4YIQB

Structure of the ceacam6-ceacam8 heterodimer
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
107
structure length
107
Chain Sequence
KLTIESTPFNVAEGKEVLLLAHNLPQNRIGYSWYKGERVDGNSLIVGYVIGTQQATPGPAYSGRETIYPNASLLIQNVTQNDTGFYTLQVIKSDLVNEEATGQFHVY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Carcinoembryonic antigen-related cell adhesion molecule 8
publication title Diverse oligomeric states of CEACAM IgV domains.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell adhesion
total genus 25
structure length 107
sequence length 107
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-03-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF07686 V-set Immunoglobulin V-set domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yiqB00
5KVGH 3WJLA 1FVDA 3MRJB 1U8HB 2DQIH 1B2WH 3MCG1 1KJMB 1MHPL 4OLYH 3BKYL 2ADIB 4LSRH 4LLWB 3NFNA 1KBGL 1EHXA 5FM5M 1VACA 5TGBB 1BLNB 2I25N 4NO2B 1HQ4A 2VLJE 1HKLL 4G8FB 4OD1H 4PJ8C 3EW3B 2FATH 3MZTA 2VO5A 2DQFB 5GZOD 3A0OA 4NN6B 2BNRE 4GUPB 5EDXA 2K7PA 3GSWA 4CNIB 1RJYB 3DUUA 1I7RB 3HZMB 5JUEH 5JTWA 2J8UF 5L88L 1AIFA 5IF0B 3RJQB 4U6VL 2JJWA 2VAAB 4I48A 3QJFB 5HYJD 3CFJB 2IAMD 3OJVC 3IDMA 1N7ML 4BK5A 1HOCB 3OF6A 4NQDB 4H8WL 3EHBC 3H9HB 4XCEB 2R2BA 4CL7A 1YEEL 2PTTB 1A02N 3DVNA 4HK3J 4L8CB 2LU7A 4HAFA 4OZGF 1E0OB 4H26A 4R4FH 1QZ1A 4TPRH 5DD6A 4G8GA 3MRCA 1XF4B 3F12A 3HRPA 5HJ3A 5D1XC 5KN5B 2JCCB 1XGUB 2DWDA 4L4VD 5SWZE 3RDTD 2F53B 1MCEA 2VLKE 4OAWA 3DTXB 4PG9A 4X0KB 1BVKA 1NGWA 4YUEH 3RWEA 3V8OA 3SDDC 3GIVA 4HKBA 4PIRF 3KYMB 4Z78B 4JQIH 1CD1A 1T0MA 1PKQA 1V3LA 2I26N 1OAYL 3JUZA 4FZEH 1Q72H 2DQUL 3LOWA 3C08H 2ZCHH 4KDWA 4BQ9A 4JFDB 2IADB 4HUUB 1G7PA 4YDKL 5TPWL 4R26H 1NC2D 4WRLA 1EIBA 4XVJH 3O6FB 5E4IA 4F7CB 4LCCC 2CKBH 1WCBA 4HKZA 3V5KA 3T0EC 4HZLA 4HWBA 3VXQB 4OI8A 12E8L 2DD8L 1ZGLP 1TZGH 2D0HA 4RGOL 1R5VA 3MCLL 4ODSH 3BN9C 3ROOA 4RISH 2P47B 2YR3A 4GW5B 43C9A 5ANMA 4F7TB 3EJYD 3CC5B 3JWOL 5I0DA 4L3ED 1FZKB 4J4PA 4JM2F 3ZLQC 3CH1B 5DS8A 1W8NA 4ZUWA 1XGTA 3MLTA 1IGCH 5DRWB 3WCYA 4C56A 2X89D 4ZFZA 5JOEA 2ZPKL 5F1SA 4YE4L 1DE4A 1LILA 2VDOH 5DEFA 4E0RB 1T89C 1TJIL 3M17B 1ADQA 1LO0L 4ZXBD 1HH6A 3D18B 1IC4H 3U4BH 4QY8A 1FNFA 2LFGA 3HC0A 2A77H 3K8LA 2D31B 4I77L 4CVZA 2ID5A 3BEVA 2APVA 2F54A 5KVMC 3MNVA 2K1MA 1FFOA 1INQA 4AY0A 4MNQE 1ETZB 5D6CB 5C0AB 2X4RB 8FABB 4RIRA 1AO7A 1F4WH 3MJ9H 3CPLA 3MRLA 4NQXA 1T1YB 4P59L 5I8KL 2BSRB 3ZE2E 2OTWB 1BJMA 2OXGA 4TUOA 2BXYA 3RIFK 4F57L 4G9FE 1NCCH 1KJVA 4R4FL 1YEKH 4LP4A 4N8PA 1JZ2A 1NGXB 3IVKB 3KPNA 1T5WB 5ACMA 1NANI 4APQD 2HH0L 1XIWA 3VG0H 5ISZA 5C0BA 4LEOA 3TBWB 4WU5B 1YMHA 2VXUH 1XEDA 3QUZD 4KK6D 5K9OA 4P57B 3EYUL 4JPKH 1NCUA 4KY1H 1LE9B 1TJGH 1BFTA 4IS6A 1IQWL 1T0NA 4JQIL 5CEZD 5LGHL 4IRSC 2ZG1A 1EMTH 1RMFH 1Q72L 2EDWA 3EZJB 3QXVA 1AP2A 3F58H 5D5MA 5HDQH 4LCYB 3KPOB 2UZIH 4WW2F 1OHQA 4X6DB 4XVTH 4Y5XA 5HGDB 4K7FA 2D9CA 3NIGF 2A9MH 1A64A 3SQBA 5I8EB 4CJ1A 1FYTE 4D9QD 1RUAH 1IL1A 1H5BA 3OR6A 1TZGL 3T0EE 5C0JA 3UTSE 4ODSL 4FTVB 4WFGD 4XAKE 2UY7A 2GK0B 4JO4L 2BNQA 4XCCL 1BZ7B 1AE6H 1N0XL 2GITA 3D3VE 5ACLA 2NY1D 5HHQB 2R4SH 3CLEL 3L3KA 3O8XC 1YNKH 2CGRL 2Q7YA 3P11H 4ISVB 4O2FB 4PJBF 1S7SB 4MX7B 5I1LB 5ICXA 1IGCL 3C2SA 3MLSH 3MGOA 3T0VA 5DTFA 5ICZB 2EDYA 1ZVYA 4Q0XH 1MI5E 4MNGE 5BZDA 3I85A 1N5AB 2KQMA 3BKJL 2YD3A 3WIIH 3OAYH 1PEZA 4LLMB 1VGKB 3GSVB 3KWWB 4N5ED 3H9SB 2A77L 3ZKXB 1I3RA 1DQDL 1VSCA 4KAQL 3CSBA 2ZUUA 5D7IA 3U30B 3ILQD 1K8DA 1MRCL 5FYKL 3ULSB 4PJ5D 1UG9A 2GTZA 3BW9B 3TVMA 1JL8A 5F7NC 3OB0H 1RJZA 5DUBA 1H3VA 4MJIE 4N8CL 4RFNB 1WIPA 1F4WL 2CSPA 2YKLH 3I75B 1QFWI 5GRYA 4JY5L 2XN9E 4QRQB 4OZHB 4XVSL 1BBDL 1YEJH 5DD0L 1ZLVH 2OMBA 4LMQE 5E8NB 1ZT4B 1BOYA 4N90D 4XNUH 4YIQA 2RQ8A 1RUQL 5E7BA 5GJTH 3VMOA 4DGYL 4YEFA 2R2EA 4U2ZA 1M05B 4YHOH 3GK8L 3MR9A 3DX6A 1UWGH 3C6LA 4D9LH 1EA9C 3L1OH 1LMKA 4GFTB 2VXUL 3TPKA 1KN2L 5FOBA 5HGAB 5HDLA 2ZJSL 2EZ0D 4NPYA 5T1DH 2ITCB 1TJGL 3U79A 4O2CB 5F7MC 3CFEA 4GW4B 5CSZA 1I1AB 1KCVL 3STLA 5HHOE 3RUGF 4JY6A 2EYSA 3BWUC 5SV3A 5E6ID 4IRJA 4F2MA 2CDFB 2UZIL 1S9XA 4HJJL 2JIXB 4ORZC 3D39E 4LSTH 4NKOB 1QBLH 4S10A 1ZGLB 3H3KA 4PRPE 1P2CA 1MUJB 3BH8A 3PHSA 2H32H 1KCRH 5TJWK 5I2IA 1NLDL 1VPOL 3RDTA 4L4VA 4BH8A 3LCYA 3MGTB 1OP3K 2DQJH 4YFLI 1AE6L 2JJVA 5EU3B 5BJTB 3GI9L 4GMTH 4JZJB 3MMEA 4LKCB 3P11L 5JXAH 2XTJC 4HMEA 4YGVB 1ZANH 1XR8A 2VDNL 2B5IC 2X1PA 4Q0XL 3RVUD 2NX5E 4JHZA 3FONB 3MNZA 4R96B 5IMOB 2E7BA 2FJGA 4ONGL 4BYHA 4GG8A 2FHFA 3VH8A 3KPMB 5ABDE 5HXMA 5FUOL 5DJ6B 5DURD 1HSAB 1UACL 3BP4B 3GUTB 2V9RA 4WUUE 3SKMA 4FQIH 3UO1L 2XXMB 2ADFH 5L6YH 5JNYB 4EJ1C 4GBXD 2PYED 3WD5L 1RZFL 1M7XA 1CICB 1N4XL 1E27A 2PW1B 5C70A 1EBAA 5MHSE 1MCJA 1FZMB 1BZQK 1OF2A 3EJJX 4S1QH 4G7YL 1AHWC 2EC9T 5HVHC 4LNRA 4L3EA 4YZFE 2LTQC 1N6QH 4HS3B 1YYMH 1WBYA 4RA0C 3IS0X 4IMLB 2A73B 4ESKA 1X5LA 1T7ZA 3FN3A 5E24E 5J3HD 2IH3B 1EO7A 4J1UB 4OTXH 2MSPA 5EB9A 2GFBB 4LLVB 2VXTH 2WIMA 3LRGA 3UJJL 5GJTL 4WDIA 4ZPVA 3GJFH 4YHOL 4BZ1H 1AD0B 3EYVB 5MEND 5DJ8A 3C2AL 3HR6A 5I30L 3G5VA 5T1DL 2H45A 5KAQF 1NAKH 1U8LB 3IETA 3SKNA 2NY7H 5HVGB 4XMLL 1GGCL 3HB3D 3OAZK 4WTZA 5GGUA 2AJUH 4P5TB 4PRIA 