4YIIA

Structure of an apc2-ubch10 complex reveals distinctive cullin-ring ligase mechanism for anaphase-promoting complex/cyclosome
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
72
structure length
72
Chain Sequence
KEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGVYRLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of E2 Complex
rcsb
molecule keywords Ubiquitin-conjugating enzyme E2 C
molecule tags Ligase/cell cycle
source organism Homo sapiens
total genus 23
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08672 ANAPC2 Anaphase promoting complex (APC) subunit 2
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4yiiA00
1XCVA 3V4GA 1O3RA 2D45A 5FLXZ 3M1EA 3REOA 2K4JA 4EV0A 5KK1A 4LLLA 4U0YA 3KFWX 4M6XA 3FXRA 4HV6A 3TO6A 2ZFWA 4A6DA 3RKWA 3WTSC 2JPCA 4BNCA 4A6EA 1Z9CA 3G73A 1EV7A 2HYGD 1YW8A 4WXHA 3CUQA 5L3DA 5ICEA 4U0WA 1Z05A 2OA4A 2FE3A 4KN4X 1SFEA 5BQTA 1QBJA 2W25A 3TDZC 3LQQA 1KYZA 3MWMA 2OQGA 3FWEA 1XB4A 4NHJA 2CW0F 5DYMA 3GZ5A 2KIUA 3N4MA 5JFRA 3IRRA 2NS0A 2AS5F 1T98A 2DTRA 3ERED 5D6EA 1IN4A 4BHPA 1ZGAA 2O3FA 3WGHA 2STTA 4XLNF 2ZCWA 1V3FA 4CYDA 1KQ8A 4PDKA 4ESFA 2L01A 5D8KB 3L7WA 2CWEA 3DXJF 5DDGA 1MJ9A 1EH8A 3SZTA 5LRRA 3JW4A 4I98B 4XSZF 4U7BA 2QENA 5ICGA 1F9NA 5ICCA 5ILVA 2CGPA 3ECOA 5J8CA 3EETA 3E6DA 1W7PB 3L2CA 4RGSA 3QP5A 1HXDA 1O57A 2FSWA 2HTSA 4RB0A 2LNBA 3WODF 4P55A 5BS6A 5LHIA 1FYLA 4JBAA 1RZ4A 1GXPA 2HYFA 5CVVA 1YTYA 1FBQA 2RC4A 2P7CB 5D5XB 4FX4A 1F5TA 1H9TA 3VB2A 2DPUA 2F2EA 2PI0A 2C6YA 2XIGA 2YU3A 1IUYA 3M8EA 4HW0A 3LAPA 2FMYA 1TLHB 1UB9A 2W85A 3LSTA 1IAWA 2PFBA 1B4AA 3EYYA 2BEOA 4HBLA 3HRSA 4GYGA 2ZNZA 3EQLF 2HQRA 5CYVA 4FX0A 2CSOA 4G94A 1SD5A 2QQBA 2TDXA 4LB5A 4L0ZB 4GYIA 3FXUA 2Z5UA 4PGHA 1K78A 1W5TA 1R1UA 3WTYC 3SFZA 3MQ0A 2LDUA 2Z9OA 5CLSA 1IZ1A 1ZH5A 2A6EF 2HKOA 1BC8C 3HTUA 2YX7A 2CQKA 3F8BA 1FP1D 1ZRCA 2KIMA 2XRNA 2QWWA 2Y48A 3K69A 2XHKA 4HX8A 2P8TA 2IJLA 4KNYA 1TW3A 2O8XA 1TQPA 4LFUA 2GQQA 2DQRA 2V1XA 5AONA 1H0MA 4AIHA 3JTHA 2DK5A 4R79A 4YIIA 4KMFA 2J5PA 3AAFA 3FF5A 1LDDA 2DU9A 2HQNA 3JAMZ 3PQKA 1IN5A 1U5TA 1BJAA 3ZN0A 1FT9A 5LGUA 2M8EA 4Q5SF 1OKRA 3I5UA 3R0AA 1R7JA 4P96A 2QBYB 2ETHA 1XGSA 3HRUA 3D5LA 5CVRA 5HDKA 4RGXA 3ZPLA 4JQFA 2K86A 2MLKA 1E17A 2YPRA 2X0LA 4GO1A 3GXOA 3BWGA 1WI9A 3BDDA 2NAZA 4OIOF 4EJUA 2P5VA 4KUMA 4P9UA 4BHBA 2V1UA 3NQOA 1MZBA 2PMUA 4EQQA 1FZPB 3BP8A 1FP2A 2HR3A 3F23A 2VBXA 2LF7A 2V79A 4RB2C 1D5VA 1T0FA 1KQ9A 1S8NA 5L3FA 3F8FA 1SMYF 3HYIA 2BV6A 2DFIA 1JGSA 4KIGA 3QU6A 5LGTA 2PMHA 2Z33A 5LGNA 5ILSA 4KYWA 1GVJA 2CO5A 1BBYA 4HOBA 2OD5A 3ZMTA 1REPC 4EJWA 1U8RA 5E18F 5K5OA 5A2QZ 1SFXA 4HA8A 2WTEA 3D0SA 4ZYEA 2MBFA 5IT3A 3ML6A 2A69F 3E5QA 5D4SA 2W84A 2L54A 1U2WA 5FD5A 4HF2A 1BI2A 2RV8A 2GAUA 1XGOA 4L5IA 4ENNA 2QQAA 4A2UA 3KP5A 1IN6A 3RKXA 5JVTA 1IXSB 2ZNYA 2XAJA 2H27A 3GFJA 2HZTA 1R1TA 4I0AA 2PEXA 2L02A 4CO8A 1ULYA 3VEPA 1KA8A 2L3DA 1SFUA 2XUBA 3I64A 3L9FA 3V8JA 4M6YA 1RUOA 3F22A 4CZZA 2G9WA 2P5LC 3EDPA 2IW5A 2B0LA 5HOOA 3HHHA 2VN2A 1Z7UA 1R5GA 2Q0OA 2Q8KA 3DP7A 4O5VA 4A0YA 1QZYA 3GFIA 1ZLJA 3T5XA 4OIQF 2BGCA 2G7HA 3CUQC 3QP6A 3O3KA 4EJTA 1P2FA 1O3TA 3TGNA 2VBYA 3MZYA 1TW2A 5KVRA 4Y15A 2JRTA 4WXCA 3V8KA 2P6TA 1U6GA 4G7OF 3EUHA 3V8LA 2BBYA 4LMYA 2PN6A 1FOKA 1K79A 1P6RA 4RB3C 1XDUA 5IT9K 2A5YB 2GXBA 5E8GA 3LA7A 2OZUA 1YQAA 4IRIA 2P5KA 3RPUA 3BJAA 2DAOA 2XROA 1ZGJA 5CJ9A 4IRHA 4MQVA 3GEZA 3RKYA 2F5DA 2RGVA 5HS7A 4A5NA 1XDSA 1UHWA 2RKHA 2RQPA 3WE3A 3LAJA 3V7CA 1YS6A 2K4BA 4M71A 3CLOA 4WWCA 5IT9Z 1G3WA 2R3SA 1CF7B 3W6JB 4KICA 2DQLA 1P4XA 2EFNA 3BY6A 2HKXA 4L5JA 2CYYA 2GZWA 4PZJA 4ZYHA 1F4KA 3E6BA 1W7PA 3WG9A 5EEGA 3MCZA 1OPCA 3WTWC 2QLZA 5E8IA 1HW1A 3L09A 2PG4A 1BI1A 4HF0A 4YG2F 1TNSA 1XGNA 4G7ZF 1ODDA 1F1ZA 2HFHA 4ZYDA 2DBBA 1IXRC 4S04A 1IF1A 3I58A 3V7RA 1U78A 2ZMEB 3IWZA 3M9AA 1BOAA 1USSA 2WC2A 5HS8A 4HX7A 2O61A 4FT8A 4EMSA 2GXGA 3F8CA 2XGXA 3E6CC 2P4WA 4NB5A 4PCQA 3Q9SA 2Y0MA 3LQRA 3ECHA 1BI3A 4OU0A 4HYEA 1XCBA 1FX7A 3W6KB 2VBZA 3VFZA 2MH2A 3TKYA 3IKTA 4ENMA 5K5RA 2F5CA 5H6RA 4MEYF 3E97A 4IRGA 2LF8A 1JXSA 1ZARA 1S6LA 2VOPA 2XV4S 2FRHA 1ZLKA 2G7UA 1FY7A 1LB2A 3WTTC 2HOEA 4IPAA 2RDPA 3T1BA 4A0ZA 3U9GA 2O0YA 1R36A 4Q47A 3B73A 2HGCA 3KP6A 4IJAA 3I59B 5D6FA 1KU3A 5HLIA 4OOIA 3C3WA 1J5YA 2HEOA 1L0OC 2NNNA 4N9HA 3H92A 4L18B 1FC3A 2PLYA 2D1HA 5LHHA 1HQCA 3SQNA 2EWNA 1QPMA 5DUIA 3WTZA 1Y0UA 4MQ9F 3IKVA 4K2EA 3DKWA 1FBUA 3BJ6A 1Z6RA 5HS9A 1SD4A 2UWMA 1Q1HA 3ISPA 4RGRA 3TO7A 1YYVA 1ZN2A 1U5TC 1BIBA 3F8NA 1PUEE 2XAQA 2QBYA 4XSXF 2VONA 1QZZA 4MGRA 1B1BA 4XLPF 4RAYA 5BPIA 3S2WA 1R5HA 2IP2A 3ZQ7A 4HAMA 5J8FA 2KIFA 3KLOA 2VE8A 3CJNA 2AXLA 2EB7A 4I02A 4LG0B 3ELKA 3BPXA 2L4AA 4R8HA 4IHTA 3WU0A 2GA1A 1J9IA 3ZMSA 1LNWA 3KP7A 5DCMB 4RGUA 5D8LB 1ZRDA 3MAJA 3B02A 3E5UA 1I5ZA 3ABUA 5ICFA 5HDNA 2EFPA 2KJBA 1P4AA 5TRDA 4KMUX 3GUDA 1RUNA 5FFXA 3HRTA 2H09A 2IA1A 2CG4A 4P9FA 1S7AA 4OIPF 1QGPA 3GX4X 2NNYA 4S05A 4KDPA 2RN7A 1BC7C 4CICA 4HQMA 4UXNA 1MJBA 3KLNA 2V1DA 3RYPA 4I7HA 1LVAA 4UVAA 3CTAA 2XASA 5ERIA 5LLQA 4IHSA 4ENJA 4WCGA 2DI3A 4KFCA 2KRFA 1AWCA 3TDUC 4AWXB 1JHHA 3I53A 1J59A 1J75A 2IA2A 1D8JA 4O3MA 1RNLA 4L9NA 3I0TA 3HSFA 2D2WA 4XRFA 1X3UA 3ZMVA 3C7JA 3RYRA 1W4MA 3KZZA 3TOBA 4NQWA 3I4PA 2QUFA 2EV0A 1ZREA 2M45A 3COAC 2QQ9A 1FSHA 3Q5FA 3TO9A 4L0YB 2MA3A 3KP3A 1XMAA 2XKOA 2VE9A 2EV5A 1OYYA 1HKQA 4PGGA 2EA2A 2FMLA 2ESHA 4R1HA 2M87A 2W57A 1XSVA 3J81K 2DT5A 5CVIA 3QPHA 4YIFA 1LEAA 2V6CA 4RAZA 5F64A 4CXFA 2EK5A 2VC1A 3IC7A 4MTEA 2ACJA 3KETA 1KQ0A 1JHFA 5TJJA 1U3EM 2F5EA 5FB2A 4Y17A 3E6MA 1BN5A 1C0WA 2H94A 3IHUA 1Z91A 2VODA 3WU1B 3GFMA 2HDCA 2JZYA 2D1VA 1CGPA 1JE8A 3I54A 4HV5A 1HBXG 4ZYGA 1YG2A 4U88A 1O3QA 5F1RA 3H3ZA 4ZH4F 3J7AO 4E70A 1K78B 3DEUA 3L00A 3RIRA 1CF7A 3F8MA 2RNJA 2QYOA 4AIJA 2UZKA 4M9SA 5L3EA 2EFQA 5DD4A 1TNTA 2A61A 2VXZA 5CVJA 3J80K 4F7ZA 3CDHA 4G6QA 1PDNC 3P9KA 3OV8A 4HDUA 1Z6TA 2O03A 1TQIA 2HWVA 1IN8A 1EH6A 4D0PA 5DCFA 2FEZA 4TV7A 5JI6A 1XN7A 5FO5A 1B9NA 1SD6A 2MD5A 4ETSA 3HTSB 3VODA 2JSCA 3J80Z 3K1MA 1NHAA 3ABTA 4LLGF 3LA3A 5DV5A 2ZMEA 1U5TB 2PBIA 2FNAA 3C1DA 3BROA 3K9TA 1ZG5A 2VBWA 4LGWA 2IT0A 4B8XA 2DO7A 1ZG1A 2J5OA 3FMRA 3KEQA 1OYWA 3QOPA 1S7OA 5D5VB 4UUVA 3MZHA 2P6SA 4LD5A 4I0BA 4EM1A 3FMQA 1UHMA 6PAXA 1FBSA 2Z99A 1T2KA 1LEBA 3GVAA 2IA0A 3JTGA 1ONVA 4HLYA 2OAZA 2EFWA 2K27A 1XSXA 3SXYA 1QO0D 3GWZA 1GHCA 4BYYA 4LK1F 3T8RA 1MDMB 2FF4A 3R61A 2LKPA 3M8FA 1W5SA 1BIAA 1O7FA 3ZP5A 1TBXA 3I71A 2F5FA 1QNTA 1YLFA 3I59A 4CGZA 4UV8A 4EVIA 4XBFA 3NRVA 4L9TA 3K0LA 4YFNF 1WQ2A 2QVOA 5FLXK 3SZPA 1AOYA 4WF2A 1YIOA 2IRFG 4QWQA 1I1SA 2ZO4A 3HHGA 2UXXA 4IXAA 5DUKA 1MKMA 4B09A 3T0YA 3FZVA 4G9YA 5EEHA 4ENKA 4RS8A 3KCCA 2HTJA 2CFXA 1B6AA 3FXQA 3IWFA 3P9CA 4KT5C 5K5QA 5D5UB 3F72A 3N97A 1V4RA 1FLIA 1ZYRF 4G6DA 5JHUA 1LDJA 2ISZA 2O6GE 3RI4A 2V9VA 3RJPA 5JR3A 1WRJA 5E20A 1ON2A 4GCVA 1HSTA 2A07F 2MLGA 3P9IA 4G8XA 4LB6B 2JPBA 3R6SA 5E1WA 3LWFA 5BPDA 4LG0A 1S29A 1PP7U 1IXCA 4EM0B 3BPVA 1O7LA 3FHZA 4A0XA 2FA5A 2MH9A 2PQ8A 2XAHA 1IW7F 5DCMA 2OBPA 2VT3A 1G4DA 4UVCA 4LK0F 4MEXF 1TQMA 4MHGA 3TOAA 2FQ3A 5L3BA 5H20A 2EV6A 3K2ZA 2IVMA 3GW2A 2MC3A 4AIKA 2WWYA 2Y75A 1PP8F 4MTDA 3KP2A 3OOPA 1I27A 4WX9A 2X4HA 4CDGA 4Q48A 1HKSA 2R7FA 4EJVA 3R0JA 1D3YA 2K02A 1FNNA 3M7GA 5CVUA 1T39A 2E7XA 2M1BA 3V7SA 1KYWA 3JSPA 2GA2A 2H6BA 4I09A 4GGGA 1DDNA 4HQEA 1FSEA 2BYVE 4OIRF 4BAYA 3CO6C 5HLHA 1KU2A 5D4RA 2COMA 1IRGA 4DQ2A 1UFMA 2JT1A 3K1NA 1R23A 1T6SA 1KU7A 4EJOA 3K1PA 2E7WA 2DLLA 2LSOA 4DNCA 3HIFA 1RIOH 2STWA 1FWZA 1HW2A 1EH7A 3WTUC 2YSRA 1ZAOA 2RVCA 1E2XA 4IF4A 1G3SA 3TQNA 5E1ZB 1BI0A 3Q9VA 2XVCA 3GLXA 4YFKF 1ZG3A 1K7AA 2NRAC 2P7VB 2ZXJA 4BH9A 2DK8A 1STZA 3T8TA 1DPUA 1WSUA 2ESNA 4L9VA 2QM3A 3ZMUA 1W7PD 3CUQB 3DFGA 4ZZDA 4ZZLA 5LEJA 4P5OA 2UXNA 3LFKA 3GYHX 1J2XA 3WGIA 4L9JA 1GXQA 1D8KA 5FD6A 4U7DA 3MEXA 3GO5A 1BM9A 3VOEA 1SD7A 1YW7A 4AVPA 2W24A 2E1NA 2NYXA 2VOOA 1ON1A 3NEUA 2A6HF 3C18A 2XAGA 1P92A 5AIPA 2A3SA 3HSEA 1R00A 2L4MA 3KZYA 3KP4A 1HSJA 1MD0A 1OYIA 5BOXA 3JAMK 3CO7C 4UHTA 3HSRA 1KU9A 1QQIA 2M5WA 2ADUA 1G3YA 5BMZA 2IPQX 2ZJ2A 3RPQA 4QLCU 3FM3A 3PFIA 4KIFA 3U1DA 3ULQB 4EM2A 4ESBA 1FYMA 2FBKA 1T38A 4M74A 5K1YA 1B9MA 4Q4ZF 1UCRA 3QRFF 1IRFA 2OQRA 4A12A 4OMZA 1YW9A 4UNOA 1A04A 4EGYA 4LJZF 2EA4A 4EGZA 3O6BB 5L3GA 3WE2A 5LBQA 3GF2A 4M72A 3CUOA 3SHFA 3RTRA 3ZMZA 3F3XA 1XD7A 5E17F 3BOQA 1LJ9A 2BE5F 2R7DA 4GXOA 3P7NA 4KA4A 4KIBA 3ZN1A 1J7KA 3J81Z 4ASNA 3ROUA 3EYIA 4WXDA 5ILUA 4I2OA 5A2QK 1MDMA 1XMKA 4RB1A 4M73A 1MGTA 2M30A 4FHTA 3WGGA 3KE2A 3WTVC 2QZ8A 1J0RA 3F6OA 1ZRFA 4AD9A 2HS5A 4M9ZA 2GWRA 1OR7A 1KGSA 4O6JA 4A5MA 1USTA 2ISYA 1I1GA 5ED4A 1G6NA 4IVNA 3O2PE 2FU4A 3LA2A 4ON0A 4OINF 4CHUA 5LRSA 2VT2A 4N9IA 2FXAA 3FMSA 1LQ1A 1S3JA 4ESJA 3MFKA 3BJOA 3DV8A 3PQJA 2PJPA 2FOKA 2EFOA 5FGMA 5E1XA 5LHGA 2YR2A 3ZMDA 1I6XA 1Z1DA 4Z2YA 2FBIA 1IN7A 1HKTA 4BHCA 1TTYA 4N0BA 2KKOA 4WK8F 4JK1X 4KN7X 3JSOA 1DUXC 2DW4A 1XSDA 1LDKB 4U0VA 1RI7A 2FBHA 4OMYA 2A68F 3QPTA 5HVQC 5HLGA 1H9GA 3DPTA 4H0EA 2ZBKA 1MJAA 2DPDA 4M9XA 1FYKA 2H6CA 3E3VA 2XKPA 3F21A 1DP7P 3F6VA 3HOSA 1SMTA 5FFZA 2WV0A 5J6XA 3QU3A 1L3LA 2ELHA 4HX4A 1SAXA 3H3UA 5F6FA 3BZ6A 3WTXC 3IRQA 3KEOA 4MNUA 4UVBA 2YX4A 1YO5C 4I01A 4HLXA 4HZFA 3RDIA 5H6QA 1DPRA 1R1VA 5AIQA 3HOTA 4BQAA 1YFHA 1WKMA 3HUGA 1O3SA 4HDVA 5D5WB 1B59A 5HDGA 2K7LA 2JTVA 3DQVC 2Z3YA 3QAHA 1G3TA 4YFXF 1YS7A 1R58A 3FX3A 4Y13A 2OU2A 3DPLC 2FNPA 3GFLA 2KJCA 4BXUA 2VC0A 5DEQA 2E1CA 2EJRA 1ZHFA 5DD8A 3R4KA 1OMIA 1HW5A 3E5XA 5L3CA 3R60A 1FPQA 4G7HF 3DF8A 5LEKA 1XGMA 2XAFA 3U2RA 1P4WA 3G3ZA 1WWXA 1VTNC 4HF1A 3FM5A 2Q2EA 2GIVA 2ZKZA 4UV9A 1K6OA 1R22A 2OZ6A 3GZ6A 4LLNA 3HRMA 3IL2A
chains in the Genus database with same CATH superfamily
2R7OA 1XCVA 4KITB 2PMZA 5GTIC 3HPGA 1D1AA 3ABMH 3V4GA 1O3RA 2D45A 3HBLA 4BXFA 1AU7A 3OYGA 2GM4A 3PNYA 4BBSJ 5FLXZ 3S14J 3M1EA 2DA1A 3REOA 3SDBA 2K4JA 4EV0A 5KK1A 4LLLA 1VZ0A 1JT6A 2DA5A 4U0YA 3KFWX 2I5UA 3Q0WA 4BJ5C 4A3EJ 2AQEA 4M6XA 2G0EA 3FXRA 1I50J 4HV6A 3PNVA 3TO6A 2ZFWA 1FTZA 1VFCA 1B8IB 4XKWA 2V6EA 4A6DA 3G1MA 3RKWA 3ZR8X 3WTSC 2JPCA 2XPUA 3PJRA 2O5RA 4X1EA 2CW7A 3ZXSA 4A6EA 4I6ZA 1Z9CA 4IO9F 4BNCA 3S1MJ 2EIJH 1WFXA 2DDAA 3G73A 3BG9A 4E7IA 1EV7A 4V19K 2HYGD 3OIOA 1YW8A 4WXHA 2LD5A 3CUQA 1OCRH 3ONQA 2FJ1A 5L3DA 4IZZA 3S3NA 5ICEA 2ID6A 2RAEA 4U0WA 3OL3A 1Z7LA 2BY2A 4CCMA 1Z05A 3M4OJ 2OA4A 2ECCA 5EF6A 3JRDA 1AHDP 2FE3A 1VQPI 5B66C 4FE7A 2VL8A 3FXOA 4KN4X 1SFEA 3GTLJ 5BQTA 1QBJA 3OYCA 2W25A 4N4OB 3TDZC 3LQQA 2HU9A 1KYZA 3MWMA 2OQGA 3SDGA 3FWEA 3K4NA 2IGKA 4B4CA 2O7OA 1K83J 1YX3A 5F08A 3E7LA 1Z21A 2HQ5A 2BY0A 3S15J 5GADJ 1XB4A 4NHJA 2CW0F 5DYMA 3GZ5A 4RLFA 1DU6A 4XLCA 2KIUA 3N4MA 5JFRA 3IRRA 2NS0A 2AS5F 1VF9A 1T98A 2DTRA 2N8GA 2Y30A 4JX4A 3ERED 1YE9A 2TCTA 3VYSB 1N25A 2YS9A 3PO2J 3GLLA 3KYDB 1IN4A 5D6EA 3TMOA 1ZGAA 4BHPA 5E3MA 2O3FA 2VKHA 3N05A 3WGHA 1A6QA 5IP7J 2WA0A 3L2VA 1Y1WJ 2MABA 2STTA 4XLNF 2ZCWA 2NVUB 1V3FA 2XDVA 4E7JA 1ZTRA 4CYDA 1KQ8A 4PDKA 4BJTA 4ESFA 3GTMJ 2L01A 4IL6C 5D8KB 3L7WA 2CQQA 2CWEA 5DS9A 2DA6A 3DXJF 5DDGA 2BXYA 2V9KA 1MJ9A 1EH8A 2XRLA 2KL4A 1UELB 2DODA 9ANTA 3SZTA 4PJLA 4XK4A 5LRRA 3A03A 1WJDA 3JW4A 2V9PA 4I98B 3QODA 4XSZF 4U7BA 1SAUA 2QENA 3OIPA 5ICGA 2XB0X 1F9NA 5ICCA 1G8XA 5ILVA 2CGPA 1FIPA 5F0CA 3AG4H 2L5QA 2MSYA 3GCMA 3ECOA 5J8CA 5EZGA 3EETA 2EIMH 1WJCA 2CUJA 3E6DA 1W7PB 2RNGA 3L2CA 4RGSA 3QP5A 1HXDA 3ERMA 3OOUA 1O57A 2CV1A 3PIOF 2FSWA 2HTSA 4RB0A 5KNLA 3BR0A 2LNBA 3WODF 4P55A 2L9SA 5IOYA 5BS6A 4LG3A 3GZNB 5LHIA 2NOGA 4FE4A 1FYLA 2WAQN 4JBAA 1RZ4A 1GXPA 4XM3A 3DEWA 3TEDA 2HYFA 2DYSH 5CVVA 1YTYA 4AU7A 3VYRB 3DPUA 1FBQA 2E71A 2XAUA 3J7YJ 2RC4A 2P7CB 2R93J 2K5CA 1Y0NA 1SVMA 5D5XB 4FX4A 1F5TA 1R71A 1H9TA 1MSFC 3VB2A 1TWFJ 4CYCA 2MGQA 2DPUA 3JRHA 