEG A;  4EJO A;  4EM2 A;  1F9N A;  2OBP A;  4G6D A;  4M9Z A;  1VQM I;  3OR1 C;  2R5Y A;  3OS2 A;  5H20 A;  1FBU A;  1F36 A;  1XCV A;  4D7N A;  3IHU A;  3AL0 C;  5E8I A;  4HG2 A;  4M3B A;  3BR0 A;  1IUY A;  2X9D A;  1IXS B;  5HOO A;  4MFD A;  2LLK A;  4RB0 A;  4ZH4 F;  3PUB A;  2MSY A;  3GXO A;  4ZYH A;  2D1V A;  1W5C C;  2FBH A;  3H5A A;  1PYV A;  1FMW A;  2G7H A;  1W5S A;  2EK5 A;  1S7E A;  5FD6 A;  3L2U A;  1KGS A;  3BY6 A;  1O7L A;  5E3N A;  1D1C A;  4HF0 A;  3TO9 A;  3ZMZ A;  4F7Z A;  2M0C A;  2XB0 X;  3LFU A;  3WU0 A;  1ITY A;  1IRG A;  2VB6 A;  4AM3 A;  3ZQI A;  2P81 A;  1Z7L A;  5TIS C;  3CUQ B;  2X48 A;  4P9F A;  2YS9 A;  4BBR J;  3JSO A;  2DU9 A;  2DXI A;  3I58 A;  4EM1 A;  3G73 A;  4EMS A;  3CCJ I;  2MA3 A;  2DMU A;  3PL8 A;  1SD4 A;  1IO2 A;  2ZJP F;  2PMZ N;  3ZMS A;  5AIP A;  2H1K A;  2XGD A;  1IRF A;  2MD0 A;  3A4C A;  1X4P A;  1RC9 A;  3MZ8 A;  3RDI A;  5JVT A;  4FX0 A;  2L7K A;  3M3Y J;  3QWL A;  5DCF A;  2NAZ A;  3FKJ A;  3FXL A;  5KVR A;  2VIX A;  2OAZ A;  2XB5 A;  4U7B A;  2R4G A;  1W36 C;  5D8L B;  4KUM A;  5IT9 K;  5F08 A;  2L5Q A;  4CCK A;  2R92 J;  1DPU A;  3H5N A;  2B63 J;  2JRM A;  2R7S A;  3QU3 A;  1WWX A;  1Z05 A;  1Z21 A;  3DV8 A;  3KZY A;  4CZZ A;  1U2W A;  3GTL J;  3HOW J;  2VBZ A;  4ON0 A;  2UUZ A;  2ADU A;  1ETY A;  2WV1 A;  1GHC A;  2VPR A;  2DTZ A;  3HUG A;  4E7Z A;  5ICC A;  1YHQ I;  2N8G A;  3HJE A;  4CIC A;  2HTS A;  2ZO4 A;  2XIG A;  2WBM A;  4Y13 A;  2GM4 A;  1VQ7 I;  4V2F A;  3BG3 A;  3K0L A;  4A3G J;  4CCJ A;  3O8H A;  3DQV C;  3FXQ A;  4U0V A;  1HW1 A;  5B1B H;  2ZKZ A;  4ZZD A;  4RA2 A;  2HTJ A;  5KAI C;  3N4M A;  2HQN A;  1IF1 A;  1IJW C;  1TL8 A;  2MAB A;  4HX4 A;  2A69 F;  3HRU A;  2K9Q A;  1R9T J;  1OQY A;  4RMN A;  1MZB A;  2XUB A;  3DWL E;  1Z7U A;  3OIO A;  2QBY A;  1B4A A;  2F6C A;  1ZEL A;  4O6J A;  3V8J A;  2M9H A;  5J4V A;  3PUF A;  1W5T A;  4E6K G;  2VJJ A;  1IW7 F;  1ZRE A;  1MBH A;  1TWG J;  2STW A;  2ID6 A;  2AQF A;  2O0Y A;  4A3B J;  4KIS A;  3F6V A;  3TMO A;  2LY2 A;  1A6I A;  2RAE A;  3OYL A;  4M71 A;  2E7X A;  3FIW A;  1TTY A;  2W00 A;  2F5C A;  2FA5 A;  3OIP A;  4E4H A;  4CHU A;  1BA5 A;  3CP2 A;  2P5V A;  4F3Q A;  2IA2 A;  1WVR A;  4PDK A;  4HDU A;  1IRZ A;  3H3U A;  3I56 I;  3PQJ A;  5FKN A;  2IGK A;  2IBD A;  2CUF A;  3J80 K;  3S93 A;  2UXN A;  1BC8 C;  3KP7 A;  2QLZ A;  2AS5 F;  4P55 A;  3FHZ A;  1A04 A;  1YW8 A;  2LY1 A;  2KRF A;  2RQQ A;  4ESF A;  1E2X A;  2ID3 A;  3ABL H;  2V79 A;  3DTE A;  4HX8 A;  1OFC X;  1EJ9 A;  1LFB A;  4K2E A;  2PN6 A;  1ZGW A;  5M5Y J;  2IA1 A;  4ESJ A;  2KRC A;  5DD4 A;  3K6G A;  2DA7 A;  1U0J A;  1OR7 C;  5EEA A;  2W57 A;  2JSC A;  2Y0M A;  2IW5 A;  4XLP F;  2FQ3 A;  3CJT B;  1WRJ A;  1ETK A;  2XAJ A;  2Y30 A;  4L9V A;  4KIT B;  4RGR A;  1MDM B;  4IEJ A;  5B1A H;  2WWY A;  1RKT A;  2XAQ A;  2VOP A;  1ZYR F;  1JTX A;  2XAS A;  1B72 B;  3F8N A;  1TW3 A;  3E6D A;  2IGM A;  4C2U A;  3VSL A;  4I0A A;  5L3G A;  3EUK L;  5EJC A;  3RQ4 A;  3DBR B;  2LKX A;  2WC2 A;  2G9W A;  2Q8K A;  2QSG X;  3L2V A;  1I1S A;  3C1D A;  3HPG A;  2R7O A;  3WG9 A;  2R7Q A;  4XLN F;  3MFK A;  3OYC A;  2DN0 A;  3V8K A;  3ASN H;  3DPT A;  4XBF A;  3LAP A;  4BJ6 C;  1ODD A;  4XLC A;  1ZRD A;  5E1Z B;  4MQ9 F;  4IXA A;  3CCS I;  4UY8 I;  4A5N A;  2L4M A;  3BWG A;  4QLC U;  1HXD A;  1XC5 A;  3WHB A;  5JHF A;  3FHN A;  3F72 A;  3KIO A;  4A0Y A;  3RZO J;  1FJL A;  2DQL A;  4BJT A;  3K1N A;  5FLX K;  2XSD C;  2XVC A;  2DMP A;  1XDU A;  1K6O A;  4RM2 A;  3DEE A;  4NC7 A;  3CF5 F;  3GTM J;  1D1B A;  2B9S A;  2HDW A;  2HXO A;  3FXM A;  3K69 A;  1IC8 A;  4ETS A;  1MJ9 A;  1OCO H;  5DV5 A;  3HOX J;  3TBI A;  2KT0 A;  4A0Z A;  3BZC A;  4C9Y A;  1UCR A;  1ZHF A;  3ZN1 A;  2G0E A;  3I4P A;  3IUO A;  1I39 A;  5CQG A;  2DLL A;  2LKS A;  1KU9 A;  4JX6 A;  5C4J J;  4J19 A;  3A01 B;  4F93 B;  1UHS A;  1RES A;  1LUJ B;  5EZH A;  3R0A A;  2ZXI A;  3Q9V A;  3GFM A;  4B47 A;  2M0M A;  3S3O A;  3OYF A;  1ETX A;  2PMZ A;  3VWB A;  3BQY A;  1TQM A;  4XLE A;  3GZN B;  5DD8 A;  1REP C;  5L3D A;  1T56 A;  4AYB N;  3P7N A;  2LC2 A;  3KX2 A;  1RR8 C;  1F1Z A;  4BDY A;  2L4A A;  1HDP A;  1I5Z A;  4OAZ A;  3KCC A;  2ZFU A;  2NNN A;  1V55 H;  4RBO A;  2OD5 A;  3I4M J;  1G4D A;  2QEN A;  3BTI A;  3KEY A;  1FPQ A;  2JK3 A;  2M4K A;  2VE8 A;  1UFM A;  3ABK H;  3AG3 H;  3OYB A;  2V9P A;  2XAF A;  1WFX A;  2JT1 A;  3CP8 A;  4HQE A;  3J7A Y;  1XS9 A;  5FRN A;  1TWH J;  4A0X A;  4DZJ A;  4J00 A;  3CZ6 A;  2GA1 A;  2LR8 A;  3SZT A;  5HVQ C;  1USS A;  2EV5 A;  1HF0 A;  1MSE C;  3K4C A;  2HVS A;  1IN6 A;  3SZP A;  5TGT A;  5B5E C;  1PUE E;  1Z3Y A;  1BBY A;  2HVR A;  1XSD A;  3G71 I;  1O3S A;  2OC6 A;  5M5X J;  2Y75 A;  4HLX A;  3LA3 A;  2AXT C;  2Y0S N;  3I54 A;  3HL2 A;  3KE2 A;  3TO7 A;  3V7S A;  3ZQF A;  3K4N A;  3U2R A;  3W6K B;  1DP7 P;  3BDD A;  1XTA A;  4DNC A;  4OAY A;  1I6H J;  2A6T A;  4FET A;  1HST A;  5F04 A;  3ZP5 A;  3AL0 B;  3IWZ A;  5HDN A;  1IN5 A;  3ZQG A;  2P7C B;  2LVS A;  3E5U A;  2M7A A;  1KU7 A;  1YJN I;  2DYS H;  4I6Z A;  3LA7 A;  1K78 