4YIFA

Crystal structure of rv0880
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
140
structure length
140
Chain Sequence
b'SDARLASDLSLAVMRLSRQLRFRNPSSPVSLSQLSALTTLANEGAMTPGALAIRERVRPPSMTRVIASLADMGFVDRAPHPIDGRQVLVSVSESGAELVKAARRARQEWLAERLATLNRSERDILRSAADLMLALVDESP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MarR family protein Rv0880
publication title Structure of the MarR family protein Rv0880 from Mycobacterium tuberculosis
doi rcsb
source organism Mycobacterium tuberculosis
molecule tags Dna binding protein
total genus 49
structure length 140
sequence length 140
chains with identical sequence B, C, D, E, F
ec nomenclature
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4yifA00
3EUHA 1R1VA 1KYZA 2JSCA 3GX4X 1YTYA 3T1BA 2IRFG 4OIOF 4M6YA 4KIBA 3R4KA 5HDKA 4OIQF 5E17F 2R3SA 1JHHA 1JE8A 3GW2A 3V8JA 3C18A 2E1CA 1U8RA 1MJ9A 1KU7A 3TO6A 5CLSA 3V8KA 2YX7A 2H94A 2LKPA 1ZLKA 2QENA 3C3WA 3L2CA 4IPAA 5DYMA 3F22A 4I7HA 4MQVA 2NS0A 1XSVA 2XUBA 1YFHA 4L9NA 3RI4A 3K1NA 2A61A 4KUMA 1S29A 4JBAA 3DXJF 1XMKA 1W5SA 2VBXA 4HV5A 4LLNA 2K7LA 4LLLA 1WWXA 4UVAA 1PP8F 2A6HF 3FMQA 2KRFA 3QOPA 2HS5A 1H9TA 1BJAA 2CFXA 3I71A 3RYRA 4XSXF 5HS9A 1BI0A 1FT9A 4A6EA 4EGZA 1BI3A 4G8XA 4A6DA 3HTSB 3GXOA 3FMSA 4BXUA 1TBXA 3RTRA 1DPRA 4R8HA 1I27A 3HOTA 1GHCA 2MH2A 2EB7A 1IZ1A 1W7PB 3CUQA 4LB6B 2CGPA 4RB1A 1F9NA 3TO9A 1TW3A 4HDUA 1VTNC 4DQ2A 4RGUA 1R58A 1KU9A 2KIMA 4WXDA 3BPXA 2GZWA 2DU9A 2PQ8A 3K1PA 2XROA 1HW5A 4WXHA 2VC1A 4U0WA 1J75A 2E7XA 1J5YA 2QBYA 3BDDA 1BN5A 2M30A 5HS8A 5HLHA 2Q8KA 1YQAA 1ZRDA 3QRFF 2WC2A 5A2QK 4CXFA 2Z3YA 1MJAA 4L5JA 5LGUA 2XAFA 5DUKA 2MA3A 1O3QA 2V1XA 2VXZA 4UUVA 2HQRA 2P7CB 2ZCWA 1QZYA 4L5IA 5L3EA 4YFNF 1OMIA 2O6GE 1KQ9A 1AWCA 3ECOA 1G6NA 3IWZA 2GWRA 3HRSA 3O2PE 3VOEA 3K69A 4LB5A 1OR7A 4Z2YA 2OBPA 3F8FA 4OINF 2RC4A 3E6DA 2EFPA 3I54A 4Q48A 1ZN2A 4KYWA 1LEAA 3T0YA 1J0RA 5DCMB 1J7KA 1OPCA 4CYDA 4MHGA 4YFXF 3N97A 5TRDA 2BEOA 1D8KA 5IT3A 2EV0A 4ENMA 5D5WB 4R1HA 2OA4A 1IAWA 1IN5A 2L4MA 4LLGF 3E6BA 2CWEA 1QQIA 2IVMA 3MEXA 2M8EA 4EJVA 4Y13A 5FGMA 4OMYA 3SQNA 4E70A 3RDIA 4KIGA 4Q4ZF 2ZMEB 3BROA 1Z91A 2IA2A 1ZRFA 1OYWA 1ZG3A 1EH8A 3BWGA 1TW2A 4RB3C 5FO5A 1R5GA 3CDHA 5F64A 2P8TA 3J81Z 3U9GA 2W84A 2B0LA 2HOEA 4RB0A 2OD5A 1L3LA 1K6OA 2OZUA 4I98B 2FOKA 4L0YB 3D0SA 2IT0A 3NRVA 3LQQA 4AVPA 3KLNA 2CG4A 3D5LA 1H9GA 3GVAA 2HEOA 1CF7B 3GYHX 3FXUA 2C6YA 5HDNA 4PDKA 4M9ZA 2FBIA 1MJBA 1TQPA 3WGIA 4KMFA 3LAJA 4ENKA 1LJ9A 2VBZA 1U5TC 3GFIA 1XGOA 2DQRA 3HTUA 1YLFA 4IRHA 3DF8A 2V79A 3CUOA 3TOBA 3ZQ7A 1GVJA 2DQLA 2AXLA 4L9TA 2A5YB 3NQOA 2E1NA 4MTDA 1GXPA 3KEOA 3JTHA 3K1MA 1ZARA 4ESFA 4EVIA 5DD8A 2ISZA 4MTEA 5H6RA 1E17A 4FT8A 2NRAC 2NAZA 3CO6C 3E97A 5H6QA 3KP2A 4GCVA 1YW9A 4P9FA 4HLYA 2BGCA 1PDNC 2UZKA 2Z99A 4HF2A 4IRIA 5J8FA 3MAJA 3VEPA 4WF2A 2DPDA 2D1VA 1BIBA 1LDJA 2PG4A 3ZMDA 2DK5A 4LMYA 3JTGA 2JZYA 3V7SA 3JSPA 5LBQA 2BYVE 3HRMA 3J7AO 1UHMA 1TNSA 1XGMA 5E1XA 1MDMB 3I0TA 1NHAA 1OYIA 1IXCA 1D8JA 3Q5FA 3OOPA 3HUGA 4B8XA 3P7NA 2FE3A 3FX3A 1E2XA 2VONA 1TNTA 4U88A 4HLXA 3O3KA 1ZYRF 2ZNZA 2CW0F 3FWEA 3TGNA 3KZYA 1FC3A 4N9HA 1BI2A 3RKYA 4WX9A 1T38A 2XAJA 4HV6A 3R0AA 5ICGA 3E6CC 1HSJA 2GAUA 3LSTA 2CSOA 2MH9A 1B1BA 5L3GA 2V6CA 3WTWC 4YIFA 2Z5UA 2K02A 1IN7A 1P92A 4XLPF 4IHTA 1HXDA 2CO5A 1LDDA 4IHSA 3WTUC 1YW7A 4M73A 2L02A 4ON0A 1STZA 2HZTA 1R00A 3DEUA 1IXRC 5JFRA 3FM3A 1V4RA 5FLXZ 2STWA 3ISPA 3KEQA 4GYIA 1O7LA 4BAYA 3V7RA 2DT5A 3ZMUA 5BS6A 4UV9A 3PFIA 5J8CA 1R7JA 3FHZA 4LG0A 4U7BA 2G7UA 4U0VA 4KICA 1PUEE 5LEJA 1T98A 1HSTA 1ZGAA 4Y15A 4EJOA 5ICFA 4ASNA 1WSUA 5IT9K 4LK0F 4HDVA 1BM9A 1S7OA 1K79A 3M1EA 2X4HA 3WTYC 1MD0A 1SD5A 2DK8A 1ODDA 4O5VA 3GEZA 2Q2EA 3QP5A 2A6EF 4HW0A 1IRFA 1LVAA 3KP6A 3WTTC 2CQKA 1YG2A 2YSRA 4HQEA 1FYKA 1I5ZA 5DDGA 1SMYF 2GXGA 2W24A 1SD4A 4I0BA 3V7CA 4WCGA 4ZYDA 5DCFA 2H6BA 2ACJA 1XSDA 1KQ8A 3F8NA 2G9WA 4KN4X 3ULQB 3G73A 1W4MA 3HRUA 2RKHA 4EGYA 3DP7A 1HW1A 4BHPA 3H92A 1LNWA 2FXAA 5CVJA 1P4XA 3QAHA 3MCZA 4P96A 4XLNF 2HYFA 1XCVA 2O0YA 1SFUA 3F72A 5D8KB 2JPCA 1RI7A 5ILVA 4RS8A 2HDCA 3C7JA 2OQGA 1U78A 1U5TB 1J2XA 3V8LA 1P4WA 3DQVC 1L0OC 2EFWA 1FYMA 3DPTA 3J81K 2FQ3A 3E5XA 2DLLA 4EJWA 1BOAA 1HW2A 3GWZA 2PEXA 4LG0B 1XB4A 1EH7A 3JSOA 3HYIA 2ZJ2A 5DUIA 1AOYA 2MD5A 1S8NA 3O6BB 2J5OA 5CYVA 3ZN0A 5H20A 1BBYA 5HOOA 2OU2A 4MEXF 2F5DA 3MZHA 3ABUA 2FBKA 5CVUA 4GGGA 4MNUA 2FMYA 2D1HA 4OIRF 4K2EA 4HF0A 3U2RA 1Z9CA 1O3TA 2XVCA 1IN8A 1CGPA 1XGNA 2XHKA 3HSRA 5K5QA 1ZAOA 3ZMVA 1KGSA 3S2WA 1FSHA 4HA8A 2HTSA 3WTXC 2Q0OA 3F3XA 2EA4A 1R23A 1ZRCA 1T6SA 3P9CA 3RYPA 3R0JA 1FY7A 3J80K 2W25A 4L18B 1U2WA 2PN6A 4HYEA 3F8CA 3GUDA 3LA3A 1FNNA 5LHIA 5BPIA 2YR2A 2NYXA 2VT2A 2JRTA 2VODA 4I2OA 4JK1X 1P4AA 4BHCA 4NQWA 1LQ1A 3FZVA 3DPLC 1USSA 5K5OA 2DO7A 2KIFA 5FFXA 4S04A 1B9NA 1ZG1A 4ZZDA 4LFUA 2XGXA 3WU0A 3JAMK 3CUQB 5BQTA 2ZKZA 1YS7A 4S05A 3BJAA 2RDPA 3BJ6A 2XASA 2V1DA 3IKTA 5L3BA 2XIGA 5JI6A 1OYYA 2STTA 3T8TA 1A04A 1EH6A 2RV8A 4RAYA 2FEZA 5BMZA 5AONA 5L3FA 3CO7C 3V4GA 5ICCA 2QBYB 2EA2A 1IW7F 2A68F 3T5XA 5KK1A 4I0AA 5BPDA 4A5NA 2HKXA 4R79A 1WI9A 3W6JB 4MQ9F 2M45A 3HHGA 2L54A 1IUYA 4M9XA 3EETA 4HOBA 3IWFA 1BI1A 2H27A 2TDXA 2QQAA 1TTYA 4CO8A 3I53A 4AWXB 4NB5A 4CZZA 2PJPA 4IXAA 1ULYA 3DKWA 3QU6A 1USTA 4YIIA 1DDNA 3TQNA 1W7PD 1P2FA 3C1DA 4EJTA 2CYYA 1QO0D 2V1UA 1FP2A 2KIUA 3GZ5A 4KIFA 3ZPLA 4WK8F 4G7ZF 1BIAA 3GLXA 5D6FA 2DAOA 5DV5A 4XRFA 3ZN1A 5E8GA 2IA1A 1F1ZA 3K9TA 1JHFA 4P9UA 4B09A 1D5VA 4A0ZA 1IN4A 4A12A 2A69F 3IRQA 4YG2F 2QUFA 4UV8A 4EJUA 3I64A 4M72A 1B4AA 1TQIA 1W5TA 5ERIA 2D45A 2IPQX 3COAC 1H0MA 2K86A 3WTSC 2QLZA 2LNBA 2NNYA 4RGXA 4GXOA 4OIPF 1JGSA 2K4JA 1XSXA 3KETA 4BNCA 5D4SA 3LA7A 1FPQA 2BE5F 3MQ0A 1REPC 1QGPA 2Y75A 3LA2A 4L9VA 1YS6A 3ML6A 1TQMA 3M9AA 2ISYA 3I59A 2D2WA 3R61A 1K78A 2HQNA 4KT5C 2DFIA 1O3SA 4UXNA 1JXSA 4LK1F 3ELKA 5F1RA 3EYIA 3F8MA 2Y48A 3RJPA 2ADUA 5D5UB 2YX4A 3FF5A 4JQFA 2ESNA 1UB9A 3HHHA 4A0YA 2EWNA 2JPBA 1B6AA 5LRSA 1R36A 4M9SA 3R6SA 3E6MA 3JW4A 4ZYGA 2KKOA 1DPUA 5JVTA 4ESBA 2HFHA 3RPUA 3BJOA 2XV4S 3E3VA 1QNTA 2M1BA 6PAXA 2PFBA 3QPHA 3F23A 5E1WA 3WTVC 2QYOA 5D4RA 1Z6TA 3IRRA 2FF4A 3FXRA 1ON1A 1R1TA 4HX7A 1G3WA 1FZPB 3F6OA 2E7WA 2QWWA 4HF1A 2P6TA 2WTEA 3M7GA 2R7FA 1ON2A 1FBSA 4FX4A 2GA1A 1HKQA 1YYVA 4G6DA 3LFKA 5L3DA 3CUQC 3BOQA 2QZ8A 1G3YA 2K27A 2HR3A 1O57A 4OU0A 2HWVA 2OZ6A 4KA4A 2UWMA 1BC8C 4QWQA 4KFCA 3ZMZA 3KE2A 3B02A 4HZFA 1SD7A 5K5RA 4KDPA 2EK5A 2MLGA 5J6XA 1XN7A 3I5UA 5EEGA 4ETSA 5FFZA 5HDGA 3E5UA 4O3MA 5HS7A 1RIOH 3TOAA 1J9IA 2XKPA 2MC3A 2LDUA 2RVCA 4RAZA 1DP7P 5EEHA 3L9FA 5HLGA 1W7PA 2P5KA 1SFEA 3WE3A 1FOKA 3SHFA 2W57A 2EV5A 1UHWA 1FP1D 1KQ0A 2VN2A 2ZFWA 4HBLA 3NEUA 2IW5A 2P4WA 2FRHA 5ICEA 2FNPA 3GO5A 4U7DA 4Q47A 3IC7A 2Z9OA 1XCBA 2JT1A 3KP4A 2KJBA 2XAQA 4ZYHA 2FU4A 4PGGA 4MGRA 3PQJA 2QQ9A 1O7FA 4EM2A 1MZBA 1RUNA 4KN7X 4GO1A 4G7HF 2PLYA 1S3JA 5L3CA 3REOA 4PGHA 2HYGD 5E20A 1IRGA 1UFMA 3BPVA 5AIQA 1XGSA 2L3DA 2P5VA 2MLKA 3WG9A 1I1GA 3I58A 4ENJA 1WKMA 1IXSB 1RZ4A 5LGNA 4LGWA 1R22A 2FNAA 5CJ9A 3CTAA 3HIFA 3VODA 5E8IA 4BH9A 3B73A 3L09A 2JTVA 4ZYEA 3SZTA 4M74A 2P5LC 2FSWA 3OV8A 1P6RA 2F5FA 2ESHA 4KNYA 5E18F 3EQLF 2L4AA 4BQAA 4G94A 2LF8A 1XDSA 2MBFA 3P9IA 2LSOA 4FHTA 5DCMA 3CLOA 1XDUA 4WXCA 3KFWX 2V9VA 1F4KA 2Z33A 1QZZA 3U1DA 2VBWA 1YO5C 2XKOA 4G9YA 2ZO4A 2IA0A 1KA8A 4MEYF 3KLOA 3WGGA 3HSFA 4IJAA 4NHJA 2YU3A 4N0BA 4A2UA 2OQRA 4U0YA 3KCCA 2HKOA 2ZMEA 3WODF 1I6XA 1X3UA 2H09A 3WGHA 3TDUC 3GZ6A 4P5OA 1FX7A 2RN7A 4O6JA 4FX0A 2EFOA 3HSEA 1UCRA 2VT3A 5LGTA 1U6GA 3ZMSA 3M8FA 3QP6A 2HTJA 5E1ZB 1HQCA 3EDPA 3ZP5A 2VOOA 3F21A 1XMAA 2WV0A 2KJCA 2OAZA 5IT9Z 3TDZC 4PCQA 3T8RA 5TJJA 1EV7A 3KP5A 3PQKA 1HKSA 4UVBA 4UVCA 4AD9A 1I1SA 4CHUA 2NNNA 1T0FA 2A07F 4QLCU 1O3RA 2O3FA 5HLIA 4KMUX 1B59A 3Q9SA 1CF7A 2DI3A 3GF2A 1D3YA 4HAMA 3KZZA 4EM0B 3GFMA 5BOXA 5D6EA 3F6VA 5DD4A 2W85A 1FWZA 2LF7A 2P7VB 3TKYA 4GYGA 1XD7A 5CVRA 1OKRA 3L00A 2QQBA 1YW8A 1FLIA 1WRJA 2ZBKA 4A0XA 3R60A 4AIKA 1BC7C 1ZLJA 4EV0A 3FXQA 5LRRA 3DFGA 2XRNA 3RKXA 1Z7UA 3N4MA 4ENNA 2PMHA 4BYYA 3K0LA 1PP7U 3E5QA 5D5XB 1DUXC 3KP7A 1SD6A 3IHUA 1T39A 2R7DA 3H3ZA 3SZPA 2QVOA 3ABTA 4EMSA 1FBUA 2J5PA 2QM3A 2XAGA 3RKWA 5D8LB 2O8XA 3Q9VA 3WE2A 3VB2A 4IVNA 1HKTA 1TLHB 3SFZA 3IL2A 2F5CA 1R1UA 1SMTA 1HBXG 2XAHA 2BBYA 2ETHA 3MFKA 1S6LA 5FD6A 1RUOA 2EFQA 2EV6A 4RGSA 3ROUA 3QU3A 5LEKA 4ESJA 1IN6A 1QBJA 4RGRA 1C0WA 2VOPA 1YIOA 4G7OF 2COMA 1R5HA 3MWMA 4ZZLA 3ERED 5JR3A 2GXBA 2K4BA 4PZJA 1SFXA 1MDMA 3LAPA 1ZHFA 3MZYA 1RNLA 5FLXK 2O61A 5A2QZ 1ZGJA 1Z6RA 1Z05A 4XSZF 3K2ZA 4AIHA 2G7HA 4Q5SF 3BP8A 1ZG5A 3SXYA 2DBBA 1KU3A 4CICA 3GFJA 2F5EA 2VC0A 2EFNA 2RGVA 1B9MA 3RIRA 5ILUA 3W6KB 4L0ZB 4CGZA 5K1YA 1G3TA 1G3SA 5D5VB 1QPMA 3AAFA 3LQRA 3I4PA 4LJZF 3J80Z 5CVVA 2VE9A 1WQ2A 2L01A 4RB2C 1S7AA 5ILSA 4EM1A 3L7WA 2HGCA 3P9KA 2PBIA 1F5TA 5HVQC 1U3EM 4ZH4F 2M5WA 5FD5A 4AIJA 2BV6A 2ZXJA 1ZH5A 3WTZA 4YFKF 2O03A 4HQMA 1KU2A 3JAMZ 3ZMTA 4OMZA 4L9JA 3QPTA 1FBQA 2Y0MA 4M71A 5ED4A 4A5MA 2UXNA 4IRGA 3HOSA 2ZNYA 1LEBA 5DEQA 2FMLA 2M87A 1FSEA 1V3FA 2X0LA 3HRTA 2VBYA 4BHBA 4I09A 1KYWA 3GFLA 1Y0UA 2RQPA 4TV7A 1MKMA 2VE8A 2FBHA 4G6QA 4P55A 5F6FA 3TO7A 4I02A 4F7ZA 2PI0A 3IKVA 3BY6A 1G4DA 3CJNA 3LWFA 2IJLA 5LHGA 4UHTA 3KP3A 2GA2A 1Q1HA 5AIPA 1LB2A 3FMRA 2GIVA 2EJRA 2GQQA 2F2EA 4DNCA 1LDKB 1T2KA 4IF4A 4D0PA 3G3ZA 2RNJA 2A3SA 2UXXA 3EYYA 4HX8A 1MGTA 4HX4A 1GXQA 1ZREA 1Z1DA 4LD5A 2DW4A 3DV8A 5CVIA 2P6SA 4XBFA 5LHHA 4CDGA 1FYLA 3I59B 1SAXA 2PMUA 3WU1B 1K78B 1ONVA 2H6CA 2WWYA 1U5TA 4H0EA 2YPRA 2AS5F 2FA5A 1IF1A 2IP2A 3BZ6A 1K7AA 3F8BA 5FB2A 2DPUA 2ELHA 4OOIA 2DTRA 3RPQA 4Y17A 5LLQA 1J59A 4I01A 4N9IA 4WWCA 5KVRA 4M6XA 3M8EA 3H3UA 3FM5A 4EQQA 3ECHA 3VFZA 5JHUA 4UNOA
chains in the Genus database with same CATH superfamily
2E2HJ 3EUHA 1R1VA 2VQLA 1KYZA 2JSCA 4PSWA 3GX4X 1JUPA 1YTYA 3T1BA 2GOMA 2IRFG 1AKHA 4OIOF 5HLTA 4AUXA 4M6YA 4DZJA 2WB1A 3VSKA 3S2DJ 1MIJA 4KIBA 3R4KA 5HDKA 3A01A 4OIQF 2OPTA 5E17F 3L1PA 2R3SA 1JHHA 1JE8A 2M9HA 3GW2A 3V8JA 3C18A 2E1CA 1RR8C 1U8RA 4JYKA 1MJ9A 1KU7A 3TO6A 4XICA 3PO2J 3FBNB 5CLSA 1YHQI 1GVDA 3IP4B 3V8KA 2HOSA 2LBFB 1T0FC 2YX7A 3CESA 2H94A 3VPRA 2LKPA 3OYLA 2QKMB 4FISA 1I3AA 1WJ5A 2BXZA 4BEHB 4DBRA 4H4KC 1NK3P 1ZLKA 2QENA 3I55I 4CCNA 3C3WA 5KCMA 2Y2ZA 3L2CA 4IPAA 5DYMA 3F22A 4I7HA 4MQVA 1XMXA 1XSVA 2NS0A 2XUBA 1YFHA 4L9NA 3RI4A 2JWTA 3K1NA 3OSFA 2GLOA 3HDDA 2EIJH 2A61A 4KUMA 4YELA 3DEWA 3H9QA 4LG3A 4M3GA 1S29A 1PYVA 4JBAA 4Y3OA 1DGRM 2RAEA 4D5FA 3DXJF 2N8GA 2VJ5A 4ZDLA 3ZQLA 1XMKA 1W5SA 3K4MA 2VBXA 4HV5A 4LLNA 2K7LA 4LLLA 4HNTA 3HKZN 3W2VA 2DA3A 1WWXA 4UVAA 3HBLA 1PP8F 2A6HF 2OC6A 3FMQA 2KRFA 3QOPA 2V1NA 2HS5A 2LD5A 1BJAA 2CFXA 2DT6A 2VKHA 3VYRB 1H9TA 1UAAA 3I71A 2DA2A 3RYRA 4BKXA 4XSXF 5HS9A 1BI0A 4Y4RA 1XS9A 2ME0A 2VQCA 4M6VA 1UG0A 4I6ZA 2ECBA 1FT9A 4A6EA 4EGZA 1VQ9I 1BI3A 4G8XA 2NVYJ 4IO9F 4A6DA 1VF9A 3HTSB 3GXOA 3FMSA 4BXUA 1G59A 1TBXA 5JHFA 2O5RA 3RTRA 1DPRA 1X19A 1UHSA 4R8HA 1I27A 3ZOBA 3HOTA 1GHCA 2MH2A 2F4MB 3QODA 2EB7A 1IZ1A 1W7PB 1X4PA 3CUQA 3QYEA 2DFFA 4RLFA 4LB6B 2CGPA 4RB1A 1F9NA 2FX0A 3TO9A 1E3PA 2EZKA 1WJEA 1TW3A 3DBHB 4HDUA 1VTNC 4DQ2A 5GP9A 4RGUA 1R58A 1KU9A 2KIMA 4WXDA 3BPXA 1YIJI 2FUG2 2V6EA 2R7UA 2GZWA 2ELJA 2DU9A 2PQ8A 3BTLA 3K1PA 2XROA 3ERMA 1HW5A 3RQIA 2YUSA 3C2BA 2MG4A 2HNHA 2VC1A 4WXHA 3TMOA 1XG1A 4U0WA 1J75A 4E4HA 2KFDA 2IAIA 2BY2A 2E7XA 1J5YA 3GTMJ 2QBYA 2WAQA 2EINH 1XC5A 4DZPA 1FTZA 3A01B 3BDDA 1BN5A 2M30A 5HS8A 1SFOJ 5HLHA 2Q8KA 1YQAA 1ZRDA 3AL0C 2DTZA 2OCEA 4M3FA 3QRFF 4FQGA 1ZGWA 2WC2A 1ETQA 3W2WA 5A2QK 5JLXA 3WG7H 3SFIA 2ZXIA 4CUGA 4CXFA 3JRIA 2Z3YA 5B5EC 1MJAA 2M0CA 2IGKA 3HC7A 3MMYB 3RZOJ 4L5JA 2ZSHB 4KJZA 2LVSA 2DMQA 5LGUA 2XAFA 5DUKA 2MA3A 3PNVA 2E2JJ 1O3QA 2DA1A 4LITA 3LSKA 5EJCA 