4YIIA

Structure of an apc2-ubch10 complex reveals distinctive cullin-ring ligase mechanism for anaphase-promoting complex/cyclosome
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
KEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of E2 Complex
rcsb
source organism Homo sapiens
molecule tags Ligase/cell cycle
molecule keywords Ubiquitin-conjugating enzyme E2 C
total genus 23
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08672 ANAPC2 Anaphase promoting complex (APC) subunit 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4yiiA00
2EWNA 5DEQA 3EYYA 1GVJA 5LHHA 3GO5A 2E1NA 1R1TA 5K5OA 3ZN1A 2ETHA 2GA2A 2YX7A 2D2WA 3GFIA 5DDGA 4WF2A 3ZMDA 5IT3A 2BEOA 1V3FA 2HEOA 5K5QA 3Q5FA 1I6XA 1FZPB 4IJAA 2FNPA 1F4KA 3FM5A 3Q9VA 2Q8KA 4LFUA 3TO7A 4N9HA 4G7OF 2IRFG 1Z05A 1BIBA 3P7NA 3H3ZA 4RB2C 2GQQA 5D4RA 1J2XA 4RB3C 4P9FA 1HSTA 5FD5A 2GZWA 1D3YA 5BPIA 4ESFA 2L02A 2DPUA 5HVQC 3GX4X 3TDUC 4LJZF 2DAOA 3VOEA 2FXAA 3GW2A 1BN5A 2JPCA 2HOEA 3OV8A 2O61A 1J0RA 5FLXZ 3QU3A 4Q4ZF 2DO7A 4EJWA 4I7HA 1SD7A 1R5HA 1RUOA 2VBYA 2OZUA 4I0BA 3SFZA 3NEUA 5DCMA 1BBYA 3JTGA 2XAHA 3KEOA 2Q0OA 4GYGA 3C18A 2M45A 1MD0A 4M9XA 3W6KB 2K27A 1KQ8A 1SFEA 1E17A 2V6CA 2XROA 1SFXA 4LB5A 4UV9A 2X0LA 3I64A 4QLCU 5F64A 4B09A 5D6FA 2XKOA 4BQAA 3BWGA 5H6RA 2L01A 4ZYGA 2E7WA 1IF1A 1YYVA 3VB2A 5FB2A 4UVCA 1LB2A 2M5WA 4ESJA 4MQ9F 4HF0A 4M6XA 2P4WA 3CLOA 2XUBA 1FYLA 3SXYA 5LHGA 4M6YA 1B6AA 1YLFA 4FHTA 1YS7A 3MZYA 2XAFA 1U8RA 2Z99A 1KU7A 3HTSB 2L3DA 3ZN0A 2M8EA 3GFJA 3WE3A 3BDDA 3CO6C 2EB7A 4IVNA 4RGRA 1KYWA 2JSCA 2NS0A 1MJAA 3WGIA 2RN7A 1XDSA 3NRVA 2ISYA 1GXPA 4ON0A 3K1PA 4HOBA 3U1DA 4N0BA 4KNYA 5L3FA 1SD6A 3E5QA 3FXUA 3R60A 2EV5A 2BBYA 3VEPA 3RIRA 5LEKA 1HSJA 4HYEA 1ZRCA 3LQRA 5TRDA 5E1WA 2P5KA 1XSVA 2HGCA 5L3DA 5CJ9A 2PMHA 3RYPA 1DUXC 1HBXG 1QGPA 1IN7A 2FMYA 1IRGA 2CW0F 3J81K 3DQVC 4I01A 3HRMA 4S04A 3L00A 3ZMTA 4HX7A 2IPQX 2HKXA 2KIUA 3H92A 1FOKA 1W5TA 4HDUA 4YFKF 2FA5A 2LKPA 1ON1A 3IKVA 2RVCA 2H6CA 3KLNA 2RC4A 3BPVA 5L3GA 1TLHB 4BHCA 4U0YA 3BPXA 2C6YA 2QQAA 4KIFA 2GXBA 4M9ZA 1F1ZA 2P8TA 3KP2A 1KU9A 3F8MA 4HF2A 1F9NA 3HUGA 2EFOA 1ZH5A 1SAXA 4UVBA 2ZMEB 2DW4A 3WTVC 3DP7A 2R7FA 3MZHA 1YIOA 4ENMA 2MC3A 4KN4X 2R3SA 4KDPA 1KGSA 5LGNA 4A6EA 4CO8A 2E7XA 2G7HA 4P9UA 3K1NA 1QQIA 2PN6A 4IHSA 4KIBA 2VE9A 1G3TA 1USSA 2HS5A 4IRIA 1FWZA 3QU6A 2AS5F 2Y0MA 4CHUA 2RGVA 3F8CA 3HSEA 1TBXA 3IRRA 3V8JA 2ZXJA 5D4SA 1B9MA 3DF8A 5F1RA 3E5XA 3WTWC 4NHJA 4I0AA 3HHGA 2M1BA 1TQPA 2HKOA 3N97A 3U2RA 3B73A 4HV6A 3R6SA 4ZZDA 1Q1HA 2A61A 4EM1A 2OA4A 1EV7A 3KCCA 4Z2YA 4HDVA 4M9SA 2DK5A 2RV8A 3L7WA 2Z3YA 4IRHA 4EMSA 5DCMB 5FFXA 4HBLA 4UXNA 4BAYA 5BMZA 3SZPA 4GO1A 5FO5A 3J81Z 3LA3A 3F21A 1ZARA 1YW8A 1HW1A 2MBFA 2PI0A 5JR3A 2JTVA 1D8JA 3CUQC 3I59B 4HF1A 3DKWA 5KVRA 3HOTA 4P55A 2FBHA 1ZHFA 3C3WA 3B02A 1W7PA 2OQGA 2FRHA 3MQ0A 4BH9A 5D8LB 5ICEA 3M7GA 4KIGA 3F22A 2P7VB 4HV5A 4LLNA 2GXGA 2H09A 2JPBA 3RJPA 1R1UA 3J7AO 1IW7F 2XGXA 2EFPA 1HW2A 1XCBA 2K02A 1OPCA 3QRFF 4KUMA 4L5IA 1W4MA 3RYRA 5CVIA 1PDNC 3KEQA 4KA4A 5EEHA 5HS8A 4R8HA 3JSOA 4M73A 4RB0A 2CGPA 5ILUA 1XGMA 1RZ4A 4LK0F 2LF7A 3SQNA 1G3SA 4KMUX 4G6QA 5HDGA 3HOSA 5DD8A 3L9FA 2PFBA 3WGHA 4WCGA 3WTXC 2WTEA 2ZO4A 4CYDA 3HSFA 2QQBA 1Z91A 4OMYA 1BI3A 2HQNA 4S05A 5JI6A 2QQ9A 3RTRA 1IN6A 2M30A 1L3LA 3IRQA 1O57A 3L2CA 4ENJA 3TGNA 3T0YA 1T38A 2ZNZA 3EYIA 2CQKA 3IL2A 4BHPA 1IUYA 2ESHA 2DBBA 4RGSA 2DK8A 2LF8A 2FNAA 4EJVA 2EFWA 2F5EA 1S7OA 1LEAA 3CDHA 2W57A 3LSTA 2OAZA 1GHCA 4AWXB 1R23A 4UVAA 1DPUA 2MH2A 2D1HA 2FU4A 4G6DA 1Y0UA 4UV8A 4MEXF 1I1SA 5HLIA 5DCFA 4FX4A 3GWZA 3EETA 2V79A 1FBUA 2ZBKA 1J75A 1ON2A 2VXZA 2XHKA 5DV5A 1TQMA 1U5TA 5TJJA 3VFZA 3WGGA 5KK1A 2TDXA 3ECHA 1FX7A 4YFXF 5J8FA 1BI0A 1R00A 3ABUA 2W85A 1OMIA 1W5SA 4PCQA 3WTYC 3NQOA 3T8TA 5BS6A 3T8RA 1ZGJA 4RB1A 3F8NA 2V1UA 1HKSA 1FYMA 1UHMA 2QENA 5E8GA 2VOOA 4WXDA 1EH7A 4XBFA 2EFNA 2DFIA 4LG0B 1IZ1A 1YFHA 4ZYDA 2K7LA 4IRGA 1YTYA 1ZRFA 2VBXA 4KFCA 4I09A 2COMA 1ODDA 1FYKA 1K78A 2NYXA 1YO5C 1MJ9A 1QZYA 1O3SA 1WRJA 3F6OA 4Y15A 5L3BA 3JW4A 3QP5A 5D8KB 1Z1DA 3J80K 4EJUA 2CO5A 2FMLA 4MTDA 5DUKA 4NQWA 1XGSA 4AIHA 1RNLA 3FX3A 2AXLA 1G4DA 4Q5SF 1SD5A 5JFRA 2W84A 3EQLF 2K4JA 2HQRA 2KIFA 2F5DA 5HS9A 3ML6A 2MD5A 1LQ1A 4CGZA 4MTEA 1FSEA 2UZKA 1OYYA 4KICA 3E6CC 2B0LA 3KP6A 2DPDA 5LGUA 3TO9A 4M74A 1FPQA 1S3JA 2JRTA 2W24A 3WTZA 3C7JA 5E20A 2F5CA 4WWCA 1P6RA 2MH9A 2DQLA 2P7CB 2ELHA 3ISPA 2D45A 3H3UA 3RPUA 3PFIA 3IHUA 1HQCA 2YR2A 1XN7A 1R22A 4K2EA 2VC0A 1YS6A 4H0EA 5HDNA 4JK1X 1P92A 1OYWA 4LGWA 3MEXA 3QPTA 3CTAA 1L0OC 3TO6A 4XLPF 1CF7A 1B59A 2O03A 3K1MA 5CVJA 2QBYA 5E1ZB 4AIJA 4U7DA 2ESNA 3FWEA 1O7LA 4HLXA 1XMKA 6PAXA 4G94A 1ZLJA 5LBQA 1YQAA 1U78A 1PP8F 2WC2A 3TKYA 2V1DA 3CUQA 3R0JA 1FP1D 5F6FA 3F6VA 1ZGAA 1BIAA 2XAJA 1TTYA 3PQJA 1QZZA 2BGCA 2Y48A 4HW0A 5D6EA 2A68F 4IHTA 1KYZA 4XSZF 2OQRA 2HYGD 1ONVA 5LHIA 2IA2A 4D0PA 3E6DA 4Q48A 3WG9A 1I27A 1AWCA 5K5RA 1QO0D 1MDMA 3V7RA 4CZZA 2X4HA 2F5FA 1ZG5A 4P5OA 2A6EF 1Z7UA 2RNJA 5ICCA 3KP3A 1JE8A 1ZAOA 1K79A 3WTTC 4I2OA 5CLSA 1P4XA 3KLOA 4G7HF 5ICGA 4M72A 3GXOA 3AAFA 1FP2A 1IRFA 4FT8A 1LEBA 2HZTA 4CICA 4LLLA 4Y13A 4RS8A 5CYVA 3FHZA 5HS7A 1XSXA 1SMTA 1UB9A 5LRSA 1YG2A 1T2KA 4ZYHA 3O2PE 4BNCA 1G3WA 1P4WA 3GEZA 5E18F 1F5TA 3EDPA 1KU3A 4PGGA 5HOOA 4DQ2A 3GFLA 1EH8A 5L3CA 3V8LA 2ACJA 3R61A 4KYWA 2XAQA 4IF4A 3ELKA 2IT0A 1O3RA 3GZ5A 2VN2A 5LGTA 3ZMVA 1WQ2A 5A2QK 3DEUA 1T98A 2W25A 4Y17A 2QYOA 1MZBA 2NNNA 3GFMA 3I53A 4U88A 1D5VA 2VT2A 2P6SA 1IN4A 3MCZA 4R79A 3I54A 2K86A 1P2FA 1ULYA 4OIPF 1USTA 3KFWX 2P5LC 3KETA 2HDCA 4AD9A 4E70A 4UHTA 5ILSA 1ZG1A 4EM0B 2KKOA 2XASA 4ASNA 2ZNYA 2NAZA 1TNTA 1XGOA 4I02A 4BHBA 4HZFA 2EA4A 1UHWA 1U6GA 5FD6A 4MHGA 1NHAA 3LAPA 5HDKA 2L4MA 1TW3A 5E1XA 2O0YA 5AONA 3TOBA 1RUNA 1S29A 1QPMA 4I98B 1H9TA 5ERIA 2J5OA 4EV0A 2MLGA 1H9GA 3CJNA 1WI9A 4R1HA 4U0VA 4KT5C 2DQRA 1J7KA 3R0AA 1FNNA 3FM3A 4EQQA 1CGPA 3F8FA 2YSRA 4M71A 1S8NA 3F3XA 4O6JA 3V8KA 1Z6TA 4HQMA 1VTNC 3ULQB 4CXFA 1UCRA 2DI3A 2QLZA 5J8CA 2FSWA 3FMSA 1D8KA 5FLXK 1P4AA 1O3TA 2FBKA 1JGSA 2ZJ2A 1OYIA 3W6JB 1R1VA 2GWRA 2QUFA 1B9NA 2IW5A 2R7DA 3QOPA 3FXQA 3DFGA 2XAGA 3BZ6A 1C0WA 3HYIA 2EJRA 3KZZA 4HX4A 2H94A 4L5JA 3M8EA 5BPDA 4EJTA 2XKPA 3I0TA 2L54A 4MGRA 4L0ZB 4A5NA 1YW9A 2E1CA 2K4BA 4WXHA 5D5WB 3FMQA 1K7AA 3CO7C 2EFQA 4OIOF 4OU0A 3P9IA 3KP7A 1FC3A 2G7UA 1T6SA 1Z6RA 4PZJA 2BV6A 1R58A 4L18B 5DD4A 1YW7A 1LJ9A 1R36A 4CDGA 3HIFA 4HQEA 5L3EA 4O3MA 1J5YA 3BOQA 5E8IA 4LMYA 3RKWA 1QBJA 3RKYA 2EV0A 2PJPA 2CG4A 4YFNF 1RI7A 1BI2A 2OBPA 3TDZC 1SFUA 3K69A 1MGTA 5JVTA 1J59A 4WX9A 2H27A 4YG2F 4L9VA 3E6BA 1ZG3A 3IKTA 4G7ZF 1WWXA 2XV4S 4A12A 4N9IA 3ZP5A 3FXRA 4B8XA 4OIQF 3P9KA 4MQVA 1MDMB 3V7SA 2P6TA 5FGMA 3SZTA 2LSOA 5HLGA 1ZYRF 2GIVA 1TW2A 4GGGA 2MA3A 4NB5A 2JT1A 4L9JA 3LFKA 2FQ3A 1MKMA 3COAC 4UUVA 1ZLKA 5A2QZ 1U2WA 3PQKA 3CUOA 4F7ZA 2EA2A 5ED4A 2ADUA 4A6DA 1A04A 1V4RA 5BOXA 3ERED 2P5VA 2QVOA 5AIPA 4IPAA 4BYYA 4MNUA 2UWMA 3K0LA 2HYFA 1KQ9A 1FBQA 4EM2A 2QBYB 1ZREA 1KA8A 1FLIA 2L4AA 2QM3A 5FFZA 3D5LA 5D5UB 1FT9A 4A0XA 4A0YA 3WTSC 2KIMA 1XSDA 3HRUA 3FZVA 4G9YA 1BJAA 3HRTA 2YU3A 2PMUA 1AOYA 2UXNA 5CVUA 3P9CA 4OIRF 1Z9CA 5CVRA 3JTHA 3RKXA 1STZA 3ROUA 1DP7P 1XDUA 4RGUA 2RDPA 2VODA 2A6HF 2QZ8A 1O7FA 3LWFA 5E17F 1B4AA 2DU9A 2A69F 1LVAA 4HAMA 5IT9Z 1MJBA 2G9WA 5AIQA 4LLGF 1QNTA 2KJBA 3RI4A 3J80Z 3RPQA 3M1EA 5HLHA 3V7CA 1T0FA 2OZ6A 2VBWA 2BYVE 3M8FA 2WWYA 3MFKA 2STWA 2O3FA 2V9VA 2VONA 4O5VA 4U0WA 2VOPA 2Q2EA 5CVVA 5EEGA 1SD4A 2Y75A 2Z9OA 5J6XA 3BP8A 1JHFA 2OU2A 4FX0A 4UNOA 1IAWA 3E5UA 4ETSA 2EV6A 4ZYEA 3MAJA 3T5XA 1FSHA 5D5VB 4PDKA 4EGZA 2WV0A 2PLYA 2XVCA 3SHFA 2DTRA 2CSOA 3I4PA 3O3KA 3FMRA 3CUQB 4HA8A 2Z33A 1IXSB 4JQFA 1LDDA 3WU1B 4PGHA 3T1BA 1U5TC 2IP2A 4OOIA 1E2XA 3S2WA 2RKHA 3ZMUA 4ZH4F 1K78B 4KN7X 1BI1A 3QP6A 1JHHA 5JHUA 3F72A 3G73A 3BJOA 2LNBA 3WU0A 5H20A 1CF7B 3IWFA 4JBAA 3IC7A 4AIKA 3WODF 4EGYA 4BXUA 5ILVA 4MEYF 1HW5A 2NNYA 5H6QA 4Q47A 1WKMA 1U3EM 4WK8F 4GXOA 4HX8A 3I71A 5LEJA 1G3YA 3HSRA 3LQQA 2STTA 3BY6A 3C1DA 3O6BB 1RIOH 4QWQA 5K1YA 2DLLA 2A5YB 2FE3A 4L9NA 3REOA 1IXCA 3VODA 4OINF 3ABTA 1U5TB 1BC8C 1REPC 3E97A 1DDNA 4EJOA 4TV7A 2HFHA 5DUIA 3JAMK 4ENNA 4GYIA 2V1XA 4XRFA 1J9IA 2ZMEA 4GCVA 4KMFA 2FOKA 2VBZA 4A5MA 5DYMA 4LB6B 1XCVA 4RAYA 2GAUA 3EUHA 2NRAC 2VC1A 3GZ6A 3TQNA 1WSUA 2CFXA 2F2EA 1DPRA 1KU2A 1HKTA 2FBIA 1IN8A 4G8XA 1BC7C 2XIGA 3GF2A 3Q9SA 3U9GA 4XSXF 2VT3A 3FF5A 4YIIA 4ESBA 4LD5A 2O6GE 1UFMA 2CWEA 2HTSA 3GVAA 1H0MA 2KJCA 3IWZA 3BROA 2H6BA 1FBSA 1W7PB 1R5GA 1R7JA 3MWMA 3LA7A 4P96A 3QAHA 3F8BA 3I59A 2ZKZA 5ICFA 3JAMZ 3DPTA 2PEXA 3N4MA 3ZMZA 2A3SA 4U7BA 2Z5UA 3JSPA 2IA1A 1PUEE 1EH6A 3ZQ7A 1PP7U 4RAZA 3K2ZA 1XMAA 3KZYA 5IT9K 4AVPA 3F23A 3ECOA 2HR3A 4RGXA 2IJLA 1HXDA 2O8XA 1S7AA 3GYHX 3HHHA 1BOAA 1G6NA 2PQ8A 1OKRA 4OMZA 4LG0A 4EVIA 3WE2A 3RDIA 3WTUC 4L0YB 1X3UA 2ZFWA 1HKQA 1OR7A 3KE2A 3OOPA 1ZRDA 3R4KA 1T39A 4YIFA 3BJAA 2CYYA 4DNCA 4ENKA 2D1VA 1S6LA 3GUDA 1XB4A 3KP4A 1K6OA 1IXRC 2M87A 3K9TA 2FF4A 3LAJA 3BJ6A 3G3ZA 3DV8A 3L09A 1LNWA 2JZYA 2PBIA 3LA2A 2FEZA 2MLKA 4HLYA 2OD5A 1XGNA 4WXCA 1FY7A 3DXJF 2IVMA 3GLXA 1O3QA 2LDUA 3ZMSA 3HRSA 3E3VA 3DPLC 2GA1A 1LDKB 4A2UA 1B1BA 3TOAA 4A0ZA 1JXSA 1I5ZA 2DT5A 1GXQA 2KRFA 1KQ0A 1TQIA 4LK1F 1IN5A 2J5PA 4IXAA 4L9TA 1W7PD 2EK5A 2YPRA 3ZPLA 5BQTA 1XD7A 4ZZLA 5LRRA 2XRNA 2RQPA 2PG4A 3M9AA 3HTUA 2A07F 2UXXA 2HTJA 3I58A 4XLNF 3I5UA 1SMYF 1ZN2A 2BE5F 2ISZA 3QPHA 1TNSA 5D5XB 2VE8A 3V4GA 3E6MA 3D0SA 2IA0A 3KP5A 1I1GA 5LLQA 1BM9A 2QWWA 2YX4A 2ZCWA 1LDJA 2HWVA
chains in the Genus database with same CATH superfamily
1KONA 2EWNA 4J01A 5F0HA 5C4JJ 4B3XA 2ECBA 5DEQA 1GUUA 2O7OA 3EYYA 1GVJA 2Q1ZB 2W82A 5LHHA 3GO5A 2E1NA 1R1TA 3G1OA 5EEAA 5K5OA 3ZN1A 2BHYA 2DA5A 2ETHA 2X1CA 2GA2A 2CH0A 4B1RA 2YX7A 2D2WA 3GFIA 1ERDA 3FXMA 4WF2A 5DDGA 3ZMDA 1A6IA 3S2HJ 5IT3A 2BEOA 1WI3A 1NG6A 2FUG2 1V3FA 2HEOA 5K5QA 3Q5FA 1I6XA 1MBKA 1FZPB 4IJAA 2FNPA 1F4KA 3Q3SA 3FM5A 2EPFA 5DM7F 4II2A 1TWHJ 3Q9VA 3HUGB 2Q8KA 2ICWG 2GOXB 4LFUA 4BL0B 1VQ5I 3TO7A 5EGOA 2CQNA 4N9HA 4G7OF 3H0GJ 1ETYA 2IRFG 1VQMI 4IKFA 1Z05A 3OYKA 3F0CA 1BIBA 3P7NA 4JOMA 4BXFA 3H3ZA 3BLYA 4RB2C 2GQQA 5D4RA 1J2XA 2JWTA 4A3KJ 4RB3C 1DGWY 3HKZN 5FJ8J 3CCSI 2DDBA 4P9FA 1MMGA 4CCMA 2CUFA 1HSTA 5FD5A 3EUAA 4B3AA 2GZWA 1D3YA 5BPIA 4GRIA 2NVYJ 3A4CA 5JHFA 3GZNB 4ESFA 1N25A 2L02A 2WAQN 2DPUA 5HVQC 1N75A 3CMEI 3GX4X 3ZQIA 3J7ZI 2AO9A 2HPMA 3TDUC 3LSHA 3S3MA 4LJZF 2DAOA 2OTJI 2DA2A 3VOEA 2VKDA 3SYTA 2FXAA 5B1AH 1RESA 3GW2A 1BN5A 2JPCA 2HOEA 2JUCA 2KHMA 3OV8A 2O61A 1JJ6C 5DTDA 3ABMH 3IV5A 1J0RA 2O8KA 5FLXZ 3OYLA 3QU3A 2H8RA 4Q4ZF 2DO7A 2X85A 4EJWA 1BA5A 3KZIC 4I7HA 1JKPC 3K4JA 1POGA 1KZHA 1SD7A 2OCCH 3QYEA 1MIJA 1R5HA 1RUOA 2VBYA 2OZUA 2R7WA 2M3AA 1BL0A 4I0BA 3SFZA 1U9OA 3NEUA 5DCMA 1BBYA 2IBDA 3JTGA 2XAHA 1U9NA 3KEOA 1WHUA 2Q0OA 4GYGA 3C18A 4E7LA 5DM6F 2M45A 4X1EA 3CQZJ 5GTHC 1T8IA 2LTPA 2RQQA 2LRDA 1MD0A 3UR3C 5LD2C 4XKCA 4M9XA 3W6KB 2K27A 1KQ8A 1SFEA 1E17A 1MH4A 3BCBA 1OR7C 2V6CA 2XROA 1SFXA 2FD5A 2R7OA 4RAGA 4LB5A 3SFIA 4UV9A 2X0LA 1HDDC 3I64A 3HZJA 4QLCU 5F64A 4B09A 1BJZA 5D6FA 2XKOA 4BQAA 3BWGA 5H6RA 2L01A 3HKZA 4ZYGA 2COBA 5HODA 2E7WA 3L2VA 2KDOA 3OL4A 1IF1A 1YYVA 5FROA 2K9LA 3VB2A 2QKLB 5FB2A 2L7ZA 4UVCA 1LB2A 3DCFA 3TEDA 2M5WA 4EATA 4ESJA 4MQ9F 4HF0A 1SFKA 4M6XA 4CYCA 2X9DA 2P4WA 3CLOA 2XUBA 1PVEA 3SXYA 5LHGA 1FYLA 2ZC2A 4M6YA 1B6AA 1YLFA 2Y69H 4FHTA 1YS7A 2FJ1A 2L2OA 3MZYA 2XAFA 1U8RA 2Z99A 1DU6A 3TBIA 1KU7A 1F43A 3HXLA 3ESWB 1YOVB 3HTSB 2L3DA 1JTYA 3ZN0A 3GFJA 2M8EA 3WE3A 4KITB 3BDDA 4W1UA 3H9GA 3CO6C 3K4BA 3SEZA 5B66C 2EB7A 3S93A 4IVNA 5GADJ 4RGRA 1KYWA 1SVLA 2JSCA 5KCMA 2CQ7A 2NS0A 4LOCA 1MJAA 3WGIA 2CFOA 2HYJA 2RN7A 1XDSA 5EYRA 