B;  2F4M B;  3GLX A;  2ESN A;  2Z99 A;  4B48 A;  2L9N A;  1QZY A;  3LSH A;  1B8I A;  4RB1 A;  2VJ4 A;  3OYJ A;  5H6Q A;  3IKT A;  1Y8Q B;  1T08 B;  5LHG A;  2CFO A;  1JJ8 C;  2DOE A;  5FB2 A;  3VFZ A;  2HDC A;  1J5Y A;  2O9L A;  2OCC H;  2JRT A;  1TWF J;  2VQL A;  3SEZ A;  3GTO J;  1EKE A;  4L9J A;  4FIS A;  5GPC A;  1X2N A;  4YIF A;  5DM6 F;  4XSZ F;  3WTS C;  1IV6 A;  4L18 B;  3MKW B;  3WE3 A;  4RAY A;  4U0Y A;  2L7F P;  5HS7 A;  2VAS A;  3J81 K;  2O03 A;  3ISP A;  5F0C A;  3RJP A;  1N25 A;  1DP3 A;  2OV7 A;  3CES A;  3L7W A;  4XMY A;  3BT9 A;  1TNS A;  5DDG A;  5IT9 Z;  1XMX A;  4GYI A;  1MJA A;  4BH9 A;  3G1M A;  1QBJ A;  1FSH A;  2CQN A;  2EZH A;  3P5J A;  3FF5 A;  4WXH A;  3DP7 A;  4G6Q A;  4ZDL A;  3S1R J;  2CWE A;  3H1C A;  4CZC A;  1JGS A;  2HGC A;  2IS6 A;  2K9S A;  1XD7 A;  4AIK A;  2X6W A;  2DDA A;  1WH5 A;  4GXO A;  5J1Y A;  1VQ4 I;  4ZDP A;  4KN4 X;  5D4S A;  1BIA A;  1TZL A;  1T39 A;  3OOP A;  4A69 C;  2IPQ X;  1U8R A;  5CJ9 A;  1PP7 U;  4IHW A;  3HSF A;  4OU0 A;  1T0F C;  2BVM A;  2P7V B;  3VYT B;  1YTY A;  4M73 A;  2HS5 A;  4RDU A;  4BE0 A;  5C3E J;  2E1N A;  5DYM A;  5CVU A;  2ESH A;  1Q1V A;  3C2G A;  1IUF A;  3E3V A;  5IYD J;  2TDX A;  1I6X A;  4DIQ A;  1WZ2 A;  2L7Z A;  4LB5 A;  3IH2 A;  1U5T A;  4E7H A;  4RAF A;  3D5S C;  3CDH A;  3Q0U A;  3QYE A;  3RSN A;  1R23 A;  4GCV A;  2DYR H;  4CDG A;  3LNQ A;  2Y9Z A;  5CPR B;  4ZTF A;  2XGE A;  3MEX A;  2KL4 A;  2CH0 A;  4XRS G;  1T6S A;  2D1H A;  2MC4 A;  1D0Z A;  4HLY A;  3SJM A;  3TW7 A;  4YG2 F;  1BC7 C;  1YOV B;  1LEB A;  1D1A A;  1I1G A;  3WE2 A;  2IXS A;  2XPW A;  4ZJZ A;  1ULY A;  2LTP A;  3QU6 A;  3OYE A;  3OSG A;  3CCE I;  1OCP A;  1ZAO A;  5HS8 A;  1GT0 C;  1WI9 A;  2LD5 A;  1MIJ A;  1R5G A;  3G1O A;  2NNY A;  3CMM A;  1KYW A;  1I3Q J;  4L0Z B;  1J7K A;  3CDL A;  4PJJ A;  1W36 D;  1K4S A;  3OYA A;  5HNH A;  1PJR A;  3UKG A;  3I59 A;  1LE8 A;  1R6R A;  5GAG J;  3FXJ A;  3I53 A;  3J80 Z;  1BOB A;  2R7W A;  2FD5 A;  2DBB A;  1XB4 A;  5TRD A;  1PUF A;  2ZSH B;  4AWX B;  3CCU I;  2QQ8 A;  3SDG A;  5LBQ A;  2LDU A;  2VJ5 A;  3CCM I;  4EEF G;  5FFX A;  4X0G A;  3GZ6 A;  2GIZ A;  1NHA A;  1Z9C A;  5IOZ A;  4F92 B;  3MKL A;  3DXJ F;  4ZYG A;  3CMY A;  3A2K A;  2L02 A;  2ZXJ A;  1H8A C;  3H0G J;  2FE3 A;  2DT7 B;  2KDZ A;  6PAX A;  1FLI A;  4KT6 A;  2OU2 A;  3KLO A;  3IRQ A;  2HOT A;  3KYC B;  3VEP A;  2AXL A;  2KLO A;  2X6X A;  1EH7 A;  3EUA A;  3F6O A;  3VDX A;  3HKZ N;  1FNN A;  5H6R A;  3I3L A;  3T8T A;  2HEO A;  3BOQ A;  2BY1 A;  1HOM A;  4HRI A;  4CYC B;  1HKS A;  1IN8 A;  3EDP A;  2B7E A;  3IV5 A;  4FCY A;  2JZY A;  4C3I J;  4P5O A;  1IRX A;  3MMY B;  2QCO A;  4UVA A;  3OYN A;  1STZ A;  5CVJ A;  3FBI B;  2DDB A;  4RB3 C;  2KIS A;  5HLG A;  3RI4 A;  1ORK A;  3BPX A;  2CV2 A;  2Y0S A;  2BXZ A;  1VQ8 I;  3AG2 H;  2A05 A;  3DF8 A;  1MMD A;  2V1N A;  1OIS A;  3RCO A;  3WOD F;  1YS6 A;  1ETQ A;  2K4B A;  3V7C A;  4E7J A;  2XC7 A;  1Y56 A;  2R7Z J;  2W25 A;  1S8N A;  5K5Q A;  4HA8 A;  3DKW A;  2DPU A;  2HDD A;  2TRT A;  3LSI A;  3GTP J;  1K83 J;  2KJB A;  1EV7 A;  1LFU P;  3RKW A;  1SMY F;  1ERD A;  2CRG A;  4UVB A;  2QQ9 A;  2LBF B;  4KMU X;  1WJC A;  2JN6 A;  1FBQ A;  2GQQ A;  2HKO A;  4NQW B;  2BE5 F;  2R7R A;  3SFZ A;  1NG6 A;  4IKF A;  5E8G A;  3K4L A;  4IOA F;  3FM5 A;  2PI0 A;  3DPL C;  4ESB A;  1MMN A;  3HXL A;  3CTA A;  4BDZ A;  3FKI J;  4A6D A;  3VOD A;  5EZG A;  3CCL I;  2PJR B;  2KDO A;  4LG0 A;  2E71 A;  5EG0 B;  4KYW A;  2COM A;  5E79 C;  2V9K A;  1U3E M;  2WAQ A;  1R4N B;  4HEA 2;  1LDD A;  2MD5 A;  3DLL F;  3GTJ J;  4B4C A;  4R1H A;  4I2O A;  2ISZ A;  1GVJ A;  2J5O A;  3BZ6 A;  4YRV A;  3CO7 C;  1D8J A;  3S14 J;  3S1M J;  3M8E A;  3TKY A;  4PSX A;  1YX3 A;  4P1W A;  4A3J J;  2HVQ A;  3WU1 B;  1Y1V J;  1N75 A;  2J5P A;  3ZCO A;  2VQC A;  3QPL A;  3OS0 A;  1NH3 A;  5B66 C;  1D8K A;  2PFB A;  4II3 A;  4DZP A;  3EPZ A;  1JT6 A;  1X1B A;  1AU7 A;  4BAY A;  1O57 A;  4IZZ A;  2CW8 A;  1TBX A;  1X2M A;  5L3F A;  5J1U A;  4KT5 C;  2R7V A;  3JAM Z;  5EGO B;  4N9I A;  1FY7 A;  3JRC A;  1WJF A;  3B6C A;  2IGN A;  2CQ7 A;  3BJA A;  2QYO A;  1U8B A;  2L3D A;  3A0B C;  3H0D A;  5EDN A;  2M8E A;  3FK6 A;  3PFY A;  2A07 F;  3GTK J;  3SQN A;  2OUM A;  3ZMT A;  2EZL A;  1O3Q A;  3J7Z I;  3VPR A;  3D1N I;  2KZV A;  2IS4 A;  3I4N J;  5D5V B;  4OMY A;  2M4G A;  3ML6 A;  4EJW A;  3OYI A;  1JTY A;  4FAS D;  3SZG A;  2K02 A;  2MC3 A;  1WHU A;  2TCT A;  3I9V 2;  4QWQ A;  4IO9 F;  2E1M C;  2XF5 A;  3HOY J;  4M3G A;  1T8I A;  1R4M B;  5KAF C;  3WTY C;  5KHD A;  2P8T A;  3RKY A;  2CUZ A;  1JUS A;  2HPM A;  1ON2 A;  2IS2 A;  4E70 A;  1XSX A;  1B59 A;  3HRS A;  5D5X B;  5E1X A;  3BTL A;  3K1P A;  3E6C C;  3LQR A;  3AFH A;  4RM3 A;  3J81 Z;  1MBE A;  2OQR A;  3HOS A;  5F0F A;  2CMP A;  2NVX J;  2R5Z A;  1D5Y A;  2Q1Z B;  3GFL A;  1FX7 A;  3GBG A;  3K9T A;  2X0L A;  4XK4 A;  4JX5 A;  4CCL A;  5GTI C;  4IPA A;  1RRJ A;  4AD9 A;  1W0T A;  1FT9 A;  2LK2 A;  3FXR A;  3IKV A;  4QPQ A;  1XSV A;  3ZMU A;  4G7H F;  2MFZ A;  4A3L J;  3S2W