4YJKA

Crystal structure of c212s mutant of shewanella oneidensis mr-1 uridine phosphorylase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
251
structure length
245
Chain Sequence
ADVFHLGLTKAMLDGATLAIVPGDPERVKRIAELMDNATFLASHREYTSYLAYADGKPVVICSTGIGGPSTSIAVEELAQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHIGVTASSDTFYPGQERYDTVTGRVTRRFAGSMKEWQDMGVLNYEMESATLFTMCATQGWRAASVAGVIVNRTQQEIPDEAVSAVSIVVAAAKKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Uridine phosphorylase
publication title Concerted action of two subunits of the functional dimer of Shewanella oneidensis MR-1 uridine phosphorylase derived from a comparison of the C212S mutant and the wild-type enzyme.
pubmed doi rcsb
source organism Shewanella oneidensis (strain mr-1)
molecule tags Transferase
total genus 83
structure length 245
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yjkA00
1K27A 1ODKA 1RYZA 4DA6A 2A0XA 3IEXA 1RFGE 1PKEA 1RCTE 4KN5A 1OTYA 4TS9A 3NBQA 3FNQA 4M3NA 2QSUA 4LNAA 1PR1A 1PR6A 1PK9A 1TCVA 4TXJA 3UAZA 4DARA 3PHBE 4MCHA 3NM6B 4F3CA 4WKBA 1FXUA 4DA7A 3OOHA 4R2XA 1Z34A 1Z33A 1VFNA 1TCUA 2H8GA 5IFKA 3FB1A 1YR3A 1Z37A 3K8QA 4TS3A 1A9TA 2ON6A 4TTAA 4OGKA 3FOWA 3OOEA 5KB3A 1Y1SA 3MMSA 5CCDA 1VHWA 3PNSA 1K9SA 4JOSA 1C3XA 4LNHA 4P54A 1SQ6A 3EEIA 3O4VA 5CXQA 3FAZA 1QE5A 1LVUA 4WKPA 3PHCA 4QAQA 1PK7A 3UT6A 1G2OA 3OZDA 2HSWA 4R2WA 3P0FA 2QTGA 3BL6A 1ULAA 1YQQA 4L5YA 4GLJA 4G41A 4MCIA 1Z36A 4WKCA 4PNPA 1M73E 3DPSA 4BMXA 3ENZA 1Q1GA 1RSZA 1JDUA 3E0QA 1TGVA 1Y1TA 2P4SA 1RT9A 1T8SA 1PR0A 4D98A 2A8YA 3KHSA 4L0MA 3GB9A 4F3KA 5F77A 1Z5OA 2IQ5A 4RJ2A 1U1CA 3DDOA 1Z38A 1NW4A 1OVGA 1T8YA 3P0EA 1PR4A 1U1GA 5EUBA 1V48A 3KVYA 5F73A 4L6IA 4ECEA 3UAVA 2QDKA 3EMVA 4WKOA 1Z39A 1RXUA 5F76A 3BSFA 4NY1A 4E1VA 2RJ3A 1WTAA 3INYA 3IOMA 3OZBA 5EFOA 4YMLA 4BN0A 2PGAA 1U1FA 4OY3A 2B94A 3E9ZA 3BGSA 5I3CA 1JDTA 4QASA 5F78A 5CYFA 1T8RA 3E9RA 4YO8A 