1FRGL 4I9WE 1PJ9A 4W4OC 2MJWA 5KZCB 1C1EL 2FIKA 4QRPD 5CD5D 5D1QA 3VD5A 4WFED 1A6TA 3HLAB 4R4BB 2X9YA 5EOTB 3B9AA 4PJHE 2V2XB 4PJIF 3T3ME 5DD3H 2QQKL 3QNXB 5EWIH 3FO1B 1AXSA 1FVEB 3CFKA 4MQSB 4PRAA 1HQRB 3CCHA 1PY4A 1CVRA 4LLUA 4JFFB 3DRQA 5HI3C 2ICWB 4RX4A 1FV1B 5C0FB 4Y4HC 4GMTL 3UTTA 3OHXB 4WVRA 4D9RD 3PGCA 1T03H 4CVXB 5E03A 5FYJE 2Z31B 1T21B 1U8JA 5BZWB 2IGFH 4QTHA 2XTJE 4DN4L 2WUCH 1G0XA 5IB5B 4PGZA 4OZ4A 5BRZA 3QO1A 3W0WA 3G08A 2OS7A 3GMRB 2NY0B 4B7LA 4F9LC 1J8HE 4X7DC 4Q6IA 1KOAA 3V6OA 4FQIL 3G5YA 5JPNA 1KGCD 5F6HJ 4RDQF 1WWBX 3WLBB 3MV9B 1BIIA 5SWSB 2WP3T 3QUXC 4CU6A 3MRBB 3BKCL 2PNDA 1IMHC 2P5EA 1XCQB 3QEHB 1TQBC 1CFQA 3VXSB 3LH2H 3VI4E 5B3JF 4O2EB 3QAZC 2DWEB 5HGHB 1JNHB 3E6HA 2XZAL 1KJ2A 1LHZA 3MJGX 2VNCA 1SY6L 4O4YH 2VTFA 1JWSA 3O2WL 4P4KB 1BQUA 4CVWA 1YYML 5J1AA 2V5TA 4RAVB 4KRPB 3PJSA 4OTXL 4TVSa 1I1YA 4KK8D 4KROD 2KQNA 3H3PH 1QD0A 3MRDB 4GXVL 1K4CA 2BOCB 2FX8L 4PGDA 1WAAF 1BQHB 1FAIL 2VQ1B 2ZUYA 3MSPA 5JZ7D 2SEBB 3RWJA 4BZ1L 2HFEA 3LEVH 1Z9MA 5LXGH 1L7IL 4ZDHA 4L3AA 1HN1A 3VD4A 1EUTA 5DK2B 3LPGA 3BP6B 4UAOB 5E56A 5CJQH 2E7MA 1UCTA 3RWGB 5GS2D 3PHOB 3UZVB 2AJUL 5IB3A 3U46A 3ARBB 4QRTA 5GGQL 3UTQA 4LVNC 1HHJA 4PJDF 1RFDL 5GGRB 1I7ZA 2IBGA 5FDWA 3MRIA 4ODTL 3SGEH 2CRMA 3VFNA 4L8BA 3DHJA 4RAUB 3RPKA 2CKBB 2VLMD 1EHLH 3U0WL 3RZCC 2V9TA 4DZBB 5BV7L 1NGQH 2VL5A 4HT1H 1BMGA 3VW3L 1XGRB 1FHGA 2UZYB 2JB6A 1BQHG 2PXYA 4WHDA 1FYHB 4RFEB 5BS0D 4WNQA 3TA3D 4FFYH 3QDGB 2RBLA 4I3GA 1MPAL 3P77A 3WFEH 4D0CA 4M7KL 2IG2H 1VKXB 1FGVL 3TZVD 4O51B 4KRNA 4OD2B 1UH3A 2AJYL 4KZDH 2F8XC 5AG8A 3NCCB 1G6VK 3QPQD 1YN6B 2XG5A 1VESA 5I9QB 1K5NB 1UA6H 1EUUA 2R0ZL 4K3JH 3LEYH 3R4DA 4ZOBA 2HJLB 4UILH 3VWKB 1W0VA 3ARUA 5LBSL 5DZNA 3L5XH 3MV8B 4LLQB 1IZKA 2F8OA 1YEFL 4D0DA 2NY5C 4Z0XA 4I3RH 3FB6A 3LH2L 4QRSB 2VL4A 4PLKC 1AGBA 4XP9H 4OGXL 3O9WB 3P40A 3VXPA 1WC7B 5C8JB 5JHDB 2XV6B 3LN4B 5BOPA 3ZTJH 1GGIH 5DFWH 4I5BA 1IVLA 4HWBH 3PQYB 3PXJA 5HHME 4CAGA 4M3KB 4TSCH 2Q1EA 1HIML 4S1DC 1SEBA 2DDQH 1FYTB 2ATKA 3N85L 3LKQB 4YHKH 3ARVA 5AZEH 2HFFA 3D85B 2RCSH 2UUDH 1FJ1A 4GBXA 4Q2ZB 3VFSA 4H25A 3E0GA 2HG5B 4R97C 4P3WA 3WN5A 1YN7B 1ACYH 4LRNH 5IMKA 1IQDB 3EGSA 1BVLA 1QKZH 5MP6H 1HHGB 3HPJA 3QXUA 2JKXA 5DA4A 4LF3B 5EIQA 1ADQH 1CFBA 1MJJA 4MNGB 3ZTNL 4I18C 1BWWA 1C12A 5D1ZD 1P5UA 2FHBA 5GIRA 4JLRA 1IM3B 1FNGA 2FSEB 4PJXB 1EHLL 3BDYH 2ITDA 3UTZA 1NGZB 4QHUB 3TBSA 3RVWC 3VXUB 4NUJA 1YPZF 3SCMA 4YNYA 2K7QA 4LRIA 3L5WB 5B8CC 5GS0C 3HG1E 1L7TH 3D25A 3WL9A 2DJ4A 4IM8A 1KCLA 5DJ2A 4CU8A 5ACZB 2PTVA 4X9FA 5C71A 4Z77A 3VFGH 1QLEH 5GSRB 4HBQA 2XA8H 4HAGA 3HRZB 4EDWL 3DX9B 5TQ0H 4YWGL 4KZDL 1TZHA 2DKMA 3G04A 5DJ0A 1CYGA 3MUHL 1S7WB 4HKJB 4P48A 4U1MA 1JTPA 2X4QA 1G7IA 2BHZA 4WI2A 2AK4E 5TFSL 3SJVB 2VC2L 4PJCA 3WIHL 3BMVA 3LEYL 2NQCA 2JB5L 3NFPA 1ZHBB 2YWZA 3MOAH 3PWLA 5DQDH 4HUVA 4UOW0 5IVNA 1CXIA 2HVJB 1P4BL 1MIML 1E4WL 1QR1A 5CGYD 3REVA 1FIGH 4Y19E 3OAUH 5IVXA 3UZQA 1P7QD 5HDBF 3X14B 5JW5B 3VRLE 3O3AB 1HHIA 4XP4L 3ARDD 2NXZB 1E4KA 3DO7B 1T1XA 3EIFA 4CBPA 3FO2B 5IWLA 1I1CA 5DFVD 5F96H 4PV9A 4LKXB 1J0KA 4G5ZL 4X6CB 3ZKNC 2EDLA 5JA8B 5DWUH 3LB6D 5J1TC 2B0SH 2IPKB 1F45A 2DDQL 4DUXA 4S0SD 1MFDL 5JQHC 1FORH 3RTQC 1OW0C 5CMAB 4TQEH 3OPZL 2DMCA 5CEYB 5FYKU 3U6RA 5C07E 1WFNA 3GKWH 4JVPA 1NCDH 5GS0H 1OAQL 3MOBL 1U95A 3GGWA 1QKZL 5JW3L 5EN2A 5DVMA 1GHFH 1URLA 2I9TB 4JVWA 1RD6A 3SOBL 1ADQL 2B1HH 1RZJH 3MFGB 3FFDB 3T4YA 5DYOA 4HXAH 2AJXH 2H32B 3FN0L 2W0LA 3RGVA 4GAJH 3QIWB 1QRNA 2E6QA 5E9DA 2VOTA 5ALBH 5TE4H 2VLRB 2XWJA 2I9LB 1CQYA 1K4DA 4UT7L 2ZCKL 3VI3E 3QWOB 3P0GB 1XGQB 5BVJA 4AEHH 2AK1H 1MREL 4KK9C 3RNQB 1DTUA 1IAIL 4PJFE 3G5ZB 5D7JC 5DD1H 4E41B 5KSAB 4HQQL 3O4OC 1MH5A 4MQTB 5DXWA 5ITFB 4UB0H 1AXTH 3QUMA 5L8JB 2ERJC 4ODHH 5ICYB 4JR9H 3DPBA 1IEBA 3MOAL 1VGEH 1EJOH 3LN9A 4FFVC 4LOUC 5KVFH 1F4YL 2R1XB 4Z7VE 3BZ4B 5EULV 4NQCD 5HHVL 3VXMB 4QHNB 4NNXA 2EXWC 1D5MB 1S9YB 4PJ9A 1FIGL 4K94H 3TA3A 5KJRL 1T7YA 2C3WA 2E6PA 2GT9B 4XHJC 3CDGB 3C5SB 4ODWB 5FCUL 1IGMH 1ZHLA 4U6XB 2XRAL 4O00A 5IJVA 1JGLH 4TUJB 3JWDL 1S5HB 4Y4FA 5HYFA 2CK0L 3NCFB 5CFHA 1WFUA 2F58H 2WV3A 4MB5A 3W5NA 3NPSC 5D2LF 3QNYB 1X5HA 5DWUL 3PE9A 4HLZG 2YPLD 1BAFH 3DV6B 4XI5D 5LAXB 1JHLL 1DLHB 1QFHA 3GJFB 1BM3L 2DF3A 1FORL 4NSKB 4W4NA 1V3JA 3SDAB 2DL9A 1T7XA 2E7LC 4QRUB 4WGWB 4BQBA 2DJSA 4PREA 1PVHA 4YDJA 3GKWL 4R0LC 1SEQH 4LAQL 2CRYA 2E3VA 4ALAL 5EO9B 1R5IA 1AGEA 2X10A 2CKNA 3JZ7A 3WBDA 4ZAKD 1GHFL 1QSFD 1R3JB 5HD8C 2E9IA 3ZE2F 1A6VL 2VIRA 3BHBA 5TDOB 1YC7A 1UB6A 2X7LB 3OQ3B 4K2UL 4QOKB 1WSST 2YBRA 1QLRA 2Y7QA 2AJXL 5EUOE 5MEPA 1NKRA 2BY0A 4TVPD 5T3ZH 5D9SB 2NZ9D 1JHKL 3VRJA 3IJSA 1KTLA 2NZIA 2PR4L 3QWQB 4P3DA 5TE4L 3BPLC 2NLJA 1L6ZA 2DBLL 1NMAL 2P5WE 5T5FL 4EQ3A 5IG7B 4F37F 2VISA 4Q9RL 1RUKH 1ZWIA 1YUHA 4GRWE 3DRTB 3NPZB 2ZUXA 2I07A 5LGJA 4NN7B 5DLMH 2COQA 5DD1L 1YEGL 3KPSB 4NN5C 1KC5H 4WHTB 4X5LA 5JXED 4GS7C 1MFEH 1QRKA 4OZFA 4ELME 2HJFA 1B0GB 1V7MH 3OXRB 1Y6MR 5T3ZE 1DQQA 4HJ0D 1EJOL 2EKJA 1A8JH 4PRHA 4CMHC 4OCSH 5DA0B 5E2TH 3B8SA 4M6NH 3DWTA 1F3JB 4HD9A 3NVQA 3QXAB 4M5YL 2IPUK 2A6JB 5FCSH 3A6CL 5DVNA 2VITA 1EAPB 4ZO9A 5EBMB 1D5IH 3HCVB 2MPAH 4PJAB 