A;  3HDD A;  2EA2 A;  4XSX F;  3FBN B;  5GPA A;  4B43 A;  1JHF A;  1ZTR A;  3TQN A;  2EPF A;  3TW6 A;  2K86 A;  4B8X A;  5K5R A;  1WPK A;  1FOX A;  2FOW A;  1IZ1 A;  2ZME A;  1Z1D A;  1OJL A;  4BEH B;  4EV0 A;  2LNB A;  2MG4 A;  3G3Z A;  2DAO A;  4OIR F;  2EQR A;  2F5D A;  4R79 A;  2YR2 A;  3DCF A;  2WY7 Q;  3DBL B;  3M1E A;  4YFX F;  4DJA A;  5JI6 A;  4IRG A;  2LH9 A;  2OQG A;  3QYF A;  1RNL A;  2RVC A;  1AKH B;  4BKX A;  2VLA A;  2K9N A;  5GP9 A;  2V6E A;  3V4G A;  2KKO A;  5BS6 A;  2JA7 J;  1Z3X A;  3VYS B;  4EAT A;  1J75 A;  4BS9 A;  1QA6 A;  1SD5 A;  4NHJ A;  3IH3 A;  2JMW A;  4LGW A;  2H8W A;  1V3F A;  2VKH A;  2VT2 A;  1KU2 A;  3CCV I;  1FYK A;  2WB1 N;  1FOK A;  1KU3 A;  2ZJR F;  1R7J A;  2LYC A;  3IWF A;  1MJB A;  3U1K A;  1V5E A;  1MW7 A;  1MGT A;  4X6A J;  1WJB A;  1KZH A;  3KEQ A;  3CC7 I;  4AVP A;  2LF8 A;  4UUT A;  4X1E A;  3F23 A;  4GRI A;  4BE2 A;  2KIU A;  1D0X A;  2XKP A;  5BPI A;  3I5U A;  2O8K A;  1G3S A;  4DYQ A;  3ZPL A;  1IDY A;  4JOM A;  2E35 A;  2EWN A;  3M1C A;  2LMD A;  4BYY A;  4ASN A;  3FMS A;  4UHT A;  4G7O F;  3WHC A;  4WWC A;  2LF7 A;  1YLF A;  2XRL A;  4I76 A;  3WTW C;  1WKM A;  1MBJ A;  2RQP A;  2ZJ2 A;  4U7D A;  3T0Y A;  3S1N J;  5LGN A;  2OF7 A;  3R0J A;  1VQ5 I;  3E7L A;  1ZGA A;  4HF2 A;  4XN3 A;  4A12 A;  2BZT A;  2Z1D A;  2HQ5 A;  4P9U A;  3ABM H;  5ICG A;  1Y6I A;  4JK1 X;  2BY0 A;  4C30 A;  1YRN B;  1P4X A;  3R4K A;  4BJ5 C;  2CS3 A;  1ETO A;  3MKZ A;  4I0B A;  4XNF A;  3S1Q J;  1BIB A;  5HDG A;  4ZYA A;  3ZQL A;  3D0S A;  3RYP A;  4EJU A;  3JTH A;  3VOE A;  5J47 A;  2M8G X;  2RN7 A;  3NAU A;  3HZJ A;  2EBI A;  4BGD A;  3E6M A;  3UR3 C;  2ME6 A;  1IGN A;  4HZF A;  1FOW A;  2QZ8 A;  4S04 A;  4D5F A;  3LQQ A;  3JRI A;  1BOA A;  3GZ5 A;  3KZI C;  4A3M J;  1X1C A;  2HFH A;  5LRS A;  3NWT A;  1XCB A;  2CJJ A;  4CA0 A;  1OPC A;  3TP0 A;  5A2Q K;  2JUC A;  2ME0 A;  2JJ7 A;  5FKO A;  3GO5 A;  2FUG 2;  1LKX A;  3B02 A;  3BJ6 A;  3EYI A;  2EFO A;  2R0Q C;  2ZC2 A;  1RUN A;  2GWR A;  1HLV A;  3CC2 I;  1ACI A;  4CCO A;  3OYG A;  2K27 A;  2BW3 B;  3HRT A;  4I09 A;  1R49 A;  1SD7 A;  3OL4 A;  1HCR A;  2WAF A;  5J40 A;  4HV5 A;  2ELK A;  2CG4 A;  5KCM A;  1FP1 D;  1W7P B;  4HAM A;  4XLH A;  1G59 A;  2Y48 A;  2STT A;  2E60 A;  4OMZ A;  3KP4 A;  2IEK A;  1AA7 A;  3ESW B;  2P4W A;  1FMV A;  3UNG C;  1VND A;  4B3A A;  2FJ1 A;  2M5W A;  4E7I A;  2ISY A;  1O3R A;  1T33 A;  2L9V A;  2XHK A;  3K1M A;  4G12 A;  1Z91 A;  1OMI A;  3PO2 J;  1WJ5 A;  1S5L C;  2PX9 A;  4M74 A;  2VQG A;  3OYD A;  4IL6 C;  1P92 A;  4UXN A;  1UZC A;  3H9G A;  3M9A A;  4L9T A;  4EQQ A;  1TP4 A;  3GFI A;  1POG A;  1SVL A;  4XL9 A;  1Z6R A;  4UUS B;  1XGO A;  2KIM A;  5FRO A;  1UAA A;  2PMU A;  5HLI A;  1NG7 A;  2QVO A;  3ZQH A;  1O3T A;  1X1D A;  2G7U A;  2K5C A;  2NVT J;  2E5N A;  1SVO A;  5DM7 F;  4M3F A;  2JA5 J;  3H3V K;  2E34 A;  2E5Z A;  3KP5 A;  3Q0V A;  4RGU A;  4ZDO A;  1GVD A;  3CCQ I;  5IOY A;  2V1X A;  1OLT A;  3KYD B;  3PIP F;  1TQP A;  3IH4 A;  4CCN A;  2RKH A;  2V1D A;  4HV6 A;  3X2Q H;  2CU7 A;  5HS9 A;  3TED A;  4BY7 J;  1MNE A;  1OCZ H;  1MBK A;  3DFG A;  2Z5U A;  1JKP C;  1KON A;  1W7P D;  2Y31 A;  5LD2 C;  3Q9S A;  5K7Z A;  3LL7 A;  1RIO H;  4AC0 A;  2DQR A;  2FF4 A;  2KFD A;  2NXN B;  4FHT A;  3BG7 A;  4B44 A;  4EJV A;  1GDT A;  1F43 A;  3RPU D;  1EA3 A;  4PJL A;  4BBS J;  2EFN A;  4G7Z F;  1DGW Y;  5B3S H;  3TOA A;  2CSO A;  2UV1 A;  3PNV A;  2Q0O A;  5IT3 A;  3CUQ A;  1M1E B;  3J7Y J;  2Y69 H;  2A5W A;  3KP2 A;  4XM3 A;  1R00 A;  5EF6 A;  3L2C A;  4B1R A;  2D5V A;  5E18 F;  4RLQ A;  3MZY A;  2K7L A;  4YEL A;  1PP8 F;  5DCM B;  3F8F A;  4RAZ A;  3DEW A;  2RRE A;  5F1R A;  3F22 A;  1U9N A;  2WB1 A;  1YJW I;  3QOP A;  2JA6 J;  4I7H A;  1CGP A;  1PVE A;  3L2R A;  3KEO A;  4I98 B;  2CQX A;  1E3O C;  1KQ8 A;  3TL4 X;  4LFU A;  3BP8 A;  1RR7 A;  1WJE A;  2CUJ A;  3OV8 A;  4FQG A;  2NOJ B;  4CSW A;  2DPD A;  3H92 A;  5ICF A;  2H27 A;  4CH7 A;  1ZQ3 P;  2BYV E;  4YEJ A;  4FE7 A;  4V19 K;  2VOO A;  2VBX A;  5E3M A;  1YO5 C;  3ONQ A;  3Q3S A;  3A1Y A;  2E1M B;  4CYD A;  4OWR B;  5J3L A;  4BXU A;  3S2D J;  5EYR A;  3GTQ J;  2VI6 A;  4D0P A;  2K85 A;  3H5R A;  4RGX A;  4EGY A;  2OZU A;  1IDZ A;  4PUS A;  4ZZL A;  3M7G A;  2UWM A;  2X51 A;  4KN7 X;  4LK1 F;  4BAC A;  1X1P A;  1T38 A;  3EYY A;  2VQH A;  3SFI A;  1CF7 B;  2QQB A;  1NK2 P;  2QEX I;  2ZXH A;  1BW6 A;  1RZ4 A;  3LOC A;  4U87 A;  1HBX G;  1XMA A;  1QQI A;  3C2B A;  2E1O A;  5F64 A;  4A3I J;  1DPR A;  2VON A;  2QM3 A;  1Y8R B;  3OL3 A;  4ZYD A;  1QHG A;  5FLM J;  3HOV J;  2X1C A;  3R60 A;  3WG7 H;  4F55 A;  2R7D A;  2F5V A;  3ZQQ A;  2ETH A;  3GW2 A;  3O3K A;  2AO9 A;  3JW4 A;  3S16 J;  4C2T A;  4L5E A;  4XLF A;  4LIU A;  4BE1 A;  1J09 A;  5D4R A;  2KIQ A;  4IHS A;  2WY8 Q;  2PMH A;  4MTD A;  2QSH X;  2Z33 A;  2Q2E B;  4WXD A;  2A3S A;  3R6S A;  3EUH A;  1SAU A;  1A36 A;  4LB6 B;  2UXX A;  4IHY A;  2DMQ A;  1MMA A;  2NS0 A;  4ITV A;  2DA1 A;  1P4W A;  5LHI A;  2MYS A;  2F4I A;  4KJZ A;  2BGC A;  3BR5 A;  4IQ4 A;  3WGG A;  