4YIIA

Structure of an apc2-ubch10 complex reveals distinctive cullin-ring ligase mechanism for anaphase-promoting complex/cyclosome
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
KEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ubiquitin-conjugating enzyme E2 C
publication title Crystal Structure of E2 Complex
rcsb
source organism Homo sapiens
molecule tags Ligase/cell cycle
total genus 23
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08672 ANAPC2 Anaphase promoting complex (APC) subunit 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4yiiA00
4S05A 3LWFA 5KK1A 1IXRC 1OYIA 4I0AA 2HYGD 3ML6A 2ELHA 2K02A 1GVJA 2GQQA 1J75A 4LK1F 4XLNF 3WU1B 2PBIA 3C18A 3DKWA 2FOKA 3OV8A 2R3SA 3QPHA 2FNAA 3K1MA 2HQNA 3H3UA 4I01A 1FC3A 1GHCA 1FY7A 1ON2A 4Y17A 2OBPA 4LLNA 2ZKZA 1KU3A 1D5VA 2BE5F 1J2XA 4UVBA 3DFGA 4GCVA 5HDGA 3Q9SA 2IPQX 4L18B 5J8FA 1ZGAA 4L9NA 1E17A 3FX3A 2CYYA 5DCMA 5LHGA 4EGYA 3FZVA 4IPAA 1SAXA 4A6EA 2QBYB 2X0LA 3K2ZA 3HSRA 3WTSC 2DPUA 2JPBA 2IA0A 3LA3A 5D5WB 4FX4A 1BM9A 1SMTA 2EFWA 2W57A 1MZBA 2VE8A 2FEZA 3MAJA 1ZREA 4I09A 5JR3A 4CICA 1YYVA 4BHPA 4NHJA 3ZMTA 1HSJA 1ZHFA 4HLYA 1DP7P 1XGMA 1YW9A 2HS5A 1TBXA 4YFXF 2UXXA 1KU7A 5CYVA 2GIVA 5KVRA 2K4BA 3H3ZA 2NNNA 3WTZA 2ISYA 3I58A 2GXGA 5D8LB 3QPTA 1ZH5A 4XSXF 1A04A 2G7UA 3CTAA 3LA7A 3REOA 2L54A 4KN4X 3WTXC 3F6VA 3JAMK 2EV6A 2KIFA 4CGZA 2Z5UA 1FZPB 1U8RA 5DYMA 1XDUA 3DP7A 4Z2YA 5EEGA 3F8MA 4L9VA 2FMLA 5IT3A 3I53A 3F21A 1UHWA 3E6BA 4LJZF 2DTRA 1ZAOA 1F9NA 1PP8F 4RB1A 4A0YA 4EV0A 2FSWA 1F4KA 1O57A 4JBAA 4KIFA 1RZ4A 3K9TA 2YR2A 4OOIA 3HSFA 4HZFA 3FWEA 3EETA 2HEOA 1NHAA 2DQRA 1U6GA 3WU0A 4XBFA 1P92A 5DD8A 2XAGA 2DFIA 2H6BA 2GA2A 2EJRA 1IRGA 1LQ1A 3GFLA 1BOAA 4OMYA 1K79A 4U7BA 1FNNA 1S8NA 2A69F 5BS6A 3CUQC 3WGIA 3SFZA 1FP2A 4ESBA 3SZTA 2L4MA 3V7SA 2Z3YA 2YX4A 2VXZA 5LGTA 4HDVA 2LF7A 3R61A 2ZJ2A 4PGGA 2CO5A 1IN4A 1MGTA 2D1HA 5FLXZ 4F7ZA 1QO0D 4MTEA 2K7LA 1R1UA 2FRHA 1FBQA 3LFKA 1EH8A 2CWEA 3BROA 2P7VB 2FU4A 3GF2A 5D8KB 4MQVA 3EYYA 4XSZF 2XGXA 2XAHA 1MDMA 2MH2A 2BEOA 2PMUA 3SQNA 4LK0F 4YIIA 2HYFA 4HQMA 4HW0A 1LVAA 1KQ0A 1XCVA 3W6KB 1L3LA 4G7OF 4RAYA 3V7RA 4S04A 3IHUA 2VOPA 1Z9CA 3LSTA 4IRHA 3BP8A 2KIMA 2VT2A 3JTGA 4LD5A 4IJAA 5LRSA 3KP6A 5FGMA 5L3BA 3V4GA 2O3FA 4RS8A 5J8CA 2UWMA 2F5EA 1FBSA 1J5YA 1I1SA 2HKXA 3ROUA 3TDZC 3PQJA 1W7PA 2PLYA 3U2RA 5E17F 5D5VB 2RQPA 5FO5A 2RN7A 4WWCA 2IT0A 2EWNA 4FHTA 4U7DA 5CVJA 3E5UA 1JHHA 3IKTA 2BBYA 4KNYA 2RC4A 2DLLA 5CVRA 4ON0A 2VC0A 3HUGA 1P6RA 3FMRA 3DPTA 3F8FA 2FE3A 1XMAA 4A0XA 1U3EM 3EYIA 1BI1A 3SXYA 4A6DA 4TV7A 3E3VA 3I54A 3EUHA 3IWFA 1TTYA 2IJLA 2VONA 5DDGA 2DQLA 4R1HA 3W6JB 2V1UA 2YX7A 2ESHA 5CLSA 3FM5A 2YPRA 2FNPA 2NRAC 4HF1A 1DPRA 1IXSB 1G3SA 2ZNYA 1ZG3A 3HIFA 1R22A 4ZYGA 2QWWA 4AIJA 2O03A 1IN5A 5HLGA 3F6OA 3C3WA 1CGPA 1FT9A 2OQRA 3I5UA 3GVAA 1QBJA 2XKOA 1D3YA 1S6LA 3GFJA 3WG9A 1KGSA 4L5JA 2OD5A 2PI0A 3RIRA 4OINF 4L0YB 2B0LA 2GXBA 5LRRA 1CF7B 3DXJF 1TW3A 5HLIA 3E6MA 4A2UA 2QVOA 4AIKA 1ZN2A 6PAXA 2IA2A 4FT8A 2EFQA 3IRQA 4IVNA 4QLCU 2D2WA 4ENJA 1GXPA 1YG2A 1TW2A 2LF8A 5HDNA 4XRFA 3CDHA 3CO7C 1U5TA 4CHUA 3WE2A 2ZXJA 1OPCA 2IRFG 4P96A 3WTVC 1BN5A 2DT5A 3QAHA 5LHHA 1IF1A 1B9NA 3RKYA 1YLFA 3HHHA 5J6XA 5ILVA 2OAZA 1IN7A 3TGNA 1FX7A 2P5LC 3R60A 2FBKA 5E18F 4WXDA 2OQGA 5ICGA 2VE9A 5DUKA 3D0SA 4KMFA 4MGRA 5BOXA 3FXUA 3WODF 4I7HA 1R58A 3J7AO 3V7CA 4M9SA 4HF2A 2CQKA 4GYGA 4CXFA 5DV5A 2VBWA 4I0BA 2ZCWA 1YIOA 3M7GA 4E70A 3LA2A 1EH6A 4RB3C 1G3TA 2K4JA 4MEXF 2HKOA 2XHKA 3FXRA 2FXAA 4KMUX 4UXNA 1B9MA 3IWZA 3U1DA 1AOYA 2RV8A 2JRTA 2C6YA 4B09A 1I5ZA 4KN7X 1JXSA 1G3WA 1UFMA 3S2WA 1BIAA 2L02A 4R8HA 4ZH4F 3ZMDA 2MLKA 2XIGA 1XGNA 3KEOA 4AVPA 3JAMZ 3QOPA 2QLZA 3CO6C 4U0VA 2UZKA 1YS6A 3KEQA 2KJBA 4WK8F 3RI4A 4NQWA 2RNJA 3GEZA 1REPC 1P2FA 1FSEA 1QNTA 1XSDA 1YTYA 5DUIA 3ECHA 3KE2A 4HV5A 3ERED 3MZYA 2RKHA 3TKYA 2JPCA 1Z7UA 1HKQA 1WKMA 4HV6A 4RGSA 1K6OA 3ZMSA 2J5PA 3O6BB 3ZQ7A 3CUQB 1O7LA 3TOAA 2DAOA 1BI0A 1RNLA 5DCFA 4PCQA 2F5DA 2ZNZA 4ENMA 4HA8A 3F72A 1K78B 1T6SA 1FP1D 3R0AA 3HRSA 3QU3A 2XUBA 2OZUA 3VFZA 1R5GA 3BJOA 5D6FA 5ICFA 2CW0F 3LQRA 1P4XA 1U5TB 1HXDA 3ABTA 2VN2A 5ILSA 3BJAA 4Q48A 2PN6A 1W4MA 4Q47A 1WSUA 2V1DA 1MJ9A 3ZP5A 4P9FA 4BH9A 3HTUA 4M72A 4M71A 4EGZA 2CFXA 4RGRA 1BI3A 3DPLC 1I27A 3I4PA 3CLOA 1H0MA 3MEXA 4ZYHA 4BHBA 1K7AA 2ESNA 5DEQA 4UVAA 2DW4A 1V4RA 3E97A 4PDKA 1HKTA 2ZMEA 1TNSA 4P5OA 5JFRA 3TQNA 2F5CA 3NRVA 1J59A 1FYMA 1WRJA 5BPIA 2EK5A 3T5XA 1S3JA 2HZTA 1D8JA 1BC8C 2DK8A 2VBYA 1TQMA 2NAZA 1RUNA 1ZGJA 3WGHA 5CVVA 1ZG1A 3G3ZA 3BOQA 2O0YA 2IW5A 4BHCA 3GUDA 3T8RA 3K1PA 2AS5F 5FD6A 2KRFA 4M74A 3JW4A 2FBHA 1DDNA 2X4HA 1LDKB 4A5NA 2QUFA 4EMSA 4OIQF 1RUOA 4XLPF 1VTNC 1QQIA 3BY6A 1T2KA 4WF2A 4LG0A 1T0FA 1I6XA 4GGGA 2OZ6A 2V1XA 2Y75A 5IT9K 2WV0A 5CVIA 1R1TA 2KJCA 3DQVC 3ZMUA 3FHZA 4UNOA 2DI3A 4G94A 2DO7A 1G6NA 1H9TA 5JVTA 2BYVE 4HX8A 2P6SA 5DCMB 4LLGF 2HTJA 1U78A 4OIOF 1IRFA 3B02A 3I59A 1RI7A 2M1BA 3K69A 2L4AA 4LGWA 1FLIA 3F3XA 5F1RA 3I71A 3ZN0A 1U5TC 1O3QA 2IVMA 2XVCA 3ISPA 1Z91A 4IHSA 5LGUA 1HSTA 1FOKA 3JSOA 4MQ9F 3DF8A 2Q2EA 4LB5A 1O3RA 4LLLA 1AWCA 3K1NA 3F22A 1ZLKA 2V6CA 3F8CA 1BBYA 2EA4A 3GW2A 4CDGA 3TO9A 4Q5SF 4WCGA 2H27A 2HQRA 3HOTA 1QGPA 2LDUA 1PUEE 2D1VA 2RDPA 5E8IA 3M8EA 4IF4A 2MA3A 3M8FA 3K0LA 4M6XA 1LB2A 4U0YA 2P8TA 3MWMA 4JK1X 1IN6A 4Q4ZF 3KZZA 4CYDA 1YFHA 2K86A 3U9GA 4MEYF 3F23A 1SD6A 3L9FA 2XRNA 4A5MA 3AAFA 4ESFA 4YG2F 1JGSA 5L3GA 4HX7A 3BPXA 4RGXA 2IA1A 4JQFA 2RGVA 2XASA 2L3DA 3GXOA 5LEJA 4ZZDA 2V79A 1HQCA 1PDNC 1Z1DA 1HW5A 1P4AA 5E20A 2TDXA 5K1YA 2A6EF 1J0RA 1UCRA 3C1DA 2W85A 2G9WA 1UB9A 3CUOA 3BWGA 3N97A 3GZ6A 1TNTA 1ZRDA 2LSOA 5E1WA 5A2QK 5BMZA 4KICA 3V8JA 1S7OA 5HS8A 2L01A 3HRMA 3MCZA 5ERIA 1LEAA 4I02A 2V9VA 1USTA 4OU0A 2LNBA 3OOPA 2O8XA 2VOOA 1HBXG 3I59B 4EJOA 1MDMB 3GX4X 1Y0UA 1SMYF 2E7XA 1BJAA 3B73A 2H94A 3D5LA 2A68F 4KIGA 2W25A 3KP2A 2AXLA 3GO5A 2HTSA 2A5YB 3ECOA 4KT5C 2FA5A 2QENA 4Y15A 4QWQA 5ED4A 2F2EA 2ZO4A 2K27A 1OMIA 4M73A 1I1GA 5FB2A 4RB2C 4UVCA 2MBFA 2QBYA 4CO8A 1FPQA 1B4AA 3PFIA 2ACJA 4HYEA 4PZJA 2GWRA 2MLGA 4I98B 4ZZLA 1J7KA 3FF5A 3GYHX 5L3EA 2FBIA 3FMQA 3TO6A 3SZPA 5L3CA 2PEXA 5D5UB 3BDDA 4KUMA 3KP3A 1W7PB 2EA2A 3E5QA 4L5IA 1FWZA 3C7JA 1HKSA 2EFPA 1SFXA 1FYLA 3ABUA 3NQOA 2R7FA 5HS7A 3VOEA 2PQ8A 1KU9A 1D8KA 4MNUA 1ZARA 5F64A 2Y0MA 3MQ0A 5ILUA 5TJJA 2ISZA 1Q1HA 4Y13A 2JTVA 4EM1A 2YSRA 1MKMA 1E2XA 3F8BA 4EJVA 3BPVA 4FX0A 4ESJA 3QP5A 1ON1A 2MC3A 2M8EA 2STTA 5L3DA 1KYZA 4IHTA 2PG4A 1ZG5A 5HDKA 1IZ1A 4UUVA 3QP6A 4HOBA 5CJ9A 1QPMA 3L7WA 1SD5A 4KYWA 1LNWA 4G6DA 3HYIA 1IUYA 2QM3A 3R6SA 4KDPA 2XKPA 3GLXA 4HDUA 4I2OA 4M9XA 2XAQA 1XN7A 2YU3A 4IXAA 5ICCA 4HLXA 1XSXA 2P5VA 3CJNA 3RYPA 1UHMA 1IW7F 3KCCA 1STZA 2Q8KA 1WI9A 5JI6A 2W24A 2A6HF 1YW7A 2BGCA 4YIFA 3FXQA 4KFCA 3GWZA 2OA4A 4BQAA 1H9GA 1ODDA 3HSEA 3J81Z 1R00A 1LDDA 3KFWX 4R79A 2FQ3A 2HOEA 2ETHA 4NB5A 3EDPA 5FFXA 5K5QA 3T8TA 1USSA 1W5TA 4WXHA 3H92A 3O3KA 3DEUA 2JSCA 1T38A 4P55A 3E5XA 1G4DA 3E6CC 4ASNA 4EJUA 2D45A 2MH9A 3MZHA 3HRTA 1KYWA 1ZRFA 3RYRA 2HR3A 5FD5A 4G9YA 4IRGA 5H6QA 5AONA 2F5FA 4EJWA 4WXCA 2BV6A 3TDUC 1SD4A 3HHGA 5HS9A 4DNCA 5IT9Z 1XDSA 2DU9A 2WTEA 2R7DA 2P7CB 2A3SA 2STWA 5LGNA 2OU2A 5D4SA 4UHTA 4AIHA 4U88A 4LB6B 1G3YA 1R23A 1BIBA 4L9TA 4U0WA 4AWXB 5TRDA 4EQQA 2MD5A 2PJPA 1OYWA 2HDCA 4ENKA 2COMA 2NYXA 1O3SA 2QYOA 4ETSA 2DK5A 2WWYA 3P7NA 3GFMA 2XAJA 1R36A 4K2EA 2M30A 3RKWA 4MTDA 3O2PE 2NNYA 2KIUA 1QZZA 2EFOA 3WTWC 2FMYA 4BXUA 4ZYEA 3Q5FA 2H09A 3L2CA 4L0ZB 1F1ZA 1WQ2A 3J81K 1KA8A 5L3FA 3E6DA 4B8XA 4YFNF 4GO1A 1ZYRF 2QZ8A 3P9CA 4YFKF 1TLHB 2EFNA 2PFBA 3LAJA 3WTYC 1FBUA 2GZWA 4HX4A 1ZLJA 5D6EA 3T1BA 1P4WA 5HVQC 3ZPLA 2M45A 3FMSA 2KKOA 3BZ6A 3LQQA 3ULQB 4N0BA 2HGCA 3QU6A 1ZRCA 1YW8A 5E1ZB 3FM3A 1QZYA 1SFEA 2GA1A 4A0ZA 3V8KA 4RAZA 5K5OA 2HWVA 4G8XA 1FYKA 2EV0A 1JE8A 2VC1A 1LEBA 1OKRA 1R7JA 1J9IA 4O5VA 3P9IA 2WC2A 3COAC 4UV8A 5E1XA 2JT1A 2Z33A 3M1EA 5EEHA 1EH7A 4PGHA 1YO5C 4L9JA 3RPQA 4P9UA 1MJBA 1V3FA 2E7WA 5JHUA 4LFUA 4G6QA 5K5RA 3VB2A 3J80Z 1DPUA 2DPDA 5LLQA 3NEUA 1RIOH 3RDIA 5F6FA 3N4MA 5BQTA 1YS7A 1CF7A 2CSOA 1O3TA 3DV8A 5HOOA 4KA4A 1BI2A 3KLOA 5A2QZ 1C0WA 1JHFA 3P9KA 2RVCA 3IL2A 1WWXA 4OIPF 2O61A 2NS0A 4H0EA 5ICEA 2H6CA 3G73A 2PMHA 3HRUA 1KQ8A 4HQEA 2DBBA 2XV4S 2Z9OA 1HW1A 2GAUA 2FF4A 3V8LA 4EJTA 2IP2A 2ZMEB 2Y48A 4ENNA 2ADUA 1KU2A 5DD4A 2EV5A 5LHIA 1Z6RA 1B6AA 2W84A 1S7AA 3TOBA 3Q9VA 4M9ZA 5HLHA 5LBQA 1TQIA 2P6TA 4GXOA 2JZYA 2CGPA 2O6GE 3IRRA 5D5XB 4DQ2A 3BJ6A 2LKPA 4N9HA 1S29A 2E1NA 4RB0A 5AIPA 4G7ZF 1U2WA 4RGUA 3SHFA 4LG0B 5AIQA 4HAMA 3L09A 3R4KA 2VT3A 5FLXK 3I64A 4LMYA 1EV7A 1F5TA 4BAYA 1LJ9A 3J80K 1B59A 1X3UA 2QQ9A 3VEPA 2VODA 1ULYA 1LDJA 5E8GA 4CZZA 2A61A 1IXCA 3ZN1A 4BYYA 1XB4A 4HBLA 1YQAA 1T98A 4UV9A 3KP4A 4G7HF 4OMZA 4O3MA 3KP7A 3RTRA 3F8NA 4GYIA 3HOSA 4AD9A 3T0YA 1Z05A 1B1BA 2UXNA 1L0OC 2G7HA 2M87A 4EVIA 2QQAA 3QRFF 1R5HA 2VBZA 3CUQA 1T39A 1XGOA 2ZFWA 3WE3A 1TQPA 4BNCA 1XCBA 1XSVA 3KZYA 2Z99A 4N9IA 1O7FA 3LAPA 1IN8A 2A07F 2XAFA 4KIBA 1Z6TA 1BC7C 3JTHA 1ONVA 3MFKA 1OR7A 1K78A 4OIRF 4MHGA 1KQ9A 4HF0A 3GFIA 2M5WA 3GZ5A 1XMKA 3EQLF 2J5OA 4ZYDA 4IRIA 1SD7A 3WTTC 5BPDA 4EM2A 5CVUA 1MD0A 3RJPA 3ZMVA 3R0JA 1GXQA 3ZMZA 2EB7A 2XROA 4A12A 5LEKA 2P5KA 3M9AA 2CG4A 4M6YA 3ELKA 3TO7A 3I0TA 3IKVA 3KP5A 1OYYA 5H6RA 3PQKA 1W7PD 1SFUA 3WTUC 2ZBKA 2P4WA 3RKXA 3KLNA 1MJAA 2Q0OA 2QQBA 3WGGA 4O6JA 1PP7U 1DUXC 5D4RA 1IAWA 1HW2A 2VBXA 4D0PA 3HTSB 2HFHA 2E1CA 3L00A 5H20A 1R1VA 5FFZA 3JSPA 1W5SA 3RPUA 1FSHA 3VODA 3KETA 4WX9A 1XGSA 3IC7A 1XD7A 4EM0B
chains in the Genus database with same CATH superfamily
4S05A 3JRDA 3LWFA 3VYRB 5KK1A 3JRCA 1IXRC 1D1CA 2HXIA 1OYIA 4I0AA 4C2TA 2W48A 2LG4A 2HYGD 5J1YA 2CV0A 3E1SA 1Z21A 3ML6A 3OSGA 3LSIA 1W36C 3GLLA 4IHWA 2ELHA 2K02A 4M3EA 1GVJA 2GQQA 1GUUA 1J75A 4BE2A 1WZ2A 4LK1F 4XLNF 2EIJH 5M3FJ 3WU1B 4UUSB 4RM2A 4PUSA 2PBIA 3C18A 3VYTB 3DKWA 2FOKA 2MSYA 3OV8A 5KCMA 3FXKA 4CCJA 2R3SA 3QPHA 2FNAA 2VQHA 4XMYA 3K1MA 2HQNA 3H3UA 4I01A 1FC3A 4ZTFA 1GHCA 3FKIJ 1FY7A 1ACIA 1G8XA 2BY3A 3J7YJ 5CPRB 1HDDC 1ON2A 2E1MB 2EBIA 4Y17A 9ANTA 2OBPA 3BG7A 1TT5B 4MO7A 4LLNA 2ZKZA 2K9MA 4AIDA 5GPCA 3MKZA 1KU3A 1D5VA 2BE5F 2ZXIA 1RESA 1J2XA 1R49A 4CCKA 4UVBA 1K6YA 2HXOA 1YX3A 3DU6A 3J7AY 2XGEA 3DFGA 2CQNA 4GCVA 2QSHX 3PIPF 3G1OA 2O8KA 3LSHA 4D5FA 5HDGA 2X9DA 4II3A 3Q9SA 2IPQX 2XSDC 4V2FA 4L18B 4IQ4A 5J8FA 5H2FC 1ZGAA 4XRSG 4A3LJ 3PUBA 4L9NA 1E17A 3FX3A 2CYYA 4DBRA 2XDVA 5DCMA 5LHGA 4EGYA 3FZVA 4IPAA 1SAXA 1WFXA 4A6EA 2QBYB 2JUCA 1TT0A 2UV1A 2X0LA 3BT9A 5IPAA 2NXNB 3K2ZA 3HSRA 3WTSC 2DPUA 2JPBA 2LP0A 2IA0A 2LY1A 1IV8A 2R5ZB 4XOPA 3LA3A 1V5GA 2MW8A 5D5WB 4FX4A 5EJCA 1BM9A 1SMTA 3SFIA 3DEEA 2EFWA 2PJRB 2W57A 1MZBA 3ZQHA 2VE8A 3ABMH 3GTKJ 2FEZA 1K4SA 3MAJA 3S3MA 1ZREA 2L0KA 4I09A 2NOGA 5JR3A 3JRGA 4CICA 1S72I 4JX5A 1YYVA 4BHPA 3ZQCA 2QQ8A 4NHJA 5DTDA 3ZXSA 3ZMTA 1HSJA 1ZHFA 4HLYA 1DP7P 2E2JJ 3OYEA 2XPUA 2ID3A 4IZZA 1XGMA 1YW9A 3ZQGA 1H8AC 4C30A 2HS5A 1TBXA 4YFXF 2UXXA 1KU7A 1ITYA 5CYVA 2LR8A 3HOYJ 4RLFA 2GIVA 4OWRB 5KVRA 2K4BA 5FKMA 3H3ZA 2MABA 2NNNA 2EILH 3WTZA 2ISYA 1FIPA 2QEXI 2R7UA 1DQUA 3I58A 2GXGA 4M3GA 5D8LB 4IX7A 3GTOJ 3QPTA 1ZH5A 4XSXF 3JRBA 5IT9Z 1A04A 2XGDA 2G7UA 3CTAA 3LA7A 3REOA 5J4YA 2L54A 4KN4X 3WTXC 2QGUA 3BR3A 2WB1N 3F6VA 4II2A 3JAMK 2EV6A 4PJMA 2KIFA 5B66C 2M2EA 3AG3H 1ZKGA 4CGZA 3H35A 2WB1A 3LSKA 5IYCJ 1LUJB 2Z5UA 4A3EJ 4HNTA 4G12A 3KYLA 1FZPB 1U8RA 5DYMA 3PO2J 2DOAA 2H1LA 2H8RA 3JR9A 4M3BA 4DGWB 2GLOA 1XDUA 3PUFA 3DP7A 4Z2YA 5EEGA 3F8MA 4L9VA 2FMLA 5IT3A 3DBRB 2FQ4A 3I53A 5FKOA 3TW6A 3F21A 1UHWA 3E6BA 4LJZF 2DDBA 2DTRA 1ZAOA 2QKLB 1YOVB 1N77A 1F9NA 2JWTA 1PP8F 4RB1A 4RLQA 2DA6A 1MNEA 4A0YA 4BGDA 4EV0A 1XG1A 2FSWA 