1D1BA 2CQ7A 1OCZH 2V1XA 5IP7J 3GZNB 5EGOA 2VXZA 4UUVA 4B43A 2HQRA 2P7CB 4A3BJ 2WADA 2ZCWA 2IBDA 3TW7A 2V4JC 1QZYA 4L5IA 5L3EA 4YFNF 1OMIA 5CKTA 2W1OA 2O6GE 3I56I 1KQ9A 1IV6A 3A0BC 3D5RC 4CCKA 2ZC2A 1AWCA 3ECOA 1G6NA 3IWZA 2XB5A 1TP4A 2GWRA 2KDOA 3HRSA 3O2PE 5M5XJ 1H89C 3VOEA 3K69A 2B7EA 4LB5A 1OR7A 4Z2YA 2OBPA 3F8FA 3P5JA 4OINF 2RC4A 2VUMJ 3ONQA 4XONA 3E6DA 3HG9A 2EFPA 4PJNA 3BR6A 3I54A 4Q48A 1FJLA 1ZN2A 4KYWA 3HOXJ 4HRIA 2M8GX 4BDYA 1LEAA 1FIAA 4PSXA 3H3VK 3T0YA 1VQKI 1J0RA 2X6WA 3QYFA 3G4SI 2CH0A 4S0HB 5DCMB 1J7KA 1OPCA 1IRXA 4CYDA 4MHGA 1A35A 4YFXF 3N97A 2LOOA 2BEOA 5TRDA 3UKGA 5FLVA 1D8KA 2K9SA 1X1PA 5IT3A 2EV0A 2DFHA 1UJ8A 5FKKA 1IC8A 4ENMA 5D5WB 1GV2A 2NOJB 4R1HA 2R93J 2IGMA 3JREA 2OA4A 1IAWA 1IN5A 4E7ZA 2L4MA 4LLGF 2ZB9A 3FIWA 3E6BA 4CCMA 2CWEA 2W82A 1WGXA 2ELKA 1QQIA 2IVMA 3MEXA 2EIMH 2M8EA 2X1CA 1MNEA 4NNJA 1BOBA 4UUSB 1D0ZA 3ZQQA 2L9NA 3VYTB 4EJVA 2HQ5A 3SZGA 4Y13A 3RQ4A 2LY2A 5FGMA 3JRBA 4OMYA 2DA4A 3SQNA 4E70A 3RDIA 4KIGA 5E3LA 1ETVA 3BR3A 4BACA 4Q4ZF 2VXDA 4CYCB 2ZMEB 3BROA 1Z91A 3J7YJ 2IA2A 1ZRFA 1OYWA 2JUCA 1ETOA 1TT0A 1ZG3A 1EH8A 3BWGA 2AO9A 2KMUA 3VWBA 1TW2A 3G1LA 3BR2A 4RB3C 5FO5A 1R5GA 3CDHA 1AA7A 5F64A 2P8TA 3J81Z 3U9GA 2W84A 2B0LA 3BTJA 2F5VA 2HOEA 4RB0A 2KIQA 1Z67A 2OD5A 1ENHA 1UG2A 4KT6A 4BL0B 1L3LA 1VZ0A 1VQ6I 3BG5A 1K6OA 2OZUA 4XLHA 4I98B 2FOKA 3X2QH 3KYLA 4BUPA 4DYQA 4L0YB 3D0SA 2IT0A 2DA5A 3NRVA 4HPQA 2VB6A 3LQQA 4D7MA 4AVPA 3KLNA 2ZSIB 2CG4A 2XGDA 3A2KA 3D5LA 3KYDB 1H9GA 3GVAA 2HEOA 3SDBA 3PNYA 1CF7B 4A69C 2VIXA 3GYHX 2XPVA 1BR1A 5DS9A 1YJNI 3FXUA 2BW3A 2C6YA 2VJIA 5HDNA 1U9OA 4PDKA 4M9ZA 1ZELA 2FBIA 3JRFA 1MJBA 1TQPA 3WGIA 3CJRB 4KMFA 2CV0A 3LAJA 2AXTC 2RNGA 3QWLA 1K4TA 3J7ZI 4ENKA 1ZK8A 1LJ9A 3K4JA 1X3ZB 3GTQJ 2VBZA 4E7JA 2TCTA 4PJ0C 1U5TC 3GFIA 1HLVA 1ITYA 1XGOA 2DQRA 2I5UA 5F04A 2K40A 3M3YJ 1D0YA 1PJRA 3S1QJ 3HTUA 3TBIA 2NVQJ 1YLFA 4IRHA 1MMAA 3DF8A 2V79A 3CUOA 3G1MA 3TOBA 3ZQ7A 4XLAA 1GVJA 3EPZA 2FQ4A 4CH7A 2DQLA 2AXLA 1IO2A 4L9TA 4C2TA 2BXYA 2K9QA 2A5YB 3NQOA 2E1NA 4MTDA 1GXPA 2UV1A 1X1BA 2E36A 1R4MB 2M2EA 1Y6IA 3KEOA 1T8IA 5IYDJ 3JTHA 1G2HA 2CFOA 3ABLH 2LRDA 1TWAJ 3K1MA 1ZARA 4ESFA 3EUAA 1VQ8I 3HOVJ 4EVIA 3S1NJ 3EUHC 5DD8A 2ISZA 4DYCA 3DLAA 3CC4I 1TC3C 3RCOA 4MTEA 4P1WA 3E1SA 5H6RA 4M3EA 1MMNA 1E17A 4FE4A 1XPXA 4FT8A 2R5YA 2NRAC 1ETKA 4XLCA 3DWLE 2NAZA 3KX2A 3CO6C 2R5ZA 1R9TJ 3H1CA 2JA7J 3E97A 4NUBA 5H6QA 3KP2A 4GCVA 1YW9A 4HSTA 4P9FA 3JRDA 1TWHJ 1MNDA 1Y8QB 4HLYA 3RZDJ 1LE8A 2BGCA 1SVLA 3QPLA 2HU9A 2H8WA 4E7HA 1WI3A 3CCLI 3BQZA 1Y1WJ 1PDNC 2UZKA 2Z99A 4HF2A 3W2AA 4IRIA 5J8FA 3CMAI 3MAJA 5GAHJ 3VEPA 2DFEA 1PVEA 4WF2A 2DPDA 2D1VA 1BIBA 1MMDA 1R5ID 2LKSA 1LDJA 1K6YA 2PG4A 3BZKA 3ZMDA 2DK5A 3V42A 2L2OA 4LMYA 3JTGA 2JZYA 3V7SA 3JSPA 1T95A 2WV1A 4BJ6C 5LBQA 1UMQA 2Y0SN 1DU0A 2BYVE 2V9KA 2DN0A 3ZR8X 4F3QA 4J19A 5E79C 5TISC 4HNUA 3K70C 3HRMA 3J7AO 1UHMA 3CC7I 1TNSA 1XGMA 5E1XA 3TP0A 5E3OA 1MDMB 3I0TA 1NHAA 1OYIA 4UUTA 2CRGA 1IXCA 5EYRA 1WH5A 1FIPA 1TL8A 1D8JA 3Q5FA 2PJRA 2BZTA 2KZVA 1IDZA 3OOPA 3HUGA 4QPOA 3P7NA 4B8XA 2FE3A 2VJJA 1JTYA 2NS8A 3FX3A 1E2XA 2VONA 1TNTA 3HKZA 4U88A 4HLXA 3TEDA 3O3KA 3GCMA 1ZYRF 2Z2SB 2GIZA 2ZNZA 2CW0F 3FWEA 3TGNA 1VNDA 3KZYA 4V19K 5F1JA 1FC3A 4N9HA 1BI2A 3RKYA 5IOZA 2E1MB 3PIOF 3OIQA 4WX9A 1T38A 2XAJA 4DYRA 4HV6A 3R0AA 5ICGA 1SVOA 1V5GA 3E6CC 1HSJA 2GAUA 3LSTA 2CSOA 3JCUC 3CCSI 3HXLA 2MH9A 1B1BA 1NH3A 1HCRA 1HOMA 5L3GA 2EZIA 1X1AA 2EILH 1IRZA 3K4CA 2V6CA 4KISA 3WTWC 5IYBJ 2HPMA 4YIFA 2Z5UA 1YJ9I 1DP3A 1IDYA 2K02A 4XM3A 4IX7A 1IN7A 1P92A 3IH2A 4XLPF 1JKOC 3K4KA 1HXDA 4IHTA 3FDYA 5EF6A 3AFHA 3BG7A 2CO5A 1LDDA 2R7RA 4IHSA 3DTIA 1YW7A 2L9VA 3WTUC 2X6YA 4M73A 2L02A 4ON0A 2R0QC 3I4MJ 2M4KA 1STZA 9ANTA 3QOEA 1BJZA 2HZTA 2P0WA 1R00A 3DEUA 4II3A 1IXRC 5JFRA 3FM3A 1ETXA 2AQEA 1V4RA 2E1OA 2ZMEC 5FLXZ 2STWA 3ISPA 3KEQA 2R5ZB 2VPLA 2LYCA 4GYIA 2E5NA 2XSDC 4UB8C 1O7LA 4BAYA 4XQFA 1SVMA 2DT5A 3BLYA 3V7RA 3ZMUA 5BS6A 4V2GA 4UV9A 3PFIA 1TWGJ 2K5CA 5J8CA 1R7JA 5M3MJ 3FHZA 5TGTA 4LG0A 4U7BA 2G7UA 4U0VA 4KICA 4XKBA 1PUEE 5LEJA 2Y30A 1T98A 1HSTA 1MSFC 1ZGAA 3BR1A 4Y15A 1BR2A 4EJOA 5ICFA 4B48A 3WHBA 4ASNA 1K61A 1LFUP 1WJCA 4M3DA 1WSUA 5IT9K 2FJ1A 4LK0F 4HDVA 1BM9A 4A3LJ 1S7OA 3F9KA 1K79A 3BG9A 4FTHA 1YJWI 5C4XJ 3M1EA 2X4HA 1RC9A 3DPUA 3EUKL 4EEFG 3WTYC 1MD0A 1SD5A 2DK8A 3GTPJ 1ODDA 4O5VA 3GEZA 2Q2EA 2DCEA 2A6EF 3QP5A 4HW0A 5K7HA 3GTGJ 1IRFA 4ZTFA 1LVAA 3KP6A 5EZGA 3WTTC 3BQYA 2CQKA 1YG2A 3IAS2 4M3BA 5EDNA 2YSRA 4HQEA 1FYKA 1I5ZA 5DDGA 1UZCA 2VKEA 1X1CA 3KIOA 1SMYF 3AG2H 1WHUA 2BY3A 5J3LA 2GXGA 2W24A 5F0CA 1OR7C 4Y52J 2LREA 2M3AA 3CDLA 1SD4A 4D1QA 4I0BA 3V7CA 4WCGA 4ZYDA 5DCFA 5J1UA 2H6BA 2ACJA 3U1KA 1NK2P 1GLNA 1XSDA 1KQ8A 3F8NA 5CQEA 2G9WA 1CQTA 4KN4X 3ULQB 2L7FP 2V9PA 2JVHA 2KZGA 1VFCA 3HOYJ 3G73A 2VPRA 1W4MA 1P7IA 3HRUA 2RKHA 3G6EI 3K4NA 4C3JJ 4EGYA 3DP7A 2CW7A 1HW1A 4BHPA 3H92A 1LNWA 1S7EA 1LKXA 3DBLB 3PM1A 2FXAA 2K3PA 4RLQA 1P4XA 3QAHA 5CVJA 4GDFA 3MCZA 4P96A 5FRNA 3JRCA 4XLNF 2R7QA 3CP8A 5EG0A 1E0EA 2HYFA 4PUSA 1XCVA 2O0YA 1SFUA 1EF4A 3F72A 5D8KB 3FISA 2JPCA 3GMEA 4HEA2 5EEAA 4A3FJ 1OJLA 1RI7A 3BTIA 4C3IJ 5ILVA 2E35A 4RS8A 2WAEA 3C7JA 2HDCA 2XSJC 1HA8A 3PFYA 2OQGA 4L5EA 1U78A 1U5TB 1X2MA 2VKDA 3CF5F 1J2XA 1JJ8C 3PJRA 5GAGJ 3V8LA 2E19A 1P4WA 1VQ7I 3NWTA 1YITI 3DQVC 3W3CA 1RETA 2O7OA 3I9V2 1L0OC 1X4OA 2EFWA 1FYMA 3DPTA 3J81K 2KQRA 4C9YA 1I39A 4AM3A 2FQ3A 3CCJI 3E5XA 2DLLA 4EJWA 5E3NA 2LP0A 3S3OA 1YOVB 2VL8A 1BOAA 5FKOA 1YRNA 2D5VA 2XGEA 1HW2A 4A3DJ 3G1OA 3GWZA 2PEXA 1ORKA 4LG0B 1G8XA 2ME6A 2DDBA 1XB4A 2KT0A 2WBMA 1EH7A 3OYEA 3JSOA 3HYIA 2ZJ2A 5H2FC 5DUIA 1VQPI 3AKZA 1AOYA 2MD5A 2DOEA 5GAEJ 3M4OJ 1S8NA 3O6BB 1IUFA 2J5OA 2LH9A 5BNGA 5CYVA 1APLC 3CZ6A 3ZN0A 5H20A 1AKHB 3H9GA 1BBYA 5HOOA 2OU2A 4B47A 4MEXF 2F5DA 3MZHA 2DDAA 2FBKA 3ABUA 5CVUA 4GGGA 4MNUA 2FMYA 5F0HA 2D1HA 4OIRF 2F4IA 4RAGA 2QSGX 3OYFA 4E6KG 2JA8J 2OTJI 4K2EA 4HF0A 5CPRB 2TRTA 2A6TA 4N4OB 3U2RA 1Z9CA 3VYUB 3A03A 1B72A 1QPIA 1O3TA 2XVCA 4C2MJ 2GM4A 4A3KJ 2CUFA 1DGWY 1IN8A 1CGPA 2EPFA 1XGNA 4PJJA 3IV5A 2XHKA 3HSRA 5K5QA 1ZAOA 3ZMVA 4C3HJ 3Q0UA 1KGSA 2KISA 3S2WA 1FSHA 4HA8A 3L2RA 2HTSA 3WTXC 2Q0OA 3F3XA 3K7AJ 2EA4A 4RMNA 1R23A 2K9NA 2JUGA 1ZRCA 4BGDA 4DW6A 2DA7A 1T6SA 4NC6A 2HVQA 3CF2A 3P9CA 2E1MC 3RYPA 3R0JA 2WB1N 1I50J 2MABA 1FY7A 3J80K 2W25A 2W7NA 4L18B 1U2WA 3HB9A 2PN6A 2XGCA 1U8BA 4N4NB 1YI2I 4HYEA 2A05A 3F8CA 3GUDA 3LA3A 1FNNA 3SYTA 1X2NA 2IGOA 5LHIA 2X1EA 5BPIA 1QHHD 2YR2A 2NYXA 2VT2A 2JRTA 5M5YJ 3OWTA 1NTCA 2VODA 4GFBA 4I2OA 2P81A 4JK1X 1FOYA 1P4AA 4BHCA 4NQWA 4AU7A 1LQ1A 3FZVA 4FCYA 3DPLC 1U0JA 3WHCA 1USSA 5DTDA 5K5OA 3LMMA 2DO7A 1T56A 2KIFA 5FFXA 5B1BH 2EZHA 4S04A 3RPUD 1B9NA 1ZG1A 5FRMA 3PSIA 2OTLI 2HXIA 2JVGA 1D1AA 4ZZDA 4LFUA 2M0MA 1JJ6C 3B6AA 1W0TA 3VSLA 2XGXA 1OLTA 3WU0A 3JAMK 1MH3A 3S16J 2E5ZA 2Y31A 3CUQB 5BQTA 2ZKZA 5J47A 1YS7A 3GLLA 4S05A 4E7LA 1J09A 3BJAA 3BG6A 2RDPA 3BJ6A 3NWSA 2RREA 2XASA 2V1DA 3M1CA 3IKTA 5L3BA 2XIGA 5C4JJ 5JI6A 3BC8A 1OYYA 2STTA 3T8TA 1MBFA 1X1DA 3CLQA 4ZTJA 1SC7A 1T33A 1A04A 1EH6A 2RV8A 2CUJA 4RAYA 2Y69H 2FEZA 1A36A 5BMZA 3BTCA 2EBIA 5AONA 5L3FA 3CO7C 3V4GA 5ICCA 2QBYB 4YRVA 2EA2A 1JUSA 4XOPA 3QYBA 4QSHA 3GTJJ 2X9DA 1IW7F 2A68F 3T5XA 5KK1A 2M34A 3BT9A 4I0AA 5BPDA 4A5NA 2B9SA 2HKXA 4R79A 2Y0SA 1WI9A 3NARA 3W6JB 1W36C 2M45A 3C2HA 4MLOA 1B72B 1K4SA 2H1KA 2DOFA 1LPQA 3H5AA 4QTRA 1ZQ3P 3HHGA 2L54A 4AVZA 5FROA 2XC7A 1IUYA 3K6GA 5LFAA 1MSEC 3L2UA 4A3IJ 1WJBA 4M9XA 3EETA 5J4VA 3OMYA 4HOBA 3IWFA 1BI1A 4CZCA 3A1YA 3O8HA 3SJMA 2H27A 2CUEA 3DLLF 2TDXA 2QQAA 3HOWJ 3JRGA 1TTYA 5GPAA 3DEEA 4I99C 4RM2A 4CO8A 4IZZA 3I53A 4AWXB 3OIPA 2V7FA 4NB5A 4OAZA 5EGOB 4CZZA 4LIVA 1WVRA 1LFPA 2PJPA 4IXAA 2L5QA 1OCCH 1ULYA 2DA6A 4HNVA 3LFUA 3DKWA 3QU6A 2JRMA 2DJNA 3H5NA 1USTA 1EA3A 4YIIA 2COBA 4DOZA 4LOCA 2WAQN 1DDNA 3OYCA 3TQNA 1XTAA 3HPGA 1BW5A 1W7PD 1P2FA 3C1DA 3PIPF 4EJTA 2CYYA 1SAUA 1QO0D 3M07A 2V1UA 1FP2A 2KIUA 2F48A 3GZ5A 2VQHA 3JR9A 4KIFA 4A3JJ 4ABZA 3FKIJ 5HODA 2LC2A 3S93A 2MYSA 3ZPLA 4WK8F 4G7ZF 2ZXHA 1JTXA 1VQLI 3CP2A 1BIAA 3ZGKA 1JKQC 3GLXA 3BCAA 1WCMJ 5D6FA 2DAOA 2LG4A 2K85A 5DV5A 4XRFA 3FK6A 3MKWB 3ZN1A 1O4XA 1EJ9A 5E8GA 3Q0VA 4DJAA 2IA1A 3FXKA 1F1ZA 3K9TA 5IY5H 1JHFA 3ZQHA 3FXOA 1RESA 4P9UA 4B09A 2XRLA 1D5VA 4A0ZA 1IN4A 4A12A 2A69F 2QQ8A 3IRQA 2HI3A 2B63J 1S72I 4YG2F 3PNTA 4DIQA 2QUFA 4IKFA 4UV8A 4EJUA 3I64A 4M72A 3S8PA 1B4AA 1EKEA 4NBQA 1D0XA 1TQIA 1W5TA 3HGYA 3ZQIA 5ERIA 5K7ZA 2D45A 2IPQX 2EZLA 5B66C 3COAC 1H0MA 2K86A 3WTSC 2QLZA 1B8IA 2IS2A 2YU9J 3MZ8A 1E3HA 2LNBA 2NNYA 2ID6A 3BCBA 2UUZA 4RGXA 4GXOA 4OIPF 2BOLA 1JGSA 2K4JA 1XSXA 2AHQA 3KETA 5KHDA 2OUMA 2QF7A 2KL4A 4BNCA 2Z16A 5D4SA 4JOMA 2EH3A 3LA7A 1FPQA 1OCOH 2BE5F 3PO3J 3S14J 3MQ0A 3S3NA 1REPC 4A93J 3ZQFA 1QGPA 2Y75A 3LA2A 4L9VA 4BXFA 1YS6A 3UNGC 3ML6A 1TQMA 3M9AA 1ZKGA 3H36A 2JSPA 2ISYA 3I59A 1TWFJ 3K70D 2D2WA 3R61A 1K78A 2HQNA 4KT5C 2DFIA 3G2BA 1O3SA 3CC2I 2VI6A 4DGWB 1WH7A 4UXNA 1JXSA 4LK1F 3ELKA 5IPAA 2NVXJ 1POGA 5F1RA 3EYIA 3F8MA 2Y48A 3RJPA 4C30A 3TP3A 1MBKA 2ADUA 5D5UB 2XDVA 2YX4A 4QIWN 3FF5A 4JQFA 4J01A 2ESNA 1UB9A 3JRAA 3HHHA 2PMZN 4XRMA 1JKPC 4IHXA 4A0YA 2EWNA 2JPBA 4XNFA 1B6AA 5LRSA 1R36A 2MGQA 4M9SA 4D9JA 3R6SA 3E6MA 3JW4A 4XKWA 4ZYGA 2KKOA 1DPUA 3H0DA 1RR7A 5JVTA 4ESBA 2DMUA 2L7MP 1FTTA 4MO7A 2HFHA 3RPUA 2HDWA 3BJOA 3HPHA 2XV4S 3E3VA 1QNTA 2M1BA 4GRIA 4IL6C 1D5YA 6PAXA 3TW6A 2PFBA 2QA4I 1R4NB 5GPCA 3QPHA 3F23A 5IP9J 5E1WA 3WTVC 2QYOA 1FOXA 2BW3B 3DU5A 5D4RA 1Z6TA 1W5CC 3IRRA 2FF4A 2BHYA 2X6OA 3FXRA 4IQ4A 1ON1A 4E7SA 1R1TA 4HX7A 1G3WA 2LBFA 2E34A 2M7BA 2JA6J 4FASD 3CJQB 3LL7A 1FZPB 3OYIA 3F6OA 2JQ7A 2E7WA 2QWWA 3KPHA 3OIOA 4HF1A 3HOZJ 4CCJA 1JGGA 2P6TA 2WTEA 1FOWA 3M7GA 4BEHA 2DMTA 2R7FA 3K4BA 1ON2A 4ZDOA 2HYJA 1FBSA 4FX4A 2GA1A 1HKQA 1YYVA 2X1DA 3CCMI 4G6DA 3LFKA 5L3DA 3CUQC 3BOQA 4F93B 1I3QJ 2QZ8A 1G3YA 3Q0WA 4E7IA 4CSWA 2K27A 2QSHX 2EIKH 2HR3A 2XAUA 1O57A 3ABMH 4OU0A 1F36A 4AYBN 3OYNA 1M1EB 2DYRH 2HWVA 2OZ6A 4XOTA 4KA4A 2UWMA 3VYSB 1BC8C 4B44A 1A6QA 2I8DA 2HOTA 4QWQA 4KFCA 3H35A 4XN3A 2HDDA 3HZJA 2CU7A 3ZMZA 2DYSH 3HEFA 3K10A 2WAFA 2ZJQF 2M4GA 4A3MJ 3KE2A 1HDPA 1MBHA 1VQOI 3ZXSA 3B02A 4XIDA 3Q3SA 2R5YB 3FHNA 4HZFA 3RKQA 1SD7A 5K5RA 1VQNI 4KDPA 2EK5A 2MLGA 2F6CA 5J6XA 1XN7A 1FEXA 3I5UA 2QEXI 2KPMA 5EEGA 2R7WA 1GUUA 2Q1ZB 2F4OB 4ETSA 2X6XA 1QRYA 5FFZA 5HDGA 1LE8B 1P9QC 3E5UA 2KHMA 1PUFA 4O3MA 1TT5B 5HS7A 1RIOH 5B1AH 3TOAA 1J9IA 2XKPA 4YIRX 1RRJA 1MBGA 1Q1VA 2MC3A 3ZQCA 2LDUA 2RVCA 4RAZA 3FXLA 4IOAF 1DP7P 5EEHA 3L9FA 5J40A 5HLGA 1W7PA 2P5KA 4XR6A 5C44J 2ECCA 1SFKA 3ZRGA 1SFEA 3WE3A 1FOKA 3K2AA 2JN6A 2XB0X 4CA0A 1HDDC 3SHFA 3ESWB 3DCFA 4G12A 2W57A 4JX4A 4BQNA 2EV5A 1OCPA 1UHWA 1FP1D 1KQ0A 2W4SA 2VN2A 2ZFWA 2L9RA 4HBLA 3N05A 2QKLB 3NEUA 2ZJPF 2MSYA 2IW5A 2P4WA 2FRHA 5ICEA 2FNPA 3GO5A 3HM5A 3W6VA 4U7DA 2PX9A 2PJRB 2WY7Q 4Q47A 3IC7A 4F55A 3HUGB 4RM3A 2Z9OA 1XCBA 2CMPA 2JT1A 3KP4A 1OQYA 2KJBA 2BY1A 1QZEA 4XMYA 3A0HC 1R49A 4NC8A 3S1MJ 4BXXJ 3MVPA 2XAQA 4ZYHA 3LSRA 2FU4A 4PGGA 4MGRA 3PQJA 2QQ9A 4ZDPA 1O7FA 4EM2A 1MZBA 1RUNA 4QPQA 4IQJA 4KN7X 4GO1A 3SEQA 4G7HF 2PLYA 1S3JA 2JA5J 2AQFA 5L3CA 3REOA 2MW8A 4PGHA 2HYGD 4ZC3A 5E20A 3OYJA 1Z77A 4BY7J 1IRGA 5GADJ 1UFMA 4B1RA 2IEKA 3BPVA 5AIQA 1XGSA 2L3DA 1MMSA 2P5VA 2VQGA 2MLKA 2OF7A 2X85A 3WG9A 1H88C 1ZTRA 1I1GA 3I58A 5F0FA 5IP6A 4ENJA 3CCQI 1WKMA 3OYAA 1IXSB 2LFBA 1RZ4A 2GOXB 3FBIB 3LNQA 5LGNA 4LGWA 2LKXA 4JP0A 3LSJA 1R22A 3HJEA 2FNAA 5CJ9A 3CTAA 1VQMI 3PUFA 4XKVA 3HIFA 1ETWA 4XORA 4MIMA 3VODA 5HNHA 2E60A 5E8IA 4BH9A 4F91B 3B73A 3L09A 2JTVA 4IHYA 4ZYEA 3S2HJ 1BW6A 3SZTA 5J1YA 3L2QA 2K3FA 3OR1C 4M74A 2P5LC 2FSWA 3OV8A 1P6RA 2F5FA 2ESHA 1V5EA 3OS1A 3F0CA 4KNYA 5E18F 3EQLF 2L4AA 3C2GA 