4GFB A;  4KDP A;  2WA0 A;  5FKK A;  2EIL H;  4ANJ A;  2R5Y B;  4OIQ F;  3HSR A;  4Y33 A;  1FP2 A;  2GOM A;  3BR3 A;  1H9T A;  5HNF A;  3REO A;  2ZJQ F;  3Q5F A;  3IAS 2;  1YFH A;  1HC8 A;  2H09 A;  3CJN A;  3OIQ A;  2DT6 A;  1K79 A;  2VBW A;  3WGI A;  2HXI A;  2F4O B;  3G1L A;  2D45 A;  1BI2 A;  2GIV A;  1ZG3 A;  3SDB A;  4CUG A;  2XKO A;  1IXR C;  2RC4 A;  2ZNZ A;  4DYC A;  3QQA A;  2HI3 A;  1XDS A;  1A5J A;  4AUX A;  4WX9 A;  4NC6 A;  1YIO A;  1FSE A;  3CF2 A;  2FBI A;  4RB2 C;  1RI7 A;  2VC1 A;  3FX3 A;  3PNT A;  3QPT A;  4HNT A;  3K2A A;  2XPU A;  1MDM A;  1BI3 A;  2BXY A;  2OA4 A;  3L2W A;  2VT3 A;  2LRD A;  2BVL A;  2QKM B;  3MN2 A;  4LJZ F;  3RQI A;  1LB2 A;  3NAR A;  4U0W A;  3LSG A;  1B72 A;  1S7O A;  4NNJ A;  2OTL I;  3PM1 A;  4UB6 C;  3FM3 A;  2Z2S B;  3K10 A;  3WGH A;  5FD5 A;  5HLT A;  4XRF A;  3GUD A;  4L5I A;  3HEF A;  1EH8 A;  3HYI A;  4LLL A;  2BHY A;  5HOD A;  1WJA A;  2DMN A;  4FT8 A;  5GAH J;  2COB A;  2CUE A;  4PSW A;  1VQ9 I;  2F5E A;  1B1B A;  2DA2 A;  3HSE A;  3S3N A;  3SYT A;  4NB5 A;  4GO1 A;  3TOB A;  3W2V A;  2VBY A;  4HSR A;  5DTD A;  1R1U A;  2K9M A;  4D9J A;  1Z6T A;  3RPU A;  2YPR A;  2PQ8 A;  4XLA A;  3TDU C;  5D8K B;  1R1T A;  2GZW A;  4Q47 A;  3PNY A;  1FTT A;  4CO8 A;  3JR9 A;  3CMA I;  5A2Q Z;  4AYB A;  4A3E J;  4E7K A;  1XGN A;  3HUG B;  1LVK A;  3OWT A;  5IY5 H;  1YJ9 I;  4IHX A;  3B73 A;  4G94 A;  3EET A;  1ZKG A;  2W82 A;  2ELH A;  5JLX A;  2W48 A;  3OYK A;  1WSU A;  3BJO A;  3F21 A;  4XON A;  1U5T C;  4Y52 J;  2VXD A;  4MLO A;  1MNM C;  3O2P E;  4G8X A;  2BBY A;  1ZN2 A;  1HQC A;  1UST A;  2R3S A;  3J7A O;  1GV5 A;  1UJ8 A;  2XF7 A;  3A01 A;  3B6A A;  1VI0 A;  4PJ0 C;  4N0B A;  5JFR A;  4PFP A;  3ZQC A;  3JRA A;  4DGW B;  1OKR A;  1G3Y A;  2HQA A;  5C44 J;  1ZLK A;  2K9L A;  2P6T A;  1ETV A;  1K6Y A;  2ZCW A;  3I71 A;  3N97 A;  2HOS A;  2XGX A;  2QBY B;  1QHH D;  2IVM A;  3PO3 J;  4W1U A;  4A3C J;  1TT5 B;  1B6A A;  1LDJ A;  5FLX Z;  3V7R A;  2IAI A;  1S72 I;  1TWA J;  2QF7 A;  4XKV A;  5IYB J;  5LHH A;  3K70 C;  4UV8 A;  2EFP A;  2VKE A;  2DJI A;  4LLN A;  5ED4 A;  3G2B A;  2CQQ A;  3IC7 A;  4NUB A;  4XQF A;  2MH2 A;  4HOB A;  1D5V A;  2L54 A;  2L9R A;  3E97 A;  2MGQ A;  3PFI A;  3T1B A;  4HNU A;  5FLV A;  5BQT A;  2XF6 A;  3QRF F;  5DS9 A;  3BTC A;  2IT0 A;  1ON1 A;  1ZG1 A;  4W97 A;  3BG9 A;  3GLL A;  3DKX A;  4BHP A;  3PJR A;  4MNU A;  1FWZ A;  2JTV A;  3LSR A;  1R22 A;  4Q48 A;  4KFC A;  2QUF A;  1SMT A;  1VQL I;  3CDI A;  3ASO H;  5TJJ A;  3OR2 C;  4RS8 A;  3K2Z A;  1DGR M;  1R71 A;  3H3Z A;  4JX4 A;  2ECC A;  3C2H A;  3BR6 A;  2H6C A;  4JQF A;  4B09 A;  1GXQ A;  2M1B A;  3MWM A;  2O3F A;  2VC0 A;  2RV8 A;  3S3M A;  3V42 A;  2DA5 A;  4M6V A;  3OOU A;  3OS1 A;  1GUU A;  1DQU A;  1T98 A;  1BJA A;  4LLG F;  3IL2 A;  3ELK A;  3JRE A;  4IHV A;  2VKD A;  1QNT A;  2W85 A;  2DFE A;  4I01 A;  2EFW A;  1RET A;  1K78 A;  1BI0 A;  2GLO A;  1R5I D;  2E19 A;  3KFW X;  4PJN A;  2QKL B;  2VN2 A;  3K7A J;  3FDY A;  4Z2Y A;  4IX7 A;  4NC8 A;  2QQA A;  3ULQ B;  5L3B A;  3HB9 A;  3JRH A;  1BW5 A;  2V9V A;  5GAE J;  2QA4 I;  4M6Y A;  1ZRC A;  4R8H A;  4Y15 A;  1I27 A;  3BCB A;  2X1D A;  1ZLJ A;  5KNL A;  3AG1 H;  5ICE A;  3T5X A;  3JTG A;  4YFK F;  4IQJ A;  5CVI A;  3HOZ J;  1APL C;  4A3K J;  5D5U B;  3A0H C;  5F1J A;  3V8L A;  4EGZ A;  3TDZ C;  5BMZ A;  1Y0N A;  4BXX J;  2L7M P;  1C0W A;  3FXK A;  3WTU C;  1CQT A;  5H2F C;  1X58 A;  3LSP A;  3HGY A;  3F8B A;  4IRH A;  1FYL A;  2IRF G;  4C3H J;  1ZAR A;  2F2E A;  2WV0 A;  4Y7N J;  1YW9 A;  3HHG A;  5J8C A;  3LAJ A;  3KET A;  1FTZ A;  4F52 A;  2KZG A;  1YS7 A;  4WK8 F;  2Z3Y A;  3FWE A;  1RKW A;  1QPI A;  2M45 A;  3BTJ A;  3VYR B;  3CQZ J;  3QAH A;  5K1Y A;  1AWC A;  1H9G A;  4II2 A;  4U88 A;  4QIW N;  4HPQ A;  3DLA A;  3CCR I;  4S05 A;  2A61 A;  3GME A;  2E2H J;  2A6H F;  4GDF A;  1MBG A;  4O3M A;  5AON A;  3BR2 A;  9ANT A;  1ZGJ A;  3GEZ A;  1X3U A;  1P7J A;  2MH9 A;  1ZRF A;  2Y2Z A;  2MW8 A;  4UB8 C;  3TP3 A;  5F27 A;  3PQK A;  2LOO A;  4DYR A;  4ENJ A;  3L2Q A;  2LG4 A;  3BR1 A;  4XN0 A;  4HW0 A;  5ILV A;  3RTR A;  2EIK H;  3QPS A;  1IXC A;  1YG2 A;  1JGG A;  3IP4 B;  5LLQ A;  2RGV A;  4D5C A;  1YIT I;  3ECH A;  3BG6 A;  2XAH A;  2L9S A;  2P5L C;  1VQO I;  2ACJ A;  2AHQ A;  3NQO A;  1S6L A;  4D7M A;  2V1U A;  4A3D J;  2FEZ A;  3QPH A;  1E3P A;  1U6G A;  1FEX A;  2CQK A;  3M8F A;  4P96 A;  1N77 A;  2DCE A;  4PK4 A;  4A3F J;  4QPO A;  2DW4 A;  3NWS A;  2F5F A;  4M9S A;  2GXB A;  3FIS A;  3PIO F;  4C2M J;  3ZN0 A;  3AAF A;  3BLY A;  4DOZ A;  2DK5 A;  2M7B A;  3H36 A;  2DTR A;  4UVC A;  3KLN A;  2YUS A;  1ZR2 A;  3KPH A;  2NS8 A;  2HYJ A;  1JXS A;  4J01 A;  3FZV A;  3F3X A;  2B0L A;  1L0O C;  1WI3 A;  4L0Y B;  2MBF A;  1TW2 A;  3RKX A;  1W4M A;  2DMT A;  1YW7 A;  3DTI A;  5C4X J;  1JT0 A;  3HKZ A;  2EIN H;  2BEO A;  3DBH B;  1JHH A;  1PDN C;  1BI1 A;  3GCM A;  2A68 F;  2DFH A;  3K4J A;  2HOA A;  2PBI A;  2WTE A;  2LP0 A;  1XPX A;  5HDK A;  2VL8 A;  3W6V A;  3NEU A;  2X4H A;  3GYH X;  5FRM A;  1YE9 A;  