3UAWA 4LDNA 1JP7A 3DJFA 3MB8A 3UAXA 1ECPA 3NM5A 2OC4A 3O6VA 4TTIA 1Y6RA 4IP0A 1V4NA 1PWYE 4OGLA 2A0WA 4D9HA 1VHJA 1OU4A 3ODGA 5C80A 4DA0A 1YRYE 1CB0A 4D8XA 1SD2A 5B7NA 2AC7A 3FUCA 4PR3A 2AI3A 1A69A 5IU6A 3PNPA 5CYGA 3OZEA 4H1TA 1JE1A 1Z5NA 4EARA 3KUKA 5EPUA 1JPVA 2GUWA 1SD1A 3K8OE 2ISCA 3UAYA 1JE0A 4DAEA 3C74A 1PW7A 1LV8A 4GMHA 1JDVA 4OJTA 3TL6A 3NM4A 2OC9A 1JYSA 1A9PA 1RR6A 4M7WA 4JP5A 4UC0A 4DANA 1B8OA 2A0YA 3GGSA 4L5CA 4NS1A 1XE3A 3DF9A 1YQUA 1ODLA 1PR5A 5CCEA 1I80A 5ETJA 4DA8A 1CG6A 4M1EA 5JPCA 1JDSA 1TGYA 4YNBA 4QEZA 4R31A 2QPLA 1A9RA 5B7QA 1PBNA 1OUMA 1OTXA 4OEHA 1RXSA 3KVVA 4LZWA 1ODIA 1OV6A 1LX7A 3T94A 3EUEA 5F7XA 1K3FA 4F1WA 4JWTA 4LKRA 3FWPA 5K1ZA 1ODJA 1Y1RA 4WKNA 1N3IA 1B8NA 1Y1QA 1ZOSA 2XRFA 5B7PA 3LA8A 4TXNA 1V41E 1V2HE 2AI1A 1TD1A 5CXSA 3KVRA 1T0UA 1RXYA 2OECA 1U1DA 2QTTA 3BJEA 1SJ9A 4D8VA 1RXCA 1Z5PA 3U40A 4BMZA 1Y6QA 3F8WA 1ZL2A 4TTJA 4BMYA 2AI2A 2HN9A 4TXHA 3KU4A 1NC1A 2HWUA 4L5AA 3D1VA 2BSXA 4OF4A 3ONVA 1U1EA 4F2PA 1V3QE 1A9OA 4GLFA 4DAOA 3SCZA 2Q7OE 3OCCA 3OF3A 3LGSA 1YBFA 4NSNA 3EUFA 1JDZA 4G89A 4I2VA 4TXLA 4D8YA 4FFSA 4DABA 4QATA 4YJKA 1VMKA 3LBAA 3OPVA 1V45E 4F2WA 4QFBA 2HRDA 4G8JA 1PR2A 4TXMA 5FAKA 2OXFA 1PF7E 5DK6A 2I4TA 1NC3A 5F7ZA 4U2KA 1Z35A 4EB8A 4GKAA 5F7OA 1T8WA 1A9QA 3OZCA 4K6OA 4QARA 4TYMA 3DP9A 4X24A 1A9SA 2I8AA 4MARA 1ULBA 3QPBA 5B7GA 5F7JA
chains in the Genus database with same CATH superfamily
1NAIA 5G3YA 3SLKA 3IFSA 4NZOA 3DO5A 3B78A 3MINB 1VI5A 2O7RA 3LC1O 3VZSA 5K0BA 3EEYA 1JMKC 2PUAA 3RM3A 4EHBA 1VPEA 4HWGA 3IAM1 1TC2A 4NMHA 5EC8A 1SCNE 3RASA 3VVCA 4A5OA 4EPTA 2GM4A 4GSYA 3CLUC 3W6ZA 4QZVA 2GPJA 3BQNB 4PYOA 3DVRX 1NXTA 1BE1A 1OTYA 3TW8B 2ZCVA 2WSSD 3C8MA 3C3XA 4M3NA 4TS9A 5TXGA 5TT1A 4B17A 5E3HA 1QHXA 2P11A 5FBHA 4D6PA 1JAYA 2IDZA 2V7TA 3IR7A 1FQOA 3VJKA 1IXSB 3WYAA 5IJ9B 4YRLA 2AXEA 1ZUNB 1PK9A 2VYVD 3BFPA 3PLRA 3KYBA 3PKZA 5FBLB 1SQSA 4O4HF 1CF2O 1K7YA 1WB5A 