2X1EA 2F2EA 1WVRA 2PI0A 2C6YA 3F0CA 2XIGA 2YU3A 1IUYA 3M8EA 1HF0A 4HW0A 2VIXA 1APLC 2R5ZB 4OWRB 1D1BA 2FOWA 3W2VA 3LAPA 2FMYA 1TLHB 1UB9A 1R4NB 4LIVA 3DU5A 2LY1A 3B6CA 1D0ZA 3VSKA 2M3AA 1OQYA 2W85A 1IGNA 4FETA 3LSTA 1PVEA 4DYCA 2BW3A 1DP3A 1IAWA 2PFBA 2CV0A 4BY7J 1B4AA 4D7NA 1GUUA 2ME0A 2L9RA 1J09A 3EYYA 3RZOJ 3CF2A 2BEOA 2E1OA 2XGEA 1RC9A 3IAS2 4HBLA 3HRSA 4GYGA 2ZNZA 2GLOA 1E3OC 1OLTA 3EQLF 2HQRA 5DTDA 5CYVA 4FX0A 2LKSA 2CSOA 2LRDA 4MFDA 1BJZA 4G94A 1SD5A 2QQBA 2TDXA 4LB5A 3M3YJ 2UUZA 4XKCA 4L0ZB 4PUSA 1CQTA 2P81A 3FXUA 2Z5UA 4GYIA 3JR9A 3BG3A 4PGHA 1K78A 1W5TA 1R1UA 1T56A 3WTYC 3PFYA 2K9NA 3SFZA 3MQ0A 1X4OA 2LDUA 1VQ4I 2Z9OA 5CLSA 1IZ1A 4B44A 1ZH5A 2A6EF 3LSHA 2BHYA 2HKOA 3JRBA 5KCMA 1BC8C 3HTUA 2YX7A 2CQKA 3CP2A 1OR7C 3F8BA 3PSIA 1TWGJ 1FP1D 2XPVA 2ZXWH 2V4JC 4FCYA 1UAAA 4YIRX 2HXIA 3H5NA 1RR7A 1ZRCA 4LITA 1TWCJ 2KIMA 2XRNA 2QWWA 3H3VK 2Y48A 3K69A 4BEHB 2IAIA 2XHKA 2P8TA 2ELJA 4HX8A 3ZQIA 2IJLA 4BQNA 4HNVA 2HNHA 1TW3A 4KNYA 2B63J 3A2KA 2O8XA 1PUFB 1VNDA 2E2HJ 4YRVA 1TQPA 4A3LJ 4LFUA 2GQQA 3HDDA 4DBRA 2DQRA 2V1XA 5AONA 3ZQFA 5GP9A 1H0MA 3CMAI 1A36A 3OYDA 4W1UA 5E3LA 4A3MJ 4RDUA 2ELKA 1BL0A 4AIHA 1W5CC 3CCUI 3M8JA 2QSGX 3BZCA 2DK5A 3JTHA 4R79A 4YIIA 2O8KA 4A3GJ 4KMFA 5CPRB 2CUFA 1NTCA 5EYRA 2J5PA 1GV5A 3FF5A 3GBGA 3AAFA 2MYSA 4CA0A 1LDDA 2DU9A 4AYBN 2HQNA 3JAMZ 3PQKA 1IN5A 1U5TA 3E0JB 1BJAA 4IHVA 2DA3A 2EIKH 3ZN0A 1FT9A 5FKNA 3JRCA 5LGUA 5GTHC 2M8EA 4E4HA 4Q5SF 1OKRA 3I5UA 3R0AA 2X9DA 1R7JA 2VB6A 4P96A 4UB8C 2EILH 2QBYB 2ETHA 1XGSA 3HRUA 3JRFA 3D5LA 1IV6A 5CVRA 5HDKA 4RGXA 2I8DA 3KZIC 3ZPLA 3ZQQA 1YIJI 3FIWA 5IYBJ 3CDLA 4JQFA 3H9GA 2K86A 3A01A 2MLKA 1E17A 2JA2A 2YPRA 5IP9J 2X0LA 3P5JA 3DBLB 4GO1A 3JRGA 5LFAA 2VJ4A 1FMVA 3VPRA 3GXOA 3BR6A 3BWGA 1WI9A 1MNDA 2EH3A 3AG2H 4KT6A 2R7ZJ 1Y56A 3BDDA 2NAZA 4OIOF 4EJUA 2P5VA 4C30A 1X1CA 4KUMA 3A0HC 2OCEA 3TP0A 4P9UA 4B43A 3WU2C 1LE8B 4BHBA 3QQAA 2V1UA 3NQOA 4C3IJ 1MZBA 2PMUA 4EQQA 1FZPB 3HOWJ 4RA2A 3BP8A 3OYBA 4XOTA 1FP2A 2HR3A 3PIPF 1ZR4A 3CMEI 3DTKA 3KIOA 4ZDPA 4ZJZA 5JLWA 1QRYA 2VBXA 3F23A 1X3ZB 2LF7A 1YI2I 3CC2I 2PJRA 2F6CA 2V79A 4RB2C 2K9SA 3KYLA 2LY9A 1D5VA 1T0FA 2W82A 1KQ9A 1S8NA 5L3FA 4IQ4A 3F8FA 1SMYF 2JA7J 3HYIA 2BV6A 2DFIA 1JGSA 3HOUJ 4KIGA 2K9LA 2VUMJ 1VQNI 3QU6A 2W4SA 5LGTA 1IO2A 2LOOA 2PMHA 2Z33A 4UB6C 2BY3A 5LGNA 1LFUP 2QF7A 5ILSA 2AHQA 4KYWA 1GVJA 4JX5A 2CO5A 1BBYA 3J7ZI 4HOBA 2OD5A 3ZMTA 4YELA 5IP6A 1S5LC 4EJWA 1REPC 1U8RA 2QKLB 5E18F 2JA5J 2COBA 5K5OA 5A2QZ 1SFXA 4HA8A 2WTEA 3D0SA 4UY8I 1GVDA 1H89C 4ZYEA 2MBFA 5IT3A 4NBQA 3ML6A 1JJ8C 5DM6F 2A69F 3E5QA 5D4SA 3DLAA 4U87A 2W84A 5EG0A 2LR8A 1WJ5A 2JMWA 2L54A 5GPAA 3OYJA 1U2WA 2JQ7A 5FD5A 5KAFC 4HF2A 1YJWI 1FEXA 1VQ6I 1BI2A 2RV8A 4IQJA 2MW8A 2GAUA 1FIAA 4PJJA 1XGOA 4L5IA 2O9LA 1UMQA 4ENNA 1Y6IA 2QQAA 4A2UA 3UR3C 1FOYA 3KP5A 1IN6A 1ACIA 3RKXA 1LFBA 5JVTA 1H8AC 1IXSB 2CUZA 2ZNYA 2XAJA 3HPHA 4XOPA 4AC0A 2H27A 3GFJA 2HZTA 3DEEA 1R1TA 4I0AA 2PEXA 2L02A 5J3LA 4CO8A 1ULYA 4Y52J 4BDZA 3VEPA 1KA8A 2E5NA 5F0FA 2L3DA 1SFUA 3BR3A 2XUBA 3VYUB 4NQWB 3I64A 3L9FA 4LIUA 3V8JA 4QPOA 4M6YA 1RUOA 3FHNA 3F22A 2G9WA 2X6OA 4CZZA 1X19A 3EDPA 2P5LC 2IW5A 1B8IA 1BR1A 2B0LA 5HOOA 2H8RA 3HHHA 3BQZA 2VN2A 1Z7UA 1R5GA 1Y1VJ 2L2OA 2M4KA 1MMDA 1IJWC 3ABLH 3NARA 3DU6A 2Q0OA 2XF5A 2R7WA 2Q8KA 3H36A 3DP7A 1W1WE 4O5VA 3DKXA 2F48A 2K3PA 1QZYA 4A0YA 3GFIA 2E34A 1ZLJA 3GTOJ 2WAEA 3LSMA 2BOLA 2R7TA 3T5XA 4OIQF 2BGCA 1RR8C 1P9QC 2JN6A 2G7HA 3CUQC 3QP6A 2W00A 3O3KA 3CCQI 3FKIJ 3BCAA 5M5WJ 2JWTA 2K85A 4EJTA 1P2FA 4JX6A 1O3TA 3TGNA 1V5FA 2VBYA 2KIQA 2QQ8A 3MZYA 1TW2A 5KVRA 2M0CA 2VQCA 4Y15A 2JRTA 3S2DJ 4WXCA 1JUSA 3V8KA 2KP6A 2P6TA 2CJJA 2WBMA 2HOTA 1U6GA 4G7OF 3EUHA 1ORKA 2L7ZA 3V8LA 2BBYA 4LMYA 2PN6A 1FOKA 1VI0A 5FRMA 2WV1A 1K79A 1P6RA 3L2WA 4RB3C 1XDUA 4OAZA 5IT9K 2A5YB 2GXBA 5E8GA 3LA7A 2OZUA 1YQAA 4IRIA 4C3JJ 2P5KA 3RPUA 3BJAA 2DAOA 4XONA 3TL4X 4XIDA 2XROA 1ZGJA 5CJ9A 4IRHA 3SEZA 3CC4I 4MQVA 3GEZA 3RCOA 1JUPA 5FKMA 4B3AA 3CJQB 1XPXA 3RKYA 1JT0A 2F5DA 1FMWA 3QYFA 2RGVA 4DYQA 5HS7A 3OYEA 4A5NA 1XDSA 5J4VA 3A4CA 3VSLA 1JUMA 1UHWA 2EINH 2RKHA 2RQPA 3C2BA 3WE3A 3LAJA 3CCEI 3V7CA 1YS6A 2FD5A 4NUBA 2K4BA 4QSHA 4M71A 3CLOA 4XORA 2V26A 2Y31A 4WWCA 5IT9Z 1Z0XA 4G6TB 1G3WA 2R3SA 3BG6A 1CF7B 3W6JB 4KICA 1W36D 2LG4A 3H9QA 2X1DA 2VLAA 1X1BA 2DQLA 1P4XA 2EFNA 3BY6A 2HKXA 3ZQHA 4L5JA 2OTJI 2CYYA 5K7FA 2GZWA 2Q1ZB 5E79C 3OYMA 4PZJA 4ZYHA 1F4KA 3E6BA 1W7PA 3WG9A 5EEGA 3BTJA 3MCZA 1U8BA 1OPCA 3WTWC 2QLZA 3HM5A 5E8IA 3W2AA 1HW1A 3L09A 2PG4A 5IPAA 1BI1A 4HF0A 4DGWB 4YG2F 5M3MJ 1TNSA 1XGNA 1BA5A 4G7ZF 1B72B 5EDNA 2X51A 4A3CJ 4XRSG 1ODDA 2AQFA 1F1ZA 2HFHA 3AKZA 1WCMJ 1RKTA 1TWAJ 3H5RA 4IHXA 3G1OA 1AKHB 1GV2A 4ZYDA 2DBBA 1EF4A 1IXRC 4XN0A 4S04A 1IF1A 3I58A 1M1EB 3V7RA 3OYFA 1U78A 1W0UA 1BR2A 2ZMEB 3IWZA 3S1QJ 3M9AA 1TZLA 4UUTA 2YU9J 3QPSA 1BOAA 4B47A 4CH7A 1USSA 2DYRH 2R5ZA 5EGOB 4J19A 3MKZA 2DFFA 2WC2A 5HS8A 3MN2A 4HX7A 2O61A 4FT8A 4EMSA 2GXGA 3F8CA 1FOXA 4HNUA 1E3HA 1TP4A 2XGXA 4NNJA 1VQ7I 3PL8A 3E6CC 2P4WA 4NB5A 2DMTA 4PCQA 1LVKA 3L2UA 3Q9SA 5DM7F 5F27A 1FTTA 2Y0MA 2EZHA 4Y33A 5HODA 4A3BJ 2AXTC 3LQRA 3ECHA 3G4SI 1BI3A 3A0BC 1MBFA 4OU0A 3MMYB 3DTIA 1UG2A 2OJED 1XCBA 1FX7A 2Z16A 4HYEA 2LBFA 3W6KB 1ERDA 3BG7A 2IXSA 2E2JJ 3J7AY 2CFOA 3CF5F 2VBZA 3VFZA 5E3OA 3UKGA 2MH2A 4CCOA 3TKYA 3MKYB 3IKTA 4ENMA 4BU2A 5K5RA 2F5CA 5H6RA 2F4OB 4MEYF 3E97A 4HPQA 4IRGA 2LF8A 1JXSA 4BUPA 1ZARA 1WH7A 4RM3A 1S6LA 4HSRA 2HDDA 3K2AA 2OF7A 1MBKA 2VOPA 1SFKA 3GTPJ 2XV4S 2XF6A 2FRHA 1X3WB 2DCEA 2E19A 3K70D 1XC5A 2KZVA 1MMNA 4C3HJ 1ZLKA 4BEHA 3L1PA 1ZQ3P 2G7UA 4FISA 1FY7A 3OS0A 1LB2A 4MO7A 3WTTC 3A1YA 2HOEA 4IPAA 2RDPA 3T1BA 4A0ZA 2ME6A 3U9GA 2O0YA 1R36A 4Q47A 1N77A 3B73A 2HGCA 3KP6A 4IJAA 1VQ8I 3I59B 5D6FA 1KU3A 5HLIA 4PJNA 4OOIA 3C3WA 1J5YA 2HEOA 4IHYA 1L0OC 3ESWB 2NNNA 4N9HA 3H92A 4L18B 1R6RA 1FC3A 3BZKA 2PX9A 1MIJA 1YITI 1XS9A 1MBJA 2PLYA 2D1HA 5LHHA 1HQCA 5IYCJ 4XR6A 2DT6A 3SQNA 2DOEA 2WB1N 2EWNA 1QPMA 3HZJA 5DUIA 4XQFA 3WTZA 3JRIA 3RKQA 1Y0UA 2MC4A 4MQ9F 4OAYA 3Q0VA 3IKVA 4K2EA 3DKWA 4BDYA 1FBUA 3BJ6A 1Z6RA 4C9YA 3S1RJ 5HS9A 1OISA 1SD4A 2UWMA 1Q1HA 3ISPA 4RGRA 3TO7A 1YYVA 2DA2A 2CH0A 1ZN2A 2KDZA 3NWSA 1U5TC 3I9V2 2QSHX 1VQLI 1Y8QB 1BIBA 3F8NA 1PUEE 2XAQA 4II3A 2QBYA 3IH3A 4N4NB 4XSXF 1QZZA 2VONA 3HG9A 2VPLA 1QVTA 1MMAA 4MGRA 2JA6J 1B1BA 4XLPF 2VQGA 1HOMA 2VQHA 4RAYA 5JHFA 1IRZA 2VPRA 1X1PA 4M3EA 4F55A 3S2WA 1R5HA 5BPIA 1GT0C 1N78A 2IP2A 3ZQ7A 2EBIA 4HAMA 5J8FA 1W36C 1BR4A 3OY9A 2KIFA 4DZJA 1OCZH 3AG3H 5M5YJ 3KLOA 1R9TJ 2W7NA 2VQLA 2VE8A 2X48A 3CJNA 3A02A 2AXLA 2EB7A 4I02A 2M7AA 4LG0B 3ELKA 3BPXA 1LE8A 3PUBA 3JCUC 2L4AA 3O8GA 3IH4A 4R8HA 4IHTA 1OCPA 3WU0A 4IEJA 3FDYA 1I3QJ 2GA1A 5CQGA 2W1OA 1J9IA 1JTXA 3FBIB 3ZMSA 1LNWA 3KP7A 5DCMB 1O4XA 2OC6A 4RGUA 1SVOA 2BY1A 5D8LB 1ZRDA 3MAJA 3B02A 2ECBA 5J4YA 3E5UA 4BGDA 1I5ZA 3ABUA 4QPQA 1IUFA 5ICFA 5HDNA 1K4SA 2EFPA 2KJBA 2DOAA 1P4AA 2DOFA 4KMUX 5TRDA 1T0FC 3GUDA 2NS8A 5J1YA 1RUNA 4J01A 2DMPA 5FFXA 2VXDA 3HRTA 2H09A 2IA1A 2CG4A 4P9FA 4J00A 3L2RA 1H88C 1S7AA 4OIPF 1QGPA 4BBRJ 3GX4X 2QSFX 2NNYA 1YRNA 1A31A 2KDOA 3HEFA 4S05A 2UV1A 4HSTA 4KDPA 2XPWA 1MNMC 1P7JA 2DA4A 3D5SC 1HCRA 3CD6I 2RN7A 1BC7C 2LH9A 2QGUA 3ASOH 4BL0B 1WI3A 4ZC3A 2ID3A 4CICA 4HQMA 1EA3A 1MJBA 4UXNA 3KLNA 4G12A 1VQOI 3AL0C 4NC7A 4AM3A 2XGCA 3HOYJ 3GTQJ 2V1DA 3SEQA 3BC8A 3RYPA 4BKXA 4I7HA 5J1UA 1LVAA 2YUSA 4UVAA 3CTAA 4KISA 2XASA 5ERIA 2VJ5A 5LLQA 4ABZA 4W97A 4IHSA 4ENJA 4WCGA 1HDPA 2DI3A 4RM2A 4KFCA 2KRFA 1AWCA 3TDUC 4AWXB 1JHHA 3CMMA 3OR1C 3I53A 2IEKA 3LMMA 1J59A 1DGWY 3S93A 3H0DA 2IA2A 1J75A 1JKPC 4O3MA 1D8JA 1RNLA 4L9NA 3OWTA 1NH3A 3PO3J 3I0TA 5FKKA 3PNTA 4P1WA 3HSFA 2D2WA 1X2MA 4XRFA 4GDFA 2LY2A 1OCOH 2E1MC 3OS2A 1X3UA 3ZMVA 4E7HA 3C7JA 3RYRA 4JOMA 2R7RA 2L0KA 4F91B 1W4MA 3KZZA 3TOBA 4NQWA 4DW6A 2LYCA 3I4PA 2QUFA 2EV0A 2XGDA 2M45A 4M6VA 1ZREA 5IYDJ 3COAC 2QQ9A 1FSHA 3Q5FA 3TO9A 2W48A 2E5ZA 2IGOA 4L0YB 2R4GA 3K70C 2MA3A 1F43A 1D1CA 1R4MB 3KP3A 1XMAA 2XKOA 2VE9A 2EV5A 1OYYA 1R5ID 1HKQA 4PGGA 2EA2A 5FKOA 2CU7A 2FMLA 4B48A 2ESHA 4R1HA 2KMUA 2M87A 2W57A 3K6GA 1XSVA 5FLVA 3J81K 2DT5A 2DMUA 5CVIA 3QPHA 4YIFA 1LEAA 2V6CA 4RAZA 4A3IJ 2HVSA 5F64A 1Y39A 4CXFA 2EK5A 4B1RA 2VC1A 1NG6A 2XSJC 1K6YA 1P7IA 3S1NJ 3IC7A 4MTEA 2ACJA 4DOZA 3KETA 2KHMA 1KQ0A 1PYVA 1JHFA 5TJJA 3KEYA 3WHBA 3CCSI 1U3EM 2F5EA 3BR1A 1JJ6C 1MBHA 4MFEA 5FB2A 1XX5A 4Y17A 4I76A 3E6MA 2VI6A 2DDBA 1BN5A 3ZCOA 2ZJRF 1C0WA 2H94A 3IHUA 3SYTA 5GAHJ 1Z91A 4XL9A 1NK2P 2VODA 3OYLA 3WU1B 2CV2A 3GFMA 2HDCA 2JZYA 2D1VA 1RESA 1LFPA 3Q3SA 4ZDOA 4JYKA 1QZEA 4UUSB 1CGPA 1JE8A 2NXNB 3I54A 4HV5A 1HBXG 4ZYGA 5EJCA 2BHZA 1X1AA 1YG2A 4U88A 1O3QA 5F1RA 3H3ZA 1PJRA 4ZH4F 3J7AO 1E3PA 1TT0A 3K4MA 3LFUA 1SC7A 2JVGA 4E70A 3I4MJ 1X2NA 4QTRA 1K78B 2WB1A 3DWLE 3DEUA 3L00A 3RIRA 4JP0A 3HOZJ 2P0WA 5GAGJ 4PFOA 1CF7A 2CQ7A 2KZGA 1KZHA 3F8MA 2RNJA 4C2UA 2QYOA 3RQIA 4AIJA 2UZKA 4M9SA 2JUCA 4LOCA 5L3EA 4C2MJ 2EFQA 2WAQA 5DD4A 2ZXIA 4CCKA 1TNTA 1S7EA 2A61A 2VXZA 5CVJA 2WY7Q 3J80K 2DFEA 3QOEA 4F7ZA 3H1CA 3IH2A 2M34A 2IGNA 3CDHA 4G6QA 1PDNC 1I6HJ 5GAEJ 3P9KA 3EUAA 3OV8A 4GFBA 3OYKA 1EKEA 4HDUA 1Z6TA 2O03A 3K4BA 2D5VA 3VYTB 1TQIA 2HWVA 5JVGF 2F5VA 1IN8A 1EH6A 4D0PA 5CKTA 5DCFA 4DJAA 2GOXB 4Z6YA 5KHDA 1SFOJ 2FEZA 4TV7A 5JI6A 2CMPA 4ZYAA 2DFHA 1HDDC 4HG2A 3ZGKA 1F36A 1WJAA 1XN7A 5FO5A 4DBQA 2HDWA 2HOAA 4PFPA 1XMXA 1AKHA 1B9NA 1SD6A 1Z67A 2MD5A 4ETSA 3HTSB 3VODA 2JSCA 3CESA 1WJEA 1JI8A 3GTGJ 4XRSA 3J80Z 3CJTB 3K1MA 3E1SA 1NHAA 2JK3A 3ABTA 4LLGF 3LA3A 3H9JA 5DV5A 1DU0A 1ZK8A 2ZMEA 2HYJA 4L5EA 3RZDJ 5M3FJ 4X0GA 1U5TB 5B3SH 2PBIA 2FNAA 3C1DA 3HGYA 3BROA 3K9TA 1ZG5A 5EGOA 4A3DJ 2VBWA 4LGWA 2FUG2 3HKZN 2IT0A 2L7FP 2OCCH 4M3BA 4B8XA 3FXLA 2DO7A 1YOVB 3OIQA 3FK6A 1ZG1A 3PUFA 3K10A 2H1KA 1Q1VA 2J5OA 3FMRA 3KEQA 1OYWA 1E0EA 3QOPA 3D5RC 1S7OA 2X6XA 2HQAA 2JRMA 3F9KA 2R7XA 5D5VB 1W0TA 2IBDA 4UUVA 3CC7I 3DKYA 4DZPA 1TC3C 1IV8A 3MZHA 3D1NI 2P6SA 3MKLA 2HVQA 4LD5A 3I55I 2JUGA 2DJIA 5IOZA 4I0BA 4EM1A 1X58A 3FMQA 1UHMA 3ZOBA 1YJ9I 3DBHB 3OSGA 6PAXA 1FBSA 1GLNA 2QKMB 2Z99A 3U21A 5F04A 1T2KA 1S72I 1N75A 3GVAA 2CQXA 2IA0A 5C4JJ 3JTGA 1LEBA 1ONVA 1V5GA 4HLYA 4BQQA 2Z2SB 2LC2A 2OAZA 1TL8A 1WGXA 3X2QH 2MD0A 1Y8RB 2EFWA 3K7AJ 2K27A 2L7MP 1S9HA 1XSXA 3SXYA 1QO0D 3GWZA 1GHCA 4LK1F 4BYYA 3T8RA 4D9JA 1LKXA 3TBIA 1MDMB 2FF4A 4FTHA 4BXXJ 2WADA 3R61A 2LKPA 1WH5A 3M8FA 1D5YA 1W5SA 2L9NA 2LTPA 2Y2ZA 1BIAA 1O7FA 1POGA 1U9OA 3KX2A 3ZP5A 1HA8A 3CCJI 1TBXA 3I71A 2BVMA 3LOCA 2M0MA 5C44J 1WPKA 2A05A 4AYBA 3HC7A 4BE1A 1G59A 5K7ZA 2F5FA 1QNTA 1YLFA 1T8IA 4RAFA 3I59A 3CJRB 2M7BA 3CCLI 4CGZA 4AIDA 4UV8A 3CMYA 4RLQA 3DBRB 4EVIA 4XBFA 4XKBA 4XLAA 3LL7A 3NRVA 4L9TA 3LSJA 3DCFA 3K0LA 4YFNF 1WQ2A 2QVOA 4BJ6C 3SZPA 5FLXK 1AOYA 4WF2A 1YIOA 2IRFG 4QWQA 3OSFA 1I1SA 2X6WA 2ZO4A 1T08B 1RKWA 3FISA 2JA8J 1XTAA 2ZB9A 3HHGA 1I39A 2UXXA 4IXAA 4F93B 5J1RA 2V1NA 5EEAA 2K9MA 2K40A 5DUKA 5FRNA 2NVTJ 1MKMA 4B3XA 2CUEA 4B09A 3T0YA 1MMGA 1EJ9A 3FZVA 4G9YA 2JVHA 5EEHA 5C3EJ 4V2FA 1VQMI 4ENKA 1ZKGA 4RS8A 3H35A 3KCCA 3C2HA 1T95A 2HTJA 4EEFG 4ITVA 1JKQC 3KYCB 4BACA 2CFXA 1B6AA 3FXQA 3IWFA 2R92J 3P9CA 3JRAA 3CCMI 4KT5C 2E1MB 5B1AH 1D0XA 3I56I 5K5QA 5D5UB 2LMDA 3F72A 3N97A 3DLLF 1V4RA 4GRIA 1FLIA 1DGRM 1ZYRF 3LSIA 4G6DA 4F92B 5JHUA 2R7QA 1LDJA 2ISZA 2O6GE 3RI4A 5KAIC 2V9VA 1ETXA 2MG4A 3RJPA 5JR3A 2X1CA 1WRJA 5E20A 1ON2A 4GCVA 1HSTA 2I10A 2MLGA 3P9IA 5TGTA 2XB5A 4G8XA 2A07F 1A5JA 4LB6B 2QA4I 2JPBA 5EZHA 1RETA 2ICWG 3R6SA 3SFIA 5FKLA 1WHUA 2LFBA 4ZTFA 5E1WA 2ZC2A 3Q0UA 3LWFA 5BPDA 3BT9A 3G71I 3BTIA 4LG0A 4D1QA 4BQOA 1S29A 1PP7U 1IXCA 4EM0B 1K61A 3ZQLA 3BPVA 2R7UA 1O7LA 3LNQA 3FHZA 2EZKA 4PSWA 3S3MA 4A0XA 3JREA 3MZ8A 2FA5A 2MH9A 1MH4A 