1F4KA 1O57A 4JBAA 2KZVA 4KIFA 1RZ4A 3DBHB 3K9TA 1FIAA 3OYGA 5IP6A 2L7ZA 2LMDA 2YR2A 3GMEA 1A35A 2OF7A 4OOIA 3HSFA 4HZFA 3FWEA 3EETA 3IAM2 2HEOA 1NHAA 2E5ZA 2DQRA 1U6GA 3NWTA 3U1KA 1RR7A 3WU0A 1JTYA 4XBFA 1P92A 5DD8A 2XAGA 2DFIA 4BS9A 3AKZA 2H6BA 2HVSA 2GA2A 2EJRA 1IRGA 1LQ1A 4FTHA 1ETKA 3GTMJ 2DJIA 3S1NJ 3IUOA 3GFLA 1A36A 1BOAA 4OMYA 1R4MB 1K79A 2M4GA 4U7BA 1FNNA 1S8NA 1G59A 2V9KA 4BEHB 1RPWA 2A69F 2CRGA 2LVSA 5BS6A 3CUQC 3WGIA 3SFZA 3DWLE 3TBIA 3CCMI 3ASOH 3BCAA 1FP2A 4ESBA 3SZTA 2L4MA 1P7JA 5DM7F 3V7SA 2DMUA 2Z3YA 2YX4A 5GP9A 1QVTA 2VXZA 2RAEA 5LGTA 4HDVA 2LK2A 4QTRA 2LYCA 2LF7A 3LSJA 1RKWA 3R61A 2OCEA 2ZJ2A 4PGGA 2CO5A 1IN4A 1QRYA 4GRIA 3BR5A 1MGTA 5FKNA 2D1HA 2X6OA 5FLXZ 1YI2I 1OR7C 4F7ZA 1QO0D 3CC4I 4MTEA 2K7LA 2O7OA 1R1UA 2FRHA 1JJ8C 1FBQA 1HOMA 3LFKA 1QPIA 1EH8A 2CWEA 3BROA 4J19A 2R4GA 2VI6A 2E60A 2FU4A 2P7VB 3GF2A 5D8KB 4MQVA 3EYYA 4XSZF 2XGXA 2VXDA 2XAHA 1MDMA 1MMNA 2MH2A 2BEOA 2PMUA 3N05A 3SQNA 4LK0F 4YIIA 2HYFA 4HQMA 1EKEA 2R7TA 3OYHA 4HW0A 2HOTA 1LVAA 2ZXHA 1KQ0A 1XCVA 1H88C 3W6KB 1L3LA 1T95A 4W1UA 3CDIA 2M7BA 4G7OF 2VKHA 4RAYA 3OYJA 3V7RA 2AHQA 4S04A 1UZCA 2FUG2 3IHUA 2VOPA 1Z9CA 3LSTA 3SDBA 5EZHA 1OCOH 4IRHA 4XKCA 3BP8A 2VKDA 2KIMA 3DKXA 3A0HC 4QPQA 2VT2A 3JTGA 3BTJA 2AXTC 3A02A 4LD5A 4IJAA 2Z16A 5LRSA 5E79C 3KP6A 3E0JB 4IO9F 1BOBA 1MH4A 4V19K 4S0HB 2EZIA 5FGMA 3ABLH 5L3BA 1T08B 3V4GA 1FTTA 1Y1VJ 2O3FA 4D7NA 3PM1A 4RS8A 5J8CA 2UWMA 2F5EA 1F43A 3DKYA 1FBSA 1J5YA 5FLMJ 1I1SA 2HKXA 2IGMA 3ROUA 3TDZC 1JJ6C 5GTIC 3PQJA 1LE8B 1WI3A 2FD5A 1W7PA 1AKHA 2PLYA 1MBFA 5B1AH 3U2RA 5E17F 3FXOA 3GCMA 4C3IJ 5D5VB 3SZGA 2UUZA 2RQPA 5FO5A 4HNVA 4X6AJ 4Y52J 3BTLA 2RN7A 4WWCA 3UKGA 2IT0A 3HC7A 2EWNA 4FHTA 1DGWY 1MNMC 4U7DA 5CVJA 1MBHA 5DM6F 3E5UA 1FOYA 4H4KC 1JHHA 3IKTA 1IRXA 2BBYA 4I76A 4KNYA 2RC4A 4PFPA 5GAHJ 4BJ6C 5JLXA 1B72B 2DLLA 5CVRA 4ON0A 2E2HJ 1HCRA 2VC0A 3HUGA 1P6RA 3JRIA 1U8BA 2VUMJ 3FMRA 3DPTA 5GPAA 3F8FA 2FE3A 1JKRC 2TRTA 1XMAA 4A0XA 1U3EM 3WG7H 3EYIA 1FMVA 1BI1A 3SXYA 4A6DA 3HOXJ 4TV7A 3E3VA 3I54A 3EUHA 3IWFA 4BDYA 3OIPA 4JP0A 1OJLA 1TTYA 2IJLA 2MC4A 1K83J 2VONA 2LY2A 3Q0VA 4XQFA 5DDGA 2R7ZJ 2DQLA 4ITVA 4R1HA 3W6JB 2V1UA 2YX7A 3HM5A 2WAEA 2CW8A 2ESHA 1A31A 5CLSA 3FDYA 3FM5A 4N4NB 3VYUB 3G4SI 2JMWA 1QHHD 2DA4A 3QYFA 4X1EA 5F1JA 4RBOA 2YPRA 2CQXA 2FNPA 2NRAC 4HF1A 2WV1A 3SJMA 1DPRA 1IXSB 2K5CA 2E1OA 2NVUB 1G3SA 2XB5A 3M07A 2L7FP 1QU3A 3D5SC 2ZNYA 1ZG3A 3HIFA 3MMYB 2K9NA 3K10A 1R22A 4ZYGA 2QWWA 1VQ8I 3I4MJ 3ZQIA 4AIJA 2O03A 2E19A 1JUSA 3X2QH 1V54H 1IN5A 5HLGA 3F6OA 1V5EA 3C3WA 3FKJA 1CGPA 2A6TA 1FT9A 1X1AA 2EQRA 2KQRA 3LOCA 2OQRA 3I5UA 2Y0SN 2XSJC 3GVAA 1QBJA 3DTKA 4DIQA 4BBSJ 2XKOA 2Y0SA 3M8JA 1D3YA 2HPMA 1S6LA 3GFJA 3KIOA 3WG9A 1KGSA 1N78A 2WA0A 1OISA 4L5JA 2LTPA 2OD5A 2PI0A 3QODA 3CMAI 1X4PA 3RIRA 3DLAA 4OINF 4L0YB 2B0LA 2GXBA 4IL6C 4LG3A 5LRRA 2XF7A 2JN6A 1CF7B 2JSPA 3CJRB 3DXJF 4DYRA 3ASNH 3M1CA 2KRCA 1DU0A 1E3OC 1TW3A 3OL3A 5HLIA 3E6MA 4A2UA 2QVOA 4AIKA 1ZN2A 6PAXA 1VQKI 1OCRH 2IA2A 2M0CA 3UR3C 3DU5A 1IGNA 2ECCA 5E3LA 4C2MJ 3VDXA 2VKEA 4E7SA 4FT8A 4BE1A 2EFQA 3IRQA 4IVNA 4QLCU 3A01A 3LSMA 2D2WA 4ENJA 4M3FA 1GXPA 4IQJA 3I9V2 1YG2A 2YU9J 1TW2A 3J7ZI 4XLFA 2LF8A 5HDNA 4XRFA 3CDHA 5EEAA 3WU2C 3CO7C 1I39A 1U5TA 3V42A 4CHUA 3WE2A 2ZXJA 1OPCA 4B1RA 2B63J 2IRFG 4P96A 3ONQA 1ETYA 3ZQFA 1EA3A 3WTVC 5HNHA 1BN5A 2DT5A 3LMMA 3QAHA 5LHHA 1IF1A 4JYKA 2V26A 2Y2ZA 4IHYA 3BG5A 5FLVA 1B9NA 3RKYA 1YLFA 3HHHA 5J6XA 5ILVA 2O5RA 1UG2A 2OAZA 1IN7A 3HBLA 3TGNA 1FX7A 1MMGA 2EINH 4G6TB 2P5LC 1MSFC 3HPHA 2IS1A 2BVLA 1POGA 3R60A 2B9SA 1RR8C 1FEXA 2FBKA 5GTHC 2OV7A 5E18F 4HNUA 3H0GJ 4WXDA 2OQGA 5ICGA 2VE9A 3S3OA 5DUKA 4XICA 3D0SA 4A3KJ 4KMFA 4MGRA 5BOXA 5J1UA 3FXUA 3WODF 3FBNB 4I7HA 1BW5A 1R58A 4RAGA 1E3HA 3J7AO 3V7CA 3CD6I 4M9SA 4HF2A 2CQKA 1MW7A 2JQ7A 4GYGA 4CXFA 5DV5A 3BQZA 1JT6A 2KLOA 5FJ8J 3IV5A 2VBWA 4I0BA 1JUMA 2X6WA 2ZCWA 4BL0B 1YIOA 3M7GA 1BW6A 5GAGJ 4E70A 3LA2A 1EH6A 1D0XA 1YITI 4RB3C 1G3TA 2K4JA 2RREA 2HKOA 3C2BA 4MEXF 1T8IA 2XHKA 1HC8A 3FXRA 2CUJA 3G1MA 2FXAA 2CQ7A 4KMUX 2KIQA 2XPVA 4DOZA 4UXNA 4RAFA 1B9MA 5KHDA 2M8GX 3IWZA 1GV2A 3U1DA 1AOYA 4DBQA 2RV8A 2JRTA 3FHNA 3S8PA 1VQ4I 2C6YA 4B09A 2JVHA 2GIZA 1I5ZA 4KN7X 1JXSA 5IOYA 3PJRA 4LITA 1G3WA 1IDZA 1UFMA 3S2WA 1BIAA 5F04A 5F08A 3KZIC 1BA5A 2L02A 4R8HA 4ZH4F 1SVLA 3ZMDA 2MLKA 3MKWB 2XIGA 3VSKA 1XGNA 3KEOA 4AVPA 3JAMZ 5GADJ 3QOPA 4FCYA 4XKVA 3RKQA 4FASD 3OYCA 2QLZA 1I6HJ 2HQAA 1FOWA 1YRNB 3CO6C 1X4OA 4U0VA 2UZKA 1YS6A 3U21A 3OYKA 3KEQA 2KJBA 3TW7A 4WK8F 2I5UA 4F92B 3RI4A 1WCMJ 2IAIA 4NQWA 2RNJA 2VL8A 3GEZA 1REPC 1P2FA 4DYQA 1FSEA 4E7JA 1QNTA 2G0EA 1YTYA 1XSDA 5DUIA 2DOFA 2DFFA 4C2UA 3ECHA 3KE2A 3W2WA 2CFOA 2LH9A 4HV5A 4OAYA 3LSPA 3ERED 3QPSA 4F91B 4ZDLA 3MZYA 2RKHA 3TKYA 2JPCA 1Z7UA 5FROA 2R5YA 1HKQA 1WKMA 4D7MA 4HV6A 4RGSA 1YHQI 1K6OA 1YJNI 3ZMSA 1ZQ3P 3JCUC 5IOZA 2J5PA 1P9QC 3O6BB 3ZQ7A 3CUQB 1O7LA 3VPRA 2GOXB 2CUZA 3TOAA 2DAOA 2DMNA 2LY9A 3KYDB 1BI0A 1XTAA 2LD5A 1RNLA 4NC6A 5DCFA 4PCQA 4C3HJ 2F5DA 5EG0A 1X1BA 3S32A 2ZNZA 4ENMA 2N8GA 1MMAA 2DA2A 2EPFA 1EJ9A 3FBIB 4FETA 3VWBA 3JRFA 2TCTA 1BR2A 4LIUA 2Y31A 4HA8A 3F72A 3L2VA 4E4HA 2WY7Q 4XN3A 1K78B 4XR6A 1T6SA 2Y9YA 2DFHA 1FP1D 1WJDA 3DLLF 2GBYA 3R0AA 3HRSA 3QU3A 2QKMB 3OIOA 1NK3P 4IKFA 2XUBA 3A4CA 3Q3SA 2BZTA 2OZUA 3VFZA 1H89C 2QF7A 1R5GA 1Z0XA 3BJOA 3S3NA 3KYCB 1ZK8A 3O8HA 2DA7A 5D6FA 5ICFA 4BXFA 1MBEA 2CW0F 3LQRA 1P4XA 4W97A 1U5TB 1HXDA 1LFBA 2VN2A 3ABTA 3CDLA 5ILSA 4A3JJ 4XLAA 3BJAA 4Q48A 1WVRA 4IOCF 2PN6A 1W4MA 1J09A 4Q47A 1WSUA 3OR2C 3K70D 2V1DA 3W2VA 1MJ9A 3ZP5A 1VQNI 4P9FA 5J4VA 4BH9A 2R92J 3HTUA 4M72A 2XPWA 1ETXA 1XC5A 3K4CA 4M71A 4EGZA 2LOOA 2CFXA 3HPGA 1VQ5I 4RGRA 1BI3A 3DPLC 3HB9A 1JTXA 2JA5J 1I27A 5C3EJ 3CCQI 4JX4A 3I4PA 3P5JA 2DFEA 3CLOA 1VFCA 1H0MA 3FK6A 3MEXA 4ZYHA 4RA2A 2CMPA 1UG0A 2JVGA 4BQQA 2WY8Q 4BHBA 1K7AA 1X2NA 2ESNA 5DEQA 5BNGA 4UVAA 3GTQJ 2DW4A 1V4RA 3E97A 1VNDA 4PDKA 3CP2A 1MIJA 3PO3J 2LC2A 1HKTA 3LFUA 1U9OA 5J47A 2ZMEA 1TNSA 4P5OA 5JFRA 2DDAA 3TQNA 3S15J 2F5CA 3NRVA 2IEKA 1J59A 3IH3A 3KPHA 1FYMA 1WRJA 5BPIA 1TP4A 2EK5A 3T5XA 2COBA 1PJRA 1S3JA 2HZTA 3EUHC 1D8JA 5K7ZA 1BC8C 2DK8A 2VBYA 2K85A 3ZQQA 1TQMA 2LBFA 2NAZA 2JA6J 1RUNA 1ZGJA 3L2UA 2L9RA 3WGHA 5CVVA 3ESWB 1ZG1A 3G3ZA 2DODA 3K4LA 3BOQA 2O0YA 4BBRJ 1E0EA 2VJJA 2IW5A 4A3MJ 4BHCA 3GUDA 3CLQA 3OS2A 3HGYA 5CQGA 2A5WA 3T8RA 1TL8A 1JKOC 1WJAA 5K7FA 2VASA 3K1PA 3KX2A 1WJEA 2AS5F 5HNFA 2LKSA 5FD6A 3SYTA 5HODA 2KRFA 4HSRA 4M74A 4MFDA 1ZR4A 4A3DJ 3PL8A 3JW4A 2FBHA 1DDNA 3W3CA 2X4HA 3OYBA 2OJED 1LDKB 2KP6A 4A5NA 2CJJA 2V7FA 1UELB 2QUFA 4EMSA 3BTCA 4OIQF 1RUOA 4BY7J 4Y33A 4XLPF 2ELKA 1VTNC 1QQIA 3BY6A 3EPZA 2AQEA 3OOUA 1T2KA 1PVEA 4WF2A 1T0FA 3K4JA 1I6XA 1WH5A 3DTEA 4LG0A 4GGGA 2OZ6A 2V1XA 2R7RA 2HOSA 2Y75A 4DYCA 2FX0A 2OPTA 2O9LA 4ZC3A 2ZC2A 4BJTA 1Y8RB 4UB6C 1MH3A 3OYFA 5IT9K 1A6QA 2WV0A 4CSWA 3QWLA 1Y6IA 2JJ7A 4M6VA 3BQYA 2BY2A 5CVIA 5EGOA 1S5LC 1JI8A 1D0ZA 1R1TA 2KJCA 3DQVC 3ZMUA 4FE7A 1OCCH 3FHZA 4UNOA 2DI3A 1TWCJ 1X3ZB 2L9SA 4G94A 2KL4A 5EG0B 2DO7A 1G6NA 1H9TA 3HGGA 5JVTA 2BYVE 3CZ6A 4HX8A 2P6SA 2ZJPF 2F4IA 2ZB9A 3CF2A 4LLGF 5DCMB 1R9TJ 5FKLA 2HTJA 4E7HA 1U78A 4I99C 4OIOF 1IRFA 3B02A 3I59A 1RI7A 1B8IA 3CC2I 2M1BA 3K69A 2L4AA 2YUSA 4LGWA 1FLIA 3OYMA 3F3XA 5F1RA 4XLEA 5C44J 1VI0A 2KZGA 3I71A 3ZN0A 1U5TC 3CCYA 1DU6A 1O3QA 1PUFA 2IVMA 3H3VK 4C3JJ 2XVCA 1V5FA 3ISPA 1VQLI 1Z91A 4IHSA 5LGUA 1JKQC 3D5RC 3QQAA 1MMSA 3FXLA 4CZCA 4ZTJA 1HSTA 4HG2A 4BKXA 1FOKA 3JSOA 4MQ9F 3DF8A 2Q2EA 4LB5A 2F6CA 2DYRH 4F93B 1O3RA 5DS9A 2Z1DA 3B6AA 2ICWG 4LLLA 1AWCA 4XONA 3OMYA 3A0BC 2VQGA 3K1NA 3HOUJ 3F22A 4YIRX 2L5QA 1ZLKA 3JRHA 4XRSA 5IYBJ 2V6CA 3F8CA 2CUFA 5JLWA 1BBYA 2EA4A 2KRHA 3A2KA 1VQ6I 3GW2A 4XK4A 4CDGA 3TO9A 3TP3A 2KFDA 4Q5SF 4WCGA 2EZHA 2H27A 2IGKA 2H8WA 4HPQA 4BQNA 2HQRA 2IBDA 3BG9A 4AUXA 2R7VA 3HOTA 2R93J 4N4OB 2M34A 1QGPA 3H0DA 2LDUA 1PUEE 1SFKA 2D1VA 5JHFA 2KMUA 2RDPA 5E8IA 1WJ5A 1X1CA 1Z3XA 1GT0C 3M8EA 4IF4A 1DGRM 2E5NA 4NBQA 1YIJI 2EZLA 2MA3A 3M8FA 3K0LA 2M7AA 4UUTA 4M6XA 1LB2A 5J3LA 4U0YA 2P8TA 3BG3A 4CYCA 2PMZN 3MWMA 4JK1X 1IN6A 4Q4ZF 3KZZA 1TWFJ 2F4OB 4CYDA 1YFHA 2PMZA 3HJEA 1Y8QB 1S7EA 2VJ4A 3LSGA 5TISC 4PSWA 3S16J 2K86A 3U9GA 4MEYF 4XN0A 3F23A 4AVZA 2X1DA 4JOMA 4A3CJ 1SD6A 3L9FA 2XRNA 4A5MA 2VPLA 4Y7NJ 2GOMA 3AAFA 4ESFA 2KISA 3MZ8A 4BQOA 4YG2F 1JGSA 5LD2C 3K7AJ 2NS7A 4AU7A 5IY5H 1X3WB 4A3GJ 2DN0A 5L3GA 4HX7A 3BPXA 4RGXA 2IA1A 3K4NA 4JQFA 3BCBA 2RGVA 2XASA 2L3DA 3GXOA 5LEJA 1BJZA 4ZZDA 3BC8A 3GBGA 2V79A 1IV6A 1HQCA 4MFEA 1UJ8A 1PDNC 1TWHJ 3ERMA 1Z1DA 4DJAA 4BDZA 1HW5A 3GTGJ 4RMNA 3HOWJ 1P4AA 3O8GA 5E20A 1Y39A 2TDXA 2OTLI 5K1YA 1JGGA 2A6EF 3PSIA 4CH7A 1ETQA 1QHGA 5F0FA 5B5EC 4A3BJ 1J0RA 3E7LA 3HEFA 3CCEI 1Y1WJ 1NH3A 1S9HA 3S93A 1UCRA 2VQLA 4MIMA 1O4XA 2CV2A 3C1DA 2W85A 2G9WA 1UB9A 3CUOA 3BWGA 3N97A 4V2GA 3I3LA 5EGOB 3GZ6A 1TNTA 1ZRDA 3QYEA 2DA3A 1XPXA 2LSOA 5E1WA 5A2QK 1AU7A 2E2IJ 5BMZA 1Y0NA 4KICA 3V8JA 1S7OA 5HS8A 1F36A 2L01A 3IH2A 3NWSA 4RM3A 3HRMA 3MCZA 5ERIA 1LEAA 4HSTA 4I02A 2V9VA 1USTA 4OU0A 2LNBA 3OOPA 2O8XA 3CF5F 2VOOA 1HBXG 2R7OA 4XLHA 3I59B 2HI3A 4EJOA 1MDMB 3GX4X 1Y0UA 2L7MP 1SMYF 3WHBA 1B8IB 2E7XA 4MLOA 5M5XJ 2Q1ZB 1BJAA 2R7QA 3B73A 3MD2A 2DMQA 2CQQA 2H94A 3D5LA 3TP0A 3BR0A 2L7KA 3VSLA 2A68F 4KIGA 3CCRI 2W25A 2R7SA 2MD0A 3KP2A 2AXLA 3GO5A 2HTSA 2A5YB 1MSEC 2YS9A 3ECOA 1WGXA 4KT5C 2FA5A 5B1BH 2K40A 2QENA 2DT6A 4Y15A 4QWQA 4Y3OA 5ED4A 2X1EA 2F2EA 1DP3A 2ZO4A 2K27A 1OMIA 2ZSHB 1I1GA 4M73A 4ANJA 2B7EA 4UB8C 5FB2A 4RB2C 2Q2EB 3A1YA 1ZGWA 4UVCA 2D5VA 4GFBA 1X1DA 2MBFA 2QBYA 4CO8A 2X6XA 1FPQA 1B4AA 2EIMH 3PFIA 4YRVA 2CV1A 1XMXA 1T56A 2ACJA 2ID6A 4HYEA 4PZJA 2GWRA 3OL4A 2MLGA 3IAS2 2R5ZA 4I98B 1SVMA 4ZZLA 4YELA 4M3DA 1X2MA 1J7KA 3FF5A 3GYHX 4BY1J 5L3EA 2FBIA 2KDZA 2PJRA 2RNGA 2XB0X 5C4JJ 4PJNA 2LREA 3FMQA 3TO6A 3SZPA 5L3CA 2PEXA 4D1QA 1LPQA 5D5UB 2HPIA 3BDDA 5J1RA 3CJQB 4XNFA 4KUMA 3BR1A 1YE9A 2DA1A 2ZMEC 1W7PB 3KP3A 1AKHB 2W82A 5F0CA 3L2RA 1JT0A 5IP7J 2EA2A 3E5QA 4L5IA 1FWZA 1OCTC 2MFZA 3BR6A 3C7JA 4EEFG 1HKSA 1NG6A 2EFPA 1SFXA 4ABZA 3D1NI 1KZHA 2F5VA 1FYLA 1SEUA 3ABUA 2IGNA 3NQOA 3QPLA 3G1LA 3SEZA 2R7FA 5HS7A 3VOEA 4CCMA 4B44A 3UNGC 3S14J 2PQ8A 1KU9A 1D8KA 4MNUA 2W00A 3CCJI 1ZARA 3FXJA 5F64A 1TWAJ 2Y0MA 3MQ0A 5ILUA 1VQ9I 5TJJA 2ISZA 1Q1HA 4Y13A 5M3MJ 3OSFA 4GDFA 3HUGB 2JTVA 2K9SA 3RCOA 3ABKH 4EM1A 2YSRA 1UAAA 2BHYA 1MKMA 3A03A 1E2XA 1TWGJ 3F8BA 4EJVA 3AFHA 3H5AA 4E7ZA 1GV5A 2XRLA 3BPVA 4FX0A 4ESJA 4FISA 3QP5A 1BR4A 1ON1A 2MC3A 2M8EA 5HLTA 2WADA 2STTA 5L3DA 1KYZA 3BR2A 4IHTA 2PG4A 3W6VA 2L9VA 1ZG5A 4A93J 5HDKA 1IZ1A 1R4NB 4UUVA 4AC0A 3QP6A 2X48A 5CKTA 4A69C 4HOBA 5F27A 5CJ9A 1YJWI 4XKBA 1QPMA 2DA5A 3L7WA 1SD5A 1T0FC 3AG4H 3DEWA 4KYWA 1LNWA 4G6DA 3HYIA 1IUYA 2DOEA 2CH0A 1OCPA 2QM3A 3R6SA 4KDPA 2XKPA 3GLXA 4HDUA 4I2OA 4M9XA 3SEQA 2XAQA 1IC8A 1XN7A 3H9QA 2YU3A 4IXAA 5ICCA 5LFAA 4HLXA 2JUGA 1XSXA 2IXSA 2P5VA 3CJNA 3RYPA 1UHMA 3CJTB 1IW7F 4BUPA 3KCCA 3S1RJ 2OTJI 1UHSA 3K4MA 1STZA 1G2HA 2Q8KA 1WI9A 4XL9A 2W24A 5JI6A 2A6HF 2K9QA 1ERDA 1YW7A 2BGCA 4YIFA 3FXQA 4KFCA 3GWZA 2OA4A 4BQAA 3SDGA 1H9GA 1GVDA 1ODDA 3H1CA 3HSEA 3J81Z 4PK4A 1R00A 1LDDA 1X1PA 3OYNA 3KFWX 5C4XJ 2HU9A 3F9KA 2A05A 1WJCA 1D1AA 4R79A 2HDWA 3CP8A 2FQ3A 2HOEA 2ETHA 3OIQA 3EDPA 4NB5A 4PJJA 5FFXA 1QZEA 1USSA 3T8TA 5K5QA 1W5TA 4WXHA 3H92A 3TMOA 3O3KA 3HDDA 2VKVA 3DEUA 1W0TA 2JSCA 3QYBA 4BEHA 1T38A 3OYAA 4P55A 3E5XA 3TL4X 1G4DA 2HVRA 3E6CC 4ASNA 2ME0A 2ELJA 2DT7B 3HXLA 2E71A 1E3PA 1OQYA 5GAEJ 4EJUA 2D45A 1IG7A 2AQFA 2MH9A 3CCUI 2H1KA 5M5YJ 4QSHA 1SFOJ 3AL0C 1ZTRA 3MZHA 3RQIA 3HRTA 1KYWA 1Z7LA 1ZRFA 5FD5A 2HR3A 3RYRA 4G9YA 3MKLA 4IRGA 5H6QA 1R6RA 5AONA 3A01B 2F5FA 5FRNA 4EJWA 2XGCA 