3NRVA 3E1SA 2JA2A 2ISYA 2CMPA 4XLHA 2L9RA 2VXDA 3K1PA 4ON0A 1GXPA 3QPLA 3FXLA 4HOBA 1UG2A 2BZTA 5KNLA 3K6GA 3U1DA 4N0BA 1NH3A 5L3FA 1SD6A 3E5QA 3FXUA 3KYCB 3RSNA 3R60A 4KNYA 2BBYA 2EV5A 3VEPA 3RIRA 4UUTA 5LEKA 4N4NB 4FE4A 1HSJA 3IH3A 4HYEA 5F08A 2A5WA 1EF4A 4BQOA 1ZRCA 4QPOA 2F4OB 3LQRA 5TRDA 5E1WA 2P5KA 1E0EA 1XSVA 2HGCA 5C4XJ 3AG2H 4CCNA 2F4MB 5L3DA 5CJ9A 2P0WA 2PMHA 3RYPA 1DUXC 3ONQA 4ANJA 4E4HA 5EDNA 2ZSHB 1HBXG 1QGPA 1IN7A 2FMYA 1IRGA 1VQPI 2CW0F 3J81K 3DQVC 1T56A 4I01A 1TWAJ 3K4KA 2RNGA 3HRMA 4S04A 1DQUA 3L00A 4C30A 4HX7A 3ZQFA 3ZMTA 2IPQX 2HKXA 2KIUA 3H92A 1W5TA 1FOKA 4HDUA 1A6QA 3LSPA 4YFKF 3H5AA 5HNHA 5IP7J 1JKQC 2FA5A 4JX4A 2LKPA 2VQHA 3BR2A 4BJ5C 4A3JJ 3ZGKA 4DZJA 3A01B 1ON1A 3X2QH 3JRIA 3IKVA 2ZJRF 3W3CA 2RVCA 2H6CA 1RETA 3KLNA 2RC4A 4MO7A 4ZTFA 4I76A 3BPVA 3FISA 5L3GA 3LMMA 1TLHB 1K61A 1D1CA 2V9PA 4BHCA 4U0YA 3BPXA 2C6YA 2QQAA 4KIFA 2GXBA 2L9NA 2CUJA 4M9ZA 4DOZA 1F1ZA 3CF2A 2P8TA 3KP2A 1KU9A 3F8MA 4HF2A 3FDYA 1VQ8I 1F9NA 3BCAA 2V1NA 2EFOA 3HUGA 1ZH5A 1SAXA 4UVBA 2ZMEB 1Z77A 2DA7A 5IOZA 3OYAA 4IZZA 1X1PA 1LKXA 2DW4A 3W2WA 2R93J 3WTVC 3TW7A 3DP7A 4PFOA 3HPGA 3BG5A 2R7FA 3BZKA 1YIOA 2VB6A 4AIDA 5M3MJ 3MZHA 1TC3C 1LE8B 2X51A 4ENMA 2BOLA 2MC3A 2HXOA 1JUMA 2LP0A 2R3SA 4KN4X 4KDPA 1V5FA 1KGSA 5LGNA 4A6EA 4CO8A 2ZXWH 2E7XA 2G7HA 1V54H 4P9UA 1JT0A 3K1NA 1VQOI 1QQIA 4E7HA 4GDFA 2PN6A 4IHSA 4KIBA 2VE9A 1G3TA 2L9VA 4MLOA 1YX5A 1USSA 2FX0A 2K3PA 4PJ0C 2HS5A 5GAGJ 2DMTA 4YELA 5E3NA 4IRIA 1FWZA 3QU6A 2AS5F 1RR8C 2Z2SB 2BY1A 4NBQA 2Y0MA 4CHUA 2RGVA 3F8CA 3HSEA 1TBXA 3IRRA 4B4CA 4BU2A 3S1QJ 2BVLA 1XTAA 3V8JA 2ZXJA 5D4SA 5IYDJ 1B9MA 3DF8A 5F1RA 3E5XA 3WTWC 4NHJA 4I0AA 1FJLA 3HHGA 3MKWB 4IQJA 2M1BA 1TQPA 2HKOA 3N97A 3U2RA 2V9KA 5KAIC 1X3WB 3B73A 4HV6A 3R6SA 4ZZDA 3CCEI 1Q1HA 1ZK8A 2A61A 4EM1A 4I6ZA 2OA4A 4A3IJ 1EV7A 2ZMEC 3KCCA 4Z2YA 4HDVA 4M9SA 2DK5A 2RV8A 3L7WA 3H5RA 2Z3YA 1ORKA 4IRHA 2WA0A 3A0BC 4EMSA 2KZVA 4IQ4A 4B44A 2E1OA 5DCMB 5FFXA 4HBLA 4UXNA 1XC5A 4BAYA 4XLFA 5BMZA 3SZPA 1IC8A 3AFHA 3HOVJ 4GO1A 5FO5A 3J81Z 3LA3A 3F21A 2W7NA 1ZARA 2DMQA 2M0CA 2XAUA 1QHHD 1YW8A 1HW1A 4D5CA 1AA7A 9ANTA 3HOZJ 1LFPA 4PK4A 3PNVA 2MBFA 4NC7A 5JR3A 1ZR2A 2GLOA 2PI0A 3FHNA 2JTVA 1D8JA 3CUQC 3CP2A 1X1AA 3HGGA 3I59B 3ZOBA 4HF1A 3DKWA 1VQ9I 1Z0XA 5KVRA 3HOTA 4P55A 2JA6J 3CP8A 2FBHA 1ZHFA 4XNFA 3C3WA 3B02A 1W7PA 2OQGA 2FRHA 2ELJA 3MQ0A 5C3EJ 4BH9A 1XMXA 1ETOA 2IS2A 2GXAA 5D8LB 5FKNA 5ICEA 3M7GA 4KIGA 3PIOF 1IG7A 4XLCA 2FQ4A 3F22A 2KRHA 5FRNA 5GPAA 2P7VB 2XF7A 4HV5A 4LLNA 2ZXHA 2ECCA 2Y0SA 1MMAA 2GXGA 2H09A 1IJWC 5J1YA 2EZIA 2JPBA 3OOUA 3RJPA 2LY9A 1R1UA 3J7AO 1IW7F 3SDGA 2XGXA 4C9YA 2EFPA 2CS3A 2OCEA 1HW2A 1IGNA 2HVRA 1XCBA 2K02A 1OPCA 3QRFF 1TZLA 1A36A 2XSJC 3CCQI 4L5EA 4RBOA 4KUMA 4L5IA 3OYHA 1ZKGA 1W4MA 2IEKA 5EGOB 1W1WE 5EJCA 3HOWJ 3RYRA 5CVIA 3CCMI 1PDNC 3KEQA 4KA4A 4KT6A 4RM2A 3QPSA 5EEHA 3AL0B 5HS8A 4R8HA 1R71A 5FKOA 1EKEA 3JSOA 2E35A 4M73A 4RB0A 2CGPA 4ZDLA 5FLVA 5ILUA 1XGMA 1RZ4A 4LK0F 2LF7A 2MGQA 3SQNA 1DGRM 5IOYA 3JR9A 5M3FJ 1VQNI 2QSFX 1P7JA 2VPLA 1G3SA 2X6XA 4KMUX 2V6EA 4G6QA 4XONA 3BR1A 3OSGA 4ZC3A 5HDGA 3Q0UA 3HOSA 5DD8A 1UG0A 3L9FA 2B9SA 2LBFB 2PFBA 4FETA 1YHQI 1Z67A 2HVSA 2CW8A 3WGHA 4WCGA 3WTXC 1R6RA 2WTEA 3LL7A 2LFBA 2IGOA 2ZO4A 1I39A 4CYDA 3OY9A 1MBHA 2Y0SN 3HSFA 2QQBA 1Z91A 1X3ZB 4OMYA 1BI3A 2W4SA 2HQNA 2DOFA 1EJ9A 3ABLH 4S05A 3DU5A 2KL4A 2DYSH 5JI6A 2QQ9A 2HDWA 2Z16A 3PL8A 3RTRA 3KYDB 1IN6A 2M30A 1L3LA 3F9KA 3Q0VA 3IRQA 1O57A 4XIDA 2GM4A 3L2CA 4ENJA 3TGNA 3T0YA 2CV2A 2V7FA 3TP3A 4XRMA 1T38A 1S7EA 4BEHB 1D0XA 2H1LA 3LOCA 1GVDA 2ZNZA 3BG3A 5K7FA 4BDYA 3EYIA 2CQKA 3IL2A 3L1PA 3DTKA 4BHPA 2CUZA 1IUYA 2Z1DA 2ESHA 2HDDA 2DBBA 4RGSA 4BY7J 2DA4A 2EIMH 2DK8A 2LF8A 2FNAA 4D9JA 4UY8I 4EJVA 2EFWA 4PSWA 2F5EA 2V26A 1S7OA 1OCTC 1ZQ3P 1ITYA 1K4TA 1B8IA 2XGDA 2HNHA 4HNTA 1LEAA 1Z21A 3M8JA 3CDHA 2W57A 3K4CA 2OAZA 2CQXA 2EZKA 3LSTA 1GHCA 4AWXB 1R23A 4UVAA 1B72B 3CC4I 2PJRB 5FKLA 1DPUA 3H3VK 2MH2A 2WAQA 2D1HA 1U8BA 2FU4A 1IV6A 4G6DA 1Y0UA 4UV8A 2K9NA 4MEXF 2BY3A 3I55I 1I1SA 1Z3XA 3D5SC 5DCFA 5HLIA 4FX4A 3K4NA 3GWZA 3EETA 2V79A 1W0UA 1FBUA 3LFUA 2ZBKA 2E60A 2QSHX 3OYEA 1J75A 1ON2A 4XN0A 2VXZA 2XHKA 4A69C 1M1EB 2NVXJ 5DV5A 1TQMA 2M7BA 3BG7A 4F92B 1U5TA 5TJJA 3IH2A 3VFZA 2VQCA 1SFOJ 3PUBA 4D7MA 4IL6C 3WGGA 2WAFA 2TRTA 5KK1A 1H8AC 1G2HA 2AQFA 2TDXA 3ECHA 1FX7A 3OWTA 4YFXF 3S1MJ 3DEWA 2E2HJ 3FXKA 3BZCA 5J8FA 1BI0A 1R00A 1BW6A 3ABUA 4IOAF 2W85A 1OMIA 3GTLJ 4MFDA 1W5SA 1T95A 4PCQA 3WTYC 3NQOA 3T8TA 5BS6A 3T8RA 1GV2A 1ZGJA 4RB1A 3F8NA 2V1UA 2KDZA 3IAS2 2ME0A 1AKHB 1YJNI 1HKSA 1FYMA 1UHMA 2QENA 5E8GA 2VOOA 4PJLA 2QQ8A 2BXZA 3FBIB 4WXDA 5LFAA 1EH7A 4XBFA 2EFNA 4CCKA 2DFIA 1MMSA 2X1DA 4LG0B 4A3BJ 4FE7A 3W6VA 1IZ1A 4E6KG 4C2UA 1WZ2A 2EBIA 4ZYDA 1YFHA 2K7LA 4IRGA 3H1CA 1MBEA 3MKYB 2NVTJ 4HEA2 1YTYA 1ZRFA 2RREA 2VBXA 2MFZA 4KFCA 4PFPA 4I09A 4NNJA 2COMA 1ODDA 2B7EA 1K78A 1FYKA 2R7SA 2CV0A 2NYXA 1XS9A 1YO5C 3G1MA 2Y9ZA 1W36C 1MJ9A 2O9LA 1QZYA 2CJJA 2LYCA 1O3SA 1WRJA 3HBLA 3F6OA 2L0KA 1DU0A 4Y15A 1DP3A 3K10A 3GTOJ 2Y30A 5L3BA 3JW4A 2D5VA 3WHCA 4UB8C 3QP5A 4HPQA 3MD2A 4RMNA 4AU7A 1PUFB 5D8KB 1TT0A 3DKYA 5GTIC 1Z1DA 3J80K 4II3A 1IO2A 2CO5A 2FMLA 4EJUA 4MTDA 3A1YA 2M0MA 4M3DA 5DUKA 4NQWA 3KYLA 3OR2C 1OLTA 1Y6IA 1XGSA 2LD5A 1QRYA 2IGKA 2LC2A 4AIHA 5M5YJ 2OF7A 1RNLA 5TGTA 1NK2P 3FX3A 4RLFA 2AXLA 1G4DA 4Q5SF 1SD5A 4YIRX 5JFRA 4FTHA 2W00A 2W84A 1LVKA 3EQLF 3H9QA 2R7ZJ 5GP9A 1UMQA 2K4JA 2Q2EB 2JUGA 4AYBA 2HQRA 2KIFA 2N8GA 2F5DA 5HS9A 3ML6A 1QA6A 2L9SA 3PJRA 2R0QC 2MD5A 2VKHA 3CMYA 1LQ1A 1D0ZA 2XF6A 4CGZA 2Y9YA 4DYRA 5EG0A 1WVRA 4MTEA 4IHVA 1BR2A 4YRVA 1FSEA 2DMNA 2QA4I 2DXIA 3HDDA 2K5CA 2UZKA 2LOOA 3VDXA 2M34A 1OYYA 2LMDA 4KICA 3E6CC 4DBRA 2B0LA 1S5LC 1FIAA 3TW6A 3FXJA 1IUFA 3KP6A 2DPDA 5LGUA 2VIXA 3RCOA 3TO9A 4M74A 1FPQA 1S3JA 2JRTA 2W24A 3I3LA 3WTZA 3C7JA 5JLWA 5E20A 2E71A 2F5CA 4BUPA 2BHZA 4WWCA 1VQ6I 3GTPJ 1ZGWA 5J3LA 1JI8A 1P6RA 3OMYA 1IDZA 1Y8RB 2MH9A 2DQLA 1X1DA 4BS9A 2ELHA 2P7CB 3ISPA 5F0CA 4UUSB 2ZJQF 2D45A 1NK3P 3H3UA 3CCYA 3RPUA 3PFIA 1YX3A 4F3QA 3IHUA 1T33A 1HQCA 2YR2A 2EINH 2XDVA 2DDAA 4V2GA 1ENHA 1XN7A 1ZELA 5K7ZA 1OCZH 1S72I 2CW7A 1R22A 2R7RA 5IP6A 4K2EA 2VC0A 3S3OA 3BR6A 3CMAI 3JRFA 1E3HA 2EZHA 1YS6A 4XORA 1BOBA 4H0EA 5HDNA 3VSKA 2X6OA 3OYJA 2DA6A 1P92A 4JK1X 3TP0A 2QSGX 1OYWA 4LGWA 3OYNA 2CU7A 3MEXA 3QPTA 4N4OB 3CTAA 2XRLA 1L0OC 1MW7A 3TO6A 2BXYA 4XLPF 2XSDC 1CF7A 3AG3H 1ETXA 3CDLA 1B59A 4Y7NJ 2FOWA 4NDLA 2O03A 3K1MA 4D5FA 2OC6A 1J09A 5CVJA 4XLEA 2DFFA 1D1AA 2QBYA 4BBRJ 2G0EA 4LG3A 5E1ZB 4AIJA 2KPMA 2R5ZB 1X2MA 4U7DA 3CCUI 2ESNA 3FWEA 1ETWA 2L7FP 3Q0WA 1O7LA 2I8DA 4HLXA 1XMKA 2L7MP 4KISA 2BW3A 6PAXA 4G94A 1ZLJA 5LBQA 1YQAA 5HNFA 4LITA 1U78A 1PP8F 4XRSG 3LSRA 2WC2A 3TKYA 2V1DA 3CUQA 3R0JA 1FP1D 5F6FA 4A3CJ 3DBLB 2WB1A 2WV1A 3F6VA 3D1NI 1MSEC 3A0HC 3MZ8A 3OYDA 1ZGAA 4D7NA 1BIAA 2NOJB 3DTIA 2XAJA 1VQ4I 1TTYA 3OSFA 1Z7LA 1NG7A 3PQJA 1QZZA 2BGCA 2Y48A 4HW0A 5D6EA 3HPHA 3G71I 2A68F 4IHTA 3CJQB 3ASOH 4XN3A 3LSIA 1KYZA 4XSZF 2OQRA 3TMOA 2R7UA 2XB5A 2HYGD 2K9MA 1ONVA 5LHIA 4DYQA 2IA2A 1MSFC 3ASNH 4D0PA 3E6DA 4Q48A 3WG9A 2HI3A 3OYCA 1I27A 1AWCA 5K5RA 2QKMB 1ETQA 4QPQA 1QO0D 3S2DJ 4CCJA 1MDMA 3V7RA 2WBMA 1RKWA 2LVSA 1JGGA 4Z6YA 4FISA 2ME6A 4XLAA 4PJJA 3U21A 4IHXA 2DMPA 4CZZA 2X4HA 3KIOA 2F5FA 1ZG5A 4P5OA 2A6EF 1Z7UA 4XKWA 2ELKA 2RNJA 5ICCA 3KX2A 3KP3A 1JE8A 1ZAOA 1K79A 4J00A 3WTTC 4I2OA 3S17J 5CLSA 1P4XA 3KLOA 4BQQA 4OAZA 3S14J 1HA8A 4G7HF 4C3JJ 5ICGA 4M72A 3GXOA 3ZRGA 1TWCJ 3PNTA 2IGNA 3AAFA 1FP2A 1IV8A 1IRFA 2KT0A 5J4VA 1WJCA 2IAIA 4BE2A 5E79C 3EUHC 4FT8A 1LEBA 4E7ZA 5B3SH 2HZTA 4CICA 2B63J 3FKJA 4LLLA 1YRNB 3S1NJ 2VL8A 2NVQJ 3VYRB 4Y13A 4RS8A 5CYVA 3PIPF 3FHZA 1ETKA 1T08B 2HU9A 5HS7A 1XSXA 1SMTA 4QTRA 1UB9A 4XICA 5B5EC 5LRSA 1YG2A 1T2KA 1OCCH 4ZYHA 3M07A 3W2VA 3O2PE 4BNCA 1CQTA 1G3WA 1P4WA 3GEZA 5E18F 1F5TA 1K83J 4MFEA 3EDPA 3S15J 1G8XA 5IYBJ 3C2GA 1X4OA 3M1CA 1KU3A 4PGGA 5HOOA 2DFHA 4DQ2A 1JJ8C 3HOYJ 2LK2A 3GFLA 1EH8A 2M4KA 5L3CA 3V8LA 2GIZA 4HG2A 3H36A 2JJ7A 2ACJA 2X1EA 1HDPA 5HLTA 3R61A 4KYWA 3OS1A 4DBQA 2XAQA 4DGWB 4IF4A 3HEFA 3ELKA 2JK3A 2IT0A 4ZYAA 1O3RA 3GZ5A 2VN2A 5LGTA 5IP9J 2ID6A 3ZMVA 1WQ2A 4H4KC 5A2QK 4BE0A 3DEUA 1T98A 2W25A 2K85A 4Y17A 3H0DA 4AUXA 2YUSA 2QYOA 1YI2I 1A35A 1MZBA 2NNNA 3PUFA 3GFMA 3I53A 4DJAA 4U88A 1D5VA 2VT2A 2P6SA 3HOUJ 1IN4A 4MIMA 3MCZA 4R79A 3RZOJ 3I54A 2K86A 2JA7J 1P2FA 1ULYA 4OIPF 1USTA 3B6AA 1MBGA 4FCYA 1XG1A 2PX9A 3KFWX 3BC8A 4M3EA 2P5LC 2VQLA 2NOGA 2E36A 2R5YA 3KETA 2HDCA 2OV7A 1ACIA 4AD9A 2ID3A 1X19A 4E70A 2IS4A 4UHTA 5ILSA 1ZG1A 4XR6A 4EM0B 3JRGA 1YE9A 5EF6A 2KKOA 4LIVA 2XASA 1I6HJ 3O8GA 3J7AY 4ASNA 3GBGA 1Y1VJ 2ZNYA 1QVTA 2NAZA 2EH3A 1TNTA 1VZ0A 1XGOA 4I02A 1QU3A 4BHBA 4HZFA 2EA4A 1UHWA 4IEJA 1U6GA 2JMWA 5FD6A 4S0HB 4RDUA 4MHGA 1NHAA 4A3EJ 5J40A 3LAPA 5HDKA 2L4MA 3OR1C 3BTJA 2QEXI 1TW3A 4NUBA 5E1XA 2O0YA 1RKTA 5AONA 2VJ5A 3TOBA 3JRCA 3JRAA 4RM3A 1RUNA 1JTXA 3G4SI 1S29A 2XPVA 3OIPA 1QPMA 4I98B 5H2FC 1H9TA 5ERIA 2J5OA 4EV0A 1MH3A 3ZQHA 5IY5H 3L2QA 2MLGA 1D0YA 1H9GA 4M6VA 3CJNA 2M2EA 1VQLI 1WI9A 4R1HA 4U0VA 4KT5C 1BR1A 2DQRA 2ZSIB 1J7KA 4XQFA 3I4MJ 2KFDA 2XPUA 3OIQA 1SVOA 3R0AA 2R7XA 2JQ7A 1FNNA 3FM3A 2V4JC 4EQQA 2UV1A 3F8FA 1CGPA 4X0GA 2YSRA 4M71A 3HC7A 1S8NA 3F3XA 4CZCA 2KQRA 3NARA 1IDYA 4O6JA 3V8KA 4XOTA 1W0TA 1Z6TA 4HQMA 1VTNC 3ULQB 4UUSA 4FASD 1OCPA 4CXFA 1UCRA 5M5XJ 2DI3A 2QLZA 1JUSA 2DT6A 2AHQA 5J8CA 1YRNA 3E0JB 3S8PA 3K70D 1OFCX 2FSWA 3RZDJ 1VF9A 3FMSA 3E7LA 3H9JA 1D8KA 4C2MJ 5FLXK 4IHWA 1P4AA 2Y2ZA 1O3TA 4I99C 2HQAA 4BY1J 2FBKA 1JGSA 2ZJ2A 2VASA 3DTEA 3NWSA 1OYIA 3W6JB 1LUJB 1R1VA 2GWRA 2QUFA 1B9NA 3HM5A 3DPUA 2IW5A 2R7DA 3DBRB 3CJTB 3QOPA 3FXQA 3DFGA 2XAGA 3BZ6A 1C0WA 1SANA 4CSWA 3HYIA 4IX7A 2EJRA 3PSIA 2E19A 3KZZA 4HX4A 3OYFA 2M7AA 1WJFA 2HOTA 2DYRH 4B48A 2H94A 4QSHA 2E1MB 4L5JA 4UB6C 5EG0B 4CH7A 3QYBA 3M8EA 4A3FJ 5BPDA 4EJTA 3OYIA 1WH7A 2K3FA 2P81A 4JX5A 2K9QA 2XKPA 3ZQLA 3I0TA 1YJWI 1OCRH 2L54A 2CUEA 4MGRA 1OCOH 1WJAA 4L0ZB 2VKVA 4A5NA 2HOSA 3ZQCA 1MMNA 3NWTA 1YW9A 2KIQA 2E1CA 2K4BA 4WXHA 3FK7A 4XK4A 5D5WB 2DOEA 3C2BA 3FMQA 5C44J 3CC2I 4BQNA 1K7AA 1N78A 1RPWA 4BE1A 3CO7C 2LY2A 1HC8A 2EFQA 3V42A 1U0JA 4OU0A 3G6EI 4OIOF 2YU9J 2PMZN 3P9IA 3KP7A 3WHBA 4KJZA 2Y31A 1FC3A 3DBHB 2G7UA 1T6SA 1Z6RA 4E7SA 3OS2A 5CPRB 3PO3J 3BTCA 4PZJA 2BV6A 1WCMJ 2BW3B 1R58A 1JUPA 2EIKH 4PJMA 4L18B 5DD4A 1XPXA 1OQYA 1YW7A 1LJ9A 1R36A 4CDGA 3HIFA 4HQEA 1SC7A 3BTIA 5L3EA 4O3MA 4DIQA 1D1BA 3CC7I 1RC9A 3O8HA 4J19A 1J5YA 3BOQA 2LG4A 2OUMA 2LR8A 5E8IA 5KAFC 2LKXA 4M3BA 3G2BA 3BR3A 2TCTA 3FIWA 4LMYA 3RKWA 1QBJA 3RKYA 2EV0A 5F04A 2PJPA 1K6YA 5FKKA 2CG4A 4YFNF 1RI7A 2JN6A 2M9HA 2WY8Q 1R5ID 2DJIA 1BI2A 1QZEA 2OBPA 3TDZC 1SFUA 3K69A 2DMUA 2ZFUA 1MGTA 5JVTA 1J59A 4WX9A 2KMUA 2H27A 2E1MC 3OL3A 4ZDPA 4YG2F 4L9VA 3QOEA 3E6BA 1ZG3A 2A6TA 2E5ZA 3IKTA 4G7ZF 1WWXA 2XV4S 3CD6I 2F48A 4A12A 1PYVA 1WJDA 4N9IA 4CCOA 1OISA 3FBNB 2DJNA 5EZGA 4AYBN 3FXRA 3ZP5A 4B8XA 5F27A 4OIQF 3S32A 3P9KA 2W48A 4MQVA 4A3DJ 1MDMB 2DFEA 4QIWN 5F1JA 3V7SA 2P6TA 5FGMA 1T0FC 2E2JJ 3SZTA 1UZCA 3OYMA 1Y39A 4CCLA 2LSOA 2LKSA 4G12A 5HLGA 1E3OC 3VYUB 3CJRB 2BVMA 1ZYRF 2GIVA 1WJBA 4JP0A 1TW2A 4E7JA 5J4YA 4GGGA 2MA3A 4M3FA 2JT1A 4L9JA 2PMZA 4NB5A 3TL4X 3LFKA 2FQ3A 1MKMA 3C2HA 3COAC 3HJEA 1ZLKA 5A2QZ 1U2WA 4UUVA 2VPRA 3PQKA 3ZR8X 3CUOA 4F7ZA 2MD0A 4IHYA 3UKGA 2EA2A 5ED4A 2ADUA 4A6DA 2O5RA 5J47A 4XL9A 1A04A 1V4RA 5BOXA 2MC4A 2R4GA 3ERED 2KRCA 2P5VA 2QVOA 3WG7H 3CCLI 5AIPA 4IPAA 1TWFJ 4FQGA 4BYYA 4BKXA 2DODA 3IUOA 4MNUA 2UWMA 3K0LA 2HYFA 2R5YB 1K4SA 3CCJI 1Q1VA 1VQ7I 1B8IB 4ITVA 1KQ9A 1XX5A 3I56I 2HXIA 2R5ZA 2I10A 2NS7A 1FBQA 4EM2A 2QBYB 3JRBA 4XKVA 2QCOA 1QVUA 