4FQ2H 4RZCB 4NCC1 3CDFA 3X17A 4OLZH 4KDTC 1BX2A 1A0QH 3BD3A 1BAFL 2V7HA 5M95B 1ZK9A 4QCIB 5FYLH 2BJMH 3GMOA 1CGWA 2GJJA 4FFZH 3VFMB 4ODXA 1JWUB 4JDVA 2G9HA 5A1AA 1FVDB 4Y4KC 5JIKA 1SJXA 2P7TA 5A16A 3NFNB 3VXRE 1M71A 2Q8BL 5TDPA 5EU7C 1VACB 3VFTA 1Y0LA 4Y16C 1HQ4B 3ZKSD 3BFOA 5HHXL 1U8QA 4LLYA 3UPCA 3S88H 5T1MA 3GSWB 3DUUB 1IKNA 2C4FU 3ARWA 3EFDH 1AIFB 1CLOL 3MBEA 1XMWA 2Q3AA 4I48B 3KLHD 1W2KT 4GKZA 4HUWB 4NKDA 3V7AG 3SE3A 1E6JH 1KJ2H 3ARXA 3ZE0F 3QUXB 3VFRB 3IDMB 3TNNA 3V4UH 3ULUD 2R2BB 3QAZB 4HIJA 3DVNB 2BSTA 4GOSA 3RY6C 4H26B 3UJTL 2H1PH 1DP0A 3IFLH 2W9DL 1MCHA 2RAMA 2DL2A 5DD6B 5GS1A 4G8GB 3W81A 3MRCB 3PWVA 3F12B 3GSQA 1MFEL 3B2VH 1EERB 2Q8AL 5HHMB 3O4LE 4UQ3B 3OKKA 4HGWA 3P30H 1V7ML 4OAWB 4C83A 4YHLH 4P2QE 1RI8A 1NGWB 1LE5A 5JDSA 3RWEB 4IOIB 4Y5YA 1WGOA 4HKBB 3PWUA 3IJHA 1KIPA 4OCSL 4HKXA 5E2TL 3VXOB 2VXVL 4F7EA 3U0PA 2QQLH 1CD1B 5F9JB 5A2LH 1X44A 1PKQB 3HFMH 3SO3B 5F88A 4OLWL 4U1LA 3QFJE 1G84A 2OMNA 2G2RA 1LO2L 4NFDA 3MLPA 2DS4A 2F74B 2MPAL 1LDSA 4AEIH 1G7PB 1K9TA 5IW1A 1T7WA 1JTOA 3B6SA 3L3HA 1CR9L 1WCBB 4HKZB 3V5KB 1YEHL 3GNML 3VGHA 4OFIA 4OLZL 4JFHE 1WICA 3DI3B 4UV4H 4H20H 3P4OA 4PYHA 3NN8B 4XB8A 1R5VB 3I9GH 4QHMA 2NY4D 2VAJA 3ROOB 2OJZL 2Z0BA 3C60A 5F72S 4JRXD 1IM9D 43C9B 5ANMB 5HVFB 4LK4A 3ILPA 4HFUH 5CEZL 2DQHL 3KR3H 5DS8B 1XGTB 5K59E 3FQWA 2Y07H 3PHQA 4C56B 3MYJA 4OM1H 2R23A 3RP1A 4H0GA 4NYLB 5AZ2H 4WEBH 3ROLB 1XGPA 1DE4B 2F19L 4FMKA 4FQCL 4M61A 4NJ9H 5DEFB 3S36L 5BW7C 2V6HA 3U4EB 1HH6B 4GXUN 4GKOA 5ESQA 5EU7E 4U7SA 3UP1A 1M1SA 1F11B 4X6FA 4BFGA 3RJDA 2HTLC 3J7HA 1QPXA 2YA1A 4NNYA 1ZLWK 2ESVD 1A6WL 1PG7X 4CVZB 5I15H 2YPLA 3BEVB 2F54B 1ZSDA 3BP5A 1ZA3A 4ZTOH 5L2JB 3RVVD 3MNVB 2WANA 1MCRA 1NCBH 2WINA 1FFOB 4M03A 1J0HA 1ZMYA 4OD3L 3SGDH 4P2RE 5IROA 4HK3N 3TFKC 4PV8A 4WW1B 2GQHA 1DCLA 4RIRB 4WTXA 4RMUA 4NQXB 3BPNC 3CPLB 2B2XH 4LVOC 2BDNH 3U2SA 4TUOB 4Y5VC 3LN5A 2IFFH 1KJVB 1N5YH 4LPXA 3SHSA 2H1PL 5I73B 3ZKMC 4X80H 1C08A 3KPNB 3U9UA 1NMBL 4PJHF 1XIWB 3P30L 5ISZB 4NFCA 3T3MF 3BE1H 5C0BB 3DBXA 3RL1A 4LEOB 1YMHB 2OBGA 5FFLA 1UZ6F 5K9OB 2R56H 1KIRA 1D6VH 5INCA 1R24A 3WXVH 2DQCL 4IS6B 3ZMRA 1T0NB 1UXWB 1PSKH 1XF1A 3S97C 1EHNA 3U7YH 4QNPF 5B39G 3OX8A 4PJEA 4KH2A 3ARZA 5EOQH 3QEQD 1U8MA 4WO4D 4K7FB 3QA3A 1I9IL 2G75A 3DMMC 3CIQA 1P4IH 1C16A 5C0EA 4A6YL 4JJ5A 2W0FA 3VWJC 4LEXH 5J06A 2E27H 5KTEL 1IL1B 1P1ZA 1H5BB 1V7NH 1X5ZA 3OR6B 4UV4L 4XWOC 5C0JB 4N1HB 1QLFA 4M02A 3QI9C 1QFUH 4Z76A 1HILA 4G6MH 2BNQB 3QG7H 4RGNB 3TH3T 2GITB 4NZJA 1ONQA 1P7HL 3L3KB 2Q7YB 5GGSY 3VI4F 3WSQH 3KR3L 5B8CB 2VKWA 1NAMH 4K8RC 5FYKE 5ICXB 3T77A 4DKEH 5CCKH 3MGOB 1UM4L 2QEJA 4M9PA 2P8PA 4OM1L 5BZDB 4KU1A 2APWA 4X4YA 1ZT7A 5F3BA 2FDBP 4FQHA 1WWAX 5DUMH 4KQ3H 1DJSA 4M1CD 3X3FH 1S7QA 1I3RB 4JM4L 2WWKT 4UOW1 1HZHH 3SGJC 3JV5A 5I15L 5D7IB 4ZTOL 1K8DB 3IDIB 5J13C 1NCBL 4LSDA 3ZL4H 3UBXA 1YJDC 1RJZB 5DUBB 5CEXA 3G6JE 3KNBA 1YEDA 2MKWA 1S7XB 3RBSA 2BDNL 3R0MA 2YK1H 2DQGH 3LPFA 3KS0H 1BJ1J 4ZUVA 1EGJL 3BQUD 3MUGA 1JZ6A 1GGBL 1LVEA 4YIQB 2O5ZH 5EOCJ 1K8IA 4YHYC 3HNVL 4OT1L 1FL6A 3MR9B 3DX6B 3C6LB 1GC1H 4PRNA 3UTPD 1H3PH 3JTTA 1MHHA 4OJFH 4M5ZH 1MCFA 1ZOXA 3LMJL 1VA9A 2LV4A 5FOBB 1KEML 1D6VL 1SMOA 1F3DH 3V0WL 3WXVL 3EDKA 4H5SA 3RTQB 4M7ZC 3CFEB 2PCPA 5I1CL 1J1XL 3STLB 3U7YL 1K2DA 2EDFA 4JY6B 5C09D 2EYSB 4IRJB 1QBAA 4UZGA 5GRZA 4QLRA 4F2MB 4AENA 2YUXA 4HIXH 1S9XB 4OCRL 5CILH 5E6ZA 3X12B 1OSPH 2DQEL 4JZNA 4M1DH 1QFPA 3MTRA 3RWIA 5L2KD 2ARWA 1P2CB 4R3SA 4P46C 5C1MB 3BIKA 4J12A 2E27L 5C2BH 3BI9X 2IC2A 2NPLX 4G6KL 2X42A 4ZFOA 3QUYA 4LIQH 5I2IB 5EUOB 3RDTB 4BH8B 1QFUL 1H15A 5MEOA 1NH6A 4G6ML 3QG7L 3KPQA 4ZG1A 4WCYH 3FAWA 3MMEB 1QO3B 1QBBA 2AQ1A 4FNLH 2AEIT 1XR8B 3ZE1E 5CCKL 1X9QA 2HAZA 3GHBH 1P7KA 2D9QB 5D4QA 1KG0A 3BMWA 3CDCA 3MNZB 3IDNA 2FJGB 3QQNA 2UWEF 5MERA 4GG8B 5DFTA 3D69A 3VH8B 5B38A 3QDMD 4MVBD 4ORGA 4FXLA 3QUMH 1QR4A 5DMGD 1QHOA 1IAII 3X3FL 3SKMB 3K2UH 4I0PC 3BN3B 2DLFL 5C0CA 2D7MA 3O4OB 4RRPG 4KGJA 1E27B 1KTDA 3GSRB 2J8UA 3ZL4L 1QSED 5I0ZA 1OF2B 4GG6A 5EPMA 2NY2C 4JRXA 2C7UA 1IM9A 2VR5A 5I8OL 1JFQL 2EICA 4JFXA 4LNRB 1DLFL 1MAML 1CFNA 3EDEA 1OM3H 1E6OH 3ORJA 1L9NA 5SX5H 1WBYB 4JB9L 2XQYK 2Q7NA 3BXNA 3IYLW 1U58A 2EDXA 3MRFA 2ZOLA 1EEZA 3Q1SL 4QEGA 1IGYA 1TXKA 2HLFD 2IANA 5B3NA 2E7HA 4OZGA 4WDIB 5EZLA 1G7JB 2O5ZL 3VH8G 2APFA 3HI5H 3QR2A 4HUMB 2XQBL 4NZDA 3LQMA 4M3JA 2ESVA 1UENA 1U9KA 3G5VB 5BXFB 1QSVA 5F7EH 3IETB 1A7NL 5D7SH 3SKNB 3THML 4AIXA 5CKAA 2KL6A 4M62L 5E95B 4XNYH 1QACA 4YDIH 3HMWL 1TMCB 1LD9A 2AI0L 2Z92B 4PRIB 5CD3A 3S37L 4UBDC 3IXAA 2CLRA 1AD9A 2FIKB 2AJVH 3C09B 4NQDD 4HIXL 3FT4A 1U2HA 5D1QB 4U1JA 1FPTH 1A2YA 3MJ8B 4PGEB 1RZ8A 1OSPL 1A6TB 4P2OA 4KMTL 2Z35A 4UTAH 1YY9C 1KCSH 1VEOA 2WWMD 1AXSB 4X6EB 1B3JA 4PRAB 5C0DA 3CCHB 4IDJL 5IB2B 1G9ML 4ZUTA 3FQNA 2EIDA 4LLUB 2F53D 1FN4A 2P1YA 4IJ3B 3DRQB 2CIIA 4F7PA 3FO0H 4LHQB 4WCYL 3UTTB 2BOBB 4YPGA 5I17A 3WHXA 3PGCB 2WK2A 3LSOA 4YO0A 3DLQR 4QTHB 5IT2H 1MQ8A 3UC0L 3AROA 4RGMC 4OZ4B 5BRZB 4JFDD 3W0WB 1HI6B 3DNKA 3HN3A 3DXAA 3G08B 3WJJC 3OL2A 4WO4A 2Y5EA 3O6FD 3L3GA 1A4JA 4WFFD 3I50L 4OZFH 3TYGH 3QUML 4G6AD 3DECA 4PB9L 4PJGE 4Q6IB 5T3XE 