4WXCA 1ZELA 2BV6A 3TDUC 1SD4A 3HHGA 3Q0UA 5HS9A 3OYDA 4J01A 4DNCA 1NG7A 3HZJA 3MVPA 2BXYA 1XDSA 2DU9A 2WTEA 2E35A 2R7DA 3FISA 4ZYAA 2P7CB 2A3SA 2STWA 1LVKA 2W4SA 2OU2A 1JUPA 3CQZJ 5D4SA 4BU2A 5LGNA 4IHXA 2K3FA 2DXIA 4UHTA 3PIOF 3MKYB 2V4JC 2QSGX 5CQEA 4AIHA 3S2HJ 5JVGF 4U88A 2EH3A 2XAUA 3H9GA 4LB6B 1G3YA 4RDUA 1R23A 3HOZJ 1FTZA 1P7IA 1BIBA 4L9TA 4U0WA 4AWXB 5TRDA 2I8DA 2XC7A 1D0YA 3EUAA 4EQQA 2MD5A 2MYSA 2PJPA 1OYWA 1SVOA 1IO2A 3PSFA 4XRMA 1R71A 2HDCA 4ENKA 2COMA 5EYRA 2NYXA 1O3SA 1A5JA 2W1OA 2QYOA 4ETSA 2DK5A 3DPUA 2DMPA 1MBGA 2WWYA 3P7NA 2X6YA 3GFMA 2XAJA 4ZJZA 2JA2A 1R36A 1I3QJ 3IH4A 1K61A 4K2EA 1ETVA 1OCZH 2HVQA 4JX6A 1Z67A 2M30A 3ZR8X 2VIXA 5KAIC 4KJZA 5J40A 3RKWA 4MTDA 3OY9A 3O2PE 3LL7A 2NNYA 2KIUA 1QZZA 2Y30A 1Q1VA 2DMTA 1AHDP 2EFOA 3WTWC 1WHUA 3PNYA 3NAUA 2FMYA 2HZDA 4BXUA 1LE8A 2VJ5A 4ZYEA 4E6KG 4NDLA 3Q5FA 2H09A 3L2CA 2JK3A 4L0ZB 2WAQN 1F1ZA 3M4OJ 1WQ2A 4E7KA 2WAQA 1JKPC 3J81K 2OCCH 3I55I 1KA8A 2MG4A 5L3FA 1SANA 2R7XA 3E6DA 4B8XA 2JA7J 4YFNF 4GO1A 1ZYRF 2QZ8A 3S17J 4A3IJ 4LOCA 3P9CA 4C9YA 5EZGA 3OWTA 4YFKF 1B72A 1TLHB 2EFNA 4PJLA 2PFBA 3WHCA 3S1MJ 4XOTA 3K2AA 3LAJA 3WTYC 1FBUA 2GZWA 2X1CA 1IDYA 4HX4A 5E3MA 3ZQLA 4B43A 1ZLJA 2HNHA 2E36A 5D6EA 3T1BA 4NC7A 1GLNA 1P4WA 5HVQC 3ZPLA 2M45A 3FMSA 3H5RA 2KKOA 3BZ6A 3LQQA 3BZCA 1IUFA 3RPUD 2R0QC 3ULQB 4N0BA 3PFYA 2LRDA 2HGCA 2EZKA 3QU6A 3BZKA 1OLTA 4NQWB 1ZRCA 2BY1A 4XM3A 1ETOA 1X58A 4DZPA 1YW8A 5EDNA 5E1ZB 3ZRGA 3FM3A 1QZYA 1SFEA 2GA1A 4B3AA 3BLYA 3FXMA 4A0ZA 4AM3A 1APLC 2R5YB 1LKXA 3V8KA 4RAZA 5K5OA 2HWVA 2KHMA 4G8XA 1FYKA 2E1MC 2NVXJ 2EV0A 1JE8A 2VC1A 1LEBA 1OKRA 1R7JA 1LFPA 1ZR2A 1J9IA 4O5VA 4IHVA 3P9IA 2WC2A 3COAC 1Y56A 4UV8A 2BXZA 5E1XA 1ENHA 3K4KA 1VQPI 2JT1A 2Z33A 3H36A 3M1EA 5EEHA 1EH7A 2XF6A 4PGHA 1YO5C 4L9JA 3RPQA 2BHZA 4F52A 4P9UA 1MJBA 1VZ0A 1V3FA 2E7WA 4PSXA 4FE4A 5JHUA 4LFUA 3CC7I 1IRZA 3EUKL 3K70C 2QA4I 4G6QA 3ZOBA 3GTLJ 3BG6A 2BOLA 1FMWA 5K5RA 3G71I 3VB2A 3G6EI 2LKXA 2AO9A 3C2HA 4EATA 3J80Z 1DPUA 2BW3A 2DPDA 5LLQA 3NEUA 5K7HA 1RIOH 3RDIA 5F6FA 3N4MA 1RKTA 4KISA 5BQTA 1YS7A 1CF7A 3L2WA 2HQ5A 2CSOA 2NVTJ 1O3TA 3DV8A 5HOOA 4KITB 4KA4A 2CS3A 1BI2A 4L5EA 1V55H 3KLOA 2V6EA 2FOWA 2IS4A 5A2QZ 1RRJA 3FK7A 1C0WA 2DCEA 1XX5A 1JHFA 3IP4B 4CCLA 3P9KA 2RVCA 1MBJA 1OFCX 3FIWA 3IL2A 1WWXA 4XORA 4OIPF 2NS0A 1N25A 4H0EA 2O61A 5ICEA 4KT6A 2H6CA 2JA8J 1T33A 1WJFA 3G73A 2NOJB 2PMHA 3HRUA 2ZJRF 1KQ8A 4HQEA 5KNLA 1HDPA 1YJ9I 2DBBA 2XV4S 4U87A 1MMDA 3AG1H 1X19A 2Z9OA 1HW1A 3G2BA 2F4MB 2GAUA 4PJ0C 2LFBA 2FF4A 5E3NA 3V8LA 1MBKA 3CMYA 4EJTA 3NARA 2IP2A 2ZMEB 2Y48A 4ENNA 4F3QA 3ZCOA 2ADUA 1KU2A 2L2OA 3L2QA 2QCOA 5DD4A 1W0UA 4NC8A 2EV5A 2L9NA 5LHIA 1Z6RA 3OS0A 1B6AA 3CCVI 3TEDA 2LBFB 3I4NJ 2Y9ZA 3I56I 5TGTA 2W84A 3HOVJ 1I50J 1S7AA 3TOBA 3Q9VA 4M9ZA 3ZGKA 5HLHA 5LBQA 3RQ4A 1TQIA 2Z2SB 2VQCA 2P6TA 1SC7A 4QIWN 4GXOA 2JZYA 2ZSIB 1HF0A 1YX5A 4BXXJ 1U9NA 5B3SH 2CGPA 2O6GE 3IRRA 3RZDJ 5D5XB 3Q0WA 4DQ2A 3BJ6A 1FOXA 2LKPA 4N9HA 4BJ5C 1PYVA 3GTJJ 2X85A 1XS9A 5IYDJ 1S29A 2E1NA 1QVUA 1WJBA 4RB0A 4LIVA 5AIPA 2HDDA 1ETWA 1A6IA 4G7ZF 2IS2A 3MN2A 1W5CC 1W1WE 3CCLI 4J00A 3HKZN 1U2WA 2VJIA 2M4KA 2ECBA 4FQGA 4RGUA 3HKZA 3K6GA 2WBMA 3SHFA 4LG0B 5AIQA 4HAMA 1RETA 2QSFX 3L09A 3R4KA 3VYSB 2VT3A 2ME6A 5FLXK 4ZDPA 3PNVA 2BY0A 4XLCA 3I64A 4LMYA 4AYBN 4HRIA 1EV7A 1F5TA 2E34A 4BAYA 1LJ9A 3J80K 1B59A 2VB6A 4AYBA 5IP9J 2BVMA 2KT0A 3CMMA 1X3UA 2QQ9A 3VEPA 2VODA 2I10A 3GTPJ 1HA8A 2GM4A 1ULYA 1IJWC 3S2DJ 1LDJA 5E8GA 4CCOA 4CZZA 4E7LA 2A61A 1M1EB 2P0WA 3L1PA 1IXCA 2X51A 3ZN1A 2OC6A 4BYYA 5E3OA 1N75A 1XB4A 4HBLA 2ZXWH 4X0GA 1GDTA 4UUSA 1YRNA 2ZJQF 1WPKA 1YQAA 1T98A 4UV9A 1D5YA 3KP4A 2GXAA 5FRMA 4IOAF 4G7HF 4OMZA 4YEJA 2JRMA 2NVQJ 4O3MA 3KP7A 2DTZA 3S1QJ 2M9HA 3C2GA 2RQQA 3RTRA 3F0CA 3F8NA 4GYIA 1VQMI 5KAFC 3HOSA 4AD9A 1EF4A 2K9LA 3T0YA 1UMQA 4Z6YA 2NS8A 1Z05A 4NUBA 1W36D 1B1BA 3K4BA 4B3XA 1FJLA 3W2AA 2UXNA 2VPRA 3QOEA 1RC9A 4I6ZA 3GZNB 3JREA 1L0OC 2G7HA 2K3PA 5EF6A 3OYIA 2M87A 1WH7A 4EVIA 2QQAA 4UY8I 4BE0A 2NVYJ 3HL2A 2R7WA 3QRFF 1R5HA 1VQOI 2VBZA 3CUQA 1T39A 3B6CA 1PUFB 1XGOA 3M3YJ 2ZFWA 3WE3A 1TQPA 4XIDA 4BNCA 1XCBA 2BW3B 1XSVA 3KZYA 1K4TA 3AL0B 2KDOA 3DBLB 2Z99A 2M0MA 1O7FA 4N9IA 3LAPA 1IN8A 2A07F 2XAFA 4KIBA 1Z6TA 4P1WA 1BC7C 3JTHA 1VQ7I 1ONVA 3MFKA 2EIKH 2PX9A 2V9PA 4DW6A 1OR7A 1K78A 4OIRF 4MHGA 4E7IA 1KQ9A 4HF0A 3GFIA 2HOAA 2MGQA 2OUMA 2M5WA 3GZ5A 3OYLA 3OR1C 1XMKA 2WAFA 3EQLF 1BR1A 2DYSH 1U0JA 2P81A 3DTIA 2J5OA 5M5WJ 1TZLA 4D5CA 4ZYDA 5FKKA 4IRIA 3KEYA 4CA0A 1LFUP 1SD7A 2XF5A 4CCNA 1I3AA 3WTTC 5BPDA 2VLAA 4EM2A 4IEJA 5CVUA 1ORKA 1MD0A 3RJPA 3ZMVA 3JRAA 3R0JA 1GXQA 3ZMZA 2EB7A 1Z3YA 2XROA 3CESA 2HYJA 4A12A 4XKWA 1BL0A 1R5ID 5LEKA 2P5KA 3M9AA 2CG4A 4M6YA 2LLKA 3ELKA 3TO7A 1TC3C 2IS6A 3I0TA 4A3FJ 3IKVA 2DJNA 3CCSI 3H9JA 2CU7A 4B47A 4B4CA 4CYCB 1MNDA 3KP5A 2KPMA 1OYYA 4D9JA 4BACA 2Y69H 4Y4RA 3LNQA 5H6RA 3LSRA 3PQKA 1QA6A 1Z77A 4DZJA 4NNJA 1W7PD 1SFUA 1KONA 1D1BA 3WTUC 4B48A 2ZBKA 1SAUA 1VF9A 2P4WA 2FJ1A 4QPOA 3AG2H 3RKXA 4PFOA 3KLNA 1MJAA 2Q0OA 5F0HA 2QQBA 3WGGA 1AA7A 3BTIA 3RZOJ 1CQTA 2V1NA 4O6JA 1PP7U 1DUXC 4OAZA 5D4RA 1IAWA 1HW2A 1HLVA 2VBXA 3H5NA 4D0PA 3HG9A 3HTSB 2IGOA 2CW7A 3OS1A 2HFHA 2F48A 2E1CA 4ZDOA 1NTCA 3L00A 5H20A 1R1VA 5FFZA 3JSPA 1W5SA 3RPUA 2ZFUA 4HEA2 1FSHA 3DCFA 3VODA 3KETA 3RSNA 4WX9A 1XGSA 2CUEA 2M3AA 4CUGA 4F55A 2W7NA 3PNTA 1NK2P 3IC7A 1XD7A 3CMEI 4EM0B
chains in the Genus database with same CATH topology
4S05A 3LWFA 5KK1A 1IXRC 1OYIA 4I0AA 2HYGD 3ML6A 2ELHA 2K02A 1GVJA 2GQQA 1J75A 4LK1F 4XLNF 3WU1B 2PBIA 3C18A 3DKWA 2FOKA 3OV8A 2R3SA 3QPHA 2FNAA 3K1MA 2HQNA 3H3UA 4I01A 1FC3A 1GHCA 1FY7A 1ON2A 4Y17A 2OBPA 4LLNA 2ZKZA 1KU3A 1D5VA 2BE5F 1J2XA 4UVBA 3DFGA 4GCVA 5HDGA 3Q9SA 2IPQX 4L18B 5J8FA 1ZGAA 4L9NA 1E17A 3FX3A 2CYYA 5DCMA 5LHGA 4EGYA 3FZVA 4IPAA 1SAXA 4A6EA 2QBYB 2X0LA 3K2ZA 3HSRA 3WTSC 2DPUA 2JPBA 2IA0A 3LA3A 5D5WB 4FX4A 1BM9A 1SMTA 2EFWA 2W57A 1MZBA 2VE8A 2FEZA 3MAJA 1ZREA 4I09A 5JR3A 4CICA 1YYVA 4BHPA 4NHJA 3ZMTA 1HSJA 1ZHFA 4HLYA 1DP7P 1XGMA 1YW9A 2HS5A 1TBXA 4YFXF 2UXXA 1KU7A 5CYVA 2GIVA 5KVRA 2K4BA 3H3ZA 2NNNA 3WTZA 2ISYA 3I58A 2GXGA 5D8LB 3QPTA 1ZH5A 4XSXF 1A04A 2G7UA 3CTAA 3LA7A 3REOA 2L54A 4KN4X 3WTXC 3F6VA 3JAMK 2EV6A 2KIFA 4CGZA 2Z5UA 1FZPB 1U8RA 5DYMA 1XDUA 3DP7A 4Z2YA 5EEGA 3F8MA 4L9VA 2FMLA 5IT3A 3I53A 3F21A 1UHWA 3E6BA 4LJZF 2DTRA 1ZAOA 1F9NA 1PP8F 4RB1A 4A0YA 4EV0A 2FSWA 1F4KA 1O57A 4JBAA 4KIFA 1RZ4A 3K9TA 2YR2A 4OOIA 3HSFA 4HZFA 3FWEA 3EETA 2HEOA 1NHAA 2DQRA 1U6GA 3WU0A 4XBFA 1P92A 5DD8A 2XAGA 2DFIA 2H6BA 2GA2A 2EJRA 1IRGA 1LQ1A 3GFLA 1BOAA 4OMYA 1K79A 4U7BA 1FNNA 1S8NA 2A69F 5BS6A 3CUQC 3WGIA 3SFZA 1FP2A 4ESBA 3SZTA 2L4MA 3V7SA 2Z3YA 2YX4A 2VXZA 5LGTA 4HDVA 2LF7A 3R61A 2ZJ2A 4PGGA 2CO5A 1IN4A 1MGTA 2D1HA 5FLXZ 4F7ZA 1QO0D 4MTEA 2K7LA 1R1UA 2FRHA 1FBQA 3LFKA 1EH8A 2CWEA 3BROA 2P7VB 2FU4A 3GF2A 5D8KB 4MQVA 3EYYA 4XSZF 2XGXA 2XAHA 1MDMA 2MH2A 2BEOA 2PMUA 3SQNA 4LK0F 4YIIA 2HYFA 4HQMA 4HW0A 1LVAA 1KQ0A 1XCVA 3W6KB 1L3LA 4G7OF 4RAYA 3V7RA 4S04A 3IHUA 2VOPA 1Z9CA 3LSTA 4IRHA 3BP8A 2KIMA 2VT2A 3JTGA 4LD5A 4IJAA 5LRSA 3KP6A 5FGMA 5L3BA 3V4GA 2O3FA 4RS8A 5J8CA 2UWMA 2F5EA 1FBSA 1J5YA 1I1SA 2HKXA 3ROUA 3TDZC 3PQJA 1W7PA 2PLYA 3U2RA 5E17F 5D5VB 2RQPA 5FO5A 2RN7A 4WWCA 2IT0A 2EWNA 4FHTA 4U7DA 5CVJA 3E5UA 1JHHA 3IKTA 2BBYA 4KNYA 2RC4A 2DLLA 5CVRA 4ON0A 2VC0A 3HUGA 1P6RA 3FMRA 3DPTA 3F8FA 2FE3A 1XMAA 4A0XA 1U3EM 3EYIA 1BI1A 3SXYA 4A6DA 4TV7A 3E3VA 3I54A 3EUHA 3IWFA 1TTYA 2IJLA 2VONA 5DDGA 2DQLA 4R1HA 3W6JB 2V1UA 2YX7A 2ESHA 5CLSA 3FM5A 2YPRA 2FNPA 2NRAC 4HF1A 1DPRA 1IXSB 1G3SA 2ZNYA 1ZG3A 3HIFA 1R22A 4ZYGA 2QWWA 4AIJA 2O03A 1IN5A 5HLGA 3F6OA 3C3WA 1CGPA 1FT9A 2OQRA 3I5UA 3GVAA 1QBJA 2XKOA 1D3YA 1S6LA 3GFJA 3WG9A 1KGSA 4L5JA 2OD5A 2PI0A 3RIRA 4OINF 4L0YB 2B0LA 2GXBA 5LRRA 1CF7B 3DXJF 1TW3A 5HLIA 3E6MA 4A2UA 2QVOA 4AIKA 1ZN2A 6PAXA 2IA2A 4FT8A 2EFQA 3IRQA 4IVNA 4QLCU 2D2WA 4ENJA 1GXPA 1YG2A 1TW2A 2LF8A 5HDNA 4XRFA 3CDHA 3CO7C 1U5TA 4CHUA 3WE2A 2ZXJA 1OPCA 2IRFG 4P96A 3WTVC 1BN5A 2DT5A 3QAHA 5LHHA 1IF1A 1B9NA 3RKYA 1YLFA 3HHHA 5J6XA 5ILVA 2OAZA 1IN7A 3TGNA 1FX7A 2P5LC 3R60A 2FBKA 5E18F 4WXDA 2OQGA 5ICGA 2VE9A 5DUKA 3D0SA 4KMFA 4MGRA 5BOXA 3FXUA 3WODF 4I7HA 1R58A 3J7AO 3V7CA 4M9SA 4HF2A 2CQKA 4GYGA 4CXFA 5DV5A 2VBWA 4I0BA 2ZCWA 1YIOA 3M7GA 4E70A 3LA2A 1EH6A 4RB3C 1G3TA 2K4JA 4MEXF 2HKOA 2XHKA 3FXRA 2FXAA 4KMUX 4UXNA 1B9MA 3IWZA 3U1DA 1AOYA 2RV8A 2JRTA 2C6YA 4B09A 1I5ZA 4KN7X 1JXSA 1G3WA 1UFMA 3S2WA 1BIAA 2L02A 4R8HA 4ZH4F 3ZMDA 2MLKA 2XIGA 1XGNA 3KEOA 4AVPA 3JAMZ 3QOPA 2QLZA 3CO6C 4U0VA 2UZKA 1YS6A 3KEQA 2KJBA 4WK8F 3RI4A 4NQWA 2RNJA 3GEZA 1REPC 1P2FA 1FSEA 1QNTA 1XSDA 1YTYA 5DUIA 3ECHA 3KE2A 4HV5A 3ERED 3MZYA 2RKHA 3TKYA 2JPCA 1Z7UA 1HKQA 1WKMA 4HV6A 4RGSA 1K6OA 3ZMSA 2J5PA 3O6BB 3ZQ7A 3CUQB 1O7LA 3TOAA 2DAOA 1BI0A 1RNLA 5DCFA 4PCQA 2F5DA 2ZNZA 4ENMA 4HA8A 3F72A 1K78B 1T6SA 1FP1D 3R0AA 3HRSA 3QU3A 2XUBA 2OZUA 3VFZA 1R5GA 3BJOA 5D6FA 5ICFA 2CW0F 3LQRA 1P4XA 1U5TB 1HXDA 3ABTA 2VN2A 5ILSA 3BJAA 4Q48A 2PN6A 1W4MA 4Q47A 1WSUA 2V1DA 1MJ9A 3ZP5A 4P9FA 4BH9A 3HTUA 4M72A 4M71A 4EGZA 2CFXA 4RGRA 1BI3A 3DPLC 1I27A 3I4PA 3CLOA 1H0MA 3MEXA 4ZYHA 4BHBA 1K7AA 2ESNA 5DEQA 4UVAA 2DW4A 1V4RA 3E97A 4PDKA 1HKTA 2ZMEA 1TNSA 4P5OA 5JFRA 3TQNA 2F5CA 3NRVA 1J59A 1FYMA 1WRJA 5BPIA 2EK5A 3T5XA 1S3JA 2HZTA 1D8JA 1BC8C 2DK8A 2VBYA 1TQMA 2NAZA 1RUNA 1ZGJA 3WGHA 5CVVA 1ZG1A 3G3ZA 3BOQA 2O0YA 2IW5A 4BHCA 3GUDA 3T8RA 3K1PA 2AS5F 5FD6A 2KRFA 4M74A 3JW4A 2FBHA 1DDNA 2X4HA 1LDKB 4A5NA 2QUFA 4EMSA 4OIQF 1RUOA 4XLPF 1VTNC 1QQIA 3BY6A 1T2KA 4WF2A 4LG0A 1T0FA 1I6XA 4GGGA 2OZ6A 2V1XA 2Y75A 5IT9K 2WV0A 5CVIA 1R1TA 2KJCA 3DQVC 3ZMUA 3FHZA 4UNOA 2DI3A 4G94A 2DO7A 1G6NA 1H9TA 5JVTA 2BYVE 4HX8A 2P6SA 5DCMB 4LLGF 2HTJA 1U78A 4OIOF 1IRFA 3B02A 3I59A 1RI7A 2M1BA 3K69A 2L4AA 4LGWA 1FLIA 3F3XA 5F1RA 3I71A 3ZN0A 1U5TC 1O3QA 2IVMA 2XVCA 3ISPA 1Z91A 4IHSA 5LGUA 1HSTA 1FOKA 3JSOA 4MQ9F 3DF8A 2Q2EA 4LB5A 1O3RA 4LLLA 1AWCA 3K1NA 3F22A 1ZLKA 2V6CA 3F8CA 1BBYA 2EA4A 3GW2A 4CDGA 3TO9A 4Q5SF 4WCGA 2H27A 2HQRA 3HOTA 1QGPA 2LDUA 1PUEE 2D1VA 2RDPA 5E8IA 3M8EA 4IF4A 2MA3A 3M8FA 3K0LA 4M6XA 1LB2A 4U0YA 2P8TA 3MWMA 4JK1X 1IN6A 4Q4ZF 3KZZA 4CYDA 1YFHA 2K86A 3U9GA 4MEYF 3F23A 1SD6A 3L9FA 2XRNA 4A5MA 3AAFA 4ESFA 4YG2F 1JGSA 5L3GA 4HX7A 3BPXA 4RGXA 2IA1A 4JQFA 2RGVA 2XASA 2L3DA 3GXOA 5LEJA 4ZZDA 2V79A 1HQCA 1PDNC 1Z1DA 1HW5A 1P4AA 5E20A 2TDXA 5K1YA 2A6EF 1J0RA 1UCRA 3C1DA 2W85A 2G9WA 1UB9A 3CUOA 3BWGA 3N97A 3GZ6A 1TNTA 1ZRDA 2LSOA 5E1WA 5A2QK 5BMZA 4KICA 3V8JA 1S7OA 5HS8A 2L01A 3HRMA 3MCZA 5ERIA 1LEAA 4I02A 2V9VA 1USTA 4OU0A 2LNBA 3OOPA 2O8XA 2VOOA 1HBXG 3I59B 4EJOA 1MDMB 3GX4X 1Y0UA 1SMYF 2E7XA 1BJAA 3B73A 2H94A 3D5LA 2A68F 4KIGA 2W25A 3KP2A 2AXLA 3GO5A 2HTSA 2A5YB 3ECOA 4KT5C 2FA5A 2QENA 4Y15A 4QWQA 5ED4A 2F2EA 2ZO4A 2K27A 1OMIA 4M73A 1I1GA 5FB2A 4RB2C 4UVCA 2MBFA 2QBYA 4CO8A 1FPQA 1B4AA 3PFIA 2ACJA 4HYEA 4PZJA 2GWRA 2MLGA 4I98B 4ZZLA 1J7KA 3FF5A 3GYHX 5L3EA 2FBIA 3FMQA 3TO6A 3SZPA 5L3CA 2PEXA 5D5UB 3BDDA 4KUMA 3KP3A 1W7PB 2EA2A 3E5QA 4L5IA 1FWZA 3C7JA 1HKSA 2EFPA 1SFXA 1FYLA 3ABUA 3NQOA 2R7FA 5HS7A 3VOEA 2PQ8A 1KU9A 1D8KA 4MNUA 1ZARA 5F64A 2Y0MA 3MQ0A 5ILUA 5TJJA 2ISZA 1Q1HA 4Y13A 2JTVA 4EM1A 2YSRA 1MKMA 1E2XA 3F8BA 4EJVA 3BPVA 4FX0A 4ESJA 3QP5A 1ON1A 2MC3A 2M8EA 2STTA 5L3DA 1KYZA 4IHTA 2PG4A 1ZG5A 5HDKA 1IZ1A 4UUVA 3QP6A 4HOBA 5CJ9A 1QPMA 3L7WA 1SD5A 4KYWA 1LNWA 4G6DA 3HYIA 1IUYA 2QM3A 3R6SA 4KDPA 2XKPA 3GLXA 4HDUA 4I2OA 4M9XA 2XAQA 1XN7A 2YU3A 4IXAA 5ICCA 4HLXA 1XSXA 2P5VA 3CJNA 3RYPA 1UHMA 1IW7F 3KCCA 1STZA 2Q8KA 1WI9A 5JI6A 2W24A 2A6HF 1YW7A 2BGCA 4YIFA 3FXQA 4KFCA 3GWZA 2OA4A 4BQAA 1H9GA 1ODDA 3HSEA 3J81Z 1R00A 1LDDA 