2DLDA 2RC5A 1IBKB 2P6RA 5G2OA 4NIMA 2DT5A 3NKLA 4FP9A 4I2NA 1DHRA 3CR3C 4XUCA 3UAZA 2CHUA 1OIVA 4L95C 4R40A 1XWWA 3FKJA 4P7FA 4QVKA 4R71A 4B46A 3G8YA 3TXAA 4LWZA 2VA9A 1GFZA 5KDDA 4ZT2A 3CTMA 4N39A 1JSZA 3NT4A 3NWEA 2CLHB 2PJRA 3TTSA 1Y5NA 3M8KA 4D4HA 1KYZA 1QQ7A 2XB4A 1UMCA 4G5GA 1H4QA 1QAMA 1T1IA 1J0DA 4R2XA 5CNKA 1DVRA 3D9QX 1Z34A 4B4OA 4BWFB 5A02A 2HR1A 5EMJA 3W3AA 2JKZA 2DCUA 2IOYA 3IJPA 2Q1TA 4XSVA 5EMHA 4JSRA 4EUHA 4JA0A 4RDIA 2A3NA 2XUOA 3L7BA 5BN4A 3CTPA 1R12A 3LX5A 3JVDA 4EFMA 2BYTA 2H06A 4NENB 4E09A 4COOA 2DULA 3CLTD 4XR9A 1E2HA 4GYJA 1PJLA 3ZHVA 4V1CI 1MQSA 4OG2A 2CKDA 4K1XA 1W36B 4D8WA 1MCZA 4K9MA 1QVVA 3FOWA 3EXHC 1Z73A 3VOSA 1E1MA 1TT7A 2CDCA 5E7JA 1Q7CA 4G86A 1E1DA 4X1IA 2YIJA 5H59A 3O9VA 4PBSA 2Y1OA 5J40A 2C2HA 3WFJA 6CHYA 2J30A 3AP2A 1OC2A 5AI4A 4C0KA 1VLMA 1RZRD 4ND5A 4P84A 2BM1A 5KYYA 1LZLA 2W2KA 2AFIA 3FBTA 5ULLA 3OZAA 1E6CA 1W85A 2Q6TA 2GJ9A 5I7WA 1C3XA 1Z4MA 4FWBA 4Y6PA 1KBOA 2HBQA 2P2SA 3TCNA 3A6FA 3WLAA 2I33A 5FPYA 5HFJA 3LKVA 3ZJTA 1H9CA 4U9IS 4PQEA 2I4IA 3DZKA 2R8ZA 5C2JB 2VH1A 2BFAA 1PDVA 1Q7GA 4E14A 1WDWB 1ZKMA 2RGUA 2OCKA 1A4RA 1XKQA 1UDCA 3ETHA 2BZ0A 5CFOA 3FRJA 3U7HB 1VB3A 5EE0A 3OLXA 1FNBA 1ZR2A 1NHWA 2ATVA 3GRAA 1XVAA 3MRSA 3SXJA 2JCVA 2I8CA 2ZT6A 4ZYYA 4OJMX 1TK9A 1VHTA 1I10A 1P44A 3FFWA 3P0FA 4Y6GB 3SJCA 3UICA 1PUXA 2ZUCA 2I2CA 3NKVA 4JEHA 3OQHA 3MSXA 3HS3A 1J06A 3JQ7A 4GG1A 3K6RA 4G41A 4N0EA 1Z7EA 3HXTA 4PRLA 2AK2A 1Z36A 2ARKA 2QVXX 1H2EA 1NQAO 2ZIXA 3MERA 4P81A 3VU0A 2OO3A 4JEUA 3TLBA 4YR9A 3OEEA 3I04M 4JXXA 2DFNA 4OB6A 1WMEA 4Q37A 1BGVA 1Q74A 1RAHA 2FB9A 3KYCB 4JJAA 2HMTA 2AN3A 2QRKA 1F8FA 3TQQA 3FR8A 1KE2A 1T25A 4UHKA 1EUZA 3T0IA 1NRWA 2PAFA 4RABA 3MHPA 5HG0A 4DG9A 1Z2OX 5FWAA 2F3RA 3UOAB 2ORWA 4LZZA 4R1PA 3P27A 4EP1A 1QLWA 2QI9F 3SJ7A 1X38A 4PYIA 5HIJA 4MVJD 3JYPA 3TJZA 2QZ4A 1GKLA 1R3UA 2QLTA 2W6CX 3AUKA 1NJ5A 3EQ9A 3G13A 3U56A 2P4UA 4FVTA 3BOSA 3FHCB 1OH5A 4FYVA 