2DXIA 4BQAA 4G94A 2LF8A 1XDSA 4AIDA 2MBFA 2H1LA 4U87A 2Y9ZA 3P9IA 1PUFB 2LSOA 4PJMA 3CMMA 4FHTA 4IHVA 5DCMA 3CLOA 4HSRA 3OS2A 1XDUA 4WXCA 3CDIA 3K4LA 3KFWX 2V9VA 1LFBA 3QPSA 3LSIA 1F4KA 3ASNH 2Z33A 1QZZA 3U1DA 5F08A 1HC8A 1MW7A 1IG7A 2VBWA 4FE7A 2Z1DA 2ZJRF 3BR0A 1YO5C 3A4CA 2XKOA 2NXNB 4G9YA 2ZO4A 2IA0A 1KA8A 3FXJA 4MEYF 3HOUJ 4BY1J 1TWCJ 1A31A 4A3GJ 3KLOA 3WGGA 4UUSA 3HSFA 4IJAA 4NHJA 2YU3A 2XF6A 3KZIC 2Q2EB 3M8JA 2DODA 5JHUA 2EQRA 2E71A 3A02A 4N0BA 2OQRA 2OJED 4A2UA 4U0YA 1QHGA 3KCCA 2IGNA 2VKVA 2HKOA 2ZMEA 4CYCA 1RPWA 4Y33A 3WODF 1I6XA 4XKCA 4FETA 4XLFA 3CMEI 1YE9A 2LTPA 1X3UA 1WJFA 2H09A 3AG1H 3WGHA 3TDUC 1RKTA 3GZ6A 4P5OA 4D7NA 1FX7A 4OWRB 3WU2C 4PFOA 2RN7A 4O6JA 4FX0A 2EFOA 3HSEA 4V2FA 1JKRC 1UCRA 1Z21A 1S5LC 2LK2A 4X6AJ 2CQXA 2VT3A 5LGTA 4DBQA 1U6GA 3ZMSA 2DJIA 2Y9YA 3M8FA 2HZDA 3BZCA 3QP6A 3LSMA 2QGUA 3S17J 2HTJA 5E1ZB 1HQCA 3EDPA 3ZP5A 4B3XA 2VOOA 3F21A 1S9HA 1XMAA 3MKYB 2WV0A 3H5RA 2KJCA 4CCOA 2OAZA 3S15J 5IT9Z 3TDZC 3DTKA 3LSHA 4PCQA 1Z0XA 3MKLA 5EG0B 4B4CA 3T8RA 5TJJA 2R7ZJ 1EV7A 3KP5A 3OL4A 1Y56A 3ABKH 3PQKA 1HKSA 1IGNA 4NC7A 1IJWC 4UVBA 4UVCA 5F27A 4AD9A 1IV8A 1I1SA 4CHUA 2NNNA 1T0FA 4BQQA 2A07F 4QLCU 1O3RA 4A3EJ 2O3FA 4XK4A 5HLIA 3OSGA 4KMUX 4C2UA 2QCOA 2HPIA 1B59A 3Q9SA 1CF7A 2A5WA 2DI3A 3GF2A 1N75A 1D3YA 4D5CA 5EZHA 4HAMA 1BA5A 3KZZA 4EM0B 2HOAA 3GFMA 4BQOA 5BOXA 5D6EA 3F6VA 5DD4A 4BJ5C 2XF5A 3NAUA 3LSGA 2W85A 1FWZA 2LF7A 2P7VB 3QQAA 3TKYA 4GYGA 1YX3A 1I6HJ 3DU6A 1XD7A 5CVRA 1W36D 3DTEA 3B6CA 4X1EA 1YRNB 1OKRA 3L00A 2QQBA 1YW8A 1FLIA 4RAFA 1WRJA 4JX5A 2ZBKA 4A0XA 2HVRA 2R7TA 3R60A 2JA2A 4AIKA 3OL3A 1BC7C 1ZLJA 2K9MA 5JVGF 2FOWA 4EV0A 4XRSG 2XPWA 1R6RA 3DKYA 3KYCB 2IS4A 2LMDA 2HVSA 5B3SH 3FXQA 3O8GA 5LRRA 4NDLA 3DFGA 1UELB 2XRNA 3I3LA 1GT0C 3RKXA 2PMZA 1Z7UA 3N4MA 1MNMC 3DKXA 2VASA 4ENNA 2PMHA 4KITB 2HXOA 4G6TB 2RQQA 4BYYA 3CQZJ 5J1RA 3I4NJ 1NG6A 3OYDA 3K0LA 1PP7U 2NVTJ 5KAIC 1WJDA 3GTKJ 4PFPA 3E5QA 5D5XB 2JMWA 1DUXC 2H8RA 3KP7A 1SD6A 2JJ7A 3E7LA 2IS6A 2CJJA 3IHUA 1T39A 2R7OA 2R7DA 4Y7NJ 3FK7A 3H3ZA 3SZPA 2QVOA 3ABTA 3IAM2 2X51A 4EMSA 1FBUA 2J5PA 2QM3A 2XAGA 3RKWA 4I76A 5D8LB 2O8XA 2OV7A 3Q9VA 4A3CJ 3WE2A 3VB2A 4IVNA 3HL2A 3S3MA 2R92J 2W48A 1HKTA 1TLHB 1V54H 3SFZA 1MBJA 3IL2A 2F5CA 2XF7A 1R1UA 2YS9A 1SMTA 1T08B 1HBXG 1Y1VJ 2BBYA 2XAHA 5GTIC 2ETHA 4BU2A 4ZJZA 1S6LA 5FD6A 3MFKA 1RUOA 4EATA 2EFQA 2DMNA 2LR8A 2EV6A 2V26A 3CJTB 4RGSA 3ROUA 3CMYA 4X0GA 3QU3A 1WZ2A 4LIUA 5LEKA 2VLAA 3ZCOA 3MKZA 3AG3H 1SEUA 1GDTA 4RBOA 4ESJA 1IN6A 1QVTA 2DOAA 4BDZA 1QBJA 5KNLA 1WJAA 2MFZA 4RGRA 1C0WA 2VOPA 1YIOA 4G7OF 2COMA 4F52A 1R5HA 1X58A 3MWMA 4ZZLA 5JR3A 5HNFA 3ERED 2GXBA 2K4BA 2G0EA 2LY1A 4PZJA 5LD2C 4NQWB 1SFXA 1Y39A 1MDMA 1JT0A 4W1UA 3D5SC 3PUBA 4OAYA 4AYBA 3LAPA 4BBRJ 3OR2C 1ZHFA 4XLEA 4XL9A 1N77A 2KLOA 3MZYA 1RNLA 3OYMA 3BG3A 5FLXK 2O8KA 3IH4A 2O61A 5A2QZ 1ZGJA 1Z6RA 1Z05A 4XSZF 3K2ZA 4AIHA 2G7HA 4Q5SF 5GTHC 3BP8A 3OS0A 5FKNA 1ZG5A 3SXYA 2DBBA 1KU3A 5M5WJ 4F92B 3L2WA 4CICA 2ZFUA 1QU3A 1Y8RB 3GFJA 2F5EA 2KRCA 2VC0A 2BVMA 2EFNA 2RGVA 1WPKA 1B9MA 3RIRA 5ILUA 1WFXA 4IOCF 3DBRB 3W6KB 4L0ZB 5DM7F 4CGZA 2NS7A 1R71A 2LLKA 5K1YA 1G3TA 1G3SA 3OYGA 5D5VB 1MMGA 1QPMA 1SANA 4HG2A 1ETYA 3AAFA 3LQRA 3I4PA 4LJZF 1U9NA 3J80Z 2NVUB 3G71I 2ZXWH 3JRHA 1Z3YA 3L2VA 5CVVA 2VE9A 2CV1A 1YX5A 4BE0A 1WQ2A 2VJ4A 2WA0A 1P7JA 1RKWA 2L01A 4J00A 2GXAA 3VDXA 4RB2C 1OCRH 2R7VA 1S7AA 5ILSA 4EM1A 2MC4A 2L9SA 4YEJA 2CQQA 3S32A 3L7WA 5JLWA 1V55H 2HGCA 3P9KA 2ICWG 2PBIA 1F5TA 3CCEI 2R4GA 4E7KA 3KEYA 1LVKA 4W97A 2KDZA 5HVQC 1X3WB 1U3EM 4ZH4F 2M5WA 1DQUA 4IEJA 5FD5A 4AIJA 2BV6A 2ZXJA 3CD6I 3E0JB 1ZH5A 1V5FA 3WTZA 2ID3A 5IYCJ 4YFKF 2W00A 1A5JA 5DM6F 2M7AA 2O03A 3RSNA 4HQMA 5FJ8J 1KU2A 3JAMZ 3ZMTA 2O9LA 2X48A 4RA2A 2CS3A 4OMZA 4L9JA 3QPTA 3SEZA 1FBQA 3OY9A 2Y0MA 1BR4A 4M71A 5ED4A 3AG4H 4A5MA 3ZQGA 2UXNA 4IRGA 2R7XA 1AHDP 2DMPA 3HOSA 2ZNYA 1LEBA 3TL4X 3OOUA 1MH4A 4BJTA 3BR5A 3J7AY 5DEQA 2FMLA 1Y0NA 2M87A 2L7KA 2E2IJ 3H9JA 4ZYAA 1FSEA 3MN2A 1V3FA 3HGGA 3D1NI 2X0LA 1ZR4A 3HRTA 2VBYA 4BHBA 2GBYA 4I09A 1E3OC 2L7ZA 1KYWA 1H8AC 4PJLA 1F43A 1ACIA 4ANJA 3GFLA 4Z6YA 1Y0UA 4IHWA 3UR3C 2RQPA 1N78A 4TV7A 1MKMA 4XRSA 4UY8I 2IXSA 2VE8A 2FBHA 3AL0B 4G6QA 4P55A 5F6FA 2CW8A 3FKJA 3TO7A 2IS1A 1A6IA 4I02A 2BHZA 1FMWA 1JI8A 4F7ZA 4JX6A 3IUOA 2PI0A 3IKVA 5E3MA 3BY6A 3CCYA 1G4DA 5K7FA 5IOYA 3CJNA 4BE1A 3LWFA 2IJLA 2WY8Q 2BVLA 5LHGA 1OISA 1VQ5I 4UHTA 3KP3A 2GA2A 1Q1HA 5AIPA 1LB2A 3FMRA 2GIVA 2JK3A 2EJRA 2GQQA 1MBEA 3FXMA 2CQNA 2F2EA 4DNCA 2DT7B 1LDKB 1T2KA 4IF4A 1TZLA 3CCUI 4D0PA 2XPUA 1B8IB 3G3ZA 3S1RJ 4PK4A 2RNJA 1D1CA 1W1WE 2A3SA 3U21A 5FKMA 2UXXA 3LOCA 5M3FJ 2R7SA 1DU6A 1JT6A 3EYYA 3OYBA 4HX8A 1MGTA 4HX4A 2MD0A 3GBGA 1ERDA 2LY9A 1GXQA 2KP6A 4II2A 1Z1DA 1ZREA 4LD5A 3CCVI 1OFCX 4BS9A 2DW4A 3PL8A 2FD5A 3DV8A 4XN0A 2P6SA 5CVIA 4XBFA 1NG7A 1QA6A 4UB6C 5LHHA 1VQ4I 1VI0A 1KZHA 4CDGA 1FYLA 3I59B 4AC0A 1SAXA 3SDGA 1FMVA 2PMUA 4ITVA 3WU1B 2HQAA 1K78B 1BL0A 1ONVA 2H6CA 2WWYA 3GTOJ 4BBSJ 1U5TA 4H0EA 2YPRA 1Z7LA 1XX5A 1HF0A 3CCRI 2CUZA 1Z3XA 4CCLA 2KRHA 1AU7A 2AS5F 4MFDA 2QSFX 2FA5A 3ASOH 5C3EJ 1IF1A 2IP2A 5FLMJ 1JUMA 1GV5A 1N25A 3BZ6A 3F8BA 1K7AA 5FB2A 2DPUA 2ELHA 4OOIA 5KAFC 2DTRA 3H0GJ 3RPQA 2BY0A 4MFEA 2OCCH 3PSFA 4Y17A 3LSPA 3GTLJ 2L0KA 1ZR2A 5LLQA 3IH3A 1LUJB 4RDUA 1J59A 4I01A 1KONA 2NOGA 4N9IA 1K83J 4WWCA 2K9LA 5KVRA 5J4YA 5CQGA 3OYHA 4M6XA 3M8EA 3H3UA 4BE2A 3FM5A 3OYKA 2I10A 4B3AA 3MD2A 5FKLA 4EQQA 1W0UA 3ECHA 2CV2A 1QVUA 3VFZA 1OCTC 4MQ9F 4UNOA
chains in the Genus database with same CATH topology
3EUHA 1R1VA 1KYZA 2JSCA 3GX4X 1YTYA 3T1BA 2IRFG 4OIOF 4M6YA 4KIBA 3R4KA 5HDKA 4OIQF 5E17F 2R3SA 1JHHA 1JE8A 3GW2A 3V8JA 3C18A 2E1CA 1U8RA 1MJ9A 1KU7A 3TO6A 5CLSA 3V8KA 2YX7A 2H94A 2LKPA 1ZLKA 2QENA 3C3WA 3L2CA 4IPAA 5DYMA 3F22A 4I7HA 4MQVA 2NS0A 1XSVA 2XUBA 1YFHA 4L9NA 3RI4A 3K1NA 2A61A 4KUMA 1S29A 4JBAA 3DXJF 1XMKA 1W5SA 2VBXA 4HV5A 4LLNA 2K7LA 4LLLA 1WWXA 4UVAA 1PP8F 2A6HF 3FMQA 2KRFA 3QOPA 2HS5A 1H9TA 1BJAA 2CFXA 3I71A 3RYRA 4XSXF 5HS9A 1BI0A 1FT9A 4A6EA 4EGZA 1BI3A 4G8XA 4A6DA 3HTSB 3GXOA 3FMSA 4BXUA 1TBXA 3RTRA 1DPRA 4R8HA 1I27A 3HOTA 1GHCA 2MH2A 2EB7A 1IZ1A 1W7PB 3CUQA 4LB6B 2CGPA 4RB1A 1F9NA 3TO9A 1TW3A 4HDUA 1VTNC 4DQ2A 4RGUA 1R58A 1KU9A 2KIMA 4WXDA 3BPXA 2GZWA 2DU9A 2PQ8A 3K1PA 2XROA 1HW5A 4WXHA 2VC1A 4U0WA 1J75A 2E7XA 1J5YA 2QBYA 3BDDA 1BN5A 2M30A 5HS8A 5HLHA 2Q8KA 1YQAA 1ZRDA 3QRFF 2WC2A 5A2QK 4CXFA 2Z3YA 1MJAA 4L5JA 5LGUA 2XAFA 5DUKA 2MA3A 1O3QA 2V1XA 2VXZA 4UUVA 2HQRA 2P7CB 2ZCWA 1QZYA 4L5IA 5L3EA 4YFNF 1OMIA 2O6GE 1KQ9A 1AWCA 3ECOA 1G6NA 3IWZA 2GWRA 3HRSA 3O2PE 3VOEA 3K69A 4LB5A 1OR7A 4Z2YA 2OBPA 3F8FA 4OINF 2RC4A 3E6DA 2EFPA 3I54A 4Q48A 1ZN2A 4KYWA 1LEAA 3T0YA 1J0RA 5DCMB 1J7KA 1OPCA 4CYDA 4MHGA 4YFXF 3N97A 5TRDA 2BEOA 1D8KA 5IT3A 2EV0A 4ENMA 5D5WB 4R1HA 2OA4A 1IAWA 1IN5A 2L4MA 4LLGF 3E6BA 2CWEA 1QQIA 2IVMA 3MEXA 2M8EA 4EJVA 4Y13A 5FGMA 4OMYA 3SQNA 4E70A 3RDIA 4KIGA 4Q4ZF 2ZMEB 3BROA 1Z91A 2IA2A 1ZRFA 1OYWA 1ZG3A 1EH8A 3BWGA 1TW2A 4RB3C 5FO5A 1R5GA 3CDHA 5F64A 2P8TA 3J81Z 3U9GA 2W84A 2B0LA 2HOEA 4RB0A 2OD5A 1L3LA 1K6OA 2OZUA 4I98B 2FOKA 4L0YB 3D0SA 2IT0A 3NRVA 3LQQA 4AVPA 3KLNA 2CG4A 3D5LA 1H9GA 3GVAA 2HEOA 1CF7B 3GYHX 3FXUA 2C6YA 5HDNA 4PDKA 4M9ZA 2FBIA 1MJBA 1TQPA 3WGIA 4KMFA 3LAJA 4ENKA 1LJ9A 2VBZA 1U5TC 3GFIA 1XGOA 2DQRA 3HTUA 1YLFA 4IRHA 3DF8A 2V79A 3CUOA 3TOBA 3ZQ7A 1GVJA 2DQLA 2AXLA 4L9TA 2A5YB 3NQOA 2E1NA 4MTDA 1GXPA 3KEOA 3JTHA 3K1MA 1ZARA 4ESFA 4EVIA 5DD8A 2ISZA 4MTEA 5H6RA 1E17A 4FT8A 2NRAC 2NAZA 3CO6C 3E97A 5H6QA 3KP2A 4GCVA 1YW9A 4P9FA 4HLYA 2BGCA 1PDNC 2UZKA 2Z99A 4HF2A 4IRIA 5J8FA 3MAJA 3VEPA 4WF2A 2DPDA 2D1VA 1BIBA 1LDJA 2PG4A 3ZMDA 2DK5A 4LMYA 3JTGA 2JZYA 3V7SA 3JSPA 5LBQA 2BYVE 3HRMA 3J7AO 1UHMA 1TNSA 1XGMA 5E1XA 1MDMB 3I0TA 1NHAA 1OYIA 1IXCA 1D8JA 3Q5FA 3OOPA 3HUGA 4B8XA 3P7NA 2FE3A 3FX3A 1E2XA 2VONA 1TNTA 4U88A 4HLXA 3O3KA 1ZYRF 2ZNZA 2CW0F 3FWEA 3TGNA 3KZYA 1FC3A 4N9HA 1BI2A 3RKYA 4WX9A 1T38A 2XAJA 4HV6A 3R0AA 5ICGA 3E6CC 1HSJA 2GAUA 3LSTA 2CSOA 2MH9A 1B1BA 5L3GA 2V6CA 3WTWC 4YIFA 2Z5UA 2K02A 1IN7A 1P92A 4XLPF 4IHTA 1HXDA 2CO5A 1LDDA 4IHSA 3WTUC 1YW7A 4M73A 2L02A 4ON0A 1STZA 2HZTA 1R00A 3DEUA 1IXRC 5JFRA 3FM3A 1V4RA 5FLXZ 2STWA 3ISPA 3KEQA 4GYIA 1O7LA 4BAYA 3V7RA 2DT5A 3ZMUA 5BS6A 4UV9A 3PFIA 5J8CA 1R7JA 3FHZA 4LG0A 4U7BA 2G7UA 4U0VA 4KICA 1PUEE 5LEJA 1T98A 1HSTA 1ZGAA 4Y15A 4EJOA 5ICFA 4ASNA 1WSUA 5IT9K 4LK0F 4HDVA 1BM9A 1S7OA 1K79A 3M1EA 2X4HA 3WTYC 1MD0A 1SD5A 2DK8A 1ODDA 4O5VA 3GEZA 2Q2EA 3QP5A 2A6EF 4HW0A 1IRFA 1LVAA 3KP6A 3WTTC 2CQKA 1YG2A 2YSRA 4HQEA 1FYKA 1I5ZA 5DDGA 1SMYF 2GXGA 2W24A 1SD4A 4I0BA 3V7CA 4WCGA 4ZYDA 5DCFA 2H6BA 2ACJA 1XSDA 1KQ8A 3F8NA 2G9WA 4KN4X 3ULQB 3G73A 1W4MA 3HRUA 2RKHA 4EGYA 3DP7A 1HW1A 4BHPA 3H92A 1LNWA 2FXAA 5CVJA 1P4XA 3QAHA 3MCZA 4P96A 4XLNF 2HYFA 1XCVA 2O0YA 1SFUA 3F72A 5D8KB 2JPCA 1RI7A 5ILVA 4RS8A 2HDCA 3C7JA 2OQGA 1U78A 1U5TB 1J2XA 3V8LA 1P4WA 3DQVC 1L0OC 2EFWA 1FYMA 3DPTA 3J81K 2FQ3A 3E5XA 2DLLA 4EJWA 1BOAA 1HW2A 3GWZA 2PEXA 4LG0B 1XB4A 1EH7A 3JSOA 3HYIA 2ZJ2A 5DUIA 1AOYA 2MD5A 1S8NA 3O6BB 2J5OA 5CYVA 3ZN0A 5H20A 1BBYA 5HOOA 2OU2A 4MEXF 2F5DA 3MZHA 3ABUA 2FBKA 5CVUA 4GGGA 4MNUA 2FMYA 2D1HA 4OIRF 4K2EA 4HF0A 3U2RA 1Z9CA 1O3TA 2XVCA 1IN8A 1CGPA 1XGNA 2XHKA 3HSRA 5K5QA 1ZAOA 3ZMVA 1KGSA 3S2WA 1FSHA 4HA8A 2HTSA 3WTXC 2Q0OA 3F3XA 2EA4A 1R23A 1ZRCA 1T6SA 3P9CA 3RYPA 3R0JA 1FY7A 3J80K 2W25A 4L18B 1U2WA 2PN6A 4HYEA 3F8CA 3GUDA 3LA3A 1FNNA 5LHIA 5BPIA 2YR2A 2NYXA 2VT2A 2JRTA 2VODA 4I2OA 4JK1X 1P4AA 4BHCA 4NQWA 1LQ1A 3FZVA 3DPLC 1USSA 5K5OA 2DO7A 2KIFA 5FFXA 4S04A 1B9NA 1ZG1A 4ZZDA 4LFUA 2XGXA 3WU0A 3JAMK 3CUQB 5BQTA 2ZKZA 1YS7A 4S05A 3BJAA 2RDPA 3BJ6A 2XASA 2V1DA 3IKTA 5L3BA 2XIGA 5JI6A 1OYYA 2STTA 3T8TA 1A04A 1EH6A 2RV8A 4RAYA 2FEZA 5BMZA 5AONA 5L3FA 3CO7C 3V4GA 5ICCA 2QBYB 2EA2A 1IW7F 2A68F 3T5XA 5KK1A 4I0AA 5BPDA 4A5NA 2HKXA 4R79A 1WI9A 3W6JB 4MQ9F 2M45A 3HHGA 2L54A 1IUYA 4M9XA 3EETA 4HOBA 3IWFA 1BI1A 2H27A 2TDXA 2QQAA 1TTYA 4CO8A 3I53A 4AWXB 4NB5A 4CZZA 2PJPA 4IXAA 1ULYA 3DKWA 3QU6A 1USTA 4YIIA 1DDNA 3TQNA 1W7PD 1P2FA 3C1DA 4EJTA 2CYYA 1QO0D 2V1UA 1FP2A 2KIUA 3GZ5A 4KIFA 3ZPLA 4WK8F 4G7ZF 1BIAA 3GLXA 5D6FA 2DAOA 5DV5A 4XRFA 3ZN1A 5E8GA 2IA1A 1F1ZA 3K9TA 1JHFA 4P9UA 4B09A 1D5VA 4A0ZA 1IN4A 4A12A 2A69F 3IRQA 4YG2F 2QUFA 4UV8A 4EJUA 3I64A 4M72A 1B4AA 1TQIA 1W5TA 5ERIA 2D45A 2IPQX 3COAC 1H0MA 2K86A 3WTSC 2QLZA 2LNBA 2NNYA 4RGXA 4GXOA 4OIPF 1JGSA 2K4JA 1XSXA 3KETA 4BNCA 5D4SA 3LA7A 1FPQA 2BE5F 3MQ0A 1REPC 1QGPA 2Y75A 3LA2A 4L9VA 1YS6A 3ML6A 1TQMA 3M9AA 2ISYA 3I59A 2D2WA 3R61A 1K78A 2HQNA 4KT5C 2DFIA 1O3SA 4UXNA 1JXSA 4LK1F 3ELKA 5F1RA 3EYIA 3F8MA 2Y48A 3RJPA 2ADUA 5D5UB 2YX4A 3FF5A 4JQFA 2ESNA 1UB9A 3HHHA 4A0YA 2EWNA 2JPBA 1B6AA 5LRSA 1R36A 4M9SA 3R6SA 3E6MA 3JW4A 4ZYGA 2KKOA 1DPUA 5JVTA 4ESBA 2HFHA 3RPUA 3BJOA 2XV4S 3E3VA 1QNTA 2M1BA 6PAXA 2PFBA 3QPHA 3F23A 5E1WA 3WTVC 2QYOA 5D4RA 1Z6TA 3IRRA 2FF4A 3FXRA 1ON1A 1R1TA 4HX7A 1G3WA 1FZPB 3F6OA 2E7WA 2QWWA 4HF1A 2P6TA 2WTEA 3M7GA 2R7FA 1ON2A 1FBSA 4FX4A 2GA1A 1HKQA 1YYVA 4G6DA 3LFKA 5L3DA 3CUQC 3BOQA 2QZ8A 1G3YA 2K27A 2HR3A 1O57A 4OU0A 2HWVA 2OZ6A 4KA4A 2UWMA 1BC8C 4QWQA 4KFCA 3ZMZA 3KE2A 3B02A 4HZFA 1SD7A 5K5RA 4KDPA 2EK5A 2MLGA 5J6XA 1XN7A 3I5UA 5EEGA 4ETSA 5FFZA 5HDGA 3E5UA 4O3MA 5HS7A 1RIOH 3TOAA 1J9IA 2XKPA 2MC3A 2LDUA 2RVCA 4RAZA 1DP7P 5EEHA 3L9FA 5HLGA 1W7PA 2P5KA 1SFEA 3WE3A 1FOKA 3SHFA 2W57A 2EV5A 1UHWA 1FP1D 1KQ0A 2VN2A 2ZFWA 4HBLA 3NEUA 2IW5A 2P4WA 2FRHA 5ICEA 2FNPA 3GO5A 4U7DA 4Q47A 3IC7A 2Z9OA 1XCBA 2JT1A 3KP4A 2KJBA 2XAQA 4ZYHA 2FU4A 4PGGA 4MGRA 3PQJA 2QQ9A 1O7FA 4EM2A 1MZBA 1RUNA 4KN7X 4GO1A 4G7HF 2PLYA 1S3JA 5L3CA 3REOA 4PGHA 2HYGD 5E20A 1IRGA 1UFMA 