5D2NA 4BQCA 3K2UL 4ZODA 5JPNB 1LO4L 5K9JH 5I18L 1OQOA 5FKPA 3MLRL 1BIIB 3ULVF 1F8TH 1HDMA 2P5EB 3CH8A 5M94B 3JV4A 1AR1D 1R5WA 1CFQB 4QXUL 4AM0A 5EIVA 2Z4QA 4YFLF 3HUJE 3E6HB 2ZNXA 1KJ2B 4V1DE 4YDLC 3WNLA 4DZ8A 3DX7A 2CJUH 1X7QA 1JWSB 3GO1H 4PY8I 1IGIH 5J1AB 1Y6NR 4WGVB 1KSRA 3C87A 3D5OF 3WUWA 4C58B 3PJSB 1I1YB 4NRYA 4AZ8A 2XFXA 2X4UA 5C0RL 1ZLSL 1A6UH 3WDJA 1FNEB 4PGDB 2LU4A 5C0ND 3ULVD 1NSNH 1MFAH 5F8RC 3RWJB 4JHAL 2EKSA 2HFEB 1Z2KA 4MXWL 3RWDA 1NJ9A 4ZDHB 4YJZL 1U8NA 4MQXD 5FEBA 4FQJH 2EEBA 4R7NA 1AC0A 4XNYL 1L0YA 1VCAA 4H0IA 2YD9A 3KPRE 5C0AD 2QSVA 4HX1A 5IB3B 3U46B 3QQ9D 3UJIL 4ZD3H 3VI3F 4QRTB 3UTQB 4KI5C 3X3GH 1HHJB 4WWKA 3WNPA 3GKZA 1FZJA 1F2QA 1I7ZB 2LQRA 4TULH 5FDWB 1OCWL 3MRIB 3CU1A 3PP3H 4Z95H 1TNMA 4WW2A 1DQTA 3S3SA 3VFNB 4XVUC 2C3GA 4KZEL 3BUYA 5CSGA 4X6DF 4B50A 4F37K 2VL5B 5DMIL 5GGTA 3BKMH 5BCAA 3ECBA 5E5RB 4XNMA 2JB6B 2PXYB 5JOPE 3MRMA 4WNQB 1M7DB 3MV7E 5ID0B 4CMMA 4LGRB 3AGVA 1HEZB 4D0CB 1JZ3A 4XP1H 4M8VA 1HH9A 4GXUM 1OOAA 4BZ2H 4OF8A 1X5JA 1EZVY 3TBVA 1A7OH 4YK4B 4J3VA 4NQEE 5EFIA 1AQDA 3SDCC 1INEH 3U7WH 4K23H 4OSUH 2H2SD 5FHAH 5CZVH 3BEWA 3ARSA 1W0VB 5CBAA 4LU5H 5GRUL 3FB8A 2Y6SD 1AGFA 4HWEL 4KKBD 5K9JL 3CLFH 5I1IL 2GHWB 1F3RB 4NGHH 3C8DA 1WTLA 2GCYA 3B9VA 1PZ5A 5HYQA 3V4PH 4FTVD 4LCWE 4BFBD 4Z0XB 2ADJA 4CN4A 3FB6B 3V7AE 4DUWA 5K9KA 5KS9A 2C4XA 1J8KA 4G7VH 1AGBB 4Z5RA 4YGAB 4OLUL 3GSXA 2HTKD 3VXPB 5L0QB 1IGIL 2VZVA 1KLUA 2O5YH 4LLDA 1K6QL 3SKOA 2YN5A 3EDDA 4HSQA 4I5BB 3ZYZA 3MRRA 1NFKA 1OTTD 2P24B 2Y1VA 4ZNEA 4OZHF 4KTDL 1CVSC 5I19H 1NSNL 1OGAE 1SEBB 3H9SD 4CW1A 2ATKB 4DTGH 1I3GH 3UAJD 1Q9LA 2HFFB 2ZUTA 1FVCA 4F15B 1HCVA 2DM3A 4GBXB 3VFSB 4H25B 3DGGA 3WN5B 4L8SA 4X9HA 1QSEA 2HWZH 4OFPA 1UM6L 5DVOA 5IMKB 1NMCC 3EGSB 4U05A 3GIZL 3HPJB 1P5VA 4TULL 4AEFA 4M6ML 3V6ZA 1REIA 4GRWF 4KI5E 4K55A 3WMSA 4Z95L 3JWNC 2LU3A 1C12B 1KJMA 5GGVY 5GIRB 4EI5C 3T0BA 4EN3C 2ITDB 3UTZB 3BKML 3AAZA 4NUJB 4JRYE 5EH1A 2AEPH 3SCMB 1N6UA 4YNYB 2VSDA 3KJ6L 5F1OB 3D25B 3WL9B 4K7PY 5DJ2B 2OR9L 4C4KO 2K3TA 4XP1L 4Z77B 1T04A 2EDJA 1I1AD 3U9PL 3HE7D 1DANU 1TZHB 1NAMB 1I8KA 5DJ0B 3G04B 1AFVH 1RU9H 4U1MB 2X4QB 1G7IB 4BQ6A 2CR3A 1MCOH 2ZUSA 3JWDC 2JIXD 4ENEC 1OWWA 4HIEA 2ENYA 1SYVA 1KB5L 1INEL 3U83A 4KKAC 2P42B 1RZKC 4PJCB 2YMXL 3I02A 4K23L 2YPVL 1YECH 5KOVC 4UNVA 3CFDA 5KANI 1FLRH 3NFPB 3DUHA 4ERSH 3PWLB 4HUVB 2XKNA 4Y1AE 4C54A 2H3NA 1XGUA 3RX5A 1QR1B 4EOWL 5J6GA 4OZIA 2OI9B 1ODAA 3N1PC 2NY3B 1J0YA 4AEEA 5IVXB 3K4AA 3FZUC 4PBWD 1NBZA 2BZDA 3ABZA 1HHIB 1XT5A 4Z7WE 5KSBE 1DDHB 5TE6L 3AFLA 1T1XB 2V7NB 1J05A 5ID1A 5IIEA 4LHUB 2IQ9L 3B4NA 4PG2C 3Q48A 4PV9B 4X7SL 1IC1A 2IADA 4HUUA 5K9QG 1BQLH 3O3DA 1F97A 5I19L 3DURA 2GJ6A 1NCAH 3IKKA 1BD2E 1QHPA 3VWJB 3NGBC 1P69B 2HYMA 4HPYH 1SBBA 2EDEA 4N0YL 3ZYJA 1CICD 4YBQC 3U6RB 2E9JA 3LPWA 5AD0A 3LV3B 4KWUA 1U95B 2DQDL 4F7TA 1OSZA 3RVTD 1FZKA 3JVGA 5EN2B 2ATPA 4H1LA 3S96A 1EX0A 3I2CH 1WITA 3IS1X 3MODH 1KELH 3QCUL 4I2XA 1MFCL 2QADB 5DYOB 9CGTA 4N1EA 4PJ7F 1FGNL 4L4TE 2PN5A 1P9MC 2XY1A 1F6FB 35C8L 3GI8H 3RGVB 1QRNB 5E9DB 1H3WM 1FNSH 3MUJA 1O5DT 1K4DB 1EVUA 1A7QH 1VFAA 2VXSH 4MAYD 4OQTA 5FUCC 2HMID 1U3HA 3FT2A 5BVJB 4KJWD 4JG1L 3D87B 2IAMC 4P5TD 1FP5A 3SGDI 5KVDH 4KVCH 5KZCD 5FHBH 3HS0A 1IGTB 5SWQA 1G6RA 2EIBA 3EDJA 1MH5B 3QUMB 1IEBB 1KJ3H 1DSFH 1NGXA 4OV5B 3VD3A 2BNRD 4TVPL 4JFFD 1TLKA 1KB9J 3BJ91 4NNXB 4DJMA 3S4SA 1A6AA 3S3JA 4PJ9B 5TF0A 2ICWJ 3U4AA 3INUH 2Z31D 1S7RB 1T0PB 3GMQA 2MMXA 4OCLC 3HE6A 3V6FA 1CGUA 5F7UA 4Y4FB 5J12B 3B9KA 3AXLA 5C3LD 4XBGA 3OKEA 3T3PE 5IB1A 1J87A 3F7VA 5TF1H 4XC1H 5JLZA 3OWEA 2NY0D 1PLGH 1D5XA 3IKCA 3NABH 3FFCA 3QPXH 3IFPA 3KAAA 3S3PA 1A7RH 3MV9D 4RNRA 5SWZD 1VDGA 3T2NH 1NBYA 2R39A 2P43B 5SWSD 4PREB 1YNLL 4YDJB 5IHZA 3OGOE 1C5CH 3GHEH 1ZTXH 3IT8D 3UPRA 4LCIL 4FTVA 2I5YL 1JZ5A 3VXSD 1YYLL 3EJYC 5E1AA 4Z7NF 1R5IB 1AGEB 3LQAL 5J11B 5LCVL 5KW9L 3QDJA 3I2CL 4P4KD 4ZS7L 4FA8A 1BFVH 3MODL 4PJDA 3BHBB 1KV3A 1KELL 1RV6X 1HINH 1JTTA 1UB6B 4KRPD 4F8TA 2WMPA 5K9QI 4ZUUA 4ZXBC 2YBRB 5F7DB 3TV3H 4DK3A 1QLRB 2Y7QB 3GSVA 3KWWA 5CIPB 3DSFH 5MEPB 4LQ1A 1T66D 4IMKC 3VRJB 3IJSB 5DJXB 1KTLB 4P3DB 4EXKA 3O2VL 2NLJB 4PR5A 1GZPA 4GRLC 3DYMA 1EO8L 1MF2L 1I1FA 1A7QL 5JO5B 4XMKL 1RK1A 1DBAH 2XICA 5BO1H 2VISB 3HR5A 7FABL 4LDLB 3HUJB 1F4XH 1ZWIB 1G9NH 3QYCA 1IILE 1KACB 3CGTA 3ARBD 5HYJE 2I07B 4CADA 5L9DH 5LGJB 4L4JA 3QUKA 5IW6A 1S7VA 1AGCA 4LSVL 3C8KA 4OZFB 4YAQA 4NUGH 1A1MA 2HJFB 4ZFGH 1KJ3L 1AH1A 4QXGH 1DQQB 4M43L 4APQC 4HWZA 5F6HI 5MEQA 1M05A 3P2TA 4K3EH 4PRHB 5DD5H 3ARGA 3QUZC 1W0WA 4WUKH 1I9RL 3QDGD 2QHLA 5FA4A 2V17L 5AAMA 4QTIL 3MBXH 4MB4A 2I60L 3T1WA 5CSBA 1RIVL 3UDWC 5EZIL 4ZTPH 3ULUL 3HE7A 3G9VA 1DVFC 4R7DA 1WF5A 1Q0YH 2CMRH 2EDTA 2AEQH 2CDFA 1J1PL 4XC1L 3EHBD 4ZUSA 4I4WB 5E2JA 4ZFOL 3ZT5A 1PLGL 4XWGH 3KDMA 4WJ5B 4Y2DA 5E70A 2V7HB 3QIBC 4JO2H 4OZFG 2MQCA 2GTWA 4U1NA 1J5OH 4C59B 1MUJA 2AJSL 1JGVH 1A3LL 4JFEE 1B4JL 3MV8D 3K74B 4YFEA 3MACL 5DJAA 3TPUA 4L9LA 4ODXB 1ZTXL 5F9WB 5DGQA 4JDVB 4X6BA 3AREC 2G9HB 4POUB 2NY1C 4ZYKA 3G6JF 4JZJA 1MLCA 3SKJH 4YXLL 4R2GB 4RAHA 3O9WD 2P7TB 4XP6L 5A16B 1AGDA 1LWRA 3FB7A 2D0GA 5LQBL 1M71B 5TDPB 2HT2D 