2GAIA 4HJRA 4K1LA 4YAWA 1XNQB 1D2AA 3H2HA 4RJ2A 3HZRA 3LYHA 2MINA 2YUIA 3B36A 1C2TA 1R8SA 3RS0A 1V8FA 4LECA 1BJTA 4DR7B 1DFIA 1Z9BA 4R1NA 4PTYA 1ISRA 5AK6A 5FB3A 2W0SA 4MQ4A 3ZY2A 1V16B 2YY5A 1IY8A 2VYVA 2C8KA 4F1JA 3AEKB 3OLQA 5JMPA 5AW2A 4TMWA 2ZAYA 5BNWA 1I7LA 4FE7A 2VKQA 4Q4HB 2ZRPA 1L8XA 5IH3A 4E7OA 2CVPA 4C2TA 1M0EA 2QI9C 4MWTA 3KV3O 4NCAA 1UJMA 4TMKA 5F76A 4PHHA 4CLXA 4D4MA 2WY2D 3EQ6A 1RM0A 1Q7TA 4H3KB 4LRUA 1LNZA 3UV3A 4HYEA 4JK3A 2QL5A 1E9VA 2ORVA 2QLJA 2DECA 2PMKA 4NNOA 4RJJA 1IYZA 1W36C 2QP4A 2G76A 4XCXA 2B78A 3I4FA 4GQIA 2EIXA 1BFUA 4KXMA 1AUVA 3OKCA 1YJBA 1ENOA 1P19A 3LDFA 3GEPA 4LHEA 1SKQA 4EY6A 4HBGA 1JILA 4PIPA 3OKAA 2FDXA 4PXSA 3TLMA 3U9SA 4EBFA 2VT2A 3HEBA 4A8JB 3GEIA 4KTVE 4KWCA 1ZNWA 2ZRNA 4U2EA 3RIHA 5H9WA 1E89A 3ZXXA 1Q57A 4J3FA 4ONEA 4YV7A 5KYNA 2HRQA 5DF1A 2AH5A 1T9DA 3JQGB 1K86A 4DMMA 3FF4A 5JE8A 2ZJ1A 3FVQA 1IEWA 3PJFA 5AOCA 4S12A 4ZOLB 3W1WA 2C4VA 2OKCA 3KPJA 4ZZ1A 1A2BA 3H7AA 3LT2A 5FPQA 2B21A 5BR1A 3B48A 4NP6A 1CFZA 4P3NA 4PPGA 3DZFA 4TV8B 4BB5A 4F9TA 2ZR8A 3SHFA 2F9MA 2TSYB 1EXMA 2G0AA 2HCBA 2QJWA 5THKA 4MI1A 5F5XA 4CL8A 4MVJH 2X58A 1GITA 4HQOA 5LKRA 2CL6X 4ZARA 2R6ZA 4ME6A 3IEVA 1Z88A 5CEJA 3L7OA 2VQFB 3QPVA 1L5LA 1ZY2A 2PXHA 3E03A 4JJGA 2FMIA 4LVUA 5K03A 2WR8A 3ZE1B 2P6OA 3QLJA 5CW2A 1TQ8A 4G0YA 1D8TA 3L4BA 2GCOB 4NICA 2ZBVA 1NTRA 8ADHA 4AY4A 2P1RA 1X7GA 2SCUA 3P2MA 4NBLA 1SVIA 4OYRA 3OKPA 4HYTA 4TLCA 4BJ1A 3QUCA 1OYVA 2EKBA 4JODA 2FTKE 3KAPA 4LXXA 3AUXA 3KOUA 1P9WA 1XELA 1EJ0A 3I12A 1R5BA 3E22B 4N7BA 1J21A 3T5MA 5CYGA 4CTNA 3KPWA 1O8BA 3A05A 4EO9A 5HFAA 4TLEA 2Q50A 4PZUA 3N0XA 2GYYA 1ZCFA 1YH3A 4TMXA 4DM3A 3JVEA 3ZX5A 1EM6A 2VHTA 1XRJA 1V5GA 3RT9A 1HMPA 2MSEB 1UKCA 3OCWA 1H22A 4D44A 4B8WA 1Z5ZA 2B8JA 3OQJA 3P32A 2D7DA 5LMNB 3LHFA 1UT6A 2K6GA 2PU5A 3NHYA 3NOOA 5EP3A 1ONSA 3PHGA 3LXUX 2FPLA 3MLEA 4K8RB 4RFLA 2BRUA 4RFVA 4ZVOA 3UMBA 4HFRA 2VQ6A 3E23A 1OFIA 2JIMA 4DNQA 2XYRA 