3BPVA 5AIQA 1XGSA 2L3DA 2P5VA 2MLKA 3WG9A 1I1GA 3I58A 4ENJA 1WKMA 1IXSB 1RZ4A 5LGNA 4LGWA 1R22A 2FNAA 5CJ9A 3CTAA 3HIFA 3VODA 5E8IA 4BH9A 3B73A 3L09A 2JTVA 4ZYEA 3SZTA 4M74A 2P5LC 2FSWA 3OV8A 1P6RA 2F5FA 2ESHA 4KNYA 5E18F 3EQLF 2L4AA 4BQAA 4G94A 2LF8A 1XDSA 2MBFA 3P9IA 2LSOA 4FHTA 5DCMA 3CLOA 1XDUA 4WXCA 3KFWX 2V9VA 1F4KA 2Z33A 1QZZA 3U1DA 2VBWA 1YO5C 2XKOA 4G9YA 2ZO4A 2IA0A 1KA8A 4MEYF 3KLOA 3WGGA 3HSFA 4IJAA 4NHJA 2YU3A 4N0BA 4A2UA 2OQRA 4U0YA 3KCCA 2HKOA 2ZMEA 3WODF 1I6XA 1X3UA 2H09A 3WGHA 3TDUC 3GZ6A 4P5OA 1FX7A 2RN7A 4O6JA 4FX0A 2EFOA 3HSEA 1UCRA 2VT3A 5LGTA 1U6GA 3ZMSA 3M8FA 3QP6A 2HTJA 5E1ZB 1HQCA 3EDPA 3ZP5A 2VOOA 3F21A 1XMAA 2WV0A 2KJCA 2OAZA 5IT9Z 3TDZC 4PCQA 3T8RA 5TJJA 1EV7A 3KP5A 3PQKA 1HKSA 4UVBA 4UVCA 4AD9A 1I1SA 4CHUA 2NNNA 1T0FA 2A07F 4QLCU 1O3RA 2O3FA 5HLIA 4KMUX 1B59A 3Q9SA 1CF7A 2DI3A 3GF2A 1D3YA 4HAMA 3KZZA 4EM0B 3GFMA 5BOXA 5D6EA 3F6VA 5DD4A 2W85A 1FWZA 2LF7A 2P7VB 3TKYA 4GYGA 1XD7A 5CVRA 1OKRA 3L00A 2QQBA 1YW8A 1FLIA 1WRJA 2ZBKA 4A0XA 3R60A 4AIKA 1BC7C 1ZLJA 4EV0A 3FXQA 5LRRA 3DFGA 2XRNA 3RKXA 1Z7UA 3N4MA 4ENNA 2PMHA 4BYYA 3K0LA 1PP7U 3E5QA 5D5XB 1DUXC 3KP7A 1SD6A 3IHUA 1T39A 2R7DA 3H3ZA 3SZPA 2QVOA 3ABTA 4EMSA 1FBUA 2J5PA 2QM3A 2XAGA 3RKWA 5D8LB 2O8XA 3Q9VA 3WE2A 3VB2A 4IVNA 1HKTA 1TLHB 3SFZA 3IL2A 2F5CA 1R1UA 1SMTA 1HBXG 2XAHA 2BBYA 2ETHA 3MFKA 1S6LA 5FD6A 1RUOA 2EFQA 2EV6A 4RGSA 3ROUA 3QU3A 5LEKA 4ESJA 1IN6A 1QBJA 4RGRA 1C0WA 2VOPA 1YIOA 4G7OF 2COMA 1R5HA 3MWMA 4ZZLA 3ERED 5JR3A 2GXBA 2K4BA 4PZJA 1SFXA 1MDMA 3LAPA 1ZHFA 3MZYA 1RNLA 5FLXK 2O61A 5A2QZ 1ZGJA 1Z6RA 1Z05A 4XSZF 3K2ZA 4AIHA 2G7HA 4Q5SF 3BP8A 1ZG5A 3SXYA 2DBBA 1KU3A 4CICA 3GFJA 2F5EA 2VC0A 2EFNA 2RGVA 1B9MA 3RIRA 5ILUA 3W6KB 4L0ZB 4CGZA 5K1YA 1G3TA 1G3SA 5D5VB 1QPMA 3AAFA 3LQRA 3I4PA 4LJZF 3J80Z 5CVVA 2VE9A 1WQ2A 2L01A 4RB2C 1S7AA 5ILSA 4EM1A 3L7WA 2HGCA 3P9KA 2PBIA 1F5TA 5HVQC 1U3EM 4ZH4F 2M5WA 5FD5A 4AIJA 2BV6A 2ZXJA 1ZH5A 3WTZA 4YFKF 2O03A 4HQMA 1KU2A 3JAMZ 3ZMTA 4OMZA 4L9JA 3QPTA 1FBQA 2Y0MA 4M71A 5ED4A 4A5MA 2UXNA 4IRGA 3HOSA 2ZNYA 1LEBA 5DEQA 2FMLA 2M87A 1FSEA 1V3FA 2X0LA 3HRTA 2VBYA 4BHBA 4I09A 1KYWA 3GFLA 1Y0UA 2RQPA 4TV7A 1MKMA 2VE8A 2FBHA 4G6QA 4P55A 5F6FA 3TO7A 4I02A 4F7ZA 2PI0A 3IKVA 3BY6A 1G4DA 3CJNA 3LWFA 2IJLA 5LHGA 4UHTA 3KP3A 2GA2A 1Q1HA 5AIPA 1LB2A 3FMRA 2GIVA 2EJRA 2GQQA 2F2EA 4DNCA 1LDKB 1T2KA 4IF4A 4D0PA 3G3ZA 2RNJA 2A3SA 2UXXA 3EYYA 4HX8A 1MGTA 4HX4A 1GXQA 1ZREA 1Z1DA 4LD5A 2DW4A 3DV8A 5CVIA 2P6SA 4XBFA 5LHHA 4CDGA 1FYLA 3I59B 1SAXA 2PMUA 3WU1B 1K78B 1ONVA 2H6CA 2WWYA 1U5TA 4H0EA 2YPRA 2AS5F 2FA5A 1IF1A 2IP2A 3BZ6A 1K7AA 3F8BA 5FB2A 2DPUA 2ELHA 4OOIA 2DTRA 3RPQA 4Y17A 5LLQA 1J59A 4I01A 4N9IA 4WWCA 5KVRA 4M6XA 3M8EA 3H3UA 3FM5A 4EQQA 3ECHA 3VFZA 5JHUA 4UNOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3EUH A;  1R1V A;  1KYZ A;  2JSC A;  3GX4 X;  1YTY A;  3T1B A;  2IRF G;  4OIO F;  4M6Y A;  4KIB A;  3R4K A;  5HDK A;  4OIQ F;  5E17 F;  2R3S A;  1JHH A;  1JE8 A;  3GW2 A;  3V8J A;  3C18 A;  2E1C A;  1U8R A;  1MJ9 A;  1KU7 A;  3TO6 A;  5CLS A;  3V8K A;  2YX7 A;  2H94 A;  2LKP A;  1ZLK A;  2QEN A;  3C3W A;  3L2C A;  4IPA A;  5DYM A;  3F22 A;  4I7H A;  4MQV A;  2NS0 A;  1XSV A;  2XUB A;  1YFH A;  4L9N A;  3RI4 A;  3K1N A;  2A61 A;  4KUM A;  1S29 A;  4JBA A;  3DXJ F;  1XMK A;  1W5S A;  2VBX A;  4HV5 A;  4LLN A;  2K7L A;  4LLL A;  1WWX A;  4UVA A;  1PP8 F;  2A6H F;  3FMQ A;  2KRF A;  3QOP A;  2HS5 A;  1H9T A;  1BJA A;  2CFX A;  3I71 A;  3RYR A;  4XSX F;  5HS9 A;  1BI0 A;  1FT9 A;  4A6E A;  4EGZ A;  1BI3 A;  4G8X A;  4A6D A;  3HTS B;  3GXO A;  3FMS A;  4BXU A;  1TBX A;  3RTR A;  1DPR A;  4R8H A;  1I27 A;  3HOT A;  1GHC A;  2MH2 A;  2EB7 A;  1IZ1 A;  1W7P B;  3CUQ A;  4LB6 B;  2CGP A;  4RB1 A;  1F9N A;  3TO9 A;  1TW3 A;  4HDU A;  1VTN C;  4DQ2 A;  4RGU A;  1R58 A;  1KU9 A;  2KIM A;  4WXD A;  3BPX A;  2GZW A;  2DU9 A;  2PQ8 A;  3K1P A;  2XRO A;  1HW5 A;  4WXH A;  2VC1 A;  4U0W A;  1J75 A;  2E7X A;  1J5Y A;  2QBY A;  3BDD A;  1BN5 A;  2M30 A;  5HS8 A;  5HLH A;  2Q8K A;  1YQA A;  1ZRD A;  3QRF F;  2WC2 A;  5A2Q K;  4CXF A;  2Z3Y A;  1MJA A;  4L5J A;  5LGU A;  2XAF A;  5DUK A;  2MA3 A;  1O3Q A;  2V1X A;  2VXZ A;  4UUV A;  2HQR A;  2P7C B;  2ZCW A;  1QZY A;  4L5I A;  5L3E A;  4YFN F;  1OMI A;  2O6G E;  1KQ9 A;  1AWC A;  3ECO A;  1G6N A;  3IWZ A;  2GWR A;  3HRS A;  3O2P E;  3VOE A;  3K69 A;  4LB5 A;  1OR7 A;  4Z2Y A;  2OBP A;  3F8F A;  4OIN F;  2RC4 A;  3E6D A;  2EFP A;  3I54 A;  4Q48 A;  1ZN2 A;  4KYW A;  1LEA A;  3T0Y A;  1J0R A;  5DCM B;  1J7K A;  1OPC A;  4CYD A;  4MHG A;  4YFX F;  3N97 A;  5TRD A;  2BEO A;  1D8K A;  5IT3 A;  2EV0 A;  4ENM A;  5D5W B;  4R1H A;  2OA4 A;  1IAW A;  1IN5 A;  2L4M A;  4LLG F;  3E6B A;  2CWE A;  1QQI A;  2IVM A;  3MEX A;  2M8E A;  4EJV A;  4Y13 A;  5FGM A;  4OMY A;  3SQN A;  4E70 A;  3RDI A;  4KIG A;  4Q4Z F;  2ZME B;  3BRO A;  1Z91 A;  2IA2 A;  1ZRF A;  1OYW A;  1ZG3 A;  1EH8 A;  3BWG A;  1TW2 A;  4RB3 C;  5FO5 A;  1R5G A;  3CDH A;  5F64 A;  2P8T A;  3J81 Z;  3U9G A;  2W84 A;  2B0L A;  2HOE A;  4RB0 A;  2OD5 A;  1L3L A;  1K6O A;  2OZU A;  4I98 B;  2FOK A;  4L0Y B;  3D0S A;  2IT0 A;  3NRV A;  3LQQ A;  4AVP A;  3KLN A;  2CG4 A;  3D5L A;  1H9G A;  3GVA A;  2HEO A;  1CF7 B;  3GYH X;  3FXU A;  2C6Y A;  5HDN A;  4PDK A;  4M9Z A;  2FBI A;  1MJB A;  1TQP A;  3WGI A;  4KMF A;  3LAJ A;  4ENK A;  1LJ9 A;  2VBZ A;  1U5T C;  3GFI A;  1XGO A;  2DQR A;  3HTU A;  1YLF A;  4IRH A;  3DF8 A;  2V79 A;  3CUO A;  3TOB A;  3ZQ7 A;  1GVJ A;  2DQL A;  2AXL A;  4L9T A;  2A5Y B;  3NQO A;  2E1N A;  4MTD A;  1GXP A;  3KEO A;  3JTH A;  3K1M A;  1ZAR A;  4ESF A;  4EVI A;  5DD8 A;  2ISZ A;  4MTE A;  5H6R A;  1E17 A;  4FT8 A;  2NRA C;  2NAZ A;  3CO6 C;  3E97 A;  5H6Q A;  3KP2 A;  4GCV A;  1YW9 A;  4P9F A;  4HLY A;  2BGC A;  1PDN C;  2UZK A;  2Z99 A;  4HF2 A;  4IRI A;  5J8F A;  3MAJ A;  3VEP A;  4WF2 A;  2DPD A;  2D1V A;  1BIB A;  1LDJ A;  2PG4 A;  3ZMD A;  2DK5 A;  4LMY A;  3JTG A;  2JZY A;  3V7S A;  3JSP A;  5LBQ A;  2BYV E;  3HRM A;  3J7A O;  1UHM A;  1TNS A;  1XGM A;  5E1X A;  1MDM B;  3I0T A;  1NHA A;  1OYI A;  1IXC A;  1D8J A;  3Q5F A;  3OOP A;  3HUG A;  4B8X A;  3P7N A;  2FE3 A;  3FX3 A;  1E2X A;  2VON A;  1TNT A;  4U88 A;  4HLX A;  3O3K A;  1ZYR F;  2ZNZ A;  2CW0 F;  3FWE A;  3TGN A;  3KZY A;  1FC3 A;  4N9H A;  1BI2 A;  3RKY A;  4WX9 A;  1T38 A;  2XAJ A;  4HV6 A;  3R0A A;  5ICG A;  3E6C C;  1HSJ A;  2GAU A;  3LST A;  2CSO A;  2MH9 A;  1B1B A;  5L3G A;  2V6C A;  3WTW C;  4YIF A;  2Z5U A;  2K02 A;  1IN7 A;  1P92 A;  4XLP F;  4IHT A;  1HXD A;  2CO5 A;  1LDD A;  4IHS A;  3WTU C;  1YW7 A;  4M73 A;  2L02 A;  4ON0 A;  1STZ A;  2HZT A;  1R00 A;  3DEU A;  1IXR C;  5JFR A;  3FM3 A;  1V4R A;  5FLX Z;  2STW A;  3ISP A;  3KEQ A;  4GYI A;  1O7L A;  4BAY A;  3V7R A;  2DT5 A;  3ZMU A;  5BS6 A;  4UV9 A;  3PFI A;  5J8C A;  1R7J A;  3FHZ A;  4LG0 A;  4U7B A;  2G7U A;  4U0V A;  4KIC A;  1PUE E;  5LEJ A;  1T98 A;  1HST A;  1ZGA A;  4Y15 A;  4EJO A;  5ICF A;  4ASN A;  1WSU A;  5IT9 K;  4LK0 F;  4HDV A;  1BM9 A;  1S7O A;  1K79 A;  3M1E A;  2X4H A;  3WTY C;  1MD0 A;  1SD5 A;  2DK8 A;  1ODD A;  4O5V A;  3GEZ A;  2Q2E A;  3QP5 A;  2A6E F;  4HW0 A;  1IRF A;  1LVA A;  3KP6 A;  3WTT C;  2CQK A;  1YG2 A;  2YSR A;  4HQE A;  1FYK A;  1I5Z A;  5DDG A;  1SMY F;  2GXG A;  2W24 A;  1SD4 A;  4I0B A;  3V7C A;  4WCG A;  4ZYD A;  5DCF A;  2H6B A;  2ACJ A;  1XSD A;  1KQ8 A;  3F8N A;  2G9W A;  4KN4 X;  3ULQ B;  3G73 A;  1W4M A;  3HRU A;  2RKH A;  4EGY A;  3DP7 A;  1HW1 A;  4BHP A;  3H92 A;  1LNW A;  2FXA A;  5CVJ A;  1P4X A;  3QAH A;  3MCZ A;  4P96 A;  4XLN F;  2HYF A;  1XCV A;  2O0Y A;  1SFU A;  3F72 A;  5D8K B;  2JPC A;  1RI7 A;  5ILV A;  4RS8 A;  2HDC A;  3C7J A;  2OQG A;  1U78 A;  1U5T B;  1J2X A;  3V8L A;  1P4W A;  3DQV C;  1L0O C;  2EFW A;  1FYM A;  3DPT A;  3J81 K;  2FQ3 A;  3E5X A;  2DLL A;  4EJW A;  1BOA A;  1HW2 A;  3GWZ A;  2PEX A;  4LG0 B;  1XB4 A;  1EH7 A;  3JSO A;  3HYI A;  2ZJ2 A;  5DUI A;  1AOY A;  2MD5 A;  1S8N A;  3O6B B;  2J5O A;  5CYV A;  3ZN0 A;  5H20 A;  1BBY A;  5HOO A;  2OU2 A;  4MEX F;  2F5D A;  3MZH A;  3ABU A;  2FBK A;  5CVU A;  4GGG A;  4MNU A;  2FMY A;  2D1H A;  4OIR F;  4K2E A;  4HF0 A;  3U2R A;  1Z9C A;  1O3T A;  2XVC A;  1IN8 A;  1CGP A;  1XGN A;  2XHK A;  3HSR A;  5K5Q A;  1ZAO A;  3ZMV A;  1KGS A;  3S2W A;  1FSH A;  4HA8 A;  2HTS A;  3WTX C;  2Q0O A;  3F3X A;  2EA4 A;  1R23 A;  1ZRC A;  1T6S A;  3P9C A;  3RYP A;  3R0J A;  1FY7 A;  3J80 K;  2W25 A;  4L18 B;  1U2W A;  2PN6 A;  4HYE A;  3F8C A;  3GUD A;  3LA3 A;  1FNN A;  5LHI A;  5BPI A;  2YR2 A;  2NYX A;  2VT2 A;  2JRT A;  2VOD A;  4I2O A;  4JK1 X;  1P4A A;  4BHC A;  4NQW A;  1LQ1 A;  3FZV A;  3DPL C;  1USS A;  5K5O A;  2DO7 A;  2KIF A;  5FFX A;  4S04 A;  1B9N A;  1ZG1 A;  4ZZD A;  4LFU A;  2XGX A;  3WU0 A;  3JAM K;  3CUQ B;  5BQT A;  2ZKZ A;  1YS7 A;  4S05 A;  3BJA A;  2RDP A;  3BJ6 A;  2XAS A;  2V1D A;  3IKT A;  5L3B A;  2XIG A;  5JI6 A;  1OYY A;  2STT A;  3T8T A;  1A04 A;  1EH6 A;  2RV8 A;  4RAY A;  2FEZ A;  5BMZ A;  5AON A;  5L3F A;  3CO7 C;  3V4G A;  5ICC A;  2QBY B;  2EA2 A;  1IW7 F;  2A68 F;  3T5X A;  5KK1 A;  4I0A A;  5BPD A;  4A5N A;  2HKX A;  4R79 A;  1WI9 A;  3W6J B;  4MQ9 F;  2M45 A;  3HHG A;  2L54 A;  1IUY A;  4M9X A;  3EET A;  4HOB A;  3IWF A;  1BI1 A;  2H27 A;  2TDX A;  2QQA A;  1TTY A;  4CO8 A;  3I53 A;  4AWX B;  4NB5 A;  4CZZ A;  2PJP A;  4IXA A;  1ULY A;  3DKW A;  3QU6 A;  1UST A;  4YII A;  1DDN A;  3TQN A;  1W7P D;  1P2F A;  3C1D A;  4EJT A;  2CYY A;  1QO0 D;  2V1U A;  1FP2 A;  2KIU A;  3GZ5 A;  4KIF A;  3ZPL A;  4WK8 F;  4G7Z F;  1BIA A;  3GLX A;  5D6F A;  2DAO A;  5DV5 A;  4XRF A;  3ZN1 A;  5E8G A;  2IA1 A;  1F1Z A;  3K9T A;  1JHF A;  4P9U A;  4B09 A;  1D5V A;  4A0Z A;  1IN4 A;  4A12 A;  2A69 F;  3IRQ A;  4YG2 F;  2QUF A;  4UV8 A;  4EJU A;  3I64 A;  4M72 A;  1B4A A;  1TQI A;  1W5T A;  5ERI A;  2D45 A;  2IPQ X;  3COA C;  1H0M A;  2K86 A;  3WTS C;  2QLZ A;  2LNB A;  2NNY A;  4RGX A;  4GXO A;  4OIP F;  1JGS A;  2K4J A;  1XSX A;  3KET A;  4BNC A;  5D4S A;  3LA7 A;  1FPQ A;  2BE5 F;  3MQ0 A;  1REP C;  1QGP A;  2Y75 A;  3LA2 A;  4L9V A;  1YS6 A;  3ML6 A;  1TQM A;  3M9A A;  2ISY A;  3I59 A;  2D2W A;  3R61 A;  1K78 A;  2HQN A;  4KT5 C;  2DFI A;  1O3S A;  4UXN A;  1JXS A;  4LK1 F;  3ELK A;  5F1R A;  3EYI A;  3F8M A;  2Y48 A;  3RJP A;  2ADU A;  5D5U B;  2YX4 A;  3FF5 A;  4JQF A;  2ESN A;  1UB9 A;  3HHH A;  4A0Y A;  2EWN A;  2JPB A;  1B6A A;  5LRS A;  1R36 A;  4M9S A;  3R6S A;  3E6M A;  3JW4 A;  4ZYG A;  2KKO A;  1DPU A;  5JVT A;  4ESB A;  2HFH A;  3RPU A;  3BJO A;  2XV4 S;  3E3V A;  1QNT A;  2M1B A;  6PAX A;  2PFB A;  3QPH A;  3F23 A;  5E1W A;  3WTV C;  2QYO A;  5D4R A;  1Z6T A;  3IRR A;  2FF4 A;  3FXR A;  1ON1 A;  1R1T A;  4HX7 A;  1G3W A;  1FZP B;  3F6O A;  2E7W A;  2QWW A;  4HF1 A;  2P6T A;  2WTE A;  3M7G A;  2R7F A;  1ON2 A;  1FBS A;  4FX4 A;  2GA1 A;  1HKQ A;  1YYV A;  4G6D A;  3LFK A;  5L3D A;  3CUQ C;  3BOQ A;  2QZ8 A;  1G3Y A;  2K27 A;  2HR3 A;  1O57 A;  4OU0 A;  2HWV A;  2OZ6 A;  4KA4 A;  2UWM A;  1BC8 C;  4QWQ A;  4KFC A;  3ZMZ A;  3KE2 A;  3B02 A;  4HZF A;  1SD7 A;  5K5R A;  4KDP A;  2EK5 A;  2MLG A;  5J6X A;  1XN7 A;  3I5U A;  5EEG A;  4ETS A;  5FFZ A;  5HDG A;  3E5U A;  4O3M A;  5HS7 A;  1RIO H;  3TOA A;  1J9I A;  2XKP A;  2MC3 A;  2LDU A;  2RVC A;  4RAZ A;  1DP7 P;  5EEH A;  3L9F A;  5HLG A;  1W7P A;  2P5K A;  1SFE A;  3WE3 A;  1FOK A;  3SHF A;  2W57 A;  2EV5 A;  1UHW A;  1FP1 D;  1KQ0 A;  2VN2 A;  2ZFW A;  4HBL A;  3NEU A;  2IW5 A;  2P4W