2PQ8A 2IGMA 2XAHA 1IW7F 2CW8A 5DCMA 5E3NA 2OBPA 3FBNB 2KRCA 2VT3A 3GTKJ 1G4DA 5HNFA 3MD2A 4UVCA 2Y0SN 4NDLA 3ABKH 1VQ5I 4LK0F 4MEXF 2ZSHB 1TQMA 3EUKL 2KQRA 1AA7A 3L2QA 1ITYA 4MHGA 3TOAA 5FJ8J 2M2EA 2FQ3A 5L3BA 1A35A 5H20A 2HVRA 2KLOA 2KPMA 4M3FA 1ZGWA 4C2TA 2EV6A 4DIQA 2AO9A 2MFZA 1OFCX 1OJLA 3K2ZA 1R49A 2IVMA 3GW2A 3HUGB 2MC3A 4PSXA 4AVZA 4AIKA 2WWYA 2HPIA 2Y75A 4MTDA 4BE2A 1MBEA 1PP8F 2IS1A 3KP2A 2DMNA 3O8HA 3OOPA 1I27A 2GXAA 4WX9A 1PUFA 2X4HA 4CDGA 2K9QA 1RPWA 1MBGA 4XICA 1SANA 1FOWA 3LSRA 4V2GA 4Q48A 1HKSA 2E60A 2R7FA 1YHQI 2Y9YA 4EJVA 1I3AA 3R0JA 2LLKA 1D3YA 2K02A 2R5YB 1BOBA 1FNNA 3M7GA 4Y7NJ 5CVUA 1T39A 2E7XA 1IDZA 3TP3A 2M1BA 2OV7A 4XN3A 3V7SA 1KYWA 3JSPA 3ZQGA 2GA2A 2H6BA 3BTLA 4I09A 4IOCF 4GGGA 1ETQA 1DDNA 2DT7B 3TW6A 4HQEA 3IUOA 1FSEA 5FLMJ 5M5XJ 5FROA 1KONA 2BYVE 2R7VA 1BW6A 3WG7H 3FK7A 4PJMA 4OIRF 4BAYA 3HKZA 2LK2A 4F52A 3G6EI 3OYAA 3CO6C 2HOSA 5HLHA 1KU2A 5D4RA 2Q2EB 2COMA 3W2WA 1IRGA 5H2FC 3QPLA 1Z77A 3W3CA 4DQ2A 1UFMA 3M07A 2JT1A 3K1NA 1R23A 1T6SA 3RPUD 1KU7A 3EPZA 4EJOA 3K1PA 4A69C 2E7WA 2DLLA 3IV5A 2LSOA 4DNCA 2TRTA 3HIFA 5J47A 1RIOH 5IY5H 2LREA 2STWA 4FASD 1WJFA 1LPQA 2Y9ZA 1FWZA 4CSWA 4HNTA 4E6KG 1EH7A 3WTUC 2YSRA 3BR5A 1ZAOA 1HW2A 2RVCA 1E2XA 4IF4A 4PK4A 2A6TA 1G3SA 4DYRA 2RQQA 2XC7A 3MKWB 3TQNA 3LSKA 5E1ZB 2VKEA 3FKJA 2B7EA 1HC8A 3NWTA 1BI0A 1SVLA 3Q9VA 2XVCA 3GLXA 2OUMA 4Y4RA 4YFKF 5K7HA 1ZG3A 4A3JJ 1K7AA 2NRAC 4CUGA 2E2IJ 1U0JA 3ASNH 2P7VB 2ZXJA 4BH9A 2DK8A 1STZA 3T8TA 1DPUA 1WSUA 5F1JA 2V7FA 2ESNA 3K4JA 4XRMA 2Y69H 4L9VA 1V54H 1MMSA 2QM3A 3SJMA 3ZMUA 5F0HA 1W7PD 3CUQB 4A3FJ 3DFGA 4ZZDA 4PJ0C 4XKVA 2VJJA 3HOVJ 2L9VA 4ZZLA 5LEJA 4UUSA 4P5OA 1IDYA 3OS1A 2UXNA 3M1CA 3LFKA 1QPIA 3GYHX 1QA6A 4CCLA 2EPFA 1V55H 1Z3XA 1J2XA 3WGIA 4L9JA 1GXQA 1D8KA 1TWHJ 5FD6A 4M3DA 1OCTC 4U7DA 3FXMA 2DTZA 3MEXA 3GO5A 1BM9A 2M8GX 3VOEA 3VWBA 1SD7A 1YW7A 2LBFB 4AVPA 2W24A 2E1NA 2OTLI 2NYXA 2VOOA 1ON1A 1ETWA 1VQ9I 4FQGA 2E36A 3NEUA 2A6HF 2Z1DA 3OYIA 4HRIA 3C18A 3ZRGA 2XAGA 4EATA 4ZDLA 4XMYA 3GMEA 1P92A 3HB9A 1GDTA 2DXIA 5AIPA 2A3SA 3HSEA 2DMQA 3CLQA 1R00A 2L4MA 1IC8A 2L7KA 2NVXJ 1WJBA 3KZYA 2CQNA 3KP4A 1HSJA 1MD0A 1OYIA 2DJNA 3AG1H 5BOXA 3JAMK 3CO7C 4UHTA 1QVUA 3HSRA 4RAGA 1KU9A 4BS9A 1QQIA 2M5WA 3OMYA 1ZELA 4XLHA 2ADUA 3NAUA 1G3YA 1X4PA 5BMZA 2IPQX 4MIMA 2QEXI 2ZJ2A 3RPQA 3OYNA 2EZLA 2NS7A 4QLCU 2ZJPF 3FM3A 3PFIA 4CCNA 5B5EC 1DQUA 4KIFA 2LP0A 3U1DA 3ULQB 4EM2A 4ESBA 1FYMA 3W6VA 3LSPA 2FBKA 2QCOA 1T38A 4XLFA 3V42A 4X6AJ 4M74A 5K1YA 1K4TA 3BQYA 2HPMA 4AUXA 3CZ6A 1B9MA 4E7SA 4Q4ZF 2KT0A 1UCRA 2DA7A 3QRFF 1IRFA 2OQRA 2ZMEC 3IAM2 4OMZA 4A12A 1YW9A 4UNOA 1A04A 3GTJJ 3K4KA 4EGYA 4LJZF 1UHSA 2EA4A 3I3LA 2Y0SA 4EGZA 3B6AA 3O6BB 5L3GA 2K3FA 4RMNA 1SEUA 1HLVA 1MH3A 1ETVA 3S8PA 2IS6A 3WE2A 5LBQA 3GF2A 4M72A 2A5WA 3CUOA 1OCCH 2BXZA 2BVLA 2PMZN 3HGGA 3RTRA 3SHFA 3ZMZA 3F3XA 1U9NA 1JGGA 1XD7A 4E7ZA 4CYCB 5E17F 2ZSIB 3BOQA 1IG7A 5BNGA 2HI3A 3FXKA 2VJIA 1LJ9A 2BE5F 2R7DA 4GXOA 4E7LA 3G1LA 3P7NA 4A93J 4BE0A 4KA4A 5B1BH 4KIBA 3ZN1A 2M9HA 3EUHC 1J7KA 3HJEA 1X1DA 3J81Z 4ASNA 3ROUA 2BW3B 4NC8A 3EYIA 1ENHA 1FJLA 1VQKI 1YX5A 4WXDA 5ILUA 4I2OA 3CP8A 5A2QK 1MDMA 1IRXA 1XMKA 4RB1A 4M73A 3HL2A 1MGTA 2HXOA 2M4GA 2M30A 2VKVA 4FHTA 4Y3OA 1LUJB 3KE2A 3RSNA 3WGGA 2EZIA 2QZ8A 3WTVC 1J0RA 3F6OA 3HXLA 1JTYA 2XSDC 4I99C 4AD9A 1ZRFA 2H8WA 2HS5A 4HEA2 4M9ZA 3CCVI 3I4NJ 2JSPA 4KJZA 2GWRA 2R7SA 2VKDA 1OR7A 1KGSA 4O6JA 1RRJA 4A5MA 5J40A 1USTA 2X85A 3BG5A 1XG1A 2ISYA 2CRGA 1I1GA 5ED4A 1G6NA 4IVNA 3O2PE 2FU4A 3BTCA 2BZTA 3LA2A 3S17J 2CS3A 4ON0A 4OINF 1YRNB 4CHUA 1D0YA 5LRSA 1MW7A 2VT2A 1NG7A 4N9IA 3S2HJ 2FXAA 3FMSA 1LQ1A 1ETYA 1S3JA 4ESJA 3MFKA 3BJOA 3DV8A 3PQJA 4IKFA 4RBOA 3G2BA 2PJPA 1G2HA 2FOKA 2EFOA 4ZTJA 5FGMA 5E1XA 5LHGA 2YR2A 1WZ2A 1JKOC 3SZGA 2ZXHA 2R0QC 2NVYJ 1MNEA 3ZMDA 5HLTA 4QIWN 1B72A 1BW5A 1I6XA 3ZQCA 1Z1DA 4Z2YA 2FBIA 1IN7A 3CCRI 1HKTA 3PSFA 4D5CA 4BHCA 1JKRC 5JLXA 1TTYA 3CDIA 3H0GJ 4N0BA 3TW7A 2KKOA 4WK8F 4JK1X 4KN7X 3JSOA 1DUXC 4ANJA 2F4IA 2DW4A 1XSDA 1LDKB 4U0VA 5TISC 1RI7A 1QU3A 2KISA 2FBHA 4OMYA 2A68F 3K4LA 2IS4A 3QPTA 2WAFA 3BLYA 4M3GA 1H9GA 5HVQC 5HLGA 3DPTA 3DTEA 3OR2C 1QHGA 2ZBKA 4H0EA 4F3QA 1MJAA 2DPDA 4M9XA 1FYKA 2H6CA 3E3VA 3S3OA 2XF7A 1ETOA 3OL4A 2XKPA 3CCYA 3F21A 1MSEC 3QYEA 1DP7P 1Z3YA 2LKXA 3F6VA 4CCJA 3UNGC 2OPTA 3HOSA 1SMTA 5FFZA 1UG0A 2WV0A 5J6XA 3QU3A 3WHCA 1L3LA 3K4CA 3A01B 2IS2A 2KRHA 2ELHA 4HX4A 1SAXA 3RQ4A 2GBYA 3H3UA 1QHHD 5F6FA 3BZ6A 5C4XJ 3KPHA 3U1KA 3WTXC 2ZJQF 3IRQA 3H5AA 4D5FA 3KEOA 4MNUA 2NOJB 1ETKA 2YX4A 4UVBA 4IOAF 2EQRA 3OYHA 1YO5C 4I01A 3CQZJ 4HLXA 4HZFA 4YEJA 3RDIA 5H6QA 2FX0A 1DPRA 1R1VA 2GIZA 5HNHA 5AIQA 1UJ8A 3HOTA 4BQAA 5LD2C 3BR2A 1WKMA 1YFHA 2E35A 3HUGA 2DN0A 1O3SA 4HDVA 2PJRB 2WY8Q 1B59A 3VDXA 4D7MA 5D5WB 3HOXJ 4IHWA 2X6YA 1YJNI 5HDGA 2K7LA 4CZCA 2RREA 2F4MB 3S32A 2JTVA 3DQVC 3IP4B 2Z3YA 4BY1J 3QAHA 1G3TA 1UZCA 4YFXF 1TT5B 1YS7A 1V5EA 1R58A 3FX3A 4Y13A 3FXJA 2OU2A 3DPLC 2FNPA 2R5YA 3GFLA 4IX7A 2KJCA 4II2A 1T33A 4BXUA 1ZR2A 2VC0A 5DEQA 2B9SA 2EJRA 1ZHFA 2E1CA 3QWLA 3R4KA 5DD8A 3BCBA 3S16J 1OMIA 2HZDA 1HW5A 3E5XA 4MLOA 5L3CA 3AFHA 1A6IA 3AL0B 3R60A 1FPQA 4A3KJ 2KFDA 4G7HF 3DF8A 4H4KC 2VASA 1NK3P 5LEKA 1XGMA 2XAFA 5EG0B 2JJ7A 3LSGA 3U2RA 1P4WA 2FQ4A 1WWXA 3G3ZA 2LVSA 2GOMA 5CQEA 1VTNC 4XNFA 4HF1A 3MVPA 3C2GA 3FM5A 3PM1A 2Q2EA 2GIVA 2ZKZA 2NVQJ 4UV9A 2H1LA 2ZFUA 4E7KA 4XLEA 1K6OA 1R22A 4S0HB 2OZ6A 3QYBA 3GZ6A 5GPCA 4LLNA 4NC6A 3HRMA 3IL2A
chains in the Genus database with same CATH topology
1XCVA 3V4GA 1O3RA 2D45A 5FLXZ 3M1EA 3REOA 2K4JA 4EV0A 5KK1A 4LLLA 4U0YA 3KFWX 4M6XA 3FXRA 4HV6A 3TO6A 2ZFWA 4A6DA 3RKWA 3WTSC 2JPCA 4BNCA 4A6EA 1Z9CA 3G73A 1EV7A 2HYGD 1YW8A 4WXHA 3CUQA 5L3DA 5ICEA 4U0WA 1Z05A 2OA4A 2FE3A 4KN4X 1SFEA 5BQTA 1QBJA 2W25A 3TDZC 3LQQA 1KYZA 3MWMA 2OQGA 3FWEA 1XB4A 4NHJA 2CW0F 5DYMA 3GZ5A 2KIUA 3N4MA 5JFRA 3IRRA 2NS0A 2AS5F 1T98A 2DTRA 3ERED 5D6EA 1IN4A 4BHPA 1ZGAA 2O3FA 3WGHA 2STTA 4XLNF 2ZCWA 1V3FA 4CYDA 1KQ8A 4PDKA 4ESFA 2L01A 5D8KB 3L7WA 2CWEA 3DXJF 5DDGA 1MJ9A 1EH8A 3SZTA 5LRRA 3JW4A 4I98B 4XSZF 4U7BA 2QENA 5ICGA 1F9NA 5ICCA 5ILVA 2CGPA 3ECOA 5J8CA 3EETA 3E6DA 1W7PB 3L2CA 4RGSA 3QP5A 1HXDA 1O57A 2FSWA 2HTSA 4RB0A 2LNBA 3WODF 4P55A 5BS6A 5LHIA 1FYLA 4JBAA 1RZ4A 1GXPA 2HYFA 5CVVA 1YTYA 1FBQA 2RC4A 2P7CB 5D5XB 4FX4A 1F5TA 1H9TA 3VB2A 2DPUA 2F2EA 2PI0A 2C6YA 2XIGA 2YU3A 1IUYA 3M8EA 4HW0A 3LAPA 2FMYA 1TLHB 1UB9A 2W85A 3LSTA 1IAWA 2PFBA 1B4AA 3EYYA 2BEOA 4HBLA 3HRSA 4GYGA 2ZNZA 3EQLF 2HQRA 5CYVA 4FX0A 2CSOA 4G94A 1SD5A 2QQBA 2TDXA 4LB5A 4L0ZB 4GYIA 3FXUA 2Z5UA 4PGHA 1K78A 1W5TA 1R1UA 3WTYC 3SFZA 3MQ0A 2LDUA 2Z9OA 5CLSA 1IZ1A 1ZH5A 2A6EF 2HKOA 1BC8C 3HTUA 2YX7A 2CQKA 3F8BA 1FP1D 1ZRCA 2KIMA 2XRNA 2QWWA 2Y48A 3K69A 2XHKA 4HX8A 2P8TA 2IJLA 4KNYA 1TW3A 2O8XA 1TQPA 4LFUA 2GQQA 2DQRA 2V1XA 5AONA 1H0MA 4AIHA 3JTHA 2DK5A 4R79A 4YIIA 4KMFA 2J5PA 3AAFA 3FF5A 1LDDA 2DU9A 2HQNA 3JAMZ 3PQKA 1IN5A 1U5TA 1BJAA 3ZN0A 1FT9A 5LGUA 2M8EA 4Q5SF 1OKRA 3I5UA 3R0AA 1R7JA 4P96A 2QBYB 2ETHA 1XGSA 3HRUA 3D5LA 5CVRA 5HDKA 4RGXA 3ZPLA 4JQFA 2K86A 2MLKA 1E17A 2YPRA 2X0LA 4GO1A 3GXOA 3BWGA 1WI9A 3BDDA 2NAZA 4OIOF 4EJUA 2P5VA 4KUMA 4P9UA 4BHBA 2V1UA 3NQOA 1MZBA 2PMUA 4EQQA 1FZPB 3BP8A 1FP2A 2HR3A 3F23A 2VBXA 2LF7A 2V79A 4RB2C 1D5VA 1T0FA 1KQ9A 1S8NA 5L3FA 3F8FA 1SMYF 3HYIA 2BV6A 2DFIA 1JGSA 4KIGA 3QU6A 5LGTA 2PMHA 2Z33A 5LGNA 5ILSA 4KYWA 1GVJA 2CO5A 1BBYA 4HOBA 2OD5A 3ZMTA 1REPC 4EJWA 1U8RA 5E18F 5K5OA 5A2QZ 1SFXA 4HA8A 2WTEA 3D0SA 4ZYEA 2MBFA 5IT3A 3ML6A 2A69F 3E5QA 5D4SA 2W84A 2L54A 1U2WA 5FD5A 4HF2A 1BI2A 2RV8A 2GAUA 1XGOA 4L5IA 4ENNA 2QQAA 4A2UA 3KP5A 1IN6A 3RKXA 5JVTA 1IXSB 2ZNYA 2XAJA 2H27A 3GFJA 2HZTA 1R1TA 4I0AA 2PEXA 2L02A 4CO8A 1ULYA 3VEPA 1KA8A 2L3DA 1SFUA 2XUBA 3I64A 3L9FA 3V8JA 4M6YA 1RUOA 3F22A 4CZZA 2G9WA 2P5LC 3EDPA 2IW5A 2B0LA 5HOOA 3HHHA 2VN2A 1Z7UA 1R5GA 2Q0OA 2Q8KA 3DP7A 4O5VA 4A0YA 1QZYA 3GFIA 1ZLJA 3T5XA 4OIQF 2BGCA 2G7HA 3CUQC 3QP6A 3O3KA 4EJTA 1P2FA 1O3TA 3TGNA 2VBYA 3MZYA 1TW2A 5KVRA 4Y15A 2JRTA 4WXCA 3V8KA 2P6TA 1U6GA 4G7OF 3EUHA 3V8LA 2BBYA 4LMYA 2PN6A 1FOKA 1K79A 1P6RA 4RB3C 1XDUA 5IT9K 2A5YB 2GXBA 5E8GA 3LA7A 2OZUA 1YQAA 4IRIA 2P5KA 3RPUA 3BJAA 2DAOA 2XROA 1ZGJA 5CJ9A 4IRHA 4MQVA 3GEZA 3RKYA 2F5DA 2RGVA 5HS7A 4A5NA 1XDSA 1UHWA 2RKHA 2RQPA 3WE3A 3LAJA 3V7CA 1YS6A 2K4BA 4M71A 3CLOA 4WWCA 5IT9Z 1G3WA 2R3SA 1CF7B 3W6JB 4KICA 2DQLA 1P4XA 2EFNA 3BY6A 2HKXA 4L5JA 2CYYA 2GZWA 4PZJA 4ZYHA 1F4KA 3E6BA 1W7PA 3WG9A 5EEGA 3MCZA 1OPCA 3WTWC 2QLZA 5E8IA 1HW1A 3L09A 2PG4A 1BI1A 4HF0A 4YG2F 1TNSA 1XGNA 4G7ZF 1ODDA 1F1ZA 2HFHA 4ZYDA 2DBBA 1IXRC 4S04A 1IF1A 3I58A 3V7RA 1U78A 2ZMEB 3IWZA 3M9AA 1BOAA 1USSA 2WC2A 5HS8A 4HX7A 2O61A 4FT8A 4EMSA 2GXGA 3F8CA 2XGXA 3E6CC 2P4WA 4NB5A 4PCQA 3Q9SA 2Y0MA 3LQRA 3ECHA 1BI3A 4OU0A 4HYEA 1XCBA 1FX7A 3W6KB 2VBZA 3VFZA 2MH2A 3TKYA 3IKTA 4ENMA 5K5RA 2F5CA 5H6RA 4MEYF 3E97A 4IRGA 2LF8A 1JXSA 1ZARA 1S6LA 2VOPA 2XV4S 2FRHA 1ZLKA 2G7UA 1FY7A 1LB2A 3WTTC 2HOEA 4IPAA 2RDPA 3T1BA 4A0ZA 3U9GA 2O0YA 1R36A 4Q47A 3B73A 2HGCA 3KP6A 4IJAA 3I59B 5D6FA 1KU3A 5HLIA 4OOIA 3C3WA 1J5YA 2HEOA 1L0OC 2NNNA 4N9HA 3H92A 4L18B 1FC3A 2PLYA 2D1HA 5LHHA 1HQCA 3SQNA 2EWNA 1QPMA 5DUIA 3WTZA 1Y0UA 4MQ9F 3IKVA 4K2EA 3DKWA 1FBUA 3BJ6A 1Z6RA 5HS9A 1SD4A 2UWMA 1Q1HA 3ISPA 4RGRA 3TO7A 1YYVA 1ZN2A 1U5TC 1BIBA 3F8NA 1PUEE 2XAQA 2QBYA 4XSXF 2VONA 1QZZA 4MGRA 1B1BA 4XLPF 4RAYA 5BPIA 3S2WA 1R5HA 2IP2A 3ZQ7A 4HAMA 5J8FA 2KIFA 3KLOA 2VE8A 3CJNA 2AXLA 2EB7A 4I02A 4LG0B 3ELKA 3BPXA 2L4AA 4R8HA 4IHTA 3WU0A 2GA1A 1J9IA 3ZMSA 1LNWA 3KP7A 5DCMB 4RGUA 5D8LB 1ZRDA 3MAJA 3B02A 3E5UA 1I5ZA 3ABUA 5ICFA 5HDNA 2EFPA 2KJBA 1P4AA 5TRDA 4KMUX 3GUDA 1RUNA 5FFXA 3HRTA 2H09A 2IA1A 2CG4A 4P9FA 1S7AA 4OIPF 1QGPA 3GX4X 2NNYA 4S05A 4KDPA 2RN7A 1BC7C 4CICA 4HQMA 4UXNA 1MJBA 3KLNA 2V1DA 3RYPA 4I7HA 1LVAA 4UVAA 3CTAA 2XASA 5ERIA 5LLQA 4IHSA 4ENJA 4WCGA 2DI3A 4KFCA 2KRFA 1AWCA 3TDUC 4AWXB 1JHHA 3I53A 1J59A 1J75A 2IA2A 1D8JA 4O3MA 1RNLA 4L9NA 3I0TA 3HSFA 2D2WA 4XRFA 1X3UA 3ZMVA 3C7JA 3RYRA 1W4MA 3KZZA 3TOBA 4NQWA 3I4PA 2QUFA 2EV0A 1ZREA 2M45A 3COAC 2QQ9A 1FSHA 3Q5FA 3TO9A 4L0YB 2MA3A 3KP3A 1XMAA 2XKOA 2VE9A 2EV5A 1OYYA 1HKQA 4PGGA 2EA2A 2FMLA 2ESHA 4R1HA 2M87A 2W57A 1XSVA 3J81K 2DT5A 5CVIA 3QPHA 4YIFA 1LEAA 2V6CA 4RAZA 5F64A 4CXFA 2EK5A 2VC1A 3IC7A 4MTEA 2ACJA 3KETA 1KQ0A 1JHFA 5TJJA 1U3EM 2F5EA 5FB2A 4Y17A 3E6MA 1BN5A 1C0WA 2H94A 3IHUA 1Z91A 2VODA 3WU1B 3GFMA 2HDCA 2JZYA 2D1VA 1CGPA 1JE8A 3I54A 4HV5A 1HBXG 4ZYGA 1YG2A 4U88A 1O3QA 5F1RA 3H3ZA 4ZH4F 3J7AO 4E70A 1K78B 3DEUA 3L00A 3RIRA 1CF7A 3F8MA 2RNJA 2QYOA 4AIJA 2UZKA 4M9SA 5L3EA 2EFQA 5DD4A 1TNTA 2A61A 2VXZA 5CVJA 3J80K 4F7ZA 3CDHA 4G6QA 1PDNC 3P9KA 3OV8A 4HDUA 1Z6TA 2O03A 1TQIA 2HWVA 1IN8A 1EH6A 4D0PA 5DCFA 2FEZA 4TV7A 5JI6A 1XN7A 5FO5A 1B9NA 1SD6A 2MD5A 4ETSA 3HTSB 3VODA 2JSCA 3J80Z 3K1MA 1NHAA 3ABTA 4LLGF 3LA3A 5DV5A 2ZMEA 1U5TB 2PBIA 2FNAA 3C1DA 3BROA 3K9TA 1ZG5A 2VBWA 4LGWA 2IT0A 4B8XA 2DO7A 1ZG1A 2J5OA 3FMRA 3KEQA 1OYWA 3QOPA 1S7OA 5D5VB 4UUVA 3MZHA 2P6SA 4LD5A 4I0BA 4EM1A 3FMQA 1UHMA 6PAXA 1FBSA 2Z99A 1T2KA 1LEBA 3GVAA 2IA0A 3JTGA 1ONVA 4HLYA 2OAZA 2EFWA 2K27A 1XSXA 3SXYA 1QO0D 3GWZA 1GHCA 4BYYA 4LK1F 3T8RA 1MDMB 2FF4A 3R61A 2LKPA 3M8FA 1W5SA 1BIAA 1O7FA 3ZP5A 1TBXA 3I71A 2F5FA 1QNTA 1YLFA 3I59A 4CGZA 4UV8A 4EVIA 4XBFA 3NRVA 4L9TA 3K0LA 4YFNF 1WQ2A 2QVOA 5FLXK 3SZPA 1AOYA 4WF2A 1YIOA 2IRFG 4QWQA 1I1SA 2ZO4A 3HHGA 2UXXA 4IXAA 5DUKA 1MKMA 4B09A 3T0YA 3FZVA 4G9YA 5EEHA 4ENKA 4RS8A 3KCCA 2HTJA 2CFXA 1B6AA 3FXQA 3IWFA 3P9CA 4KT5C 5K5QA 5D5UB 3F72A 3N97A 1V4RA 1FLIA 1ZYRF 4G6DA 5JHUA 1LDJA 2ISZA 2O6GE 3RI4A 2V9VA 3RJPA 5JR3A 1WRJA 5E20A 1ON2A 4GCVA 1HSTA 2A07F 2MLGA 3P9IA 4G8XA 4LB6B 2JPBA 