1ZREA 5F0FA 1KA8A 3S1RJ 1N77A 1A31A 4W97A 1FLIA 1VQKI 2L4AA 2QM3A 5FFZA 1H88C 4RLQA 2DT7B 2BY2A 3D5LA 1ZTRA 2WB1N 2QF7A 3ZQGA 5D5UB 4V2FA 1TT5B 1FT9A 2AXTC 1Y0NA 2KZGA 2XC7A 3QWLA 4A0XA 1W5CC 4A0YA 4DZPA 3WTSC 2KIMA 2MSYA 3OIOA 1XSDA 3HRUA 3JCUC 2CQQA 2IS6A 4X6AJ 3L2RA 3FZVA 3BQYA 3K70C 2M8GX 4G9YA 4BDZA 1BJAA 3HRTA 2QGUA 2YU3A 3J7YJ 3DKXA 1JKOC 2ZXIA 2PMUA 1AOYA 2HZDA 5CKTA 3PM1A 4HNUA 2UXNA 3GTQJ 1VFCA 2XGEA 1UJ8A 3MMYB 3P9CA 5CVUA 4OIRF 3HOXJ 1Z9CA 5CVRA 2BY0A 5E3OA 3JTHA 2IGMA 2OJED 2R92J 5B1BH 3OS0A 4OWRB 2XB0X 4V19K 3RKXA 1X2NA 1STZA 3ERMA 3ROUA 1DP7P 3M3YJ 1XDUA 4RGUA 2RDPA 2VODA 2A6HF 2OTLI 4NC6A 2QZ8A 3K2AA 1WPKA 2JRMA 2EIJH 3CDIA 3QYFA 5FLMJ 1O7FA 3LWFA 1F36A 3CZ6A 1YITI 3RPUD 2L7KA 1B4AA 5E17F 3LNQA 3B6CA 1D5YA 1WJEA 2DU9A 2A69F 1LVAA 4HAMA 5IT9Z 1MJBA 3QODA 2G9WA 2DTZA 1RR7A 5AIQA 1SEUA 3JRHA 4LLGF 3SDBA 4DW6A 1QNTA 2KJBA 3RI4A 2HVQA 3J80Z 5FRMA 3RPQA 3BR0A 3M1EA 5HLHA 3V7CA 4PJNA 1T0FA 2OZ6A 2VBWA 5TISC 1P9QC 4IO9F 3GCMA 2NXNB 2LREA 2BYVE 3M8FA 4M3GA 4B47A 3BT9A 2WWYA 3MFKA 2STWA 2O3FA 3PFYA 2OPTA 2V9VA 5E3LA 1FMVA 4O5VA 2VONA 1VI0A 2DN0A 4U0WA 1FIPA 3AL0C 4C3HJ 2VOPA 4ZDOA 2Q2EA 5CVVA 5EEGA 1SD4A 1W36D 2Y75A 3CCRI 2Z9OA 5J6XA 3BP8A 1JHFA 4XKBA 2OU2A 4FX0A 4UNOA 4BGDA 1IAWA 4XRSA 3E5UA 4ETSA 2EV6A 1VNDA 4ZYEA 3MAJA 3AG4H 2LH9A 2X6WA 4NQWB 1X58A 3T5XA 2VJIA 4HNVA 1FSHA 5D5VB 4PDKA 4EGZA 4C2TA 2NVUB 2WV0A 2PLYA 5JLXA 5KHDA 2XVCA 1G59A 3SHFA 2DTRA 2CSOA 1PUFA 3MKLA 3EUKL 3I4PA 3O3KA 3FMRA 1TWGJ 4BBSJ 3CUQB 3PNYA 4Y4RA 4HA8A 2EZLA 2Z33A 1MBFA 1R9TJ 4OAYA 1IXSB 4JQFA 1LDDA 3NAUA 1GV5A 2A05A 1A5JA 3WU1B 4PGHA 3T1BA 1U5TC 3AG1H 4ZJZA 2IP2A 3HGYA 1UHSA 4OOIA 1V5EA 1E2XA 1S9HA 2F6CA 4F91B 3S2WA 2RKHA 3ZMUA 4F52A 2L5QA 1IRXA 4ZH4F 1GT0C 3OYGA 1H89C 1K78B 4KN7X 1BI1A 1QPIA 3QP6A 1JHHA 5JHUA 2ZJPF 3F72A 3G73A 3BJOA 2LNBA 4NC8A 4F55A 3WU0A 5H20A 3KEYA 1CF7B 2DOAA 3IWFA 4JBAA 2XPWA 1SVMA 2JVGA 3IC7A 4A3MJ 3BTLA 4AIKA 3WODF 4EGYA 2VKEA 4BXUA 3HG9A 2I5UA 3WU2C 1GDTA 5ILVA 4MEYF 1HW5A 2NNYA 1AKHA 3I4NJ 5H6QA 4Q47A 1WKMA 1U3EM 1NTCA 4WK8F 4GXOA 4HX8A 2HQ5A 3I71A 5LEJA 1G3YA 3HSRA 1AHDP 3LQQA 2STTA 4U87A 5GAEJ 2K40A 4ABZA 3BY6A 3C1DA 2JVHA 3L2UA 3L2WA 3O6BB 4GFBA 5CQEA 2JA8J 2R7QA 3W2AA 1RIOH 4QWQA 1YIJI 5K1YA 2DLLA 2A5YB 2FE3A 4L9NA 3REOA 1LFUP 1IXCA 1I3AA 3UNGC 4C3IJ 1MNDA 4HSRA 2LY1A 3VODA 4E7IA 2LBFA 4OINF 4BXXJ 2AQEA 2HPIA 1Y1WJ 3ABTA 5BNGA 1U5TB 3G1LA 4XMYA 1BC8C 1REPC 1YJ9I 3E97A 1DDNA 1MNEA 2HOAA 3BG6A 4Y3OA 1JKRC 4EJOA 1IRZA 3FXOA 4TV7A 1AU7A 2HFHA 5J1RA 3MN2A 5DUIA 3JAMK 3S16J 4ENNA 2CV1A 4GYIA 2V1XA 4XRFA 5K7HA 1J9IA 2GBYA 2ZMEA 4LIUA 4XOPA 3VWBA 4GCVA 2E34A 4KMFA 5FKMA 2FOKA 3RKQA 1JT6A 2VBZA 4A5MA 5DYMA 5DS9A 3ZCOA 4LB6B 1XCVA 4RAYA 2GAUA 3EUHA 4E7KA 1FTTA 3GTMJ 2NRAC 2X48A 2VC1A 3GZ6A 3A02A 3CF5F 3TQNA 1B72A 1WSUA 2CFXA 2F2EA 1DPRA 1I3QJ 4PSXA 1KU2A 4ZTJA 1HKTA 3BG9A 4AC0A 2FBIA 1Y56A 1HF0A 1IN8A 4G8XA 3HL2A 4BJTA 2XIGA 1BC7C 3GF2A 1BR4A 3Q9SA 3U9GA 4A93J 1X1CA 3N05A 1X4PA 4XSXF 5IPAA 2VT3A 3FF5A 4YIIA 4ESBA 3GTKJ 4LD5A 3SZGA 2O6GE 1UFMA 2CWEA 2MG4A 4PUSA 2JSPA 2HTSA 3D5RC 3MKZA 2NS8A 3GVAA 2EILH 3JREA 1H0MA 2KJCA 4B43A 4AVZA 1P7IA 3H35A 3IWZA 3BROA 2H6BA 3GTJJ 1FBSA 1WGXA 2F4IA 3ZQQA 5J1UA 1W7PB 2WY7Q 3K4MA 3VSLA 1R5GA 1R7JA 4CA0A 1TL8A 4BEHA 3MWMA 3LA7A 4P96A 3QAHA 3F8BA 4RAFA 4A3LJ 1LPQA 2JA5J 2R7TA 3I59A 2ZKZA 5ICFA 3JAMZ 3DPTA 2PEXA 3N4MA 1MMDA 2A3SA 1FOYA 3ZMZA 4U7BA 2Z5UA 4P1WA 1WFXA 3JSPA 3VPRA 3P5JA 4F93B 2IA1A 1PUEE 5CQGA 1EH6A 3LSGA 2XGCA 3ZQ7A 2IXSA 1FOXA 1PP7U 3CESA 4RAZA 3A2KA 2VJJA 3K2ZA 1XMAA 3KZYA 2KP6A 2H1KA 5IT9K 1QHGA 4AVPA 3F23A 3ECOA 2HR3A 4DYCA 4RGXA 2IJLA 2EQRA 1HXDA 2O8XA 1S7AA 1R4MB 2XF5A 3H5NA 3HB9A 3GLLA 3GYHX 3HHHA 4HSTA 2LLKA 1BW5A 1BOAA 4Y52J 5IYCJ 1G6NA 2PQ8A 3IAM2 5JVGF 1I50J 1OKRA 2DA3A 4BACA 3VYTB 4OMZA 2VUMJ 5EZHA 1Y8QB 1WH5A 1FOWA 1PJRA 3CLQA 3VYSB 4LG0A 4EVIA 3WE2A 3AKZA 3RDIA 4XM3A 3WTUC 4L0YB 1X3UA 2ZFWA 3A03A 4JX6A 1HKQA 1OR7A 3KE2A 4HRIA 3DLAA 3OOPA 3DWLE 1ZRDA 3MVPA 3R4KA 1T39A 4YIFA 3LSJA 3BJAA 2CYYA 4DNCA 3CCVI 4ENKA 1GLNA 2D1VA 5E3MA 1S6LA 3GUDA 3PSFA 1XB4A 3KP4A 1K6OA 5GAHJ 1IXRC 2VQGA 2M87A 2UUZA 1FEXA 3IH4A 1E3PA 2IS1A 3K9TA 2VLAA 3FK6A 4YEJA 2FF4A 2GOMA 3LAJA 3BJ6A 1WJ5A 3G3ZA 3ABKH 3DV8A 3L09A 1LNWA 5M5WJ 2JZYA 2PBIA 3SJMA 3RQIA 3LA2A 2FEZA 2MLKA 4CYCB 4HLYA 1O4XA 2OD5A 1XGNA 2W1OA 1HLVA 4WXCA 1FY7A 3DU6A 3DLLF 1LE8A 1R4NB 3PO2J 1UAAA 3DXJF 2WADA 2DCEA 2KISA 4G6TB 1OJLA 1HOMA 2IVMA 3GLXA 1FTZA 3FKIJ 1O3QA 3M4OJ 2K9SA 1FMWA 2LDUA 3LSMA 2M4GA 1Z3YA 3CMMA 2MYSA 3ZMSA 4EEFG 1EA3A 2ZB9A 3HRSA 3JRDA 3KPHA 3E3VA 1UELB 3IP4B 3DPLC 2GA1A 1ETVA 3K7AJ 1HCRA 4A3GJ 1LDKB 1TP4A 2CRGA 1R49A 2R7VA 4A2UA 1B1BA 3OYBA 1SAUA 2VJ4A 3TOAA 4D1QA 4IOCF 1X1BA 4A0ZA 1JXSA 1I5ZA 2DT5A 4RA2A 2DA1A 2PJRA 1GXQA 2KRFA 3S3NA 1KQ0A 1TQIA 1LFBA 4CUGA 4LK1F 1IN5A 3GTGJ 2J5PA 3ZXSA 4IXAA 4L9TA 1W7PD 2EK5A 2YPRA 3I9V2 1ZR4A 3DEEA 3GMEA 3ZPLA 5GPCA 2F5VA 3RQ4A 5BQTA 1XD7A 4ZZLA 2E2IJ 2WAEA 1V55H 4Y33A 2RAEA 5LRRA 2XRNA 2RQPA 3A01A 2PG4A 3U1KA 3M9AA 3HTUA 2A07F 1RRJA 3SEQA 2UXXA 3BR5A 4JYKA 4BJ6C 2HTJA 3I58A 2E5NA 4XLNF 3I5UA 1MBJA 1SMYF 2YS9A 1APLC 1ZN2A 2BE5F 2ISZA 3QPHA 2KLOA 2MABA 1TNSA 5D5XB 2VE8A 1V5GA 3V4GA 3EPZA 3E6MA 3D0SA 3K4LA 2IA0A 2VI6A 2MW8A 3KP5A 1I1GA 2X6YA 1MNMC 5LLQA 1BM9A 2QWWA 3LSKA 2H8WA 2YX4A 2ZCWA 4AM3A 3QQAA 1LDJA 3BQZA 2HWVA
chains in the Genus database with same CATH topology
2EWNA 5DEQA 3EYYA 1GVJA 5LHHA 3GO5A 2E1NA 1R1TA 5K5OA 3ZN1A 2ETHA 2GA2A 2YX7A 2D2WA 3GFIA 5DDGA 4WF2A 3ZMDA 5IT3A 2BEOA 1V3FA 2HEOA 5K5QA 3Q5FA 1I6XA 1FZPB 4IJAA 2FNPA 1F4KA 3FM5A 3Q9VA 2Q8KA 4LFUA 3TO7A 4N9HA 4G7OF 2IRFG 1Z05A 1BIBA 3P7NA 3H3ZA 4RB2C 2GQQA 5D4RA 1J2XA 4RB3C 4P9FA 1HSTA 5FD5A 2GZWA 1D3YA 5BPIA 4ESFA 2L02A 2DPUA 5HVQC 3GX4X 3TDUC 4LJZF 2DAOA 3VOEA 2FXAA 3GW2A 1BN5A 2JPCA 2HOEA 3OV8A 2O61A 1J0RA 5FLXZ 3QU3A 4Q4ZF 2DO7A 4EJWA 4I7HA 1SD7A 1R5HA 1RUOA 2VBYA 2OZUA 4I0BA 3SFZA 3NEUA 5DCMA 1BBYA 3JTGA 2XAHA 3KEOA 2Q0OA 4GYGA 3C18A 2M45A 1MD0A 4M9XA 3W6KB 2K27A 1KQ8A 1SFEA 1E17A 2V6CA 2XROA 1SFXA 4LB5A 4UV9A 2X0LA 3I64A 4QLCU 5F64A 4B09A 5D6FA 2XKOA 4BQAA 3BWGA 5H6RA 2L01A 4ZYGA 2E7WA 1IF1A 1YYVA 3VB2A 5FB2A 4UVCA 1LB2A 2M5WA 4ESJA 4MQ9F 4HF0A 4M6XA 2P4WA 3CLOA 2XUBA 1FYLA 3SXYA 5LHGA 4M6YA 1B6AA 1YLFA 4FHTA 1YS7A 3MZYA 2XAFA 1U8RA 2Z99A 1KU7A 3HTSB 2L3DA 3ZN0A 2M8EA 3GFJA 3WE3A 3BDDA 3CO6C 2EB7A 4IVNA 4RGRA 1KYWA 2JSCA 2NS0A 1MJAA 3WGIA 2RN7A 1XDSA 3NRVA 2ISYA 1GXPA 4ON0A 3K1PA 4HOBA 3U1DA 4N0BA 4KNYA 5L3FA 1SD6A 3E5QA 3FXUA 3R60A 2EV5A 2BBYA 3VEPA 3RIRA 5LEKA 1HSJA 4HYEA 1ZRCA 3LQRA 5TRDA 5E1WA 2P5KA 1XSVA 2HGCA 5L3DA 5CJ9A 2PMHA 3RYPA 1DUXC 1HBXG 1QGPA 1IN7A 2FMYA 1IRGA 2CW0F 3J81K 3DQVC 4I01A 3HRMA 4S04A 3L00A 3ZMTA 4HX7A 2IPQX 2HKXA 2KIUA 3H92A 1FOKA 1W5TA 4HDUA 4YFKF 2FA5A 2LKPA 1ON1A 3IKVA 2RVCA 2H6CA 3KLNA 2RC4A 3BPVA 5L3GA 1TLHB 4BHCA 4U0YA 3BPXA 2C6YA 2QQAA 4KIFA 2GXBA 4M9ZA 1F1ZA 2P8TA 3KP2A 1KU9A 3F8MA 4HF2A 1F9NA 3HUGA 2EFOA 1ZH5A 1SAXA 4UVBA 2ZMEB 2DW4A 3WTVC 3DP7A 2R7FA 3MZHA 1YIOA 4ENMA 2MC3A 4KN4X 2R3SA 4KDPA 1KGSA 5LGNA 4A6EA 4CO8A 2E7XA 2G7HA 4P9UA 3K1NA 1QQIA 2PN6A 4IHSA 4KIBA 2VE9A 1G3TA 1USSA 2HS5A 4IRIA 1FWZA 3QU6A 2AS5F 2Y0MA 4CHUA 2RGVA 3F8CA 3HSEA 1TBXA 3IRRA 3V8JA 2ZXJA 5D4SA 1B9MA 3DF8A 5F1RA 3E5XA 3WTWC 4NHJA 4I0AA 3HHGA 2M1BA 1TQPA 2HKOA 3N97A 3U2RA 3B73A 4HV6A 3R6SA 4ZZDA 1Q1HA 2A61A 4EM1A 2OA4A 1EV7A 3KCCA 4Z2YA 4HDVA 4M9SA 2DK5A 2RV8A 3L7WA 2Z3YA 4IRHA 4EMSA 5DCMB 5FFXA 4HBLA 4UXNA 4BAYA 5BMZA 3SZPA 4GO1A 5FO5A 3J81Z 3LA3A 3F21A 1ZARA 1YW8A 1HW1A 2MBFA 2PI0A 5JR3A 2JTVA 1D8JA 3CUQC 3I59B 4HF1A 3DKWA 5KVRA 3HOTA 4P55A 2FBHA 1ZHFA 3C3WA 3B02A 1W7PA 2OQGA 2FRHA 3MQ0A 4BH9A 5D8LB 5ICEA 3M7GA 4KIGA 3F22A 2P7VB 4HV5A 4LLNA 2GXGA 2H09A 2JPBA 3RJPA 1R1UA 3J7AO 1IW7F 2XGXA 2EFPA 1HW2A 1XCBA 2K02A 1OPCA 3QRFF 4KUMA 4L5IA 1W4MA 3RYRA 5CVIA 1PDNC 3KEQA 4KA4A 5EEHA 5HS8A 4R8HA 3JSOA 4M73A 4RB0A 2CGPA 5ILUA 1XGMA 1RZ4A 4LK0F 2LF7A 3SQNA 1G3SA 4KMUX 4G6QA 5HDGA 3HOSA 5DD8A 3L9FA 2PFBA 3WGHA 4WCGA 3WTXC 2WTEA 2ZO4A 4CYDA 3HSFA 2QQBA 1Z91A 4OMYA 1BI3A 2HQNA 4S05A 5JI6A 2QQ9A 3RTRA 1IN6A 2M30A 1L3LA 3IRQA 1O57A 3L2CA 4ENJA 3TGNA 3T0YA 1T38A 2ZNZA 3EYIA 2CQKA 3IL2A 4BHPA 1IUYA 2ESHA 2DBBA 4RGSA 2DK8A 2LF8A 2FNAA 4EJVA 2EFWA 2F5EA 1S7OA 1LEAA 3CDHA 2W57A 3LSTA 2OAZA 1GHCA 4AWXB 1R23A 4UVAA 1DPUA 2MH2A 2D1HA 2FU4A 4G6DA 1Y0UA 4UV8A 4MEXF 1I1SA 5HLIA 5DCFA 4FX4A 3GWZA 3EETA 2V79A 1FBUA 2ZBKA 1J75A 1ON2A 2VXZA 2XHKA 5DV5A 1TQMA 1U5TA 5TJJA 3VFZA 3WGGA 5KK1A 2TDXA 3ECHA 1FX7A 4YFXF 5J8FA 1BI0A 1R00A 3ABUA 2W85A 1OMIA 1W5SA 4PCQA 3WTYC 3NQOA 3T8TA 5BS6A 3T8RA 1ZGJA 4RB1A 3F8NA 2V1UA 1HKSA 1FYMA 1UHMA 2QENA 5E8GA 2VOOA 4WXDA 1EH7A 4XBFA 2EFNA 2DFIA 4LG0B 1IZ1A 1YFHA 4ZYDA 2K7LA 4IRGA 1YTYA 1ZRFA 2VBXA 4KFCA 4I09A 2COMA 1ODDA 1FYKA 1K78A 2NYXA 1YO5C 1MJ9A 1QZYA 1O3SA 1WRJA 3F6OA 4Y15A 5L3BA 3JW4A 3QP5A 5D8KB 1Z1DA 3J80K 4EJUA 2CO5A 2FMLA 4MTDA 5DUKA 4NQWA 1XGSA 4AIHA 1RNLA 3FX3A 2AXLA 1G4DA 4Q5SF 1SD5A 5JFRA 2W84A 3EQLF 2K4JA 2HQRA 2KIFA 2F5DA 5HS9A 3ML6A 2MD5A 1LQ1A 4CGZA 4MTEA 1FSEA 2UZKA 1OYYA 4KICA 3E6CC 2B0LA 3KP6A 2DPDA 5LGUA 3TO9A 4M74A 1FPQA 1S3JA 2JRTA 2W24A 3WTZA 3C7JA 5E20A 2F5CA 4WWCA 1P6RA 2MH9A 2DQLA 2P7CB 2ELHA 3ISPA 2D45A 3H3UA 3RPUA 3PFIA 3IHUA 1HQCA 2YR2A 1XN7A 1R22A 4K2EA 2VC0A 1YS6A 4H0EA 5HDNA 4JK1X 1P92A 1OYWA 4LGWA 3MEXA 3QPTA 3CTAA 1L0OC 3TO6A 4XLPF 1CF7A 1B59A 2O03A 3K1MA 5CVJA 2QBYA 5E1ZB 4AIJA 4U7DA 2ESNA 3FWEA 1O7LA 4HLXA 1XMKA 6PAXA 4G94A 1ZLJA 5LBQA 1YQAA 1U78A 1PP8F 2WC2A 3TKYA 2V1DA 3CUQA 3R0JA 1FP1D 5F6FA 3F6VA 1ZGAA 1BIAA 2XAJA 1TTYA 3PQJA 1QZZA 2BGCA 2Y48A 4HW0A 5D6EA 2A68F 4IHTA 1KYZA 4XSZF 2OQRA 2HYGD 1ONVA 5LHIA 2IA2A 4D0PA 3E6DA 4Q48A 3WG9A 1I27A 1AWCA 5K5RA 1QO0D 1MDMA 3V7RA 4CZZA 2X4HA 2F5FA 1ZG5A 4P5OA 2A6EF 1Z7UA 2RNJA 5ICCA 3KP3A 1JE8A 1ZAOA 1K79A 3WTTC 4I2OA 5CLSA 1P4XA 3KLOA 4G7HF 5ICGA 4M72A 3GXOA 3AAFA 1FP2A 1IRFA 4FT8A 1LEBA 2HZTA 4CICA 4LLLA 4Y13A 4RS8A 5CYVA 3FHZA 5HS7A 1XSXA 1SMTA 1UB9A 5LRSA 1YG2A 1T2KA 4ZYHA 3O2PE 4BNCA 1G3WA 1P4WA 3GEZA 5E18F 1F5TA 3EDPA 1KU3A 4PGGA 5HOOA 4DQ2A 3GFLA 1EH8A 5L3CA 3V8LA 2ACJA 3R61A 4KYWA 2XAQA 4IF4A 3ELKA 2IT0A 1O3RA 3GZ5A 2VN2A 5LGTA 3ZMVA 1WQ2A 5A2QK 3DEUA 1T98A 2W25A 4Y17A 2QYOA 1MZBA 2NNNA 3GFMA 3I53A 4U88A 1D5VA 2VT2A 2P6SA 1IN4A 3MCZA 4R79A 3I54A 2K86A 1P2FA 1ULYA 4OIPF 1USTA 3KFWX 2P5LC 3KETA 2HDCA 4AD9A 4E70A 4UHTA 5ILSA 1ZG1A 4EM0B 2KKOA 2XASA 4ASNA 2ZNYA 2NAZA 1TNTA 1XGOA 4I02A 4BHBA 4HZFA 2EA4A 1UHWA 1U6GA 5FD6A 4MHGA 1NHAA 3LAPA 5HDKA 2L4MA 1TW3A 5E1XA 2O0YA 5AONA 3TOBA 1RUNA 1S29A 1QPMA 4I98B 1H9TA 5ERIA 2J5OA 4EV0A 2MLGA 1H9GA 3CJNA 1WI9A 4R1HA 4U0VA 4KT5C 2DQRA 1J7KA 3R0AA 1FNNA 3FM3A 4EQQA 1CGPA 3F8FA 2YSRA 4M71A 1S8NA 3F3XA 4O6JA 3V8KA 1Z6TA 4HQMA 1VTNC 3ULQB 4CXFA 1UCRA 2DI3A 2QLZA 5J8CA 2FSWA 3FMSA 1D8KA 5FLXK 1P4AA 1O3TA 2FBKA 1JGSA 2ZJ2A 1OYIA 3W6JB 1R1VA 2GWRA 2QUFA 1B9NA 2IW5A 2R7DA 3QOPA 3FXQA 3DFGA 2XAGA 3BZ6A 1C0WA 3HYIA 2EJRA 3KZZA 4HX4A 2H94A 4L5JA 3M8EA 5BPDA 4EJTA 2XKPA 3I0TA 2L54A 4MGRA 4L0ZB 4A5NA 1YW9A 2E1CA 2K4BA 4WXHA 5D5WB 3FMQA 1K7AA 3CO7C 2EFQA 4OIOF 4OU0A 3P9IA 3KP7A 1FC3A 2G7UA 1T6SA 1Z6RA 4PZJA 2BV6A 1R58A 4L18B 5DD4A 1YW7A 1LJ9A 1R36A 4CDGA 3HIFA 4HQEA 5L3EA 4O3MA 1J5YA 3BOQA 5E8IA 4LMYA 3RKWA 1QBJA 3RKYA 2EV0A 2PJPA 2CG4A 4YFNF 1RI7A 1BI2A 2OBPA 3TDZC 1SFUA 3K69A 1MGTA 5JVTA 1J59A 4WX9A 2H27A 4YG2F 4L9VA 3E6BA 1ZG3A 3IKTA 4G7ZF 1WWXA 2XV4S 4A12A 4N9IA 3ZP5A 3FXRA 4B8XA 4OIQF 3P9KA 4MQVA 1MDMB 3V7SA 2P6TA 5FGMA 3SZTA 2LSOA 5HLGA 1ZYRF 2GIVA 1TW2A 4GGGA 2MA3A 4NB5A 2JT1A 4L9JA 3LFKA 2FQ3A 1MKMA 3COAC 4UUVA 1ZLKA 5A2QZ 1U2WA 3PQKA 