2HYF A;  5FJ8 J;  3SEQ A;  1FBS A;  4IJA A;  4JBA A;  3AKZ A;  4GYG A;  4Q4Z F;  1MH4 A;  2XV4 S;  5E1W A;  4Z6Y A;  1B8I B;  1QU3 A;  3C3W A;  5IP7 J;  1L3L A;  5AIQ A;  1MSF C;  1HDD C;  2DA6 A;  2CGP A;  1RPW A;  1MBF A;  4HDV A;  3L9F A;  2DO7 A;  3TGN A;  3OY9 A;  4PJM A;  4BQN A;  2OCE A;  3HGG A;  1SFX A;  1OR7 A;  2KJC A;  5FKM A;  2ECB A;  3WTT C;  1SFU A;  5FGM A;  1FOY A;  2L2O A;  3HTU A;  2MLG A;  4M9X A;  3I64 A;  2NVQ J;  4Q5S F;  1SD6 A;  3BPV A;  1R1V A;  3K4K A;  4OIN F;  4FTH A;  5E20 A;  4CYC A;  5KK1 A;  3MZH A;  1Y1W J;  5FKL A;  4PGG A;  2FU4 A;  2CW7 A;  4KIG A;  3U21 A;  1SFE A;  2YX4 A;  2ZB9 A;  2R7F A;  3HOU J;  1BR2 A;  3RYR A;  2NVU B;  3BQZ A;  3K4M A;  1X3Z B;  1WH7 A;  2ZME C;  4IF4 A;  2LRE A;  3QP5 A;  4XKW A;  4DW6 A;  3GTG J;  3KP6 A;  1D3Y A;  3SXY A;  2FBK A;  3LST A;  2W4S A;  2V7F A;  4NDL A;  5L3C A;  5J8F A;  1FIP A;  4UNO A;  1R5H A;  4S0H B;  1XMK A;  2HWV A;  1MD0 A;  2Z16 A;  1MMS A;  2QGU A;  4XRM A;  4OOI A;  4MEY F;  1F5T A;  2CO5 A;  3CLQ A;  2EA4 A;  3PSI A;  4Y17 A;  2E36 A;  4BY1 J;  2HZD A;  3ZOB A;  1YYV A;  2X85 A;  3F8C A;  1ENH A;  2CYY A;  3ABU A;  2O5R A;  1J9I A;  1BM9 A;  5LGU A;  2X6O A;  1HA8 A;  3P9K A;  3ZGK A;  1OCT C;  2LBF A;  4UUV A;  3E5Q A;  3MCZ A;  2GXA A;  2HNH A;  1U5T B;  2R93 J;  2WAD A;  1GLN A;  4NQW A;  3N05 A;  1SFO J;  1K61 A;  4M72 A;  3AG4 H;  3CJQ B;  3WTX C;  3CD6 I;  4BU2 A;  3JRF A;  1JJ6 C;  1YX5 A;  3ZRG A;  3FXO A;  4EM0 B;  2XSJ C;  2BY3 A;  1XN7 A;  3W3C A;  3RPQ A;  5D5W B;  3ABT A;  4KIF A;  1QZZ A;  2DI3 A;  2HR3 A;  3DKY A;  2PJR A;  2P5K A;  1B9N A;  1XX5 A;  3LSK A;  1WJD A;  4LD5 A;  5EG0 A;  4CXF A;  2K3F A;  3CLO A;  3A03 A;  2M2E A;  4DQ2 A;  1E0E A;  4DBR A;  4H0E A;  5J6X A;  2GOX B;  2KHM A;  3DU5 A;  1HW2 A;  4YII A;  1VF9 A;  1XGS A;  1KYZ A;  1X3W B;  4PFO A;  3S8P A;  4A6E A;  4XOP A;  4EVI A;  3FMR A;  2EB7 A;  2YSR A;  2LKP A;  2PJP A;  3U1D A;  3I59 B;  5GTH C;  1LE8 B;  2HQR A;  2XPV A;  4LIT A;  3W2W A;  2KQR A;  2Z9O A;  1Y39 A;  2PG4 A;  3H35 A;  1ZR4 A;  1PUF B;  2JSP A;  1UG0 A;  5EGO A;  2H6B A;  3Q0W A;  1R58 A;  4CGZ A;  1ETW A;  4HX7 A;  5BPD A;  1EF4 A;  5GAD J;  2DFI A;  2GBY A;  2BV6 A;  1JKR C;  1A35 A;  3A02 A;  2H8R A;  4O5V A;  1G8X A;  3CO6 C;  1J0R A;  1IAW A;  1IV8 A;  3W6J B;  4BQO A;  1ZK8 A;  3BG5 A;  3RIR A;  3LFK A;  5D6F A;  2ZNY A;  3KP3 A;  1S3J A;  3OSF A;  1P2F A;  5IYC J;  3OYM A;  3IAM 2;  2UZK A;  5CLS A;  1UB9 A;  2AQE A;  4M3E A;  3TO6 A;  2O61 A;  1H89 C;  1TT0 A;  4L5J A;  2XDV A;  1XG1 A;  4XIC A;  5IP6 A;  2DOF A;  3ERM A;  2CV1 A;  4AIH A;  4XID A;  5CVV A;  2FQ4 A;  2JPB A;  3E1S A;  3DEU A;  2BHZ A;  1VFC A;  1BR4 A;  4I99 C;  4B3X A;  3K70 D;  2E7W A;  1AHD P;  4XOR A;  3BC8 A;  5LEK A;  4XKC A;  2KPM A;  1E3H A;  2ELJ A;  2XGC A;  3H9J A;  1DU0 A;  1GV2 A;  3BCA A;  3ZMD A;  2K40 A;  3L1P A;  2K3P A;  3LA2 A;  3ECO A;  3HM5 A;  5F6F A;  2L0K A;  4KMF A;  1D0Y A;  2IA0 A;  1YIJ I;  3HHH A;  2BOL A;  2XRO A;  1S29 A;  1FC3 A;  4A93 J;  3F0C A;  5DUI A;  3LSJ A;  3HOT A;  2M30 A;  2PLY A;  2X1E A;  4NBQ A;  1FZP B;  4HF1 A;  1TQI A;  2RNG A;  4BHC A;  1U78 A;  4JYK A;  2ZFW A;  3GWZ A;  3RKQ A;  4BEH A;  4YIR X;  1J59 A;  1GXP A;  1IN4 A;  4ZC3 A;  1G3W A;  3MD2 A;  2E2J J;  3FMQ A;  4JP0 A;  2KP6 A;  4E7S A;  1X19 A;  4OIP F;  4QSH A;  3VYU B;  1EH6 A;  3MVP A;  1JUM A;  1FYM A;  1E17 A;  1SVM A;  3KZZ A;  3MQ0 A;  2RNJ A;  4LK0 F;  4BHB A;  1OYI A;  3JAM K;  1UEL B;  2JPC A;  1V4R A;  1AKH A;  1NK3 P;  5K5O A;  1T0F A;  2GXG A;  1K4T A;  4LG0 B;  3D5R C;  3ZMV A;  3JCU C;  2FMY A;  2CFX A;  5ILS A;  1QO0 D;  1LEA A;  5DEQ A;  3GFJ A;  3P9I A;  3E6B A;  3HG9 A;  3VSK A;  5F0H A;  1LQ1 A;  1DU6 A;  3JSP A;  3GVA A;  2OZ6 A;  1OCR H;  1VQN I;  4F91 B;  1YI2 I;  1S7A A;  3HC7 A;  4ABZ A;  4C3J J;  5M5W J;  3T8R A;  4KA4 A;  1LNW A;  3CME I;  2KMU A;  2IJL A;  2HOE A;  1A31 A;  2VPL A;  1UHM A;  5BNG A;  4IHT A;  1JI8 A;  1Y0U A;  3S15 J;  4AVZ A;  1UG2 A;  2OTJ I;  2EFQ A;  3FXU A;  4EJT A;  3HIF A;  1P6R A;  2XAU A;  3OMY A;  4HYE A;  1ZH5 A;  3CUQ C;  2NOG A;  2I10 A;  1MKM A;  2W1O A;  1G3T A;  2LFB A;  1H0M A;  1BJZ A;  2EZK A;  1W1W E;  5IPA A;  1OYW A;  2CV0 A;  4HNV A;  1TLH B;  1V54 H;  2I8D A;  3DPU A;  3O8G A;  4ENN A;  1KQ9 A;  3CC4 I;  2WAQ N;  2XRN A;  4BNC A;  3QP6 A;  2O6G E;  4H4K C;  1HW5 A;  2NVY J;  5ILU A;  1UMQ A;  2FOK A;  1JKQ C;  3JRB A;  4QTR A;  2NS7 A;  1LJ9 A;  1X4O A;  2W24 A;  1YRN A;  2H94 A;  1KQ0 A;  4N4O B;  2QWW A;  4LOC A;  2X6Y A;  2E2I J;  4MQV A;  4DBQ A;  2EV0 A;  2O8X A;  3CUO A;  3PSF A;  3HPH A;  4PCQ A;  1SC7 A;  2IP2 A;  2FNA A;  1BN5 A;  4AID A;  2A5Y B;  2KIF A;  5CYV A;  3QOD A;  1Z77 A;  1IG7 A;  2NYX A;  1TNT A;  1IN7 A;  3KYL A;  1MMG A;  1V5G A;  2DT5 A;  2VE9 A;  2FNP A;  1RUO A;  3W2A A;  4N4N B;  3WTZ A;  2VJI A;  2R5Z B;  5HLH A;  3U9G A;  1P4A A;  1BL0 A;  2HKX A;  4FE4 A;  1LPQ A;  2FRH A;  3WTV C;  5FO5 A;  3ZR8 X;  2FML A;  4LMY A;  4XKB A;  4XR6 A;  5CKT A;  1YQA A;  