3R6SA 5E1WA 3LWFA 5BPDA 4LG0A 1S29A 1PP7U 1IXCA 4EM0B 3BPVA 1O7LA 3FHZA 4A0XA 2FA5A 2MH9A 2PQ8A 2XAHA 1IW7F 5DCMA 2OBPA 2VT3A 1G4DA 4UVCA 4LK0F 4MEXF 1TQMA 4MHGA 3TOAA 2FQ3A 5L3BA 5H20A 2EV6A 3K2ZA 2IVMA 3GW2A 2MC3A 4AIKA 2WWYA 2Y75A 1PP8F 4MTDA 3KP2A 3OOPA 1I27A 4WX9A 2X4HA 4CDGA 4Q48A 1HKSA 2R7FA 4EJVA 3R0JA 1D3YA 2K02A 1FNNA 3M7GA 5CVUA 1T39A 2E7XA 2M1BA 3V7SA 1KYWA 3JSPA 2GA2A 2H6BA 4I09A 4GGGA 1DDNA 4HQEA 1FSEA 2BYVE 4OIRF 4BAYA 3CO6C 5HLHA 1KU2A 5D4RA 2COMA 1IRGA 4DQ2A 1UFMA 2JT1A 3K1NA 1R23A 1T6SA 1KU7A 4EJOA 3K1PA 2E7WA 2DLLA 2LSOA 4DNCA 3HIFA 1RIOH 2STWA 1FWZA 1HW2A 1EH7A 3WTUC 2YSRA 1ZAOA 2RVCA 1E2XA 4IF4A 1G3SA 3TQNA 5E1ZB 1BI0A 3Q9VA 2XVCA 3GLXA 4YFKF 1ZG3A 1K7AA 2NRAC 2P7VB 2ZXJA 4BH9A 2DK8A 1STZA 3T8TA 1DPUA 1WSUA 2ESNA 4L9VA 2QM3A 3ZMUA 1W7PD 3CUQB 3DFGA 4ZZDA 4ZZLA 5LEJA 4P5OA 2UXNA 3LFKA 3GYHX 1J2XA 3WGIA 4L9JA 1GXQA 1D8KA 5FD6A 4U7DA 3MEXA 3GO5A 1BM9A 3VOEA 1SD7A 1YW7A 4AVPA 2W24A 2E1NA 2NYXA 2VOOA 1ON1A 3NEUA 2A6HF 3C18A 2XAGA 1P92A 5AIPA 2A3SA 3HSEA 1R00A 2L4MA 3KZYA 3KP4A 1HSJA 1MD0A 1OYIA 5BOXA 3JAMK 3CO7C 4UHTA 3HSRA 1KU9A 1QQIA 2M5WA 2ADUA 1G3YA 5BMZA 2IPQX 2ZJ2A 3RPQA 4QLCU 3FM3A 3PFIA 4KIFA 3U1DA 3ULQB 4EM2A 4ESBA 1FYMA 2FBKA 1T38A 4M74A 5K1YA 1B9MA 4Q4ZF 1UCRA 3QRFF 1IRFA 2OQRA 4A12A 4OMZA 1YW9A 4UNOA 1A04A 4EGYA 4LJZF 2EA4A 4EGZA 3O6BB 5L3GA 3WE2A 5LBQA 3GF2A 4M72A 3CUOA 3SHFA 3RTRA 3ZMZA 3F3XA 1XD7A 5E17F 3BOQA 1LJ9A 2BE5F 2R7DA 4GXOA 3P7NA 4KA4A 4KIBA 3ZN1A 1J7KA 3J81Z 4ASNA 3ROUA 3EYIA 4WXDA 5ILUA 4I2OA 5A2QK 1MDMA 1XMKA 4RB1A 4M73A 1MGTA 2M30A 4FHTA 3WGGA 3KE2A 3WTVC 2QZ8A 1J0RA 3F6OA 1ZRFA 4AD9A 2HS5A 4M9ZA 2GWRA 1OR7A 1KGSA 4O6JA 4A5MA 1USTA 2ISYA 1I1GA 5ED4A 1G6NA 4IVNA 3O2PE 2FU4A 3LA2A 4ON0A 4OINF 4CHUA 5LRSA 2VT2A 4N9IA 2FXAA 3FMSA 1LQ1A 1S3JA 4ESJA 3MFKA 3BJOA 3DV8A 3PQJA 2PJPA 2FOKA 2EFOA 5FGMA 5E1XA 5LHGA 2YR2A 3ZMDA 1I6XA 1Z1DA 4Z2YA 2FBIA 1IN7A 1HKTA 4BHCA 1TTYA 4N0BA 2KKOA 4WK8F 4JK1X 4KN7X 3JSOA 1DUXC 2DW4A 1XSDA 1LDKB 4U0VA 1RI7A 2FBHA 4OMYA 2A68F 3QPTA 5HVQC 5HLGA 1H9GA 3DPTA 4H0EA 2ZBKA 1MJAA 2DPDA 4M9XA 1FYKA 2H6CA 3E3VA 2XKPA 3F21A 1DP7P 3F6VA 3HOSA 1SMTA 5FFZA 2WV0A 5J6XA 3QU3A 1L3LA 2ELHA 4HX4A 1SAXA 3H3UA 5F6FA 3BZ6A 3WTXC 3IRQA 3KEOA 4MNUA 4UVBA 2YX4A 1YO5C 4I01A 4HLXA 4HZFA 3RDIA 5H6QA 1DPRA 1R1VA 5AIQA 3HOTA 4BQAA 1YFHA 1WKMA 3HUGA 1O3SA 4HDVA 5D5WB 1B59A 5HDGA 2K7LA 2JTVA 3DQVC 2Z3YA 3QAHA 1G3TA 4YFXF 1YS7A 1R58A 3FX3A 4Y13A 2OU2A 3DPLC 2FNPA 3GFLA 2KJCA 4BXUA 2VC0A 5DEQA 2E1CA 2EJRA 1ZHFA 5DD8A 3R4KA 1OMIA 1HW5A 3E5XA 5L3CA 3R60A 1FPQA 4G7HF 3DF8A 5LEKA 1XGMA 2XAFA 3U2RA 1P4WA 3G3ZA 1WWXA 1VTNC 4HF1A 3FM5A 2Q2EA 2GIVA 2ZKZA 4UV9A 1K6OA 1R22A 2OZ6A 3GZ6A 4LLNA 3HRMA 3IL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XCV A;  3V4G A;  1O3R A;  2D45 A;  5FLX Z;  3M1E A;  3REO A;  2K4J A;  4EV0 A;  5KK1 A;  4LLL A;  4U0Y A;  3KFW X;  4M6X A;  3FXR A;  4HV6 A;  3TO6 A;  2ZFW A;  4A6D A;  3RKW A;  3WTS C;  2JPC A;  4BNC A;  4A6E A;  1Z9C A;  3G73 A;  1EV7 A;  2HYG D;  1YW8 A;  4WXH A;  3CUQ A;  5L3D A;  5ICE A;  4U0W A;  1Z05 A;  2OA4 A;  2FE3 A;  4KN4 X;  1SFE A;  5BQT A;  1QBJ A;  2W25 A;  3TDZ C;  3LQQ A;  1KYZ A;  3MWM A;  2OQG A;  3FWE A;  1XB4 A;  4NHJ A;  2CW0 F;  5DYM A;  3GZ5 A;  2KIU A;  3N4M A;  5JFR A;  3IRR A;  2NS0 A;  2AS5 F;  1T98 A;  2DTR A;  3ERE D;  5D6E A;  1IN4 A;  4BHP A;  1ZGA A;  2O3F A;  3WGH A;  2STT A;  4XLN F;  2ZCW A;  1V3F A;  4CYD A;  1KQ8 A;  4PDK A;  4ESF A;  2L01 A;  5D8K B;  3L7W A;  2CWE A;  3DXJ F;  5DDG A;  1MJ9 A;  1EH8 A;  3SZT A;  5LRR A;  3JW4 A;  4I98 B;  4XSZ F;  4U7B A;  2QEN A;  5ICG A;  1F9N A;  5ICC A;  5ILV A;  2CGP A;  3ECO A;  5J8C A;  3EET A;  3E6D A;  1W7P B;  3L2C A;  4RGS A;  3QP5 A;  1HXD A;  1O57 A;  2FSW A;  2HTS A;  4RB0 A;  2LNB A;  3WOD F;  4P55 A;  5BS6 A;  5LHI A;  1FYL A;  4JBA A;  1RZ4 A;  1GXP A;  2HYF A;  5CVV A;  1YTY A;  1FBQ A;  2RC4 A;  2P7C B;  5D5X B;  4FX4 A;  1F5T A;  1H9T A;  3VB2 A;  2DPU A;  2F2E A;  2PI0 A;  2C6Y A;  2XIG A;  2YU3 A;  1IUY A;  3M8E A;  4HW0 A;  3LAP A;  2FMY A;  1TLH B;  1UB9 A;  2W85 A;  3LST A;  1IAW A;  2PFB A;  1B4A A;  3EYY A;  2BEO A;  4HBL A;  3HRS A;  4GYG A;  2ZNZ A;  3EQL F;  2HQR A;  5CYV A;  4FX0 A;  2CSO A;  4G94 A;  1SD5 A;  2QQB A;  2TDX A;  4LB5 A;  4L0Z B;  4GYI A;  3FXU A;  2Z5U A;  4PGH A;  1K78 A;  1W5T A;  1R1U A;  3WTY C;  3SFZ A;  3MQ0 A;  2LDU A;  2Z9O A;  5CLS A;  1IZ1 A;  1ZH5 A;  2A6E F;  2HKO A;  1BC8 C;  3HTU A;  2YX7 A;  2CQK A;  3F8B A;  1FP1 D;  1ZRC A;  2KIM A;  2XRN A;  2QWW A;  2Y48 A;  3K69 A;  2XHK A;  4HX8 A;  2P8T A;  2IJL A;  4KNY A;  1TW3 A;  2O8X A;  1TQP A;  4LFU A;  2GQQ A;  2DQR A;  2V1X A;  5AON A;  1H0M A;  4AIH A;  3JTH A;  2DK5 A;  4R79 A;  4YII A;  4KMF A;  2J5P A;  3AAF A;  3FF5 A;  1LDD A;  2DU9 A;  2HQN A;  3JAM Z;  3PQK A;  1IN5 A;  1U5T A;  1BJA A;  3ZN0 A;  1FT9 A;  5LGU A;  2M8E A;  4Q5S F;  1OKR A;  3I5U A;  3R0A A;  1R7J A;  4P96 A;  2QBY B;  2ETH A;  1XGS A;  3HRU A;  3D5L A;  5CVR A;  5HDK A;  4RGX A;  3ZPL A;  4JQF A;  2K86 A;  2MLK A;  1E17 A;  2YPR A;  2X0L A;  4GO1 A;  3GXO A;  3BWG A;  1WI9 A;  3BDD A;  2NAZ A;  4OIO F;  4EJU A;  2P5V A;  4KUM A;  4P9U A;  4BHB A;  2V1U A;  3NQO A;  1MZB A;  2PMU A;  4EQQ A;  1FZP B;  3BP8 A;  1FP2 A;  2HR3 A;  3F23 A;  2VBX A;  2LF7 A;  2V79 A;  4RB2 C;  1D5V A;  1T0F A;  1KQ9 A;  1S8N A;  5L3F A;  3F8F A;  1SMY F;  3HYI A;  2BV6 A;  2DFI A;  1JGS A;  4KIG A;  3QU6 A;  5LGT A;  2PMH A;  2Z33 A;  5LGN A;  5ILS A;  4KYW A;  1GVJ A;  2CO5 A;  1BBY A;  4HOB A;  2OD5 A;  3ZMT A;  1REP C;  4EJW A;  1U8R A;  5E18 F;  5K5O A;  5A2Q Z;  1SFX A;  4HA8 A;  2WTE A;  3D0S A;  4ZYE A;  2MBF A;  5IT3 A;  3ML6 A;  2A69 F;  3E5Q A;  5D4S A;  2W84 A;  2L54 A;  1U2W A;  5FD5 A;  4HF2 A;  1BI2 A;  2RV8 A;  2GAU A;  1XGO A;  4L5I A;  4ENN A;  2QQA A;  4A2U A;  3KP5 A;  1IN6 A;  3RKX A;  5JVT A;  1IXS B;  2ZNY A;  2XAJ A;  2H27 A;  3GFJ A;  2HZT A;  1R1T A;  4I0A A;  2PEX A;  2L02 A;  4CO8 A;  1ULY A;  3VEP A;  1KA8 A;  2L3D A;  1SFU A;  2XUB A;  3I64 A;  3L9F A;  3V8J A;  4M6Y A;  1RUO A;  3F22 A;  4CZZ A;  2G9W A;  2P5L C;  3EDP A;  2IW5 A;  2B0L A;  5HOO A;  3HHH A;  2VN2 A;  1Z7U A;  1R5G A;  2Q0O A;  2Q8K A;  3DP7 A;  4O5V A;  4A0Y A;  1QZY A;  3GFI A;  1ZLJ A;  3T5X A;  4OIQ F;  2BGC A;  2G7H A;  3CUQ C;  3QP6 A;  3O3K A;  4EJT A;  1P2F A;  1O3T A;  3TGN A;  2VBY A;  3MZY A;  1TW2 A;  5KVR A;  4Y15 A;  2JRT A;  4WXC A;  3V8K A;  2P6T A;  1U6G A;  4G7O F;  3EUH A;  3V8L A;  2BBY A;  4LMY A;  2PN6 A;  1FOK A;  1K79 A;  1P6R A;  4RB3 C;  1XDU A;  5IT9 K;  2A5Y B;  2GXB A;  5E8G A;  3LA7 A;  2OZU A;  1YQA A;  4IRI A;  2P5K A;  3RPU A;  3BJA A;  2DAO A;  2XRO A;  1ZGJ A;  5CJ9 A;  4IRH A;  4MQV A;  3GEZ A;  3RKY A;  2F5D A;  2RGV A;  5HS7 A;  4A5N A;  1XDS A;  1UHW A;  2RKH A;  2RQP A;  3WE3 A;  3LAJ A;  3V7C A;  1YS6 A;  2K4B A;  4M71 A;  3CLO A;  4WWC A;  5IT9 Z;  1G3W A;  2R3S A;  1CF7 B;  3W6J B;  4KIC A;  2DQL A;  1P4X A;  2EFN A;  3BY6 A;  2HKX A;  4L5J A;  2CYY A;  2GZW A;  4PZJ A;  4ZYH A;  1F4K A;  3E6B A;  1W7P A;  3WG9 A;  5EEG A;  3MCZ A;  1OPC A;  3WTW C;  2QLZ A;  5E8I A;  1HW1 A;  3L09 A;  2PG4 A;  1BI1 A;  4HF0 A;  4YG2 F;  1TNS A;  1XGN A;  4G7Z F;  1ODD A;  1F1Z A;  2HFH A;  4ZYD A;  2DBB A;  1IXR C;  4S04 A;  1IF1 A;  3I58 A;  3V7R A;  1U78 A;  2ZME B;  3IWZ A;  3M9A A;  1BOA A;  1USS A;  2WC2 A;  5HS8 A;  4HX7 A;  2O61 A;  4FT8 A;  4EMS A;  2GXG A;  3F8C A;  2XGX A;  3E6C C;  2P4W A;  4NB5 A;  4PCQ A;  3Q9S A;  2Y0M A;  3LQR A;  3ECH A;  1BI3 A;  4OU0 A;  4HYE A;  1XCB A;  1FX7 A;  3W6K B;  2VBZ A;  3VFZ A;  2MH2 A;  3TKY A;  3IKT A;  4ENM A;  5K5R A;  2F5C A;  5H6R A;  4MEY F;  3E97 A;  4IRG A;  2LF8 A;  1JXS A;  1ZAR A;  1S6L A;  2VOP A;  2XV4 S;  2FRH A;  1ZLK A;  2G7U A;  1FY7 A;  1LB2 A;  3WTT C;  2HOE A;  4IPA A;  2RDP A;  3T1B A;  4A0Z A;  3U9G A;  2O0Y A;  1R36 A;  4Q47 A;  3B73 A;  2HGC A;  3KP6 A;  4IJA A;  3I59 B;  5D6F A;  1KU3 A;  5HLI A;  4OOI A;  3C3W A;  1J5Y A;  2HEO A;  1L0O C;  2NNN A;  4N9H A;  3H92 A;  4L18 B;  1FC3 A;  2PLY A;  2D1H A;  5LHH A;  1HQC A;  3SQN A;  2EWN A;  1QPM A;  5DUI A;  3WTZ A;  1Y0U A;  4MQ9 F;  3IKV A;  4K2E A;  3DKW A;  1FBU A;  3BJ6 A;  1Z6R A;  5HS9 A;  1SD4 A;  2UWM A;  1Q1H A;  3ISP A;  4RGR A;  3TO7 A;  1YYV A;  1ZN2 A;  1U5T C;  1BIB A;  3F8N A;  1PUE E;  2XAQ A;  2QBY A;  4XSX F;  2VON A;  1QZZ A;  4MGR A;  1B1B A;  4XLP F;  4RAY A;  5BPI A;  3S2W A;  1R5H A;  2IP2 A;  3ZQ7 A;  4HAM A;  5J8F A;  2KIF A;  3KLO A;  2VE8 A;  3CJN A;  2AXL A;  2EB7 A;  4I02 A;  4LG0 B;  3ELK A;  3BPX A;  2L4A A;  4R8H A;  4IHT A;  3WU0 A;  2GA1 A;  1J9I A;  3ZMS A;  1LNW A;  3KP7 A;  5DCM B;  4RGU A;  5D8L B;  1ZRD A;  3MAJ A;  3B02 A;  3E5U A;  1I5Z A;  3ABU A;  5ICF A;  5HDN A;  2EFP A;  2KJB A;  1P4A A;  5TRD A;  4KMU X;  3GUD A;  1RUN A;  5FFX A;  3HRT A;  2H09 A;  2IA1 A;  2CG4 A;  4P9F A;  1S7A A;  4OIP F;  1QGP A;  3GX4 X;  2NNY A;  4S05 A;  4KDP A;  2RN7 A;  1BC7 C;  4CIC A;  4HQM A;  4UXN A;  1MJB A;  3KLN A;  2V1D A;  3RYP A;  4I7H A;  1LVA A;  4UVA A;  3CTA A;  2XAS A;  5ERI A;  5LLQ A;  4IHS A;  4ENJ A;  4WCG A;  2DI3 A;  4KFC A;  2KRF A;  1AWC A;  3TDU C;  4AWX B;  1JHH A;  3I53 A;  1J59 A;  1J75 A;  2IA2 A;  1D8J A;  4O3M A;  1RNL A;  4L9N A;  3I0T A;  3HSF A;  2D2W A;  4XRF A;  1X3U A;  3ZMV A;  3C7J A;  3RYR A;  1W4M A;  3KZZ A;  3TOB A;  4NQW A;  3I4P A;  2QUF A;  2EV0 A;  1ZRE A;  2M45 A;  3COA C;  2QQ9 A;  1FSH A;  3Q5F A;  3TO9 A;  4L0Y B;  2MA3 A;  3KP3 A;  1XMA A;  2XKO A;  2VE9 A;  2EV5 A;  1OYY A;  1HKQ A;  4PGG A;  2EA2 A;  2FML A;  2ESH A;  4R1H A;  2M87 A;  2W57 A;  1XSV A;  3J81 K;  2DT5 A;  5CVI A;  3QPH A;  4YIF A;  1LEA A;  2V6C A;  4RAZ A;  5F64 A;  4CXF A;  2EK5 A;  2VC1 A;  3IC7 A;  4MTE A;  2ACJ A;  3KET A;  1KQ0 A;  1JHF A;  5TJJ A;  1U3E M;  2F5E A;  5FB2 A;  4Y17 A;  3E6M A;  1BN5 A;  1C0W A;  2H94 A;  3IHU A;  1Z91 A;  2VOD A;  3WU1 B;  3GFM A;  2HDC A;  2JZY A;  2D1V A;  1CGP A;  1JE8 A;  3I54 A;  4HV5 A;  1HBX G;  4ZYG A;  1YG2 A;  4U88 A;  1O3Q A;  5F1R A;  3H3Z A;  4ZH4 F;  3J7A O;  4E70 A;  1K78 B;  3DEU A;  3L00 A;  3RIR A;  1CF7 A;  3F8M A;  2RNJ A;  2QYO A;  4AIJ A;  2UZK A;  4M9S A;  5L3E A;  2EFQ A;  5DD4 A;  1TNT A;  2A61 A;  2VXZ A;  5CVJ A;  3J80 K;  4F7Z A;  3CDH A;  4G6Q A;  1PDN C;  3P9K A;  3OV8 A;  4HDU A;  1Z6T A;  2O03 A;  1TQI A;  2HWV A;  1IN8 A;  1EH6 A;  4D0P A;  5DCF A;  2FEZ A;  4TV7 A;  5JI6 A;  1XN7 A;  5FO5 A;  1B9N A;  1SD6 A;  2MD5 A;  4ETS A;  3HTS B;  3VOD A;  2JSC A;  3J80 Z;  3K1M A;  1NHA A;  3ABT A;  4LLG F;  3LA3 A;  5DV5 A;  2ZME A;  1U5T B;  2PBI A;  2FNA A;  3C1D A;  3BRO A;  3K9T A;  1ZG5 A;  2VBW A;  4LGW A;  2IT0 A;  4B8X A;  2DO7 A;  1ZG1 A;  2J5O A;  3FMR A;  3KEQ A;  1OYW A;  3QOP A;  1S7O A;  5D5V B;  4UUV A;  3MZH A;  2P6S A;  4LD5 A;  4I0B A;  4EM1 A;  3FMQ A;  1UHM A;  6PAX A;  1FBS A;  2Z99 A;  1T2K A;  1LEB A;  3GVA A;  2IA0 A;  3JTG A;  1ONV A;  4HLY A;  2OAZ A;  2EFW A;  2K27 A;  1XSX A;  3SXY A;  1QO0 D;  3GWZ A;  1GHC A;  4BYY A;  4LK1 F;  3T8R A;  1MDM B;  2FF4 A;  3R61 A;  2LKP A;  3M8F A;  1W5S A;  1BIA A;  1O7F A;  3ZP5 A;  1TBX A;  3I71 A;  2F5F A;  1QNT A;  1YLF A;  3I59 A;  4CGZ A;  4UV8 A;  4EVI A;  4XBF A;  3NRV A;  4L9T A;  3K0L A;  4YFN F;  1WQ2 A;  2QVO A;  5FLX K;  3SZP A;  1AOY A;  4WF2 A;  1YIO A;  2IRF G;  4QWQ A;  1I1S A;  2ZO4 A;  3HHG A;  2UXX A;  4IXA A;  5DUK A;  1MKM A;  4B09 A;  3T0Y A;  3FZV A;  4G9Y