A;  2FRH A;  5ICE A;  2FNP A;  3GO5 A;  4U7D A;  4Q47 A;  3IC7 A;  2Z9O A;  1XCB A;  2JT1 A;  3KP4 A;  2KJB A;  2XAQ A;  4ZYH A;  2FU4 A;  4PGG A;  4MGR A;  3PQJ A;  2QQ9 A;  1O7F A;  4EM2 A;  1MZB A;  1RUN A;  4KN7 X;  4GO1 A;  4G7H F;  2PLY A;  1S3J A;  5L3C A;  3REO A;  4PGH A;  2HYG D;  5E20 A;  1IRG A;  1UFM A;  3BPV A;  5AIQ A;  1XGS A;  2L3D A;  2P5V A;  2MLK A;  3WG9 A;  1I1G A;  3I58 A;  4ENJ A;  1WKM A;  1IXS B;  1RZ4 A;  5LGN A;  4LGW A;  1R22 A;  2FNA A;  5CJ9 A;  3CTA A;  3HIF A;  3VOD A;  5E8I A;  4BH9 A;  3B73 A;  3L09 A;  2JTV A;  4ZYE A;  3SZT A;  4M74 A;  2P5L C;  2FSW A;  3OV8 A;  1P6R A;  2F5F A;  2ESH A;  4KNY A;  5E18 F;  3EQL F;  2L4A A;  4BQA A;  4G94 A;  2LF8 A;  1XDS A;  2MBF A;  3P9I A;  2LSO A;  4FHT A;  5DCM A;  3CLO A;  1XDU A;  4WXC A;  3KFW X;  2V9V A;  1F4K A;  2Z33 A;  1QZZ A;  3U1D A;  2VBW A;  1YO5 C;  2XKO A;  4G9Y A;  2ZO4 A;  2IA0 A;  1KA8 A;  4MEY F;  3KLO A;  3WGG A;  3HSF A;  4IJA A;  4NHJ A;  2YU3 A;  4N0B A;  4A2U A;  2OQR A;  4U0Y A;  3KCC A;  2HKO A;  2ZME A;  3WOD F;  1I6X A;  1X3U A;  2H09 A;  3WGH A;  3TDU C;  3GZ6 A;  4P5O A;  1FX7 A;  2RN7 A;  4O6J A;  4FX0 A;  2EFO A;  3HSE A;  1UCR A;  2VT3 A;  5LGT A;  1U6G A;  3ZMS A;  3M8F A;  3QP6 A;  2HTJ A;  5E1Z B;  1HQC A;  3EDP A;  3ZP5 A;  2VOO A;  3F21 A;  1XMA A;  2WV0 A;  2KJC A;  2OAZ A;  5IT9 Z;  3TDZ C;  4PCQ A;  3T8R A;  5TJJ A;  1EV7 A;  3KP5 A;  3PQK A;  1HKS A;  4UVB A;  4UVC A;  4AD9 A;  1I1S A;  4CHU A;  2NNN A;  1T0F A;  2A07 F;  4QLC U;  1O3R A;  2O3F A;  5HLI A;  4KMU X;  1B59 A;  3Q9S A;  1CF7 A;  2DI3 A;  3GF2 A;  1D3Y A;  4HAM A;  3KZZ A;  4EM0 B;  3GFM A;  5BOX A;  5D6E A;  3F6V A;  5DD4 A;  2W85 A;  1FWZ A;  2LF7 A;  2P7V B;  3TKY A;  4GYG A;  1XD7 A;  5CVR A;  1OKR A;  3L00 A;  2QQB A;  1YW8 A;  1FLI A;  1WRJ A;  2ZBK A;  4A0X A;  3R60 A;  4AIK A;  1BC7 C;  1ZLJ A;  4EV0 A;  3FXQ A;  5LRR A;  3DFG A;  2XRN A;  3RKX A;  1Z7U A;  3N4M A;  4ENN A;  2PMH A;  4BYY A;  3K0L A;  1PP7 U;  3E5Q A;  5D5X B;  1DUX C;  3KP7 A;  1SD6 A;  3IHU A;  1T39 A;  2R7D A;  3H3Z A;  3SZP A;  2QVO A;  3ABT A;  4EMS A;  1FBU A;  2J5P A;  2QM3 A;  2XAG A;  3RKW A;  5D8L B;  2O8X A;  3Q9V A;  3WE2 A;  3VB2 A;  4IVN A;  1HKT A;  1TLH B;  3SFZ A;  3IL2 A;  2F5C A;  1R1U A;  1SMT A;  1HBX G;  2XAH A;  2BBY A;  2ETH A;  3MFK A;  1S6L A;  5FD6 A;  1RUO A;  2EFQ A;  2EV6 A;  4RGS A;  3ROU A;  3QU3 A;  5LEK A;  4ESJ A;  1IN6 A;  1QBJ A;  4RGR A;  1C0W A;  2VOP A;  1YIO A;  4G7O F;  2COM A;  1R5H A;  3MWM A;  4ZZL A;  3ERE D;  5JR3 A;  2GXB A;  2K4B A;  4PZJ A;  1SFX A;  1MDM A;  3LAP A;  1ZHF A;  3MZY A;  1RNL A;  5FLX K;  2O61 A;  5A2Q Z;  1ZGJ A;  1Z6R A;  1Z05 A;  4XSZ F;  3K2Z A;  4AIH A;  2G7H A;  4Q5S F;  3BP8 A;  1ZG5 A;  3SXY A;  2DBB A;  1KU3 A;  4CIC A;  3GFJ A;  2F5E A;  2VC0 A;  2EFN A;  2RGV A;  1B9M A;  3RIR A;  5ILU A;  3W6K B;  4L0Z B;  4CGZ A;  5K1Y A;  1G3T A;  1G3S A;  5D5V B;  1QPM A;  3AAF A;  3LQR A;  3I4P A;  4LJZ F;  3J80 Z;  5CVV A;  2VE9 A;  1WQ2 A;  2L01 A;  4RB2 C;  1S7A A;  5ILS A;  4EM1 A;  3L7W A;  2HGC A;  3P9K A;  2PBI A;  1F5T A;  5HVQ C;  1U3E M;  4ZH4 F;  2M5W A;  5FD5 A;  4AIJ A;  2BV6 A;  2ZXJ A;  1ZH5 A;  3WTZ A;  4YFK F;  2O03 A;  4HQM A;  1KU2 A;  3JAM Z;  3ZMT A;  4OMZ A;  4L9J A;  3QPT A;  1FBQ A;  2Y0M A;  4M71 A;  5ED4 A;  4A5M A;  2UXN A;  4IRG A;  3HOS A;  2ZNY A;  1LEB A;  5DEQ A;  2FML A;  2M87 A;  1FSE A;  1V3F A;  2X0L A;  3HRT A;  2VBY A;  4BHB A;  4I09 A;  1KYW A;  3GFL A;  1Y0U A;  2RQP A;  4TV7 A;  1MKM A;  2VE8 A;  2FBH A;  4G6Q A;  4P55 A;  5F6F A;  3TO7 A;  4I02 A;  4F7Z A;  2PI0 A;  3IKV A;  3BY6 A;  1G4D A;  3CJN A;  3LWF A;  2IJL A;  5LHG A;  4UHT A;  3KP3 A;  2GA2 A;  1Q1H A;  5AIP A;  1LB2 A;  3FMR A;  2GIV A;  2EJR A;  2GQQ A;  2F2E A;  4DNC A;  1LDK B;  1T2K A;  4IF4 A;  4D0P A;  3G3Z A;  2RNJ A;  2A3S A;  2UXX A;  3EYY A;  4HX8 A;  1MGT A;  4HX4 A;  1GXQ A;  1ZRE A;  1Z1D A;  4LD5 A;  2DW4 A;  3DV8 A;  5CVI A;  2P6S A;  4XBF A;  5LHH A;  4CDG A;  1FYL A;  3I59 B;  1SAX A;  2PMU A;  3WU1 B;  1K78 B;  1ONV A;  2H6C A;  2WWY A;  1U5T A;  4H0E A;  2YPR A;  2AS5 F;  2FA5 A;  1IF1 A;  2IP2 A;  3BZ6 A;  1K7A A;  3F8B A;  5FB2 A;  2DPU A;  2ELH A;  4OOI A;  2DTR A;  3RPQ A;  4Y17 A;  5LLQ A;  1J59 A;  4I01 A;  4N9I A;  4WWC A;  5KVR A;  4M6X A;  3M8E A;  3H3U A;  3FM5 A;  4EQQ A;  3ECH A;  3VFZ A;  5JHU A;  4UNO A; 
#chains in the Genus database with same CATH topology
 2E2H J;  3EUH A;  1R1V A;  2VQL A;  1KYZ A;  2JSC A;  4PSW A;  3GX4 X;  1JUP A;  1YTY A;  3T1B A;  2GOM A;  2IRF G;  1AKH A;  4OIO F;  5HLT A;  4AUX A;  4M6Y A;  4DZJ A;  2WB1 A;  3VSK A;  3S2D J;  1MIJ A;  4KIB A;  3R4K A;  5HDK A;  3A01 A;  4OIQ F;  2OPT A;  5E17 F;  3L1P A;  2R3S A;  1JHH A;  1JE8 A;  2M9H A;  3GW2 A;  3V8J A;  3C18 A;  2E1C A;  1RR8 C;  1U8R A;  4JYK A;  1MJ9 A;  1KU7 A;  3TO6 A;  4XIC A;  3PO2 J;  3FBN B;  5CLS A;  1YHQ I;  1GVD A;  3IP4 B;  3V8K A;  2HOS A;  2LBF B;  1T0F C;  2YX7 A;  3CES A;  2H94 A;  3VPR A;  2LKP A;  3OYL A;  2QKM B;  4FIS A;  1I3A A;  1WJ5 A;  2BXZ A;  4BEH B;  4DBR A;  4H4K C;  1NK3 P;  1ZLK A;  2QEN A;  3I55 I;  4CCN A;  3C3W A;  5KCM A;  2Y2Z A;  3L2C A;  4IPA A;  5DYM A;  3F22 A;  4I7H A;  4MQV A;  1XMX A;  1XSV A;  2NS0 A;  2XUB A;  1YFH A;  4L9N A;  3RI4 A;  2JWT A;  3K1N A;  3OSF A;  2GLO A;  3HDD A;  2EIJ H;  2A61 A;  4KUM A;  4YEL A;  3DEW A;  3H9Q A;  4LG3 A;  4M3G A;  1S29 A;  1PYV A;  4JBA A;  4Y3O A;  1DGR M;  2RAE A;  4D5F A;  3DXJ F;  2N8G A;  2VJ5 A;  4ZDL A;  3ZQL A;  1XMK A;  1W5S A;  3K4M A;  2VBX A;  4HV5 A;  4LLN A;  2K7L A;  4LLL A;  4HNT A;  3HKZ N;  3W2V A;  2DA3 A;  1WWX A;  4UVA A;  3HBL A;  1PP8 F;  2A6H F;  2OC6 A;  3FMQ A;  2KRF A;  3QOP A;  2V1N A;  2HS5 A;  2LD5 A;  1BJA A;  2CFX A;  2DT6 A;  2VKH A;  3VYR B;  1H9T A;  1UAA A;  3I71 A;  2DA2 A;  3RYR A;  4BKX A;  4XSX F;  5HS9 A;  1BI0 A;  4Y4R A;  1XS9 A;  2ME0 A;  2VQC A;  4M6V A;  1UG0 A;  4I6Z A;  2ECB A;  1FT9 A;  4A6E A;  4EGZ A;  1VQ9 I;  1BI3 A;  4G8X A;  2NVY J;  4IO9 F;  4A6D A;  1VF9 A;  3HTS B;  3GXO A;  3FMS A;  4BXU A;  1G59 A;  1TBX A;  5JHF A;  2O5R A;  3RTR A;  1DPR A;  1X19 A;  1UHS A;  4R8H A;  1I27 A;  3ZOB A;  3HOT A;  1GHC A;  2MH2 A;  2F4M B;  3QOD A;  2EB7 A;  1IZ1 A;  1W7P B;  1X4P A;  3CUQ A;  3QYE A;  2DFF A;  4RLF A;  4LB6 B;  2CGP A;  4RB1 A;  1F9N A;  2FX0 A;  3TO9 A;  1E3P A;  2EZK A;  1WJE A;  1TW3 A;  3DBH B;  4HDU A;  1VTN C;  4DQ2 A;  5GP9 A;  4RGU A;  1R58 A;  1KU9 A;  2KIM A;  4WXD A;  3BPX A;  1YIJ I;  2FUG 2;  2V6E A;  2R7U A;  2GZW A;  2ELJ A;  2DU9 A;  2PQ8 A;  3BTL A;  3K1P A;  2XRO A;  3ERM A;  1HW5 A;  3RQI A;  2YUS A;  3C2B A;  2MG4 A;  2HNH A;  2VC1 A;  4WXH A;  3TMO A;  1XG1 A;  4U0W A;  1J75 A;  4E4H A;  2KFD A;  2IAI A;  2BY2 A;  2E7X A;  1J5Y A;  3GTM J;  2QBY A;  2WAQ A;  2EIN H;  1XC5 A;  4DZP A;  1FTZ A;  3A01 B;  3BDD A;  1BN5 A;  2M30 A;  5HS8 A;  1SFO J;  5HLH A;  2Q8K A;  1YQA A;  1ZRD A;  3AL0 C;  2DTZ A;  2OCE A;  4M3F A;  3QRF F;  4FQG A;  1ZGW A;  2WC2 A;  1ETQ A;  3W2W A;  5A2Q K;  5JLX A;  3WG7 H;  3SFI A;  2ZXI A;  4CUG A;  4CXF A;  3JRI A;  2Z3Y A;  5B5E C;  1MJA A;  2M0C A;  2IGK A;  3HC7 A;  3MMY B;  3RZO J;  4L5J A;  2ZSH B;  4KJZ A;  2LVS A;  2DMQ A;  5LGU A;  2XAF A;  5DUK A;  2MA3 A;  3PNV A;  2E2J J;  1O3Q A;  2DA1 A;  4LIT A;  3LSK A;  5EJC A;  1D1B A;  2CQ7 A;  1OCZ H;  2V1X A;  5IP7 J;  3GZN B;  5EGO A;  2VXZ A;  4UUV A;  4B43 A;  2HQR A;  2P7C B;  4A3B J;  2WAD A;  2ZCW A;  2IBD A;  3TW7 A;  2V4J C;  1QZY A;  4L5I A;  5L3E A;  4YFN F;  1OMI A;  5CKT A;  2W1O A;  2O6G E;  3I56 I;  1KQ9 A;  1IV6 A;  3A0B C;  3D5R C;  4CCK A;  2ZC2 A;  1AWC A;  3ECO A;  1G6N A;  3IWZ A;  2XB5 A;  1TP4 A;  2GWR A;  2KDO A;  3HRS A;  3O2P E;  5M5X J;  1H89 C;  3VOE A;  3K69 A;  2B7E A;  4LB5 A;  1OR7 A;  4Z2Y A;  2OBP A;  3F8F A;  3P5J A;  4OIN F;  2RC4 A;  2VUM J;  3ONQ A;  4XON A;  3E6D A;  3HG9 A;  2EFP A;  4PJN A;  3BR6 A;  3I54 A;  4Q48 A;  1FJL A;  1ZN2 A;  4KYW A;  3HOX J;  4HRI A;  2M8G X;  4BDY A;  1LEA A;  1FIA A;  4PSX A;  3H3V K;  3T0Y A;  1VQK I;  1J0R A;  2X6W A;  3QYF A;  3G4S I;  2CH0 A;  4S0H B;  5DCM B;  1J7K A;  1OPC A;  1IRX A;  4CYD A;  4MHG A;  1A35 A;  4YFX F;  3N97 A;  2LOO A;  2BEO A;  5TRD A;  3UKG A;  5FLV A;  1D8K A;  2K9S A;  1X1P A;  5IT3 A;  2EV0 A;  2DFH A;  1UJ8 A;  5FKK A;  1IC8 A;  4ENM A;  5D5W B;  1GV2 A;  2NOJ B;  4R1H A;  2R93 J;  2IGM A;  3JRE A;  2OA4 A;  1IAW A;  1IN5 A;  4E7Z A;  2L4M A;  4LLG F;  2ZB9 A;  3FIW A;  3E6B A;  4CCM A;  2CWE A;  2W82 A;  1WGX A;  2ELK A;  1QQI A;  2IVM A;  3MEX A;  2EIM H;  2M8E A;  2X1C A;  1MNE A;  4NNJ A;  1BOB A;  4UUS B;  1D0Z A;  3ZQQ A;  2L9N A;  3VYT B;  4EJV A;  2HQ5 A;  3SZG A;  4Y13 A;  3RQ4 A;  2LY2 A;  5FGM A;  3JRB A;  4OMY A;  2DA4 A;  3SQN A;  4E70 A;  3RDI A;  4KIG A;  5E3L A;  1ETV A;  3BR3 A;  4BAC A;  4Q4Z F;  2VXD A;  4CYC B;  2ZME B;  3BRO A;  1Z91 A;  3J7Y J;  2IA2 A;  1ZRF A;  1OYW A;  2JUC A;  1ETO A;  1TT0 A;  1ZG3 A;  1EH8 A;  3BWG A;  2AO9 A;  2KMU A;  3VWB A;  1TW2 A;  3G1L A;  3BR2 A;  4RB3 C;  5FO5 A;  1R5G A;  3CDH A;  1AA7 A;  5F64 A;  2P8T A;  3J81 Z;  3U9G A;  2W84 A;  2B0L A;  3BTJ A;  2F5V A;  2HOE A;  4RB0 A;  2KIQ A;  1Z67 A;  2OD5 A;  1ENH A;  1UG2 A;  4KT6 A;  4BL0 B;  1L3L A;  1VZ0 A;  1VQ6 I;  3BG5 A;  1K6O A;  2OZU A;  4XLH A;  4I98 B;  2FOK A;  3X2Q H;  3KYL A;  4BUP A;  4DYQ A;  4L0Y B;  3D0S A;  2IT0 A;  2DA5 A;  3NRV A;  4HPQ A;  2VB6 A;  3LQQ A;  4D7M A;  4AVP A;  3KLN A;  2ZSI B;  2CG4 A;  2XGD A;  3A2K A;  3D5L A;  3KYD B;  1H9G A;  3GVA A;  2HEO A;  3SDB A;  3PNY A;  1CF7 B;  4A69 C;  2VIX A;  3GYH X;  2XPV A;  1BR1 A;  5DS9 A;  1YJN I;  3FXU A;  2BW3 A;  2C6Y A;  2VJI A;  5HDN A;  1U9O A;  4PDK A;  4M9Z A;  1ZEL A;  2FBI A;  3JRF A;  1MJB A;  1TQP A;  3WGI A;  3CJR B;  4KMF A;  2CV0 A;  3LAJ A;  2AXT C;  2RNG A;  3QWL A;  1K4T A;  3J7Z I;  4ENK A;  1ZK8 A;  1LJ9 A;  3K4J A;  1X3Z B;  3GTQ J;  2VBZ A;  4E7J A;  2TCT A;  4PJ0 C;  1U5T C;  3GFI A;  1HLV A;  1ITY A;  1XGO A;  2DQR A;  2I5U A;  5F04 A;  2K40 A;  3M3Y J;  1D0Y A;  1PJR A;  3S1Q J;  3HTU A;  3TBI A;  2NVQ J;  1YLF A;  4IRH A;  1MMA A;  3DF8 A;  2V79 A;  3CUO A;  3G1M A;  3TOB A;  3ZQ7 A;  4XLA A;  1GVJ A;  3EPZ A;  2FQ4 A;  4CH7 A;  2DQL A;  2AXL A;  1IO2 A;  4L9T A;  4C2T A;  2BXY A;  2K9Q A;  2A5Y B;  3NQO A;  2E1N A;  4MTD A;  1GXP A;  2UV1 A;  1X1B A;  2E36 A;  1R4M B;  2M2E A;  1Y6I A;  3KEO A;  1T8I A;  5IYD J;  3JTH A;  1G2H A;  2CFO A;  3ABL H;  2LRD A;  1TWA J;  3K1M A;  1ZAR A;  4ESF A;  3EUA A;  1VQ8 I;  3HOV J;  4EVI A;  3S1N J;  3EUH C;  5DD8 A;  2ISZ A;  4DYC A;  3DLA A;  3CC4 I;  1TC3 C;  3RCO A;  4MTE A;  4P1W A;  3E1S A;  5H6R A;  4M3E A;  1MMN A;  1E17 A;  4FE4 A;  1XPX A;  4FT8 A;  2R5Y A;  2NRA C;  1ETK A;  4XLC A;  3DWL E;  2NAZ A;  3KX2 A;  3CO6 C;  2R5Z A;  1R9T J;  3H1C A;  2JA7 J;  3E97 A;  4NUB A;  5H6Q A;  3KP2 A;  4GCV A;  1YW9 A;  4HST A;  4P9F A;  3JRD A;  1TWH J;  1MND A;  1Y8Q B;  4HLY A;  3RZD J;  1LE8 A;  2BGC A;  1SVL A;  3QPL A;  2HU9 A;  2H8W A;  4E7H A;  1WI3 A;  3CCL I;  3BQZ A;  1Y1W J;  1PDN C;  2UZK A;  2Z99 A;  4HF2 A;  3W2A A;  4IRI A;  5J8F A;  3CMA I;  3MAJ A;  5GAH J;  3VEP A;  2DFE A;  1PVE A;  4WF2 A;  2DPD A;  2D1V A;  1BIB A;  1MMD A;  1R5I D;  2LKS A;  1LDJ A;  1K6Y A;  2PG4 A;  3BZK A;  3ZMD A;  2DK5 A;  3V42 A;  2L2O A;  4LMY A;  3JTG A;  2JZY A;  3V7S A;  3JSP A;  1T95 A;  2WV1 A;  4BJ6 