3KFWX 4R79A 2FQ3A 2HOEA 2ETHA 4NB5A 3EDPA 5FFXA 5K5QA 3T8TA 1USSA 1W5TA 4WXHA 3H92A 3O3KA 3DEUA 2JSCA 1T38A 4P55A 3E5XA 1G4DA 3E6CC 4ASNA 4EJUA 2D45A 2MH9A 3MZHA 3HRTA 1KYWA 1ZRFA 3RYRA 2HR3A 5FD5A 4G9YA 4IRGA 5H6QA 5AONA 2F5FA 4EJWA 4WXCA 2BV6A 3TDUC 1SD4A 3HHGA 5HS9A 4DNCA 5IT9Z 1XDSA 2DU9A 2WTEA 2R7DA 2P7CB 2A3SA 2STWA 5LGNA 2OU2A 5D4SA 4UHTA 4AIHA 4U88A 4LB6B 1G3YA 1R23A 1BIBA 4L9TA 4U0WA 4AWXB 5TRDA 4EQQA 2MD5A 2PJPA 1OYWA 2HDCA 4ENKA 2COMA 2NYXA 1O3SA 2QYOA 4ETSA 2DK5A 2WWYA 3P7NA 3GFMA 2XAJA 1R36A 4K2EA 2M30A 3RKWA 4MTDA 3O2PE 2NNYA 2KIUA 1QZZA 2EFOA 3WTWC 2FMYA 4BXUA 4ZYEA 3Q5FA 2H09A 3L2CA 4L0ZB 1F1ZA 1WQ2A 3J81K 1KA8A 5L3FA 3E6DA 4B8XA 4YFNF 4GO1A 1ZYRF 2QZ8A 3P9CA 4YFKF 1TLHB 2EFNA 2PFBA 3LAJA 3WTYC 1FBUA 2GZWA 4HX4A 1ZLJA 5D6EA 3T1BA 1P4WA 5HVQC 3ZPLA 2M45A 3FMSA 2KKOA 3BZ6A 3LQQA 3ULQB 4N0BA 2HGCA 3QU6A 1ZRCA 1YW8A 5E1ZB 3FM3A 1QZYA 1SFEA 2GA1A 4A0ZA 3V8KA 4RAZA 5K5OA 2HWVA 4G8XA 1FYKA 2EV0A 1JE8A 2VC1A 1LEBA 1OKRA 1R7JA 1J9IA 4O5VA 3P9IA 2WC2A 3COAC 4UV8A 5E1XA 2JT1A 2Z33A 3M1EA 5EEHA 1EH7A 4PGHA 1YO5C 4L9JA 3RPQA 4P9UA 1MJBA 1V3FA 2E7WA 5JHUA 4LFUA 4G6QA 5K5RA 3VB2A 3J80Z 1DPUA 2DPDA 5LLQA 3NEUA 1RIOH 3RDIA 5F6FA 3N4MA 5BQTA 1YS7A 1CF7A 2CSOA 1O3TA 3DV8A 5HOOA 4KA4A 1BI2A 3KLOA 5A2QZ 1C0WA 1JHFA 3P9KA 2RVCA 3IL2A 1WWXA 4OIPF 2O61A 2NS0A 4H0EA 5ICEA 2H6CA 3G73A 2PMHA 3HRUA 1KQ8A 4HQEA 2DBBA 2XV4S 2Z9OA 1HW1A 2GAUA 2FF4A 3V8LA 4EJTA 2IP2A 2ZMEB 2Y48A 4ENNA 2ADUA 1KU2A 5DD4A 2EV5A 5LHIA 1Z6RA 1B6AA 2W84A 1S7AA 3TOBA 3Q9VA 4M9ZA 5HLHA 5LBQA 1TQIA 2P6TA 4GXOA 2JZYA 2CGPA 2O6GE 3IRRA 5D5XB 4DQ2A 3BJ6A 2LKPA 4N9HA 1S29A 2E1NA 4RB0A 5AIPA 4G7ZF 1U2WA 4RGUA 3SHFA 4LG0B 5AIQA 4HAMA 3L09A 3R4KA 2VT3A 5FLXK 3I64A 4LMYA 1EV7A 1F5TA 4BAYA 1LJ9A 3J80K 1B59A 1X3UA 2QQ9A 3VEPA 2VODA 1ULYA 1LDJA 5E8GA 4CZZA 2A61A 1IXCA 3ZN1A 4BYYA 1XB4A 4HBLA 1YQAA 1T98A 4UV9A 3KP4A 4G7HF 4OMZA 4O3MA 3KP7A 3RTRA 3F8NA 4GYIA 3HOSA 4AD9A 3T0YA 1Z05A 1B1BA 2UXNA 1L0OC 2G7HA 2M87A 4EVIA 2QQAA 3QRFF 1R5HA 2VBZA 3CUQA 1T39A 1XGOA 2ZFWA 3WE3A 1TQPA 4BNCA 1XCBA 1XSVA 3KZYA 2Z99A 4N9IA 1O7FA 3LAPA 1IN8A 2A07F 2XAFA 4KIBA 1Z6TA 1BC7C 3JTHA 1ONVA 3MFKA 1OR7A 1K78A 4OIRF 4MHGA 1KQ9A 4HF0A 3GFIA 2M5WA 3GZ5A 1XMKA 3EQLF 2J5OA 4ZYDA 4IRIA 1SD7A 3WTTC 5BPDA 4EM2A 5CVUA 1MD0A 3RJPA 3ZMVA 3R0JA 1GXQA 3ZMZA 2EB7A 2XROA 4A12A 5LEKA 2P5KA 3M9AA 2CG4A 4M6YA 3ELKA 3TO7A 3I0TA 3IKVA 3KP5A 1OYYA 5H6RA 3PQKA 1W7PD 1SFUA 3WTUC 2ZBKA 2P4WA 3RKXA 3KLNA 1MJAA 2Q0OA 2QQBA 3WGGA 4O6JA 1PP7U 1DUXC 5D4RA 1IAWA 1HW2A 2VBXA 4D0PA 3HTSB 2HFHA 2E1CA 3L00A 5H20A 1R1VA 5FFZA 3JSPA 1W5SA 3RPUA 1FSHA 3VODA 3KETA 4WX9A 1XGSA 3IC7A 1XD7A 4EM0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4S05 A;  3LWF A;  5KK1 A;  1IXR C;  1OYI A;  4I0A A;  2HYG D;  3ML6 A;  2ELH A;  2K02 A;  1GVJ A;  2GQQ A;  1J75 A;  4LK1 F;  4XLN F;  3WU1 B;  2PBI A;  3C18 A;  3DKW A;  2FOK A;  3OV8 A;  2R3S A;  3QPH A;  2FNA A;  3K1M A;  2HQN A;  3H3U A;  4I01 A;  1FC3 A;  1GHC A;  1FY7 A;  1ON2 A;  4Y17 A;  2OBP A;  4LLN A;  2ZKZ A;  1KU3 A;  1D5V A;  2BE5 F;  1J2X A;  4UVB A;  3DFG A;  4GCV A;  5HDG A;  3Q9S A;  2IPQ X;  4L18 B;  5J8F A;  1ZGA A;  4L9N A;  1E17 A;  3FX3 A;  2CYY A;  5DCM A;  5LHG A;  4EGY A;  3FZV A;  4IPA A;  1SAX A;  4A6E A;  2QBY B;  2X0L A;  3K2Z A;  3HSR A;  3WTS C;  2DPU A;  2JPB A;  2IA0 A;  3LA3 A;  5D5W B;  4FX4 A;  1BM9 A;  1SMT A;  2EFW A;  2W57 A;  1MZB A;  2VE8 A;  2FEZ A;  3MAJ A;  1ZRE A;  4I09 A;  5JR3 A;  4CIC A;  1YYV A;  4BHP A;  4NHJ A;  3ZMT A;  1HSJ A;  1ZHF A;  4HLY A;  1DP7 P;  1XGM A;  1YW9 A;  2HS5 A;  1TBX A;  4YFX F;  2UXX A;  1KU7 A;  5CYV A;  2GIV A;  5KVR A;  2K4B A;  3H3Z A;  2NNN A;  3WTZ A;  2ISY A;  3I58 A;  2GXG A;  5D8L B;  3QPT A;  1ZH5 A;  4XSX F;  1A04 A;  2G7U A;  3CTA A;  3LA7 A;  3REO A;  2L54 A;  4KN4 X;  3WTX C;  3F6V A;  3JAM K;  2EV6 A;  2KIF A;  4CGZ A;  2Z5U A;  1FZP B;  1U8R A;  5DYM A;  1XDU A;  3DP7 A;  4Z2Y A;  5EEG A;  3F8M A;  4L9V A;  2FML A;  5IT3 A;  3I53 A;  3F21 A;  1UHW A;  3E6B A;  4LJZ F;  2DTR A;  1ZAO A;  1F9N A;  1PP8 F;  4RB1 A;  4A0Y A;  4EV0 A;  2FSW A;  1F4K A;  1O57 A;  4JBA A;  4KIF A;  1RZ4 A;  3K9T A;  2YR2 A;  4OOI A;  3HSF A;  4HZF A;  3FWE A;  3EET A;  2HEO A;  1NHA A;  2DQR A;  1U6G A;  3WU0 A;  4XBF A;  1P92 A;  5DD8 A;  2XAG A;  2DFI A;  2H6B A;  2GA2 A;  2EJR A;  1IRG A;  1LQ1 A;  3GFL A;  1BOA A;  4OMY A;  1K79 A;  4U7B A;  1FNN A;  1S8N A;  2A69 F;  5BS6 A;  3CUQ C;  3WGI A;  3SFZ A;  1FP2 A;  4ESB A;  3SZT A;  2L4M A;  3V7S A;  2Z3Y A;  2YX4 A;  2VXZ A;  5LGT A;  4HDV A;  2LF7 A;  3R61 A;  2ZJ2 A;  4PGG A;  2CO5 A;  1IN4 A;  1MGT A;  2D1H A;  5FLX Z;  4F7Z A;  1QO0 D;  4MTE A;  2K7L A;  1R1U A;  2FRH A;  1FBQ A;  3LFK A;  1EH8 A;  2CWE A;  3BRO A;  2P7V B;  2FU4 A;  3GF2 A;  5D8K B;  4MQV A;  3EYY A;  4XSZ F;  2XGX A;  2XAH A;  1MDM A;  2MH2 A;  2BEO A;  2PMU A;  3SQN A;  4LK0 F;  4YII A;  2HYF A;  4HQM A;  4HW0 A;  1LVA A;  1KQ0 A;  1XCV A;  3W6K B;  1L3L A;  4G7O F;  4RAY A;  3V7R A;  4S04 A;  3IHU A;  2VOP A;  1Z9C A;  3LST A;  4IRH A;  3BP8 A;  2KIM A;  2VT2 A;  3JTG A;  4LD5 A;  4IJA A;  5LRS A;  3KP6 A;  5FGM A;  5L3B A;  3V4G A;  2O3F A;  4RS8 A;  5J8C A;  2UWM A;  2F5E A;  1FBS A;  1J5Y A;  1I1S A;  2HKX A;  3ROU A;  3TDZ C;  3PQJ A;  1W7P A;  2PLY A;  3U2R A;  5E17 F;  5D5V B;  2RQP A;  5FO5 A;  2RN7 A;  4WWC A;  2IT0 A;  2EWN A;  4FHT A;  4U7D A;  5CVJ A;  3E5U A;  1JHH A;  3IKT A;  2BBY A;  4KNY A;  2RC4 A;  2DLL A;  5CVR A;  4ON0 A;  2VC0 A;  3HUG A;  1P6R A;  3FMR A;  3DPT A;  3F8F A;  2FE3 A;  1XMA A;  4A0X A;  1U3E M;  3EYI A;  1BI1 A;  3SXY A;  4A6D A;  4TV7 A;  3E3V A;  3I54 A;  3EUH A;  3IWF A;  1TTY A;  2IJL A;  2VON A;  5DDG A;  2DQL A;  4R1H A;  3W6J B;  2V1U A;  2YX7 A;  2ESH A;  5CLS A;  3FM5 A;  2YPR A;  2FNP A;  2NRA C;  4HF1 A;  1DPR A;  1IXS B;  1G3S A;  2ZNY A;  1ZG3 A;  3HIF A;  1R22 A;  4ZYG A;  2QWW A;  4AIJ A;  2O03 A;  1IN5 A;  5HLG A;  3F6O A;  3C3W A;  1CGP A;  1FT9 A;  2OQR A;  3I5U A;  3GVA A;  1QBJ A;  2XKO A;  1D3Y A;  1S6L A;  3GFJ A;  3WG9 A;  1KGS A;  4L5J A;  2OD5 A;  2PI0 A;  3RIR A;  4OIN F;  4L0Y B;  2B0L A;  2GXB A;  5LRR A;  1CF7 B;  3DXJ F;  1TW3 A;  5HLI A;  3E6M A;  4A2U A;  2QVO A;  4AIK A;  1ZN2 A;  6PAX A;  2IA2 A;  4FT8 A;  2EFQ A;  3IRQ A;  4IVN A;  4QLC U;  2D2W A;  4ENJ A;  1GXP A;  1YG2 A;  1TW2 A;  2LF8 A;  5HDN A;  4XRF A;  3CDH A;  3CO7 C;  1U5T A;  4CHU A;  3WE2 A;  2ZXJ A;  1OPC A;  2IRF G;  4P96 A;  3WTV C;  1BN5 A;  2DT5 A;  3QAH A;  5LHH A;  1IF1 A;  1B9N A;  3RKY A;  1YLF A;  3HHH A;  5J6X A;  5ILV A;  2OAZ A;  1IN7 A;  3TGN A;  1FX7 A;  2P5L C;  3R60 A;  2FBK A;  5E18 F;  4WXD A;  2OQG A;  5ICG A;  2VE9 A;  5DUK A;  3D0S A;  4KMF A;  4MGR A;  5BOX A;  3FXU A;  3WOD F;  4I7H A;  1R58 A;  3J7A O;  3V7C A;  4M9S A;  4HF2 A;  2CQK A;  4GYG A;  4CXF A;  5DV5 A;  2VBW A;  4I0B A;  2ZCW A;  1YIO A;  3M7G A;  4E70 A;  3LA2 A;  1EH6 A;  4RB3 C;  1G3T A;  2K4J A;  4MEX F;  2HKO A;  2XHK A;  3FXR A;  2FXA A;  4KMU X;  4UXN A;  1B9M A;  3IWZ A;  3U1D A;  1AOY A;  2RV8 A;  2JRT A;  2C6Y A;  4B09 A;  1I5Z A;  4KN7 X;  1JXS A;  1G3W A;  1UFM A;  3S2W A;  1BIA A;  2L02 A;  4R8H A;  4ZH4 F;  3ZMD A;  2MLK A;  2XIG A;  1XGN A;  3KEO A;  4AVP A;  3JAM Z;  3QOP A;  2QLZ A;  3CO6 C;  4U0V A;  2UZK A;  1YS6 A;  3KEQ A;  2KJB A;  4WK8 F;  3RI4 A;  4NQW A;  2RNJ A;  3GEZ A;  1REP C;  1P2F A;  1FSE A;  1QNT A;  1XSD A;  1YTY A;  5DUI A;  3ECH A;  3KE2 A;  4HV5 A;  3ERE D;  3MZY A;  2RKH A;  3TKY A;  2JPC A;  1Z7U A;  1HKQ A;  1WKM A;  4HV6 A;  4RGS A;  1K6O A;  3ZMS A;  2J5P A;  3O6B B;  3ZQ7 A;  3CUQ B;  1O7L A;  3TOA A;  2DAO A;  1BI0 A;  1RNL A;  5DCF A;  4PCQ A;  2F5D A;  2ZNZ A;  4ENM A;  4HA8 A;  3F72 A;  1K78 B;  1T6S A;  1FP1 D;  3R0A A;  3HRS A;  3QU3 A;  2XUB A;  2OZU A;  3VFZ A;  1R5G A;  3BJO A;  5D6F A;  5ICF A;  2CW0 F;  3LQR A;  1P4X A;  1U5T B;  1HXD A;  3ABT A;  2VN2 A;  5ILS A;  3BJA A;  4Q48 A;  2PN6 A;  1W4M A;  4Q47 A;  1WSU A;  2V1D A;  1MJ9 A;  3ZP5 A;  4P9F A;  4BH9 A;  3HTU A;  4M72 A;  4M71 A;  4EGZ A;  2CFX A;  4RGR A;  1BI3 A;  3DPL C;  1I27 A;  3I4P A;  3CLO A;  1H0M A;  3MEX A;  4ZYH A;  4BHB A;  1K7A A;  2ESN A;  5DEQ A;  4UVA A;  2DW4 A;  1V4R A;  3E97 A;  4PDK A;  1HKT A;  2ZME A;  1TNS A;  4P5O A;  5JFR A;  3TQN A;  2F5C A;  3NRV A;  1J59 A;  1FYM A;  1WRJ A;  5BPI A;  2EK5 A;  3T5X A;  1S3J A;  2HZT A;  1D8J A;  1BC8 C;  2DK8 A;  2VBY A;  1TQM A;  2NAZ A;  1RUN A;  1ZGJ A;  3WGH A;  5CVV A;  1ZG1 A;  3G3Z A;  3BOQ A;  2O0Y A;  2IW5 A;  4BHC A;  3GUD A;  3T8R A;  3K1P A;  2AS5 F;  5FD6 A;  2KRF A;  4M74 A;  3JW4 A;  2FBH A;  1DDN A;  2X4H A;  1LDK B;  4A5N A;  2QUF A;  4EMS A;  4OIQ F;  1RUO A;  4XLP F;  1VTN C;  1QQI A;  3BY6 A;  1T2K A;  4WF2 A;  4LG0 A;  1T0F A;  1I6X A;  4GGG A;  2OZ6 A;  2V1X A;  2Y75 A;  5IT9 K;  2WV0 A;  5CVI A;  1R1T A;  2KJC A;  3DQV C;  3ZMU A;  3FHZ A;  4UNO A;  2DI3 A;  4G94 A;  2DO7 A;  1G6N A;  1H9T A;  5JVT A;  2BYV E;  4HX8 A;  2P6S A;  5DCM B;  4LLG F;  2HTJ A;  1U78 A;  4OIO F;  1IRF A;  3B02 A;  3I59 A;  1RI7 A;  2M1B A;  3K69 A;  2L4A A;  4LGW A;  1FLI A;  3F3X A;  5F1R A;  3I71 A;  3ZN0 A;  1U5T C;  1O3Q A;  2IVM A;  2XVC A;  3ISP A;  1Z91 A;  4IHS A;  5LGU A;  1HST A;  1FOK A;  3JSO A;  4MQ9 F;  3DF8 A;  2Q2E A;  4LB5 A;  1O3R A;  4LLL A;  1AWC A;  3K1N A;  3F22 A;  1ZLK A;  2V6C A;  3F8C A;  1BBY A;  2EA4 A;  3GW2 A;  4CDG A;  3TO9 A;  4Q5S F;  4WCG A;  2H27 A;  2HQR A;  3HOT A;  1QGP A;  2LDU A;  1PUE E;  2D1V A;  2RDP A;  5E8I A;  3M8E A;  4IF4 A;  2MA3 A;  3M8F A;  3K0L A;  4M6X A;  1LB2 A;  4U0Y A;  2P8T A;  3MWM A;  4JK1 X;  1IN6 A;  4Q4Z F;  3KZZ A;  4CYD A;  1YFH A;  2K86 A;  3U9G A;  4MEY F;  3F23 A;  1SD6 A;  3L9F A;  2XRN A;  4A5M A;  3AAF A;  4ESF A;  4YG2 F;  1JGS A;  5L3G A;  4HX7 A;  3BPX A;  4RGX A;  2IA1 A;  4JQF A;  2RGV A;  2XAS A;  2L3D A;  3GXO A;  5LEJ A;  4ZZD A;  2V79 A;  1HQC A;  1PDN C;  1Z1D A;  1HW5 A;  1P4A A;  5E20 A;  2TDX A;  5K1Y A;  2A6E F;  1J0R A;  1UCR A;  3C1D A;  2W85 A;  2G9W A;  1UB9 A;  3CUO A;  3BWG A;  3N97 A;  3GZ6 A;  1TNT A;  1ZRD A;  2LSO A;  5E1W A;  5A2Q K;  5BMZ A;  4KIC A;  3V8J A;  1S7O A;  5HS8 A;  2L01 A;  3HRM A;  3MCZ A;  5ERI A;  1LEA A;  4I02 A;  2V9V A;  1UST A;  4OU0 A;  2LNB A;  3OOP A;  2O8X A;  2VOO A;  1HBX G;  3I59 B;  4EJO A;  1MDM B;  3GX4 X;  1Y0U A;  1SMY F;  2E7X A;  1BJA A;  3B73 A;  2H94 A;  3D5L A;  2A68 F;  4KIG A;  2W25 A;  3KP2 A;  2AXL A;  3GO5 A;  2HTS A;  2A5Y B;  3ECO A;  4KT5 C;  2FA5 A;  2QEN A;  4Y15 A;  4QWQ A;  5ED4 A;  2F2E A;  2ZO4 A;  2K27 A;  1OMI A;  4M73 A;  1I1G A;  5FB2 A;  4RB2 C;  4UVC A;  2MBF A;  2QBY A;  4CO8 A;  1FPQ A;  1B4A A;  3PFI A;  2ACJ A;  4HYE A;  4PZJ A;  2GWR A;  2MLG A;  4I98 B;  4ZZL A;  1J7K A;  3FF5 A;  3GYH X;  5L3E A;  2FBI A;  3FMQ A;  3TO6 A;  3SZP A;  5L3C A;  2PEX A;  5D5U B;  3BDD A;  4KUM A;  3KP3 A;  1W7P B;  2EA2 A;  3E5Q A;  4L5I A;  1FWZ A;  3C7J A;  1HKS A;  2EFP A;  1SFX A;  1FYL A;  3ABU A;  3NQO A;  2R7F A;  5HS7 A;  3VOE A;  2PQ8 A;  1KU9 A;  1D8K A;  4MNU A;  1ZAR A;  5F64 A;  2Y0M A;  3MQ0 A;  5ILU A;  5TJJ A;  2ISZ A;  1Q1H A;  4Y13 A;  2JTV A;  4EM1 A;  2YSR A;  1MKM A;  1E2X A;  3F8B A;  4EJV A;  3BPV A;  4FX0 A;  4ESJ A;  3QP5 A;  1ON1 A;  2MC3 A;  2M8E A;  2STT A;  5L3D A;  1KYZ A;  4IHT A;  2PG4 A;  1ZG5 A;  5HDK A;  1IZ1 A;  4UUV A;  3QP6 A;  4HOB A;  5CJ9 A;  1QPM A;  3L7W A;  1SD5 A;  4KYW A;  1LNW A;  4G6D A;  3HYI A;  