A;  5EEH A;  4ENK A;  4RS8 A;  3KCC A;  2HTJ A;  2CFX A;  1B6A A;  3FXQ A;  3IWF A;  3P9C A;  4KT5 C;  5K5Q A;  5D5U B;  3F72 A;  3N97 A;  1V4R A;  1FLI A;  1ZYR F;  4G6D A;  5JHU A;  1LDJ A;  2ISZ A;  2O6G E;  3RI4 A;  2V9V A;  3RJP A;  5JR3 A;  1WRJ A;  5E20 A;  1ON2 A;  4GCV A;  1HST A;  2A07 F;  2MLG A;  3P9I A;  4G8X A;  4LB6 B;  2JPB A;  3R6S A;  5E1W A;  3LWF A;  5BPD A;  4LG0 A;  1S29 A;  1PP7 U;  1IXC A;  4EM0 B;  3BPV A;  1O7L A;  3FHZ A;  4A0X A;  2FA5 A;  2MH9 A;  2PQ8 A;  2XAH A;  1IW7 F;  5DCM A;  2OBP A;  2VT3 A;  1G4D A;  4UVC A;  4LK0 F;  4MEX F;  1TQM A;  4MHG A;  3TOA A;  2FQ3 A;  5L3B A;  5H20 A;  2EV6 A;  3K2Z A;  2IVM A;  3GW2 A;  2MC3 A;  4AIK A;  2WWY A;  2Y75 A;  1PP8 F;  4MTD A;  3KP2 A;  3OOP A;  1I27 A;  4WX9 A;  2X4H A;  4CDG A;  4Q48 A;  1HKS A;  2R7F A;  4EJV A;  3R0J A;  1D3Y A;  2K02 A;  1FNN A;  3M7G A;  5CVU A;  1T39 A;  2E7X A;  2M1B A;  3V7S A;  1KYW A;  3JSP A;  2GA2 A;  2H6B A;  4I09 A;  4GGG A;  1DDN A;  4HQE A;  1FSE A;  2BYV E;  4OIR F;  4BAY A;  3CO6 C;  5HLH A;  1KU2 A;  5D4R A;  2COM A;  1IRG A;  4DQ2 A;  1UFM A;  2JT1 A;  3K1N A;  1R23 A;  1T6S A;  1KU7 A;  4EJO A;  3K1P A;  2E7W A;  2DLL A;  2LSO A;  4DNC A;  3HIF A;  1RIO H;  2STW A;  1FWZ A;  1HW2 A;  1EH7 A;  3WTU C;  2YSR A;  1ZAO A;  2RVC A;  1E2X A;  4IF4 A;  1G3S A;  3TQN A;  5E1Z B;  1BI0 A;  3Q9V A;  2XVC A;  3GLX A;  4YFK F;  1ZG3 A;  1K7A A;  2NRA C;  2P7V B;  2ZXJ A;  4BH9 A;  2DK8 A;  1STZ A;  3T8T A;  1DPU A;  1WSU A;  2ESN A;  4L9V A;  2QM3 A;  3ZMU A;  1W7P D;  3CUQ B;  3DFG A;  4ZZD A;  4ZZL A;  5LEJ A;  4P5O A;  2UXN A;  3LFK A;  3GYH X;  1J2X A;  3WGI A;  4L9J A;  1GXQ A;  1D8K A;  5FD6 A;  4U7D A;  3MEX A;  3GO5 A;  1BM9 A;  3VOE A;  1SD7 A;  1YW7 A;  4AVP A;  2W24 A;  2E1N A;  2NYX A;  2VOO A;  1ON1 A;  3NEU A;  2A6H F;  3C18 A;  2XAG A;  1P92 A;  5AIP A;  2A3S A;  3HSE A;  1R00 A;  2L4M A;  3KZY A;  3KP4 A;  1HSJ A;  1MD0 A;  1OYI A;  5BOX A;  3JAM K;  3CO7 C;  4UHT A;  3HSR A;  1KU9 A;  1QQI A;  2M5W A;  2ADU A;  1G3Y A;  5BMZ A;  2IPQ X;  2ZJ2 A;  3RPQ A;  4QLC U;  3FM3 A;  3PFI A;  4KIF A;  3U1D A;  3ULQ B;  4EM2 A;  4ESB A;  1FYM A;  2FBK A;  1T38 A;  4M74 A;  5K1Y A;  1B9M A;  4Q4Z F;  1UCR A;  3QRF F;  1IRF A;  2OQR A;  4A12 A;  4OMZ A;  1YW9 A;  4UNO A;  1A04 A;  4EGY A;  4LJZ F;  2EA4 A;  4EGZ A;  3O6B B;  5L3G A;  3WE2 A;  5LBQ A;  3GF2 A;  4M72 A;  3CUO A;  3SHF A;  3RTR A;  3ZMZ A;  3F3X A;  1XD7 A;  5E17 F;  3BOQ A;  1LJ9 A;  2BE5 F;  2R7D A;  4GXO A;  3P7N A;  4KA4 A;  4KIB A;  3ZN1 A;  1J7K A;  3J81 Z;  4ASN A;  3ROU A;  3EYI A;  4WXD A;  5ILU A;  4I2O A;  5A2Q K;  1MDM A;  1XMK A;  4RB1 A;  4M73 A;  1MGT A;  2M30 A;  4FHT A;  3WGG A;  3KE2 A;  3WTV C;  2QZ8 A;  1J0R A;  3F6O A;  1ZRF A;  4AD9 A;  2HS5 A;  4M9Z A;  2GWR A;  1OR7 A;  1KGS A;  4O6J A;  4A5M A;  1UST A;  2ISY A;  1I1G A;  5ED4 A;  1G6N A;  4IVN A;  3O2P E;  2FU4 A;  3LA2 A;  4ON0 A;  4OIN F;  4CHU A;  5LRS A;  2VT2 A;  4N9I A;  2FXA A;  3FMS A;  1LQ1 A;  1S3J A;  4ESJ A;  3MFK A;  3BJO A;  3DV8 A;  3PQJ A;  2PJP A;  2FOK A;  2EFO A;  5FGM A;  5E1X A;  5LHG A;  2YR2 A;  3ZMD A;  1I6X A;  1Z1D A;  4Z2Y A;  2FBI A;  1IN7 A;  1HKT A;  4BHC A;  1TTY A;  4N0B A;  2KKO A;  4WK8 F;  4JK1 X;  4KN7 X;  3JSO A;  1DUX C;  2DW4 A;  1XSD A;  1LDK B;  4U0V A;  1RI7 A;  2FBH A;  4OMY A;  2A68 F;  3QPT A;  5HVQ C;  5HLG A;  1H9G A;  3DPT A;  4H0E A;  2ZBK A;  1MJA A;  2DPD A;  4M9X A;  1FYK A;  2H6C A;  3E3V A;  2XKP A;  3F21 A;  1DP7 P;  3F6V A;  3HOS A;  1SMT A;  5FFZ A;  2WV0 A;  5J6X A;  3QU3 A;  1L3L A;  2ELH A;  4HX4 A;  1SAX A;  3H3U A;  5F6F A;  3BZ6 A;  3WTX C;  3IRQ A;  3KEO A;  4MNU A;  4UVB A;  2YX4 A;  1YO5 C;  4I01 A;  4HLX A;  4HZF A;  3RDI A;  5H6Q A;  1DPR A;  1R1V A;  5AIQ A;  3HOT A;  4BQA A;  1YFH A;  1WKM A;  3HUG A;  1O3S A;  4HDV A;  5D5W B;  1B59 A;  5HDG A;  2K7L A;  2JTV A;  3DQV C;  2Z3Y A;  3QAH A;  1G3T A;  4YFX F;  1YS7 A;  1R58 A;  3FX3 A;  4Y13 A;  2OU2 A;  3DPL C;  2FNP A;  3GFL A;  2KJC A;  4BXU A;  2VC0 A;  5DEQ A;  2E1C A;  2EJR A;  1ZHF A;  5DD8 A;  3R4K A;  1OMI A;  1HW5 A;  3E5X A;  5L3C A;  3R60 A;  1FPQ A;  4G7H F;  3DF8 A;  5LEK A;  1XGM A;  2XAF A;  3U2R A;  1P4W A;  3G3Z A;  1WWX A;  1VTN C;  4HF1 A;  3FM5 A;  2Q2E A;  2GIV A;  2ZKZ A;  4UV9 A;  1K6O A;  1R22 A;  2OZ6 A;  3GZ6 A;  4LLN A;  3HRM A;  3IL2 A; 
#chains in the Genus database with same CATH topology
 2R7O A;  1XCV A;  4KIT B;  2PMZ A;  5GTI C;  3HPG A;  1D1A A;  3ABM H;  3V4G A;  1O3R A;  2D45 A;  3HBL A;  4BXF A;  1AU7 A;  3OYG A;  2GM4 A;  3PNY A;  4BBS J;  5FLX Z;  3S14 J;  3M1E A;  2DA1 A;  3REO A;  3SDB A;  2K4J A;  4EV0 A;  5KK1 A;  4LLL A;  1VZ0 A;  1JT6 A;  2DA5 A;  4U0Y A;  3KFW X;  2I5U A;  3Q0W A;  4BJ5 C;  4A3E J;  2AQE A;  4M6X A;  2G0E A;  3FXR A;  1I50 J;  4HV6 A;  3PNV A;  3TO6 A;  2ZFW A;  1FTZ A;  1VFC A;  1B8I B;  4XKW A;  2V6E A;  4A6D A;  3G1M A;  3RKW A;  3ZR8 X;  3WTS C;  2JPC A;  2XPU A;  3PJR A;  2O5R A;  4X1E A;  2CW7 A;  3ZXS A;  4A6E A;  4I6Z A;  1Z9C A;  4IO9 F;  4BNC A;  3S1M J;  2EIJ H;  1WFX A;  2DDA A;  3G73 A;  3BG9 A;  4E7I A;  1EV7 A;  4V19 K;  2HYG D;  3OIO A;  1YW8 A;  4WXH A;  2LD5 A;  3CUQ A;  1OCR H;  3ONQ A;  2FJ1 A;  5L3D A;  4IZZ A;  3S3N A;  5ICE A;  2ID6 A;  2RAE A;  4U0W A;  3OL3 A;  1Z7L A;  2BY2 A;  4CCM A;  1Z05 A;  3M4O J;  2OA4 A;  2ECC A;  5EF6 A;  3JRD A;  1AHD P;  2FE3 A;  1VQP I;  5B66 C;  4FE7 A;  2VL8 A;  3FXO A;  4KN4 X;  1SFE A;  3GTL J;  5BQT A;  1QBJ A;  3OYC A;  2W25 A;  4N4O B;  3TDZ C;  3LQQ A;  2HU9 A;  1KYZ A;  3MWM A;  2OQG A;  3SDG A;  3FWE A;  3K4N A;  2IGK A;  4B4C A;  2O7O A;  1K83 J;  1YX3 A;  5F08 A;  3E7L A;  1Z21 A;  2HQ5 A;  2BY0 A;  3S15 J;  5GAD J;  1XB4 A;  4NHJ A;  2CW0 F;  5DYM A;  3GZ5 A;  4RLF A;  1DU6 A;  4XLC A;  2KIU A;  3N4M A;  5JFR A;  3IRR A;  2NS0 A;  2AS5 F;  1VF9 A;  1T98 A;  2DTR A;  2N8G A;  2Y30 A;  4JX4 A;  3ERE D;  1YE9 A;  2TCT A;  3VYS B;  1N25 A;  2YS9 A;  3PO2 J;  3GLL A;  3KYD B;  1IN4 A;  5D6E A;  3TMO A;  1ZGA A;  4BHP A;  5E3M A;  2O3F A;  2VKH A;  3N05 A;  3WGH A;  1A6Q A;  5IP7 J;  2WA0 A;  3L2V A;  1Y1W J;  2MAB A;  2STT A;  4XLN F;  2ZCW A;  2NVU B;  1V3F A;  2XDV A;  4E7J A;  1ZTR A;  4CYD A;  1KQ8 A;  4PDK A;  4BJT A;  4ESF A;  3GTM J;  2L01 A;  4IL6 C;  5D8K B;  3L7W A;  2CQQ A;  2CWE A;  5DS9 A;  2DA6 A;  3DXJ F;  5DDG A;  2BXY A;  2V9K A;  1MJ9 A;  1EH8 A;  2XRL A;  2KL4 A;  1UEL B;  2DOD A;  9ANT A;  3SZT A;  4PJL A;  4XK4 A;  5LRR A;  3A03 A;  1WJD A;  3JW4 A;  2V9P A;  4I98 B;  3QOD A;  4XSZ F;  4U7B A;  1SAU A;  2QEN A;  3OIP A;  5ICG A;  2XB0 X;  1F9N A;  5ICC A;  1G8X A;  5ILV A;  2CGP A;  1FIP A;  5F0C A;  3AG4 H;  2L5Q A;  2MSY A;  3GCM A;  3ECO A;  5J8C A;  5EZG A;  3EET A;  2EIM H;  1WJC A;  2CUJ A;  3E6D A;  1W7P B;  2RNG A;  3L2C A;  4RGS A;  3QP5 A;  1HXD A;  3ERM A;  3OOU A;  1O57 A;  2CV1 A;  3PIO F;  2FSW A;  2HTS A;  4RB0 A;  5KNL A;  3BR0 A;  2LNB A;  3WOD F;  4P55 A;  2L9S A;  5IOY A;  5BS6 A;  4LG3 A;  3GZN B;  5LHI A;  2NOG A;  4FE4 A;  1FYL A;  2WAQ N;  4JBA A;  1RZ4 A;  1GXP A;  4XM3 A;  3DEW A;  3TED A;  2HYF A;  2DYS H;  5CVV A;  1YTY A;  4AU7 A;  3VYR B;  3DPU A;  1FBQ A;  2E71 A;  2XAU A;  3J7Y J;  2RC4 A;  2P7C B;  2R93 J;  2K5C A;  1Y0N A;  1SVM A;  5D5X B;  4FX4 A;  1F5T A;  1R71 A;  1H9T A;  1MSF C;  3VB2 A;  1TWF J;  4CYC A;  2MGQ A;  2DPU A;  3JRH A;  2X1E A;  2F2E A;  1WVR A;  2PI0 A;  2C6Y A;  3F0C A;  2XIG A;  2YU3 A;  1IUY A;  3M8E A;  1HF0 A;  4HW0 A;  2VIX A;  1APL C;  2R5Z B;  4OWR B;  1D1B A;  2FOW A;  3W2V A;  3LAP A;  2FMY A;  1TLH B;  1UB9 A;  1R4N B;  4LIV A;  3DU5 A;  2LY1 A;  3B6C A;  1D0Z A;  3VSK A;  2M3A A;  1OQY A;  2W85 A;  1IGN A;  4FET A;  3LST A;  1PVE A;  4DYC A;  2BW3 A;  1DP3 A;  1IAW A;  2PFB A;  2CV0 A;  4BY7 J;  1B4A A;  4D7N A;  1GUU A;  2ME0 A;  2L9R A;  1J09 A;  3EYY A;  3RZO J;  3CF2 A;  2BEO A;  2E1O A;  2XGE A;  1RC9 A;  3IAS 2;  4HBL A;  3HRS A;  4GYG A;  2ZNZ A;  2GLO A;  1E3O C;  1OLT A;  3EQL F;  2HQR A;  5DTD A;  5CYV A;  4FX0 A;  2LKS A;  2CSO A;  2LRD A;  4MFD A;  1BJZ A;  4G94 A;  1SD5 A;  2QQB A;  2TDX A;  4LB5 A;  3M3Y J;  2UUZ A;  4XKC A;  4L0Z B;  4PUS A;  1CQT A;  2P81 A;  3FXU A;  2Z5U A;  4GYI A;  3JR9 A;  3BG3 A;  4PGH A;  1K78 A;  1W5T A;  1R1U A;  1T56 A;  3WTY C;  3PFY A;  2K9N A;  3SFZ A;  3MQ0 A;  1X4O A;  2LDU A;  1VQ4 I;  2Z9O A;  5CLS A;  1IZ1 A;  4B44 A;  1ZH5 A;  2A6E F;  3LSH A;  2BHY A;  2HKO A;  3JRB A;  5KCM A;  1BC8 C;  3HTU A;  2YX7 A;  2CQK A;  3CP2 A;  1OR7 C;  3F8B A;  3PSI A;  1TWG J;  1FP1 D;  2XPV A;  2ZXW H;  2V4J C;  4FCY A;  1UAA A;  4YIR X;  2HXI A;  3H5N A;  1RR7 A;  1ZRC A;  4LIT A;  1TWC J;  2KIM A;  2XRN A;  2QWW A;  3H3V K;  2Y48 A;  3K69 A;  4BEH B;  2IAI A;  2XHK A;  2P8T A;  2ELJ A;  4HX8 A;  3ZQI A;  2IJL A;  4BQN A;  4HNV A;  2HNH A;  1TW3 A;  4KNY A;  2B63 J;  3A2K A;  2O8X A;  1PUF B;  1VND A;  2E2H J;  4YRV A;  1TQP A;  4A3L J;  4LFU A;  2GQQ A;  3HDD A;  4DBR A;  2DQR A;  2V1X A;  5AON A;  3ZQF A;  5GP9 A;  1H0M A;  3CMA I;  1A36 A;  3OYD A;  4W1U A;  5E3L A;  4A3M J;  4RDU A;  2ELK A;  1BL0 A;  4AIH A;  1W5C C;  3CCU I;  3M8J A;  2QSG X;  3BZC A;  2DK5 A;  3JTH A;  4R79 A;  4YII A;  2O8K A;  4A3G J;  4KMF A;  5CPR B;  2CUF A;  1NTC A;  5EYR A;  2J5P A;  1GV5 A;  3FF5 A;  3GBG A;  3AAF A;  2MYS A;  4CA0 A;  1LDD A;  2DU9 A;  4AYB N;  2HQN A;  3JAM Z;  3PQK A;  1IN5 A;  1U5T A;  3E0J B;  1BJA A;  4IHV A;  2DA3 A;  2EIK H;  3ZN0 A;  1FT9 A;  5FKN A;  3JRC A;  5LGU A;  5GTH C;  2M8E A;  4E4H A;  4Q5S F;  1OKR A;  3I5U A;  3R0A A;  2X9D A;  1R7J A;  2VB6 A;  4P96 A;  4UB8 C;  2EIL H;  2QBY B;  2ETH A;  1XGS A;  3HRU A;  3JRF A;  3D5L A;  1IV6 A;  5CVR A;  5HDK A;  4RGX A;  2I8D A;  3KZI C;  3ZPL A;  3ZQQ A;  1YIJ I;  3FIW A;  5IYB J;  3CDL A;  4JQF A;  3H9G A;  2K86 A;  3A01 A;  2MLK A;  1E17 A;  2JA2 A;  2YPR A;  5IP9 J;  2X0L A;  3P5J A;  3DBL B;  4GO1 A;  3JRG A;  5LFA A;  2VJ4 A;  1FMV A;  3VPR A;  3GXO A;  3BR6 A;  3BWG A;  1WI9 A;  1MND A;  2EH3 A;  3AG2 H;  4KT6 A;  2R7Z J;  1Y56 A;  3BDD A;  2NAZ A;  4OIO F;  4EJU A;  2P5V A;  4C30 A;  1X1C A;  4KUM A;  3A0H C;  2OCE A;  3TP0 A;  4P9U A;  4B43 A;  3WU2 C;  1LE8 B;  4BHB A;  3QQA A;  2V1U A;  3NQO A;  4C3I J;  1MZB A;  2PMU A;  4EQQ A;  1FZP B;  3HOW J;  4RA2 A;  3BP8 A;  3OYB A;  4XOT A;  1FP2 A;  2HR3 A;  3PIP F;  1ZR4 A;  3CME I;  3DTK A;  3KIO A;  4ZDP A;  4ZJZ A;  5JLW A;  1QRY A;  2VBX A;  3F23 A;  1X3Z B;  2LF7 A;  1YI2 I;  3CC2 I;  2PJR A;  2F6C A;  2V79 A;  4RB2 C;  2K9S A;  3KYL A;  2LY9 A;  1D5V A;  1T0F A;  2W82 A;  1KQ9 A;  1S8N A;  5L3F A;  4IQ4 A;  3F8F A;  1SMY F;  2JA7 J;  3HYI A;  2BV6 A;  2DFI A;  1JGS A;  3HOU J;  4KIG A;  2K9L A;  2VUM J;  1VQN I;  3QU6 A;  2W4S A;  5LGT A;  1IO2 A;  2LOO A;  2PMH A;  2Z33 A;  4UB6 C;  2BY3 A;  5LGN A;  1LFU P;  2QF7 A;  5ILS A;  2AHQ A;  4KYW A;  1GVJ A;  4JX5 A;  2CO5 A;  1BBY A;  3J7Z I;  4HOB A;  2OD5 A;  3ZMT A;  4YEL A;  5IP6 A;  1S5L C;  4EJW A;  1REP C;  1U8R A;  2QKL B;  5E18 F;  2JA5 J;  2COB A;  5K5O A;  5A2Q Z;  1SFX A;  4HA8 A;  2WTE A;  3D0S A;  4UY8 I;  1GVD A;  1H89 C;  4ZYE A;  2MBF A;  5IT3 A;  4NBQ A;  3ML6 A;  1JJ8 C;  5DM6 F;  2A69 F;  3E5Q A;  5D4S A;  3DLA A;  4U87 A;  2W84 A;  5EG0 A;  2LR8 A;  1WJ5 A;  2JMW A;  2L54 A;  5GPA A;  3OYJ A;  1U2W A;  2JQ7 A;  5FD5 A;  5KAF C;  4HF2 A;  1YJW I;  1FEX A;  1VQ6 I;  1BI2 A;  2RV8 A;  4IQJ A;  2MW8 A;  2GAU