3CUOA 4F7ZA 2EA2A 5ED4A 2ADUA 4A6DA 1A04A 1V4RA 5BOXA 3ERED 2P5VA 2QVOA 5AIPA 4IPAA 4BYYA 4MNUA 2UWMA 3K0LA 2HYFA 1KQ9A 1FBQA 4EM2A 2QBYB 1ZREA 1KA8A 1FLIA 2L4AA 2QM3A 5FFZA 3D5LA 5D5UB 1FT9A 4A0XA 4A0YA 3WTSC 2KIMA 1XSDA 3HRUA 3FZVA 4G9YA 1BJAA 3HRTA 2YU3A 2PMUA 1AOYA 2UXNA 5CVUA 3P9CA 4OIRF 1Z9CA 5CVRA 3JTHA 3RKXA 1STZA 3ROUA 1DP7P 1XDUA 4RGUA 2RDPA 2VODA 2A6HF 2QZ8A 1O7FA 3LWFA 5E17F 1B4AA 2DU9A 2A69F 1LVAA 4HAMA 5IT9Z 1MJBA 2G9WA 5AIQA 4LLGF 1QNTA 2KJBA 3RI4A 3J80Z 3RPQA 3M1EA 5HLHA 3V7CA 1T0FA 2OZ6A 2VBWA 2BYVE 3M8FA 2WWYA 3MFKA 2STWA 2O3FA 2V9VA 2VONA 4O5VA 4U0WA 2VOPA 2Q2EA 5CVVA 5EEGA 1SD4A 2Y75A 2Z9OA 5J6XA 3BP8A 1JHFA 2OU2A 4FX0A 4UNOA 1IAWA 3E5UA 4ETSA 2EV6A 4ZYEA 3MAJA 3T5XA 1FSHA 5D5VB 4PDKA 4EGZA 2WV0A 2PLYA 2XVCA 3SHFA 2DTRA 2CSOA 3I4PA 3O3KA 3FMRA 3CUQB 4HA8A 2Z33A 1IXSB 4JQFA 1LDDA 3WU1B 4PGHA 3T1BA 1U5TC 2IP2A 4OOIA 1E2XA 3S2WA 2RKHA 3ZMUA 4ZH4F 1K78B 4KN7X 1BI1A 3QP6A 1JHHA 5JHUA 3F72A 3G73A 3BJOA 2LNBA 3WU0A 5H20A 1CF7B 3IWFA 4JBAA 3IC7A 4AIKA 3WODF 4EGYA 4BXUA 5ILVA 4MEYF 1HW5A 2NNYA 5H6QA 4Q47A 1WKMA 1U3EM 4WK8F 4GXOA 4HX8A 3I71A 5LEJA 1G3YA 3HSRA 3LQQA 2STTA 3BY6A 3C1DA 3O6BB 1RIOH 4QWQA 5K1YA 2DLLA 2A5YB 2FE3A 4L9NA 3REOA 1IXCA 3VODA 4OINF 3ABTA 1U5TB 1BC8C 1REPC 3E97A 1DDNA 4EJOA 4TV7A 2HFHA 5DUIA 3JAMK 4ENNA 4GYIA 2V1XA 4XRFA 1J9IA 2ZMEA 4GCVA 4KMFA 2FOKA 2VBZA 4A5MA 5DYMA 4LB6B 1XCVA 4RAYA 2GAUA 3EUHA 2NRAC 2VC1A 3GZ6A 3TQNA 1WSUA 2CFXA 2F2EA 1DPRA 1KU2A 1HKTA 2FBIA 1IN8A 4G8XA 1BC7C 2XIGA 3GF2A 3Q9SA 3U9GA 4XSXF 2VT3A 3FF5A 4YIIA 4ESBA 4LD5A 2O6GE 1UFMA 2CWEA 2HTSA 3GVAA 1H0MA 2KJCA 3IWZA 3BROA 2H6BA 1FBSA 1W7PB 1R5GA 1R7JA 3MWMA 3LA7A 4P96A 3QAHA 3F8BA 3I59A 2ZKZA 5ICFA 3JAMZ 3DPTA 2PEXA 3N4MA 3ZMZA 2A3SA 4U7BA 2Z5UA 3JSPA 2IA1A 1PUEE 1EH6A 3ZQ7A 1PP7U 4RAZA 3K2ZA 1XMAA 3KZYA 5IT9K 4AVPA 3F23A 3ECOA 2HR3A 4RGXA 2IJLA 1HXDA 2O8XA 1S7AA 3GYHX 3HHHA 1BOAA 1G6NA 2PQ8A 1OKRA 4OMZA 4LG0A 4EVIA 3WE2A 3RDIA 3WTUC 4L0YB 1X3UA 2ZFWA 1HKQA 1OR7A 3KE2A 3OOPA 1ZRDA 3R4KA 1T39A 4YIFA 3BJAA 2CYYA 4DNCA 4ENKA 2D1VA 1S6LA 3GUDA 1XB4A 3KP4A 1K6OA 1IXRC 2M87A 3K9TA 2FF4A 3LAJA 3BJ6A 3G3ZA 3DV8A 3L09A 1LNWA 2JZYA 2PBIA 3LA2A 2FEZA 2MLKA 4HLYA 2OD5A 1XGNA 4WXCA 1FY7A 3DXJF 2IVMA 3GLXA 1O3QA 2LDUA 3ZMSA 3HRSA 3E3VA 3DPLC 2GA1A 1LDKB 4A2UA 1B1BA 3TOAA 4A0ZA 1JXSA 1I5ZA 2DT5A 1GXQA 2KRFA 1KQ0A 1TQIA 4LK1F 1IN5A 2J5PA 4IXAA 4L9TA 1W7PD 2EK5A 2YPRA 3ZPLA 5BQTA 1XD7A 4ZZLA 5LRRA 2XRNA 2RQPA 2PG4A 3M9AA 3HTUA 2A07F 2UXXA 2HTJA 3I58A 4XLNF 3I5UA 1SMYF 1ZN2A 2BE5F 2ISZA 3QPHA 1TNSA 5D5XB 2VE8A 3V4GA 3E6MA 3D0SA 2IA0A 3KP5A 1I1GA 5LLQA 1BM9A 2QWWA 2YX4A 2ZCWA 1LDJA 2HWVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EWN A;  5DEQ A;  3EYY A;  1GVJ A;  5LHH A;  3GO5 A;  2E1N A;  1R1T A;  5K5O A;  3ZN1 A;  2ETH A;  2GA2 A;  2YX7 A;  2D2W A;  3GFI A;  5DDG A;  4WF2 A;  3ZMD A;  5IT3 A;  2BEO A;  1V3F A;  2HEO A;  5K5Q A;  3Q5F A;  1I6X A;  1FZP B;  4IJA A;  2FNP A;  1F4K A;  3FM5 A;  3Q9V A;  2Q8K A;  4LFU A;  3TO7 A;  4N9H A;  4G7O F;  2IRF G;  1Z05 A;  1BIB A;  3P7N A;  3H3Z A;  4RB2 C;  2GQQ A;  5D4R A;  1J2X A;  4RB3 C;  4P9F A;  1HST A;  5FD5 A;  2GZW A;  1D3Y A;  5BPI A;  4ESF A;  2L02 A;  2DPU A;  5HVQ C;  3GX4 X;  3TDU C;  4LJZ F;  2DAO A;  3VOE A;  2FXA A;  3GW2 A;  1BN5 A;  2JPC A;  2HOE A;  3OV8 A;  2O61 A;  1J0R A;  5FLX Z;  3QU3 A;  4Q4Z F;  2DO7 A;  4EJW A;  4I7H A;  1SD7 A;  1R5H A;  1RUO A;  2VBY A;  2OZU A;  4I0B A;  3SFZ A;  3NEU A;  5DCM A;  1BBY A;  3JTG A;  2XAH A;  3KEO A;  2Q0O A;  4GYG A;  3C18 A;  2M45 A;  1MD0 A;  4M9X A;  3W6K B;  2K27 A;  1KQ8 A;  1SFE A;  1E17 A;  2V6C A;  2XRO A;  1SFX A;  4LB5 A;  4UV9 A;  2X0L A;  3I64 A;  4QLC U;  5F64 A;  4B09 A;  5D6F A;  2XKO A;  4BQA A;  3BWG A;  5H6R A;  2L01 A;  4ZYG A;  2E7W A;  1IF1 A;  1YYV A;  3VB2 A;  5FB2 A;  4UVC A;  1LB2 A;  2M5W A;  4ESJ A;  4MQ9 F;  4HF0 A;  4M6X A;  2P4W A;  3CLO A;  2XUB A;  1FYL A;  3SXY A;  5LHG A;  4M6Y A;  1B6A A;  1YLF A;  4FHT A;  1YS7 A;  3MZY A;  2XAF A;  1U8R A;  2Z99 A;  1KU7 A;  3HTS B;  2L3D A;  3ZN0 A;  2M8E A;  3GFJ A;  3WE3 A;  3BDD A;  3CO6 C;  2EB7 A;  4IVN A;  4RGR A;  1KYW A;  2JSC A;  2NS0 A;  1MJA A;  3WGI A;  2RN7 A;  1XDS A;  3NRV A;  2ISY A;  1GXP A;  4ON0 A;  3K1P A;  4HOB A;  3U1D A;  4N0B A;  4KNY A;  5L3F A;  1SD6 A;  3E5Q A;  3FXU A;  3R60 A;  2EV5 A;  2BBY A;  3VEP A;  3RIR A;  5LEK A;  1HSJ A;  4HYE A;  1ZRC A;  3LQR A;  5TRD A;  5E1W A;  2P5K A;  1XSV A;  2HGC A;  5L3D A;  5CJ9 A;  2PMH A;  3RYP A;  1DUX C;  1HBX G;  1QGP A;  1IN7 A;  2FMY A;  1IRG A;  2CW0 F;  3J81 K;  3DQV C;  4I01 A;  3HRM A;  4S04 A;  3L00 A;  3ZMT A;  4HX7 A;  2IPQ X;  2HKX A;  2KIU A;  3H92 A;  1FOK A;  1W5T A;  4HDU A;  4YFK F;  2FA5 A;  2LKP A;  1ON1 A;  3IKV A;  2RVC A;  2H6C A;  3KLN A;  2RC4 A;  3BPV A;  5L3G A;  1TLH B;  4BHC A;  4U0Y A;  3BPX A;  2C6Y A;  2QQA A;  4KIF A;  2GXB A;  4M9Z A;  1F1Z A;  2P8T A;  3KP2 A;  1KU9 A;  3F8M A;  4HF2 A;  1F9N A;  3HUG A;  2EFO A;  1ZH5 A;  1SAX A;  4UVB A;  2ZME B;  2DW4 A;  3WTV C;  3DP7 A;  2R7F A;  3MZH A;  1YIO A;  4ENM A;  2MC3 A;  4KN4 X;  2R3S A;  4KDP A;  1KGS A;  5LGN A;  4A6E A;  4CO8 A;  2E7X A;  2G7H A;  4P9U A;  3K1N A;  1QQI A;  2PN6 A;  4IHS A;  4KIB A;  2VE9 A;  1G3T A;  1USS A;  2HS5 A;  4IRI A;  1FWZ A;  3QU6 A;  2AS5 F;  2Y0M A;  4CHU A;  2RGV A;  3F8C A;  3HSE A;  1TBX A;  3IRR A;  3V8J A;  2ZXJ A;  5D4S A;  1B9M A;  3DF8 A;  5F1R A;  3E5X A;  3WTW C;  4NHJ A;  4I0A A;  3HHG A;  2M1B A;  1TQP A;  2HKO A;  3N97 A;  3U2R A;  3B73 A;  4HV6 A;  3R6S A;  4ZZD A;  1Q1H A;  2A61 A;  4EM1 A;  2OA4 A;  1EV7 A;  3KCC A;  4Z2Y A;  4HDV A;  4M9S A;  2DK5 A;  2RV8 A;  3L7W A;  2Z3Y A;  4IRH A;  4EMS A;  5DCM B;  5FFX A;  4HBL A;  4UXN A;  4BAY A;  5BMZ A;  3SZP A;  4GO1 A;  5FO5 A;  3J81 Z;  3LA3 A;  3F21 A;  1ZAR A;  1YW8 A;  1HW1 A;  2MBF A;  2PI0 A;  5JR3 A;  2JTV A;  1D8J A;  3CUQ C;  3I59 B;  4HF1 A;  3DKW A;  5KVR A;  3HOT A;  4P55 A;  2FBH A;  1ZHF A;  3C3W A;  3B02 A;  1W7P A;  2OQG A;  2FRH A;  3MQ0 A;  4BH9 A;  5D8L B;  5ICE A;  3M7G A;  4KIG A;  3F22 A;  2P7V B;  4HV5 A;  4LLN A;  2GXG A;  2H09 A;  2JPB A;  3RJP A;  1R1U A;  3J7A O;  1IW7 F;  2XGX A;  2EFP A;  1HW2 A;  1XCB A;  2K02 A;  1OPC A;  3QRF F;  4KUM A;  4L5I A;  1W4M A;  3RYR A;  5CVI A;  1PDN C;  3KEQ A;  4KA4 A;  5EEH A;  5HS8 A;  4R8H A;  3JSO A;  4M73 A;  4RB0 A;  2CGP A;  5ILU A;  1XGM A;  1RZ4 A;  4LK0 F;  2LF7 A;  3SQN A;  1G3S A;  4KMU X;  4G6Q A;  5HDG A;  3HOS A;  5DD8 A;  3L9F A;  2PFB A;  3WGH A;  4WCG A;  3WTX C;  2WTE A;  2ZO4 A;  4CYD A;  3HSF A;  2QQB A;  1Z91 A;  4OMY A;  1BI3 A;  2HQN A;  4S05 A;  5JI6 A;  2QQ9 A;  3RTR A;  1IN6 A;  2M30 A;  1L3L A;  3IRQ A;  1O57 A;  3L2C A;  4ENJ A;  3TGN A;  3T0Y A;  1T38 A;  2ZNZ A;  3EYI A;  2CQK A;  3IL2 A;  4BHP A;  1IUY A;  2ESH A;  2DBB A;  4RGS A;  2DK8 A;  2LF8 A;  2FNA A;  4EJV A;  2EFW A;  2F5E A;  1S7O A;  1LEA A;  3CDH A;  2W57 A;  3LST A;  2OAZ A;  1GHC A;  4AWX B;  1R23 A;  4UVA A;  1DPU A;  2MH2 A;  2D1H A;  2FU4 A;  4G6D A;  1Y0U A;  4UV8 A;  4MEX F;  1I1S A;  5HLI A;  5DCF A;  4FX4 A;  3GWZ A;  3EET A;  2V79 A;  1FBU A;  2ZBK A;  1J75 A;  1ON2 A;  2VXZ A;  2XHK A;  5DV5 A;  1TQM A;  1U5T A;  5TJJ A;  3VFZ A;  3WGG A;  5KK1 A;  2TDX A;  3ECH A;  1FX7 A;  4YFX F;  5J8F A;  1BI0 A;  1R00 A;  3ABU A;  2W85 A;  1OMI A;  1W5S A;  4PCQ A;  3WTY C;  3NQO A;  3T8T A;  5BS6 A;  3T8R A;  1ZGJ A;  4RB1 A;  3F8N A;  2V1U A;  1HKS A;  1FYM A;  1UHM A;  2QEN A;  5E8G A;  2VOO A;  4WXD A;  1EH7 A;  4XBF A;  2EFN A;  2DFI A;  4LG0 B;  1IZ1 A;  1YFH A;  4ZYD A;  2K7L A;  4IRG A;  1YTY A;  1ZRF A;  2VBX A;  4KFC A;  4I09 A;  2COM A;  1ODD A;  1FYK A;  1K78 A;  2NYX A;  1YO5 C;  1MJ9 A;  1QZY A;  1O3S A;  1WRJ A;  3F6O A;  4Y15 A;  5L3B A;  3JW4 A;  3QP5 A;  5D8K B;  1Z1D A;  3J80 K;  4EJU A;  2CO5 A;  2FML A;  4MTD A;  5DUK A;  4NQW A;  1XGS A;  4AIH A;  1RNL A;  3FX3 A;  2AXL A;  1G4D A;  4Q5S F;  1SD5 A;  5JFR A;  2W84 A;  3EQL F;  2K4J A;  2HQR A;  2KIF A;  2F5D A;  5HS9 A;  3ML6 A;  2MD5 A;  1LQ1 A;  4CGZ A;  4MTE A;  1FSE A;  2UZK A;  1OYY A;  4KIC A;  3E6C C;  2B0L A;  3KP6 A;  2DPD A;  5LGU A;  3TO9 A;  4M74 A;  1FPQ A;  1S3J A;  2JRT A;  2W24 A;  3WTZ A;  3C7J A;  5E20 A;  2F5C A;  4WWC A;  1P6R A;  2MH9 A;  2DQL A;  2P7C B;  2ELH A;  3ISP A;  2D45 A;  3H3U A;  3RPU A;  3PFI A;  3IHU A;  1HQC A;  2YR2 A;  1XN7 A;  1R22 A;  4K2E A;  2VC0 A;  1YS6 A;  4H0E A;  5HDN A;  4JK1 X;  1P92 A;  1OYW A;  4LGW A;  3MEX A;  3QPT A;  3CTA A;  1L0O C;  3TO6 A;  4XLP F;  1CF7 A;  1B59 A;  2O03 A;  3K1M A;  5CVJ A;  2QBY A;  5E1Z B;  4AIJ A;  4U7D A;  2ESN A;  3FWE A;  1O7L A;  4HLX A;  1XMK A;  6PAX A;  4G94 A;  1ZLJ A;  5LBQ A;  1YQA A;  1U78 A;  1PP8 F;  2WC2 A;  3TKY A;  2V1D A;  3CUQ A;  3R0J A;  1FP1 D;  5F6F A;  3F6V A;  1ZGA A;  1BIA A;  2XAJ A;  1TTY A;  3PQJ A;  1QZZ A;  2BGC A;  2Y48 A;  4HW0 A;  5D6E A;  2A68 F;  4IHT A;  1KYZ A;  4XSZ F;  2OQR A;  2HYG D;  1ONV A;  5LHI A;  2IA2 A;  4D0P A;  3E6D A;  4Q48 A;  3WG9 A;  1I27 A;  1AWC A;  5K5R A;  1QO0 D;  1MDM A;  3V7R A;  4CZZ A;  2X4H A;  2F5F A;  1ZG5 A;  4P5O A;  2A6E F;  1Z7U A;  2RNJ A;  5ICC A;  3KP3 A;  1JE8 A;  1ZAO A;  1K79 A;  3WTT C;  4I2O A;  5CLS A;  1P4X A;  3KLO A;  4G7H F;  5ICG A;  4M72 A;  3GXO A;  3AAF A;  1FP2 A;  1IRF A;  4FT8 A;  1LEB A;  2HZT A;  4CIC A;  4LLL A;  4Y13 A;  4RS8 A;  5CYV A;  3FHZ A;  5HS7 A;  1XSX A;  1SMT A;  1UB9 A;  5LRS A;  1YG2 A;  1T2K A;  4ZYH A;  3O2P E;  4BNC A;  1G3W A;  1P4W A;  3GEZ A;  5E18 F;  1F5T A;  3EDP A;  1KU3 A;  4PGG A;  5HOO A;  4DQ2 A;  3GFL A;  1EH8 A;  5L3C A;  3V8L A;  2ACJ A;  3R61 A;  4KYW A;  2XAQ A;  4IF4 A;  3ELK A;  2IT0 A;  1O3R A;  3GZ5 A;  2VN2 A;  5LGT A;  3ZMV A;  1WQ2 A;  5A2Q K;  3DEU A;  1T98 A;  2W25 A;  4Y17 A;  2QYO A;  1MZB A;  2NNN A;  3GFM A;  3I53 A;  4U88 A;  1D5V A;  2VT2 A;  2P6S A;  1IN4 A;  3MCZ A;  4R79 A;  3I54 A;  2K86 A;  1P2F A;  1ULY A;  4OIP F;  1UST A;  3KFW X;  2P5L C;  3KET A;  2HDC A;  4AD9 A;  4E70 A;  4UHT A;  5ILS A;  1ZG1 A;  4EM0 B;  2KKO A;  2XAS A;  4ASN A;  2ZNY A;  2NAZ A;  1TNT A;  1XGO A;  4I02 A;  4BHB A;  4HZF A;  2EA4 A;  1UHW A;  1U6G A;  5FD6 A;  4MHG A;  1NHA A;  3LAP A;  5HDK A;  2L4M A;  1TW3 A;  5E1X A;  2O0Y A;  5AON A;  3TOB A;  1RUN A;  1S29 A;  1QPM A;  4I98 B;  1H9T A;  5ERI A;  2J5O A;  4EV0 A;  2MLG A;  1H9G A;  3CJN A;  1WI9 A;  4R1H A;  4U0V A;  4KT5 C;  2DQR A;  1J7K A;  3R0A A;  1FNN A;  3FM3 A;  4EQQ A;  1CGP A;  3F8F A;  2YSR A;  4M71 A;  1S8N A;  3F3X A;  4O6J A;  3V8K A;  1Z6T A;  4HQM A;  1VTN C;  3ULQ B;  4CXF A;  1UCR A;  2DI3 A;  2QLZ A;  5J8C A;  2FSW A;  3FMS A;  1D8K A;  5FLX K;  1P4A A;  1O3T A;  2FBK A;  1JGS A;  2ZJ2 A;  1OYI A;  3W6J B;  1R1V A;  2GWR A;  2QUF A;  1B9N A;  2IW5 A;  2R7D A;  3QOP A;  3FXQ A;  3DFG A;  2XAG A;  3BZ6 A;  1C0W A;  3HYI A;  2EJR A;  3KZZ A;  4HX4 A;  2H94 A;  4L5J A;  3M8E A;  5BPD A;  4EJT A;  2XKP A;  3I0T A;  2L54 A;  4MGR A;  4L0Z B;  4A5N A;  1YW9 A;  2E1C A;  2K4B A;  4WXH A;  5D5W B;  3FMQ A;  1K7A A;  3CO7 C;  2EFQ A;  4OIO F;  4OU0 A;  3P9I A;  3KP7 A;  1FC3 A;  2G7U A;  1T6S A;  1Z6R A;  4PZJ A;  2BV6 A;  1R58 A;  4L18 B;  5DD4 A;  1YW7 A;  1LJ9 A;  1R36 A;  4CDG A;  3HIF A;  4HQE A;  5L3E A;  4O3M A;  1J5Y A;  3BOQ A;  5E8I A;  4LMY A;  3RKW A;  1QBJ A;  3RKY A;  2EV0 A;  2PJP A;  2CG4 A;  4YFN F;  1RI7 A;  1BI2 A;  2OBP A;  3TDZ C;  1SFU A;  3K69 A;  1MGT A;  5JVT A;  