C;  5LBQ A;  1UMQ A;  2Y0S N;  1DU0 A;  2BYV E;  2V9K A;  2DN0 A;  3ZR8 X;  4F3Q A;  4J19 A;  5E79 C;  5TIS C;  4HNU A;  3K70 C;  3HRM A;  3J7A O;  1UHM A;  3CC7 I;  1TNS A;  1XGM A;  5E1X A;  3TP0 A;  5E3O A;  1MDM B;  3I0T A;  1NHA A;  1OYI A;  4UUT A;  2CRG A;  1IXC A;  5EYR A;  1WH5 A;  1FIP A;  1TL8 A;  1D8J A;  3Q5F A;  2PJR A;  2BZT A;  2KZV A;  1IDZ A;  3OOP A;  3HUG A;  4QPO A;  3P7N A;  4B8X A;  2FE3 A;  2VJJ A;  1JTY A;  2NS8 A;  3FX3 A;  1E2X A;  2VON A;  1TNT A;  3HKZ A;  4U88 A;  4HLX A;  3TED A;  3O3K A;  3GCM A;  1ZYR F;  2Z2S B;  2GIZ A;  2ZNZ A;  2CW0 F;  3FWE A;  3TGN A;  1VND A;  3KZY A;  4V19 K;  5F1J A;  1FC3 A;  4N9H A;  1BI2 A;  3RKY A;  5IOZ A;  2E1M B;  3PIO F;  3OIQ A;  4WX9 A;  1T38 A;  2XAJ A;  4DYR A;  4HV6 A;  3R0A A;  5ICG A;  1SVO A;  1V5G A;  3E6C C;  1HSJ A;  2GAU A;  3LST A;  2CSO A;  3JCU C;  3CCS I;  3HXL A;  2MH9 A;  1B1B A;  1NH3 A;  1HCR A;  1HOM A;  5L3G A;  2EZI A;  1X1A A;  2EIL H;  1IRZ A;  3K4C A;  2V6C A;  4KIS A;  3WTW C;  5IYB J;  2HPM A;  4YIF A;  2Z5U A;  1YJ9 I;  1DP3 A;  1IDY A;  2K02 A;  4XM3 A;  4IX7 A;  1IN7 A;  1P92 A;  3IH2 A;  4XLP F;  1JKO C;  3K4K A;  1HXD A;  4IHT A;  3FDY A;  5EF6 A;  3AFH A;  3BG7 A;  2CO5 A;  1LDD A;  2R7R A;  4IHS A;  3DTI A;  1YW7 A;  2L9V A;  3WTU C;  2X6Y A;  4M73 A;  2L02 A;  4ON0 A;  2R0Q C;  3I4M J;  2M4K A;  1STZ A;  9ANT A;  3QOE A;  1BJZ A;  2HZT A;  2P0W A;  1R00 A;  3DEU A;  4II3 A;  1IXR C;  5JFR A;  3FM3 A;  1ETX A;  2AQE A;  1V4R A;  2E1O A;  2ZME C;  5FLX Z;  2STW A;  3ISP A;  3KEQ A;  2R5Z B;  2VPL A;  2LYC A;  4GYI A;  2E5N A;  2XSD C;  4UB8 C;  1O7L A;  4BAY A;  4XQF A;  1SVM A;  2DT5 A;  3BLY A;  3V7R A;  3ZMU A;  5BS6 A;  4V2G A;  4UV9 A;  3PFI A;  1TWG J;  2K5C A;  5J8C A;  1R7J A;  5M3M J;  3FHZ A;  5TGT A;  4LG0 A;  4U7B A;  2G7U A;  4U0V A;  4KIC A;  4XKB A;  1PUE E;  5LEJ A;  2Y30 A;  1T98 A;  1HST A;  1MSF C;  1ZGA A;  3BR1 A;  4Y15 A;  1BR2 A;  4EJO A;  5ICF A;  4B48 A;  3WHB A;  4ASN A;  1K61 A;  1LFU P;  1WJC A;  4M3D A;  1WSU A;  5IT9 K;  2FJ1 A;  4LK0 F;  4HDV A;  1BM9 A;  4A3L J;  1S7O A;  3F9K A;  1K79 A;  3BG9 A;  4FTH A;  1YJW I;  5C4X J;  3M1E A;  2X4H A;  1RC9 A;  3DPU A;  3EUK L;  4EEF G;  3WTY C;  1MD0 A;  1SD5 A;  2DK8 A;  3GTP J;  1ODD A;  4O5V A;  3GEZ A;  2Q2E A;  2DCE A;  2A6E F;  3QP5 A;  4HW0 A;  5K7H A;  3GTG J;  1IRF A;  4ZTF A;  1LVA A;  3KP6 A;  5EZG A;  3WTT C;  3BQY A;  2CQK A;  1YG2 A;  3IAS 2;  4M3B A;  5EDN A;  2YSR A;  4HQE A;  1FYK A;  1I5Z A;  5DDG A;  1UZC A;  2VKE A;  1X1C A;  3KIO A;  1SMY F;  3AG2 H;  1WHU A;  2BY3 A;  5J3L A;  2GXG A;  2W24 A;  5F0C A;  1OR7 C;  4Y52 J;  2LRE A;  2M3A A;  3CDL A;  1SD4 A;  4D1Q A;  4I0B A;  3V7C A;  4WCG A;  4ZYD A;  5DCF A;  5J1U A;  2H6B A;  2ACJ A;  3U1K A;  1NK2 P;  1GLN A;  1XSD A;  1KQ8 A;  3F8N A;  5CQE A;  2G9W A;  1CQT A;  4KN4 X;  3ULQ B;  2L7F P;  2V9P A;  2JVH A;  2KZG A;  1VFC A;  3HOY J;  3G73 A;  2VPR A;  1W4M A;  1P7I A;  3HRU A;  2RKH A;  3G6E I;  3K4N A;  4C3J J;  4EGY A;  3DP7 A;  2CW7 A;  1HW1 A;  4BHP A;  3H92 A;  1LNW A;  1S7E A;  1LKX A;  3DBL B;  3PM1 A;  2FXA A;  2K3P A;  4RLQ A;  1P4X A;  3QAH A;  5CVJ A;  4GDF A;  3MCZ A;  4P96 A;  5FRN A;  3JRC A;  4XLN F;  2R7Q A;  3CP8 A;  5EG0 A;  1E0E A;  2HYF A;  4PUS A;  1XCV A;  2O0Y A;  1SFU A;  1EF4 A;  3F72 A;  5D8K B;  3FIS A;  2JPC A;  3GME A;  4HEA 2;  5EEA A;  4A3F J;  1OJL A;  1RI7 A;  3BTI A;  4C3I J;  5ILV A;  2E35 A;  4RS8 A;  2WAE A;  3C7J A;  2HDC A;  2XSJ C;  1HA8 A;  3PFY A;  2OQG A;  4L5E A;  1U78 A;  1U5T B;  1X2M A;  2VKD A;  3CF5 F;  1J2X A;  1JJ8 C;  3PJR A;  5GAG J;  3V8L A;  2E19 A;  1P4W A;  1VQ7 I;  3NWT A;  1YIT I;  3DQV C;  3W3C A;  1RET A;  2O7O A;  3I9V 2;  1L0O C;  1X4O A;  2EFW A;  1FYM A;  3DPT A;  3J81 K;  2KQR A;  4C9Y A;  1I39 A;  4AM3 A;  2FQ3 A;  3CCJ I;  3E5X A;  2DLL A;  4EJW A;  5E3N A;  2LP0 A;  3S3O A;  1YOV B;  2VL8 A;  1BOA A;  5FKO A;  1YRN A;  2D5V A;  2XGE A;  1HW2 A;  4A3D J;  3G1O A;  3GWZ A;  2PEX A;  1ORK A;  4LG0 B;  1G8X A;  2ME6 A;  2DDB A;  1XB4 A;  2KT0 A;  2WBM A;  1EH7 A;  3OYE A;  3JSO A;  3HYI A;  2ZJ2 A;  5H2F C;  5DUI A;  1VQP I;  3AKZ A;  1AOY A;  2MD5 A;  2DOE A;  5GAE J;  3M4O J;  1S8N A;  3O6B B;  1IUF A;  2J5O A;  2LH9 A;  5BNG A;  5CYV A;  1APL C;  3CZ6 A;  3ZN0 A;  5H20 A;  1AKH B;  3H9G A;  1BBY A;  5HOO A;  2OU2 A;  4B47 A;  4MEX F;  2F5D A;  3MZH A;  2DDA A;  2FBK A;  3ABU A;  5CVU A;  4GGG A;  4MNU A;  2FMY A;  5F0H A;  2D1H A;  4OIR F;  2F4I A;  4RAG A;  2QSG X;  3OYF A;  4E6K G;  2JA8 J;  2OTJ I;  4K2E A;  4HF0 A;  5CPR B;  2TRT A;  2A6T A;  4N4O B;  3U2R A;  1Z9C A;  3VYU B;  3A03 A;  1B72 A;  1QPI A;  1O3T A;  2XVC A;  4C2M J;  2GM4 A;  4A3K J;  2CUF A;  1DGW Y;  1IN8 A;  1CGP A;  2EPF A;  1XGN A;  4PJJ A;  3IV5 A;  2XHK A;  3HSR A;  5K5Q A;  1ZAO A;  3ZMV A;  4C3H J;  3Q0U A;  1KGS A;  2KIS A;  3S2W A;  1FSH A;  4HA8 A;  3L2R A;  2HTS A;  3WTX C;  2Q0O A;  3F3X A;  3K7A J;  2EA4 A;  4RMN A;  1R23 A;  2K9N A;  2JUG A;  1ZRC A;  4BGD A;  4DW6 A;  2DA7 A;  1T6S A;  4NC6 A;  2HVQ A;  3CF2 A;  3P9C A;  2E1M C;  3RYP A;  3R0J A;  2WB1 N;  1I50 J;  2MAB A;  1FY7 A;  3J80 K;  2W25 A;  2W7N A;  4L18 B;  1U2W A;  3HB9 A;  2PN6 A;  2XGC A;  1U8B A;  4N4N B;  1YI2 I;  4HYE A;  2A05 A;  3F8C A;  3GUD A;  3LA3 A;  1FNN A;  3SYT A;  1X2N A;  2IGO A;  5LHI A;  2X1E A;  5BPI A;  1QHH D;  2YR2 A;  2NYX A;  2VT2 A;  2JRT A;  5M5Y J;  3OWT A;  1NTC A;  2VOD A;  4GFB A;  4I2O A;  2P81 A;  4JK1 X;  1FOY A;  1P4A A;  4BHC A;  4NQW A;  4AU7 A;  1LQ1 A;  3FZV A;  4FCY A;  3DPL C;  1U0J A;  3WHC A;  1USS A;  5DTD A;  5K5O A;  3LMM A;  2DO7 A;  1T56 A;  2KIF A;  5FFX A;  5B1B H;  2EZH A;  4S04 A;  3RPU D;  1B9N A;  1ZG1 A;  5FRM A;  3PSI A;  2OTL I;  2HXI A;  2JVG A;  1D1A A;  4ZZD A;  4LFU A;  2M0M A;  1JJ6 C;  3B6A A;  1W0T A;  3VSL A;  2XGX A;  1OLT A;  3WU0 A;  3JAM K;  1MH3 A;  3S16 J;  2E5Z A;  2Y31 A;  3CUQ B;  5BQT A;  2ZKZ A;  5J47 A;  1YS7 A;  3GLL A;  4S05 A;  4E7L A;  1J09 A;  3BJA A;  3BG6 A;  2RDP A;  3BJ6 A;  3NWS A;  2RRE A;  2XAS A;  2V1D A;  3M1C A;  3IKT A;  5L3B A;  2XIG A;  5C4J J;  5JI6 A;  3BC8 A;  1OYY A;  2STT A;  3T8T A;  1MBF A;  1X1D A;  3CLQ A;  4ZTJ A;  1SC7 A;  1T33 A;  1A04 A;  1EH6 A;  2RV8 A;  2CUJ A;  4RAY A;  2Y69 H;  2FEZ A;  1A36 A;  5BMZ A;  3BTC A;  2EBI A;  5AON A;  5L3F A;  3CO7 C;  3V4G A;  5ICC A;  2QBY B;  4YRV A;  2EA2 A;  1JUS A;  4XOP A;  3QYB A;  4QSH A;  3GTJ J;  2X9D A;  1IW7 F;  2A68 F;  3T5X A;  5KK1 A;  2M34 A;  3BT9 A;  4I0A A;  5BPD A;  4A5N A;  2B9S A;  2HKX A;  4R79 A;  2Y0S A;  1WI9 A;  3NAR A;  3W6J B;  1W36 C;  2M45 A;  3C2H A;  4MLO A;  1B72 B;  1K4S A;  2H1K A;  2DOF A;  1LPQ A;  3H5A A;  4QTR A;  1ZQ3 P;  3HHG A;  2L54 A;  4AVZ A;  5FRO A;  2XC7 A;  1IUY A;  3K6G A;  5LFA A;  1MSE C;  3L2U A;  4A3I J;  1WJB A;  4M9X A;  3EET A;  5J4V A;  3OMY A;  4HOB A;  3IWF A;  1BI1 A;  4CZC A;  3A1Y A;  3O8H A;  3SJM A;  2H27 A;  2CUE A;  3DLL F;  2TDX A;  2QQA A;  3HOW J;  3JRG A;  1TTY A;  5GPA A;  3DEE A;  4I99 C;  4RM2 A;  4CO8 A;  4IZZ A;  3I53 A;  4AWX B;  3OIP A;  2V7F A;  4NB5 A;  4OAZ A;  5EGO B;  4CZZ A;  4LIV A;  1WVR A;  1LFP A;  2PJP A;  4IXA A;  2L5Q A;  1OCC H;  1ULY A;  2DA6 A;  4HNV A;  3LFU A;  3DKW A;  3QU6 A;  2JRM A;  2DJN A;  3H5N A;  1UST A;  1EA3 A;  4YII A;  2COB A;  4DOZ A;  4LOC A;  2WAQ N;  1DDN A;  3OYC A;  3TQN A;  1XTA A;  3HPG A;  1BW5 A;  1W7P D;  1P2F A;  3C1D A;  3PIP F;  4EJT A;  2CYY A;  1SAU A;  1QO0 D;  3M07 A;  2V1U A;  1FP2 A;  2KIU A;  2F48 A;  3GZ5 A;  2VQH A;  3JR9 A;  4KIF A;  4A3J J;  4ABZ A;  3FKI J;  5HOD A;  2LC2 A;  3S93 A;  2MYS A;  3ZPL A;  4WK8 F;  4G7Z F;  2ZXH A;  1JTX A;  1VQL I;  3CP2 A;  1BIA A;  3ZGK A;  1JKQ C;  3GLX A;  3BCA A;  1WCM J;  5D6F A;  2DAO A;  2LG4 A;  2K85 A;  5DV5 A;  4XRF A;  3FK6 A;  3MKW B;  3ZN1 A;  1O4X A;  1EJ9 A;  5E8G A;  3Q0V A;  4DJA A;  2IA1 A;  3FXK A;  1F1Z A;  3K9T A;  5IY5 H;  1JHF A;  3ZQH A;  3FXO A;  1RES A;  4P9U A;  4B09 A;  2XRL A;  1D5V A;  4A0Z A;  1IN4 A;  4A12 A;  2A69 F;  2QQ8 A;  3IRQ A;  2HI3 A;  2B63 J;  1S72 I;  4YG2 F;  3PNT A;  4DIQ A;  2QUF A;  4IKF A;  4UV8 A;  4EJU A;  3I64 A;  4M72 A;  3S8P A;  1B4A A;  1EKE A;  4NBQ A;  1D0X A;  1TQI A;  1W5T A;  3HGY A;  3ZQI A;  5ERI A;  5K7Z A;  2D45 A;  2IPQ X;  2EZL A;  5B66 C;  3COA C;  1H0M A;  2K86 A;  3WTS C;  2QLZ A;  1B8I A;  2IS2 A;  2YU9 J;  3MZ8 A;  1E3H A;  2LNB A;  2NNY A;  2ID6 A;  3BCB A;  2UUZ A;  4RGX A;  4GXO A;  4OIP F;  2BOL A;  1JGS A;  2K4J A;  1XSX A;  2AHQ A;  3KET A;  5KHD A;  2OUM A;  2QF7 A;  2KL4 A;  4BNC A;  2Z16 A;  5D4S A;  4JOM A;  2EH3 A;  3LA7 A;  1FPQ A;  1OCO H;  2BE5 F;  3PO3 J;  3S14 J;  3MQ0 A;  3S3N A;  1REP C;  4A93 J;  3ZQF A;  1QGP A;  2Y75 A;  3LA2 A;  4L9V A;  4BXF A;  1YS6 A;  3UNG C;  3ML6 A;  1TQM A;  3M9A A;  1ZKG A;  3H36 A;  2JSP A;  2ISY A;  3I59 A;  1TWF J;  3K70 D;  2D2W A;  3R61 A;  1K78 A;  2HQN A;  4KT5 C;  2DFI A;  3G2B A;  1O3S A;  3CC2 I;  2VI6 A;  4DGW B;  1WH7 A;  4UXN A;  1JXS A;  4LK1 F;  3ELK A;  5IPA A;  2NVX J;  1POG A;  5F1R A;  3EYI A;  3F8M A;  2Y48 A;  3RJP A;  4C30 A;  3TP3 A;  1MBK A;  2ADU A;  5D5U B;  2XDV A;  2YX4 A;  4QIW N;  3FF5 A;  4JQF A;  4J01 A;  2ESN A;  1UB9 A;  3JRA A;  3HHH A;  2PMZ N;  4XRM A;  1JKP C;  4IHX A;  4A0Y A;  2EWN A;  2JPB A;  4XNF A;  1B6A A;  5LRS A;  1R36 A;  2MGQ A;  4M9S A;  4D9J A;  3R6S A;  3E6M A;  3JW4 A;  4XKW A;  4ZYG A;  2KKO A;  1DPU A;  3H0D A;  1RR7 A;  5JVT A;  4ESB A;  2DMU A;  2L7M P;  1FTT A;  4MO7 A;  2HFH A;  3RPU A;  2HDW A;  3BJO A;  3HPH A;  2XV4 S;  3E3V A;  1QNT A;  2M1B A;  4GRI A;  4IL6 C;  1D5Y A;  6PAX A;  3TW6 A;  2PFB A;  2QA4 I;  1R4N B;  5GPC A;  3QPH A;  3F23 A;  5IP9 J;  5E1W A;  3WTV C;  2QYO A;  1FOX A;  2BW3 B;  3DU5 A;  5D4R A;  1Z6T A;  1W5C C;  3IRR A;  2FF4 A;  2BHY A;  2X6O A;  3FXR A;  4IQ4 A;  1ON1 A;  4E7S A;  1R1T A;  4HX7 A;  1G3W A;  2LBF A;  2E34 A;  2M7B A;  2JA6 J;  4FAS D;  3CJQ B;  3LL7 A;  1FZP B;  3OYI A;  3F6O A;  2JQ7 A;  2E7W A;  2QWW A;  3KPH A;  3OIO A;  4HF1 A;  3HOZ J;  4CCJ A;  1JGG A;  2P6T A;  2WTE A;  1FOW A;  3M7G A;  4BEH A;  2DMT A;  2R7F A;  3K4B A;  1ON2 A;  4ZDO A;  2HYJ A;  1FBS A;  4FX4 A;  2GA1 A;  1HKQ A;  1YYV A;  2X1D A;  3CCM I;  4G6D A;  3LFK A;  5L3D A;  3CUQ C;  3BOQ A;  4F93 B;  1I3Q J;  2QZ8 A;  1G3Y A;  3Q0W A;  4E7I A;  4CSW A;  2K27 A;  2QSH X;  2EIK H;  2HR3 A;  2XAU A;  1O57 A;  3ABM H;  4OU0 A;  1F36 A;  4AYB N;  3OYN A;  1M1E B;  2DYR H;  2HWV A;  2OZ6 A;  4XOT A;  4KA4 A;  2UWM A;  3VYS B;  1BC8 C;  4B44 A;  1A6Q A;  2I8D A;  2HOT A;  4QWQ A;  4KFC A;  3H35 A;  4XN3 A;  2HDD A;  3HZJ A;  2CU7 A;  3ZMZ A;  2DYS H;  3HEF A;  3K10 A;  2WAF A;  2ZJQ F;  2M4G A;  4A3M J;  3KE2 A;  1HDP A;  1MBH A;  1VQO I;  3ZXS A;  3B02 A;  4XID A;  3Q3S A;  2R5Y B;  3FHN A;  4HZF A;  3RKQ A;  1SD7 A;  5K5R A;  1VQN I;  4KDP A;  2EK5 A;  2MLG A;  2F6C A;  5J6X A;  1XN7 A;  1FEX A;  3I5U A;  2QEX I;  2KPM A;  5EEG A;  2R7W A;  1GUU A;  2Q1Z B;  2F4O B;  4ETS A;  2X6X A;  1QRY A;  5FFZ A;  5HDG A;  1LE8 B;  1P9Q C;  3E5U A;  2KHM A;  1PUF A;  4O3M A;  1TT5 B;  5HS7 A;  1RIO H;  5B1A H;  3TOA A;  1J9I A;  2XKP A;  4YIR X;  1RRJ A;  1MBG A;  1Q1V A;  2MC3 A;  3ZQC A;  2LDU A;  2RVC A;  4RAZ A;  3FXL A;  4IOA F;  1DP7 P;  5EEH A;  3L9F A;  5J40 A;  5HLG A;  1W7P A;  2P5K A;  4XR6 A;  5C44 J;  2ECC A;  1SFK A;  3ZRG A;  1SFE A;  3WE3 A;  1FOK A;  3K2A