A;  1FIA A;  4PJJ A;  1XGO A;  4L5I A;  2O9L A;  1UMQ A;  4ENN A;  1Y6I A;  2QQA A;  4A2U A;  3UR3 C;  1FOY A;  3KP5 A;  1IN6 A;  1ACI A;  3RKX A;  1LFB A;  5JVT A;  1H8A C;  1IXS B;  2CUZ A;  2ZNY A;  2XAJ A;  3HPH A;  4XOP A;  4AC0 A;  2H27 A;  3GFJ A;  2HZT A;  3DEE A;  1R1T A;  4I0A A;  2PEX A;  2L02 A;  5J3L A;  4CO8 A;  1ULY A;  4Y52 J;  4BDZ A;  3VEP A;  1KA8 A;  2E5N A;  5F0F A;  2L3D A;  1SFU A;  3BR3 A;  2XUB A;  3VYU B;  4NQW B;  3I64 A;  3L9F A;  4LIU A;  3V8J A;  4QPO A;  4M6Y A;  1RUO A;  3FHN A;  3F22 A;  2G9W A;  2X6O A;  4CZZ A;  1X19 A;  3EDP A;  2P5L C;  2IW5 A;  1B8I A;  1BR1 A;  2B0L A;  5HOO A;  2H8R A;  3HHH A;  3BQZ A;  2VN2 A;  1Z7U A;  1R5G A;  1Y1V J;  2L2O A;  2M4K A;  1MMD A;  1IJW C;  3ABL H;  3NAR A;  3DU6 A;  2Q0O A;  2XF5 A;  2R7W A;  2Q8K A;  3H36 A;  3DP7 A;  1W1W E;  4O5V A;  3DKX A;  2F48 A;  2K3P A;  1QZY A;  4A0Y A;  3GFI A;  2E34 A;  1ZLJ A;  3GTO J;  2WAE A;  3LSM A;  2BOL A;  2R7T A;  3T5X A;  4OIQ F;  2BGC A;  1RR8 C;  1P9Q C;  2JN6 A;  2G7H A;  3CUQ C;  3QP6 A;  2W00 A;  3O3K A;  3CCQ I;  3FKI J;  3BCA A;  5M5W J;  2JWT A;  2K85 A;  4EJT A;  1P2F A;  4JX6 A;  1O3T A;  3TGN A;  1V5F A;  2VBY A;  2KIQ A;  2QQ8 A;  3MZY A;  1TW2 A;  5KVR A;  2M0C A;  2VQC A;  4Y15 A;  2JRT A;  3S2D J;  4WXC A;  1JUS A;  3V8K A;  2KP6 A;  2P6T A;  2CJJ A;  2WBM A;  2HOT A;  1U6G A;  4G7O F;  3EUH A;  1ORK A;  2L7Z A;  3V8L A;  2BBY A;  4LMY A;  2PN6 A;  1FOK A;  1VI0 A;  5FRM A;  2WV1 A;  1K79 A;  1P6R A;  3L2W A;  4RB3 C;  1XDU A;  4OAZ A;  5IT9 K;  2A5Y B;  2GXB A;  5E8G A;  3LA7 A;  2OZU A;  1YQA A;  4IRI A;  4C3J J;  2P5K A;  3RPU A;  3BJA A;  2DAO A;  4XON A;  3TL4 X;  4XID A;  2XRO A;  1ZGJ A;  5CJ9 A;  4IRH A;  3SEZ A;  3CC4 I;  4MQV A;  3GEZ A;  3RCO A;  1JUP A;  5FKM A;  4B3A A;  3CJQ B;  1XPX A;  3RKY A;  1JT0 A;  2F5D A;  1FMW A;  3QYF A;  2RGV A;  4DYQ A;  5HS7 A;  3OYE A;  4A5N A;  1XDS A;  5J4V A;  3A4C A;  3VSL A;  1JUM A;  1UHW A;  2EIN H;  2RKH A;  2RQP A;  3C2B A;  3WE3 A;  3LAJ A;  3CCE I;  3V7C A;  1YS6 A;  2FD5 A;  4NUB A;  2K4B A;  4QSH A;  4M71 A;  3CLO A;  4XOR A;  2V26 A;  2Y31 A;  4WWC A;  5IT9 Z;  1Z0X A;  4G6T B;  1G3W A;  2R3S A;  3BG6 A;  1CF7 B;  3W6J B;  4KIC A;  1W36 D;  2LG4 A;  3H9Q A;  2X1D A;  2VLA A;  1X1B A;  2DQL A;  1P4X A;  2EFN A;  3BY6 A;  2HKX A;  3ZQH A;  4L5J A;  2OTJ I;  2CYY A;  5K7F A;  2GZW A;  2Q1Z B;  5E79 C;  3OYM A;  4PZJ A;  4ZYH A;  1F4K A;  3E6B A;  1W7P A;  3WG9 A;  5EEG A;  3BTJ A;  3MCZ A;  1U8B A;  1OPC A;  3WTW C;  2QLZ A;  3HM5 A;  5E8I A;  3W2A A;  1HW1 A;  3L09 A;  2PG4 A;  5IPA A;  1BI1 A;  4HF0 A;  4DGW B;  4YG2 F;  5M3M J;  1TNS A;  1XGN A;  1BA5 A;  4G7Z F;  1B72 B;  5EDN A;  2X51 A;  4A3C J;  4XRS G;  1ODD A;  2AQF A;  1F1Z A;  2HFH A;  3AKZ A;  1WCM J;  1RKT A;  1TWA J;  3H5R A;  4IHX A;  3G1O A;  1AKH B;  1GV2 A;  4ZYD A;  2DBB A;  1EF4 A;  1IXR C;  4XN0 A;  4S04 A;  1IF1 A;  3I58 A;  1M1E B;  3V7R A;  3OYF A;  1U78 A;  1W0U A;  1BR2 A;  2ZME B;  3IWZ A;  3S1Q J;  3M9A A;  1TZL A;  4UUT A;  2YU9 J;  3QPS A;  1BOA A;  4B47 A;  4CH7 A;  1USS A;  2DYR H;  2R5Z A;  5EGO B;  4J19 A;  3MKZ A;  2DFF A;  2WC2 A;  5HS8 A;  3MN2 A;  4HX7 A;  2O61 A;  4FT8 A;  4EMS A;  2GXG A;  3F8C A;  1FOX A;  4HNU A;  1E3H A;  1TP4 A;  2XGX A;  4NNJ A;  1VQ7 I;  3PL8 A;  3E6C C;  2P4W A;  4NB5 A;  2DMT A;  4PCQ A;  1LVK A;  3L2U A;  3Q9S A;  5DM7 F;  5F27 A;  1FTT A;  2Y0M A;  2EZH A;  4Y33 A;  5HOD A;  4A3B J;  2AXT C;  3LQR A;  3ECH A;  3G4S I;  1BI3 A;  3A0B C;  1MBF A;  4OU0 A;  3MMY B;  3DTI A;  1UG2 A;  2OJE D;  1XCB A;  1FX7 A;  2Z16 A;  4HYE A;  2LBF A;  3W6K B;  1ERD A;  3BG7 A;  2IXS A;  2E2J J;  3J7A Y;  2CFO A;  3CF5 F;  2VBZ A;  3VFZ A;  5E3O A;  3UKG A;  2MH2 A;  4CCO A;  3TKY A;  3MKY B;  3IKT A;  4ENM A;  4BU2 A;  5K5R A;  2F5C A;  5H6R A;  2F4O B;  4MEY F;  3E97 A;  4HPQ A;  4IRG A;  2LF8 A;  1JXS A;  4BUP A;  1ZAR A;  1WH7 A;  4RM3 A;  1S6L A;  4HSR A;  2HDD A;  3K2A A;  2OF7 A;  1MBK A;  2VOP A;  1SFK A;  3GTP J;  2XV4 S;  2XF6 A;  2FRH A;  1X3W B;  2DCE A;  2E19 A;  3K70 D;  1XC5 A;  2KZV A;  1MMN A;  4C3H J;  1ZLK A;  4BEH A;  3L1P A;  1ZQ3 P;  2G7U A;  4FIS A;  1FY7 A;  3OS0 A;  1LB2 A;  4MO7 A;  3WTT C;  3A1Y A;  2HOE A;  4IPA A;  2RDP A;  3T1B A;  4A0Z A;  2ME6 A;  3U9G A;  2O0Y A;  1R36 A;  4Q47 A;  1N77 A;  3B73 A;  2HGC A;  3KP6 A;  4IJA A;  1VQ8 I;  3I59 B;  5D6F A;  1KU3 A;  5HLI A;  4PJN A;  4OOI A;  3C3W A;  1J5Y A;  2HEO A;  4IHY A;  1L0O C;  3ESW B;  2NNN A;  4N9H A;  3H92 A;  4L18 B;  1R6R A;  1FC3 A;  3BZK A;  2PX9 A;  1MIJ A;  1YIT I;  1XS9 A;  1MBJ A;  2PLY A;  2D1H A;  5LHH A;  1HQC A;  5IYC J;  4XR6 A;  2DT6 A;  3SQN A;  2DOE A;  2WB1 N;  2EWN A;  1QPM A;  3HZJ A;  5DUI A;  4XQF A;  3WTZ A;  3JRI A;  3RKQ A;  1Y0U A;  2MC4 A;  4MQ9 F;  4OAY A;  3Q0V A;  3IKV A;  4K2E A;  3DKW A;  4BDY A;  1FBU A;  3BJ6 A;  1Z6R A;  4C9Y A;  3S1R J;  5HS9 A;  1OIS A;  1SD4 A;  2UWM A;  1Q1H A;  3ISP A;  4RGR A;  3TO7 A;  1YYV A;  2DA2 A;  2CH0 A;  1ZN2 A;  2KDZ A;  3NWS A;  1U5T C;  3I9V 2;  2QSH X;  1VQL I;  1Y8Q B;  1BIB A;  3F8N A;  1PUE E;  2XAQ A;  4II3 A;  2QBY A;  3IH3 A;  4N4N B;  4XSX F;  1QZZ A;  2VON A;  3HG9 A;  2VPL A;  1QVT A;  1MMA A;  4MGR A;  2JA6 J;  1B1B A;  4XLP F;  2VQG A;  1HOM A;  2VQH A;  4RAY A;  5JHF A;  1IRZ A;  2VPR A;  1X1P A;  4M3E A;  4F55 A;  3S2W A;  1R5H A;  5BPI A;  1GT0 C;  1N78 A;  2IP2 A;  3ZQ7 A;  2EBI A;  4HAM A;  5J8F A;  1W36 C;  1BR4 A;  3OY9 A;  2KIF A;  4DZJ A;  1OCZ H;  3AG3 H;  5M5Y J;  3KLO A;  1R9T J;  2W7N A;  2VQL A;  2VE8 A;  2X48 A;  3CJN A;  3A02 A;  2AXL A;  2EB7 A;  4I02 A;  2M7A A;  4LG0 B;  3ELK A;  3BPX A;  1LE8 A;  3PUB A;  3JCU C;  2L4A A;  3O8G A;  3IH4 A;  4R8H A;  4IHT A;  1OCP A;  3WU0 A;  4IEJ A;  3FDY A;  1I3Q J;  2GA1 A;  5CQG A;  2W1O A;  1J9I A;  1JTX A;  3FBI B;  3ZMS A;  1LNW A;  3KP7 A;  5DCM B;  1O4X A;  2OC6 A;  4RGU A;  1SVO A;  2BY1 A;  5D8L B;  1ZRD A;  3MAJ A;  3B02 A;  2ECB A;  5J4Y A;  3E5U A;  4BGD A;  1I5Z A;  3ABU A;  4QPQ A;  1IUF A;  5ICF A;  5HDN A;  1K4S A;  2EFP A;  2KJB A;  2DOA A;  1P4A A;  2DOF A;  4KMU X;  5TRD A;  1T0F C;  3GUD A;  2NS8 A;  5J1Y A;  1RUN A;  4J01 A;  2DMP A;  5FFX A;  2VXD A;  3HRT A;  2H09 A;  2IA1 A;  2CG4 A;  4P9F A;  4J00 A;  3L2R A;  1H88 C;  1S7A A;  4OIP F;  1QGP A;  4BBR J;  3GX4 X;  2QSF X;  2NNY A;  1YRN A;  1A31 A;  2KDO A;  3HEF A;  4S05 A;  2UV1 A;  4HST A;  4KDP A;  2XPW A;  1MNM C;  1P7J A;  2DA4 A;  3D5S C;  1HCR A;  3CD6 I;  2RN7 A;  1BC7 C;  2LH9 A;  2QGU A;  3ASO H;  4BL0 B;  1WI3 A;  4ZC3 A;  2ID3 A;  4CIC A;  4HQM A;  1EA3 A;  1MJB A;  4UXN A;  3KLN A;  4G12 A;  1VQO I;  3AL0 C;  4NC7 A;  4AM3 A;  2XGC A;  3HOY J;  3GTQ J;  2V1D A;  3SEQ A;  3BC8 A;  3RYP A;  4BKX A;  4I7H A;  5J1U A;  1LVA A;  2YUS A;  4UVA A;  3CTA A;  4KIS A;  2XAS A;  5ERI A;  2VJ5 A;  5LLQ A;  4ABZ A;  4W97 A;  4IHS A;  4ENJ A;  4WCG A;  1HDP A;  2DI3 A;  4RM2 A;  4KFC A;  2KRF A;  1AWC A;  3TDU C;  4AWX B;  1JHH A;  3CMM A;  3OR1 C;  3I53 A;  2IEK A;  3LMM A;  1J59 A;  1DGW Y;  3S93 A;  3H0D A;  2IA2 A;  1J75 A;  1JKP C;  4O3M A;  1D8J A;  1RNL A;  4L9N A;  3OWT A;  1NH3 A;  3PO3 J;  3I0T A;  5FKK A;  3PNT A;  4P1W A;  3HSF A;  2D2W A;  1X2M A;  4XRF A;  4GDF A;  2LY2 A;  1OCO H;  2E1M C;  3OS2 A;  1X3U A;  3ZMV A;  4E7H A;  3C7J A;  3RYR A;  4JOM A;  2R7R A;  2L0K A;  4F91 B;  1W4M A;  3KZZ A;  3TOB A;  4NQW A;  4DW6 A;  2LYC A;  3I4P A;  2QUF A;  2EV0 A;  2XGD A;  2M45 A;  4M6V A;  1ZRE A;  5IYD J;  3COA C;  2QQ9 A;  1FSH A;  3Q5F A;  3TO9 A;  2W48 A;  2E5Z A;  2IGO A;  4L0Y B;  2R4G A;  3K70 C;  2MA3 A;  1F43 A;  1D1C A;  1R4M B;  3KP3 A;  1XMA A;  2XKO A;  2VE9 A;  2EV5 A;  1OYY A;  1R5I D;  1HKQ A;  4PGG A;  2EA2 A;  5FKO A;  2CU7 A;  2FML A;  4B48 A;  2ESH A;  4R1H A;  2KMU A;  2M87 A;  2W57 A;  3K6G A;  1XSV A;  5FLV A;  3J81 K;  2DT5 A;  2DMU A;  5CVI A;  3QPH A;  4YIF A;  1LEA A;  2V6C A;  4RAZ A;  4A3I J;  2HVS A;  5F64 A;  1Y39 A;  4CXF A;  2EK5 A;  4B1R A;  2VC1 A;  1NG6 A;  2XSJ C;  1K6Y A;  1P7I A;  3S1N J;  3IC7 A;  4MTE A;  2ACJ A;  4DOZ A;  3KET A;  2KHM A;  1KQ0 A;  1PYV A;  1JHF A;  5TJJ A;  3KEY A;  3WHB A;  3CCS I;  1U3E M;  2F5E A;  3BR1 A;  1JJ6 C;  1MBH A;  4MFE A;  5FB2 A;  1XX5 A;  4Y17 A;  4I76 A;  3E6M A;  2VI6 A;  2DDB A;  1BN5 A;  3ZCO A;  2ZJR F;  1C0W A;  2H94 A;  3IHU A;  3SYT A;  5GAH J;  1Z91 A;  4XL9 A;  1NK2 P;  2VOD A;  3OYL A;  3WU1 B;  2CV2 A;  3GFM A;  2HDC A;  2JZY A;  2D1V A;  1RES A;  1LFP A;  3Q3S A;  4ZDO A;  4JYK A;  1QZE A;  4UUS B;  1CGP A;  1JE8 A;  2NXN B;  3I54 A;  4HV5 A;  1HBX G;  4ZYG A;  5EJC A;  2BHZ A;  1X1A A;  1YG2 A;  4U88 A;  1O3Q A;  5F1R A;  3H3Z A;  1PJR A;  4ZH4 F;  3J7A O;  1E3P A;  1TT0 A;  3K4M A;  3LFU A;  1SC7 A;  2JVG A;  4E70 A;  3I4M J;  1X2N A;  4QTR A;  1K78 B;  2WB1 A;  3DWL E;  3DEU A;  3L00 A;  3RIR A;  4JP0 A;  3HOZ J;  2P0W A;  5GAG J;  4PFO A;  1CF7 A;  2CQ7 A;  2KZG A;  1KZH A;  3F8M A;  2RNJ A;  4C2U A;  2QYO A;  3RQI A;  4AIJ A;  2UZK A;  4M9S A;  2JUC A;  4LOC A;  5L3E A;  4C2M J;  2EFQ A;  2WAQ A;  5DD4 A;  2ZXI A;  4CCK A;  1TNT A;  1S7E A;  2A61 A;  2VXZ A;  5CVJ A;  2WY7 Q;  3J80 K;  2DFE A;  3QOE A;  4F7Z A;  3H1C A;  3IH2 A;  2M34 A;  2IGN A;  3CDH A;  4G6Q A;  1PDN C;  1I6H J;  5GAE J;  3P9K A;  3EUA A;  3OV8 A;  4GFB A;  3OYK A;  1EKE A;  4HDU A;  1Z6T A;  2O03 A;  3K4B A;  2D5V A;  3VYT B;  1TQI A;  2HWV A;  5JVG F;  2F5V A;  1IN8 A;  1EH6 A;  4D0P A;  5CKT A;  5DCF A;  4DJA A;  2GOX B;  4Z6Y A;  5KHD A;  1SFO J;  2FEZ A;  4TV7 A;  5JI6 A;  2CMP A;  4ZYA A;  2DFH A;  1HDD C;  4HG2 A;  3ZGK A;  1F36 A;  1WJA A;  1XN7 A;  5FO5 A;  4DBQ A;  2HDW A;  2HOA A;  4PFP A;  1XMX A;  1AKH A;  1B9N A;  1SD6 A;  1Z67 A;  2MD5 A;  4ETS A;  3HTS B;  3VOD A;  2JSC A;  3CES A;  1WJE A;  1JI8 A;  3GTG J;  4XRS A;  3J80 Z;  3CJT B;  3K1M A;  3E1S A;  1NHA A;  2JK3 A;  3ABT A;  4LLG F;  3LA3 A;  3H9J A;  5DV5 A;  1DU0 A;  1ZK8 A;  2ZME A;  2HYJ A;  4L5E A;  3RZD J;  5M3F J;  4X0G A;  1U5T B;  5B3S H;  2PBI A;  2FNA A;  3C1D A;  3HGY A;  3BRO A;  3K9T A;  1ZG5 A;  5EGO A;  4A3D J;  2VBW A;  4LGW A;  2FUG 2;  3HKZ N;  2IT0 A;  2L7F P;  2OCC H;  4M3B A;  4B8X A;  3FXL A;  2DO7 A;  1YOV B;  3OIQ A;  3FK6 A;  1ZG1 A;  3PUF A;  3K10 A;  2H1K A;  1Q1V A;  2J5O A;  3FMR A;  3KEQ A;  1OYW A;  1E0E A;  3QOP A;  3D5R C;  1S7O A;  2X6X A;  2HQA A;  2JRM A;  3F9K A;  2R7X A;  5D5V B;  1W0T A;  2IBD A;  4UUV A;  3CC7 I;  3DKY A;  4DZP A;  1TC3 C;  1IV8 A;  3MZH A;  3D1N I;  2P6S A;  3MKL A;  2HVQ A;  4LD5 A;  3I55 I;  2JUG A;  2DJI A;  5IOZ A;  4I0B A;  4EM1 A;  1X58 A;  3FMQ A;  1UHM A;  3ZOB A;  1YJ9 I;  3DBH B;  3OSG A;  6PAX A;  1FBS A;  1GLN A;  2QKM B;  2Z99 A;  3U21 A;  5F04 A;  1T2K A;  1S72 I;  1N75 A;  3GVA A;  2CQX A;  2IA0 A;  5C4J J;  3JTG A;  1LEB A;  1ONV A;  1V5G A;  4HLY A;  4BQQ A;  2Z2S B;  2LC2 A;  2OAZ A;  1TL8 A;  1WGX A;  3X2Q H;  2MD0 A;  1Y8R B;  2EFW A;  3K7A J;  2K27 A;  2L7M P;  1S9H A;  1XSX A;  3SXY A;  1QO0 D;  3GWZ A;  1GHC A;  4LK1 F;  4BYY A;  3T8R A;  4D9J A;  1LKX A;  3TBI A;  1MDM B;  2FF4 A;  4FTH A;  4BXX J;  2WAD A;  3R61 A;  2LKP A;  1WH5 A;  3M8F A;  1D5Y A;  1W5S A;  2L9N A;  2LTP A;  2Y2Z A;  1BIA A;  1O7F A;  1POG A;  1U9O A;  3KX2 A;  3ZP5 A;  1HA8 A;  3CCJ I;  1TBX A;  3I71 A;  2BVM A;  3LOC A;  2M0M A;  5C44 J;  1WPK A;  2A05 A;  4AYB A;  3HC7 A;  4BE1 A;  1G59 A;  5K7Z A;  2F5F A;  1QNT A;  1YLF A;  