1J59 A;  4WX9 A;  2H27 A;  4YG2 F;  4L9V A;  3E6B A;  1ZG3 A;  3IKT A;  4G7Z F;  1WWX A;  2XV4 S;  4A12 A;  4N9I A;  3ZP5 A;  3FXR A;  4B8X A;  4OIQ F;  3P9K A;  4MQV A;  1MDM B;  3V7S A;  2P6T A;  5FGM A;  3SZT A;  2LSO A;  5HLG A;  1ZYR F;  2GIV A;  1TW2 A;  4GGG A;  2MA3 A;  4NB5 A;  2JT1 A;  4L9J A;  3LFK A;  2FQ3 A;  1MKM A;  3COA C;  4UUV A;  1ZLK A;  5A2Q Z;  1U2W A;  3PQK A;  3CUO A;  4F7Z A;  2EA2 A;  5ED4 A;  2ADU A;  4A6D A;  1A04 A;  1V4R A;  5BOX A;  3ERE D;  2P5V A;  2QVO A;  5AIP A;  4IPA A;  4BYY A;  4MNU A;  2UWM A;  3K0L A;  2HYF A;  1KQ9 A;  1FBQ A;  4EM2 A;  2QBY B;  1ZRE A;  1KA8 A;  1FLI A;  2L4A A;  2QM3 A;  5FFZ A;  3D5L A;  5D5U B;  1FT9 A;  4A0X A;  4A0Y A;  3WTS C;  2KIM A;  1XSD A;  3HRU A;  3FZV A;  4G9Y A;  1BJA A;  3HRT A;  2YU3 A;  2PMU A;  1AOY A;  2UXN A;  5CVU A;  3P9C A;  4OIR F;  1Z9C A;  5CVR A;  3JTH A;  3RKX A;  1STZ A;  3ROU A;  1DP7 P;  1XDU A;  4RGU A;  2RDP A;  2VOD A;  2A6H F;  2QZ8 A;  1O7F A;  3LWF A;  5E17 F;  1B4A A;  2DU9 A;  2A69 F;  1LVA A;  4HAM A;  5IT9 Z;  1MJB A;  2G9W A;  5AIQ A;  4LLG F;  1QNT A;  2KJB A;  3RI4 A;  3J80 Z;  3RPQ A;  3M1E A;  5HLH A;  3V7C A;  1T0F A;  2OZ6 A;  2VBW A;  2BYV E;  3M8F A;  2WWY A;  3MFK A;  2STW A;  2O3F A;  2V9V A;  2VON A;  4O5V A;  4U0W A;  2VOP A;  2Q2E A;  5CVV A;  5EEG A;  1SD4 A;  2Y75 A;  2Z9O A;  5J6X A;  3BP8 A;  1JHF A;  2OU2 A;  4FX0 A;  4UNO A;  1IAW A;  3E5U A;  4ETS A;  2EV6 A;  4ZYE A;  3MAJ A;  3T5X A;  1FSH A;  5D5V B;  4PDK A;  4EGZ A;  2WV0 A;  2PLY A;  2XVC A;  3SHF A;  2DTR A;  2CSO A;  3I4P A;  3O3K A;  3FMR A;  3CUQ B;  4HA8 A;  2Z33 A;  1IXS B;  4JQF A;  1LDD A;  3WU1 B;  4PGH A;  3T1B A;  1U5T C;  2IP2 A;  4OOI A;  1E2X A;  3S2W A;  2RKH A;  3ZMU A;  4ZH4 F;  1K78 B;  4KN7 X;  1BI1 A;  3QP6 A;  1JHH A;  5JHU A;  3F72 A;  3G73 A;  3BJO A;  2LNB A;  3WU0 A;  5H20 A;  1CF7 B;  3IWF A;  4JBA A;  3IC7 A;  4AIK A;  3WOD F;  4EGY A;  4BXU A;  5ILV A;  4MEY F;  1HW5 A;  2NNY A;  5H6Q A;  4Q47 A;  1WKM A;  1U3E M;  4WK8 F;  4GXO A;  4HX8 A;  3I71 A;  5LEJ A;  1G3Y A;  3HSR A;  3LQQ A;  2STT A;  3BY6 A;  3C1D A;  3O6B B;  1RIO H;  4QWQ A;  5K1Y A;  2DLL A;  2A5Y B;  2FE3 A;  4L9N A;  3REO A;  1IXC A;  3VOD A;  4OIN F;  3ABT A;  1U5T B;  1BC8 C;  1REP C;  3E97 A;  1DDN A;  4EJO A;  4TV7 A;  2HFH A;  5DUI A;  3JAM K;  4ENN A;  4GYI A;  2V1X A;  4XRF A;  1J9I A;  2ZME A;  4GCV A;  4KMF A;  2FOK A;  2VBZ A;  4A5M A;  5DYM A;  4LB6 B;  1XCV A;  4RAY A;  2GAU A;  3EUH A;  2NRA C;  2VC1 A;  3GZ6 A;  3TQN A;  1WSU A;  2CFX A;  2F2E A;  1DPR A;  1KU2 A;  1HKT A;  2FBI A;  1IN8 A;  4G8X A;  1BC7 C;  2XIG A;  3GF2 A;  3Q9S A;  3U9G A;  4XSX F;  2VT3 A;  3FF5 A;  4YII A;  4ESB A;  4LD5 A;  2O6G E;  1UFM A;  2CWE A;  2HTS A;  3GVA A;  1H0M A;  2KJC A;  3IWZ A;  3BRO A;  2H6B A;  1FBS A;  1W7P B;  1R5G A;  1R7J A;  3MWM A;  3LA7 A;  4P96 A;  3QAH A;  3F8B A;  3I59 A;  2ZKZ A;  5ICF A;  3JAM Z;  3DPT A;  2PEX A;  3N4M A;  3ZMZ A;  2A3S A;  4U7B A;  2Z5U A;  3JSP A;  2IA1 A;  1PUE E;  1EH6 A;  3ZQ7 A;  1PP7 U;  4RAZ A;  3K2Z A;  1XMA A;  3KZY A;  5IT9 K;  4AVP A;  3F23 A;  3ECO A;  2HR3 A;  4RGX A;  2IJL A;  1HXD A;  2O8X A;  1S7A A;  3GYH X;  3HHH A;  1BOA A;  1G6N A;  2PQ8 A;  1OKR A;  4OMZ A;  4LG0 A;  4EVI A;  3WE2 A;  3RDI A;  3WTU C;  4L0Y B;  1X3U A;  2ZFW A;  1HKQ A;  1OR7 A;  3KE2 A;  3OOP A;  1ZRD A;  3R4K A;  1T39 A;  4YIF A;  3BJA A;  2CYY A;  4DNC A;  4ENK A;  2D1V A;  1S6L A;  3GUD A;  1XB4 A;  3KP4 A;  1K6O A;  1IXR C;  2M87 A;  3K9T A;  2FF4 A;  3LAJ A;  3BJ6 A;  3G3Z A;  3DV8 A;  3L09 A;  1LNW A;  2JZY A;  2PBI A;  3LA2 A;  2FEZ A;  2MLK A;  4HLY A;  2OD5 A;  1XGN A;  4WXC A;  1FY7 A;  3DXJ F;  2IVM A;  3GLX A;  1O3Q A;  2LDU A;  3ZMS A;  3HRS A;  3E3V A;  3DPL C;  2GA1 A;  1LDK B;  4A2U A;  1B1B A;  3TOA A;  4A0Z A;  1JXS A;  1I5Z A;  2DT5 A;  1GXQ A;  2KRF A;  1KQ0 A;  1TQI A;  4LK1 F;  1IN5 A;  2J5P A;  4IXA A;  4L9T A;  1W7P D;  2EK5 A;  2YPR A;  3ZPL A;  5BQT A;  1XD7 A;  4ZZL A;  5LRR A;  2XRN A;  2RQP A;  2PG4 A;  3M9A A;  3HTU A;  2A07 F;  2UXX A;  2HTJ A;  3I58 A;  4XLN F;  3I5U A;  1SMY F;  1ZN2 A;  2BE5 F;  2ISZ A;  3QPH A;  1TNS A;  5D5X B;  2VE8 A;  3V4G A;  3E6M A;  3D0S A;  2IA0 A;  3KP5 A;  1I1G A;  5LLQ A;  1BM9 A;  2QWW A;  2YX4 A;  2ZCW A;  1LDJ A;  2HWV A; 
#chains in the Genus database with same CATH topology
 1KON A;  2EWN A;  4J01 A;  5F0H A;  5C4J J;  4B3X A;  2ECB A;  5DEQ A;  1GUU A;  2O7O A;  3EYY A;  1GVJ A;  2Q1Z B;  2W82 A;  5LHH A;  3GO5 A;  2E1N A;  1R1T A;  3G1O A;  5EEA A;  5K5O A;  3ZN1 A;  2BHY A;  2DA5 A;  2ETH A;  2X1C A;  2GA2 A;  2CH0 A;  4B1R A;  2YX7 A;  2D2W A;  3GFI A;  1ERD A;  3FXM A;  4WF2 A;  5DDG A;  3ZMD A;  1A6I A;  3S2H J;  5IT3 A;  2BEO A;  1WI3 A;  1NG6 A;  2FUG 2;  1V3F A;  2HEO A;  5K5Q A;  3Q5F A;  1I6X A;  1MBK A;  1FZP B;  4IJA A;  2FNP A;  1F4K A;  3Q3S A;  3FM5 A;  2EPF A;  5DM7 F;  4II2 A;  1TWH J;  3Q9V A;  3HUG B;  2Q8K A;  2ICW G;  2GOX B;  4LFU A;  4BL0 B;  1VQ5 I;  3TO7 A;  5EGO A;  2CQN A;  4N9H A;  4G7O F;  3H0G J;  1ETY A;  2IRF G;  1VQM I;  4IKF A;  1Z05 A;  3OYK A;  3F0C A;  1BIB A;  3P7N A;  4JOM A;  4BXF A;  3H3Z A;  3BLY A;  4RB2 C;  2GQQ A;  5D4R A;  1J2X A;  2JWT A;  4A3K J;  4RB3 C;  1DGW Y;  3HKZ N;  5FJ8 J;  3CCS I;  2DDB A;  4P9F A;  1MMG A;  4CCM A;  2CUF A;  1HST A;  5FD5 A;  3EUA A;  4B3A A;  2GZW A;  1D3Y A;  5BPI A;  4GRI A;  2NVY J;  3A4C A;  5JHF A;  3GZN B;  4ESF A;  1N25 A;  2L02 A;  2WAQ N;  2DPU A;  5HVQ C;  1N75 A;  3CME I;  3GX4 X;  3ZQI A;  3J7Z I;  2AO9 A;  2HPM A;  3TDU C;  3LSH A;  3S3M A;  4LJZ F;  2DAO A;  2OTJ I;  2DA2 A;  3VOE A;  2VKD A;  3SYT A;  2FXA A;  5B1A H;  1RES A;  3GW2 A;  1BN5 A;  2JPC A;  2HOE A;  2JUC A;  2KHM A;  3OV8 A;  2O61 A;  1JJ6 C;  5DTD A;  3ABM H;  3IV5 A;  1J0R A;  2O8K A;  5FLX Z;  3OYL A;  3QU3 A;  2H8R A;  4Q4Z F;  2DO7 A;  2X85 A;  4EJW A;  1BA5 A;  3KZI C;  4I7H A;  1JKP C;  3K4J A;  1POG A;  1KZH A;  1SD7 A;  2OCC H;  3QYE A;  1MIJ A;  1R5H A;  1RUO A;  2VBY A;  2OZU A;  2R7W A;  2M3A A;  1BL0 A;  4I0B A;  3SFZ A;  1U9O A;  3NEU A;  5DCM A;  1BBY A;  2IBD A;  3JTG A;  2XAH A;  1U9N A;  3KEO A;  1WHU A;  2Q0O A;  4GYG A;  3C18 A;  4E7L A;  5DM6 F;  2M45 A;  4X1E A;  3CQZ J;  5GTH C;  1T8I A;  2LTP A;  2RQQ A;  2LRD A;  1MD0 A;  3UR3 C;  5LD2 C;  4XKC A;  4M9X A;  3W6K B;  2K27 A;  1KQ8 A;  1SFE A;  1E17 A;  1MH4 A;  3BCB A;  1OR7 C;  2V6C A;  2XRO A;  1SFX A;  2FD5 A;  2R7O A;  4RAG A;  4LB5 A;  3SFI A;  4UV9 A;  2X0L A;  1HDD C;  3I64 A;  3HZJ A;  4QLC U;  5F64 A;  4B09 A;  1BJZ A;  5D6F A;  2XKO A;  4BQA A;  3BWG A;  5H6R A;  2L01 A;  3HKZ A;  4ZYG A;  2COB A;  5HOD A;  2E7W A;  3L2V A;  2KDO A;  3OL4 A;  1IF1 A;  1YYV A;  5FRO A;  2K9L A;  3VB2 A;  2QKL B;  5FB2 A;  2L7Z A;  4UVC A;  1LB2 A;  3DCF A;  3TED A;  2M5W A;  4EAT A;  4ESJ A;  4MQ9 F;  4HF0 A;  1SFK A;  4M6X A;  4CYC A;  2X9D A;  2P4W A;  3CLO A;  2XUB A;  1PVE A;  3SXY A;  5LHG A;  1FYL A;  2ZC2 A;  4M6Y A;  1B6A A;  1YLF A;  2Y69 H;  4FHT A;  1YS7 A;  2FJ1 A;  2L2O A;  3MZY A;  2XAF A;  1U8R A;  2Z99 A;  1DU6 A;  3TBI A;  1KU7 A;  1F43 A;  3HXL A;  3ESW B;  1YOV B;  3HTS B;  2L3D A;  1JTY A;  3ZN0 A;  3GFJ A;  2M8E A;  3WE3 A;  4KIT B;  3BDD A;  4W1U A;  3H9G A;  3CO6 C;  3K4B A;  3SEZ A;  5B66 C;  2EB7 A;  3S93 A;  4IVN A;  5GAD J;  4RGR A;  1KYW A;  1SVL A;  2JSC A;  5KCM A;  2CQ7 A;  2NS0 A;  4LOC A;  1MJA A;  3WGI A;  2CFO A;  2HYJ A;  2RN7 A;  1XDS A;  5EYR A;  3NRV A;  3E1S A;  2JA2 A;  2ISY A;  2CMP A;  4XLH A;  2L9R A;  2VXD A;  3K1P A;  4ON0 A;  1GXP A;  3QPL A;  3FXL A;  4HOB A;  1UG2 A;  2BZT A;  5KNL A;  3K6G A;  3U1D A;  4N0B A;  1NH3 A;  5L3F A;  1SD6 A;  3E5Q A;  3FXU A;  3KYC B;  3RSN A;  3R60 A;  4KNY A;  2BBY A;  2EV5 A;  3VEP A;  3RIR A;  4UUT A;  5LEK A;  4N4N B;  4FE4 A;  1HSJ A;  3IH3 A;  4HYE A;  5F08 A;  2A5W A;  1EF4 A;  4BQO A;  1ZRC A;  4QPO A;  2F4O B;  3LQR A;  5TRD A;  5E1W A;  2P5K A;  1E0E A;  1XSV A;  2HGC A;  5C4X J;  3AG2 H;  4CCN A;  2F4M B;  5L3D A;  5CJ9 A;  2P0W A;  2PMH A;  3RYP A;  1DUX C;  3ONQ A;  4ANJ A;  4E4H A;  5EDN A;  2ZSH B;  1HBX G;  1QGP A;  1IN7 A;  2FMY A;  1IRG A;  1VQP I;  2CW0 F;  3J81 K;  3DQV C;  1T56 A;  4I01 A;  1TWA J;  3K4K A;  2RNG A;  3HRM A;  4S04 A;  1DQU A;  3L00 A;  4C30 A;  4HX7 A;  3ZQF A;  3ZMT A;  2IPQ X;  2HKX A;  2KIU A;  3H92 A;  1W5T A;  1FOK A;  4HDU A;  1A6Q A;  3LSP A;  4YFK F;  3H5A A;  5HNH A;  5IP7 J;  1JKQ C;  2FA5 A;  4JX4 A;  2LKP A;  2VQH A;  3BR2 A;  4BJ5 C;  4A3J J;  3ZGK A;  4DZJ A;  3A01 B;  1ON1 A;  3X2Q H;  3JRI A;  3IKV A;  2ZJR F;  3W3C A;  2RVC A;  2H6C A;  1RET A;  3KLN A;  2RC4 A;  4MO7 A;  4ZTF A;  4I76 A;  3BPV A;  3FIS A;  5L3G A;  3LMM A;  1TLH B;  1K61 A;  1D1C A;  2V9P A;  4BHC A;  4U0Y A;  3BPX A;  2C6Y A;  2QQA A;  4KIF A;  2GXB A;  2L9N A;  2CUJ A;  4M9Z A;  4DOZ A;  1F1Z A;  3CF2 A;  2P8T A;  3KP2 A;  1KU9 A;  3F8M A;  4HF2 A;  3FDY A;  1VQ8 I;  1F9N A;  3BCA A;  2V1N A;  2EFO A;  3HUG A;  1ZH5 A;  1SAX A;  4UVB A;  2ZME B;  1Z77 A;  2DA7 A;  5IOZ A;  3OYA A;  4IZZ A;  1X1P A;  1LKX A;  2DW4 A;  3W2W A;  2R93 J;  3WTV C;  3TW7 A;  3DP7 A;  4PFO A;  3HPG A;  3BG5 A;  2R7F A;  3BZK A;  1YIO A;  2VB6 A;  4AID A;  5M3M J;  3MZH A;  1TC3 C;  1LE8 B;  2X51 A;  4ENM A;  2BOL A;  2MC3 A;  2HXO A;  1JUM A;  2LP0 A;  2R3S A;  4KN4 X;  4KDP A;  1V5F A;  1KGS A;  5LGN A;  4A6E A;  4CO8 A;  2ZXW H;  2E7X A;  2G7H A;  1V54 H;  4P9U A;  1JT0 A;  3K1N A;  1VQO I;  1QQI A;  4E7H A;  4GDF A;  2PN6 A;  4IHS A;  4KIB A;  2VE9 A;  1G3T A;  2L9V A;  4MLO A;  1YX5 A;  1USS A;  2FX0 A;  2K3P A;  4PJ0 C;  2HS5 A;  5GAG J;  2DMT A;  4YEL A;  5E3N A;  4IRI A;  1FWZ A;  3QU6 A;  2AS5 F;  1RR8 C;  2Z2S B;  2BY1 A;  4NBQ A;  2Y0M A;  4CHU A;  2RGV A;  3F8C A;  3HSE A;  1TBX A;  3IRR A;  4B4C A;  4BU2 A;  3S1Q J;  2BVL A;  1XTA A;  3V8J A;  2ZXJ A;  5D4S A;  5IYD J;  1B9M A;  3DF8 A;  5F1R A;  3E5X A;  3WTW C;  4NHJ A;  4I0A A;  1FJL A;  3HHG A;  3MKW B;  4IQJ A;  2M1B A;  1TQP A;  2HKO A;  3N97 A;  3U2R A;  2V9K A;  5KAI C;  1X3W B;  3B73 A;  4HV6 A;  3R6S A;  4ZZD A;  3CCE I;  1Q1H A;  1ZK8 A;  2A61 A;  4EM1 A;  4I6Z A;  2OA4 A;  4A3I J;  1EV7 A;  2ZME C;  3KCC A;  4Z2Y A;  4HDV A;  4M9S A;  2DK5 A;  2RV8 A;  3L7W A;  3H5R A;  2Z3Y A;  1ORK A;  4IRH A;  2WA0 A;  3A0B C;  4EMS A;  2KZV A;  4IQ4 A;  4B44 A;  2E1O A;  5DCM B;  5FFX A;  4HBL A;  4UXN A;  1XC5 A;  4BAY A;  4XLF A;  5BMZ A;  3SZP A;  1IC8 A;  3AFH A;  3HOV J;  4GO1 A;  5FO5 A;  3J81 Z;  3LA3 A;  3F21 A;  2W7N A;  1ZAR A;  2DMQ A;  2M0C A;  2XAU A;  1QHH D;  1YW8 A;  1HW1 A;  4D5C A;  1AA7 A;  9ANT A;  3HOZ J;  1LFP A;  4PK4 A;  3PNV A;  2MBF A;  4NC7 A;  5JR3 A;  1ZR2 A;  2GLO A;  2PI0 A;  3FHN A;  2JTV A;  1D8J A;  3CUQ C;  3CP2 A;  1X1A A;  3HGG A;  3I59 B;  3ZOB A;  4HF1 A;  3DKW A;  1VQ9 I;  1Z0X A;  5KVR A;  3HOT A;  4P55 A;  2JA6 J;  3CP8 A;  2FBH A;  1ZHF A;  4XNF A;  3C3W A;  3B02 A;  1W7P A;  2OQG A;  2FRH A;  2ELJ A;  3MQ0 A;  5C3E J;  4BH9 A;  1XMX A;  1ETO A;  2IS2 A;  2GXA A;  5D8L B;  5FKN A;  5ICE A;  3M7G A;  4KIG A;  3PIO F;  1IG7 A;  4XLC A;  2FQ4 A;  3F22 A;  2KRH A;  5FRN A;  5GPA A;  2P7V B;  2XF7 A;  4HV5 A;  4LLN A;  2ZXH A;  2ECC A;  2Y0S A;  1MMA A;  2GXG A;  2H09 A;  1IJW C;  5J1Y A;  2EZI A;  2JPB A;  3OOU A;  3RJP A;  2LY9 A;  1R1U A;  3J7A O;  1IW7 F;  3SDG A;  2XGX A;  4C9Y A;  2EFP A;  2CS3 A;  2OCE A;  1HW2 A;  1IGN A;  