2JVH A;  3MAJ A;  3ZXS A;  5ERI A;  4A2U A;  4ZYE A;  1JUP A;  2F48 A;  2V26 A;  3BZK A;  4M6X A;  1JKO C;  2M87 A;  4KIB A;  4MHG A;  1QRY A;  3G4S I;  4V2G A;  1H88 C;  1P9Q C;  1WQ2 A;  2YU9 J;  2R7X A;  2M34 A;  1LFP A;  2ZME B;  2ICW G;  2ZXW H;  1SEU A;  2RDP A;  2DA4 A;  1HKQ A;  3K4B A;  2V6C A;  4UV9 A;  2BW3 A;  3EUH C;  2LY9 A;  3COA C;  1VTN C;  3IRR A;  4BXF A;  1WGX A;  1W7P A;  2VOD A;  2A6E F;  1OCC H;  4IRI A;  3O6B B;  3OYH A;  3M07 A;  3HTS B;  4XRS A;  5CVR A;  2CW0 F;  2HU9 A;  1J2X A;  5LGT A;  1TC3 C;  4M3D A;  4RLF A;  2GA2 A;  5BOX A;  5CQE A;  3I55 I;  2ZSI B;  4GGG A;  1BR1 A;  5JR3 A;  2QSF X;  3S17 J;  4BUP A;  4AIJ A;  3RZD J;  2OPT A;  5LFA A;  1Z0X A;  2E1C A;  2C6Y A;  1I3A A;  4HBL A;  2HZT A;  4IVN A;  4TV7 A;  1U9O A;  1SAN A;  2EIM H;  3H9Q A;  3ROU A;  2EZI A;  3F9K A;  4UUS A;  2H1L A;  3LWF A;  4HQM A;  3E5X A;  1V5F A;  2FSW A;  2R7T A;  1QVU A;  4G9Y A;  4RGS A;  1MH3 A;  4LG3 A;  2DFF A;  5EEH A;  1O7F A;  3EQL F;  4ENK A;  4ENM A;  2FXA A;  1I50 J;  1DUX C;  1X1A A;  4N9H A;  2Y9Y A;  2I5U A;  3CCY A;  3JRG A;  3M4O J;  2ZBK A;  2P0W A;  2XAG A;  4MGR A;  2JWT A;  3S2H J;  2P6S A;  3WU2 C;  3G6E I;  5J1R A;  1KA8 A;  4XOT A;  4BQQ A;  5M3M J;  4MFE A;  4D1Q A;  3HBL A;  4Y3O A;  3LMM A;  4BQA A;  3C7J A;  5IP9 J;  5M3F J;  3FK7 A;  1W0U A;  3GX4 X;  1SAX A;  1Z67 A;  5K7H A;  5L3E A;  2OJE D;  1VZ0 A;  3C18 A;  4I02 A;  3S32 A;  1B9M A;  2WAE A;  2K4J A;  1AOY A;  4MTE A;  2EV6 A;  5FFZ A;  3DU6 A;  2YX7 A;  4MIM A;  1P7I A;  4WXC A;  2M3A A;  2VXZ A;  3ZQ7 A;  5JLW A;  1JE8 A;  1VQK I;  4OIO F;  2IS1 A;  5JHU A;  5DUK A;  2FX0 A;  2KRH A;  5DCM A;  4AU7 A;  1WCM J;  4RAG A;  1T2K A;  1A6Q A;  2D2W A;  2O7O A;  2VUM J;  3R61 A;  3LSM A;  3VB2 A;  4CCM A;  1N78 A;  1VQP I;  1HKT A;  1R36 A;  1T95 A;  1QVT A;  3D5L A;  3SHF A;  4BL0 B;  2DJN A;  2MLK A;  2JQ7 A;  1QPM A;  3GF2 A;  4L9N A;  3L00 A;  1LVA A;  1ZG5 A;  1UHW A;  4WCG A;  1QGP A; 
#chains in the Genus database with same CATH homology
 5LEJ A;  3L09 A;  1HSJ A;  1LDK B;  3BRO A;  1K7A A;  4PZJ A;  3HRM A;  1ONV A;  3F8M A;  1Q1H A;  2NRA C;  3NRV A;  5D6E A;  2DK8 A;  1CF7 A;  4YFN F;  5LRR A;  2L01 A;  1F4K A;  3P9C A;  4FX4 A;  2GAU A;  1DDN A;  4WF2 A;  1G6N A;  2YU3 A;  5E17 F;  2EJR A;  2HYG D;  1XGM A;  4KNY A;  2PEX A;  2W84 A;  4PGH A;  2LSO A;  2Q2E A;  4MEX F;  1OYY A;  4KIC A;  3ERE D;  4A5M A;  3I0T A;  5EEG A;  4EJO A;  4EM2 A;  1F9N A;  2OBP A;  4G6D A;  4M9Z A;  5H20 A;  1FBU A;  1XCV A;  3IHU A;  5E8I A;  1IUY A;  1IXS B;  5HOO A;  4RB0 A;  4ZH4 F;  4ZYH A;  3GXO A;  2D1V A;  2FBH A;  2G7H A;  1W5S A;  2EK5 A;  5FD6 A;  1KGS A;  3BY6 A;  1O7L A;  4HF0 A;  3TO9 A;  3ZMZ A;  4F7Z A;  3WU0 A;  1IRG A;  3CUQ B;  4P9F A;  3JSO A;  2DU9 A;  3I58 A;  4EM1 A;  3G73 A;  4EMS A;  2MA3 A;  1SD4 A;  3ZMS A;  5AIP A;  1IRF A;  3RDI A;  5JVT A;  4FX0 A;  5DCF A;  2NAZ A;  5KVR A;  2OAZ A;  4U7B A;  5D8L B;  4KUM A;  5IT9 K;  1DPU A;  3QU3 A;  1WWX A;  1Z05 A;  3DV8 A;  3KZY A;  4CZZ A;  1U2W A;  2VBZ A;  4ON0 A;  2ADU A;  1GHC A;  3HUG A;  5ICC A;  4CIC A;  2HTS A;  2ZO4 A;  2XIG A;  4Y13 A;  3K0L A;  3DQV C;  3FXQ A;  4U0V A;  1HW1 A;  2ZKZ A;  4ZZD A;  2HTJ A;  3N4M A;  2HQN A;  1IF1 A;  4HX4 A;  2A69 F;  3HRU A;  1MZB A;  2XUB A;  2QBY A;  1Z7U A;  1B4A A;  4O6J A;  3V8J A;  1W5T A;  1IW7 F;  1ZRE A;  2STW A;  2O0Y A;  3F6V A;  4M71 A;  2E7X A;  1TTY A;  2F5C A;  2FA5 A;  4CHU A;  2P5V A;  2IA2 A;  4PDK A;  4HDU A;  3H3U A;  3PQJ A;  3J80 K;  2UXN A;  1BC8 C;  3KP7 A;  2QLZ A;  2AS5 F;  4P55 A;  3FHZ A;  1A04 A;  1YW8 A;  4ESF A;  2KRF A;  1E2X A;  4HX8 A;  2V79 A;  4K2E A;  2PN6 A;  2IA1 A;  4ESJ A;  5DD4 A;  2W57 A;  2JSC A;  2Y0M A;  2IW5 A;  4XLP F;  2FQ3 A;  1WRJ A;  2XAJ A;  4L9V A;  4RGR A;  1MDM B;  2WWY A;  2XAQ A;  2VOP A;  1ZYR F;  2XAS A;  3F8N A;  1TW3 A;  3E6D A;  4I0A A;  5L3G A;  2WC2 A;  2G9W A;  2Q8K A;  1I1S A;  3C1D A;  3WG9 A;  4XLN F;  3MFK A;  3V8K A;  3DPT A;  4XBF A;  3LAP A;  1ODD A;  1ZRD A;  5E1Z B;  4MQ9 F;  4IXA A;  4A5N A;  2L4M A;  3BWG A;  4QLC U;  1HXD A;  3F72 A;  4A0Y A;  5FLX K;  2DQL A;  3K1N A;  2XVC A;  1XDU A;  1K6O A;  3K69 A;  4ETS A;  1MJ9 A;  5DV5 A;  4A0Z A;  1UCR A;  1ZHF A;  3ZN1 A;  3I4P A;  2DLL A;  1KU9 A;  3R0A A;  3Q9V A;  3GFM A;  1TQM A;  5DD8 A;  1REP C;  5L3D A;  3P7N A;  1F1Z A;  2L4A A;  1I5Z A;  3KCC A;  2NNN A;  2OD5 A;  1G4D A;  2QEN A;  1FPQ A;  2VE8 A;  1UFM A;  2XAF A;  2JT1 A;  4HQE A;  4A0X A;  3SZT A;  2GA1 A;  5HVQ C;  1USS A;  2EV5 A;  1IN6 A;  3SZP A;  1PUE E;  1BBY A;  1XSD A;  1O3S A;  2Y75 A;  4HLX A;  3LA3 A;  3I54 A;  3KE2 A;  3TO7 A;  3V7S A;  3U2R A;  3W6K B;  1DP7 P;  3BDD A;  4DNC A;  1HST A;  3ZP5 A;  3IWZ A;  5HDN A;  1IN5 A;  2P7C B;  3E5U A;  1KU7 A;  3LA7 A;  1K78 B;  3GLX A;  2ESN A;  2Z99 A;  1QZY A;  4RB1 A;  3IKT A;  5H6Q A;  5LHG A;  5FB2 A;  3VFZ A;  2HDC A;  1J5Y A;  2JRT A;  4L9J A;  4YIF A;  3WTS C;  4XSZ F;  4L18 B;  3WE3 A;  4RAY A;  4U0Y A;  5HS7 A;  3J81 K;  2O03 A;  3ISP A;  