1T8I A;  4RAF A;  3I59 A;  3CJR B;  2M7B A;  3CCL I;  4CGZ A;  4AID A;  4UV8 A;  3CMY A;  4RLQ A;  3DBR B;  4EVI A;  4XBF A;  4XKB A;  4XLA A;  3LL7 A;  3NRV A;  4L9T A;  3LSJ A;  3DCF A;  3K0L A;  4YFN F;  1WQ2 A;  2QVO A;  4BJ6 C;  3SZP A;  5FLX K;  1AOY A;  4WF2 A;  1YIO A;  2IRF G;  4QWQ A;  3OSF A;  1I1S A;  2X6W A;  2ZO4 A;  1T08 B;  1RKW A;  3FIS A;  2JA8 J;  1XTA A;  2ZB9 A;  3HHG A;  1I39 A;  2UXX A;  4IXA A;  4F93 B;  5J1R A;  2V1N A;  5EEA A;  2K9M A;  2K40 A;  5DUK A;  5FRN A;  2NVT J;  1MKM A;  4B3X A;  2CUE A;  4B09 A;  3T0Y A;  1MMG A;  1EJ9 A;  3FZV A;  4G9Y A;  2JVH A;  5EEH A;  5C3E J;  4V2F A;  1VQM I;  4ENK A;  1ZKG A;  4RS8 A;  3H35 A;  3KCC A;  3C2H A;  1T95 A;  2HTJ A;  4EEF G;  4ITV A;  1JKQ C;  3KYC B;  4BAC A;  2CFX A;  1B6A A;  3FXQ A;  3IWF A;  2R92 J;  3P9C A;  3JRA A;  3CCM I;  4KT5 C;  2E1M B;  5B1A H;  1D0X A;  3I56 I;  5K5Q A;  5D5U B;  2LMD A;  3F72 A;  3N97 A;  3DLL F;  1V4R A;  4GRI A;  1FLI A;  1DGR M;  1ZYR F;  3LSI A;  4G6D A;  4F92 B;  5JHU A;  2R7Q A;  1LDJ A;  2ISZ A;  2O6G E;  3RI4 A;  5KAI C;  2V9V A;  1ETX A;  2MG4 A;  3RJP A;  5JR3 A;  2X1C A;  1WRJ A;  5E20 A;  1ON2 A;  4GCV A;  1HST A;  2I10 A;  2MLG A;  3P9I A;  5TGT A;  2XB5 A;  4G8X A;  2A07 F;  1A5J A;  4LB6 B;  2QA4 I;  2JPB A;  5EZH A;  1RET A;  2ICW G;  3R6S A;  3SFI A;  5FKL A;  1WHU A;  2LFB A;  4ZTF A;  5E1W A;  2ZC2 A;  3Q0U A;  3LWF A;  5BPD A;  3BT9 A;  3G71 I;  3BTI A;  4LG0 A;  4D1Q A;  4BQO A;  1S29 A;  1PP7 U;  1IXC A;  4EM0 B;  1K61 A;  3ZQL A;  3BPV A;  2R7U A;  1O7L A;  3LNQ A;  3FHZ A;  2EZK A;  4PSW A;  3S3M A;  4A0X A;  3JRE A;  3MZ8 A;  2FA5 A;  2MH9 A;  1MH4 A;  2PQ8 A;  2IGM A;  2XAH A;  1IW7 F;  2CW8 A;  5DCM A;  5E3N A;  2OBP A;  3FBN B;  2KRC A;  2VT3 A;  3GTK J;  1G4D A;  5HNF A;  3MD2 A;  4UVC A;  2Y0S N;  4NDL A;  3ABK H;  1VQ5 I;  4LK0 F;  4MEX F;  2ZSH B;  1TQM A;  3EUK L;  2KQR A;  1AA7 A;  3L2Q A;  1ITY A;  4MHG A;  3TOA A;  5FJ8 J;  2M2E A;  2FQ3 A;  5L3B A;  1A35 A;  5H20 A;  2HVR A;  2KLO A;  2KPM A;  4M3F A;  1ZGW A;  4C2T A;  2EV6 A;  4DIQ A;  2AO9 A;  2MFZ A;  1OFC X;  1OJL A;  3K2Z A;  1R49 A;  2IVM A;  3GW2 A;  3HUG B;  2MC3 A;  4PSX A;  4AVZ A;  4AIK A;  2WWY A;  2HPI A;  2Y75 A;  4MTD A;  4BE2 A;  1MBE A;  1PP8 F;  2IS1 A;  3KP2 A;  2DMN A;  3O8H A;  3OOP A;  1I27 A;  2GXA A;  4WX9 A;  1PUF A;  2X4H A;  4CDG A;  2K9Q A;  1RPW A;  1MBG A;  4XIC A;  1SAN A;  1FOW A;  3LSR A;  4V2G A;  4Q48 A;  1HKS A;  2E60 A;  2R7F A;  1YHQ I;  2Y9Y A;  4EJV A;  1I3A A;  3R0J A;  2LLK A;  1D3Y A;  2K02 A;  2R5Y B;  1BOB A;  1FNN A;  3M7G A;  4Y7N J;  5CVU A;  1T39 A;  2E7X A;  1IDZ A;  3TP3 A;  2M1B A;  2OV7 A;  4XN3 A;  3V7S A;  1KYW A;  3JSP A;  3ZQG A;  2GA2 A;  2H6B A;  3BTL A;  4I09 A;  4IOC F;  4GGG A;  1ETQ A;  1DDN A;  2DT7 B;  3TW6 A;  4HQE A;  3IUO A;  1FSE A;  5FLM J;  5M5X J;  5FRO A;  1KON A;  2BYV E;  2R7V A;  1BW6 A;  3WG7 H;  3FK7 A;  4PJM A;  4OIR F;  4BAY A;  3HKZ A;  2LK2 A;  4F52 A;  3G6E I;  3OYA A;  3CO6 C;  2HOS A;  5HLH A;  1KU2 A;  5D4R A;  2Q2E B;  2COM A;  3W2W A;  1IRG A;  5H2F C;  3QPL A;  1Z77 A;  3W3C A;  4DQ2 A;  1UFM A;  3M07 A;  2JT1 A;  3K1N A;  1R23 A;  1T6S A;  3RPU D;  1KU7 A;  3EPZ A;  4EJO A;  3K1P A;  4A69 C;  2E7W A;  2DLL A;  3IV5 A;  2LSO A;  4DNC A;  2TRT A;  3HIF A;  5J47 A;  1RIO H;  5IY5 H;  2LRE A;  2STW A;  4FAS D;  1WJF A;  1LPQ A;  2Y9Z A;  1FWZ A;  4CSW A;  4HNT A;  4E6K G;  1EH7 A;  3WTU C;  2YSR A;  3BR5 A;  1ZAO A;  1HW2 A;  2RVC A;  1E2X A;  4IF4 A;  4PK4 A;  2A6T A;  1G3S A;  4DYR A;  2RQQ A;  2XC7 A;  3MKW B;  3TQN A;  3LSK A;  5E1Z B;  2VKE A;  3FKJ A;  2B7E A;  1HC8 A;  3NWT A;  1BI0 A;  1SVL A;  3Q9V A;  2XVC A;  3GLX A;  2OUM A;  4Y4R A;  4YFK F;  5K7H A;  1ZG3 A;  4A3J J;  1K7A A;  2NRA C;  4CUG A;  2E2I J;  1U0J A;  3ASN H;  2P7V B;  2ZXJ A;  4BH9 A;  2DK8 A;  1STZ A;  3T8T A;  1DPU A;  1WSU A;  5F1J A;  2V7F A;  2ESN A;  3K4J A;  4XRM A;  2Y69 H;  4L9V A;  1V54 H;  1MMS A;  2QM3 A;  3SJM A;  3ZMU A;  5F0H A;  1W7P D;  3CUQ B;  4A3F J;  3DFG A;  4ZZD A;  4PJ0 C;  4XKV A;  2VJJ A;  3HOV J;  2L9V A;  4ZZL A;  5LEJ A;  4UUS A;  4P5O A;  1IDY A;  3OS1 A;  2UXN A;  3M1C A;  3LFK A;  1QPI A;  3GYH X;  1QA6 A;  4CCL A;  2EPF A;  1V55 H;  1Z3X A;  1J2X A;  3WGI A;  4L9J A;  1GXQ A;  1D8K A;  1TWH J;  5FD6 A;  4M3D A;  1OCT C;  4U7D A;  3FXM A;  2DTZ A;  3MEX A;  3GO5 A;  1BM9 A;  2M8G X;  3VOE A;  3VWB A;  1SD7 A;  1YW7 A;  2LBF B;  4AVP A;  2W24 A;  2E1N A;  2OTL I;  2NYX A;  2VOO A;  1ON1 A;  1ETW A;  1VQ9 I;  4FQG A;  2E36 A;  3NEU A;  2A6H F;  2Z1D A;  3OYI A;  4HRI A;  3C18 A;  3ZRG A;  2XAG A;  4EAT A;  4ZDL A;  4XMY A;  3GME A;  1P92 A;  3HB9 A;  1GDT A;  2DXI A;  5AIP A;  2A3S A;  3HSE A;  2DMQ A;  3CLQ A;  1R00 A;  2L4M A;  1IC8 A;  2L7K A;  2NVX J;  1WJB A;  3KZY A;  2CQN A;  3KP4 A;  1HSJ A;  1MD0 A;  1OYI A;  2DJN A;  3AG1 H;  5BOX A;  3JAM K;  3CO7 C;  4UHT A;  1QVU A;  3HSR A;  4RAG A;  1KU9 A;  4BS9 A;  1QQI A;  2M5W A;  3OMY A;  1ZEL A;  4XLH A;  2ADU A;  3NAU A;  1G3Y A;  1X4P A;  5BMZ A;  2IPQ X;  4MIM A;  2QEX I;  2ZJ2 A;  3RPQ A;  3OYN A;  2EZL A;  2NS7 A;  4QLC U;  2ZJP F;  3FM3 A;  3PFI A;  4CCN A;  5B5E C;  1DQU A;  4KIF A;  2LP0 A;  3U1D A;  3ULQ B;  4EM2 A;  4ESB A;  1FYM A;  3W6V A;  3LSP A;  2FBK A;  2QCO A;  1T38 A;  4XLF A;  3V42 A;  4X6A J;  4M74 A;  5K1Y A;  1K4T A;  3BQY A;  2HPM A;  4AUX A;  3CZ6 A;  1B9M A;  4E7S A;  4Q4Z F;  2KT0 A;  1UCR A;  2DA7 A;  3QRF F;  1IRF A;  2OQR A;  2ZME C;  3IAM 2;  4OMZ A;  4A12 A;  1YW9 A;  4UNO A;  1A04 A;  3GTJ J;  3K4K A;  4EGY A;  4LJZ F;  1UHS A;  2EA4 A;  3I3L A;  2Y0S A;  4EGZ A;  3B6A A;  3O6B B;  5L3G A;  2K3F A;  4RMN A;  1SEU A;  1HLV A;  1MH3 A;  1ETV A;  3S8P A;  2IS6 A;  3WE2 A;  5LBQ A;  3GF2 A;  4M72 A;  2A5W A;  3CUO A;  1OCC H;  2BXZ A;  2BVL A;  2PMZ N;  3HGG A;  3RTR A;  3SHF A;  3ZMZ A;  3F3X A;  1U9N A;  1JGG A;  1XD7 A;  4E7Z A;  4CYC B;  5E17 F;  2ZSI B;  3BOQ A;  1IG7 A;  5BNG A;  2HI3 A;  3FXK A;  2VJI A;  1LJ9 A;  2BE5 F;  2R7D A;  4GXO A;  4E7L A;  3G1L A;  3P7N A;  4A93 J;  4BE0 A;  4KA4 A;  5B1B H;  4KIB A;  3ZN1 A;  2M9H A;  3EUH C;  1J7K A;  3HJE A;  1X1D A;  3J81 Z;  4ASN A;  3ROU A;  2BW3 B;  4NC8 A;  3EYI A;  1ENH A;  1FJL A;  1VQK I;  1YX5 A;  4WXD A;  5ILU A;  4I2O A;  3CP8 A;  5A2Q K;  1MDM A;  1IRX A;  1XMK A;  4RB1 A;  4M73 A;  3HL2 A;  1MGT A;  2HXO A;  2M4G A;  2M30 A;  2VKV A;  4FHT A;  4Y3O A;  1LUJ B;  3KE2 A;  3RSN A;  3WGG A;  2EZI A;  2QZ8 A;  3WTV C;  1J0R A;  3F6O A;  3HXL A;  1JTY A;  2XSD C;  4I99 C;  4AD9 A;  1ZRF A;  2H8W A;  2HS5 A;  4HEA 2;  4M9Z A;  3CCV I;  3I4N J;  2JSP A;  4KJZ A;  2GWR A;  2R7S A;  2VKD A;  1OR7 A;  1KGS A;  4O6J A;  1RRJ A;  4A5M A;  5J40 A;  1UST A;  2X85 A;  3BG5 A;  1XG1 A;  2ISY A;  2CRG A;  1I1G A;  5ED4 A;  1G6N A;  4IVN A;  3O2P E;  2FU4 A;  3BTC A;  2BZT A;  3LA2 A;  3S17 J;  2CS3 A;  4ON0 A;  4OIN F;  1YRN B;  4CHU A;  1D0Y A;  5LRS A;  1MW7 A;  2VT2 A;  1NG7 A;  4N9I A;  3S2H J;  2FXA A;  3FMS A;  1LQ1 A;  1ETY A;  1S3J A;  4ESJ A;  3MFK A;  3BJO A;  3DV8 A;  3PQJ A;  4IKF A;  4RBO A;  3G2B A;  2PJP A;  1G2H A;  2FOK A;  2EFO A;  4ZTJ A;  5FGM A;  5E1X A;  5LHG A;  2YR2 A;  1WZ2 A;  1JKO C;  3SZG A;  2ZXH A;  2R0Q C;  2NVY J;  1MNE A;  3ZMD A;  5HLT A;  4QIW N;  1B72 A;  1BW5 A;  1I6X A;  3ZQC A;  1Z1D A;  4Z2Y A;  2FBI A;  1IN7 A;  3CCR I;  1HKT A;  3PSF A;  4D5C A;  4BHC A;  1JKR C;  5JLX A;  1TTY A;  3CDI A;  3H0G J;  4N0B A;  3TW7 A;  2KKO A;  4WK8 F;  4JK1 X;  4KN7 X;  3JSO A;  1DUX C;  4ANJ A;  2F4I A;  2DW4 A;  1XSD A;  1LDK B;  4U0V A;  5TIS C;  1RI7 A;  1QU3 A;  2KIS A;  2FBH A;  4OMY A;  2A68 F;  3K4L A;  2IS4 A;  3QPT A;  2WAF A;  3BLY A;  4M3G A;  1H9G A;  5HVQ C;  5HLG A;  3DPT A;  3DTE A;  3OR2 C;  1QHG A;  2ZBK A;  4H0E A;  4F3Q A;  1MJA A;  2DPD A;  4M9X A;  1FYK A;  2H6C A;  3E3V A;  3S3O A;  2XF7 A;  1ETO A;  3OL4 A;  2XKP A;  3CCY A;  3F21 A;  1MSE C;  3QYE A;  1DP7 P;  1Z3Y A;  2LKX A;  3F6V A;  4CCJ A;  3UNG C;  2OPT A;  3HOS A;  1SMT A;  5FFZ A;  1UG0 A;  2WV0 A;  5J6X A;  3QU3 A;  3WHC A;  1L3L A;  3K4C A;  3A01 B;  2IS2 A;  2KRH A;  2ELH A;  4HX4 A;  1SAX A;  3RQ4 A;  2GBY A;  3H3U A;  1QHH D;  5F6F A;  3BZ6 A;  5C4X J;  3KPH A;  3U1K A;  3WTX C;  2ZJQ F;  3IRQ A;  3H5A A;  4D5F A;  3KEO A;  4MNU A;  2NOJ B;  1ETK A;  2YX4 A;  4UVB A;  4IOA F;  2EQR A;  3OYH A;  1YO5 C;  4I01 A;  3CQZ J;  4HLX A;  4HZF A;  4YEJ A;  3RDI A;  5H6Q A;  2FX0 A;  1DPR A;  1R1V A;  2GIZ A;  5HNH A;  5AIQ A;  1UJ8 A;  3HOT A;  4BQA A;  5LD2 C;  3BR2 A;  1WKM A;  1YFH A;  2E35 A;  3HUG A;  2DN0 A;  1O3S A;  4HDV A;  2PJR B;  2WY8 Q;  1B59 A;  3VDX A;  4D7M A;  5D5W B;  3HOX J;  4IHW A;  2X6Y A;  1YJN I;  5HDG A;  2K7L A;  4CZC A;  2RRE A;  2F4M B;  3S32 A;  2JTV A;  3DQV C;  3IP4 B;  2Z3Y A;  4BY1 J;  3QAH A;  1G3T A;  1UZC A;  4YFX F;  1TT5 B;  1YS7 A;  1V5E A;  1R58 A;  3FX3 A;  4Y13 A;  3FXJ A;  2OU2 A;  3DPL C;  2FNP A;  2R5Y A;  3GFL A;  4IX7 A;  2KJC A;  4II2 A;  1T33 A;  4BXU A;  1ZR2 A;  2VC0 A;  5DEQ A;  2B9S A;  2EJR A;  1ZHF A;  2E1C A;  3QWL A;  3R4K A;  5DD8 A;  3BCB A;  3S16 J;  1OMI A;  2HZD A;  1HW5 A;  3E5X A;  4MLO A;  5L3C A;  3AFH A;  1A6I A;  3AL0 B;  3R60 A;  1FPQ A;  4A3K J;  2KFD A;  4G7H F;  3DF8 A;  4H4K C;  2VAS A;  1NK3 P;  5LEK A;  1XGM A;  2XAF A;  5EG0 B;  2JJ7 A;  3LSG A;  3U2R A;  1P4W A;  2FQ4 A;  1WWX A;  3G3Z A;  2LVS A;  2GOM A;  5CQE A;  1VTN C;  4XNF A;  4HF1 A;  3MVP A;  3C2G A;  3FM5 A;  3PM1 A;  2Q2E A;  2GIV A;  2ZKZ A;  2NVQ J;  4UV9 A;  2H1L A;  2ZFU A;  4E7K A;  4XLE A;  1K6O A;  1R22 A;  4S0H B;  2OZ6 A;  3QYB A;  3GZ6 A;  5GPC A;  4LLN A;  4NC6 A;  3HRM A;  3IL2 A; 
#chains in the Genus database with same CATH homology