2HVR A;  1XCB A;  2K02 A;  1OPC A;  3QRF F;  1TZL A;  1A36 A;  2XSJ C;  3CCQ I;  4L5E A;  4RBO A;  4KUM A;  4L5I A;  3OYH A;  1ZKG A;  1W4M A;  2IEK A;  5EGO B;  1W1W E;  5EJC A;  3HOW J;  3RYR A;  5CVI A;  3CCM I;  1PDN C;  3KEQ A;  4KA4 A;  4KT6 A;  4RM2 A;  3QPS A;  5EEH A;  3AL0 B;  5HS8 A;  4R8H A;  1R71 A;  5FKO A;  1EKE A;  3JSO A;  2E35 A;  4M73 A;  4RB0 A;  2CGP A;  4ZDL A;  5FLV A;  5ILU A;  1XGM A;  1RZ4 A;  4LK0 F;  2LF7 A;  2MGQ A;  3SQN A;  1DGR M;  5IOY A;  3JR9 A;  5M3F J;  1VQN I;  2QSF X;  1P7J A;  2VPL A;  1G3S A;  2X6X A;  4KMU X;  2V6E A;  4G6Q A;  4XON A;  3BR1 A;  3OSG A;  4ZC3 A;  5HDG A;  3Q0U A;  3HOS A;  5DD8 A;  1UG0 A;  3L9F A;  2B9S A;  2LBF B;  2PFB A;  4FET A;  1YHQ I;  1Z67 A;  2HVS A;  2CW8 A;  3WGH A;  4WCG A;  3WTX C;  1R6R A;  2WTE A;  3LL7 A;  2LFB A;  2IGO A;  2ZO4 A;  1I39 A;  4CYD A;  3OY9 A;  1MBH A;  2Y0S N;  3HSF A;  2QQB A;  1Z91 A;  1X3Z B;  4OMY A;  1BI3 A;  2W4S A;  2HQN A;  2DOF A;  1EJ9 A;  3ABL H;  4S05 A;  3DU5 A;  2KL4 A;  2DYS H;  5JI6 A;  2QQ9 A;  2HDW A;  2Z16 A;  3PL8 A;  3RTR A;  3KYD B;  1IN6 A;  2M30 A;  1L3L A;  3F9K A;  3Q0V A;  3IRQ A;  1O57 A;  4XID A;  2GM4 A;  3L2C A;  4ENJ A;  3TGN A;  3T0Y A;  2CV2 A;  2V7F A;  3TP3 A;  4XRM A;  1T38 A;  1S7E A;  4BEH B;  1D0X A;  2H1L A;  3LOC A;  1GVD A;  2ZNZ A;  3BG3 A;  5K7F A;  4BDY A;  3EYI A;  2CQK A;  3IL2 A;  3L1P A;  3DTK A;  4BHP A;  2CUZ A;  1IUY A;  2Z1D A;  2ESH A;  2HDD A;  2DBB A;  4RGS A;  4BY7 J;  2DA4 A;  2EIM H;  2DK8 A;  2LF8 A;  2FNA A;  4D9J A;  4UY8 I;  4EJV A;  2EFW A;  4PSW A;  2F5E A;  2V26 A;  1S7O A;  1OCT C;  1ZQ3 P;  1ITY A;  1K4T A;  1B8I A;  2XGD A;  2HNH A;  4HNT A;  1LEA A;  1Z21 A;  3M8J A;  3CDH A;  2W57 A;  3K4C A;  2OAZ A;  2CQX A;  2EZK A;  3LST A;  1GHC A;  4AWX B;  1R23 A;  4UVA A;  1B72 B;  3CC4 I;  2PJR B;  5FKL A;  1DPU A;  3H3V K;  2MH2 A;  2WAQ A;  2D1H A;  1U8B A;  2FU4 A;  1IV6 A;  4G6D A;  1Y0U A;  4UV8 A;  2K9N A;  4MEX F;  2BY3 A;  3I55 I;  1I1S A;  1Z3X A;  3D5S C;  5DCF A;  5HLI A;  4FX4 A;  3K4N A;  3GWZ A;  3EET A;  2V79 A;  1W0U A;  1FBU A;  3LFU A;  2ZBK A;  2E60 A;  2QSH X;  3OYE A;  1J75 A;  1ON2 A;  4XN0 A;  2VXZ A;  2XHK A;  4A69 C;  1M1E B;  2NVX J;  5DV5 A;  1TQM A;  2M7B A;  3BG7 A;  4F92 B;  1U5T A;  5TJJ A;  3IH2 A;  3VFZ A;  2VQC A;  1SFO J;  3PUB A;  4D7M A;  4IL6 C;  3WGG A;  2WAF A;  2TRT A;  5KK1 A;  1H8A C;  1G2H A;  2AQF A;  2TDX A;  3ECH A;  1FX7 A;  3OWT A;  4YFX F;  3S1M J;  3DEW A;  2E2H J;  3FXK A;  3BZC A;  5J8F A;  1BI0 A;  1R00 A;  1BW6 A;  3ABU A;  4IOA F;  2W85 A;  1OMI A;  3GTL J;  4MFD A;  1W5S A;  1T95 A;  4PCQ A;  3WTY C;  3NQO A;  3T8T A;  5BS6 A;  3T8R A;  1GV2 A;  1ZGJ A;  4RB1 A;  3F8N A;  2V1U A;  2KDZ A;  3IAS 2;  2ME0 A;  1AKH B;  1YJN I;  1HKS A;  1FYM A;  1UHM A;  2QEN A;  5E8G A;  2VOO A;  4PJL A;  2QQ8 A;  2BXZ A;  3FBI B;  4WXD A;  5LFA A;  1EH7 A;  4XBF A;  2EFN A;  4CCK A;  2DFI A;  1MMS A;  2X1D A;  4LG0 B;  4A3B J;  4FE7 A;  3W6V A;  1IZ1 A;  4E6K G;  4C2U A;  1WZ2 A;  2EBI A;  4ZYD A;  1YFH A;  2K7L A;  4IRG A;  3H1C A;  1MBE A;  3MKY B;  2NVT J;  4HEA 2;  1YTY A;  1ZRF A;  2RRE A;  2VBX A;  2MFZ A;  4KFC A;  4PFP A;  4I09 A;  4NNJ A;  2COM A;  1ODD A;  2B7E A;  1K78 A;  1FYK A;  2R7S A;  2CV0 A;  2NYX A;  1XS9 A;  1YO5 C;  3G1M A;  2Y9Z A;  1W36 C;  1MJ9 A;  2O9L A;  1QZY A;  2CJJ A;  2LYC A;  1O3S A;  1WRJ A;  3HBL A;  3F6O A;  2L0K A;  1DU0 A;  4Y15 A;  1DP3 A;  3K10 A;  3GTO J;  2Y30 A;  5L3B A;  3JW4 A;  2D5V A;  3WHC A;  4UB8 C;  3QP5 A;  4HPQ A;  3MD2 A;  4RMN A;  4AU7 A;  1PUF B;  5D8K B;  1TT0 A;  3DKY A;  5GTI C;  1Z1D A;  3J80 K;  4II3 A;  1IO2 A;  2CO5 A;  2FML A;  4EJU A;  4MTD A;  3A1Y A;  2M0M A;  4M3D A;  5DUK A;  4NQW A;  3KYL A;  3OR2 C;  1OLT A;  1Y6I A;  1XGS A;  2LD5 A;  1QRY A;  2IGK A;  2LC2 A;  4AIH A;  5M5Y J;  2OF7 A;  1RNL A;  5TGT A;  1NK2 P;  3FX3 A;  4RLF A;  2AXL A;  1G4D A;  4Q5S F;  1SD5 A;  4YIR X;  5JFR A;  4FTH A;  2W00 A;  2W84 A;  1LVK A;  3EQL F;  3H9Q A;  2R7Z J;  5GP9 A;  1UMQ A;  2K4J A;  2Q2E B;  2JUG A;  4AYB A;  2HQR A;  2KIF A;  2N8G A;  2F5D A;  5HS9 A;  3ML6 A;  1QA6 A;  2L9S A;  3PJR A;  2R0Q C;  2MD5 A;  2VKH A;  3CMY A;  1LQ1 A;  1D0Z A;  2XF6 A;  4CGZ A;  2Y9Y A;  4DYR A;  5EG0 A;  1WVR A;  4MTE A;  4IHV A;  1BR2 A;  4YRV A;  1FSE A;  2DMN A;  2QA4 I;  2DXI A;  3HDD A;  2K5C A;  2UZK A;  2LOO A;  3VDX A;  2M34 A;  1OYY A;  2LMD A;  4KIC A;  3E6C C;  4DBR A;  2B0L A;  1S5L C;  1FIA A;  3TW6 A;  3FXJ A;  1IUF A;  3KP6 A;  2DPD A;  5LGU A;  2VIX A;  3RCO A;  3TO9 A;  4M74 A;  1FPQ A;  1S3J A;  2JRT A;  2W24 A;  3I3L A;  3WTZ A;  3C7J A;  5JLW A;  5E20 A;  2E71 A;  2F5C A;  4BUP A;  2BHZ A;  4WWC A;  1VQ6 I;  3GTP J;  1ZGW A;  5J3L A;  1JI8 A;  1P6R A;  3OMY A;  1IDZ A;  1Y8R B;  2MH9 A;  2DQL A;  1X1D A;  4BS9 A;  2ELH A;  2P7C B;  3ISP A;  5F0C A;  4UUS B;  2ZJQ F;  2D45 A;  1NK3 P;  3H3U A;  3CCY A;  3RPU A;  3PFI A;  1YX3 A;  4F3Q A;  3IHU A;  1T33 A;  1HQC A;  2YR2 A;  2EIN H;  2XDV A;  2DDA A;  4V2G A;  1ENH A;  1XN7 A;  1ZEL A;  5K7Z A;  1OCZ H;  1S72 I;  2CW7 A;  1R22 A;  2R7R A;  5IP6 A;  4K2E A;  2VC0 A;  3S3O A;  3BR6 A;  3CMA I;  3JRF A;  1E3H A;  2EZH A;  1YS6 A;  4XOR A;  1BOB A;  4H0E A;  5HDN A;  3VSK A;  2X6O A;  3OYJ A;  2DA6 A;  1P92 A;  4JK1 X;  3TP0 A;  2QSG X;  1OYW A;  4LGW A;  3OYN A;  2CU7 A;  3MEX A;  3QPT A;  4N4O B;  3CTA A;  2XRL A;  1L0O C;  1MW7 A;  3TO6 A;  2BXY A;  4XLP F;  2XSD C;  1CF7 A;  3AG3 H;  1ETX A;  3CDL A;  1B59 A;  4Y7N J;  2FOW A;  4NDL A;  2O03 A;  3K1M A;  4D5F A;  2OC6 A;  1J09 A;  5CVJ A;  4XLE A;  2DFF A;  1D1A A;  2QBY A;  4BBR J;  2G0E A;  4LG3 A;  5E1Z B;  4AIJ A;  2KPM A;  2R5Z B;  1X2M A;  4U7D A;  3CCU I;  2ESN A;  3FWE A;  1ETW A;  2L7F P;  3Q0W A;  1O7L A;  2I8D A;  4HLX A;  1XMK A;  2L7M P;  4KIS A;  2BW3 A;  6PAX A;  4G94 A;  1ZLJ A;  5LBQ A;  1YQA A;  5HNF A;  4LIT A;  1U78 A;  1PP8 F;  4XRS G;  3LSR A;  2WC2 A;  3TKY A;  2V1D A;  3CUQ A;  3R0J A;  1FP1 D;  5F6F A;  4A3C J;  3DBL B;  2WB1 A;  2WV1 A;  3F6V A;  3D1N I;  1MSE C;  3A0H C;  3MZ8 A;  3OYD A;  1ZGA A;  4D7N A;  1BIA A;  2NOJ B;  3DTI A;  2XAJ A;  1VQ4 I;  1TTY A;  3OSF A;  1Z7L A;  1NG7 A;  3PQJ A;  1QZZ A;  2BGC A;  2Y48 A;  4HW0 A;  5D6E A;  3HPH A;  3G71 I;  2A68 F;  4IHT A;  3CJQ B;  3ASO H;  4XN3 A;  3LSI A;  1KYZ A;  4XSZ F;  2OQR A;  3TMO A;  2R7U A;  2XB5 A;  2HYG D;  2K9M A;  1ONV A;  5LHI A;  4DYQ A;  2IA2 A;  1MSF C;  3ASN H;  4D0P A;  3E6D A;  4Q48 A;  3WG9 A;  2HI3 A;  3OYC A;  1I27 A;  1AWC A;  5K5R A;  2QKM B;  1ETQ A;  4QPQ A;  1QO0 D;  3S2D J;  4CCJ A;  1MDM A;  3V7R A;  2WBM A;  1RKW A;  2LVS A;  1JGG A;  4Z6Y A;  4FIS A;  2ME6 A;  4XLA A;  4PJJ A;  3U21 A;  4IHX A;  2DMP A;  4CZZ A;  2X4H A;  3KIO A;  2F5F A;  1ZG5 A;  4P5O A;  2A6E F;  1Z7U A;  4XKW A;  2ELK A;  2RNJ A;  5ICC A;  3KX2 A;  3KP3 A;  1JE8 A;  1ZAO A;  1K79 A;  4J00 A;  3WTT C;  4I2O A;  3S17 J;  5CLS A;  1P4X A;  3KLO A;  4BQQ A;  4OAZ A;  3S14 J;  1HA8 A;  4G7H F;  4C3J J;  5ICG A;  4M72 A;  3GXO A;  3ZRG A;  1TWC J;  3PNT A;  2IGN A;  3AAF A;  1FP2 A;  1IV8 A;  1IRF A;  2KT0 A;  5J4V A;  1WJC A;  2IAI A;  4BE2 A;  5E79 C;  3EUH C;  4FT8 A;  1LEB A;  4E7Z A;  5B3S H;  2HZT A;  4CIC A;  2B63 J;  3FKJ A;  4LLL A;  1YRN B;  3S1N J;  2VL8 A;  2NVQ J;  3VYR B;  4Y13 A;  4RS8 A;  5CYV A;  3PIP F;  3FHZ A;  1ETK A;  1T08 B;  2HU9 A;  5HS7 A;  1XSX A;  1SMT A;  4QTR A;  1UB9 A;  4XIC A;  5B5E C;  5LRS A;  1YG2 A;  1T2K A;  1OCC H;  4ZYH A;  3M07 A;  3W2V A;  3O2P E;  4BNC A;  1CQT A;  1G3W A;  1P4W A;  3GEZ A;  5E18 F;  1F5T A;  1K83 J;  4MFE A;  3EDP A;  3S15 J;  1G8X A;  5IYB J;  3C2G A;  1X4O A;  3M1C A;  1KU3 A;  4PGG A;  5HOO A;  2DFH A;  4DQ2 A;  1JJ8 C;  3HOY J;  2LK2 A;  3GFL A;  1EH8 A;  2M4K A;  5L3C A;  3V8L A;  2GIZ A;  4HG2 A;  3H36 A;  2JJ7 A;  2ACJ A;  2X1E A;  1HDP A;  5HLT A;  3R61 A;  4KYW A;  3OS1 A;  4DBQ A;  2XAQ A;  4DGW B;  4IF4 A;  3HEF A;  3ELK A;  2JK3 A;  2IT0 A;  4ZYA A;  1O3R A;  3GZ5 A;  2VN2 A;  5LGT A;  5IP9 J;  2ID6 A;  3ZMV A;  1WQ2 A;  4H4K C;  5A2Q K;  4BE0 A;  3DEU A;  1T98 A;  2W25 A;  2K85 A;  4Y17 A;  3H0D A;  4AUX A;  2YUS A;  2QYO A;  1YI2 I;  1A35 A;  1MZB A;  2NNN A;  3PUF A;  3GFM A;  3I53 A;  4DJA A;  4U88 A;  1D5V A;  2VT2 A;  2P6S A;  3HOU J;  1IN4 A;  4MIM A;  3MCZ A;  4R79 A;  3RZO J;  3I54 A;  2K86 A;  2JA7 J;  1P2F A;  1ULY A;  4OIP F;  1UST A;  3B6A A;  1MBG A;  4FCY A;  1XG1 A;  2PX9 A;  3KFW X;  3BC8 A;  4M3E A;  2P5L C;  2VQL A;  2NOG A;  2E36 A;  2R5Y A;  3KET A;  2HDC A;  2OV7 A;  1ACI A;  4AD9 A;  2ID3 A;  1X19 A;  4E70 A;  2IS4 A;  4UHT A;  5ILS A;  1ZG1 A;  4XR6 A;  4EM0 B;  3JRG A;  1YE9 A;  5EF6 A;  2KKO A;  4LIV A;  2XAS A;  1I6H J;  3O8G A;  3J7A Y;  4ASN A;  3GBG A;  1Y1V J;  2ZNY A;  1QVT A;  2NAZ A;  2EH3 A;  1TNT A;  1VZ0 A;  1XGO A;  4I02 A;  1QU3 A;  4BHB A;  4HZF A;  2EA4 A;  1UHW A;  4IEJ A;  1U6G A;  2JMW A;  5FD6 A;  4S0H B;  4RDU A;  4MHG A;  1NHA A;  4A3E J;  5J40 A;  3LAP A;  5HDK A;  2L4M A;  3OR1 C;  3BTJ A;  2QEX I;  1TW3 A;  4NUB A;  5E1X A;  2O0Y A;  1RKT A;  5AON A;  2VJ5 A;  3TOB A;  3JRC A;  3JRA A;  4RM3 A;  1RUN A;  1JTX A;  3G4S I;  1S29 A;  2XPV A;  3OIP A;  1QPM A;  4I98 B;  5H2F C;  1H9T A;  5ERI A;  2J5O A;  4EV0 A;  1MH3 A;  3ZQH A;  5IY5 H;  3L2Q A;  2MLG A;  1D0Y A;  1H9G A;  4M6V A;  3CJN A;  2M2E A;  1VQL I;  1WI9 A;  4R1H A;  4U0V A;  4KT5 C;  1BR1 A;  2DQR A;  2ZSI B;  1J7K A;  4XQF A;  3I4M J;  2KFD A;  2XPU A;  3OIQ A;  1SVO A;  3R0A A;  2R7X A;  2JQ7 A;  1FNN A;  3FM3 A;  2V4J C;  4EQQ A;  2UV1 A;  3F8F A;  1CGP A;  4X0G A;  2YSR A;  4M71 A;  3HC7 A;  1S8N A;  3F3X A;  4CZC A;  2KQR A;  3NAR A;  1IDY A;  4O6J A;  3V8K A;  4XOT A;  1W0T A;  1Z6T A;  4HQM A;  1VTN C;  3ULQ B;  4UUS A;  4FAS D;  1OCP A;  4CXF A;  1UCR A;  5M5X J;  2DI3 A;  2QLZ A;  1JUS A;  2DT6 A;  2AHQ A;  5J8C A;  1YRN A;  3E0J B;  3S8P A;  3K70 D;  1OFC X;  2FSW A;  3RZD J;  1VF9 A;  3FMS A;  3E7L A;  3H9J A;  1D8K A;  4C2M J;  5FLX K;  4IHW A;  1P4A A;  2Y2Z A;  1O3T A;  4I99 C;  2HQA A;  4BY1 J;  2FBK A;  1JGS A;  2ZJ2 A;  2VAS A;  3DTE A;  3NWS A;  1OYI A;  3W6J B;  1LUJ B;  1R1V A;  2GWR A;  2QUF A;  1B9N A;  3HM5 A;  3DPU A;  2IW5 A;  2R7D A;  3DBR B;  3CJT B;  3QOP A;  3FXQ A;  3DFG A;  2XAG A;  3BZ6 A;  1C0W A;  1SAN A;  4CSW A;  3HYI A;  4IX7 A;  2EJR A;  3PSI A;  2E19 A;  3KZZ A;  4HX4 A;  3OYF A;  2M7A A;  1WJF A;  2HOT A;  2DYR H;  4B48 A;  2H94 A;  4QSH A;  2E1M B;  4L5J A;  4UB6 C;  5EG0 B;  4CH7 A;  3QYB A;  3M8E A;  4A3F J;  5BPD A;  4EJT A;  3OYI A;  1WH7 A;  2K3F A;  2P81 A;  4JX5 A;  2K9Q A;  2XKP A;  3ZQL A;  3I0T A;  1YJW I;  1OCR H;  2L54 A;  2CUE A;  4MGR A;  1OCO H;  1WJA A;  4L0Z B;  2VKV A;  4A5N A;  2HOS A;  3ZQC A;  1MMN A;  3NWT A;  1YW9 A;  2KIQ A;  2E1C A;  2K4B A;  4WXH A;  3FK7 A;  4XK4 A;  5D5W B;  2DOE A;  3C2B A;  3FMQ A;  5C44 J;  3CC2 I;  4BQN A;  1K7A A;  1N78 A;  1RPW A;  4BE1 A;  3CO7 C;  2LY2 A;  1HC8 A;  2EFQ A;  3V42 A;  1U0J A;  4OU0 A;  3G6E I;  4OIO F;  2YU9 J;  2PMZ N;  3P9I A;  3KP7 A;  3WHB A;  4KJZ A;  2Y31 A;  1FC3 A;  3DBH B;  2G7U A;  1T6S A;  1Z6R A;  4E7S A;  3OS2 A;  5CPR B;  3PO3 J;  3BTC A;  4PZJ A;  2BV6 A;  1WCM J;  2BW3 B;  1R58 A;  1JUP A;  2EIK H;  4PJM A;  4L18 B;  5DD4 A;  1XPX A;  1OQY A;  1YW7 A;  1LJ9 A;  1R36 A;  4CDG A;  3HIF A;  4HQE A;  1SC7 A;  3BTI A;  5L3E A;  4O3M A;  4DIQ A;  1D1B A;  3CC7 I;  