3RJP A;  3L7W A;  1TNS A;  5DDG A;  5IT9 Z;  4GYI A;  1MJA A;  4BH9 A;  1QBJ A;  1FSH A;  4WXH A;  3FF5 A;  3DP7 A;  4G6Q A;  2CWE A;  1JGS A;  2HGC A;  1XD7 A;  4AIK A;  4GXO A;  4KN4 X;  5D4S A;  1BIA A;  1T39 A;  3OOP A;  2IPQ X;  1U8R A;  5CJ9 A;  1PP7 U;  3HSF A;  4OU0 A;  2P7V B;  1YTY A;  4M73 A;  2HS5 A;  2E1N A;  5DYM A;  5CVU A;  2ESH A;  3E3V A;  2TDX A;  1I6X A;  4LB5 A;  1U5T A;  3CDH A;  1R23 A;  4GCV A;  4CDG A;  3MEX A;  1T6S A;  2D1H A;  4HLY A;  4YG2 F;  1BC7 C;  1LEB A;  1I1G A;  3WE2 A;  1ULY A;  3QU6 A;  1ZAO A;  5HS8 A;  1WI9 A;  1R5G A;  2NNY A;  1KYW A;  4L0Z B;  1J7K A;  3I59 A;  3I53 A;  3J80 Z;  5TRD A;  2DBB A;  1XB4 A;  4AWX B;  5LBQ A;  2LDU A;  5FFX A;  3GZ6 A;  1NHA A;  1Z9C A;  3DXJ F;  4ZYG A;  2L02 A;  2ZXJ A;  2FE3 A;  6PAX A;  1FLI A;  2OU2 A;  3KLO A;  3IRQ A;  3VEP A;  2AXL A;  1EH7 A;  3F6O A;  1FNN A;  5H6R A;  3T8T A;  2HEO A;  3BOQ A;  1HKS A;  1IN8 A;  3EDP A;  2JZY A;  4P5O A;  4UVA A;  1STZ A;  5CVJ A;  4RB3 C;  5HLG A;  3RI4 A;  3BPX A;  3DF8 A;  3WOD F;  1YS6 A;  2K4B A;  3V7C A;  2W25 A;  1S8N A;  5K5Q A;  4HA8 A;  3DKW A;  2DPU A;  2KJB A;  1EV7 A;  3RKW A;  1SMY F;  4UVB A;  2QQ9 A;  4KMU X;  1FBQ A;  2GQQ A;  2HKO A;  2BE5 F;  3SFZ A;  5E8G A;  3FM5 A;  2PI0 A;  3DPL C;  4ESB A;  3CTA A;  4A6D A;  3VOD A;  4LG0 A;  4KYW A;  2COM A;  1U3E M;  1LDD A;  2MD5 A;  4R1H A;  4I2O A;  2ISZ A;  1GVJ A;  2J5O A;  3BZ6 A;  3CO7 C;  1D8J A;  3M8E A;  3TKY A;  3WU1 B;  2J5P A;  1D8K A;  2PFB A;  4BAY A;  1O57 A;  1TBX A;  5L3F A;  4KT5 C;  3JAM Z;  4N9I A;  1FY7 A;  3BJA A;  2QYO A;  2L3D A;  2M8E A;  2A07 F;  3SQN A;  3ZMT A;  1O3Q A;  5D5V B;  4OMY A;  3ML6 A;  4EJW A;  2K02 A;  2MC3 A;  4QWQ A;  3WTY C;  2P8T A;  3RKY A;  1ON2 A;  4E70 A;  1XSX A;  1B59 A;  3HRS A;  5D5X B;  5E1X A;  3K1P A;  3E6C C;  3LQR A;  3J81 Z;  3HOS A;  2OQR A;  3GFL A;  1FX7 A;  3K9T A;  2X0L A;  4IPA A;  4AD9 A;  1FT9 A;  3FXR A;  3IKV A;  1XSV A;  3ZMU A;  4G7H F;  3S2W A;  2EA2 A;  4XSX F;  1JHF A;  3TQN A;  2K86 A;  4B8X A;  5K5R A;  1IZ1 A;  2ZME A;  1Z1D A;  4EV0 A;  2LNB A;  3G3Z A;  2DAO A;  4OIR F;  4R79 A;  2F5D A;  2YR2 A;  3M1E A;  4YFX F;  5JI6 A;  4IRG A;  2OQG A;  1RNL A;  2RVC A;  3V4G A;  2KKO A;  5BS6 A;  1J75 A;  1SD5 A;  4NHJ A;  4LGW A;  1V3F A;  2VT2 A;  1KU2 A;  1FYK A;  1FOK A;  1KU3 A;  1R7J A;  3IWF A;  1MJB A;  1MGT A;  3KEQ A;  4AVP A;  2LF8 A;  3F23 A;  2KIU A;  2XKP A;  5BPI A;  3I5U A;  1G3S A;  3ZPL A;  2EWN A;  4BYY A;  4ASN A;  3FMS A;  4UHT A;  4G7O F;  4WWC A;  2LF7 A;  1YLF A;  3WTW C;  1WKM A;  2RQP A;  2ZJ2 A;  4U7D A;  3T0Y A;  5LGN A;  3R0J A;  1ZGA A;  4HF2 A;  4A12 A;  4P9U A;  5ICG A;  4JK1 X;  1P4X A;  3R4K A;  4I0B A;  1BIB A;  5HDG A;  3D0S A;  3RYP A;  4EJU A;  3JTH A;  3VOE A;  2RN7 A;  3E6M A;  4HZF A;  2QZ8 A;  4S04 A;  3LQQ A;  1BOA A;  3GZ5 A;  2HFH A;  5LRS A;  1XCB A;  1OPC A;  5A2Q K;  3GO5 A;  3B02 A;  3BJ6 A;  3EYI A;  2EFO A;  1RUN A;  2GWR A;  2K27 A;  3HRT A;  4I09 A;  1SD7 A;  4HV5 A;  2CG4 A;  1FP1 D;  1W7P B;  4HAM A;  2Y48 A;  2STT A;  4OMZ A;  3KP4 A;  2P4W A;  2M5W A;  2ISY A;  1O3R A;  2XHK A;  3K1M A;  1Z91 A;  1OMI A;  4M74 A;  1P92 A;  4UXN A;  3M9A A;  4L9T A;  4EQQ A;  3GFI A;  1Z6R A;  1XGO A;  2KIM A;  2PMU A;  5HLI A;  2QVO A;  1O3T A;  2G7U A;  3KP5 A;  4RGU A;  2V1X A;  1TQP A;  2RKH A;  2V1D A;  4HV6 A;  5HS9 A;  3DFG A;  2Z5U A;  1W7P D;  3Q9S A;  1RIO H;  2DQR A;  2FF4 A;  4FHT A;  4EJV A;  2EFN A;  4G7Z F;  3TOA A;  2CSO A;  2Q0O A;  5IT3 A;  3CUQ A;  3KP2 A;  3L2C A;  1R00 A;  5E18 F;  3MZY A;  2K7L A;  1PP8 F;  5DCM B;  3F8F A;  4RAZ A;  5F1R A;  3F22 A;  3QOP A;  4I7H A;  1CGP A;  3KEO A;  4I98 B;  1KQ8 A;  4LFU A;  3BP8 A;  3OV8 A;  2DPD A;  3H92 A;  5ICF A;  2H27 A;  2BYV E;  2VOO A;  2VBX A;  1YO5 C;  4CYD A;  4BXU A;  4D0P A;  4RGX A;  4EGY A;  2OZU A;  4ZZL A;  3M7G A;  2UWM A;  4KN7 X;  4LK1 F;  1T38 A;  3EYY A;  1CF7 B;  2QQB A;  1RZ4 A;  1HBX G;  1XMA A;  1QQI A;  5F64 A;  1DPR A;  2VON A;  2QM3 A;  4ZYD A;  3R60 A;  2R7D A;  2ETH A;  3GW2 A;  3O3K A;  3JW4 A;  5D4R A;  4IHS A;  2PMH A;  4MTD A;  2Z33 A;  4WXD A;  2A3S A;  3R6S A;  3EUH A;  4LB6 B;  2UXX A;  2NS0 A;  1P4W A;  5LHI A;  2BGC A;  3WGG A;  4KDP A;  4OIQ F;  3HSR A;  1FP2 A;  1H9T A;  3REO A;  3Q5F A;  1YFH A;  2H09 A;  3CJN A;  1K79 A;  2VBW A;  3WGI A;  2D45 A;  1BI2 A;  2GIV A;  1ZG3 A;  2XKO A;  1IXR C;  2RC4 A;  2ZNZ A;  1XDS A;  4WX9 A;  1YIO A;  1FSE A;  2FBI A;  4RB2 C;  1RI7 A;  2VC1 A;  3FX3 A;  3QPT A;  1MDM A;  1BI3 A;  2OA4 A;  2VT3 A;  4LJZ F;  1LB2 A;  4U0W A;  1S7O A;  3FM3 A;  3WGH A;  5FD5 A;  4XRF A;  3GUD A;  4L5I A;  1EH8 A;  3HYI A;  4LLL A;  4FT8 A;  2F5E A;  1B1B A;  3HSE A;  4NB5 A;  4GO1 A;  3TOB A;  2VBY A;  1R1U A;  1Z6T A;  3RPU A;  2YPR A;  2PQ8 A;  3TDU C;  5D8K B;  1R1T A;  2GZW A;  4Q47 A;  4CO8 A;  5A2Q Z;  1XGN A;  3B73 A;  4G94 A;  3EET A;  2ELH A;  1WSU A;  3BJO A;  3F21 A;  1U5T C;  3O2P E;  4G8X A;  2BBY A;  1ZN2 A;  1HQC A;  1UST A;  2R3S A;  3J7A O;  5JFR A;  4N0B A;  1OKR