4OM0H 3TYFA 3T09A 1Y0LB 2APBA 1DQMH 2I27N 2JJTA 3CJJA 4R96A 1U8QB 3LIZL 3PQYD 3E2HB 4MDJB 5T1MB 4N5EC 4WI6A 3DSFL 1FYTD 1HSAA 3MBEB 1FG2A 3P9WB 4PJXF 1C7TA 3CZFA 3D85D 1MCPH 3DSNA 3VFVA 4GKZB 4MA8L 4NKDB 4NM4H 3GJEA 3MLXL 2V5YA 1ZS8A 5GISL 4W68A 3A6OA 1QNZL 4F9PC 3TNNB 2CUIA 1DN0A 3MXVH 2KZ1B 3MLUH 5HHPA 4HIJB 2BSTB 3SEPA 1A6ZB 4XPFL 5E8EB 5IJKC 4YLQT 5GS1B 3PWVB 3GSQB 1DFBL 3OKKB 4PLNC 2GFBA 2FGWL 3BZFA 4LLVA 4C83B 5C0IA 3UYPA 4OGYH 3VXUD 1LE5B 5JDSB 4Y5YB 1GJIA 4K3EL 4ONHA 3PWUB 1KXVC 1XGYH 3IJHB 3U0PB 4F7EB 4Y2OA 1CDGA 3EYVA 5J7CC 2D7NA 4EIZC 1YMMA 2EZ0C 4NOBA 2X1QA 1ZEAH 4U1LB 3VFOA 4MAYA 2C1PA 1HSBA 3B2UC 5CEZE 4NDMA 3NCMA 5IW1B 5E6IC 4P5TA 1Q0YL 2CMRL 3B6SB 3L3HB 2F5BL 3TN0A 3EDFA 5DVKA 3SJVD 5GGTH 1D5ZA 2X70A 4XWGL 3BDBA 1CIDA 1CBVL 3P4OB 4M93B 4JO2L 3S34H 2XQYG 4QHMB 1J5OL 5FB8A 2VLJA 1JGVL 3C60B 5IKCA 2PO6A 1U0QA 4D9QE 2BNRA 2FNBA 1G1YA 2PTUA 4M48H 3ILPB 2KH2B 3RU8H 4NQSA 1FV1A 2VR9A 4GSDL 4WFGE 4XAWH 3FQWB 3PHQB 4JFQA 3UEZA 2WBJA 4CVXA 2R23B 3CUPB 4YC2C 3OV6A 1XGPB 4M61B 1TVBA 5BZWA 3RVUC 5ESQB 5IB5A 1F6AA 3BGMA 2P46B 1NQBA 3TT3L 2BX5A 4X6FB 3PL6A 3ZDZE 4JN1H 5CUSH 3SDCB 4NNYB 3ETBF 4YQXH 5F7WC 2ED7A 2YPLB 5LGKA 1ZSDB 3BP5B 1ZA3B 3CMOL 2VDPL 5D8JH 2WINB 3IDGA 5SWZA 2VLKA 4ODVL 4PV8B 2A1WH 4M7JL 4PJBE 4LARL 3T0AA 3U2SB 4PJ5E 4O2EA 2DWEA 4QRRE 4YXKL 4X5WA 2VDRH 3GMPA 3RWHA 5GGVL 1R6VA 2R1WA 3WE6B 5AWNL 4P9ML 4P4KA 5F6IC 1C08B 1CXFA 1CDCA 3UCRA 2F5AL 3SQOL 3Q6GH 1KPVA 1IAKB 3SPVA 4XXCC 1JIBA 4OIBA 3DBXB 3RL1B 4MYWB 3RAJH 1OAKH 4N90E 4NWUL 4K7PL 3QIWD 1KIRB 5INCB 3S5LA 1CU4H 4OCYH 1R24B 3MJ7A 4P9HL 3BIAX 4K3GA 2VLRD 1WT5A 1Q38A 2VDMH 2XZQH 1VADB 3OX8B 4KTEH 3RL2A 4FN0A 2BC4A 4PJEB 3BP6A 4B41A 2AV1A 4NWTL 1U8MB 3QA3B 3VE0A 1JCKA 2D0FA 2DKSA 2G75B 3MLZH 4OI9A 2D2OA 4E41D 4JJ5B 5KSAD 4B7IA 1BREA 3FHQA 1P1ZB 4FQXC 3HZKA 4EI5B 2DMBA 4RAUA 2G5RA 4L4TB 4DZBA 4Z76B 3N9GH 2FD6L 1T4KA 3EOTH 2YD1A 3GB7A 4LDEB 5I1AA 3BGFC 2VE6A 1A9EA 1ONQB 4PJ8A 3NAAH 2W91A 3RU8L 1QYGH 3IXTA 3TT1H 2IBZY 2NTFA 2NR6C 3TH4T 3T77B 1IEHA 1VKXA 3RUGE 1GYAA 5J89A 5DRZA 4MNQA 1WZ1L 3JV6A 2PUQT 1MCQA 2Z93A 1DQLH 1ZT7B 5F3BB 4FQHB 4EXPX 4Q97A 2J6EA 4JPIB 3VA6A 3CXDL 1S7QB 2CUHA 3TJHD 25C8L 4JFOB 3B9EA 4Y8AA 3N1MC 3SDAD 3VGGA 3E6FA 4GRMA 1AKJA 4J6RL 2OK0L 5CEXB 1CLYL 4LLQA 4MMZC 2AEWA 5D1XA 1CT8A 2PYEE 3KNBB 3CFCH 1YEDB 3K1KC 3MLVH 5FYJD 3CSGA 3L7EA 3SDDA 1YQ2A 4UINH 2FBJL 2XTJD 5DUPH 3WFDL 3MUGB 3MJ9A 4NZTH 3S9DB 1WC7A 1YEIL 1FL6B 4KK8C 4U1IA 4QOKD 4PRNB 3MRHA 1V8HA 2R1YA 4X9IA 4U7KA 3RAJL 3JTTB 1CD8A 1MHHB 3HMXA 3RX8A 2XKUA 3LRSA 1G9MC 1PX3A 1WIOA 5JZ7C 3PP4H 4UT9L 1R3IH 2OL3A 2UYLA 2OZ4H 4MGXA 1CS6A 1FYTA 4RCAA 3V9FA 4LCCA 1XF2A 4H5SB 3NGBB 4JKLA 2R2CA 1E4XH 2YD2A 2EE3A 2PCPB 4NO5A 3UTSA 3T0EA 2VDML 5MENE 1HYSC 3UBXG 1RUPH 1IAMA 4H1LH 2B1AH 4KTEL 4S1SL 1U91B 2HG5A 1PKOA 3OZ9L 1YN7A 4AENB 3D3VA 1QTYT 1KN4H 2QV2A 3TIEA 4K71B 4NRXB 3RWIB 3KPSD 4R3SB 5D71H 4QRPE 1MI5A 1IRAY 3BIKB 4MNGA 5HPMB 1MQKL 1FC2D 4WFEE 3QUYB 3QNZA 1IM3A 4J3WA 4UIKH 1H15B 2V2TA 1ZLUK 2P8LA 1T89A 3KPQB 3VXUA 3GMMA 2DN7A 4QYOA 4OQTH 1VFUA 3N0PB 1CL7L 1RUMH 4Y89A 4BSWB 3HAEG 1BP3B 4O9HH 1P7KB 4N8VB 5I1GH 3O3EA 3TZVC 2L7JA 1KG0B 4YR6A 4D9RE 3IDNB 3NTCH 3DX9A 2DYPA 4PTTB 4MJIA 5MERB 1G6RH 4V2BA 2BRQA 3D69B 5B38B 3QPQC 5GGRY 2MWCA 2P48B 5D6DC 2XN9A 4N68A 4HJGA 4PPTA 2GW5A 4PJIE 1GAFL 3P9LA 3SJVA 5C0CB 2J2ZA 2J88L 5T33H 3C9NA 1FNHA 2FX9H 5HI5C 1KTDB 1XF5A 2NY4B 2J8UB 2WLYA 2JJUA 1J1OL 2Q3ZA 1KGCE 2R0LL 3ISWA 4GG6B 5EPMB 2HVJA 5JMRA 1BJ8A 2C7UB 4YXHH 4JFXB 5E8DH 3BPCA 5HI3D 1EDQA 2Y36L 3MLVL 4XHQA 3BXNB 2N56A 1U58B 4Q9CA 2ZOLB 1EEZB 3GRWA 3O3AA 5DUPL 5HHOA 4IRSA 4I0CC 1IGYB 2IANB 3ZZ1A 2CDGA 4OZGB 5EZLB 3ARFC 2AQ2A 3D39A 1XFPA 4S1RL 3CZJA 3NBNA 4FMFA 5H37H 3L5IA 2ESVB 5IBUG 4RWHA 1UEYA 4PRPA 2HKHL 3RWFA 5CBEB 4JFEB 2FB4H 1P84J 5B3JE 4P4RA 1U3ZA 4MD5A 3QUXD 5CEYA 1U6AL 1LD9B 4M4RA 5CD3B 1JE6A 2VDLH 1UCBH 4PP1D 3FT4B 3OGCA 4U1JB 1A2YB 3QJHA 3C5ZC 1RZ8B 4PP2A 1S7UB 1KN4L 4KRMB 4P2OB 2HRLA 3VXTA 2I9TA 2Z35B 3KVQA 4HH8A 3O8XA 1KB9K 1MWAA 5D70H 2O61A 2NX5A 2AKRA 4Y88A 5D1ZC 5FK9A 3PG2A 1WTGT 5C0DB 3ULVL 5HHMD 1WAAE 4ZUTB 3FQNB 1FN4B 5KBNC 3FOMA 3QZWA 2VLME 2ZUWA 3PGFL 1DBBL 2CIIB 4WUUA 2B4CC 4OUUA 1BFOA 2J5LB 4JAMA 4YPGB 3WHXB 4M6OH 3LSOB 2NMSA 1FCCA 4YO0B 5BS0E 3UBXI 1T22B 4UTBH 4O9HL 1OAZL 2C4FT 5I1GL 4JM2B 5DEGA 4IIQC 3QWOA 3K4DA 3PWNA 4Z7WF 4Z7OE 1H9VA 1G6RL 5KSBF 3DETD 3DXAB 5ITBH 3CMGA 4WO4B 5E6YA 3L3GB 1A4JB 3BUTA 5F9OL 4HS8L 1MHCA 3QFDA 3NZ8A 5I74B 2R29H 5D2NB 1NUNB 3JBG7 1MVFA 1UH4A 5T33L 3O3UN 3K3QA 5FKPB 4LSSL 1HDMB 5IBTL 5ICYA 1R5WB 4HMCA 3L9RA 2Z4QB 4YXHL 3PDGA 5I75B 5CGYC 3SN6N 2AXHA 3LS4L 5E8OA 4WY7L 5IK3A 4DZ8B 3DX7B 1DEDA 1X7QB 2QSTA 4G9DA 4JJHA 2GT9A 1TFHA 4GQPH 4C56D 4ODWA 2OCFD 1I8LC 3WUWB 1FFPA 4A2MA 3ARDC 3LDBB 4NRYB 1YDPA 2XFXB 2X4UB 1S5HA 5DFVC 5SX4H 2AK4D 4I3SH 3VFUA 5TQ2L 1ZVHA 4K9EL 1MLBA 3EFFA 4LSUH 2AAVA 2A83A 2EKSB 3L6FA 3LB6C 3RWDB 4XXDB 4PJHA 2F54D 1WK0A 2ADGA 3QIBB 4R7NB 3QXTA 2ILLA 1CLZL 4QRUA 1CK0L 4GJTB 4HX1B 3GM0A 4IRZL 4Y19D 1IC7H 1ZXQA 2BHUA 3FOLB 4WWKB 5BOZG 1UCBL 1QFOA 1R3HA 2ZUQB 