1RC9 A;  3O8H A;  4J19 A;  1J5Y A;  3BOQ A;  2LG4 A;  2OUM A;  2LR8 A;  5E8I A;  5KAF C;  2LKX A;  4M3B A;  3G2B A;  3BR3 A;  2TCT A;  3FIW A;  4LMY A;  3RKW A;  1QBJ A;  3RKY A;  2EV0 A;  5F04 A;  2PJP A;  1K6Y A;  5FKK A;  2CG4 A;  4YFN F;  1RI7 A;  2JN6 A;  2M9H A;  2WY8 Q;  1R5I D;  2DJI A;  1BI2 A;  1QZE A;  2OBP A;  3TDZ C;  1SFU A;  3K69 A;  2DMU A;  2ZFU A;  1MGT A;  5JVT A;  1J59 A;  4WX9 A;  2KMU A;  2H27 A;  2E1M C;  3OL3 A;  4ZDP A;  4YG2 F;  4L9V A;  3QOE A;  3E6B A;  1ZG3 A;  2A6T A;  2E5Z A;  3IKT A;  4G7Z F;  1WWX A;  2XV4 S;  3CD6 I;  2F48 A;  4A12 A;  1PYV A;  1WJD A;  4N9I A;  4CCO A;  1OIS A;  3FBN B;  2DJN A;  5EZG A;  4AYB N;  3FXR A;  3ZP5 A;  4B8X A;  5F27 A;  4OIQ F;  3S32 A;  3P9K A;  2W48 A;  4MQV A;  4A3D J;  1MDM B;  2DFE A;  4QIW N;  5F1J A;  3V7S A;  2P6T A;  5FGM A;  1T0F C;  2E2J J;  3SZT A;  1UZC A;  3OYM A;  1Y39 A;  4CCL A;  2LSO A;  2LKS A;  4G12 A;  5HLG A;  1E3O C;  3VYU B;  3CJR B;  2BVM A;  1ZYR F;  2GIV A;  1WJB A;  4JP0 A;  1TW2 A;  4E7J A;  5J4Y A;  4GGG A;  2MA3 A;  4M3F A;  2JT1 A;  4L9J A;  2PMZ A;  4NB5 A;  3TL4 X;  3LFK A;  2FQ3 A;  1MKM A;  3C2H A;  3COA C;  3HJE A;  1ZLK A;  5A2Q Z;  1U2W A;  4UUV A;  2VPR A;  3PQK A;  3ZR8 X;  3CUO A;  4F7Z A;  2MD0 A;  4IHY A;  3UKG A;  2EA2 A;  5ED4 A;  2ADU A;  4A6D A;  2O5R A;  5J47 A;  4XL9 A;  1A04 A;  1V4R A;  5BOX A;  2MC4 A;  2R4G A;  3ERE D;  2KRC A;  2P5V A;  2QVO A;  3WG7 H;  3CCL I;  5AIP A;  4IPA A;  1TWF J;  4FQG A;  4BYY A;  4BKX A;  2DOD A;  3IUO A;  4MNU A;  2UWM A;  3K0L A;  2HYF A;  2R5Y B;  1K4S A;  3CCJ I;  1Q1V A;  1VQ7 I;  1B8I B;  4ITV A;  1KQ9 A;  1XX5 A;  3I56 I;  2HXI A;  2R5Z A;  2I10 A;  2NS7 A;  1FBQ A;  4EM2 A;  2QBY B;  3JRB A;  4XKV A;  2QCO A;  1QVU A;  1ZRE A;  5F0F A;  1KA8 A;  3S1R J;  1N77 A;  1A31 A;  4W97 A;  1FLI A;  1VQK I;  2L4A A;  2QM3 A;  5FFZ A;  1H88 C;  4RLQ A;  2DT7 B;  2BY2 A;  3D5L A;  1ZTR A;  2WB1 N;  2QF7 A;  3ZQG A;  5D5U B;  4V2F A;  1TT5 B;  1FT9 A;  2AXT C;  1Y0N A;  2KZG A;  2XC7 A;  3QWL A;  4A0X A;  1W5C C;  4A0Y A;  4DZP A;  3WTS C;  2KIM A;  2MSY A;  3OIO A;  1XSD A;  3HRU A;  3JCU C;  2CQQ A;  2IS6 A;  4X6A J;  3L2R A;  3FZV A;  3BQY A;  3K70 C;  2M8G X;  4G9Y A;  4BDZ A;  1BJA A;  3HRT A;  2QGU A;  2YU3 A;  3J7Y J;  3DKX A;  1JKO C;  2ZXI A;  2PMU A;  1AOY A;  2HZD A;  5CKT A;  3PM1 A;  4HNU A;  2UXN A;  3GTQ J;  1VFC A;  2XGE A;  1UJ8 A;  3MMY B;  3P9C A;  5CVU A;  4OIR F;  3HOX J;  1Z9C A;  5CVR A;  2BY0 A;  5E3O A;  3JTH A;  2IGM A;  2OJE D;  2R92 J;  5B1B H;  3OS0 A;  4OWR B;  2XB0 X;  4V19 K;  3RKX A;  1X2N A;  1STZ A;  3ERM A;  3ROU A;  1DP7 P;  3M3Y J;  1XDU A;  4RGU A;  2RDP A;  2VOD A;  2A6H F;  2OTL I;  4NC6 A;  2QZ8 A;  3K2A A;  1WPK A;  2JRM A;  2EIJ H;  3CDI A;  3QYF A;  5FLM J;  1O7F A;  3LWF A;  1F36 A;  3CZ6 A;  1YIT I;  3RPU D;  2L7K A;  1B4A A;  5E17 F;  3LNQ A;  3B6C A;  1D5Y A;  1WJE A;  2DU9 A;  2A69 F;  1LVA A;  4HAM A;  5IT9 Z;  1MJB A;  3QOD A;  2G9W A;  2DTZ A;  1RR7 A;  5AIQ A;  1SEU A;  3JRH A;  4LLG F;  3SDB A;  4DW6 A;  1QNT A;  2KJB A;  3RI4 A;  2HVQ A;  3J80 Z;  5FRM A;  3RPQ A;  3BR0 A;  3M1E A;  5HLH A;  3V7C A;  4PJN A;  1T0F A;  2OZ6 A;  2VBW A;  5TIS C;  1P9Q C;  4IO9 F;  3GCM A;  2NXN B;  2LRE A;  2BYV E;  3M8F A;  4M3G A;  4B47 A;  3BT9 A;  2WWY A;  3MFK A;  2STW A;  2O3F A;  3PFY A;  2OPT A;  2V9V A;  5E3L A;  1FMV A;  4O5V A;  2VON A;  1VI0 A;  2DN0 A;  4U0W A;  1FIP A;  3AL0 C;  4C3H J;  2VOP A;  4ZDO A;  2Q2E A;  5CVV A;  5EEG A;  1SD4 A;  1W36 D;  2Y75 A;  3CCR I;  2Z9O A;  5J6X A;  3BP8 A;  1JHF A;  4XKB A;  2OU2 A;  4FX0 A;  4UNO A;  4BGD A;  1IAW A;  4XRS A;  3E5U A;  4ETS A;  2EV6 A;  1VND A;  4ZYE A;  3MAJ A;  3AG4 H;  2LH9 A;  2X6W A;  4NQW B;  1X58 A;  3T5X A;  2VJI A;  4HNV A;  1FSH A;  5D5V B;  4PDK A;  4EGZ A;  4C2T A;  2NVU B;  2WV0 A;  2PLY A;  5JLX A;  5KHD A;  2XVC A;  1G59 A;  3SHF A;  2DTR A;  2CSO A;  1PUF A;  3MKL A;  3EUK L;  3I4P A;  3O3K A;  3FMR A;  1TWG J;  4BBS J;  3CUQ B;  3PNY A;  4Y4R A;  4HA8 A;  2EZL A;  2Z33 A;  1MBF A;  1R9T J;  4OAY A;  1IXS B;  4JQF A;  1LDD A;  3NAU A;  1GV5 A;  2A05 A;  1A5J A;  3WU1 B;  4PGH A;  3T1B A;  1U5T C;  3AG1 H;  4ZJZ A;  2IP2 A;  3HGY A;  1UHS A;  4OOI A;  1V5E A;  1E2X A;  1S9H A;  2F6C A;  4F91 B;  3S2W A;  2RKH A;  3ZMU A;  4F52 A;  2L5Q A;  1IRX A;  4ZH4 F;  1GT0 C;  3OYG A;  1H89 C;  1K78 B;  4KN7 X;  1BI1 A;  1QPI A;  3QP6 A;  1JHH A;  5JHU A;  2ZJP F;  3F72 A;  3G73 A;  3BJO A;  2LNB A;  4NC8 A;  4F55 A;  3WU0 A;  5H20 A;  3KEY A;  1CF7 B;  2DOA A;  3IWF A;  4JBA A;  2XPW A;  1SVM A;  2JVG A;  3IC7 A;  4A3M J;  3BTL A;  4AIK A;  3WOD F;  4EGY A;  2VKE A;  4BXU A;  3HG9 A;  2I5U A;  3WU2 C;  1GDT A;  5ILV A;  4MEY F;  1HW5 A;  2NNY A;  1AKH A;  3I4N J;  5H6Q A;  4Q47 A;  1WKM A;  1U3E M;  1NTC A;  4WK8 F;  4GXO A;  4HX8 A;  2HQ5 A;  3I71 A;  5LEJ A;  1G3Y A;  3HSR A;  1AHD P;  3LQQ A;  2STT A;  4U87 A;  5GAE J;  2K40 A;  4ABZ A;  3BY6 A;  3C1D A;  2JVH A;  3L2U A;  3L2W A;  3O6B B;  4GFB A;  5CQE A;  2JA8 J;  2R7Q A;  3W2A A;  1RIO H;  4QWQ A;  1YIJ I;  5K1Y A;  2DLL A;  2A5Y B;  2FE3 A;  4L9N A;  3REO A;  1LFU P;  1IXC A;  1I3A A;  3UNG C;  4C3I J;  1MND A;  4HSR A;  2LY1 A;  3VOD A;  4E7I A;  2LBF A;  4OIN F;  4BXX J;  2AQE A;  2HPI A;  1Y1W J;  3ABT A;  5BNG A;  1U5T B;  3G1L A;  4XMY A;  1BC8 C;  1REP C;  1YJ9 I;  3E97 A;  1DDN A;  1MNE A;  2HOA A;  3BG6 A;  4Y3O A;  1JKR C;  4EJO A;  1IRZ A;  3FXO A;  4TV7 A;  1AU7 A;  2HFH A;  5J1R A;  3MN2 A;  5DUI A;  3JAM K;  3S16 J;  4ENN A;  2CV1 A;  4GYI A;  2V1X A;  4XRF A;  5K7H A;  1J9I A;  2GBY A;  2ZME A;  4LIU A;  4XOP A;  3VWB A;  4GCV A;  2E34 A;  4KMF A;  5FKM A;  2FOK A;  3RKQ A;  1JT6 A;  2VBZ A;  4A5M A;  5DYM A;  5DS9 A;  3ZCO A;  4LB6 B;  1XCV A;  4RAY A;  2GAU A;  3EUH A;  4E7K A;  1FTT A;  3GTM J;  2NRA C;  2X48 A;  2VC1 A;  3GZ6 A;  3A02 A;  3CF5 F;  3TQN A;  1B72 A;  1WSU A;  2CFX A;  2F2E A;  1DPR A;  1I3Q J;  4PSX A;  1KU2 A;  4ZTJ A;  1HKT A;  3BG9 A;  4AC0 A;  2FBI A;  1Y56 A;  1HF0 A;  1IN8 A;  4G8X A;  3HL2 A;  4BJT A;  2XIG A;  1BC7 C;  3GF2 A;  1BR4 A;  3Q9S A;  3U9G A;  4A93 J;  1X1C A;  3N05 A;  1X4P A;  4XSX F;  5IPA A;  2VT3 A;  3FF5 A;  4YII A;  4ESB A;  3GTK J;  4LD5 A;  3SZG A;  2O6G E;  1UFM A;  2CWE A;  2MG4 A;  4PUS A;  2JSP A;  2HTS A;  3D5R C;  3MKZ A;  2NS8 A;  3GVA A;  2EIL H;  3JRE A;  1H0M A;  2KJC A;  4B43 A;  4AVZ A;  1P7I A;  3H35 A;  3IWZ A;  3BRO A;  2H6B A;  3GTJ J;  1FBS A;  1WGX A;  2F4I A;  3ZQQ A;  5J1U A;  1W7P B;  2WY7 Q;  3K4M A;  3VSL A;  1R5G A;  1R7J A;  4CA0 A;  1TL8 A;  4BEH A;  3MWM A;  3LA7 A;  4P96 A;  3QAH A;  3F8B A;  4RAF A;  4A3L J;  1LPQ A;  2JA5 J;  2R7T A;  3I59 A;  2ZKZ A;  5ICF A;  3JAM Z;  3DPT A;  2PEX A;  3N4M A;  1MMD A;  2A3S A;  1FOY A;  3ZMZ A;  4U7B A;  2Z5U A;  4P1W A;  1WFX A;  3JSP A;  3VPR A;  3P5J A;  4F93 B;  2IA1 A;  1PUE E;  5CQG A;  1EH6 A;  3LSG A;  2XGC A;  3ZQ7 A;  2IXS A;  1FOX A;  1PP7 U;  3CES A;  4RAZ A;  3A2K A;  2VJJ A;  3K2Z A;  1XMA A;  3KZY A;  2KP6 A;  2H1K A;  5IT9 K;  1QHG A;  4AVP A;  3F23 A;  3ECO A;  2HR3 A;  4DYC A;  4RGX A;  2IJL A;  2EQR A;  1HXD A;  2O8X A;  1S7A A;  1R4M B;  2XF5 A;  3H5N A;  3HB9 A;  3GLL A;  3GYH X;  3HHH A;  4HST A;  2LLK A;  1BW5 A;  1BOA A;  4Y52 J;  5IYC J;  1G6N A;  2PQ8 A;  3IAM 2;  5JVG F;  1I50 J;  1OKR A;  2DA3 A;  4BAC A;  3VYT B;  4OMZ A;  2VUM J;  5EZH A;  1Y8Q B;  1WH5 A;  1FOW A;  1PJR A;  3CLQ A;  3VYS B;  4LG0 A;  4EVI A;  3WE2 A;  3AKZ A;  3RDI A;  4XM3 A;  3WTU C;  4L0Y B;  1X3U A;  2ZFW A;  3A03 A;  4JX6 A;  1HKQ A;  1OR7 A;  3KE2 A;  4HRI A;  3DLA A;  3OOP A;  3DWL E;  1ZRD A;  3MVP A;  3R4K A;  1T39 A;  4YIF A;  3LSJ A;  3BJA A;  2CYY A;  4DNC A;  3CCV I;  4ENK A;  1GLN A;  2D1V A;  5E3M A;  1S6L A;  3GUD A;  3PSF A;  1XB4 A;  3KP4 A;  1K6O A;  5GAH J;  1IXR C;  2VQG A;  2M87 A;  2UUZ A;  1FEX A;  3IH4 A;  1E3P A;  2IS1 A;  3K9T A;  2VLA A;  3FK6 A;  4YEJ A;  2FF4 A;  2GOM A;  3LAJ A;  3BJ6 A;  1WJ5 A;  3G3Z A;  3ABK H;  3DV8 A;  3L09 A;  1LNW A;  5M5W J;  2JZY A;  2PBI A;  3SJM A;  3RQI A;  3LA2 A;  2FEZ A;  2MLK A;  4CYC B;  4HLY A;  1O4X A;  2OD5 A;  1XGN A;  2W1O A;  1HLV A;  4WXC A;  1FY7 A;  3DU6 A;  3DLL F;  1LE8 A;  1R4N B;  3PO2 J;  1UAA A;  3DXJ F;  2WAD A;  2DCE A;  2KIS A;  4G6T B;  1OJL A;  1HOM A;  2IVM A;  3GLX A;  1FTZ A;  3FKI J;  1O3Q A;  3M4O J;  2K9S A;  1FMW A;  2LDU A;  3LSM A;  2M4G A;  1Z3Y A;  3CMM A;  2MYS A;  3ZMS A;  4EEF G;  1EA3 A;  2ZB9 A;  3HRS A;  3JRD A;  3KPH A;  3E3V A;  1UEL B;  3IP4 B;  3DPL C;  2GA1 A;  1ETV A;  3K7A J;  1HCR A;  4A3G J;  1LDK B;  1TP4 A;  2CRG A;  1R49 A;  2R7V A;  4A2U A;  1B1B A;  3OYB A;  1SAU A;  2VJ4 A;  3TOA A;  4D1Q A;  4IOC F;  1X1B A;  4A0Z A;  1JXS A;  1I5Z A;  2DT5 A;  4RA2 A;  2DA1 A;  2PJR A;  1GXQ A;  2KRF A;  3S3N A;  1KQ0 A;  1TQI A;  1LFB A;  4CUG A;  4LK1 F;  1IN5 A;  3GTG J;  2J5P A;  3ZXS A;  4IXA A;  4L9T A;  1W7P D;  2EK5 A;  2YPR A;  3I9V 2;  1ZR4 A;  3DEE A;  3GME A;  3ZPL A;  5GPC A;  2F5V A;  3RQ4 A;  5BQT A;  1XD7 A;  4ZZL A;  2E2I J;  2WAE A;  1V55 H;  4Y33 A;  2RAE A;  5LRR A;  2XRN A;  2RQP A;  3A01 A;  2PG4 A;  3U1K A;  3M9A A;  3HTU A;  2A07 F;  1RRJ A;  3SEQ A;  2UXX A;  3BR5 A;  4JYK A;  4BJ6 C;  2HTJ A;  3I58 A;  2E5N A;  4XLN F;  3I5U A;  1MBJ A;  1SMY F;  2YS9 A;  1APL C;  1ZN2 A;  2BE5 F;  2ISZ A;  3QPH A;  2KLO A;  2MAB A;  1TNS A;  5D5X B;  2VE8 A;  1V5G A;  3V4G A;  3EPZ A;  3E6M A;  3D0S A;  3K4L A;  2IA0 A;  2VI6 A;  2MW8 A;  3KP5 A;  1I1G A;  2X6Y A;  1MNM C;  5LLQ A;  1BM9 A;  2QWW A;  3LSK A;  2H8W A;  2YX4 A;  2ZCW A;  4AM3 A;  3QQA A;  1LDJ A;  3BQZ A;  2HWV A; 
#chains in the Genus database with same CATH homology