1IUY A;  2QM3 A;  3R6S A;  4KDP A;  2XKP A;  3GLX A;  4HDU A;  4I2O A;  4M9X A;  2XAQ A;  1XN7 A;  2YU3 A;  4IXA A;  5ICC A;  4HLX A;  1XSX A;  2P5V A;  3CJN A;  3RYP A;  1UHM A;  1IW7 F;  3KCC A;  1STZ A;  2Q8K A;  1WI9 A;  5JI6 A;  2W24 A;  2A6H F;  1YW7 A;  2BGC A;  4YIF A;  3FXQ A;  4KFC A;  3GWZ A;  2OA4 A;  4BQA A;  1H9G A;  1ODD A;  3HSE A;  3J81 Z;  1R00 A;  1LDD A;  3KFW X;  4R79 A;  2FQ3 A;  2HOE A;  2ETH A;  4NB5 A;  3EDP A;  5FFX A;  5K5Q A;  3T8T A;  1USS A;  1W5T A;  4WXH A;  3H92 A;  3O3K A;  3DEU A;  2JSC A;  1T38 A;  4P55 A;  3E5X A;  1G4D A;  3E6C C;  4ASN A;  4EJU A;  2D45 A;  2MH9 A;  3MZH A;  3HRT A;  1KYW A;  1ZRF A;  3RYR A;  2HR3 A;  5FD5 A;  4G9Y A;  4IRG A;  5H6Q A;  5AON A;  2F5F A;  4EJW A;  4WXC A;  2BV6 A;  3TDU C;  1SD4 A;  3HHG A;  5HS9 A;  4DNC A;  5IT9 Z;  1XDS A;  2DU9 A;  2WTE A;  2R7D A;  2P7C B;  2A3S A;  2STW A;  5LGN A;  2OU2 A;  5D4S A;  4UHT A;  4AIH A;  4U88 A;  4LB6 B;  1G3Y A;  1R23 A;  1BIB A;  4L9T A;  4U0W A;  4AWX B;  5TRD A;  4EQQ A;  2MD5 A;  2PJP A;  1OYW A;  2HDC A;  4ENK A;  2COM A;  2NYX A;  1O3S A;  2QYO A;  4ETS A;  2DK5 A;  2WWY A;  3P7N A;  3GFM A;  2XAJ A;  1R36 A;  4K2E A;  2M30 A;  3RKW A;  4MTD A;  3O2P E;  2NNY A;  2KIU A;  1QZZ A;  2EFO A;  3WTW C;  2FMY A;  4BXU A;  4ZYE A;  3Q5F A;  2H09 A;  3L2C A;  4L0Z B;  1F1Z A;  1WQ2 A;  3J81 K;  1KA8 A;  5L3F A;  3E6D A;  4B8X A;  4YFN F;  4GO1 A;  1ZYR F;  2QZ8 A;  3P9C A;  4YFK F;  1TLH B;  2EFN A;  2PFB A;  3LAJ A;  3WTY C;  1FBU A;  2GZW A;  4HX4 A;  1ZLJ A;  5D6E A;  3T1B A;  1P4W A;  5HVQ C;  3ZPL A;  2M45 A;  3FMS A;  2KKO A;  3BZ6 A;  3LQQ A;  3ULQ B;  4N0B A;  2HGC A;  3QU6 A;  1ZRC A;  1YW8 A;  5E1Z B;  3FM3 A;  1QZY A;  1SFE A;  2GA1 A;  4A0Z A;  3V8K A;  4RAZ A;  5K5O A;  2HWV A;  4G8X A;  1FYK A;  2EV0 A;  1JE8 A;  2VC1 A;  1LEB A;  1OKR A;  1R7J A;  1J9I A;  4O5V A;  3P9I A;  2WC2 A;  3COA C;  4UV8 A;  5E1X A;  2JT1 A;  2Z33 A;  3M1E A;  5EEH A;  1EH7 A;  4PGH A;  1YO5 C;  4L9J A;  3RPQ A;  4P9U A;  1MJB A;  1V3F A;  2E7W A;  5JHU A;  4LFU A;  4G6Q A;  5K5R A;  3VB2 A;  3J80 Z;  1DPU A;  2DPD A;  5LLQ A;  3NEU A;  1RIO H;  3RDI A;  5F6F A;  3N4M A;  5BQT A;  1YS7 A;  1CF7 A;  2CSO A;  1O3T A;  3DV8 A;  5HOO A;  4KA4 A;  1BI2 A;  3KLO A;  5A2Q Z;  1C0W A;  1JHF A;  3P9K A;  2RVC A;  3IL2 A;  1WWX A;  4OIP F;  2O61 A;  2NS0 A;  4H0E A;  5ICE A;  2H6C A;  3G73 A;  2PMH A;  3HRU A;  1KQ8 A;  4HQE A;  2DBB A;  2XV4 S;  2Z9O A;  1HW1 A;  2GAU A;  2FF4 A;  3V8L A;  4EJT A;  2IP2 A;  2ZME B;  2Y48 A;  4ENN A;  2ADU A;  1KU2 A;  5DD4 A;  2EV5 A;  5LHI A;  1Z6R A;  1B6A A;  2W84 A;  1S7A A;  3TOB A;  3Q9V A;  4M9Z A;  5HLH A;  5LBQ A;  1TQI A;  2P6T A;  4GXO A;  2JZY A;  2CGP A;  2O6G E;  3IRR A;  5D5X B;  4DQ2 A;  3BJ6 A;  2LKP A;  4N9H A;  1S29 A;  2E1N A;  4RB0 A;  5AIP A;  4G7Z F;  1U2W A;  4RGU A;  3SHF A;  4LG0 B;  5AIQ A;  4HAM A;  3L09 A;  3R4K A;  2VT3 A;  5FLX K;  3I64 A;  4LMY A;  1EV7 A;  1F5T A;  4BAY A;  1LJ9 A;  3J80 K;  1B59 A;  1X3U A;  2QQ9 A;  3VEP A;  2VOD A;  1ULY A;  1LDJ A;  5E8G A;  4CZZ A;  2A61 A;  1IXC A;  3ZN1 A;  4BYY A;  1XB4 A;  4HBL A;  1YQA A;  1T98 A;  4UV9 A;  3KP4 A;  4G7H F;  4OMZ A;  4O3M A;  3KP7 A;  3RTR A;  3F8N A;  4GYI A;  3HOS A;  4AD9 A;  3T0Y A;  1Z05 A;  1B1B A;  2UXN A;  1L0O C;  2G7H A;  2M87 A;  4EVI A;  2QQA A;  3QRF F;  1R5H A;  2VBZ A;  3CUQ A;  1T39 A;  1XGO A;  2ZFW A;  3WE3 A;  1TQP A;  4BNC A;  1XCB A;  1XSV A;  3KZY A;  2Z99 A;  4N9I A;  1O7F A;  3LAP A;  1IN8 A;  2A07 F;  2XAF A;  4KIB A;  1Z6T A;  1BC7 C;  3JTH A;  1ONV A;  3MFK A;  1OR7 A;  1K78 A;  4OIR F;  4MHG A;  1KQ9 A;  4HF0 A;  3GFI A;  2M5W A;  3GZ5 A;  1XMK A;  3EQL F;  2J5O A;  4ZYD A;  4IRI A;  1SD7 A;  3WTT C;  5BPD A;  4EM2 A;  5CVU A;  1MD0 A;  3RJP A;  3ZMV A;  3R0J A;  1GXQ A;  3ZMZ A;  2EB7 A;  2XRO A;  4A12 A;  5LEK A;  2P5K A;  3M9A A;  2CG4 A;  4M6Y A;  3ELK A;  3TO7 A;  3I0T A;  3IKV A;  3KP5 A;  1OYY A;  5H6R A;  3PQK A;  1W7P D;  1SFU A;  3WTU C;  2ZBK A;  2P4W A;  3RKX A;  3KLN A;  1MJA A;  2Q0O A;  2QQB A;  3WGG A;  4O6J A;  1PP7 U;  1DUX C;  5D4R A;  1IAW A;  1HW2 A;  2VBX A;  4D0P A;  3HTS B;  2HFH A;  2E1C A;  3L00 A;  5H20 A;  1R1V A;  5FFZ A;  3JSP A;  1W5S A;  3RPU A;  1FSH A;  3VOD A;  3KET A;  4WX9 A;  1XGS A;  3IC7 A;  1XD7 A;  4EM0 B; 
#chains in the Genus database with same CATH topology
 4S05 A;  3JRD A;  3LWF A;  3VYR B;  5KK1 A;  3JRC A;  1IXR C;  1D1C A;  2HXI A;  1OYI A;  4I0A A;  4C2T A;  2W48 A;  2LG4 A;  2HYG D;  5J1Y A;  2CV0 A;  3E1S A;  1Z21 A;  3ML6 A;  3OSG A;  3LSI A;  1W36 C;  3GLL A;  4IHW A;  2ELH A;  2K02 A;  4M3E A;  1GVJ A;  2GQQ A;  1GUU A;  1J75 A;  4BE2 A;  1WZ2 A;  4LK1 F;  4XLN F;  2EIJ H;  5M3F J;  3WU1 B;  4UUS B;  4RM2 A;  4PUS A;  2PBI A;  3C18 A;  3VYT B;  3DKW A;  2FOK A;  2MSY A;  3OV8 A;  5KCM A;  3FXK A;  4CCJ A;  2R3S A;  3QPH A;  2FNA A;  2VQH A;  4XMY A;  3K1M A;  2HQN A;  3H3U A;  4I01 A;  1FC3 A;  4ZTF A;  1GHC A;  3FKI J;  1FY7 A;  1ACI A;  1G8X A;  2BY3 A;  3J7Y J;  5CPR B;  1HDD C;  1ON2 A;  2E1M B;  2EBI A;  4Y17 A;  9ANT A;  2OBP A;  3BG7 A;  1TT5 B;  4MO7 A;  4LLN A;  2ZKZ A;  2K9M A;  4AID A;  5GPC A;  3MKZ A;  1KU3 A;  1D5V A;  2BE5 F;  2ZXI A;  1RES A;  1J2X A;  1R49 A;  4CCK A;  4UVB A;  1K6Y A;  2HXO A;  1YX3 A;  3DU6 A;  3J7A Y;  2XGE A;  3DFG A;  2CQN A;  4GCV A;  2QSH X;  3PIP F;  3G1O A;  2O8K A;  3LSH A;  4D5F A;  5HDG A;  2X9D A;  4II3 A;  3Q9S A;  2IPQ X;  2XSD C;  4V2F A;  4L18 B;  4IQ4 A;  5J8F A;  5H2F C;  1ZGA A;  4XRS G;  4A3L J;  3PUB A;  4L9N A;  1E17 A;  3FX3 A;  2CYY A;  4DBR A;  2XDV A;  5DCM A;  5LHG A;  4EGY A;  3FZV A;  4IPA A;  1SAX A;  1WFX A;  4A6E A;  2QBY B;  2JUC A;  1TT0 A;  2UV1 A;  2X0L A;  3BT9 A;  5IPA A;  2NXN B;  3K2Z A;  3HSR A;  3WTS C;  2DPU A;  2JPB A;  2LP0 A;  2IA0 A;  2LY1 A;  1IV8 A;  2R5Z B;  4XOP A;  3LA3 A;  1V5G A;  2MW8 A;  5D5W B;  4FX4 A;  5EJC A;  1BM9 A;  1SMT A;  3SFI A;  3DEE A;  2EFW A;  2PJR B;  2W57 A;  1MZB A;  3ZQH A;  2VE8 A;  3ABM H;  3GTK J;  2FEZ A;  1K4S A;  3MAJ A;  3S3M A;  1ZRE A;  2L0K A;  4I09 A;  2NOG A;  5JR3 A;  3JRG A;  4CIC A;  1S72 I;  4JX5 A;  1YYV A;  4BHP A;  3ZQC A;  2QQ8 A;  4NHJ A;  5DTD A;  3ZXS A;  3ZMT A;  1HSJ A;  1ZHF A;  4HLY A;  1DP7 P;  2E2J J;  3OYE A;  2XPU A;  2ID3 A;  4IZZ A;  1XGM A;  1YW9 A;  3ZQG A;  1H8A C;  4C30 A;  2HS5 A;  1TBX A;  4YFX F;  2UXX A;  1KU7 A;  1ITY A;  5CYV A;  2LR8 A;  3HOY J;  4RLF A;  2GIV A;  4OWR B;  5KVR A;  2K4B A;  5FKM A;  3H3Z A;  2MAB A;  2NNN A;  2EIL H;  3WTZ A;  2ISY A;  1FIP A;  2QEX I;  2R7U A;  1DQU A;  3I58 A;  2GXG A;  4M3G A;  5D8L B;  4IX7 A;  3GTO J;  3QPT A;  1ZH5 A;  4XSX F;  3JRB A;  5IT9 Z;  1A04 A;  2XGD A;  2G7U A;  3CTA A;  3LA7 A;  3REO A;  5J4Y A;  2L54 A;  4KN4 X;  3WTX C;  2QGU A;  3BR3 A;  2WB1 N;  3F6V A;  4II2 A;  3JAM K;  2EV6 A;  4PJM A;  2KIF A;  5B66 C;  2M2E A;  3AG3 H;  1ZKG A;  4CGZ A;  3H35 A;  2WB1 A;  3LSK A;  5IYC J;  1LUJ B;  2Z5U A;  4A3E J;  4HNT A;  4G12 A;  3KYL A;  1FZP B;  1U8R A;  5DYM A;  3PO2 J;  2DOA A;  2H1L A;  2H8R A;  3JR9 A;  4M3B A;  4DGW B;  2GLO A;  1XDU A;  3PUF A;  3DP7 A;  4Z2Y A;  5EEG A;  3F8M A;  4L9V A;  2FML A;  5IT3 A;  3DBR B;  2FQ4 A;  3I53 A;  5FKO A;  3TW6 A;  3F21 A;  1UHW A;  3E6B A;  4LJZ F;  2DDB A;  2DTR A;  1ZAO A;  2QKL B;  1YOV B;  1N77 A;  1F9N A;  2JWT A;  1PP8 F;  4RB1 A;  4RLQ A;  2DA6 A;  1MNE A;  4A0Y A;  4BGD A;  4EV0 A;  1XG1 A;  2FSW A;  1F4K A;  1O57 A;  4JBA A;  2KZV A;  4KIF A;  1RZ4 A;  3DBH B;  3K9T A;  1FIA A;  3OYG A;  5IP6 A;  2L7Z A;  2LMD A;  2YR2 A;  3GME A;  1A35 A;  2OF7 A;  4OOI A;  3HSF A;  4HZF A;  3FWE A;  3EET A;  3IAM 2;  2HEO A;  1NHA A;  2E5Z A;  2DQR A;  1U6G A;  3NWT A;  3U1K A;  1RR7 A;  3WU0 A;  1JTY A;  4XBF A;  1P92 A;  5DD8 A;  2XAG A;  2DFI A;  4BS9 A;  3AKZ A;  2H6B A;  2HVS A;  2GA2 A;  2EJR A;  1IRG A;  1LQ1 A;  4FTH A;  1ETK A;  3GTM J;  2DJI A;  3S1N J;  3IUO A;  3GFL A;  1A36 A;  1BOA A;  4OMY A;  1R4M B;  1K79 A;  2M4G A;  4U7B A;  1FNN A;  1S8N A;  1G59 A;  2V9K A;  4BEH B;  1RPW A;  2A69 F;  2CRG A;  2LVS A;  5BS6 A;  3CUQ C;  3WGI A;  3SFZ A;  3DWL E;  3TBI A;  3CCM I;  3ASO H;  3BCA A;  1FP2 A;  4ESB A;  3SZT A;  2L4M A;  1P7J A;  5DM7 F;  3V7S A;  2DMU A;  2Z3Y A;  2YX4 A;  5GP9 A;  1QVT A;  2VXZ A;  2RAE A;  5LGT A;  4HDV A;  2LK2 A;  4QTR A;  2LYC A;  2LF7 A;  3LSJ A;  1RKW A;  3R61 A;  2OCE A;  2ZJ2 A;  4PGG A;  2CO5 A;  1IN4 A;  1QRY A;  4GRI A;  3BR5 A;  1MGT A;  5FKN A;  2D1H A;  2X6O A;  5FLX Z;  1YI2 I;  1OR7 C;  4F7Z A;  1QO0 D;  3CC4 I;  4MTE A;  2K7L A;  2O7O A;  1R1U A;  2FRH A;  1JJ8 C;  1FBQ A;  1HOM A;  3LFK A;  1QPI A;  1EH8 A;  2CWE A;  3BRO A;  4J19 A;  2R4G A;  2VI6 A;  2E60 A;  2FU4 A;  2P7V B;  3GF2 A;  5D8K B;  4MQV A;  3EYY A;  4XSZ F;  2XGX A;  2VXD A;  2XAH A;  1MDM A;  1MMN A;  2MH2 A;  2BEO A;  2PMU A;  3N05 A;  3SQN A;  4LK0 F;  4YII A;  2HYF A;  4HQM A;  1EKE A;  2R7T A;  3OYH A;  4HW0 A;  2HOT A;  1LVA A;  2ZXH A;  1KQ0 A;  1XCV A;  1H88 C;  3W6K B;  1L3L A;  1T95 A;  4W1U A;  3CDI A;  2M7B A;  4G7O F;  2VKH A;  4RAY A;  3OYJ A;  3V7R A;  2AHQ A;  4S04 A;  1UZC A;  2FUG 2;  3IHU A;  2VOP A;  1Z9C A;  3LST A;  3SDB A;  5EZH A;  1OCO H;  4IRH A;  4XKC A;  3BP8 A;  2VKD A;  2KIM A;  3DKX A;  3A0H C;  4QPQ A;  2VT2 A;  3JTG A;  3BTJ A;  2AXT C;  3A02 A;  4LD5 A;  4IJA A;  2Z16 A;  5LRS A;  5E79 C;  3KP6 A;  3E0J B;  4IO9 F;  1BOB A;  1MH4 A;  4V19 K;  4S0H B;  2EZI A;  5FGM A;  3ABL H;  5L3B A;  1T08 B;  3V4G A;  1FTT A;  1Y1V J;  2O3F A;  4D7N A;  3PM1 A;  4RS8 A;  5J8C A;  2UWM A;  2F5E A;  1F43 A;  3DKY A;  1FBS A;  1J5Y A;  5FLM J;  1I1S A;  2HKX A;  2IGM A;  3ROU A;  3TDZ C;  1JJ6 C;  5GTI C;  3PQJ A;  1LE8 B;  1WI3 A;  2FD5 A;  1W7P A;  1AKH A;  2PLY A;  1MBF A;  5B1A H;  3U2R A;  5E17 F;  3FXO A;  3GCM A;  4C3I J;  5D5V B;  3SZG A;  2UUZ A;  2RQP A;  5FO5 A;  4HNV A;  4X6A J;  4Y52 J;  3BTL A;  2RN7 A;  4WWC A;  3UKG A;  2IT0 A;  3HC7 A;  2EWN A;  4FHT A;  1DGW Y;  1MNM C;  4U7D A;  5CVJ A;  1MBH A;  5DM6 F;  3E5U A;  1FOY A;  4H4K C;  1JHH A;  3IKT A;  1IRX A;  2BBY A;  4I76 A;  4KNY A;  2RC4 A;  4PFP A;  5GAH J;  4BJ6 C;  5JLX A;  1B72 B;  2DLL A;  5CVR A;  4ON0 A;  2E2H J;  1HCR A;  2VC0 A;  3HUG A;  1P6R A;  3JRI A;  1U8B A;  2VUM J;  3FMR A;  3DPT A;  5GPA A;  3F8F A;  2FE3 A;  1JKR C;  2TRT A;  1XMA A;  4A0X A;  1U3E M;  3WG7 H;  3EYI A;  1FMV A;  1BI1 A;  3SXY A;  4A6D A;  3HOX J;  4TV7 A;  3E3V A;  3I54 A;  3EUH A;  3IWF A;  4BDY A;  3OIP A;  4JP0 A;  1OJL A;  1TTY A;  2IJL A;  2MC4 A;  1K83 J;  2VON A;  2LY2 A;  3Q0V A;  4XQF A;  5DDG A;  2R7Z J;  2DQL A;  4ITV A;  4R1H A;  3W6J B;  2V1U A;  2YX7 A;  3HM5 A;  2WAE A;  2CW8 A;  2ESH A;  1A31 A;  5CLS A;  3FDY A;  3FM5 A;  4N4N B;  3VYU B;  3G4S I;  2JMW A;  1QHH D;  2DA4 A;  3QYF A;  4X1E A;  5F1J A;  4RBO A;  2YPR A;  2CQX A;  2FNP A;  2NRA C;  4HF1 A;  2WV1 A;  3SJM A;  1DPR A;  1IXS B;  2K5C A;  2E1O A;  2NVU B;  1G3S A;  2XB5 A;  3M07 A;  2L7F P;  1QU3 A;  3D5S C;  2ZNY A;  1ZG3 A;  3HIF A;  3MMY B;  2K9N A;  3K10 A;  1R22 A;  4ZYG A;  2QWW A;  1VQ8 I;  3I4M J;  3ZQI A;  4AIJ A;  2O03 A;  2E19 A;  1JUS A;  3X2Q H;  1V54 H;  1IN5 A;  5HLG A;  3F6O A;  1V5E A;  3C3W A;  3FKJ A;  1CGP A;  2A6T A;  1FT9 A;  1X1A A;  2EQR A;  2KQR A;  3LOC A;  2OQR A;  3I5U A;  2Y0S N;  2XSJ C;  3GVA A;  1QBJ A;  3DTK A;  4DIQ A;  4BBS J;  2XKO A;  2Y0S A;  3M8J A;  