3K8KA 3NZHL 4MWFA 3AREB 4ONFH 4U3XA 5GJSL 3CVIH 5EZOL 5FXCH 4WW2B 5C0GA 1R0AL 1R3JA 3G6AA 1MCBA 2XKSA 5D5MF 3O0RH 1TCRA 1UZ8A 3MA9L 5D70L 2X44D 4KUCF 1B88A 1SBSH 3ECBB 4OF5A 1A7PL 1XIWD 1MSPA 4XNMB 4BFIA 1JI2A 3OKNA 1TJHL 1C5BL 3DV4A 5C0BD 4JPWH 4DOHB 5EIIA 3RKDD 5H35A 3MRMB 1J8HA 2J3SA 4CMMB 2Y9RT 2PKDA 3FKUS 5CLTA 5DRXA 1Q9KA 5ILTH 3MCKA 1HH9B 3NA9L 5E4EC 3TBVB 4EKXA 1IARB 1QEWA 2JELH 4QRRB 5EFIB 1AQDB 2LABA 3MA7A 5MI0C 1T20A 1AHWA 4BH7A 3LZFH 1RPQA 3BEWB 3NIFF 2Z8RA 5FUZH 5CBAB 3FB8B 1AGFB 5CINH 2ED9A 2KDGA 1YQVH 1WZLA 5ADOH 1UADC 4XRCA 4OKDA 3DIFA 4FS0A 4N0FB 4KHTL 2GK2A 5HYQB 1YPZE 4OIIH 1UQSB 4MHHG 1EEQA 2YXFA 2ADJB 1K3IA 2BNQD 2M1KA 5E2WH 1D6EA 4RGND 5K9KB 3RVWD 1MNUH 5KS9B 3BT2L 3OMZA 4Z5RB 5GS3A 5GS0D 3GSXB 4TNVF 4U1HB 3QXAA 1RIUH 5J56B 1KLUB 1X4ZA 4LLDB 4LQFH 3SKOB 4E42B 4Z7QF 1D3CA 5DK3A 1BOGA 4MLSA 5I1KH 4FQPA 3EO1A 3X13A 4AH2B 5EUKA 4JFZH 4CW1B 4LSUL 1OPGH 4W4OA 2O26U 1Q9LB 3EYSH 4XI5C 3G6DL 1FVCB 1ZT1A 4F3FA 3RY4A 3EOAA 5E7FA 1DN2A 3DGGB 4PYGA 4QCIA 4L8SB 2EC9U 1UWEL 5DDHA 1QSEB 1NPUA 4CJ0A 4HCRL 1IC7L 5HYSA 5HDBE 1JWUA 4WFHD 3V6ZB 5IGXL 4ZAKC 4Y4HA 4PY7A 3ALPA 3CVIL 3HI6H 3PXHA 2FWOB 3MXWL 1Q1JH 4OGAD 2A6KA 1RIHL 4YBLB 4LASH 1SBSL 3TJEL 1CD9B 3H9YA 4IBLT 1TTGA 3AAZB 3KJ4B 1NDMA 3C6LD 3PUCA 4JPWL 3AU1A 4C55A 1AI1H 1J0ZA 4OI7A 2FIRT 2I24N 2NZ9C 2XYCA 5ILTL 4F9LA 1T04B 4G80A 4MAUH 3CNKA 3RTQD 1KNOA 4CKVX 1RY7B 1MRFL 4HUWA 4OCXL 1UYWH 1I8KB 4S11A 3QUXA 4IRJD 2FLBT 3ARRA 3ARQA 4PY8J 5GHWH 3VFRA 4DW2H 3HNSH 4HIEB 5IFHH 2AXJA 1SYVB 5I1HL 3I02B 4TSBH 4KKLC 3BH9A 1TETL 3CFDB 3ARPA 2MCPL 5JXEC 4X98A 3LKOA 3KYNA 2XKNB 4FZ8H 1GCFA 4UQ3A 2H3NB 3DOSA 2GUOB 4NZRL 2D03H 2HRPL 3UROR 3QHFL 4HJ0C 5J6GB 4OZIB 1GPOH 3OB0K 3GBNH 1ZKAA 4FQLH 3QXWA 4NKMA 4MA7L 5TE7H 4IOIA 3SBWC 5E2UH 1A4KA 3QG6B 3VXOA 4ZMAT 1NBZB 4NQCE 4OF7A 1SQ2N 4R6UA 3QHZH 3BRFA 2H26A 5F9JA 5KSVA 5HYIA 3LQAC 4PD4J 1JGDA 1ZLVK 1IKFL 5ID1B 1J05B 5IIEB 4LQFL 3T2QA 1FFRA 4CDGC 5FF6A 2F74A 1T5XA 5FAAA 3O3DB 4KK9D 3N06B 3DURB 2GJ6B 4DUVA 4RSVA 3EYSL 4R8WL 5D96B 4FQ1L 5T3ZD 3NN8A 4MHHI 1IBGH 1LP9E 5AD0B 3RZCA 4Z18A 4P49A 4Q74A 2Z91A 3FRUA 4F58H 3WUZA 3KHOA 1LDPH 3OJMB 2W0KA 1JNNL 1OSZB 4QXTB 3HG1A 3SE4C 2ATPB 4H1LB 3S96B 2EXWD 4HS6A 2X6MA 2NW3A 5KVGL 4J3TA 2DQIL 4XHJD 1B2WL 2J6EH 1KIQA 2BVYA 4OLYL 5FGCE 5F71A 4NYLA 4LSRL 1QSFE 4I2XB 3ROLA 4DFIA 3VGAB 4HGKC 5D2LE 3KPTA 4JO1H 1CZ8H 4LASL 3U4EA 2HFGH 4JN2A 4OD1L 1CDIA 2AK4A 4UV7H 2FATL 1INDH 4CUCA 2A74A 1TQCB 1F11A 1OAXH 4U49A 3O6KH 5JUEL 1VFAB 5D7LE 3IDYB 5L2JA 1J0JA 1U3HB 3FT2B 1IEAB 1PQZA 1BIHA 1KFAH 1WFOA 1BPVA 4PRID 5KAQG 4WW1A 1CI5A 4Y19A 1CWVA 2MQ3A 3T1FA 5IBLD 3HS0B 4H1LG 5D1QD 3ULUC 1F5WA 2OR7A 4RMSA 5SWQB 1G6RB 3BESR 4DCQA 4J8RA 4RFOH 3HMXH 4TPRL 1EEUA 3DHMA 3OG4B 3C6SA 5FGBC 2XY2A 2OL3H 4J3XA 2FO4A 3T0DA 2HP4A 2FECL 2D03L 4RX4D 3ZHKA 1CE1H 5FYLD 1GPOL 3S4SB 1A6AB 4L3CB 2AJ3A 4YUEL 1RZIA 3UTTD 4NIKB 5AYUH 5JOFA 1TCMA 5CWSA 2IJ0C 1UXWA 3HI1A 2R69H 3GMQB 3QHZL 3OKMA 4HUNB 3HE6B 5C07A 3GSNA 3V6FB 1B4RA 1FFQA 3BAEH 1EHAA 4FZEL 4ZO7A 5JR1H 3B9KB 3AXLB 3QSKB 4XBGB 3OKEB 3C08L 5BRZD 5IB1B 3W0WD 3F7VB 2ZCHL 4JREB 5KSUA 1JNLH 5JLZB 2H9GA 3LD8B 4R26L 4XVJL 3IKCB 1D5XB 3GJFK 3WLWC 2CKBL 3FFCB 3IFPB 1N64H 5ESAA 1EXUA 2NNAA 3ZDZF 5E94A 2R2HA 4RNRB 1HNGA 1NBYB 4TN9A 4I18A 4P2QD 2P5ED 5IHZB 2RGSA 4LVHB 3BPOC 1IBGL 1NLBH 4RISL 3EO0B 4RDQG 4FQQA 3UPRB 1PGRB 1OTSC 5E1AB 1V3KA 2CLZA 2W65A 1LDPL 1TITA 3QQ4A 4K3DH 4NCC2 1GOHA 1AR2A 2FL5B 1CL7I 3QDJB 5B8CA 2BK8A 5HDOA 2VLLB 2F8VA 4PJDB 1I9JH 3P0YH 3B5TA 1UJ3C 3ESVF 3FJTA 4NNPH 4X99A 1JYWA 4ZUUB 2VDOL 3P4LA 4I1NB 4PJFA 1A6PA 1H0DA 3TBYA 5IHLB 2X09A 4KXZI 1RK0A 5GXBB 4Q7DA 4NRZA 1IC4L 3U4BL 3TEUA 3HC4H 2VB5A 3IAGC 1ZHNA 4PR5B 1GZPB 2HJKA 3WFCH 1CXEA 5IFJA 2LVEA 1I1FB 3K46A 4J3SA 4AL8H 1RK1B 5DHYB 5CJ8A 3HR5B 4Q9QH 5DO2C 5H37G 1OARH 3IDIA 3M07A 4Z7VA 1KUMA 2WM0A 1UKTA 3PWPE 3PABA 4UDUB 4CADB 4ACPA 3GRWH 5CJBA 3QUKB 4MDIA 3MJ9L 1S7XA 5IW6B 3CVHA 3ULUE 1S7VB 5IUSA 1AGCB 4M4PA 4XX1E 3C8KB 1NCCL 4YAQB 3B5GA 1YEKL 1A1MB 3QH3A 4RFOL 1TPXC 1MCKA 3W9EA 2H6PA 4GLRH 4HWZB 3ARFB 5MEQB 4JO3H 4JY4B 2PXYD 1Q9OA 1NEUA 3VG0L 4BSVB 4U0RB 5HTSA 3ARGB 1W0WB 4FXKA 1MFBH 4YHMH 5FA4B 1MEXH 3WO4C 5C7XH 2EH7H 4JPKL 4KY1L 4YBHA 3ZE0E 4MD4A 3O11A 3RTQA 1OW0A 1IAOA 5DHXB 3WXWH 5GRVK 3HE7B 1EMTL 3BAEL 1HKFA 1RMFL 3OR7A 1UH2A 4R7DB 3QRGH 3F58L 3T0XA 1J7VR 1MWAH 5HDQL 5FGRA 4XVTL 1VENA 2QKIB 1JNLL 4ZUSB 3S35X 3RPIA 1X5YA 3X12A 3C5ZB 3ALXA 4U2YA 3KDMB 1B90A 2FBOJ 4Y2DB 2A9ML 2NY6B 1N64L 2GTWB 4U1NB 3J8F7 3L95A 1RUAL 4H88H 4HXBH 4MA1B 1IZJA 5DJAB 3TPUB 4L9LB 5EUOA 1HXYA 4MXQD 4X6BB 3F7YA 5BVPH 5F93C 3WS6C 4ZYKB 1MLCB 1QO3A 2R4SL 2P5WA 1YNKL 5DI8A 4HEPG 1AGDB 3FB7B 5DF0A 5I6XC 5ENWA 3QO0A 3O2DA 3TYFB 3MLSL 1I9JL 2CUMA 4LPUA 1QFWM 4NNPL 5ERWA 1T2XA 1P84K 3BIBX 4NM8H 3WIIL 5JQ6H 4M1CC 1S7TA 3CFIC 3HC4L 3BD4A 3FL7A 5D7JA 3D9AH 1FG2B 2L0DA 3CZFB 3VFVB 4U4BA 4ELMA 3GJEB 4PTUA 4DWHA 1FDLH 1ZS8B 3KYKH 4P9HC 2WUBH 4Q9QL 3GSRA 4DEPC 1DN0B 3TCLA 1HXMA 3UXFA 1NFDE 2O5XH 5HHPB 2CLVA 3IDXH 3FO9A 2YKLL 3QHTC 3GRWL 1Z9SA 2L4OA 1KCKA 5DJDA 1YEJL 4OCWH 1G9EA 3BQUC 