 2EWN A;  5DEQ A;  3EYY A;  1GVJ A;  5LHH A;  3GO5 A;  2E1N A;  1R1T A;  5K5O A;  3ZN1 A;  2ETH A;  2GA2 A;  2YX7 A;  2D2W A;  3GFI A;  5DDG A;  4WF2 A;  3ZMD A;  5IT3 A;  2BEO A;  1V3F A;  2HEO A;  5K5Q A;  3Q5F A;  1I6X A;  1FZP B;  4IJA A;  2FNP A;  1F4K A;  3FM5 A;  3Q9V A;  2Q8K A;  4LFU A;  3TO7 A;  4N9H A;  4G7O F;  2IRF G;  1Z05 A;  1BIB A;  3P7N A;  3H3Z A;  4RB2 C;  2GQQ A;  5D4R A;  1J2X A;  4RB3 C;  4P9F A;  1HST A;  5FD5 A;  2GZW A;  1D3Y A;  5BPI A;  4ESF A;  2L02 A;  2DPU A;  5HVQ C;  3GX4 X;  3TDU C;  4LJZ F;  2DAO A;  3VOE A;  2FXA A;  3GW2 A;  1BN5 A;  2JPC A;  2HOE A;  3OV8 A;  2O61 A;  1J0R A;  5FLX Z;  3QU3 A;  4Q4Z F;  2DO7 A;  4EJW A;  4I7H A;  1SD7 A;  1R5H A;  1RUO A;  2VBY A;  2OZU A;  4I0B A;  3SFZ A;  3NEU A;  5DCM A;  1BBY A;  3JTG A;  2XAH A;  3KEO A;  2Q0O A;  4GYG A;  3C18 A;  2M45 A;  1MD0 A;  4M9X A;  3W6K B;  2K27 A;  1KQ8 A;  1SFE A;  1E17 A;  2V6C A;  2XRO A;  1SFX A;  4LB5 A;  4UV9 A;  2X0L A;  3I64 A;  4QLC U;  5F64 A;  4B09 A;  5D6F A;  2XKO A;  4BQA A;  3BWG A;  5H6R A;  2L01 A;  4ZYG A;  2E7W A;  1IF1 A;  1YYV A;  3VB2 A;  5FB2 A;  4UVC A;  1LB2 A;  2M5W A;  4ESJ A;  4MQ9 F;  4HF0 A;  4M6X A;  2P4W A;  3CLO A;  2XUB A;  1FYL A;  3SXY A;  5LHG A;  4M6Y A;  1B6A A;  1YLF A;  4FHT A;  1YS7 A;  3MZY A;  2XAF A;  1U8R A;  2Z99 A;  1KU7 A;  3HTS B;  2L3D A;  3ZN0 A;  2M8E A;  3GFJ A;  3WE3 A;  3BDD A;  3CO6 C;  2EB7 A;  4IVN A;  4RGR A;  1KYW A;  2JSC A;  2NS0 A;  1MJA A;  3WGI A;  2RN7 A;  1XDS A;  3NRV A;  2ISY A;  1GXP A;  4ON0 A;  3K1P A;  4HOB A;  3U1D A;  4N0B A;  4KNY A;  5L3F A;  1SD6 A;  3E5Q A;  3FXU A;  3R60 A;  2EV5 A;  2BBY A;  3VEP A;  3RIR A;  5LEK A;  1HSJ A;  4HYE A;  1ZRC A;  3LQR A;  5TRD A;  5E1W A;  2P5K A;  1XSV A;  2HGC A;  5L3D A;  5CJ9 A;  2PMH A;  3RYP A;  1DUX C;  1HBX G;  1QGP A;  1IN7 A;  2FMY A;  1IRG A;  2CW0 F;  3J81 K;  3DQV C;  4I01 A;  3HRM A;  4S04 A;  3L00 A;  3ZMT A;  4HX7 A;  2IPQ X;  2HKX A;  2KIU A;  3H92 A;  1FOK A;  1W5T A;  4HDU A;  4YFK F;  2FA5 A;  2LKP A;  1ON1 A;  3IKV A;  2RVC A;  2H6C A;  3KLN A;  2RC4 A;  3BPV A;  5L3G A;  1TLH B;  4BHC A;  4U0Y A;  3BPX A;  2C6Y A;  2QQA A;  4KIF A;  2GXB A;  4M9Z A;  1F1Z A;  2P8T A;  3KP2 A;  1KU9 A;  3F8M A;  4HF2 A;  1F9N A;  3HUG A;  2EFO A;  1ZH5 A;  1SAX A;  4UVB A;  2ZME B;  2DW4 A;  3WTV C;  3DP7 A;  2R7F A;  3MZH A;  1YIO A;  4ENM A;  2MC3 A;  4KN4 X;  2R3S A;  4KDP A;  1KGS A;  5LGN A;  4A6E A;  4CO8 A;  2E7X A;  2G7H A;  4P9U A;  3K1N A;  1QQI A;  2PN6 A;  4IHS A;  4KIB A;  2VE9 A;  1G3T A;  1USS A;  2HS5 A;  4IRI A;  1FWZ A;  3QU6 A;  2AS5 F;  2Y0M A;  4CHU A;  2RGV A;  3F8C A;  3HSE A;  1TBX A;  3IRR A;  3V8J A;  2ZXJ A;  5D4S A;  1B9M A;  3DF8 A;  5F1R A;  3E5X A;  3WTW C;  4NHJ A;  4I0A A;  3HHG A;  2M1B A;  1TQP A;  2HKO A;  3N97 A;  3U2R A;  3B73 A;  4HV6 A;  3R6S A;  4ZZD A;  1Q1H A;  2A61 A;  4EM1 A;  2OA4 A;  1EV7 A;  3KCC A;  4Z2Y A;  4HDV A;  4M9S A;  2DK5 A;  2RV8 A;  3L7W A;  2Z3Y A;  4IRH A;  4EMS A;  5DCM B;  5FFX A;  4HBL A;  4UXN A;  4BAY A;  5BMZ A;  3SZP A;  4GO1 A;  5FO5 A;  3J81 Z;  3LA3 A;  3F21 A;  1ZAR A;  1YW8 A;  1HW1 A;  2MBF A;  2PI0 A;  5JR3 A;  2JTV A;  1D8J A;  3CUQ C;  3I59 B;  4HF1 A;  3DKW A;  5KVR A;  3HOT A;  4P55 A;  2FBH A;  1ZHF A;  3C3W A;  3B02 A;  1W7P A;  2OQG A;  2FRH A;  3MQ0 A;  4BH9 A;  5D8L B;  5ICE A;  3M7G A;  4KIG A;  3F22 A;  2P7V B;  4HV5 A;  4LLN A;  2GXG A;  2H09 A;  2JPB A;  3RJP A;  1R1U A;  3J7A O;  1IW7 F;  2XGX A;  2EFP A;  1HW2 A;  1XCB A;  2K02 A;  1OPC A;  3QRF F;  4KUM A;  4L5I A;  1W4M A;  3RYR A;  5CVI A;  1PDN C;  3KEQ A;  4KA4 A;  5EEH A;  5HS8 A;  4R8H A;  3JSO A;  4M73 A;  4RB0 A;  2CGP A;  5ILU A;  1XGM A;  1RZ4 A;  4LK0 F;  2LF7 A;  3SQN A;  1G3S A;  4KMU X;  4G6Q A;  5HDG A;  3HOS A;  5DD8 A;  3L9F A;  2PFB A;  3WGH A;  4WCG A;  3WTX C;  2WTE A;  2ZO4 A;  4CYD A;  3HSF A;  2QQB A;  1Z91 A;  4OMY A;  1BI3 A;  2HQN A;  4S05 A;  5JI6 A;  2QQ9 A;  3RTR A;  1IN6 A;  2M30 A;  1L3L A;  3IRQ A;  1O57 A;  3L2C A;  4ENJ A;  3TGN A;  3T0Y A;  1T38 A;  2ZNZ A;  3EYI A;  2CQK A;  3IL2 A;  4BHP A;  1IUY A;  2ESH A;  2DBB A;  4RGS A;  2DK8 A;  2LF8 A;  2FNA A;  4EJV A;  2EFW A;  2F5E A;  1S7O A;  1LEA A;  3CDH A;  2W57 A;  3LST A;  2OAZ A;  1GHC A;  4AWX B;  1R23 A;  4UVA A;  1DPU A;  2MH2 A;  2D1H A;  2FU4 A;  4G6D A;  1Y0U A;  4UV8 A;  4MEX F;  1I1S A;  5HLI A;  5DCF A;  4FX4 A;  3GWZ A;  3EET A;  2V79 A;  1FBU A;  2ZBK A;  1J75 A;  1ON2 A;  2VXZ A;  2XHK A;  5DV5 A;  1TQM A;  1U5T A;  5TJJ A;  3VFZ A;  3WGG A;  5KK1 A;  2TDX A;  3ECH A;  1FX7 A;  4YFX F;  5J8F A;  1BI0 A;  1R00 A;  3ABU A;  2W85 A;  1OMI A;  1W5S A;  4PCQ A;  3WTY C;  3NQO A;  3T8T A;  5BS6 A;  3T8R A;  1ZGJ A;  4RB1 A;  3F8N A;  2V1U A;  1HKS A;  1FYM A;  1UHM A;  2QEN A;  5E8G A;  2VOO A;  4WXD A;  1EH7 A;  4XBF A;  2EFN A;  2DFI A;  4LG0 B;  1IZ1 A;  1YFH A;  4ZYD A;  2K7L A;  4IRG A;  1YTY A;  1ZRF A;  2VBX A;  4KFC A;  4I09 A;  2COM A;  1ODD A;  1FYK A;  1K78 A;  2NYX A;  1YO5 C;  1MJ9 A;  1QZY A;  1O3S A;  1WRJ A;  3F6O A;  4Y15 A;  5L3B A;  3JW4 A;  3QP5 A;  5D8K B;  1Z1D A;  3J80 K;  4EJU A;  2CO5 A;  2FML A;  4MTD A;  5DUK A;  4NQW A;  1XGS A;  4AIH A;  1RNL A;  3FX3 A;  2AXL A;  1G4D A;  4Q5S F;  1SD5 A;  5JFR A;  2W84 A;  3EQL F;  2K4J A;  2HQR A;  2KIF A;  2F5D A;  5HS9 A;  3ML6 A;  2MD5 A;  1LQ1 A;  4CGZ A;  4MTE A;  1FSE A;  2UZK A;  1OYY A;  4KIC A;  3E6C C;  2B0L A;  3KP6 A;  2DPD A;  5LGU A;  3TO9 A;  4M74 A;  1FPQ A;  1S3J A;  2JRT A;  2W24 A;  3WTZ A;  3C7J A;  5E20 A;  2F5C A;  4WWC A;  1P6R A;  2MH9 A;  2DQL A;  2P7C B;  2ELH A;  3ISP A;  2D45 A;  3H3U A;  3RPU A;  3PFI A;  3IHU A;  1HQC A;  2YR2 A;  1XN7 A;  1R22 A;  4K2E A;  2VC0 A;  1YS6 A;  4H0E A;  5HDN A;  4JK1 X;  1P92 A;  1OYW A;  4LGW A;  3MEX A;  3QPT A;  3CTA A;  1L0O C;  3TO6 A;  4XLP F;  1CF7 A;  1B59 A;  2O03 A;  3K1M A;  5CVJ A;  2QBY A;  5E1Z B;  4AIJ A;  4U7D A;  2ESN A;  3FWE A;  1O7L A;  4HLX A;  1XMK A;  6PAX A;  4G94 A;  1ZLJ A;  5LBQ A;  1YQA A;  1U78 A;  1PP8 F;  2WC2 A;  3TKY A;  2V1D A;  3CUQ A;  3R0J A;  1FP1 D;  5F6F A;  3F6V A;  1ZGA A;  1BIA A;  2XAJ A;  1TTY A;  3PQJ A;  1QZZ A;  2BGC A;  2Y48 A;  4HW0 A;  5D6E A;  2A68 F;  4IHT A;  1KYZ A;  4XSZ F;  2OQR A;  2HYG D;  1ONV A;  5LHI A;  2IA2 A;  4D0P A;  3E6D A;  4Q48 A;  3WG9 A;  1I27 A;  1AWC A;  5K5R A;  1QO0 D;  1MDM A;  3V7R A;  4CZZ A;  2X4H A;  2F5F A;  1ZG5 A;  4P5O A;  2A6E F;  1Z7U A;  2RNJ A;  5ICC A;  3KP3 A;  1JE8 A;  1ZAO A;  1K79 A;  3WTT C;  4I2O A;  5CLS A;  1P4X A;  3KLO A;  4G7H F;  5ICG A;  4M72 A;  3GXO A;  3AAF A;  1FP2 A;  1IRF A;  4FT8 A;  1LEB A;  2HZT A;  4CIC A;  4LLL A;  4Y13 A;  4RS8 A;  5CYV A;  3FHZ A;  5HS7 A;  1XSX A;  1SMT A;  1UB9 A;  5LRS A;  1YG2 A;  1T2K A;  4ZYH A;  3O2P E;  4BNC A;  1G3W A;  1P4W A;  3GEZ A;  5E18 F;  1F5T A;  3EDP A;  1KU3 A;  4PGG A;  5HOO A;  4DQ2 A;  3GFL A;  1EH8 A;  5L3C A;  3V8L A;  2ACJ A;  3R61 A;  4KYW A;  2XAQ A;  4IF4 A;  3ELK A;  2IT0 A;  1O3R A;  3GZ5 A;  2VN2 A;  5LGT A;  3ZMV A;  1WQ2 A;  5A2Q K;  3DEU A;  1T98 A;  2W25 A;  4Y17 A;  2QYO A;  1MZB A;  2NNN A;  3GFM A;  3I53 A;  4U88 A;  1D5V A;  2VT2 A;  2P6S A;  1IN4 A;  3MCZ A;  4R79 A;  3I54 A;  2K86 A;  1P2F A;  1ULY A;  4OIP F;  1UST A;  3KFW X;  2P5L C;  3KET A;  2HDC A;  4AD9 A;  4E70 A;  4UHT A;  5ILS A;  1ZG1 A;  4EM0 B;  2KKO A;  2XAS A;  4ASN A;  2ZNY A;  2NAZ A;  1TNT A;  1XGO A;  4I02 A;  4BHB A;  4HZF A;  2EA4 A;  1UHW A;  1U6G A;  5FD6 A;  4MHG A;  1NHA A;  3LAP A;  5HDK A;  2L4M A;  1TW3 A;  5E1X A;  2O0Y A;  5AON A;  3TOB A;  1RUN A;  1S29 A;  1QPM A;  4I98 B;  1H9T A;  5ERI A;  2J5O A;  4EV0 A;  2MLG A;  1H9G A;  3CJN A;  1WI9 A;  4R1H A;  4U0V A;  4KT5 C;  2DQR A;  1J7K A;  3R0A A;  1FNN A;  3FM3 A;  4EQQ A;  1CGP A;  3F8F A;  2YSR A;  4M71 A;  1S8N A;  3F3X A;  4O6J A;  3V8K A;  1Z6T A;  4HQM A;  1VTN C;  3ULQ B;  4CXF A;  1UCR A;  2DI3 A;  2QLZ A;  5J8C A;  2FSW A;  3FMS A;  1D8K A;  5FLX K;  1P4A A;  1O3T A;  2FBK A;  1JGS A;  2ZJ2 A;  1OYI A;  3W6J B;  1R1V A;  2GWR A;  2QUF A;  1B9N A;  2IW5 A;  2R7D A;  3QOP A;  3FXQ A;  3DFG A;  2XAG A;  3BZ6 A;  1C0W A;  3HYI A;  2EJR A;  3KZZ A;  4HX4 A;  2H94 A;  4L5J A;  3M8E A;  5BPD A;  4EJT A;  2XKP A;  3I0T A;  2L54 A;  4MGR A;  4L0Z B;  4A5N A;  1YW9 A;  2E1C A;  2K4B A;  4WXH A;  5D5W B;  3FMQ A;  1K7A A;  3CO7 C;  2EFQ A;  4OIO F;  4OU0 A;  3P9I A;  3KP7 A;  1FC3 A;  2G7U A;  1T6S A;  1Z6R A;  4PZJ A;  2BV6 A;  1R58 A;  4L18 B;  5DD4 A;  1YW7 A;  1LJ9 A;  1R36 A;  4CDG A;  3HIF A;  4HQE A;  5L3E A;  4O3M A;  1J5Y A;  3BOQ A;  5E8I A;  4LMY A;  3RKW A;  1QBJ A;  3RKY A;  2EV0 A;  2PJP A;  2CG4 A;  4YFN F;  1RI7 A;  1BI2 A;  2OBP A;  3TDZ C;  1SFU A;  3K69 A;  1MGT A;  5JVT A;  1J59 A;  4WX9 A;  2H27 A;  4YG2 F;  4L9V A;  3E6B A;  1ZG3 A;  3IKT A;  4G7Z F;  1WWX A;  2XV4 S;  4A12 A;  4N9I A;  3ZP5 A;  3FXR A;  4B8X A;  4OIQ F;  3P9K A;  4MQV A;  1MDM B;  3V7S A;  2P6T A;  5FGM A;  3SZT A;  2LSO A;  5HLG A;  1ZYR F;  2GIV A;  1TW2 A;  4GGG A;  2MA3 A;  4NB5 A;  2JT1 A;  4L9J A;  3LFK A;  2FQ3 A;  1MKM A;  3COA C;  4UUV A;  1ZLK A;  5A2Q Z;  1U2W A;  3PQK A;  3CUO A;  4F7Z A;  2EA2 A;  5ED4 A;  2ADU A;  4A6D A;  1A04 A;  1V4R A;  5BOX A;  3ERE D;  2P5V A;  2QVO A;  5AIP A;  4IPA A;  4BYY A;  4MNU A;  2UWM A;  3K0L A;  2HYF A;  1KQ9 A;  1FBQ A;  4EM2 A;  2QBY B;  1ZRE A;  1KA8 A;  1FLI A;  2L4A A;  2QM3 A;  5FFZ A;  3D5L A;  5D5U B;  1FT9 A;  4A0X A;  4A0Y A;  3WTS C;  2KIM A;  1XSD A;  3HRU A;  3FZV A;  4G9Y A;  1BJA A;  3HRT A;  2YU3 A;  2PMU A;  1AOY A;  2UXN A;  5CVU A;  3P9C A;  4OIR F;  1Z9C A;  5CVR A;  3JTH A;  3RKX A;  1STZ A;  3ROU A;  1DP7 P;  1XDU A;  4RGU A;  2RDP A;  2VOD A;  2A6H F;  2QZ8 A;  1O7F A;  3LWF A;  5E17 F;  1B4A A;  2DU9 A;  2A69 F;  1LVA A;  4HAM A;  5IT9 Z;  1MJB A;  2G9W A;  5AIQ A;  4LLG F;  1QNT A;  2KJB A;  3RI4 A;  3J80 Z;  3RPQ A;  3M1E A;  5HLH A;  3V7C A;  1T0F A;  2OZ6 A;  2VBW A;  2BYV E;  3M8F A;  2WWY A;  3MFK A;  2STW A;  2O3F A;  2V9V A;  2VON A;  4O5V A;  4U0W A;  2VOP A;  2Q2E A;  5CVV A;  5EEG A;  1SD4 A;  2Y75 A;  2Z9O A;  5J6X A;  3BP8 A;  1JHF A;  2OU2 A;  4FX0 A;  4UNO A;  1IAW A;  3E5U A;  4ETS A;  2EV6 A;  4ZYE A;  3MAJ A;  3T5X A;  1FSH A;  5D5V B;  4PDK A;  4EGZ A;  2WV0 A;  2PLY A;  2XVC A;  3SHF A;  2DTR A;  2CSO A;  3I4P A;  3O3K A;  3FMR A;  3CUQ B;  4HA8 A;  2Z33 A;  1IXS B;  4JQF A;  1LDD A;  3WU1 B;  4PGH A;  3T1B A;  1U5T C;  2IP2 A;  4OOI A;  1E2X A;  3S2W A;  2RKH A;  3ZMU A;  4ZH4 F;  1K78 B;  4KN7 X;  1BI1 A;  3QP6 A;  1JHH A;  5JHU A;  3F72 A;  3G73 A;  3BJO A;  2LNB A;  3WU0 A;  5H20 A;  1CF7 B;  3IWF A;  4JBA A;  3IC7 A;  4AIK A;  3WOD F;  4EGY A;  4BXU A;  5ILV A;  4MEY F;  1HW5 A;  2NNY A;  5H6Q A;  4Q47 A;  1WKM A;  1U3E M;  4WK8 F;  4GXO A;  4HX8 A;  3I71 A;  5LEJ A;  1G3Y A;  3HSR A;  3LQQ A;  2STT A;  3BY6 A;  3C1D A;  3O6B B;  1RIO H;  4QWQ A;  5K1Y A;  2DLL A;  2A5Y B;  2FE3 A;  4L9N A;  3REO A;  1IXC A;  3VOD A;  4OIN F;  3ABT A;  1U5T B;  1BC8 C;  1REP C;  3E97 A;  1DDN A;  4EJO A;  4TV7 A;  2HFH A;  5DUI A;  3JAM K;  4ENN A;  4GYI A;  2V1X A;  4XRF A;  1J9I A;  2ZME A;  4GCV A;  4KMF A;  2FOK A;  2VBZ A;  4A5M A;  5DYM A;  4LB6 B;  1XCV A;  4RAY A;  2GAU A;  3EUH A;  2NRA C;  2VC1 A;  3GZ6 A;  3TQN A;  1WSU A;  2CFX A;  2F2E A;  1DPR A;  1KU2 A;  1HKT A;  2FBI A;  1IN8 A;  4G8X A;  1BC7 C;  2XIG A;  3GF2 A;  3Q9S A;  3U9G A;  4XSX F;  2VT3 A;  3FF5 A;  4YII A;  4ESB A;  4LD5 A;  2O6G E;  1UFM A;  2CWE A;  2HTS A;  3GVA A;  1H0M A;  2KJC A;  3IWZ A;  3BRO A;  2H6B A;  1FBS A;  1W7P B;  1R5G A;  1R7J A;  3MWM A;  3LA7 A;  4P96 A;  3QAH A;  3F8B A;  3I59 A;  2ZKZ A;  5ICF A;  3JAM Z;  3DPT A;  2PEX A;  3N4M A;  3ZMZ A;  2A3S A;  4U7B A;  2Z5U A;  3JSP A;  2IA1 A;  1PUE E;  1EH6 A;  3ZQ7 A;  1PP7 U;  4RAZ A;  3K2Z A;  1XMA A;  3KZY A;  5IT9 K;  4AVP A;  3F23 A;  3ECO A;  2HR3 A;  4RGX A;  2IJL A;  1HXD A;  2O8X A;  1S7A A;  3GYH X;  3HHH A;  1BOA A;  1G6N A;  2PQ8 A;  1OKR A;  4OMZ A;  4LG0 A;  4EVI A;  3WE2 A;  3RDI A;  3WTU C;  4L0Y B;  1X3U A;  2ZFW A;  1HKQ A;  1OR7 A;  3KE2 A;  3OOP A;  1ZRD A;  3R4K A;  1T39 A;  4YIF A;  3BJA A;  2CYY A;  4DNC A;  4ENK A;  2D1V A;  1S6L A;  3GUD A;  1XB4 A;  3KP4 A;  1K6O A;  1IXR C;  2M87 A;  3K9T A;  2FF4 A;  3LAJ A;  3BJ6 A;  3G3Z A;  3DV8 A;  3L09 A;  1LNW A;  2JZY A;  2PBI A;  3LA2 A;  2FEZ A;  2MLK A;  4HLY A;  2OD5 A;  1XGN A;  4WXC A;  1FY7 A;  3DXJ F;  2IVM A;  3GLX A;  1O3Q A;  2LDU A;  3ZMS A;  3HRS A;  3E3V A;  3DPL C;  2GA1 A;  1LDK B;  4A2U A;  1B1B A;  3TOA A;  4A0Z A;  1JXS A;  1I5Z A;  2DT5 A;  1GXQ A;  2KRF A;  1KQ0 A;  1TQI A;  4LK1 F;  1IN5 A;  2J5P A;  4IXA A;  4L9T A;  1W7P D;  2EK5 A;  2YPR A;  3ZPL A;  5BQT A;  1XD7 A;  4ZZL A;  5LRR A;  2XRN A;  2RQP A;  2PG4 A;  3M9A A;  3HTU A;  2A07 F;  2UXX A;  2HTJ A;  3I58 A;  4XLN F;  3I5U A;  1SMY F;  1ZN2 A;  2BE5 F;  2ISZ A;  3QPH A;  1TNS A;  5D5X B;  2VE8 A;  3V4G A;  3E6M A;  3D0S A;  2IA0 A;  3KP5 A;  1I1G A;  5LLQ A;  1BM9 A;  2QWW A;  2YX4 A;  2ZCW A;  1LDJ A;  2HWV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...