1D3Y A;  2HPM A;  1S6L A;  3GFJ A;  3KIO A;  3WG9 A;  1KGS A;  1N78 A;  2WA0 A;  1OIS A;  4L5J A;  2LTP A;  2OD5 A;  2PI0 A;  3QOD A;  3CMA I;  1X4P A;  3RIR A;  3DLA A;  4OIN F;  4L0Y B;  2B0L A;  2GXB A;  4IL6 C;  4LG3 A;  5LRR A;  2XF7 A;  2JN6 A;  1CF7 B;  2JSP A;  3CJR B;  3DXJ F;  4DYR A;  3ASN H;  3M1C A;  2KRC A;  1DU0 A;  1E3O C;  1TW3 A;  3OL3 A;  5HLI A;  3E6M A;  4A2U A;  2QVO A;  4AIK A;  1ZN2 A;  6PAX A;  1VQK I;  1OCR H;  2IA2 A;  2M0C A;  3UR3 C;  3DU5 A;  1IGN A;  2ECC A;  5E3L A;  4C2M J;  3VDX A;  2VKE A;  4E7S A;  4FT8 A;  4BE1 A;  2EFQ A;  3IRQ A;  4IVN A;  4QLC U;  3A01 A;  3LSM A;  2D2W A;  4ENJ A;  4M3F A;  1GXP A;  4IQJ A;  3I9V 2;  1YG2 A;  2YU9 J;  1TW2 A;  3J7Z I;  4XLF A;  2LF8 A;  5HDN A;  4XRF A;  3CDH A;  5EEA A;  3WU2 C;  3CO7 C;  1I39 A;  1U5T A;  3V42 A;  4CHU A;  3WE2 A;  2ZXJ A;  1OPC A;  4B1R A;  2B63 J;  2IRF G;  4P96 A;  3ONQ A;  1ETY A;  3ZQF A;  1EA3 A;  3WTV C;  5HNH A;  1BN5 A;  2DT5 A;  3LMM A;  3QAH A;  5LHH A;  1IF1 A;  4JYK A;  2V26 A;  2Y2Z A;  4IHY A;  3BG5 A;  5FLV A;  1B9N A;  3RKY A;  1YLF A;  3HHH A;  5J6X A;  5ILV A;  2O5R A;  1UG2 A;  2OAZ A;  1IN7 A;  3HBL A;  3TGN A;  1FX7 A;  1MMG A;  2EIN H;  4G6T B;  2P5L C;  1MSF C;  3HPH A;  2IS1 A;  2BVL A;  1POG A;  3R60 A;  2B9S A;  1RR8 C;  1FEX A;  2FBK A;  5GTH C;  2OV7 A;  5E18 F;  4HNU A;  3H0G J;  4WXD A;  2OQG A;  5ICG A;  2VE9 A;  3S3O A;  5DUK A;  4XIC A;  3D0S A;  4A3K J;  4KMF A;  4MGR A;  5BOX A;  5J1U A;  3FXU A;  3WOD F;  3FBN B;  4I7H A;  1BW5 A;  1R58 A;  4RAG A;  1E3H A;  3J7A O;  3V7C A;  3CD6 I;  4M9S A;  4HF2 A;  2CQK A;  1MW7 A;  2JQ7 A;  4GYG A;  4CXF A;  5DV5 A;  3BQZ A;  1JT6 A;  2KLO A;  5FJ8 J;  3IV5 A;  2VBW A;  4I0B A;  1JUM A;  2X6W A;  2ZCW A;  4BL0 B;  1YIO A;  3M7G A;  1BW6 A;  5GAG J;  4E70 A;  3LA2 A;  1EH6 A;  1D0X A;  1YIT I;  4RB3 C;  1G3T A;  2K4J A;  2RRE A;  2HKO A;  3C2B A;  4MEX F;  1T8I A;  2XHK A;  1HC8 A;  3FXR A;  2CUJ A;  3G1M A;  2FXA A;  2CQ7 A;  4KMU X;  2KIQ A;  2XPV A;  4DOZ A;  4UXN A;  4RAF A;  1B9M A;  5KHD A;  2M8G X;  3IWZ A;  1GV2 A;  3U1D A;  1AOY A;  4DBQ A;  2RV8 A;  2JRT A;  3FHN A;  3S8P A;  1VQ4 I;  2C6Y A;  4B09 A;  2JVH A;  2GIZ A;  1I5Z A;  4KN7 X;  1JXS A;  5IOY A;  3PJR A;  4LIT A;  1G3W A;  1IDZ A;  1UFM A;  3S2W A;  1BIA A;  5F04 A;  5F08 A;  3KZI C;  1BA5 A;  2L02 A;  4R8H A;  4ZH4 F;  1SVL A;  3ZMD A;  2MLK A;  3MKW B;  2XIG A;  3VSK A;  1XGN A;  3KEO A;  4AVP A;  3JAM Z;  5GAD J;  3QOP A;  4FCY A;  4XKV A;  3RKQ A;  4FAS D;  3OYC A;  2QLZ A;  1I6H J;  2HQA A;  1FOW A;  1YRN B;  3CO6 C;  1X4O A;  4U0V A;  2UZK A;  1YS6 A;  3U21 A;  3OYK A;  3KEQ A;  2KJB A;  3TW7 A;  4WK8 F;  2I5U A;  4F92 B;  3RI4 A;  1WCM J;  2IAI A;  4NQW A;  2RNJ A;  2VL8 A;  3GEZ A;  1REP C;  1P2F A;  4DYQ A;  1FSE A;  4E7J A;  1QNT A;  2G0E A;  1YTY A;  1XSD A;  5DUI A;  2DOF A;  2DFF A;  4C2U A;  3ECH A;  3KE2 A;  3W2W A;  2CFO A;  2LH9 A;  4HV5 A;  4OAY A;  3LSP A;  3ERE D;  3QPS A;  4F91 B;  4ZDL A;  3MZY A;  2RKH A;  3TKY A;  2JPC A;  1Z7U A;  5FRO A;  2R5Y A;  1HKQ A;  1WKM A;  4D7M A;  4HV6 A;  4RGS A;  1YHQ I;  1K6O A;  1YJN I;  3ZMS A;  1ZQ3 P;  3JCU C;  5IOZ A;  2J5P A;  1P9Q C;  3O6B B;  3ZQ7 A;  3CUQ B;  1O7L A;  3VPR A;  2GOX B;  2CUZ A;  3TOA A;  2DAO A;  2DMN A;  2LY9 A;  3KYD B;  1BI0 A;  1XTA A;  2LD5 A;  1RNL A;  4NC6 A;  5DCF A;  4PCQ A;  4C3H J;  2F5D A;  5EG0 A;  1X1B A;  3S32 A;  2ZNZ A;  4ENM A;  2N8G A;  1MMA A;  2DA2 A;  2EPF A;  1EJ9 A;  3FBI B;  4FET A;  3VWB A;  3JRF A;  2TCT A;  1BR2 A;  4LIU A;  2Y31 A;  4HA8 A;  3F72 A;  3L2V A;  4E4H A;  2WY7 Q;  4XN3 A;  1K78 B;  4XR6 A;  1T6S A;  2Y9Y A;  2DFH A;  1FP1 D;  1WJD A;  3DLL F;  2GBY A;  3R0A A;  3HRS A;  3QU3 A;  2QKM B;  3OIO A;  1NK3 P;  4IKF A;  2XUB A;  3A4C A;  3Q3S A;  2BZT A;  2OZU A;  3VFZ A;  1H89 C;  2QF7 A;  1R5G A;  1Z0X A;  3BJO A;  3S3N A;  3KYC B;  1ZK8 A;  3O8H A;  2DA7 A;  5D6F A;  5ICF A;  4BXF A;  1MBE A;  2CW0 F;  3LQR A;  1P4X A;  4W97 A;  1U5T B;  1HXD A;  1LFB A;  2VN2 A;  3ABT A;  3CDL A;  5ILS A;  4A3J J;  4XLA A;  3BJA A;  4Q48 A;  1WVR A;  4IOC F;  2PN6 A;  1W4M A;  1J09 A;  4Q47 A;  1WSU A;  3OR2 C;  3K70 D;  2V1D A;  3W2V A;  1MJ9 A;  3ZP5 A;  1VQN I;  4P9F A;  5J4V A;  4BH9 A;  2R92 J;  3HTU A;  4M72 A;  2XPW A;  1ETX A;  1XC5 A;  3K4C A;  4M71 A;  4EGZ A;  2LOO A;  2CFX A;  3HPG A;  1VQ5 I;  4RGR A;  1BI3 A;  3DPL C;  3HB9 A;  1JTX A;  2JA5 J;  1I27 A;  5C3E J;  3CCQ I;  4JX4 A;  3I4P A;  3P5J A;  2DFE A;  3CLO A;  1VFC A;  1H0M A;  3FK6 A;  3MEX A;  4ZYH A;  4RA2 A;  2CMP A;  1UG0 A;  2JVG A;  4BQQ A;  2WY8 Q;  4BHB A;  1K7A A;  1X2N A;  2ESN A;  5DEQ A;  5BNG A;  4UVA A;  3GTQ J;  2DW4 A;  1V4R A;  3E97 A;  1VND A;  4PDK A;  3CP2 A;  1MIJ A;  3PO3 J;  2LC2 A;  1HKT A;  3LFU A;  1U9O A;  5J47 A;  2ZME A;  1TNS A;  4P5O A;  5JFR A;  2DDA A;  3TQN A;  3S15 J;  2F5C A;  3NRV A;  2IEK A;  1J59 A;  3IH3 A;  3KPH A;  1FYM A;  1WRJ A;  5BPI A;  1TP4 A;  2EK5 A;  3T5X A;  2COB A;  1PJR A;  1S3J A;  2HZT A;  3EUH C;  1D8J A;  5K7Z A;  1BC8 C;  2DK8 A;  2VBY A;  2K85 A;  3ZQQ A;  1TQM A;  2LBF A;  2NAZ A;  2JA6 J;  1RUN A;  1ZGJ A;  3L2U A;  2L9R A;  3WGH A;  5CVV A;  3ESW B;  1ZG1 A;  3G3Z A;  2DOD A;  3K4L A;  3BOQ A;  2O0Y A;  4BBR J;  1E0E A;  2VJJ A;  2IW5 A;  4A3M J;  4BHC A;  3GUD A;  3CLQ A;  3OS2 A;  3HGY A;  5CQG A;  2A5W A;  3T8R A;  1TL8 A;  1JKO C;  1WJA A;  5K7F A;  2VAS A;  3K1P A;  3KX2 A;  1WJE A;  2AS5 F;  5HNF A;  2LKS A;  5FD6 A;  3SYT A;  5HOD A;  2KRF A;  4HSR A;  4M74 A;  4MFD A;  1ZR4 A;  4A3D J;  3PL8 A;  3JW4 A;  2FBH A;  1DDN A;  3W3C A;  2X4H A;  3OYB A;  2OJE D;  1LDK B;  2KP6 A;  4A5N A;  2CJJ A;  2V7F A;  1UEL B;  2QUF A;  4EMS A;  3BTC A;  4OIQ F;  1RUO A;  4BY7 J;  4Y33 A;  4XLP F;  2ELK A;  1VTN C;  1QQI A;  3BY6 A;  3EPZ A;  2AQE A;  3OOU A;  1T2K A;  1PVE A;  4WF2 A;  1T0F A;  3K4J A;  1I6X A;  1WH5 A;  3DTE A;  4LG0 A;  4GGG A;  2OZ6 A;  2V1X A;  2R7R A;  2HOS A;  2Y75 A;  4DYC A;  2FX0 A;  2OPT A;  2O9L A;  4ZC3 A;  2ZC2 A;  4BJT A;  1Y8R B;  4UB6 C;  1MH3 A;  3OYF A;  5IT9 K;  1A6Q A;  2WV0 A;  4CSW A;  3QWL A;  1Y6I A;  2JJ7 A;  4M6V A;  3BQY A;  2BY2 A;  5CVI A;  5EGO A;  1S5L C;  1JI8 A;  1D0Z A;  1R1T A;  2KJC A;  3DQV C;  3ZMU A;  4FE7 A;  1OCC H;  3FHZ A;  4UNO A;  2DI3 A;  1TWC J;  1X3Z B;  2L9S A;  4G94 A;  2KL4 A;  5EG0 B;  2DO7 A;  1G6N A;  1H9T A;  3HGG A;  5JVT A;  2BYV E;  3CZ6 A;  4HX8 A;  2P6S A;  2ZJP F;  2F4I A;  2ZB9 A;  3CF2 A;  4LLG F;  5DCM B;  1R9T J;  5FKL A;  2HTJ A;  4E7H A;  1U78 A;  4I99 C;  4OIO F;  1IRF A;  3B02 A;  3I59 A;  1RI7 A;  1B8I A;  3CC2 I;  2M1B A;  3K69 A;  2L4A A;  2YUS A;  4LGW A;  1FLI A;  3OYM A;  3F3X A;  5F1R A;  4XLE A;  5C44 J;  1VI0 A;  2KZG A;  3I71 A;  3ZN0 A;  1U5T C;  3CCY A;  1DU6 A;  1O3Q A;  1PUF A;  2IVM A;  3H3V K;  4C3J J;  2XVC A;  1V5F A;  3ISP A;  1VQL I;  1Z91 A;  4IHS A;  5LGU A;  1JKQ C;  3D5R C;  3QQA A;  1MMS A;  3FXL A;  4CZC A;  4ZTJ A;  1HST A;  4HG2 A;  4BKX A;  1FOK A;  3JSO A;  4MQ9 F;  3DF8 A;  2Q2E A;  4LB5 A;  2F6C A;  2DYR H;  4F93 B;  1O3R A;  5DS9 A;  2Z1D A;  3B6A A;  2ICW G;  4LLL A;  1AWC A;  4XON A;  3OMY A;  3A0B C;  2VQG A;  3K1N A;  3HOU J;  3F22 A;  4YIR X;  2L5Q A;  1ZLK A;  3JRH A;  4XRS A;  5IYB J;  2V6C A;  3F8C A;  2CUF A;  5JLW A;  1BBY A;  2EA4 A;  2KRH A;  3A2K A;  1VQ6 I;  3GW2 A;  4XK4 A;  4CDG A;  3TO9 A;  3TP3 A;  2KFD A;  4Q5S F;  4WCG A;  2EZH A;  2H27 A;  2IGK A;  2H8W A;  4HPQ A;  4BQN A;  2HQR A;  2IBD A;  3BG9 A;  4AUX A;  2R7V A;  3HOT A;  2R93 J;  4N4O B;  2M34 A;  1QGP A;  3H0D A;  2LDU A;  1PUE E;  1SFK A;  2D1V A;  5JHF A;  2KMU A;  2RDP A;  5E8I A;  1WJ5 A;  1X1C A;  1Z3X A;  1GT0 C;  3M8E A;  4IF4 A;  1DGR M;  2E5N A;  4NBQ A;  1YIJ I;  2EZL A;  2MA3 A;  3M8F A;  3K0L A;  2M7A A;  4UUT A;  4M6X A;  1LB2 A;  5J3L A;  4U0Y A;  2P8T A;  3BG3 A;  4CYC A;  2PMZ N;  3MWM A;  4JK1 X;  1IN6 A;  4Q4Z F;  3KZZ A;  1TWF J;  2F4O B;  4CYD A;  1YFH A;  2PMZ A;  3HJE A;  1Y8Q B;  1S7E A;  2VJ4 A;  3LSG A;  5TIS C;  4PSW A;  3S16 J;  2K86 A;  3U9G A;  4MEY F;  4XN0 A;  3F23 A;  4AVZ A;  2X1D A;  4JOM A;  4A3C J;  1SD6 A;  3L9F A;  2XRN A;  4A5M A;  2VPL A;  4Y7N J;  2GOM A;  3AAF A;  4ESF A;  2KIS A;  3MZ8 A;  4BQO A;  4YG2 F;  1JGS A;  5LD2 C;  3K7A J;  2NS7 A;  4AU7 A;  5IY5 H;  1X3W B;  4A3G J;  2DN0 A;  5L3G A;  4HX7 A;  3BPX A;  4RGX A;  2IA1 A;  3K4N A;  4JQF A;  3BCB A;  2RGV A;  2XAS A;  2L3D A;  3GXO A;  5LEJ A;  1BJZ A;  4ZZD A;  3BC8 A;  3GBG A;  2V79 A;  1IV6 A;  1HQC A;  4MFE A;  1UJ8 A;  1PDN C;  1TWH J;  3ERM A;  1Z1D A;  4DJA A;  4BDZ A;  1HW5 A;  3GTG J;  4RMN A;  3HOW J;  1P4A A;  3O8G A;  5E20 A;  1Y39 A;  2TDX A;  2OTL I;  5K1Y A;  1JGG A;  2A6E F;  3PSI A;  4CH7 A;  1ETQ A;  1QHG A;  5F0F A;  5B5E C;  4A3B J;  1J0R A;  3E7L A;  3HEF A;  3CCE I;  1Y1W J;  1NH3 A;  1S9H A;  3S93 A;  1UCR A;  2VQL A;  4MIM A;  1O4X A;  2CV2 A;  3C1D A;  2W85 A;  2G9W A;  1UB9 A;  3CUO A;  3BWG A;  3N97 A;  4V2G A;  3I3L A;  5EGO B;  3GZ6 A;  1TNT A;  1ZRD A;  3QYE A;  2DA3 A;  1XPX A;  2LSO A;  5E1W A;  5A2Q K;  1AU7 A;  2E2I J;  5BMZ A;  1Y0N A;  4KIC A;  3V8J A;  1S7O A;  5HS8 A;  1F36 A;  2L01 A;  3IH2 A;  3NWS A;  4RM3 A;  3HRM A;  3MCZ A;  5ERI A;  1LEA A;  4HST A;  4I02 A;  2V9V A;  1UST A;  4OU0 A;  2LNB A;  3OOP A;  2O8X A;  3CF5 F;  2VOO A;  1HBX G;  2R7O A;  4XLH A;  3I59 B;  2HI3 A;  4EJO A;  1MDM B;  3GX4 X;  1Y0U A;  2L7M P;  1SMY F;  3WHB A;  1B8I B;  2E7X A;  4MLO A;  5M5X J;  2Q1Z B;  1BJA A;  2R7Q A;  3B73 A;  3MD2 A;  2DMQ A;  2CQQ A;  2H94 A;  3D5L A;  3TP0 A;  3BR0 A;  2L7K A;  3VSL A;  2A68 F;  4KIG A;  3CCR I;  2W25 A;  2R7S A;  2MD0 A;  3KP2 A;  2AXL A;  3GO5 A;  2HTS A;  2A5Y B;  1MSE C;  2YS9 A;  3ECO A;  1WGX A;  4KT5 C;  2FA5 A;  5B1B H;  2K40 A;  2QEN A;  2DT6 A;  4Y15 A;  4QWQ A;  4Y3O A;  5ED4 A;  2X1E A;  2F2E A;  1DP3 A;  2ZO4 A;  2K27 A;  1OMI A;  2ZSH B;  1I1G A;  4M73 A;  4ANJ A;  2B7E A;  4UB8 C;  5FB2 A;  4RB2 C;  2Q2E B;  3A1Y A;  1ZGW A;  4UVC A;  2D5V A;  4GFB A;  1X1D A;  2MBF A;  2QBY A;  4CO8 A;  2X6X A;  1FPQ A;  1B4A A;  2EIM H;  3PFI A;  4YRV A;  2CV1 A;  1XMX A;  1T56 A;  2ACJ A;  2ID6 A;  4HYE A;  4PZJ A;  2GWR A;  3OL4 A;  2MLG A;  3IAS 2;  2R5Z A;  4I98 B;  1SVM A;  4ZZL A;  4YEL A;  4M3D A;  1X2M A;  1J7K A;  3FF5 A;  3GYH X;  4BY1 J;  5L3E A;  2FBI A;  2KDZ A;  2PJR A;  2RNG A;  2XB0 X;  5C4J J;  4PJN A;  2LRE A;  3FMQ A;  3TO6 A;  3SZP A;  5L3C A;  2PEX A;  4D1Q A;  1LPQ A;  5D5U B;  2HPI A;  3BDD A;  5J1R A;  3CJQ B;  4XNF A;  4KUM A;  3BR1 A;  1YE9 A;  2DA1 A;  2ZME C;  1W7P B;  3KP3 A;  1AKH B;  2W82 A;  5F0C A;  3L2R A;  1JT0 A;  5IP7 J;  2EA2 A;  3E5Q A;  4L5I A;  1FWZ A;  1OCT C;  2MFZ A;  3BR6 A;  3C7J A;  4EEF G;  1HKS A;  1NG6 A;  2EFP A;  1SFX A;  4ABZ A;  3D1N I;  1KZH A;  2F5V A;  1FYL A;  1SEU A;  3ABU A;  2IGN A;  3NQO A;  3QPL A;  3G1L A;  3SEZ A;  2R7F A;  5HS7 A;  3VOE A;  4CCM A;  4B44 A;  3UNG C;  3S14 J;  2PQ8 A;  1KU9 A;  1D8K A;  4MNU A;  2W00 A;  3CCJ I;  1ZAR A;  3FXJ A;  5F64 A;  1TWA J;  2Y0M A;  3MQ0 A;  5ILU A;  1VQ9 I;  5TJJ A;  2ISZ A;  1Q1H A;  4Y13 A;  5M3M J;  3OSF A;  4GDF A;  3HUG B;  2JTV A;  2K9S A;  3RCO A;  3ABK H;  4EM1 A;  2YSR A;  1UAA A;  2BHY A;  1MKM A;  3A03 A;  1E2X A;  1TWG J;  3F8B A;  4EJV A;  3AFH A;  3H5A A;  4E7Z A;  1GV5 A;  2XRL A;  3BPV A;  4FX0 A;  4ESJ A;  4FIS A;  3QP5 A;  1BR4 A;  1ON1 A;  2MC3 A;  2M8E