 1XCV A;  3V4G A;  1O3R A;  2D45 A;  5FLX Z;  3M1E A;  3REO A;  2K4J A;  4EV0 A;  5KK1 A;  4LLL A;  4U0Y A;  3KFW X;  4M6X A;  3FXR A;  4HV6 A;  3TO6 A;  2ZFW A;  4A6D A;  3RKW A;  3WTS C;  2JPC A;  4BNC A;  4A6E A;  1Z9C A;  3G73 A;  1EV7 A;  2HYG D;  1YW8 A;  4WXH A;  3CUQ A;  5L3D A;  5ICE A;  4U0W A;  1Z05 A;  2OA4 A;  2FE3 A;  4KN4 X;  1SFE A;  5BQT A;  1QBJ A;  2W25 A;  3TDZ C;  3LQQ A;  1KYZ A;  3MWM A;  2OQG A;  3FWE A;  1XB4 A;  4NHJ A;  2CW0 F;  5DYM A;  3GZ5 A;  2KIU A;  3N4M A;  5JFR A;  3IRR A;  2NS0 A;  2AS5 F;  1T98 A;  2DTR A;  3ERE D;  5D6E A;  1IN4 A;  4BHP A;  1ZGA A;  2O3F A;  3WGH A;  2STT A;  4XLN F;  2ZCW A;  1V3F A;  4CYD A;  1KQ8 A;  4PDK A;  4ESF A;  2L01 A;  5D8K B;  3L7W A;  2CWE A;  3DXJ F;  5DDG A;  1MJ9 A;  1EH8 A;  3SZT A;  5LRR A;  3JW4 A;  4I98 B;  4XSZ F;  4U7B A;  2QEN A;  5ICG A;  1F9N A;  5ICC A;  5ILV A;  2CGP A;  3ECO A;  5J8C A;  3EET A;  3E6D A;  1W7P B;  3L2C A;  4RGS A;  3QP5 A;  1HXD A;  1O57 A;  2FSW A;  2HTS A;  4RB0 A;  2LNB A;  3WOD F;  4P55 A;  5BS6 A;  5LHI A;  1FYL A;  4JBA A;  1RZ4 A;  1GXP A;  2HYF A;  5CVV A;  1YTY A;  1FBQ A;  2RC4 A;  2P7C B;  5D5X B;  4FX4 A;  1F5T A;  1H9T A;  3VB2 A;  2DPU A;  2F2E A;  2PI0 A;  2C6Y A;  2XIG A;  2YU3 A;  1IUY A;  3M8E A;  4HW0 A;  3LAP A;  2FMY A;  1TLH B;  1UB9 A;  2W85 A;  3LST A;  1IAW A;  2PFB A;  1B4A A;  3EYY A;  2BEO A;  4HBL A;  3HRS A;  4GYG A;  2ZNZ A;  3EQL F;  2HQR A;  5CYV A;  4FX0 A;  2CSO A;  4G94 A;  1SD5 A;  2QQB A;  2TDX A;  4LB5 A;  4L0Z B;  4GYI A;  3FXU A;  2Z5U A;  4PGH A;  1K78 A;  1W5T A;  1R1U A;  3WTY C;  3SFZ A;  3MQ0 A;  2LDU A;  2Z9O A;  5CLS A;  1IZ1 A;  1ZH5 A;  2A6E F;  2HKO A;  1BC8 C;  3HTU A;  2YX7 A;  2CQK A;  3F8B A;  1FP1 D;  1ZRC A;  2KIM A;  2XRN A;  2QWW A;  2Y48 A;  3K69 A;  2XHK A;  4HX8 A;  2P8T A;  2IJL A;  4KNY A;  1TW3 A;  2O8X A;  1TQP A;  4LFU A;  2GQQ A;  2DQR A;  2V1X A;  5AON A;  1H0M A;  4AIH A;  3JTH A;  2DK5 A;  4R79 A;  4YII A;  4KMF A;  2J5P A;  3AAF A;  3FF5 A;  1LDD A;  2DU9 A;  2HQN A;  3JAM Z;  3PQK A;  1IN5 A;  1U5T A;  1BJA A;  3ZN0 A;  1FT9 A;  5LGU A;  2M8E A;  4Q5S F;  1OKR A;  3I5U A;  3R0A A;  1R7J A;  4P96 A;  2QBY B;  2ETH A;  1XGS A;  3HRU A;  3D5L A;  5CVR A;  5HDK A;  4RGX A;  3ZPL A;  4JQF A;  2K86 A;  2MLK A;  1E17 A;  2YPR A;  2X0L A;  4GO1 A;  3GXO A;  3BWG A;  1WI9 A;  3BDD A;  2NAZ A;  4OIO F;  4EJU A;  2P5V A;  4KUM A;  4P9U A;  4BHB A;  2V1U A;  3NQO A;  1MZB A;  2PMU A;  4EQQ A;  1FZP B;  3BP8 A;  1FP2 A;  2HR3 A;  3F23 A;  2VBX A;  2LF7 A;  2V79 A;  4RB2 C;  1D5V A;  1T0F A;  1KQ9 A;  1S8N A;  5L3F A;  3F8F A;  1SMY F;  3HYI A;  2BV6 A;  2DFI A;  1JGS A;  4KIG A;  3QU6 A;  5LGT A;  2PMH A;  2Z33 A;  5LGN A;  5ILS A;  4KYW A;  1GVJ A;  2CO5 A;  1BBY A;  4HOB A;  2OD5 A;  3ZMT A;  1REP C;  4EJW A;  1U8R A;  5E18 F;  5K5O A;  5A2Q Z;  1SFX A;  4HA8 A;  2WTE A;  3D0S A;  4ZYE A;  2MBF A;  5IT3 A;  3ML6 A;  2A69 F;  3E5Q A;  5D4S A;  2W84 A;  2L54 A;  1U2W A;  5FD5 A;  4HF2 A;  1BI2 A;  2RV8 A;  2GAU A;  1XGO A;  4L5I A;  4ENN A;  2QQA A;  4A2U A;  3KP5 A;  1IN6 A;  3RKX A;  5JVT A;  1IXS B;  2ZNY A;  2XAJ A;  2H27 A;  3GFJ A;  2HZT A;  1R1T A;  4I0A A;  2PEX A;  2L02 A;  4CO8 A;  1ULY A;  3VEP A;  1KA8 A;  2L3D A;  1SFU A;  2XUB A;  3I64 A;  3L9F A;  3V8J A;  4M6Y A;  1RUO A;  3F22 A;  4CZZ A;  2G9W A;  2P5L C;  3EDP A;  2IW5 A;  2B0L A;  5HOO A;  3HHH A;  2VN2 A;  1Z7U A;  1R5G A;  2Q0O A;  2Q8K A;  3DP7 A;  4O5V A;  4A0Y A;  1QZY A;  3GFI A;  1ZLJ A;  3T5X A;  4OIQ F;  2BGC A;  2G7H A;  3CUQ C;  3QP6 A;  3O3K A;  4EJT A;  1P2F A;  1O3T A;  3TGN A;  2VBY A;  3MZY A;  1TW2 A;  5KVR A;  4Y15 A;  2JRT A;  4WXC A;  3V8K A;  2P6T A;  1U6G A;  4G7O F;  3EUH A;  3V8L A;  2BBY A;  4LMY A;  2PN6 A;  1FOK A;  1K79 A;  1P6R A;  4RB3 C;  1XDU A;  5IT9 K;  2A5Y B;  2GXB A;  5E8G A;  3LA7 A;  2OZU A;  1YQA A;  4IRI A;  2P5K A;  3RPU A;  3BJA A;  2DAO A;  2XRO A;  1ZGJ A;  5CJ9 A;  4IRH A;  4MQV A;  3GEZ A;  3RKY A;  2F5D A;  2RGV A;  5HS7 A;  4A5N A;  1XDS A;  1UHW A;  2RKH A;  2RQP A;  3WE3 A;  3LAJ A;  3V7C A;  1YS6 A;  2K4B A;  4M71 A;  3CLO A;  4WWC A;  5IT9 Z;  1G3W A;  2R3S A;  1CF7 B;  3W6J B;  4KIC A;  2DQL A;  1P4X A;  2EFN A;  3BY6 A;  2HKX A;  4L5J A;  2CYY A;  2GZW A;  4PZJ A;  4ZYH A;  1F4K A;  3E6B A;  1W7P A;  3WG9 A;  5EEG A;  3MCZ A;  1OPC A;  3WTW C;  2QLZ A;  5E8I A;  1HW1 A;  3L09 A;  2PG4 A;  1BI1 A;  4HF0 A;  4YG2 F;  1TNS A;  1XGN A;  4G7Z F;  1ODD A;  1F1Z A;  2HFH A;  4ZYD A;  2DBB A;  1IXR C;  4S04 A;  1IF1 A;  3I58 A;  3V7R A;  1U78 A;  2ZME B;  3IWZ A;  3M9A A;  1BOA A;  1USS A;  2WC2 A;  5HS8 A;  4HX7 A;  2O61 A;  4FT8 A;  4EMS A;  2GXG A;  3F8C A;  2XGX A;  3E6C C;  2P4W A;  4NB5 A;  4PCQ A;  3Q9S A;  2Y0M A;  3LQR A;  3ECH A;  1BI3 A;  4OU0 A;  4HYE A;  1XCB A;  1FX7 A;  3W6K B;  2VBZ A;  3VFZ A;  2MH2 A;  3TKY A;  3IKT A;  4ENM A;  5K5R A;  2F5C A;  5H6R A;  4MEY F;  3E97 A;  4IRG A;  2LF8 A;  1JXS A;  1ZAR A;  1S6L A;  2VOP A;  2XV4 S;  2FRH A;  1ZLK A;  2G7U A;  1FY7 A;  1LB2 A;  3WTT C;  2HOE A;  4IPA A;  2RDP A;  3T1B A;  4A0Z A;  3U9G A;  2O0Y A;  1R36 A;  4Q47 A;  3B73 A;  2HGC A;  3KP6 A;  4IJA A;  3I59 B;  5D6F A;  1KU3 A;  5HLI A;  4OOI A;  3C3W A;  1J5Y A;  2HEO A;  1L0O C;  2NNN A;  4N9H A;  3H92 A;  4L18 B;  1FC3 A;  2PLY A;  2D1H A;  5LHH A;  1HQC A;  3SQN A;  2EWN A;  1QPM A;  5DUI A;  3WTZ A;  1Y0U A;  4MQ9 F;  3IKV A;  4K2E A;  3DKW A;  1FBU A;  3BJ6 A;  1Z6R A;  5HS9 A;  1SD4 A;  2UWM A;  1Q1H A;  3ISP A;  4RGR A;  3TO7 A;  1YYV A;  1ZN2 A;  1U5T C;  1BIB A;  3F8N A;  1PUE E;  2XAQ A;  2QBY A;  4XSX F;  2VON A;  1QZZ A;  4MGR A;  1B1B A;  4XLP F;  4RAY A;  5BPI A;  3S2W A;  1R5H A;  2IP2 A;  3ZQ7 A;  4HAM A;  5J8F A;  2KIF A;  3KLO A;  2VE8 A;  3CJN A;  2AXL A;  2EB7 A;  4I02 A;  4LG0 B;  3ELK A;  3BPX A;  2L4A A;  4R8H A;  4IHT A;  3WU0 A;  2GA1 A;  1J9I A;  3ZMS A;  1LNW A;  3KP7 A;  5DCM B;  4RGU A;  5D8L B;  1ZRD A;  3MAJ A;  3B02 A;  3E5U A;  1I5Z A;  3ABU A;  5ICF A;  5HDN A;  2EFP A;  2KJB A;  1P4A A;  5TRD A;  4KMU X;  3GUD A;  1RUN A;  5FFX A;  3HRT A;  2H09 A;  2IA1 A;  2CG4 A;  4P9F A;  1S7A A;  4OIP F;  1QGP A;  3GX4 X;  2NNY A;  4S05 A;  4KDP A;  2RN7 A;  1BC7 C;  4CIC A;  4HQM A;  4UXN A;  1MJB A;  3KLN A;  2V1D A;  3RYP A;  4I7H A;  1LVA A;  4UVA A;  3CTA A;  2XAS A;  5ERI A;  5LLQ A;  4IHS A;  4ENJ A;  4WCG A;  2DI3 A;  4KFC A;  2KRF A;  1AWC A;  3TDU C;  4AWX B;  1JHH A;  3I53 A;  1J59 A;  1J75 A;  2IA2 A;  1D8J A;  4O3M A;  1RNL A;  4L9N A;  3I0T A;  3HSF A;  2D2W A;  4XRF A;  1X3U A;  3ZMV A;  3C7J A;  3RYR A;  1W4M A;  3KZZ A;  3TOB A;  4NQW A;  3I4P A;  2QUF A;  2EV0 A;  1ZRE A;  2M45 A;  3COA C;  2QQ9 A;  1FSH A;  3Q5F A;  3TO9 A;  4L0Y B;  2MA3 A;  3KP3 A;  1XMA A;  2XKO A;  2VE9 A;  2EV5 A;  1OYY A;  1HKQ A;  4PGG A;  2EA2 A;  2FML A;  2ESH A;  4R1H A;  2M87 A;  2W57 A;  1XSV A;  3J81 K;  2DT5 A;  5CVI A;  3QPH A;  4YIF A;  1LEA A;  2V6C A;  4RAZ A;  5F64 A;  4CXF A;  2EK5 A;  2VC1 A;  3IC7 A;  4MTE A;  2ACJ A;  3KET A;  1KQ0 A;  1JHF A;  5TJJ A;  1U3E M;  2F5E A;  5FB2 A;  4Y17 A;  3E6M A;  1BN5 A;  1C0W A;  2H94 A;  3IHU A;  1Z91 A;  2VOD A;  3WU1 B;  3GFM A;  2HDC A;  2JZY A;  2D1V A;  1CGP A;  1JE8 A;  3I54 A;  4HV5 A;  1HBX G;  4ZYG A;  1YG2 A;  4U88 A;  1O3Q A;  5F1R A;  3H3Z A;  4ZH4 F;  3J7A O;  4E70 A;  1K78 B;  3DEU A;  3L00 A;  3RIR A;  1CF7 A;  3F8M A;  2RNJ A;  2QYO A;  4AIJ A;  2UZK A;  4M9S A;  5L3E A;  2EFQ A;  5DD4 A;  1TNT A;  2A61 A;  2VXZ A;  5CVJ A;  3J80 K;  4F7Z A;  3CDH A;  4G6Q A;  1PDN C;  3P9K A;  3OV8 A;  4HDU A;  1Z6T A;  2O03 A;  1TQI A;  2HWV A;  1IN8 A;  1EH6 A;  4D0P A;  5DCF A;  2FEZ A;  4TV7 A;  5JI6 A;  1XN7 A;  5FO5 A;  1B9N A;  1SD6 A;  2MD5 A;  4ETS A;  3HTS B;  3VOD A;  2JSC A;  3J80 Z;  3K1M A;  1NHA A;  3ABT A;  4LLG F;  3LA3 A;  5DV5 A;  2ZME A;  1U5T B;  2PBI A;  2FNA A;  3C1D A;  3BRO A;  3K9T A;  1ZG5 A;  2VBW A;  4LGW A;  2IT0 A;  4B8X A;  2DO7 A;  1ZG1 A;  2J5O A;  3FMR A;  3KEQ A;  1OYW A;  3QOP A;  1S7O A;  5D5V B;  4UUV A;  3MZH A;  2P6S A;  4LD5 A;  4I0B A;  4EM1 A;  3FMQ A;  1UHM A;  6PAX A;  1FBS A;  2Z99 A;  1T2K A;  1LEB A;  3GVA A;  2IA0 A;  3JTG A;  1ONV A;  4HLY A;  2OAZ A;  2EFW A;  2K27 A;  1XSX A;  3SXY A;  1QO0 D;  3GWZ A;  1GHC A;  4BYY A;  4LK1 F;  3T8R A;  1MDM B;  2FF4 A;  3R61 A;  2LKP A;  3M8F A;  1W5S A;  1BIA A;  1O7F A;  3ZP5 A;  1TBX A;  3I71 A;  2F5F A;  1QNT A;  1YLF A;  3I59 A;  4CGZ A;  4UV8 A;  4EVI A;  4XBF A;  3NRV A;  4L9T A;  3K0L A;  4YFN F;  1WQ2 A;  2QVO A;  5FLX K;  3SZP A;  1AOY A;  4WF2 A;  1YIO A;  2IRF G;  4QWQ A;  1I1S A;  2ZO4 A;  3HHG A;  2UXX A;  4IXA A;  5DUK A;  1MKM A;  4B09 A;  3T0Y A;  3FZV A;  4G9Y A;  5EEH A;  4ENK A;  4RS8 A;  3KCC A;  2HTJ A;  2CFX A;  1B6A A;  3FXQ A;  3IWF A;  3P9C A;  4KT5 C;  5K5Q A;  5D5U B;  3F72 A;  3N97 A;  1V4R A;  1FLI A;  1ZYR F;  4G6D A;  5JHU A;  1LDJ A;  2ISZ A;  2O6G E;  3RI4 A;  2V9V A;  3RJP A;  5JR3 A;  1WRJ A;  5E20 A;  1ON2 A;  4GCV A;  1HST A;  2A07 F;  2MLG A;  3P9I A;  4G8X A;  4LB6 B;  2JPB A;  3R6S A;  5E1W A;  3LWF A;  5BPD A;  4LG0 A;  1S29 A;  1PP7 U;  1IXC A;  4EM0 B;  3BPV A;  1O7L A;  3FHZ A;  4A0X A;  2FA5 A;  2MH9 A;  2PQ8 A;  2XAH A;  1IW7 F;  5DCM A;  2OBP A;  2VT3 A;  1G4D A;  4UVC A;  4LK0 F;  4MEX F;  1TQM A;  4MHG A;  3TOA A;  2FQ3 A;  5L3B A;  5H20 A;  2EV6 A;  3K2Z A;  2IVM A;  3GW2 A;  2MC3 A;  4AIK A;  2WWY A;  2Y75 A;  1PP8 F;  4MTD A;  3KP2 A;  3OOP A;  1I27 A;  4WX9 A;  2X4H A;  4CDG A;  4Q48 A;  1HKS A;  2R7F A;  4EJV A;  3R0J A;  1D3Y A;  2K02 A;  1FNN A;  3M7G A;  5CVU A;  1T39 A;  2E7X A;  2M1B A;  3V7S A;  1KYW A;  3JSP A;  2GA2 A;  2H6B A;  4I09 A;  4GGG A;  1DDN A;  4HQE A;  1FSE A;  2BYV E;  4OIR F;  4BAY A;  3CO6 C;  5HLH A;  1KU2 A;  5D4R A;  2COM A;  1IRG A;  4DQ2 A;  1UFM A;  2JT1 A;  3K1N A;  1R23 A;  1T6S A;  1KU7 A;  4EJO A;  3K1P A;  2E7W A;  2DLL A;  2LSO A;  4DNC A;  3HIF A;  1RIO H;  2STW A;  1FWZ A;  1HW2 A;  1EH7 A;  3WTU C;  2YSR A;  1ZAO A;  2RVC A;  1E2X A;  4IF4 A;  1G3S A;  3TQN A;  5E1Z B;  1BI0 A;  3Q9V A;  2XVC A;  3GLX A;  4YFK F;  1ZG3 A;  1K7A A;  2NRA C;  2P7V B;  2ZXJ A;  4BH9 A;  2DK8 A;  1STZ A;  3T8T A;  1DPU A;  1WSU A;  2ESN A;  4L9V A;  2QM3 A;  3ZMU A;  1W7P D;  3CUQ B;  3DFG A;  4ZZD A;  4ZZL A;  5LEJ A;  4P5O A;  2UXN A;  3LFK A;  3GYH X;  1J2X A;  3WGI A;  4L9J A;  1GXQ A;  1D8K A;  5FD6 A;  4U7D A;  3MEX A;  3GO5 A;  1BM9 A;  3VOE A;  1SD7 A;  1YW7 A;  4AVP A;  2W24 A;  2E1N A;  2NYX A;  2VOO A;  1ON1 A;  3NEU A;  2A6H F;  3C18 A;  2XAG A;  1P92 A;  5AIP A;  2A3S A;  3HSE A;  1R00 A;  2L4M A;  3KZY A;  3KP4 A;  1HSJ A;  1MD0 A;  1OYI A;  5BOX A;  3JAM K;  3CO7 C;  4UHT A;  3HSR A;  1KU9 A;  1QQI A;  2M5W A;  2ADU A;  1G3Y A;  5BMZ A;  2IPQ X;  2ZJ2 A;  3RPQ A;  4QLC U;  3FM3 A;  3PFI A;  4KIF A;  3U1D A;  3ULQ B;  4EM2 A;  4ESB A;  1FYM A;  2FBK A;  1T38 A;  4M74 A;  5K1Y A;  1B9M A;  4Q4Z F;  1UCR A;  3QRF F;  1IRF A;  2OQR A;  4A12 A;  4OMZ A;  1YW9 A;  4UNO A;  1A04 A;  4EGY A;  4LJZ F;  2EA4 A;  4EGZ A;  3O6B B;  5L3G A;  3WE2 A;  5LBQ A;  3GF2 A;  4M72 A;  3CUO A;  3SHF A;  3RTR A;  3ZMZ A;  3F3X A;  1XD7 A;  5E17 F;  3BOQ A;  1LJ9 A;  2BE5 F;  2R7D A;  4GXO A;  3P7N A;  4KA4 A;  4KIB A;  3ZN1 A;  1J7K A;  3J81 Z;  4ASN A;  3ROU A;  3EYI A;  4WXD A;  5ILU A;  4I2O A;  5A2Q K;  1MDM A;  1XMK A;  4RB1 A;  4M73 A;  1MGT A;  2M30 A;  4FHT A;  3WGG A;  3KE2 A;  3WTV C;  2QZ8 A;  1J0R A;  3F6O A;  1ZRF A;  4AD9 A;  2HS5 A;  4M9Z A;  2GWR A;  1OR7 A;  1KGS A;  4O6J A;  4A5M A;  1UST A;  2ISY A;  1I1G A;  5ED4 A;  1G6N A;  4IVN A;  3O2P E;  2FU4 A;  3LA2 A;  4ON0 A;  4OIN F;  4CHU A;  5LRS A;  2VT2 A;  4N9I A;  2FXA A;  3FMS A;  1LQ1 A;  1S3J A;  4ESJ A;  3MFK A;  3BJO A;  3DV8 A;  3PQJ A;  2PJP A;  2FOK A;  2EFO A;  5FGM A;  5E1X A;  5LHG A;  2YR2 A;  3ZMD A;  1I6X A;  1Z1D A;  4Z2Y A;  2FBI A;  1IN7 A;  1HKT A;  4BHC A;  1TTY A;  4N0B A;  2KKO A;  4WK8 F;  4JK1 X;  4KN7 X;  3JSO A;  1DUX C;  2DW4 A;  1XSD A;  1LDK B;  4U0V A;  1RI7 A;  2FBH A;  4OMY A;  2A68 F;  3QPT A;  5HVQ C;  5HLG A;  1H9G A;  3DPT A;  4H0E A;  2ZBK A;  1MJA A;  2DPD A;  4M9X A;  1FYK A;  2H6C A;  3E3V A;  2XKP A;  3F21 A;  1DP7 P;  3F6V A;  3HOS A;  1SMT A;  5FFZ A;  2WV0 A;  5J6X A;  3QU3 A;  1L3L A;  2ELH A;  4HX4 A;  1SAX A;  3H3U A;  5F6F A;  3BZ6 A;  3WTX C;  3IRQ A;  3KEO A;  4MNU A;  4UVB A;  2YX4 A;  1YO5 C;  4I01 A;  4HLX A;  4HZF A;  3RDI A;  5H6Q A;  1DPR A;  1R1V A;  5AIQ A;  3HOT A;  4BQA A;  1YFH A;  1WKM A;  3HUG A;  1O3S A;  4HDV A;  5D5W B;  1B59 A;  5HDG A;  2K7L A;  2JTV A;  3DQV C;  2Z3Y A;  3QAH A;  1G3T A;  4YFX F;  1YS7 A;  1R58 A;  3FX3 A;  4Y13 A;  2OU2 A;  3DPL C;  2FNP A;  3GFL A;  2KJC A;  4BXU A;  2VC0 A;  5DEQ A;  2E1C A;  2EJR A;  1ZHF A;  5DD8 A;  3R4K A;  1OMI A;  1HW5 A;  3E5X A;  5L3C A;  3R60 A;  1FPQ A;  4G7H F;  3DF8 A;  5LEK A;  1XGM A;  2XAF A;  3U2R A;  1P4W A;  3G3Z A;  1WWX A;  1VTN C;  4HF1 A;  3FM5 A;  2Q2E A;  2GIV A;  2ZKZ A;  4UV9 A;  1K6O A;  1R22 A;  2OZ6 A;  3GZ6 A;  4LLN A;  3HRM A;  3IL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...