A;  2JN6 A;  2XB0 X;  4CA0 A;  1HDD C;  3SHF A;  3ESW B;  3DCF A;  4G12 A;  2W57 A;  4JX4 A;  4BQN A;  2EV5 A;  1OCP A;  1UHW A;  1FP1 D;  1KQ0 A;  2W4S A;  2VN2 A;  2ZFW A;  2L9R A;  4HBL A;  3N05 A;  2QKL B;  3NEU A;  2ZJP F;  2MSY A;  2IW5 A;  2P4W A;  2FRH A;  5ICE A;  2FNP A;  3GO5 A;  3HM5 A;  3W6V A;  4U7D A;  2PX9 A;  2PJR B;  2WY7 Q;  4Q47 A;  3IC7 A;  4F55 A;  3HUG B;  4RM3 A;  2Z9O A;  1XCB A;  2CMP A;  2JT1 A;  3KP4 A;  1OQY A;  2KJB A;  2BY1 A;  1QZE A;  4XMY A;  3A0H C;  1R49 A;  4NC8 A;  3S1M J;  4BXX J;  3MVP A;  2XAQ A;  4ZYH A;  3LSR A;  2FU4 A;  4PGG A;  4MGR A;  3PQJ A;  2QQ9 A;  4ZDP A;  1O7F A;  4EM2 A;  1MZB A;  1RUN A;  4QPQ A;  4IQJ A;  4KN7 X;  4GO1 A;  3SEQ A;  4G7H F;  2PLY A;  1S3J A;  2JA5 J;  2AQF A;  5L3C A;  3REO A;  2MW8 A;  4PGH A;  2HYG D;  4ZC3 A;  5E20 A;  3OYJ A;  1Z77 A;  4BY7 J;  1IRG A;  5GAD J;  1UFM A;  4B1R A;  2IEK A;  3BPV A;  5AIQ A;  1XGS A;  2L3D A;  1MMS A;  2P5V A;  2VQG A;  2MLK A;  2OF7 A;  2X85 A;  3WG9 A;  1H88 C;  1ZTR A;  1I1G A;  3I58 A;  5F0F A;  5IP6 A;  4ENJ A;  3CCQ I;  1WKM A;  3OYA A;  1IXS B;  2LFB A;  1RZ4 A;  2GOX B;  3FBI B;  3LNQ A;  5LGN A;  4LGW A;  2LKX A;  4JP0 A;  3LSJ A;  1R22 A;  3HJE A;  2FNA A;  5CJ9 A;  3CTA A;  1VQM I;  3PUF A;  4XKV A;  3HIF A;  1ETW A;  4XOR A;  4MIM A;  3VOD A;  5HNH A;  2E60 A;  5E8I A;  4BH9 A;  4F91 B;  3B73 A;  3L09 A;  2JTV A;  4IHY A;  4ZYE A;  3S2H J;  1BW6 A;  3SZT A;  5J1Y A;  3L2Q A;  2K3F A;  3OR1 C;  4M74 A;  2P5L C;  2FSW A;  3OV8 A;  1P6R A;  2F5F A;  2ESH A;  1V5E A;  3OS1 A;  3F0C A;  4KNY A;  5E18 F;  3EQL F;  2L4A A;  3C2G A;  2DXI A;  4BQA A;  4G94 A;  2LF8 A;  1XDS A;  4AID A;  2MBF A;  2H1L A;  4U87 A;  2Y9Z A;  3P9I A;  1PUF B;  2LSO A;  4PJM A;  3CMM A;  4FHT A;  4IHV A;  5DCM A;  3CLO A;  4HSR A;  3OS2 A;  1XDU A;  4WXC A;  3CDI A;  3K4L A;  3KFW X;  2V9V A;  1LFB A;  3QPS A;  3LSI A;  1F4K A;  3ASN H;  2Z33 A;  1QZZ A;  3U1D A;  5F08 A;  1HC8 A;  1MW7 A;  1IG7 A;  2VBW A;  4FE7 A;  2Z1D A;  2ZJR F;  3BR0 A;  1YO5 C;  3A4C A;  2XKO A;  2NXN B;  4G9Y A;  2ZO4 A;  2IA0 A;  1KA8 A;  3FXJ A;  4MEY F;  3HOU J;  4BY1 J;  1TWC J;  1A31 A;  4A3G J;  3KLO A;  3WGG A;  4UUS A;  3HSF A;  4IJA A;  4NHJ A;  2YU3 A;  2XF6 A;  3KZI C;  2Q2E B;  3M8J A;  2DOD A;  5JHU A;  2EQR A;  2E71 A;  3A02 A;  4N0B A;  2OQR A;  2OJE D;  4A2U A;  4U0Y A;  1QHG A;  3KCC A;  2IGN A;  2VKV A;  2HKO A;  2ZME A;  4CYC A;  1RPW A;  4Y33 A;  3WOD F;  1I6X A;  4XKC A;  4FET A;  4XLF A;  3CME I;  1YE9 A;  2LTP A;  1X3U A;  1WJF A;  2H09 A;  3AG1 H;  3WGH A;  3TDU C;  1RKT A;  3GZ6 A;  4P5O A;  4D7N A;  1FX7 A;  4OWR B;  3WU2 C;  4PFO A;  2RN7 A;  4O6J A;  4FX0 A;  2EFO A;  3HSE A;  4V2F A;  1JKR C;  1UCR A;  1Z21 A;  1S5L C;  2LK2 A;  4X6A J;  2CQX A;  2VT3 A;  5LGT A;  4DBQ A;  1U6G A;  3ZMS A;  2DJI A;  2Y9Y A;  3M8F A;  2HZD A;  3BZC A;  3QP6 A;  3LSM A;  2QGU A;  3S17 J;  2HTJ A;  5E1Z B;  1HQC A;  3EDP A;  3ZP5 A;  4B3X A;  2VOO A;  3F21 A;  1S9H A;  1XMA A;  3MKY B;  2WV0 A;  3H5R A;  2KJC A;  4CCO A;  2OAZ A;  3S15 J;  5IT9 Z;  3TDZ C;  3DTK A;  3LSH A;  4PCQ A;  1Z0X A;  3MKL A;  5EG0 B;  4B4C A;  3T8R A;  5TJJ A;  2R7Z J;  1EV7 A;  3KP5 A;  3OL4 A;  1Y56 A;  3ABK H;  3PQK A;  1HKS A;  1IGN A;  4NC7 A;  1IJW C;  4UVB A;  4UVC A;  5F27 A;  4AD9 A;  1IV8 A;  1I1S A;  4CHU A;  2NNN A;  1T0F A;  4BQQ A;  2A07 F;  4QLC U;  1O3R A;  4A3E J;  2O3F A;  4XK4 A;  5HLI A;  3OSG A;  4KMU X;  4C2U A;  2QCO A;  2HPI A;  1B59 A;  3Q9S A;  1CF7 A;  2A5W A;  2DI3 A;  3GF2 A;  1N75 A;  1D3Y A;  4D5C A;  5EZH A;  4HAM A;  1BA5 A;  3KZZ A;  4EM0 B;  2HOA A;  3GFM A;  4BQO A;  5BOX A;  5D6E A;  3F6V A;  5DD4 A;  4BJ5 C;  2XF5 A;  3NAU A;  3LSG A;  2W85 A;  1FWZ A;  2LF7 A;  2P7V B;  3QQA A;  3TKY A;  4GYG A;  1YX3 A;  1I6H J;  3DU6 A;  1XD7 A;  5CVR A;  1W36 D;  3DTE A;  3B6C A;  4X1E A;  1YRN B;  1OKR A;  3L00 A;  2QQB A;  1YW8 A;  1FLI A;  4RAF A;  1WRJ A;  4JX5 A;  2ZBK A;  4A0X A;  2HVR A;  2R7T A;  3R60 A;  2JA2 A;  4AIK A;  3OL3 A;  1BC7 C;  1ZLJ A;  2K9M A;  5JVG F;  2FOW A;  4EV0 A;  4XRS G;  2XPW A;  1R6R A;  3DKY A;  3KYC B;  2IS4 A;  2LMD A;  2HVS A;  5B3S H;  3FXQ A;  3O8G A;  5LRR A;  4NDL A;  3DFG A;  1UEL B;  2XRN A;  3I3L A;  1GT0 C;  3RKX A;  2PMZ A;  1Z7U A;  3N4M A;  1MNM C;  3DKX A;  2VAS A;  4ENN A;  2PMH A;  4KIT B;  2HXO A;  4G6T B;  2RQQ A;  4BYY A;  3CQZ J;  5J1R A;  3I4N J;  1NG6 A;  3OYD A;  3K0L A;  1PP7 U;  2NVT J;  5KAI C;  1WJD A;  3GTK J;  4PFP A;  3E5Q A;  5D5X B;  2JMW A;  1DUX C;  2H8R A;  3KP7 A;  1SD6 A;  2JJ7 A;  3E7L A;  2IS6 A;  2CJJ A;  3IHU A;  1T39 A;  2R7O A;  2R7D A;  4Y7N J;  3FK7 A;  3H3Z A;  3SZP A;  2QVO A;  3ABT A;  3IAM 2;  2X51 A;  4EMS A;  1FBU A;  2J5P A;  2QM3 A;  2XAG A;  3RKW A;  4I76 A;  5D8L B;  2O8X A;  2OV7 A;  3Q9V A;  4A3C J;  3WE2 A;  3VB2 A;  4IVN A;  3HL2 A;  3S3M A;  2R92 J;  2W48 A;  1HKT A;  1TLH B;  1V54 H;  3SFZ A;  1MBJ A;  3IL2 A;  2F5C A;  2XF7 A;  1R1U A;  2YS9 A;  1SMT A;  1T08 B;  1HBX G;  1Y1V J;  2BBY A;  2XAH A;  5GTI C;  2ETH A;  4BU2 A;  4ZJZ A;  1S6L A;  5FD6 A;  3MFK A;  1RUO A;  4EAT A;  2EFQ A;  2DMN A;  2LR8 A;  2EV6 A;  2V26 A;  3CJT B;  4RGS A;  3ROU A;  3CMY A;  4X0G A;  3QU3 A;  1WZ2 A;  4LIU A;  5LEK A;  2VLA A;  3ZCO A;  3MKZ A;  3AG3 H;  1SEU A;  1GDT A;  4RBO A;  4ESJ A;  1IN6 A;  1QVT A;  2DOA A;  4BDZ A;  1QBJ A;  5KNL A;  1WJA A;  2MFZ A;  4RGR A;  1C0W A;  2VOP A;  1YIO A;  4G7O F;  2COM A;  4F52 A;  1R5H A;  1X58 A;  3MWM A;  4ZZL A;  5JR3 A;  5HNF A;  3ERE D;  2GXB A;  2K4B A;  2G0E A;  2LY1 A;  4PZJ A;  5LD2 C;  4NQW B;  1SFX A;  1Y39 A;  1MDM A;  1JT0 A;  4W1U A;  3D5S C;  3PUB A;  4OAY A;  4AYB A;  3LAP A;  4BBR J;  3OR2 C;  1ZHF A;  4XLE A;  4XL9 A;  1N77 A;  2KLO A;  3MZY A;  1RNL A;  3OYM A;  3BG3 A;  5FLX K;  2O8K A;  3IH4 A;  2O61 A;  5A2Q Z;  1ZGJ A;  1Z6R A;  1Z05 A;  4XSZ F;  3K2Z A;  4AIH A;  2G7H A;  4Q5S F;  5GTH C;  3BP8 A;  3OS0 A;  5FKN A;  1ZG5 A;  3SXY A;  2DBB A;  1KU3 A;  5M5W J;  4F92 B;  3L2W A;  4CIC A;  2ZFU A;  1QU3 A;  1Y8R B;  3GFJ A;  2F5E A;  2KRC A;  2VC0 A;  2BVM A;  2EFN A;  2RGV A;  1WPK A;  1B9M A;  3RIR A;  5ILU A;  1WFX A;  4IOC F;  3DBR B;  3W6K B;  4L0Z B;  5DM7 F;  4CGZ A;  2NS7 A;  1R71 A;  2LLK A;  5K1Y A;  1G3T A;  1G3S A;  3OYG A;  5D5V B;  1MMG A;  1QPM A;  1SAN A;  4HG2 A;  1ETY A;  3AAF A;  3LQR A;  3I4P A;  4LJZ F;  1U9N A;  3J80 Z;  2NVU B;  3G71 I;  2ZXW H;  3JRH A;  1Z3Y A;  3L2V A;  5CVV A;  2VE9 A;  2CV1 A;  1YX5 A;  4BE0 A;  1WQ2 A;  2VJ4 A;  2WA0 A;  1P7J A;  1RKW A;  2L01 A;  4J00 A;  2GXA A;  3VDX A;  4RB2 C;  1OCR H;  2R7V A;  1S7A A;  5ILS A;  4EM1 A;  2MC4 A;  2L9S A;  4YEJ A;  2CQQ A;  3S32 A;  3L7W A;  5JLW A;  1V55 H;  2HGC A;  3P9K A;  2ICW G;  2PBI A;  1F5T A;  3CCE I;  2R4G A;  4E7K A;  3KEY A;  1LVK A;  4W97 A;  2KDZ A;  5HVQ C;  1X3W B;  1U3E M;  4ZH4 F;  2M5W A;  1DQU A;  4IEJ A;  5FD5 A;  4AIJ A;  2BV6 A;  2ZXJ A;  3CD6 I;  3E0J B;  1ZH5 A;  1V5F A;  3WTZ A;  2ID3 A;  5IYC J;  4YFK F;  2W00 A;  1A5J A;  5DM6 F;  2M7A A;  2O03 A;  3RSN A;  4HQM A;  5FJ8 J;  1KU2 A;  3JAM Z;  3ZMT A;  2O9L A;  2X48 A;  4RA2 A;  2CS3 A;  4OMZ A;  4L9J A;  3QPT A;  3SEZ A;  1FBQ A;  3OY9 A;  2Y0M A;  1BR4 A;  4M71 A;  5ED4 A;  3AG4 H;  4A5M A;  3ZQG A;  2UXN A;  4IRG A;  2R7X A;  1AHD P;  2DMP A;  3HOS A;  2ZNY A;  1LEB A;  3TL4 X;  3OOU A;  1MH4 A;  4BJT A;  3BR5 A;  3J7A Y;  5DEQ A;  2FML A;  1Y0N A;  2M87 A;  2L7K A;  2E2I J;  3H9J A;  4ZYA A;  1FSE A;  3MN2 A;  1V3F A;  3HGG A;  3D1N I;  2X0L A;  1ZR4 A;  3HRT A;  2VBY A;  4BHB A;  2GBY A;  4I09 A;  1E3O C;  2L7Z A;  1KYW A;  1H8A C;  4PJL A;  1F43 A;  1ACI A;  4ANJ A;  3GFL A;  4Z6Y A;  1Y0U A;  4IHW A;  3UR3 C;  2RQP A;  1N78 A;  4TV7 A;  1MKM A;  4XRS A;  4UY8 I;  2IXS A;  2VE8 A;  2FBH A;  3AL0 B;  4G6Q A;  4P55 A;  5F6F A;  2CW8 A;  3FKJ A;  3TO7 A;  2IS1 A;  1A6I A;  4I02 A;  2BHZ A;  1FMW A;  1JI8 A;  4F7Z A;  4JX6 A;  3IUO A;  2PI0 A;  3IKV A;  5E3M A;  3BY6 A;  3CCY A;  1G4D A;  5K7F A;  5IOY A;  3CJN A;  4BE1 A;  3LWF A;  2IJL A;  2WY8 Q;  2BVL A;  5LHG A;  1OIS A;  1VQ5 I;  4UHT A;  3KP3 A;  2GA2 A;  1Q1H A;  5AIP A;  1LB2 A;  3FMR A;  2GIV A;  2JK3 A;  2EJR A;  2GQQ A;  1MBE A;  3FXM A;  2CQN A;  2F2E A;  4DNC A;  2DT7 B;  1LDK B;  1T2K A;  4IF4 A;  1TZL A;  3CCU I;  4D0P A;  2XPU A;  1B8I B;  3G3Z A;  3S1R J;  4PK4 A;  2RNJ A;  1D1C A;  1W1W E;  2A3S A;  3U21 A;  5FKM A;  2UXX A;  3LOC A;  5M3F J;  2R7S A;  1DU6 A;  1JT6 A;  3EYY A;  3OYB A;  4HX8 A;  1MGT A;  4HX4 A;  2MD0 A;  3GBG A;  1ERD A;  2LY9 A;  1GXQ A;  2KP6 A;  4II2 A;  1Z1D A;  1ZRE A;  4LD5 A;  3CCV I;  1OFC X;  4BS9 A;  2DW4 A;  3PL8 A;  2FD5 A;  3DV8 A;  4XN0 A;  2P6S A;  5CVI A;  4XBF A;  1NG7 A;  1QA6 A;  4UB6 C;  5LHH A;  1VQ4 I;  1VI0 A;  1KZH A;  4CDG A;  1FYL A;  3I59 B;  4AC0 A;  1SAX A;  3SDG A;  1FMV A;  2PMU A;  4ITV A;  3WU1 B;  2HQA A;  1K78 B;  1BL0 A;  1ONV A;  2H6C A;  2WWY A;  3GTO J;  4BBS J;  1U5T A;  4H0E A;  2YPR A;  1Z7L A;  1XX5 A;  1HF0 A;  3CCR I;  2CUZ A;  1Z3X A;  4CCL A;  2KRH A;  1AU7 A;  2AS5 F;  4MFD A;  2QSF X;  2FA5 A;  3ASO H;  5C3E J;  1IF1 A;  2IP2 A;  5FLM J;  1JUM A;  1GV5 A;  1N25 A;  3BZ6 A;  3F8B A;  1K7A A;  5FB2 A;  2DPU A;  2ELH A;  4OOI A;  5KAF C;  2DTR A;  3H0G J;  3RPQ A;  2BY0 A;  4MFE A;  2OCC H;  3PSF A;  4Y17 A;  3LSP A;  3GTL J;  2L0K A;  1ZR2 A;  5LLQ A;  3IH3 A;  1LUJ B;  4RDU A;  1J59 A;  4I01 A;  1KON A;  2NOG A;  4N9I A;  1K83 J;  4WWC A;  2K9L A;  5KVR A;  5J4Y A;  5CQG A;  3OYH A;  4M6X A;  3M8E A;  3H3U A;  4BE2 A;  3FM5 A;  3OYK A;  2I10 A;  4B3A A;  3MD2 A;  5FKL A;  4EQQ A;  1W0U A;  3ECH A;  2CV2 A;  1QVU A;  3VFZ A;  1OCT C;  4MQ9 F;  4UNO A; 
#chains in the Genus database with same CATH homology