A;  5HLT A;  2WAD A;  2STT A;  5L3D A;  1KYZ A;  3BR2 A;  4IHT A;  2PG4 A;  3W6V A;  2L9V A;  1ZG5 A;  4A93 J;  5HDK A;  1IZ1 A;  1R4N B;  4UUV A;  4AC0 A;  3QP6 A;  2X48 A;  5CKT A;  4A69 C;  4HOB A;  5F27 A;  5CJ9 A;  1YJW I;  4XKB A;  1QPM A;  2DA5 A;  3L7W A;  1SD5 A;  1T0F C;  3AG4 H;  3DEW A;  4KYW A;  1LNW A;  4G6D A;  3HYI A;  1IUY A;  2DOE A;  2CH0 A;  1OCP A;  2QM3 A;  3R6S A;  4KDP A;  2XKP A;  3GLX A;  4HDU A;  4I2O A;  4M9X A;  3SEQ A;  2XAQ A;  1IC8 A;  1XN7 A;  3H9Q A;  2YU3 A;  4IXA A;  5ICC A;  5LFA A;  4HLX A;  2JUG A;  1XSX A;  2IXS A;  2P5V A;  3CJN A;  3RYP A;  1UHM A;  3CJT B;  1IW7 F;  4BUP A;  3KCC A;  3S1R J;  2OTJ I;  1UHS A;  3K4M A;  1STZ A;  1G2H A;  2Q8K A;  1WI9 A;  4XL9 A;  2W24 A;  5JI6 A;  2A6H F;  2K9Q A;  1ERD A;  1YW7 A;  2BGC A;  4YIF A;  3FXQ A;  4KFC A;  3GWZ A;  2OA4 A;  4BQA A;  3SDG A;  1H9G A;  1GVD A;  1ODD A;  3H1C A;  3HSE A;  3J81 Z;  4PK4 A;  1R00 A;  1LDD A;  1X1P A;  3OYN A;  3KFW X;  5C4X J;  2HU9 A;  3F9K A;  2A05 A;  1WJC A;  1D1A A;  4R79 A;  2HDW A;  3CP8 A;  2FQ3 A;  2HOE A;  2ETH A;  3OIQ A;  3EDP A;  4NB5 A;  4PJJ A;  5FFX A;  1QZE A;  1USS A;  3T8T A;  5K5Q A;  1W5T A;  4WXH A;  3H92 A;  3TMO A;  3O3K A;  3HDD A;  2VKV A;  3DEU A;  1W0T A;  2JSC A;  3QYB A;  4BEH A;  1T38 A;  3OYA A;  4P55 A;  3E5X A;  3TL4 X;  1G4D A;  2HVR A;  3E6C C;  4ASN A;  2ME0 A;  2ELJ A;  2DT7 B;  3HXL A;  2E71 A;  1E3P A;  1OQY A;  5GAE J;  4EJU A;  2D45 A;  1IG7 A;  2AQF A;  2MH9 A;  3CCU I;  2H1K A;  5M5Y J;  4QSH A;  1SFO J;  3AL0 C;  1ZTR A;  3MZH A;  3RQI A;  3HRT A;  1KYW A;  1Z7L A;  1ZRF A;  5FD5 A;  2HR3 A;  3RYR A;  4G9Y A;  3MKL A;  4IRG A;  5H6Q A;  1R6R A;  5AON A;  3A01 B;  2F5F A;  5FRN A;  4EJW A;  2XGC A;  4WXC A;  1ZEL A;  2BV6 A;  3TDU C;  1SD4 A;  3HHG A;  3Q0U A;  5HS9 A;  3OYD A;  4J01 A;  4DNC A;  1NG7 A;  3HZJ A;  3MVP A;  2BXY A;  1XDS A;  2DU9 A;  2WTE A;  2E35 A;  2R7D A;  3FIS A;  4ZYA A;  2P7C B;  2A3S A;  2STW A;  1LVK A;  2W4S A;  2OU2 A;  1JUP A;  3CQZ J;  5D4S A;  4BU2 A;  5LGN A;  4IHX A;  2K3F A;  2DXI A;  4UHT A;  3PIO F;  3MKY B;  2V4J C;  2QSG X;  5CQE A;  4AIH A;  3S2H J;  5JVG F;  4U88 A;  2EH3 A;  2XAU A;  3H9G A;  4LB6 B;  1G3Y A;  4RDU A;  1R23 A;  3HOZ J;  1FTZ A;  1P7I A;  1BIB A;  4L9T A;  4U0W A;  4AWX B;  5TRD A;  2I8D A;  2XC7 A;  1D0Y A;  3EUA A;  4EQQ A;  2MD5 A;  2MYS A;  2PJP A;  1OYW A;  1SVO A;  1IO2 A;  3PSF A;  4XRM A;  1R71 A;  2HDC A;  4ENK A;  2COM A;  5EYR A;  2NYX A;  1O3S A;  1A5J A;  2W1O A;  2QYO A;  4ETS A;  2DK5 A;  3DPU A;  2DMP A;  1MBG A;  2WWY A;  3P7N A;  2X6Y A;  3GFM A;  2XAJ A;  4ZJZ A;  2JA2 A;  1R36 A;  1I3Q J;  3IH4 A;  1K61 A;  4K2E A;  1ETV A;  1OCZ H;  2HVQ A;  4JX6 A;  1Z67 A;  2M30 A;  3ZR8 X;  2VIX A;  5KAI C;  4KJZ A;  5J40 A;  3RKW A;  4MTD A;  3OY9 A;  3O2P E;  3LL7 A;  2NNY A;  2KIU A;  1QZZ A;  2Y30 A;  1Q1V A;  2DMT A;  1AHD P;  2EFO A;  3WTW C;  1WHU A;  3PNY A;  3NAU A;  2FMY A;  2HZD A;  4BXU A;  1LE8 A;  2VJ5 A;  4ZYE A;  4E6K G;  4NDL A;  3Q5F A;  2H09 A;  3L2C A;  2JK3 A;  4L0Z B;  2WAQ N;  1F1Z A;  3M4O J;  1WQ2 A;  4E7K A;  2WAQ A;  1JKP C;  3J81 K;  2OCC H;  3I55 I;  1KA8 A;  2MG4 A;  5L3F A;  1SAN A;  2R7X A;  3E6D A;  4B8X A;  2JA7 J;  4YFN F;  4GO1 A;  1ZYR F;  2QZ8 A;  3S17 J;  4A3I J;  4LOC A;  3P9C A;  4C9Y A;  5EZG A;  3OWT A;  4YFK F;  1B72 A;  1TLH B;  2EFN A;  4PJL A;  2PFB A;  3WHC A;  3S1M J;  4XOT A;  3K2A A;  3LAJ A;  3WTY C;  1FBU A;  2GZW A;  2X1C A;  1IDY A;  4HX4 A;  5E3M A;  3ZQL A;  4B43 A;  1ZLJ A;  2HNH A;  2E36 A;  5D6E A;  3T1B A;  4NC7 A;  1GLN A;  1P4W A;  5HVQ C;  3ZPL A;  2M45 A;  3FMS A;  3H5R A;  2KKO A;  3BZ6 A;  3LQQ A;  3BZC A;  1IUF A;  3RPU D;  2R0Q C;  3ULQ B;  4N0B A;  3PFY A;  2LRD A;  2HGC A;  2EZK A;  3QU6 A;  3BZK A;  1OLT A;  4NQW B;  1ZRC A;  2BY1 A;  4XM3 A;  1ETO A;  1X58 A;  4DZP A;  1YW8 A;  5EDN A;  5E1Z B;  3ZRG A;  3FM3 A;  1QZY A;  1SFE A;  2GA1 A;  4B3A A;  3BLY A;  3FXM A;  4A0Z A;  4AM3 A;  1APL C;  2R5Y B;  1LKX A;  3V8K A;  4RAZ A;  5K5O A;  2HWV A;  2KHM A;  4G8X A;  1FYK A;  2E1M C;  2NVX J;  2EV0 A;  1JE8 A;  2VC1 A;  1LEB A;  1OKR A;  1R7J A;  1LFP A;  1ZR2 A;  1J9I A;  4O5V A;  4IHV A;  3P9I A;  2WC2 A;  3COA C;  1Y56 A;  4UV8 A;  2BXZ A;  5E1X A;  1ENH A;  3K4K A;  1VQP I;  2JT1 A;  2Z33 A;  3H36 A;  3M1E A;  5EEH A;  1EH7 A;  2XF6 A;  4PGH A;  1YO5 C;  4L9J A;  3RPQ A;  2BHZ A;  4F52 A;  4P9U A;  1MJB A;  1VZ0 A;  1V3F A;  2E7W A;  4PSX A;  4FE4 A;  5JHU A;  4LFU A;  3CC7 I;  1IRZ A;  3EUK L;  3K70 C;  2QA4 I;  4G6Q A;  3ZOB A;  3GTL J;  3BG6 A;  2BOL A;  1FMW A;  5K5R A;  3G71 I;  3VB2 A;  3G6E I;  2LKX A;  2AO9 A;  3C2H A;  4EAT A;  3J80 Z;  1DPU A;  2BW3 A;  2DPD A;  5LLQ A;  3NEU A;  5K7H A;  1RIO H;  3RDI A;  5F6F A;  3N4M A;  1RKT A;  4KIS A;  5BQT A;  1YS7 A;  1CF7 A;  3L2W A;  2HQ5 A;  2CSO A;  2NVT J;  1O3T A;  3DV8 A;  5HOO A;  4KIT B;  4KA4 A;  2CS3 A;  1BI2 A;  4L5E A;  1V55 H;  3KLO A;  2V6E A;  2FOW A;  2IS4 A;  5A2Q Z;  1RRJ A;  3FK7 A;  1C0W A;  2DCE A;  1XX5 A;  1JHF A;  3IP4 B;  4CCL A;  3P9K A;  2RVC A;  1MBJ A;  1OFC X;  3FIW A;  3IL2 A;  1WWX A;  4XOR A;  4OIP F;  2NS0 A;  1N25 A;  4H0E A;  2O61 A;  5ICE A;  4KT6 A;  2H6C A;  2JA8 J;  1T33 A;  1WJF A;  3G73 A;  2NOJ B;  2PMH A;  3HRU A;  2ZJR F;  1KQ8 A;  4HQE A;  5KNL A;  1HDP A;  1YJ9 I;  2DBB A;  2XV4 S;  4U87 A;  1MMD A;  3AG1 H;  1X19 A;  2Z9O A;  1HW1 A;  3G2B A;  2F4M B;  2GAU A;  4PJ0 C;  2LFB A;  2FF4 A;  5E3N A;  3V8L A;  1MBK A;  3CMY A;  4EJT A;  3NAR A;  2IP2 A;  2ZME B;  2Y48 A;  4ENN A;  4F3Q A;  3ZCO A;  2ADU A;  1KU2 A;  2L2O A;  3L2Q A;  2QCO A;  5DD4 A;  1W0U A;  4NC8 A;  2EV5 A;  2L9N A;  5LHI A;  1Z6R A;  3OS0 A;  1B6A A;  3CCV I;  3TED A;  2LBF B;  3I4N J;  2Y9Z A;  3I56 I;  5TGT A;  2W84 A;  3HOV J;  1I50 J;  1S7A A;  3TOB A;  3Q9V A;  4M9Z A;  3ZGK A;  5HLH A;  5LBQ A;  3RQ4 A;  1TQI A;  2Z2S B;  2VQC A;  2P6T A;  1SC7 A;  4QIW N;  4GXO A;  2JZY A;  2ZSI B;  1HF0 A;  1YX5 A;  4BXX J;  1U9N A;  5B3S H;  2CGP A;  2O6G E;  3IRR A;  3RZD J;  5D5X B;  3Q0W A;  4DQ2 A;  3BJ6 A;  1FOX A;  2LKP A;  4N9H A;  4BJ5 C;  1PYV A;  3GTJ J;  2X85 A;  1XS9 A;  5IYD J;  1S29 A;  2E1N A;  1QVU A;  1WJB A;  4RB0 A;  4LIV A;  5AIP A;  2HDD A;  1ETW A;  1A6I A;  4G7Z F;  2IS2 A;  3MN2 A;  1W5C C;  1W1W E;  3CCL I;  4J00 A;  3HKZ N;  1U2W A;  2VJI A;  2M4K A;  2ECB A;  4FQG A;  4RGU A;  3HKZ A;  3K6G A;  2WBM A;  3SHF A;  4LG0 B;  5AIQ A;  4HAM A;  1RET A;  2QSF X;  3L09 A;  3R4K A;  3VYS B;  2VT3 A;  2ME6 A;  5FLX K;  4ZDP A;  3PNV A;  2BY0 A;  4XLC A;  3I64 A;  4LMY A;  4AYB N;  4HRI A;  1EV7 A;  1F5T A;  2E34 A;  4BAY A;  1LJ9 A;  3J80 K;  1B59 A;  2VB6 A;  4AYB A;  5IP9 J;  2BVM A;  2KT0 A;  3CMM A;  1X3U A;  2QQ9 A;  3VEP A;  2VOD A;  2I10 A;  3GTP J;  1HA8 A;  2GM4 A;  1ULY A;  1IJW C;  3S2D J;  1LDJ A;  5E8G A;  4CCO A;  4CZZ A;  4E7L A;  2A61 A;  1M1E B;  2P0W A;  3L1P A;  1IXC A;  2X51 A;  3ZN1 A;  2OC6 A;  4BYY A;  5E3O A;  1N75 A;  1XB4 A;  4HBL A;  2ZXW H;  4X0G A;  1GDT A;  4UUS A;  1YRN A;  2ZJQ F;  1WPK A;  1YQA A;  1T98 A;  4UV9 A;  1D5Y A;  3KP4 A;  2GXA A;  5FRM A;  4IOA F;  4G7H F;  4OMZ A;  4YEJ A;  2JRM A;  2NVQ J;  4O3M A;  3KP7 A;  2DTZ A;  3S1Q J;  2M9H A;  3C2G A;  2RQQ A;  3RTR A;  3F0C A;  3F8N A;  4GYI A;  1VQM I;  5KAF C;  3HOS A;  4AD9 A;  1EF4 A;  2K9L A;  3T0Y A;  1UMQ A;  4Z6Y A;  2NS8 A;  1Z05 A;  4NUB A;  1W36 D;  1B1B A;  3K4B A;  4B3X A;  1FJL A;  3W2A A;  2UXN A;  2VPR A;  3QOE A;  1RC9 A;  4I6Z A;  3GZN B;  3JRE A;  1L0O C;  2G7H A;  2K3P A;  5EF6 A;  3OYI A;  2M87 A;  1WH7 A;  4EVI A;  2QQA A;  4UY8 I;  4BE0 A;  2NVY J;  3HL2 A;  2R7W A;  3QRF F;  1R5H A;  1VQO I;  2VBZ A;  3CUQ A;  1T39 A;  3B6C A;  1PUF B;  1XGO A;  3M3Y J;  2ZFW A;  3WE3 A;  1TQP A;  4XID A;  4BNC A;  1XCB A;  2BW3 B;  1XSV A;  3KZY A;  1K4T A;  3AL0 B;  2KDO A;  3DBL B;  2Z99 A;  2M0M A;  1O7F A;  4N9I A;  3LAP A;  1IN8 A;  2A07 F;  2XAF A;  4KIB A;  1Z6T A;  4P1W A;  1BC7 C;  3JTH A;  1VQ7 I;  1ONV A;  3MFK A;  2EIK H;  2PX9 A;  2V9P A;  4DW6 A;  1OR7 A;  1K78 A;  4OIR F;  4MHG A;  4E7I A;  1KQ9 A;  4HF0 A;  3GFI A;  2HOA A;  2MGQ A;  2OUM A;  2M5W A;  3GZ5 A;  3OYL A;  3OR1 C;  1XMK A;  2WAF A;  3EQL F;  1BR1 A;  2DYS H;  1U0J A;  2P81 A;  3DTI A;  2J5O A;  5M5W J;  1TZL A;  4D5C A;  4ZYD A;  5FKK A;  4IRI A;  3KEY A;  4CA0 A;  1LFU P;  1SD7 A;  2XF5 A;  4CCN A;  1I3A A;  3WTT C;  5BPD A;  2VLA A;  4EM2 A;  4IEJ A;  5CVU A;  1ORK A;  1MD0 A;  3RJP A;  3ZMV A;  3JRA A;  3R0J A;  1GXQ A;  3ZMZ A;  2EB7 A;  1Z3Y A;  2XRO A;  3CES A;  2HYJ A;  4A12 A;  4XKW A;  1BL0 A;  1R5I D;  5LEK A;  2P5K A;  3M9A A;  2CG4 A;  4M6Y A;  2LLK A;  3ELK A;  3TO7 A;  1TC3 C;  2IS6 A;  3I0T A;  4A3F J;  3IKV A;  2DJN A;  3CCS I;  3H9J A;  2CU7 A;  4B47 A;  4B4C A;  4CYC B;  1MND A;  3KP5 A;  2KPM A;  1OYY A;  4D9J A;  4BAC A;  2Y69 H;  4Y4R A;  3LNQ A;  5H6R A;  3LSR A;  3PQK A;  1QA6 A;  1Z77 A;  4DZJ A;  4NNJ A;  1W7P D;  1SFU A;  1KON A;  1D1B A;  3WTU C;  4B48 A;  2ZBK A;  1SAU A;  1VF9 A;  2P4W A;  2FJ1 A;  4QPO A;  3AG2 H;  3RKX A;  4PFO A;  3KLN A;  1MJA A;  2Q0O A;  5F0H A;  2QQB A;  3WGG A;  1AA7 A;  3BTI A;  3RZO J;  1CQT A;  2V1N A;  4O6J A;  1PP7 U;  1DUX C;  4OAZ A;  5D4R A;  1IAW A;  1HW2 A;  1HLV A;  2VBX A;  3H5N A;  4D0P A;  3HG9 A;  3HTS B;  2IGO A;  2CW7 A;  3OS1 A;  2HFH A;  2F48 A;  2E1C A;  4ZDO A;  1NTC A;  3L00 A;  5H20 A;  1R1V A;  5FFZ A;  3JSP A;  1W5S A;  3RPU A;  2ZFU A;  4HEA 2;  1FSH A;  3DCF A;  3VOD A;  3KET A;  3RSN A;  4WX9 A;  1XGS A;  2CUE A;  2M3A A;  4CUG A;  4F55 A;  2W7N A;  3PNT A;  1NK2 P;  3IC7 A;  1XD7 A;  3CME I;  4EM0 B; 
#chains in the Genus database with same CATH homology