5J6HA 3WNKA 3IF1A 1ACZA 4JDTH 3BZFB 1CFTA 5C0IB 1I8IA 3KYOA 4XNUL 4DK6A 1G7JA 4FABH 4LBEA 2VDQH 4ONHB 3SCMD 1VFMA 1UWGL 4D9LL 2EIZA 3BSZH 5EBWA 2Y4SA 4HDIA 2V5SA 3L1OL 2HTLD 1YMMB 4YHML 4LPWA 1B6UA 2J4WH 5IESH 1EVTC 5BXFA 3VFOB 4MAYB 4G43B 2C1PB 3K0WA 5I8CA 1HSBB 4EI6A 3WXWL 4NDMB 3FB5A 2AW2A 5FYJH 2E7LA 1SJEA 1MELA 1JGUH 1JPTH 4TRPH 5JHLH 3TFKD 2Z92A 4J23A 5IVXF 2BRRH 3QRGL 4R0LA 4GT7A 3TN0B 2W59A 5JW4M 2VUOA 3MJ8A 3QEQE 1EH9A 3PV7A 4LSTL 4PGEA 1D5ZB 2X70B 1T6WA 1QBLL 3VXRA 1A3RH 2J1KA 5FB8B 1QOKA 2VLJB 3P73A 1G1CA 1OVZA 4XPHH 3RIAF 4X6EA 5IKCB 3WFBH 1UZ6E 1KCRL 2PO6B 5IB2A 4HXBL 3L7FA 5E99H 2BNRB 5F7FA 3ZYIA 3TO4C 1R3KA 4NQSB 2NY3D 2DQJL 3MOQA 3CSYB 2BOBA 4JFQB 4U1KA 4QNPE 2WBJB 1D9KC 5E4EB 5JXAL 2MNUA 3S98A 4N0UE 1ZANL 5C9KA 1TVBB 2D4FA 3F7PC 5LWYH 1ZA6A 4L1DA 4LHUD 1TIUA 1F6AB 3BGMB 3R06A 5D93C 1UWXH 5EZJA 5JIHA 1HI6A 5CZXC 4NM8L 1NBVH 3PL6B 3CK0H 3K7UA 5JQ6L 4MVBC 4H0HB 1DANT 1IFHH 3KS0J 5DMGC 5MI0B 4ZSOE 5I71B 4MCYA 3FQUA 3VWJD 5FM5O 2ADFL 3IDGB 1N6VA 5ECJE 3O4LA 4MJ6A 5L6YL 1JWMA 5SWZB 1FDLL 4XWOD 3KYKL 2VLKB 5CP3A 4AG4H 4P2QA 2GIYA 2Y25A 3WHE1 3PV6A 1CCZA 2ZOKA 4S1QL 1F3DJ 2O5XL 3IDXL 4X5WB 1BZ9A 3NH7H 1A1NA 3GMPB 3QFJA 3RWHB 3EJZC 2R1WB 4YDVB 4EDXB 3IB4A 4K8RD 5FO8A 1N6QL 2IALA 4U1GB 4OCWL 4TUKH 1KPVB 2QADD 3SPVB 2GAZA 32C2A 3HPLB 4JDTL 4GQ9H 4AQ1B 2VXTL 1FFNA 3E1F1 1FNEA 4HMDA 3NIDF 3RGVD 4FABL 1QRND 5E9DD 3S5LB 3DARA 3MJ7B 3BYYA 4PRBB 3UTPE 4JPVH 4KDTA 4MB3A 1AY1H 2YSSA 1NAKL 2PYFA 4XMPH 3RL2B 2BC4B 3MRPB 4BSJA 2NY7L 1QVOA 1NCWH 2AV1B 1JNJA 4G6FD 5FYJL 1FSKB 1KT2B 3VE0B 4TRPL 1FC1A 3VG9B 4M1GH 2HFTA 5C09E 4Z7OF 4KJYA 4DN3H 3BX7C 4Y4KA 4S0TD 3HZKB 1FLTX 2WWMC 5DD3L 5L2KE 1T4KB 5EWIL 3ZDYE 3GB7B 5I1AB 2AABH 2D7PA 1U36A 2VE6B 4Y16A 3VFWB 1A9EB 1D5BA 4PJ8B 4MS8D 4PB0H 2QHRH 3S5LG 1M7DA 4PJ9D 3IXTB 2NTFB 3H42H 5ID0A 2X40A 4BFEA 1HEZA 5AG9A 1F42A 1XF3A 4WENB 5DRZB 1BEYH 1T03L 4MNQB 1FO0H 4C57C 4P2RA 3QULA 4XCFH 3JV6B 4Y4FD 2IGFL 2Z93B 2WUCL 4P23C 1G0DA 5F97E 2BSSA 3OKOB 4Z7UE 4JKPH 1RULH 3O6FC 5ADPH 3CK0L 3FQRA 2DI9A 3P0VH 4G9FB 3QDME 4X5XA 3RY6A 4TNVK 3E6FB 4GRMB 1AKJB 5CJOH 1T2JA 4WI9A 3SDXE 3MV01 5D1XB 1CT8B 1OB1A 2EIEA 5H8DA 3KXFE 1U8PA 1TTFA 3EO9H 3L7EB 3SDDB 1KYOJ 3NH7L 5IR1B 4PS4H 4O4YL 2MOVA 2M26A 2R0WH 2UWEE 5KVEH 5GRVL 4TUKL 4IOSD 4B0MM 4KMQA 3Q6FA 4U1IB 3IDJA 2GYSA 2R1YB 3MRHB 4D0BB 2P24A 3S35H 1NGPH 5T3XD 3H3PL 3ULVC 3LRSB 4KK5D 2OL3B 2Q20A 2UYLB 3AM8C 1XF2B 4LCCB 4I0PD 2EC8A 4NO5B 3LEVL 3T0EB 4JPVL 1NUGA 4MQXC 3UTSB 5LXGL 3RI5F 4DKFH 2ZG2A 4XMPL 2K9UA 2ICWI 2P44B 2VXQH 3D3VB 4V1DD 5CJQL 1DQJA 5DT1H 1QFWH 2UV3A 2DIAA 4EZMA 3TIEB 1CD0A 3SDYH 3O41B 4NQDE 1MI5B 2A0LD 5D72H 4JGJA 3QNZB 1UM5H 5CGTA 4D2NA 4EBQH 4XH2A 1NGQL 2V2TB 1JUFB 5BW7A 1MJ7H 4HT1L 2AABL 2P8LB 1M7IA 2JF1A 2OP4H 4PD4K 4RBPK 3GMMB 1EV2E 4HF5H 4P99A 4QYOB 2G60H 5DR5H 3CXHJ 4PRHD 3IU4H 2JCCE 1TTUA 2O93L 2F53E 1VFOA 1B0RA 4KJPD 3H42L 4FFYL 3A67H 4YX2H 3WFEL 4HEME 2IG2L 3O3EB 2Y23A 2NY5H 5ETUB 4YR6B 3TWCH 2UVFA 2DYPB 2ICCA 3G6JA 4MJIB 1NAMA 5F1IA 4EQ2A 2QL1A 3EYQC 2JK5A 4KHXH 2WQRA 3B3IA 2XN9B 4UBDD 3MNWA 4HJGB 3ARYA 1A14H 1MFNA 4JFDE 1U8KA 3P0VL 3P9LB 5IHUH 1UA6L 2H2SC 4ZOCA 4K3JL 4K9EC 3C9NB 4Y5VA 2HT3D 4UILL 2Y6SC 4KKBC 5F9DC 1YY9D 1XF5B 2X4OA 1XAUA 1JK8A 4NHUB 3L5XL 5C08E 3OB8A 2FRGP 4HUXB 3BPCB 2MHAA 4I3RL 2FECI 4MSWA 4O58H 3GSNH 1QSZA 2DQTH 4R2GD 4LSQH 1KXTB 1Q8MA 4XP9L 4LP5A 2HTKC 2WIIA 5CJXC 5HHOB 2R0WL 1DR9A 4IRSB 2W07A 5BMFH 1DDHA 2CDGB 1MRDH 3F5WB 2V7NA 4JZOA 4LHUA 1L0XA 1GGIL 1OTTC 3D39B 2EDNA 4HWBL 4JQVC 4DQOH 4XCYA 2ZNWA 4TSCL 2OX5A 3ZKXC 3MBED 3DMMA 4PRPB 3BRDA 4YHKL 3RWFB 3UAJC 3ULVE 4NHCH 3VWJA 4OLXH 4XNXH 1LEGB 5AZEL 3U30C 2RCSL 2LE9A 2E8YA 4KVNH 4LCWD 4P4RB 2R0KH 2VQUA 4MD5B 1UKSA 1MJ8H 1RHHA 4J3OC 3QI9A 1ACYL 3OGCB 4RFNC 4MZ2A 4LRNL 3LV3A 3QJHB 4PP2B 5C0AE 3N50A 3HTLX 5MP6L 3BO8A 3VXTB 3O8XB 1MWAB 4XPBH 1CGVA 2O61B 2NX5B 2XOTA 2AKRB 5FK9B 4L5FH 5IEHA 2NW2B 3L5HA 1DBKH 4K3HA 5F1KC 2WW8A 3FOMB 3QZWB 3BDYL 1RJCA 1RZ7H 2OP4L 4WUUB 5CP7B 3ZO0A 4HF5L 4OUUB 1BFOB 4JAMB 4DGIH 5DR5L 3TBTA 1CG9A 1L7TL 4LFHD 3Q3GB 3A67L 3SGJA 4YX2L 5DEGB 3VFGL 1QLEL 1GGUA 1I1AC 1KPUA 2XA8L 3PWNB 5TQ0L 4GMSH 4R90H 2DLHA 3CVHH 2JJSC 43CAA 1A1OA 3ALWA 3B9DA 5T1KA 4KI5D 1MHCB 3QFDB 3NZ8B 1KCUH 1VEPA 1IGTA 3P4NB 1A14L 4X6DE 1X5AA 3IFNH 2X4NA 3Q5TA 4E9LA 3OSKA 1JN6A 1GXEA 1EJ6A 4XVUD 3V0AC 3GFUA 4XTRC 3C60D 4JRYD 1U92A 2BVOA 4OV5A 3L9RB 5DQDL 1NKOA 2VZUA 3NCJH 3VD9A 4XPTH 5E8OB 1LP9F 5IK3B 4G9DB 3ES6A 3OAUL 2OSLA 2DQTL 5GRJH 1AJ7H 4NC0B 4EUPB 1FFPB 3V8CA 1WISA 1S7RA 1OP5H 1E28A 1YDPB 5DZLA 3VFUB 4HBCH 3PIQA 1FL5A 1MLBB 3EFFB 1EFXA 4J3UA 5F96L 2A83B 3L6FB 3SDCD 4IEFB 3WKMH 2X4SB 4PJHB 2B0SL 4Z8FH 1BVZA 5IV2A 3RBGA 4XBEH 3IGAA 3QCTH 4V2CB 3QEGH 2EDRA 2ADGB 3H9SE 2OR8A 4L8DA 4P46A 4TQEL 3SE8H 1MHEA 1CICC 2R0KL 2X4PA 4QWWC 1MCNA 1TNNA 4GKNA 3UYOD 1NCDL 5GS0L 1R3HB 3O2DH 4MWFB 5AUMA 3RVTC 3CFBA 1H3GA 3KPLA 1IT9H 5C0GB 4GRWH 3G6AB 4LPCA 3TH2T 3SGKC 3GBMH 5AAWA 1ND0B 4H8WC 1BGXH 2XTJB 1TCRB 5D7KD 1UZ8B 5T1LD 3ESUF 2B1HL 2B5IB 1RZJL 4OZHE 3O6LH 1SY6A 4BFIB 5EIIB 3OKNB 5H35B 3DV4B 1S3KH 3O45A 