 3EUH A;  1R1V A;  1KYZ A;  2JSC A;  3GX4 X;  1YTY A;  3T1B A;  2IRF G;  4OIO F;  4M6Y A;  4KIB A;  3R4K A;  5HDK A;  4OIQ F;  5E17 F;  2R3S A;  1JHH A;  1JE8 A;  3GW2 A;  3V8J A;  3C18 A;  2E1C A;  1U8R A;  1MJ9 A;  1KU7 A;  3TO6 A;  5CLS A;  3V8K A;  2YX7 A;  2H94 A;  2LKP A;  1ZLK A;  2QEN A;  3C3W A;  3L2C A;  4IPA A;  5DYM A;  3F22 A;  4I7H A;  4MQV A;  2NS0 A;  1XSV A;  2XUB A;  1YFH A;  4L9N A;  3RI4 A;  3K1N A;  2A61 A;  4KUM A;  1S29 A;  4JBA A;  3DXJ F;  1XMK A;  1W5S A;  2VBX A;  4HV5 A;  4LLN A;  2K7L A;  4LLL A;  1WWX A;  4UVA A;  1PP8 F;  2A6H F;  3FMQ A;  2KRF A;  3QOP A;  2HS5 A;  1H9T A;  1BJA A;  2CFX A;  3I71 A;  3RYR A;  4XSX F;  5HS9 A;  1BI0 A;  1FT9 A;  4A6E A;  4EGZ A;  1BI3 A;  4G8X A;  4A6D A;  3HTS B;  3GXO A;  3FMS A;  4BXU A;  1TBX A;  3RTR A;  1DPR A;  4R8H A;  1I27 A;  3HOT A;  1GHC A;  2MH2 A;  2EB7 A;  1IZ1 A;  1W7P B;  3CUQ A;  4LB6 B;  2CGP A;  4RB1 A;  1F9N A;  3TO9 A;  1TW3 A;  4HDU A;  1VTN C;  4DQ2 A;  4RGU A;  1R58 A;  1KU9 A;  2KIM A;  4WXD A;  3BPX A;  2GZW A;  2DU9 A;  2PQ8 A;  3K1P A;  2XRO A;  1HW5 A;  4WXH A;  2VC1 A;  4U0W A;  1J75 A;  2E7X A;  1J5Y A;  2QBY A;  3BDD A;  1BN5 A;  2M30 A;  5HS8 A;  5HLH A;  2Q8K A;  1YQA A;  1ZRD A;  3QRF F;  2WC2 A;  5A2Q K;  4CXF A;  2Z3Y A;  1MJA A;  4L5J A;  5LGU A;  2XAF A;  5DUK A;  2MA3 A;  1O3Q A;  2V1X A;  2VXZ A;  4UUV A;  2HQR A;  2P7C B;  2ZCW A;  1QZY A;  4L5I A;  5L3E A;  4YFN F;  1OMI A;  2O6G E;  1KQ9 A;  1AWC A;  3ECO A;  1G6N A;  3IWZ A;  2GWR A;  3HRS A;  3O2P E;  3VOE A;  3K69 A;  4LB5 A;  1OR7 A;  4Z2Y A;  2OBP A;  3F8F A;  4OIN F;  2RC4 A;  3E6D A;  2EFP A;  3I54 A;  4Q48 A;  1ZN2 A;  4KYW A;  1LEA A;  3T0Y A;  1J0R A;  5DCM B;  1J7K A;  1OPC A;  4CYD A;  4MHG A;  4YFX F;  3N97 A;  5TRD A;  2BEO A;  1D8K A;  5IT3 A;  2EV0 A;  4ENM A;  5D5W B;  4R1H A;  2OA4 A;  1IAW A;  1IN5 A;  2L4M A;  4LLG F;  3E6B A;  2CWE A;  1QQI A;  2IVM A;  3MEX A;  2M8E A;  4EJV A;  4Y13 A;  5FGM A;  4OMY A;  3SQN A;  4E70 A;  3RDI A;  4KIG A;  4Q4Z F;  2ZME B;  3BRO A;  1Z91 A;  2IA2 A;  1ZRF A;  1OYW A;  1ZG3 A;  1EH8 A;  3BWG A;  1TW2 A;  4RB3 C;  5FO5 A;  1R5G A;  3CDH A;  5F64 A;  2P8T A;  3J81 Z;  3U9G A;  2W84 A;  2B0L A;  2HOE A;  4RB0 A;  2OD5 A;  1L3L A;  1K6O A;  2OZU A;  4I98 B;  2FOK A;  4L0Y B;  3D0S A;  2IT0 A;  3NRV A;  3LQQ A;  4AVP A;  3KLN A;  2CG4 A;  3D5L A;  1H9G A;  3GVA A;  2HEO A;  1CF7 B;  3GYH X;  3FXU A;  2C6Y A;  5HDN A;  4PDK A;  4M9Z A;  2FBI A;  1MJB A;  1TQP A;  3WGI A;  4KMF A;  3LAJ A;  4ENK A;  1LJ9 A;  2VBZ A;  1U5T C;  3GFI A;  1XGO A;  2DQR A;  3HTU A;  1YLF A;  4IRH A;  3DF8 A;  2V79 A;  3CUO A;  3TOB A;  3ZQ7 A;  1GVJ A;  2DQL A;  2AXL A;  4L9T A;  2A5Y B;  3NQO A;  2E1N A;  4MTD A;  1GXP A;  3KEO A;  3JTH A;  3K1M A;  1ZAR A;  4ESF A;  4EVI A;  5DD8 A;  2ISZ A;  4MTE A;  5H6R A;  1E17 A;  4FT8 A;  2NRA C;  2NAZ A;  3CO6 C;  3E97 A;  5H6Q A;  3KP2 A;  4GCV A;  1YW9 A;  4P9F A;  4HLY A;  2BGC A;  1PDN C;  2UZK A;  2Z99 A;  4HF2 A;  4IRI A;  5J8F A;  3MAJ A;  3VEP A;  4WF2 A;  2DPD A;  2D1V A;  1BIB A;  1LDJ A;  2PG4 A;  3ZMD A;  2DK5 A;  4LMY A;  3JTG A;  2JZY A;  3V7S A;  3JSP A;  5LBQ A;  2BYV E;  3HRM A;  3J7A O;  1UHM A;  1TNS A;  1XGM A;  5E1X A;  1MDM B;  3I0T A;  1NHA A;  1OYI A;  1IXC A;  1D8J A;  3Q5F A;  3OOP A;  3HUG A;  4B8X A;  3P7N A;  2FE3 A;  3FX3 A;  1E2X A;  2VON A;  1TNT A;  4U88 A;  4HLX A;  3O3K A;  1ZYR F;  2ZNZ A;  2CW0 F;  3FWE A;  3TGN A;  3KZY A;  1FC3 A;  4N9H A;  1BI2 A;  3RKY A;  4WX9 A;  1T38 A;  2XAJ A;  4HV6 A;  3R0A A;  5ICG A;  3E6C C;  1HSJ A;  2GAU A;  3LST A;  2CSO A;  2MH9 A;  1B1B A;  5L3G A;  2V6C A;  3WTW C;  4YIF A;  2Z5U A;  2K02 A;  1IN7 A;  1P92 A;  4XLP F;  4IHT A;  1HXD A;  2CO5 A;  1LDD A;  4IHS A;  3WTU C;  1YW7 A;  4M73 A;  2L02 A;  4ON0 A;  1STZ A;  2HZT A;  1R00 A;  3DEU A;  1IXR C;  5JFR A;  3FM3 A;  1V4R A;  5FLX Z;  2STW A;  3ISP A;  3KEQ A;  4GYI A;  1O7L A;  4BAY A;  3V7R A;  2DT5 A;  3ZMU A;  5BS6 A;  4UV9 A;  3PFI A;  5J8C A;  1R7J A;  3FHZ A;  4LG0 A;  4U7B A;  2G7U A;  4U0V A;  4KIC A;  1PUE E;  5LEJ A;  1T98 A;  1HST A;  1ZGA A;  4Y15 A;  4EJO A;  5ICF A;  4ASN A;  1WSU A;  5IT9 K;  4LK0 F;  4HDV A;  1BM9 A;  1S7O A;  1K79 A;  3M1E A;  2X4H A;  3WTY C;  1MD0 A;  1SD5 A;  2DK8 A;  1ODD A;  4O5V A;  3GEZ A;  2Q2E A;  3QP5 A;  2A6E F;  4HW0 A;  1IRF A;  1LVA A;  3KP6 A;  3WTT C;  2CQK A;  1YG2 A;  2YSR A;  4HQE A;  1FYK A;  1I5Z A;  5DDG A;  1SMY F;  2GXG A;  2W24 A;  1SD4 A;  4I0B A;  3V7C A;  4WCG A;  4ZYD A;  5DCF A;  2H6B A;  2ACJ A;  1XSD A;  1KQ8 A;  3F8N A;  2G9W A;  4KN4 X;  3ULQ B;  3G73 A;  1W4M A;  3HRU A;  2RKH A;  4EGY A;  3DP7 A;  1HW1 A;  4BHP A;  3H92 A;  1LNW A;  2FXA A;  5CVJ A;  1P4X A;  3QAH A;  3MCZ A;  4P96 A;  4XLN F;  2HYF A;  1XCV A;  2O0Y A;  1SFU A;  3F72 A;  5D8K B;  2JPC A;  1RI7 A;  5ILV A;  4RS8 A;  2HDC A;  3C7J A;  2OQG A;  1U78 A;  1U5T B;  1J2X A;  3V8L A;  1P4W A;  3DQV C;  1L0O C;  2EFW A;  1FYM A;  3DPT A;  3J81 K;  2FQ3 A;  3E5X A;  2DLL A;  4EJW A;  1BOA A;  1HW2 A;  3GWZ A;  2PEX A;  4LG0 B;  1XB4 A;  1EH7 A;  3JSO A;  3HYI A;  2ZJ2 A;  5DUI A;  1AOY A;  2MD5 A;  1S8N A;  3O6B B;  2J5O A;  5CYV A;  3ZN0 A;  5H20 A;  1BBY A;  5HOO A;  2OU2 A;  4MEX F;  2F5D A;  3MZH A;  3ABU A;  2FBK A;  5CVU A;  4GGG A;  4MNU A;  2FMY A;  2D1H A;  4OIR F;  4K2E A;  4HF0 A;  3U2R A;  1Z9C A;  1O3T A;  2XVC A;  1IN8 A;  1CGP A;  1XGN A;  2XHK A;  3HSR A;  5K5Q A;  1ZAO A;  3ZMV A;  1KGS A;  3S2W A;  1FSH A;  4HA8 A;  2HTS A;  3WTX C;  2Q0O A;  3F3X A;  2EA4 A;  1R23 A;  1ZRC A;  1T6S A;  3P9C A;  3RYP A;  3R0J A;  1FY7 A;  3J80 K;  2W25 A;  4L18 B;  1U2W A;  2PN6 A;  4HYE A;  3F8C A;  3GUD A;  3LA3 A;  1FNN A;  5LHI A;  5BPI A;  2YR2 A;  2NYX A;  2VT2 A;  2JRT A;  2VOD A;  4I2O A;  4JK1 X;  1P4A A;  4BHC A;  4NQW A;  1LQ1 A;  3FZV A;  3DPL C;  1USS A;  5K5O A;  2DO7 A;  2KIF A;  5FFX A;  4S04 A;  1B9N A;  1ZG1 A;  4ZZD A;  4LFU A;  2XGX A;  3WU0 A;  3JAM K;  3CUQ B;  5BQT A;  2ZKZ A;  1YS7 A;  4S05 A;  3BJA A;  2RDP A;  3BJ6 A;  2XAS A;  2V1D A;  3IKT A;  5L3B A;  2XIG A;  5JI6 A;  1OYY A;  2STT A;  3T8T A;  1A04 A;  1EH6 A;  2RV8 A;  4RAY A;  2FEZ A;  5BMZ A;  5AON A;  5L3F A;  3CO7 C;  3V4G A;  5ICC A;  2QBY B;  2EA2 A;  1IW7 F;  2A68 F;  3T5X A;  5KK1 A;  4I0A A;  5BPD A;  4A5N A;  2HKX A;  4R79 A;  1WI9 A;  3W6J B;  4MQ9 F;  2M45 A;  3HHG A;  2L54 A;  1IUY A;  4M9X A;  3EET A;  4HOB A;  3IWF A;  1BI1 A;  2H27 A;  2TDX A;  2QQA A;  1TTY A;  4CO8 A;  3I53 A;  4AWX B;  4NB5 A;  4CZZ A;  2PJP A;  4IXA A;  1ULY A;  3DKW A;  3QU6 A;  1UST A;  4YII A;  1DDN A;  3TQN A;  1W7P D;  1P2F A;  3C1D A;  4EJT A;  2CYY A;  1QO0 D;  2V1U A;  1FP2 A;  2KIU A;  3GZ5 A;  4KIF A;  3ZPL A;  4WK8 F;  4G7Z F;  1BIA A;  3GLX A;  5D6F A;  2DAO A;  5DV5 A;  4XRF A;  3ZN1 A;  5E8G A;  2IA1 A;  1F1Z A;  3K9T A;  1JHF A;  4P9U A;  4B09 A;  1D5V A;  4A0Z A;  1IN4 A;  4A12 A;  2A69 F;  3IRQ A;  4YG2 F;  2QUF A;  4UV8 A;  4EJU A;  3I64 A;  4M72 A;  1B4A A;  1TQI A;  1W5T A;  5ERI A;  2D45 A;  2IPQ X;  3COA C;  1H0M A;  2K86 A;  3WTS C;  2QLZ A;  2LNB A;  2NNY A;  4RGX A;  4GXO A;  4OIP F;  1JGS A;  2K4J A;  1XSX A;  3KET A;  4BNC A;  5D4S A;  3LA7 A;  1FPQ A;  2BE5 F;  3MQ0 A;  1REP C;  1QGP A;  2Y75 A;  3LA2 A;  4L9V A;  1YS6 A;  3ML6 A;  1TQM A;  3M9A A;  2ISY A;  3I59 A;  2D2W A;  3R61 A;  1K78 A;  2HQN A;  4KT5 C;  2DFI A;  1O3S A;  4UXN A;  1JXS A;  4LK1 F;  3ELK A;  5F1R A;  3EYI A;  3F8M A;  2Y48 A;  3RJP A;  2ADU A;  5D5U B;  2YX4 A;  3FF5 A;  4JQF A;  2ESN A;  1UB9 A;  3HHH A;  4A0Y A;  2EWN A;  2JPB A;  1B6A A;  5LRS A;  1R36 A;  4M9S A;  3R6S A;  3E6M A;  3JW4 A;  4ZYG A;  2KKO A;  1DPU A;  5JVT A;  4ESB A;  2HFH A;  3RPU A;  3BJO A;  2XV4 S;  3E3V A;  1QNT A;  2M1B A;  6PAX A;  2PFB A;  3QPH A;  3F23 A;  5E1W A;  3WTV C;  2QYO A;  5D4R A;  1Z6T A;  3IRR A;  2FF4 A;  3FXR A;  1ON1 A;  1R1T A;  4HX7 A;  1G3W A;  1FZP B;  3F6O A;  2E7W A;  2QWW A;  4HF1 A;  2P6T A;  2WTE A;  3M7G A;  2R7F A;  1ON2 A;  1FBS A;  4FX4 A;  2GA1 A;  1HKQ A;  1YYV A;  4G6D A;  3LFK A;  5L3D A;  3CUQ C;  3BOQ A;  2QZ8 A;  1G3Y A;  2K27 A;  2HR3 A;  1O57 A;  4OU0 A;  2HWV A;  2OZ6 A;  4KA4 A;  2UWM A;  1BC8 C;  4QWQ A;  4KFC A;  3ZMZ A;  3KE2 A;  3B02 A;  4HZF A;  1SD7 A;  5K5R A;  4KDP A;  2EK5 A;  2MLG A;  5J6X A;  1XN7 A;  3I5U A;  5EEG A;  4ETS A;  5FFZ A;  5HDG A;  3E5U A;  4O3M A;  5HS7 A;  1RIO H;  3TOA A;  1J9I A;  2XKP A;  2MC3 A;  2LDU A;  2RVC A;  4RAZ A;  1DP7 P;  5EEH A;  3L9F A;  5HLG A;  1W7P A;  2P5K A;  1SFE A;  3WE3 A;  1FOK A;  3SHF A;  2W57 A;  2EV5 A;  1UHW A;  1FP1 D;  1KQ0 A;  2VN2 A;  2ZFW A;  4HBL A;  3NEU A;  2IW5 A;  2P4W A;  2FRH A;  5ICE A;  2FNP A;  3GO5 A;  4U7D A;  4Q47 A;  3IC7 A;  2Z9O A;  1XCB A;  2JT1 A;  3KP4 A;  2KJB A;  2XAQ A;  4ZYH A;  2FU4 A;  4PGG A;  4MGR A;  3PQJ A;  2QQ9 A;  1O7F A;  4EM2 A;  1MZB A;  1RUN A;  4KN7 X;  4GO1 A;  4G7H F;  2PLY A;  1S3J A;  5L3C A;  3REO A;  4PGH A;  2HYG D;  5E20 A;  1IRG A;  1UFM A;  3BPV A;  5AIQ A;  1XGS A;  2L3D A;  2P5V A;  2MLK A;  3WG9 A;  1I1G A;  3I58 A;  4ENJ A;  1WKM A;  1IXS B;  1RZ4 A;  5LGN A;  4LGW A;  1R22 A;  2FNA A;  5CJ9 A;  3CTA A;  3HIF A;  3VOD A;  5E8I A;  4BH9 A;  3B73 A;  3L09 A;  2JTV A;  4ZYE A;  3SZT A;  4M74 A;  2P5L C;  2FSW A;  3OV8 A;  1P6R A;  2F5F A;  2ESH A;  4KNY A;  5E18 F;  3EQL F;  2L4A A;  4BQA A;  4G94 A;  2LF8 A;  1XDS A;  2MBF A;  3P9I A;  2LSO A;  4FHT A;  5DCM A;  3CLO A;  1XDU A;  4WXC A;  3KFW X;  2V9V A;  1F4K A;  2Z33 A;  1QZZ A;  3U1D A;  2VBW A;  1YO5 C;  2XKO A;  4G9Y A;  2ZO4 A;  2IA0 A;  1KA8 A;  4MEY F;  3KLO A;  3WGG A;  3HSF A;  4IJA A;  4NHJ A;  2YU3 A;  4N0B A;  4A2U A;  2OQR A;  4U0Y A;  3KCC A;  2HKO A;  2ZME A;  3WOD F;  1I6X A;  1X3U A;  2H09 A;  3WGH A;  3TDU C;  3GZ6 A;  4P5O A;  1FX7 A;  2RN7 A;  4O6J A;  4FX0 A;  2EFO A;  3HSE A;  1UCR A;  2VT3 A;  5LGT A;  1U6G A;  3ZMS A;  3M8F A;  3QP6 A;  2HTJ A;  5E1Z B;  1HQC A;  3EDP A;  3ZP5 A;  2VOO A;  3F21 A;  1XMA A;  2WV0 A;  2KJC A;  2OAZ A;  5IT9 Z;  3TDZ C;  4PCQ A;  3T8R A;  5TJJ A;  1EV7 A;  3KP5 A;  3PQK A;  1HKS A;  4UVB A;  4UVC A;  4AD9 A;  1I1S A;  4CHU A;  2NNN A;  1T0F A;  2A07 F;  4QLC U;  1O3R A;  2O3F A;  5HLI A;  4KMU X;  1B59 A;  3Q9S A;  1CF7 A;  2DI3 A;  3GF2 A;  1D3Y A;  4HAM A;  3KZZ A;  4EM0 B;  3GFM A;  5BOX A;  5D6E A;  3F6V A;  5DD4 A;  2W85 A;  1FWZ A;  2LF7 A;  2P7V B;  3TKY A;  4GYG A;  1XD7 A;  5CVR A;  1OKR A;  3L00 A;  2QQB A;  1YW8 A;  1FLI A;  1WRJ A;  2ZBK A;  4A0X A;  3R60 A;  4AIK A;  1BC7 C;  1ZLJ A;  4EV0 A;  3FXQ A;  5LRR A;  3DFG A;  2XRN A;  3RKX A;  1Z7U A;  3N4M A;  4ENN A;  2PMH A;  4BYY A;  3K0L A;  1PP7 U;  3E5Q A;  5D5X B;  1DUX C;  3KP7 A;  1SD6 A;  3IHU A;  1T39 A;  2R7D A;  3H3Z A;  3SZP A;  2QVO A;  3ABT A;  4EMS A;  1FBU A;  2J5P A;  2QM3 A;  2XAG A;  3RKW A;  5D8L B;  2O8X A;  3Q9V A;  3WE2 A;  3VB2 A;  4IVN A;  1HKT A;  1TLH B;  3SFZ A;  3IL2 A;  2F5C A;  1R1U A;  1SMT A;  1HBX G;  2XAH A;  2BBY A;  2ETH A;  3MFK A;  1S6L A;  5FD6 A;  1RUO A;  2EFQ A;  2EV6 A;  4RGS A;  3ROU A;  3QU3 A;  5LEK A;  4ESJ A;  1IN6 A;  1QBJ A;  4RGR A;  1C0W A;  2VOP A;  1YIO A;  4G7O F;  2COM A;  1R5H A;  3MWM A;  4ZZL A;  3ERE D;  5JR3 A;  2GXB A;  2K4B A;  4PZJ A;  1SFX A;  1MDM A;  3LAP A;  1ZHF A;  3MZY A;  1RNL A;  5FLX K;  2O61 A;  5A2Q Z;  1ZGJ A;  1Z6R A;  1Z05 A;  4XSZ F;  3K2Z A;  4AIH A;  2G7H A;  4Q5S F;  3BP8 A;  1ZG5 A;  3SXY A;  2DBB A;  1KU3 A;  4CIC A;  3GFJ A;  2F5E A;  2VC0 A;  2EFN A;  2RGV A;  1B9M A;  3RIR A;  5ILU A;  3W6K B;  4L0Z B;  4CGZ A;  5K1Y A;  1G3T A;  1G3S A;  5D5V B;  1QPM A;  3AAF A;  3LQR A;  3I4P A;  4LJZ F;  3J80 Z;  5CVV A;  2VE9 A;  1WQ2 A;  2L01 A;  4RB2 C;  1S7A A;  5ILS A;  4EM1 A;  3L7W A;  2HGC A;  3P9K A;  2PBI A;  1F5T A;  5HVQ C;  1U3E M;  4ZH4 F;  2M5W A;  5FD5 A;  4AIJ A;  2BV6 A;  2ZXJ A;  1ZH5 A;  3WTZ A;  4YFK F;  2O03 A;  4HQM A;  1KU2 A;  3JAM Z;  3ZMT A;  4OMZ A;  4L9J A;  3QPT A;  1FBQ A;  2Y0M A;  4M71 A;  5ED4 A;  4A5M A;  2UXN A;  4IRG A;  3HOS A;  2ZNY A;  1LEB A;  5DEQ A;  2FML A;  2M87 A;  1FSE A;  1V3F A;  2X0L A;  3HRT A;  2VBY A;  4BHB A;  4I09 A;  1KYW A;  3GFL A;  1Y0U A;  2RQP A;  4TV7 A;  1MKM A;  2VE8 A;  2FBH A;  4G6Q A;  4P55 A;  5F6F A;  3TO7 A;  4I02 A;  4F7Z A;  2PI0 A;  3IKV A;  3BY6 A;  1G4D A;  3CJN A;  3LWF A;  2IJL A;  5LHG A;  4UHT A;  3KP3 A;  2GA2 A;  1Q1H A;  5AIP A;  1LB2 A;  3FMR A;  2GIV A;  2EJR A;  2GQQ A;  2F2E A;  4DNC A;  1LDK B;  1T2K A;  4IF4 A;  4D0P A;  3G3Z A;  2RNJ A;  2A3S A;  2UXX A;  3EYY A;  4HX8 A;  1MGT A;  4HX4 A;  1GXQ A;  1ZRE A;  1Z1D A;  4LD5 A;  2DW4 A;  3DV8 A;  5CVI A;  2P6S A;  4XBF A;  5LHH A;  4CDG A;  1FYL A;  3I59 B;  1SAX A;  2PMU A;  3WU1 B;  1K78 B;  1ONV A;  2H6C A;  2WWY A;  1U5T A;  4H0E A;  2YPR A;  2AS5 F;  2FA5 A;  1IF1 A;  2IP2 A;  3BZ6 A;  1K7A A;  3F8B A;  5FB2 A;  2DPU A;  2ELH A;  4OOI A;  2DTR A;  3RPQ A;  4Y17 A;  5LLQ A;  1J59 A;  4I01 A;  4N9I A;  4WWC A;  5KVR A;  4M6X A;  3M8E A;  3H3U A;  3FM5 A;  4EQQ A;  3ECH A;  3VFZ A;  5JHU A;  4UNO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...