 4S05 A;  3LWF A;  5KK1 A;  1IXR C;  1OYI A;  4I0A A;  2HYG D;  3ML6 A;  2ELH A;  2K02 A;  1GVJ A;  2GQQ A;  1J75 A;  4LK1 F;  4XLN F;  3WU1 B;  2PBI A;  3C18 A;  3DKW A;  2FOK A;  3OV8 A;  2R3S A;  3QPH A;  2FNA A;  3K1M A;  2HQN A;  3H3U A;  4I01 A;  1FC3 A;  1GHC A;  1FY7 A;  1ON2 A;  4Y17 A;  2OBP A;  4LLN A;  2ZKZ A;  1KU3 A;  1D5V A;  2BE5 F;  1J2X A;  4UVB A;  3DFG A;  4GCV A;  5HDG A;  3Q9S A;  2IPQ X;  4L18 B;  5J8F A;  1ZGA A;  4L9N A;  1E17 A;  3FX3 A;  2CYY A;  5DCM A;  5LHG A;  4EGY A;  3FZV A;  4IPA A;  1SAX A;  4A6E A;  2QBY B;  2X0L A;  3K2Z A;  3HSR A;  3WTS C;  2DPU A;  2JPB A;  2IA0 A;  3LA3 A;  5D5W B;  4FX4 A;  1BM9 A;  1SMT A;  2EFW A;  2W57 A;  1MZB A;  2VE8 A;  2FEZ A;  3MAJ A;  1ZRE A;  4I09 A;  5JR3 A;  4CIC A;  1YYV A;  4BHP A;  4NHJ A;  3ZMT A;  1HSJ A;  1ZHF A;  4HLY A;  1DP7 P;  1XGM A;  1YW9 A;  2HS5 A;  1TBX A;  4YFX F;  2UXX A;  1KU7 A;  5CYV A;  2GIV A;  5KVR A;  2K4B A;  3H3Z A;  2NNN A;  3WTZ A;  2ISY A;  3I58 A;  2GXG A;  5D8L B;  3QPT A;  1ZH5 A;  4XSX F;  1A04 A;  2G7U A;  3CTA A;  3LA7 A;  3REO A;  2L54 A;  4KN4 X;  3WTX C;  3F6V A;  3JAM K;  2EV6 A;  2KIF A;  4CGZ A;  2Z5U A;  1FZP B;  1U8R A;  5DYM A;  1XDU A;  3DP7 A;  4Z2Y A;  5EEG A;  3F8M A;  4L9V A;  2FML A;  5IT3 A;  3I53 A;  3F21 A;  1UHW A;  3E6B A;  4LJZ F;  2DTR A;  1ZAO A;  1F9N A;  1PP8 F;  4RB1 A;  4A0Y A;  4EV0 A;  2FSW A;  1F4K A;  1O57 A;  4JBA A;  4KIF A;  1RZ4 A;  3K9T A;  2YR2 A;  4OOI A;  3HSF A;  4HZF A;  3FWE A;  3EET A;  2HEO A;  1NHA A;  2DQR A;  1U6G A;  3WU0 A;  4XBF A;  1P92 A;  5DD8 A;  2XAG A;  2DFI A;  2H6B A;  2GA2 A;  2EJR A;  1IRG A;  1LQ1 A;  3GFL A;  1BOA A;  4OMY A;  1K79 A;  4U7B A;  1FNN A;  1S8N A;  2A69 F;  5BS6 A;  3CUQ C;  3WGI A;  3SFZ A;  1FP2 A;  4ESB A;  3SZT A;  2L4M A;  3V7S A;  2Z3Y A;  2YX4 A;  2VXZ A;  5LGT A;  4HDV A;  2LF7 A;  3R61 A;  2ZJ2 A;  4PGG A;  2CO5 A;  1IN4 A;  1MGT A;  2D1H A;  5FLX Z;  4F7Z A;  1QO0 D;  4MTE A;  2K7L A;  1R1U A;  2FRH A;  1FBQ A;  3LFK A;  1EH8 A;  2CWE A;  3BRO A;  2P7V B;  2FU4 A;  3GF2 A;  5D8K B;  4MQV A;  3EYY A;  4XSZ F;  2XGX A;  2XAH A;  1MDM A;  2MH2 A;  2BEO A;  2PMU A;  3SQN A;  4LK0 F;  4YII A;  2HYF A;  4HQM A;  4HW0 A;  1LVA A;  1KQ0 A;  1XCV A;  3W6K B;  1L3L A;  4G7O F;  4RAY A;  3V7R A;  4S04 A;  3IHU A;  2VOP A;  1Z9C A;  3LST A;  4IRH A;  3BP8 A;  2KIM A;  2VT2 A;  3JTG A;  4LD5 A;  4IJA A;  5LRS A;  3KP6 A;  5FGM A;  5L3B A;  3V4G A;  2O3F A;  4RS8 A;  5J8C A;  2UWM A;  2F5E A;  1FBS A;  1J5Y A;  1I1S A;  2HKX A;  3ROU A;  3TDZ C;  3PQJ A;  1W7P A;  2PLY A;  3U2R A;  5E17 F;  5D5V B;  2RQP A;  5FO5 A;  2RN7 A;  4WWC A;  2IT0 A;  2EWN A;  4FHT A;  4U7D A;  5CVJ A;  3E5U A;  1JHH A;  3IKT A;  2BBY A;  4KNY A;  2RC4 A;  2DLL A;  5CVR A;  4ON0 A;  2VC0 A;  3HUG A;  1P6R A;  3FMR A;  3DPT A;  3F8F A;  2FE3 A;  1XMA A;  4A0X A;  1U3E M;  3EYI A;  1BI1 A;  3SXY A;  4A6D A;  4TV7 A;  3E3V A;  3I54 A;  3EUH A;  3IWF A;  1TTY A;  2IJL A;  2VON A;  5DDG A;  2DQL A;  4R1H A;  3W6J B;  2V1U A;  2YX7 A;  2ESH A;  5CLS A;  3FM5 A;  2YPR A;  2FNP A;  2NRA C;  4HF1 A;  1DPR A;  1IXS B;  1G3S A;  2ZNY A;  1ZG3 A;  3HIF A;  1R22 A;  4ZYG A;  2QWW A;  4AIJ A;  2O03 A;  1IN5 A;  5HLG A;  3F6O A;  3C3W A;  1CGP A;  1FT9 A;  2OQR A;  3I5U A;  3GVA A;  1QBJ A;  2XKO A;  1D3Y A;  1S6L A;  3GFJ A;  3WG9 A;  1KGS A;  4L5J A;  2OD5 A;  2PI0 A;  3RIR A;  4OIN F;  4L0Y B;  2B0L A;  2GXB A;  5LRR A;  1CF7 B;  3DXJ F;  1TW3 A;  5HLI A;  3E6M A;  4A2U A;  2QVO A;  4AIK A;  1ZN2 A;  6PAX A;  2IA2 A;  4FT8 A;  2EFQ A;  3IRQ A;  4IVN A;  4QLC U;  2D2W A;  4ENJ A;  1GXP A;  1YG2 A;  1TW2 A;  2LF8 A;  5HDN A;  4XRF A;  3CDH A;  3CO7 C;  1U5T A;  4CHU A;  3WE2 A;  2ZXJ A;  1OPC A;  2IRF G;  4P96 A;  3WTV C;  1BN5 A;  2DT5 A;  3QAH A;  5LHH A;  1IF1 A;  1B9N A;  3RKY A;  1YLF A;  3HHH A;  5J6X A;  5ILV A;  2OAZ A;  1IN7 A;  3TGN A;  1FX7 A;  2P5L C;  3R60 A;  2FBK A;  5E18 F;  4WXD A;  2OQG A;  5ICG A;  2VE9 A;  5DUK A;  3D0S A;  4KMF A;  4MGR A;  5BOX A;  3FXU A;  3WOD F;  4I7H A;  1R58 A;  3J7A O;  3V7C A;  4M9S A;  4HF2 A;  2CQK A;  4GYG A;  4CXF A;  5DV5 A;  2VBW A;  4I0B A;  2ZCW A;  1YIO A;  3M7G A;  4E70 A;  3LA2 A;  1EH6 A;  4RB3 C;  1G3T A;  2K4J A;  4MEX F;  2HKO A;  2XHK A;  3FXR A;  2FXA A;  4KMU X;  4UXN A;  1B9M A;  3IWZ A;  3U1D A;  1AOY A;  2RV8 A;  2JRT A;  2C6Y A;  4B09 A;  1I5Z A;  4KN7 X;  1JXS A;  1G3W A;  1UFM A;  3S2W A;  1BIA A;  2L02 A;  4R8H A;  4ZH4 F;  3ZMD A;  2MLK A;  2XIG A;  1XGN A;  3KEO A;  4AVP A;  3JAM Z;  3QOP A;  2QLZ A;  3CO6 C;  4U0V A;  2UZK A;  1YS6 A;  3KEQ A;  2KJB A;  4WK8 F;  3RI4 A;  4NQW A;  2RNJ A;  3GEZ A;  1REP C;  1P2F A;  1FSE A;  1QNT A;  1XSD A;  1YTY A;  5DUI A;  3ECH A;  3KE2 A;  4HV5 A;  3ERE D;  3MZY A;  2RKH A;  3TKY A;  2JPC A;  1Z7U A;  1HKQ A;  1WKM A;  4HV6 A;  4RGS A;  1K6O A;  3ZMS A;  2J5P A;  3O6B B;  3ZQ7 A;  3CUQ B;  1O7L A;  3TOA A;  2DAO A;  1BI0 A;  1RNL A;  5DCF A;  4PCQ A;  2F5D A;  2ZNZ A;  4ENM A;  4HA8 A;  3F72 A;  1K78 B;  1T6S A;  1FP1 D;  3R0A A;  3HRS A;  3QU3 A;  2XUB A;  2OZU A;  3VFZ A;  1R5G A;  3BJO A;  5D6F A;  5ICF A;  2CW0 F;  3LQR A;  1P4X A;  1U5T B;  1HXD A;  3ABT A;  2VN2 A;  5ILS A;  3BJA A;  4Q48 A;  2PN6 A;  1W4M A;  4Q47 A;  1WSU A;  2V1D A;  1MJ9 A;  3ZP5 A;  4P9F A;  4BH9 A;  3HTU A;  4M72 A;  4M71 A;  4EGZ A;  2CFX A;  4RGR A;  1BI3 A;  3DPL C;  1I27 A;  3I4P A;  3CLO A;  1H0M A;  3MEX A;  4ZYH A;  4BHB A;  1K7A A;  2ESN A;  5DEQ A;  4UVA A;  2DW4 A;  1V4R A;  3E97 A;  4PDK A;  1HKT A;  2ZME A;  1TNS A;  4P5O A;  5JFR A;  3TQN A;  2F5C A;  3NRV A;  1J59 A;  1FYM A;  1WRJ A;  5BPI A;  2EK5 A;  3T5X A;  1S3J A;  2HZT A;  1D8J A;  1BC8 C;  2DK8 A;  2VBY A;  1TQM A;  2NAZ A;  1RUN A;  1ZGJ A;  3WGH A;  5CVV A;  1ZG1 A;  3G3Z A;  3BOQ A;  2O0Y A;  2IW5 A;  4BHC A;  3GUD A;  3T8R A;  3K1P A;  2AS5 F;  5FD6 A;  2KRF A;  4M74 A;  3JW4 A;  2FBH A;  1DDN A;  2X4H A;  1LDK B;  4A5N A;  2QUF A;  4EMS A;  4OIQ F;  1RUO A;  4XLP F;  1VTN C;  1QQI A;  3BY6 A;  1T2K A;  4WF2 A;  4LG0 A;  1T0F A;  1I6X A;  4GGG A;  2OZ6 A;  2V1X A;  2Y75 A;  5IT9 K;  2WV0 A;  5CVI A;  1R1T A;  2KJC A;  3DQV C;  3ZMU A;  3FHZ A;  4UNO A;  2DI3 A;  4G94 A;  2DO7 A;  1G6N A;  1H9T A;  5JVT A;  2BYV E;  4HX8 A;  2P6S A;  5DCM B;  4LLG F;  2HTJ A;  1U78 A;  4OIO F;  1IRF A;  3B02 A;  3I59 A;  1RI7 A;  2M1B A;  3K69 A;  2L4A A;  4LGW A;  1FLI A;  3F3X A;  5F1R A;  3I71 A;  3ZN0 A;  1U5T C;  1O3Q A;  2IVM A;  2XVC A;  3ISP A;  1Z91 A;  4IHS A;  5LGU A;  1HST A;  1FOK A;  3JSO A;  4MQ9 F;  3DF8 A;  2Q2E A;  4LB5 A;  1O3R A;  4LLL A;  1AWC A;  3K1N A;  3F22 A;  1ZLK A;  2V6C A;  3F8C A;  1BBY A;  2EA4 A;  3GW2 A;  4CDG A;  3TO9 A;  4Q5S F;  4WCG A;  2H27 A;  2HQR A;  3HOT A;  1QGP A;  2LDU A;  1PUE E;  2D1V A;  2RDP A;  5E8I A;  3M8E A;  4IF4 A;  2MA3 A;  3M8F A;  3K0L A;  4M6X A;  1LB2 A;  4U0Y A;  2P8T A;  3MWM A;  4JK1 X;  1IN6 A;  4Q4Z F;  3KZZ A;  4CYD A;  1YFH A;  2K86 A;  3U9G A;  4MEY F;  3F23 A;  1SD6 A;  3L9F A;  2XRN A;  4A5M A;  3AAF A;  4ESF A;  4YG2 F;  1JGS A;  5L3G A;  4HX7 A;  3BPX A;  4RGX A;  2IA1 A;  4JQF A;  2RGV A;  2XAS A;  2L3D A;  3GXO A;  5LEJ A;  4ZZD A;  2V79 A;  1HQC A;  1PDN C;  1Z1D A;  1HW5 A;  1P4A A;  5E20 A;  2TDX A;  5K1Y A;  2A6E F;  1J0R A;  1UCR A;  3C1D A;  2W85 A;  2G9W A;  1UB9 A;  3CUO A;  3BWG A;  3N97 A;  3GZ6 A;  1TNT A;  1ZRD A;  2LSO A;  5E1W A;  5A2Q K;  5BMZ A;  4KIC A;  3V8J A;  1S7O A;  5HS8 A;  2L01 A;  3HRM A;  3MCZ A;  5ERI A;  1LEA A;  4I02 A;  2V9V A;  1UST A;  4OU0 A;  2LNB A;  3OOP A;  2O8X A;  2VOO A;  1HBX G;  3I59 B;  4EJO A;  1MDM B;  3GX4 X;  1Y0U A;  1SMY F;  2E7X A;  1BJA A;  3B73 A;  2H94 A;  3D5L A;  2A68 F;  4KIG A;  2W25 A;  3KP2 A;  2AXL A;  3GO5 A;  2HTS A;  2A5Y B;  3ECO A;  4KT5 C;  2FA5 A;  2QEN A;  4Y15 A;  4QWQ A;  5ED4 A;  2F2E A;  2ZO4 A;  2K27 A;  1OMI A;  4M73 A;  1I1G A;  5FB2 A;  4RB2 C;  4UVC A;  2MBF A;  2QBY A;  4CO8 A;  1FPQ A;  1B4A A;  3PFI A;  2ACJ A;  4HYE A;  4PZJ A;  2GWR A;  2MLG A;  4I98 B;  4ZZL A;  1J7K A;  3FF5 A;  3GYH X;  5L3E A;  2FBI A;  3FMQ A;  3TO6 A;  3SZP A;  5L3C A;  2PEX A;  5D5U B;  3BDD A;  4KUM A;  3KP3 A;  1W7P B;  2EA2 A;  3E5Q A;  4L5I A;  1FWZ A;  3C7J A;  1HKS A;  2EFP A;  1SFX A;  1FYL A;  3ABU A;  3NQO A;  2R7F A;  5HS7 A;  3VOE A;  2PQ8 A;  1KU9 A;  1D8K A;  4MNU A;  1ZAR A;  5F64 A;  2Y0M A;  3MQ0 A;  5ILU A;  5TJJ A;  2ISZ A;  1Q1H A;  4Y13 A;  2JTV A;  4EM1 A;  2YSR A;  1MKM A;  1E2X A;  3F8B A;  4EJV A;  3BPV A;  4FX0 A;  4ESJ A;  3QP5 A;  1ON1 A;  2MC3 A;  2M8E A;  2STT A;  5L3D A;  1KYZ A;  4IHT A;  2PG4 A;  1ZG5 A;  5HDK A;  1IZ1 A;  4UUV A;  3QP6 A;  4HOB A;  5CJ9 A;  1QPM A;  3L7W A;  1SD5 A;  4KYW A;  1LNW A;  4G6D A;  3HYI A;  1IUY A;  2QM3 A;  3R6S A;  4KDP A;  2XKP A;  3GLX A;  4HDU A;  4I2O A;  4M9X A;  2XAQ A;  1XN7 A;  2YU3 A;  4IXA A;  5ICC A;  4HLX A;  1XSX A;  2P5V A;  3CJN A;  3RYP A;  1UHM A;  1IW7 F;  3KCC A;  1STZ A;  2Q8K A;  1WI9 A;  5JI6 A;  2W24 A;  2A6H F;  1YW7 A;  2BGC A;  4YIF A;  3FXQ A;  4KFC A;  3GWZ A;  2OA4 A;  4BQA A;  1H9G A;  1ODD A;  3HSE A;  3J81 Z;  1R00 A;  1LDD A;  3KFW X;  4R79 A;  2FQ3 A;  2HOE A;  2ETH A;  4NB5 A;  3EDP A;  5FFX A;  5K5Q A;  3T8T A;  1USS A;  1W5T A;  4WXH A;  3H92 A;  3O3K A;  3DEU A;  2JSC A;  1T38 A;  4P55 A;  3E5X A;  1G4D A;  3E6C C;  4ASN A;  4EJU A;  2D45 A;  2MH9 A;  3MZH A;  3HRT A;  1KYW A;  1ZRF A;  3RYR A;  2HR3 A;  5FD5 A;  4G9Y A;  4IRG A;  5H6Q A;  5AON A;  2F5F A;  4EJW A;  4WXC A;  2BV6 A;  3TDU C;  1SD4 A;  3HHG A;  5HS9 A;  4DNC A;  5IT9 Z;  1XDS A;  2DU9 A;  2WTE A;  2R7D A;  2P7C B;  2A3S A;  2STW A;  5LGN A;  2OU2 A;  5D4S A;  4UHT A;  4AIH A;  4U88 A;  4LB6 B;  1G3Y A;  1R23 A;  1BIB A;  4L9T A;  4U0W A;  4AWX B;  5TRD A;  4EQQ A;  2MD5 A;  2PJP A;  1OYW A;  2HDC A;  4ENK A;  2COM A;  2NYX A;  1O3S A;  2QYO A;  4ETS A;  2DK5 A;  2WWY A;  3P7N A;  3GFM A;  2XAJ A;  1R36 A;  4K2E A;  2M30 A;  3RKW A;  4MTD A;  3O2P E;  2NNY A;  2KIU A;  1QZZ A;  2EFO A;  3WTW C;  2FMY A;  4BXU A;  4ZYE A;  3Q5F A;  2H09 A;  3L2C A;  4L0Z B;  1F1Z A;  1WQ2 A;  3J81 K;  1KA8 A;  5L3F A;  3E6D A;  4B8X A;  4YFN F;  4GO1 A;  1ZYR F;  2QZ8 A;  3P9C A;  4YFK F;  1TLH B;  2EFN A;  2PFB A;  3LAJ A;  3WTY C;  1FBU A;  2GZW A;  4HX4 A;  1ZLJ A;  5D6E A;  3T1B A;  1P4W A;  5HVQ C;  3ZPL A;  2M45 A;  3FMS A;  2KKO A;  3BZ6 A;  3LQQ A;  3ULQ B;  4N0B A;  2HGC A;  3QU6 A;  1ZRC A;  1YW8 A;  5E1Z B;  3FM3 A;  1QZY A;  1SFE A;  2GA1 A;  4A0Z A;  3V8K A;  4RAZ A;  5K5O A;  2HWV A;  4G8X A;  1FYK A;  2EV0 A;  1JE8 A;  2VC1 A;  1LEB A;  1OKR A;  1R7J A;  1J9I A;  4O5V A;  3P9I A;  2WC2 A;  3COA C;  4UV8 A;  5E1X A;  2JT1 A;  2Z33 A;  3M1E A;  5EEH A;  1EH7 A;  4PGH A;  1YO5 C;  4L9J A;  3RPQ A;  4P9U A;  1MJB A;  1V3F A;  2E7W A;  5JHU A;  4LFU A;  4G6Q A;  5K5R A;  3VB2 A;  3J80 Z;  1DPU A;  2DPD A;  5LLQ A;  3NEU A;  1RIO H;  3RDI A;  5F6F A;  3N4M A;  5BQT A;  1YS7 A;  1CF7 A;  2CSO A;  1O3T A;  3DV8 A;  5HOO A;  4KA4 A;  1BI2 A;  3KLO A;  5A2Q Z;  1C0W A;  1JHF A;  3P9K A;  2RVC A;  3IL2 A;  1WWX A;  4OIP F;  2O61 A;  2NS0 A;  4H0E A;  5ICE A;  2H6C A;  3G73 A;  2PMH A;  3HRU A;  1KQ8 A;  4HQE A;  2DBB A;  2XV4 S;  2Z9O A;  1HW1 A;  2GAU A;  2FF4 A;  3V8L A;  4EJT A;  2IP2 A;  2ZME B;  2Y48 A;  4ENN A;  2ADU A;  1KU2 A;  5DD4 A;  2EV5 A;  5LHI A;  1Z6R A;  1B6A A;  2W84 A;  1S7A A;  3TOB A;  3Q9V A;  4M9Z A;  5HLH A;  5LBQ A;  1TQI A;  2P6T A;  4GXO A;  2JZY A;  2CGP A;  2O6G E;  3IRR A;  5D5X B;  4DQ2 A;  3BJ6 A;  2LKP A;  4N9H A;  1S29 A;  2E1N A;  4RB0 A;  5AIP A;  4G7Z F;  1U2W A;  4RGU A;  3SHF A;  4LG0 B;  5AIQ A;  4HAM A;  3L09 A;  3R4K A;  2VT3 A;  5FLX K;  3I64 A;  4LMY A;  1EV7 A;  1F5T A;  4BAY A;  1LJ9 A;  3J80 K;  1B59 A;  1X3U A;  2QQ9 A;  3VEP A;  2VOD A;  1ULY A;  1LDJ A;  5E8G A;  4CZZ A;  2A61 A;  1IXC A;  3ZN1 A;  4BYY A;  1XB4 A;  4HBL A;  1YQA A;  1T98 A;  4UV9 A;  3KP4 A;  4G7H F;  4OMZ A;  4O3M A;  3KP7 A;  3RTR A;  3F8N A;  4GYI A;  3HOS A;  4AD9 A;  3T0Y A;  1Z05 A;  1B1B A;  2UXN A;  1L0O C;  2G7H A;  2M87 A;  4EVI A;  2QQA A;  3QRF F;  1R5H A;  2VBZ A;  3CUQ A;  1T39 A;  1XGO A;  2ZFW A;  3WE3 A;  1TQP A;  4BNC A;  1XCB A;  1XSV A;  3KZY A;  2Z99 A;  4N9I A;  1O7F A;  3LAP A;  1IN8 A;  2A07 F;  2XAF A;  4KIB A;  1Z6T A;  1BC7 C;  3JTH A;  1ONV A;  3MFK A;  1OR7 A;  1K78 A;  4OIR F;  4MHG A;  1KQ9 A;  4HF0 A;  3GFI A;  2M5W A;  3GZ5 A;  1XMK A;  3EQL F;  2J5O A;  4ZYD A;  4IRI A;  1SD7 A;  3WTT C;  5BPD A;  4EM2 A;  5CVU A;  1MD0 A;  3RJP A;  3ZMV A;  3R0J A;  1GXQ A;  3ZMZ A;  2EB7 A;  2XRO A;  4A12 A;  5LEK A;  2P5K A;  3M9A A;  2CG4 A;  4M6Y A;  3ELK A;  3TO7 A;  3I0T A;  3IKV A;  3KP5 A;  1OYY A;  5H6R A;  3PQK A;  1W7P D;  1SFU A;  3WTU C;  2ZBK A;  2P4W A;  3RKX A;  3KLN A;  1MJA A;  2Q0O A;  2QQB A;  3WGG A;  4O6J A;  1PP7 U;  1DUX C;  5D4R A;  1IAW A;  1HW2 A;  2VBX A;  4D0P A;  3HTS B;  2HFH A;  2E1C A;  3L00 A;  5H20 A;  1R1V A;  5FFZ A;  3JSP A;  1W5S A;  3RPU A;  1FSH A;  3VOD A;  3KET A;  4WX9 A;  1XGS A;  3IC7 A;  1XD7 A;  4EM0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...