3E3QC 4HXAL 5F7DA 5JPMA 1J8HB 1P53A 4M8QA 4PJGA 1RZ7L 2IPTH 2XA3A 5CIPA 4GAJL 5DRXB 1Q9KB 3MCKB 5I1EH 5ALBL 3HNTH 1ZE3C 5DJXA 4I0PA 5F1NA 1W72A 4FXGA 2ARJQ 2D3VA 1RURH 5JO5A 1QEWB 2HMIC 1MY7A 2EDKA 4G6JH 4UUJB 1ES0A 5GZND 3HUJA 1ZLUH 2Y06H 2CDEB 2FH8A 4M9OA 2FCBA 4R90L 4AEHL 4LPYA 2AK1L 3AUVA 4V1DA 1HWHB 3MA7B 1U3YA 1T20B 5GSVA 1AHWB 5E0QA 4BH7B 5HVHB 4PLJC 2LTQB 1SVCP 1MHPH 1CXLA 4XRCB 3DIFB 4MD0A 4EI5D 1KBGH 1U8OB 4UB0L 5A2FA 1AXTL 4L4TD 4ODHL 2BY1A 4JR9L 5IFAH 2JE8A 5GPRA 2KPNA 5H94A 1D6EB 1HKLH 1VGEL 2ICEA 5KVFL 2CD0A 2BFVH 2FEDC 4XPTL 3WFHA 5L88H 5CS7A 2FH6A 4K94L 3JWOC 4U6VH 2Z31C 5GRJL 4N0CD 1AJ7L 2YPKA 1IGML 3KPRA 3DI2B 2Q6WB 1BOGB 4BUGA 1JGLL 2XIDA 3EO1B 3X13B 5EUKB 1JMXA 5F7YC 1T80A 2AGJH 1N7MH 2F58L 2XWTA 5F3HA 1YEEH 4B5EA 2NY0C 1ZT1B 4I4WA 4KKAD 4TNWF 4WJ5A 4F3FB 3EOAB 3MRGA 3KPPA 4HK0A 5DDHB 3SE8L 3LKSA 3MV7A 5I16A 1SEQL 5HYSB 3TO4B 3VJ6A 3O2DL 1S5IH 2EXYD 2W1NA 1IT9L 4Y4HB 4PY7B 3VGFA 5EU6E 3FZUD 4HUKB 2A6KB 4NQEA 2DQUH 3ULUF 3SO5A 3O6LL 4M00A 1FCGA 1I75A 1NDMB 4FHBD 3AU1B 4YDKH 5D93B 5TPWH 3U48A 4MDJA 1G7HA 3WJJA 4FRWA 3E3QE 5CP3H 1CGYA 1T66C 5DJYA 3WDIA 5T3ZL 3RKPA 4HIHA 1ZAGA 2BSED 4G80B 12E8H 1KNOB 2DD8H 3C5JB 2AV7B 2MKLC 1JZ8A 4RGOH 3V6BR 4LCWA 2C1OA 3MCLH 4KQ4H 4UAOC 3OTTA 3KXFB 5K93A 1RUKL 5FYJU 2YC1A 1FO0B 4HWUA 2Y06L 1TQBB 4NOFA 3ARBC 2GEEA 3D48R 5EG6C 1I85C 2UWEB 5DLML 3BH9B 1A6ZA 1IGFH 5E8EA 1KC5L 1I7UA 2E5EA 4X98B 3LKOB 3TP4A 4PJ7E 1ORSA 2Q87A 3KYNB 3QUYD 2ZPKH 2ZKHH 4YE4H 4QGTA 2P45B 1LK2B 1TJIH 1LO0H 3K80A 5IFAL 2YXMA 1OGAA 1WUNT 1QBMH 2FHCA 1MIEH 2GSIB 2CRZA 4NKMB 3LKPA 2BXZA 2BFVL 1A4KB 4JFFE 4M6NL 4I77H 2H26B 5KSVB 4OFYA 3T4AB 1F02I 4GG6F 1JGDB 4JKMA 1X4YA 5FF6B 1D5IL 3RIAK 1UVQB 1T5XB 1SJHA 4FQ2L 3MV11 2KZWA 2AGJL 5I8KH 4P59H 2M2DA 5I9QC 4LVNB 2PETA 1BECA 3LS5H 5C0CD 4F57H 1A0QL 3DUSA 2HN7A 3VWKC 4U0QB 1AC6A 4W6YB 2KUTA 4JE4B 3VA2C 3JTSA 3O3BA 4BZYA 5FYLL 3RZCB 2BJML 4JRYA 3RVXD 4CU7A 3WIHA 2Z91B 2HH0H 2XNAA 3FRUB 3MV9E 4FFZL 5KG9A 1JPGA 2CRIA 3HG1B 5SWSE 3RRQA 5FA3A 1BHGA 4HS6B 3QIUC 3RA7H 3EYUH 4BK4A 2EE2A 2NW3B 1S5IL 15C8H 3VXSE 1L4IA 1NFDF 1S9VA 1IQWH 3O9WC 1KIQB 5LGHH 3CUPA 4NO3A 2HT2C 2IAND 1EEYA 2YA0A 1T1WA 4WTWA 4JN2B 2AK4B 4P23B 1JRHH 2EEAA 3S88L 2A74B 3ZTJG 5JORA 3SDCA 2AVGA 1FIEA 3EFDL 1NC4D 4JFED 1S9WA 5C08B 5E08H 4Y1AA 4GAYB 1PQZB 1E6JL 1KJ2L 3FN9A 1M6OA 4KQ4L 4Z7NE 2HVKA 3VD7A 3AS1A 4JEGB 4JO4H 4Y19B 2ZCLH 4XCCH 3T1FB 3MUZ1 3OXSA 1N0XH 3V4UL 3VXNB 3CLEH 4P2OD 2CGRH 4Z7WA 4DCQB 5KSBA 1FAKT 2YRPA 3IFLL 4J8RB 1IGFL 3WE6A 3IDUA 1G7QA 3C6SB 5T1LA 3IU3B 2QTEA 3L3OA 2FO4B 3B2VL 4PLOB 2ZKHL 4U1SA 5A2KH 3BKJH 4M7LT 1IAKA 4YHLL 1QBML 1MIEL 1FNLA 4ZS6C 2AJ3B 1RZIB 1BD2A 2DLEA 4LCUA 3M1BA 3N1QC 1NL0H 1DQDH 5JOFB 5CWSB 4KAQH 1XH3A 3QT2A 3H7LA 3W39A 3HI1B 2QQLL 3B43A 4POZC 4LPVA 3OKMB 4GRLD 5SX5K 4AQOA 3HFML 4PRDA 4NQUA 5C07B 3GSNB 3QDGE 1MRCH 2ZSWA 4JM2D 5FYKH 1VADA 4G8IA 3H0TA 2YD5A 1XZ0A 2A38A 4R97B 4AEIL 4X4ME 1A47A 5B39A 5KSUB 4GAGH 1VEMA 3DXAD 3TGXA 1WBZA 4HC1A 2H9GB 4N8CH 5HPOA 5HYEA 1OTUD 3AS3A 4HWNA 4JY5H 3LS5L 5ESAB 4XVSH 1EXUB 2NNAB 1BBDH 5E94B 2FJFA 2R2HB 5DD0H 3SGEI 4H20L 4I18B 5EBLA 3RZWA 1KYOK 4IOFD 4NQVA 4EI5A 3I9GL 4L4TA 1RUQH 3AY4C 4FQQB 4EN3A 4DGYH 2W9EH 2CLZB 3GK8H 1JF1A 2W65B 3O6MH 3ZHDA 3MV8E 3QQ4B 1FZOA 1S9KC 3VCLB 5IB4B 4HFUL 2DM7A 3RA7L 5EO0A 1KN2H 5DQJA 2ZJSH 4U3HA 15C8L 3VDBA 2Y07L 1HNFA 5LG1A 4RMWA 5AZ2L 4NQTA 4WEBL 2NXZC 1KCVH 4IHOA 4X99B 1FE8H 4NJ9L 4PJFB 3TBYB 1H0DB 3M8OH 5JHDE 1RK0B 2W60A 1DVFD 4NRZB 3H7BA 1LEKA 4JPIA 1JRHL 4HJJH 4RQQA 1ZHNB 1DEEA 1XR9A 2DLTA 3PQYE 2HJKB 5IFJB 4JFOA 3LRHA 3QIBD 2ARJA 5E08L 2B20A 4Z7VB 5HI4D 3Q5OA 3UPAA 1JPST 1RSFA 3N1GC 3WV0A 1NLDH 1VPOH 1X5GA 4D8PA 3PABB 4WWKD 4XZUA 2NYYD 2ZCLL 3WDHA 4MDIB 3PDOA 2B2XL 3ARED 4X9BA 3GI9H 3CVHB 4WV1C 3CXHK 2IFFL 3MRQA 4BJLA 1N5YL 2VDNH 2BVPA 3QH3B 4OLVH 4X80L 1CLCA 3RI5K 3P9MA 2H6PB 3W9EB 5HGBA 4ONGH 1Q94A 4PG2A 5A3ID 1QA9A 1Q9OB 1GRWA 3P3YA 3BE1L 4PJXE 5FUOH 3ZDYF 4CDHA 4FXKB 3QIWC 1UACH 2R56L 3KLSA 3VXUE 3UO1H 1NL0L 1U2CA 4MD4B 2WAHA 4FG6D 3O11B 1PSKL 1IAOB 4R4NC 3WD5H 3V5HA 1RZFH 5KS9F 1N4XH 2YUVA 3OR7B 4QRRD 1U91A 5EOQL 4GAGL 4G7YH 4K8RH 3RPIB 1P4IL 5KSAC 4NRXA 4Z7UF 2DI7A 4LEXL 4U31A 2XTLA 2YWYA 5HPMA 3L95B 3SJVE 2OXHA 3VMPA 1V7NL 1JF6A 3UJJH 1HXYB 1T3FA 2W9EL 3F7YB 3SDXF 1P9MA 3O6ML 2P5WB 2R9HD 3C2AH 5DI8B 4BSWA 3F7RA 3WSQL 5I30H 2V9QA 5ENWB 1NAML 3PP3K 1YJDH 3QO0B 4DKEL 4N8VA 1R3LA 1N0LA 4XMLH 5ERWB 4GRWB 1GGCH 3LEXA 4PTTA 1FE8L 3B2UD 5HYJA 4UDTA 2V2WA 3M8OL 1FRGH 2VZOA 3DX8B 2IAMA 4TTGA 1S7TB 5C6PB 3TIDA 5DUML 1QQDA 4KQ3L 1C1EH 1B0WA 5D7JB 3TJHC 3TNMA 3AC0A 4U3CA 4X6CE 1LGVA 5DSCA 4ELMB 1HZHL 4PTUB 3SDAC 4W81A 5BQ7B 2QQKH 4N9OB 2ERJB 1XCTA 3HZVA 4RRPA 5EC1A 2P8MA 3TCLB 1HXMB 1ORQA 2XPGA 2CLVB 4QF1A 3FO9B 3ZHLA 2HT4C 3V5DA 4ZPTB 5LJYH 1OGTA 2YK1L 2VRAA 2DQGL 2BY3A 5DJDB 2GKIA 5J6HB 1EPFA 4OLVL 1WEJH 3V95A 3IF1B 3MC0A 4DN4H 1CFTB 1I8IB 3KYOB 2DRUA 4LBEB 2WLZA 4HLZH 3DVIA 4JDZA 5BV7C 4JFPB 3IJYB 1GC1L 2EIZB 4LNVA 2QR0A 5EBWB 4HDIB 1H3PL 1T83C 1NC2A 4OJFL 3NPSB 4M5ZL 2DMKA 3T0WA 1NC4A 2VMFA 2JCCF 5CBEA 4JFEA 5I8CB 4OZIF