A;  1G3Y A;  1ZLK A;  2P6T A;  3N97 A;  2ZCW A;  3I71 A;  2XGX A;  2QBY B;  2IVM A;  1B6A A;  1LDJ A;  5FLX Z;  3V7R A;  5LHH A;  4UV8 A;  2EFP A;  4LLN A;  5ED4 A;  3IC7 A;  2MH2 A;  4HOB A;  1D5V A;  2L54 A;  3E97 A;  3PFI A;  3T1B A;  5BQT A;  3QRF F;  2IT0 A;  1ON1 A;  1ZG1 A;  4BHP A;  4MNU A;  1FWZ A;  2JTV A;  1R22 A;  4Q48 A;  4KFC A;  2QUF A;  1SMT A;  5TJJ A;  4RS8 A;  3K2Z A;  3H3Z A;  4JQF A;  2H6C A;  4B09 A;  1GXQ A;  2M1B A;  3MWM A;  2O3F A;  2VC0 A;  2RV8 A;  1T98 A;  1BJA A;  4LLG F;  3IL2 A;  3ELK A;  1QNT A;  2W85 A;  4I01 A;  2EFW A;  1K78 A;  1BI0 A;  3KFW X;  2VN2 A;  4Z2Y A;  2QQA A;  3ULQ B;  5L3B A;  2V9V A;  4M6Y A;  1ZRC A;  4R8H A;  4Y15 A;  1I27 A;  1ZLJ A;  5ICE A;  3T5X A;  3JTG A;  4YFK F;  5CVI A;  5D5U B;  3V8L A;  4EGZ A;  3TDZ C;  5BMZ A;  1C0W A;  3WTU C;  1FYL A;  3F8B A;  4IRH A;  2IRF G;  1ZAR A;  2F2E A;  2WV0 A;  1YW9 A;  3HHG A;  5J8C A;  3LAJ A;  3KET A;  1YS7 A;  4WK8 F;  2Z3Y A;  3FWE A;  2M45 A;  3QAH A;  5K1Y A;  1AWC A;  1H9G A;  4U88 A;  4S05 A;  2A61 A;  2A6H F;  4O3M A;  5AON A;  1ZGJ A;  3GEZ A;  1X3U A;  2MH9 A;  1ZRF A;  3PQK A;  4ENJ A;  5ILV A;  4HW0 A;  3RTR A;  1IXC A;  1YG2 A;  5LLQ A;  2RGV A;  3ECH A;  2XAH A;  2P5L C;  2ACJ A;  3NQO A;  1S6L A;  2V1U A;  2FEZ A;  3QPH A;  1U6G A;  2CQK A;  3M8F A;  4P96 A;  2DW4 A;  2F5F A;  4M9S A;  2GXB A;  3ZN0 A;  3AAF A;  2DK5 A;  2DTR A;  4UVC A;  3KLN A;  1JXS A;  3FZV A;  3F3X A;  2B0L A;  1L0O C;  4L0Y B;  2MBF A;  1TW2 A;  3RKX A;  1W4M A;  1YW7 A;  2BEO A;  1JHH A;  1PDN C;  1BI1 A;  2A68 F;  2PBI A;  2WTE A;  5HDK A;  3NEU A;  2X4H A;  3GYH X;  2HYF A;  1FBS A;  4IJA A;  4JBA A;  4GYG A;  4Q4Z F;  2XV4 S;  5E1W A;  3C3W A;  1L3L A;  5AIQ A;  2CGP A;  4HDV A;  3L9F A;  2DO7 A;  3TGN A;  1SFX A;  1OR7 A;  2KJC A;  3WTT C;  1SFU A;  5FGM A;  3HTU A;  2MLG A;  4M9X A;  3I64 A;  4Q5S F;  1SD6 A;  3BPV A;  1R1V A;  4OIN F;  5E20 A;  3MZH A;  5KK1 A;  4PGG A;  2FU4 A;  4KIG A;  1SFE A;  2YX4 A;  2R7F A;  3RYR A;  4IF4 A;  3QP5 A;  3KP6 A;  1D3Y A;  3SXY A;  2FBK A;  3LST A;  5L3C A;  5J8F A;  4UNO A;  1R5H A;  1XMK A;  2HWV A;  1MD0 A;  4OOI A;  4MEY F;  1F5T A;  2CO5 A;  2EA4 A;  4Y17 A;  1YYV A;  3F8C A;  2CYY A;  3ABU A;  1J9I A;  1BM9 A;  5LGU A;  3P9K A;  4UUV A;  3E5Q A;  3MCZ A;  1U5T B;  4NQW A;  4M72 A;  3WTX C;  4EM0 B;  3RPQ A;  1XN7 A;  5D5W B;  3ABT A;  4KIF A;  1QZZ A;  2DI3 A;  2HR3 A;  2P5K A;  1B9N A;  4LD5 A;  4CXF A;  3CLO A;  4DQ2 A;  4H0E A;  5J6X A;  1HW2 A;  4YII A;  1XGS A;  1KYZ A;  4A6E A;  4EVI A;  3FMR A;  2EB7 A;  2YSR A;  2LKP A;  2PJP A;  3U1D A;  3I59 B;  2HQR A;  2Z9O A;  2PG4 A;  2H6B A;  1R58 A;  4CGZ A;  4HX7 A;  5BPD A;  2DFI A;  2BV6 A;  4O5V A;  3CO6 C;  1J0R A;  1IAW A;  3W6J B;  3RIR A;  3LFK A;  5D6F A;  2ZNY A;  3KP3 A;  1S3J A;  1P2F A;  2UZK A;  5CLS A;  1UB9 A;  3TO6 A;  2O61 A;  4L5J A;  4AIH A;  5CVV A;  2JPB A;  3DEU A;  2E7W A;  5LEK A;  3ZMD A;  3LA2 A;  3ECO A;  5F6F A;  4KMF A;  2IA0 A;  3HHH A;  2XRO A;  1S29 A;  1FC3 A;  5DUI A;  3HOT A;  2M30 A;  2PLY A;  1FZP B;  4HF1 A;  1TQI A;  4BHC A;  1U78 A;  2ZFW A;  3GWZ A;  1GXP A;  1J59 A;  1IN4 A;  1G3W A;  3FMQ A;  4OIP F;  1EH6 A;  1FYM A;  1E17 A;  3KZZ A;  3MQ0 A;  2RNJ A;  4LK0 F;  4BHB A;  1OYI A;  3JAM K;  2JPC A;  1V4R A;  5K5O A;  1T0F A;  2GXG A;  4LG0 B;  3ZMV A;  2FMY A;  2CFX A;  5ILS A;  1QO0 D;  1LEA A;  5DEQ A;  3GFJ A;  3P9I A;  3E6B A;  1LQ1 A;  3JSP A;  3GVA A;  2OZ6 A;  1S7A A;  3T8R A;  4KA4 A;  1LNW A;  2IJL A;  2HOE A;  1UHM A;  4IHT A;  1Y0U A;  2EFQ A;  3FXU A;  4EJT A;  3HIF A;  1P6R A;  1ZH5 A;  4HYE A;  3CUQ C;  1MKM A;  1G3T A;  1H0M A;  1OYW A;  1TLH B;  4ENN A;  1KQ9 A;  2XRN A;  4BNC A;  3QP6 A;  2O6G E;  1HW5 A;  5ILU A;  2FOK A;  1LJ9 A;  2W24 A;  2H94 A;  1KQ0 A;  2QWW A;  4MQV A;  2EV0 A;  2O8X A;  3CUO A;  4PCQ A;  2IP2 A;  2FNA A;  1BN5 A;  2A5Y B;  2KIF A;  5CYV A;  2NYX A;  1TNT A;  1IN7 A;  2DT5 A;  2VE9 A;  2FNP A;  1RUO A;  3WTZ A;  5HLH A;  3U9G A;  1P4A A;  2HKX A;  2FRH A;  3WTV C;  5FO5 A;  2FML A;  4LMY A;  1YQA A;  3MAJ A;  5ERI A;  4A2U A;  4ZYE A;  4M6X A;  2M87 A;  4KIB A;  4MHG A;  1WQ2 A;  2ZME B;  2RDP A;  1HKQ A;  2V6C A;  4UV9 A;  3COA C;  1VTN C;  3IRR A;  1W7P A;  2VOD A;  2A6E F;  4IRI A;  3O6B B;  3HTS B;  5CVR A;  2CW0 F;  1J2X A;  5LGT A;  2GA2 A;  5BOX A;  4GGG A;  5JR3 A;  4AIJ A;  2E1C A;  2C6Y A;  4HBL A;  4IVN A;  2HZT A;  4TV7 A;  3ROU A;  3LWF A;  4HQM A;  3E5X A;  2FSW A;  4G9Y A;  4RGS A;  5EEH A;  1O7F A;  3EQL F;  4ENK A;  4ENM A;  2FXA A;  1DUX C;  4N9H A;  2ZBK A;  2XAG A;  4MGR A;  2P6S A;  1KA8 A;  4BQA A;  3C7J A;  3GX4 X;  1SAX A;  5L3E A;  4I02 A;  3C18 A;  1B9M A;  1AOY A;  2K4J A;  4MTE A;  2EV6 A;  5FFZ A;  2YX7 A;  4WXC A;  2VXZ A;  3ZQ7 A;  1JE8 A;  4OIO F;  5JHU A;  5DUK A;  5DCM A;  1T2K A;  2D2W A;  3R61 A;  3VB2 A;  1HKT A;  1R36 A;  3D5L A;  3SHF A;  2MLK A;  1QPM A;  3GF2 A;  4L9N A;  3L00 A;  1LVA A;  1ZG5 A;  1UHW A;  4WCG A;  1QGP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...