2LKCA 5ITWA 4GR9A 3RHSA 2X1VA 4Y0VA 4QJ5A 5LYYA 8OHMA 3C5HA 3DEJA 4OJTA 5BQPA 3RRFA 4IDQA 3LX6A 3ZGXA 3STHA 5J4KA 1FFYA 2PVCA 3GOQA 1U31A 1LRJA 2LCIA 5JHHB 4QU0A 5IEBA 2BLLA 3Q9NA 2PX6A 5JJCA 4HI0E 5J2TA 5JJBA 1K08A 3KWLA 3B9PA 3GRZA 4MVJA 1LBHA 2DPMA 4R6WA 1F12A 4M7WA 4IO0A 1SUWA 4DVJA 2Y4OA 1WXWA 4B3RB 1F0KA 1O87A 2OV1A 4PR0A 1C3OB 2VF5X 4R4JA 3K15A 5T8KC 4CN9A 3VNVA 1A9XA 3ZCUA 4F06A 4DANA 2I1VB 2XA1A 3OH8A 1VDZA 3DAPA 3PQEA 3P9PA 2DR3A 1N7HA 2CHFA 1N2IA 1OBFO 1WV0A 4R2KA 3V8PA 1BCSB 2AUMA 2WG1A 5BNZA 1PR5A 1LTKA 5AM1A 1KVQA 4RIFA 5JAOA 3GJRA 4O2BA 2CBGA 4KXNA 4LHXA 4V0RA 2JA1A 5AJXA 3WWYA 4MRAA 4JUIA 3WLMA 5KJFA 2JGIA 3VKUA 4TT3D 1I4LD 4B33A 4HWPA 4W82A 3GQBA 3MWKA 3ZWQA 4E1VA 5A6SA 5KSYA 4Y1RB 1HYGA 1AQIA 1FNSA 3T7KA 5DI3A 2G06A 1XXHA 1WA5A 2YY6A 2W6NA 3DV0B 5IF9A 2E21A 1Y9EA 4QUHA 4UVEA 1N75A 2BMFA 5F33A 1YVUA 3HWRA 2JFWA 3NHPA 4AYXA 3EQZA 4Z49A 5B7QA 1GRNA 1GNPA 1MEJA 4HD8A 4N8SA 2UZ3A 4IV8A 3VZRA 1FP4B 4WJLA 1LX7A 2L18A 2Q8NA 5HF8A 1ZD4A 2JHPA 5HRAA 1HA3A 5HF9A 3LUPA 4ITRC 1XMSA 4AJKA 3UXEA 3I23A 2QG4A 1LX6A 1CUXA 2D2IA 4DDUA 1W5FA 4CFYA 1R4NB 3PYMA 4CIYA 3P2KA 3PB3A 1UBLS 4G2TA 5LVAA 2FW1A 1OWOA 1U0FA 3F97A 5HZHA 2IDMA 3IE0A 5DM0A 2JVKA 1Z74A 2W6MA 1SCIA 1WKVA 2YQZA 1CQXA 1NN3A 2ZOSA 4P1ZA 2NU8B 4NPCA 3ZDAA 5CXSA 3HYLA 4QNNA 5C32A 2HCRA 4JH0A 1KJ8A 1E99A 1TADA 3BDAA 5DVZA 4TWIA 3UHAA 1C2YA 2YOFA 2EKLA 1NPTO 4FILA 4ESHA 2H1OA 2HLDA 1VSTA 5EPEA 5AXBA 5TF4A 1J20A 1FK8A 4EGQA 5K0SA 2GZ2A 1ZP6A 2PUWA 3HDTA 3L1KA 4FOOA 4JS0A 4FKMA 5E4JA 3DOCA 4ER6A 2QAIA 2H4YA 3QEOA 3DTTA 1PWEA 1SZPA 1ZL2A 3OQVA 3UH1A 1SU7A 2NTYC 3AUJB 3OJCA 2AD5A 3NEAA 4BVAA 3PUIA 4OO3A 1AS0A 2R9VA 5ESRA 4XM1A 4A23A 3TF5A 3P5SA 1BX0A 2HWUA 4S2UA 2J46A 1DC6A 3UO8B 3IRUA 3ZQKA 1PS8A 5FFFA 5CFQA 6PFKA 4S1TA 1REQA 4P53A 4JI0B 4WNCA 5K3FA 3AEYA 5BQOA 3UGTA 3DMGA 3ONVA 1D2GA 5B1DA 2PY6A 4E5KA 4K86A 4IKEA 3VNRA 2NP6A 2XDQA 2ZWPA 2O2GA 1K9VF 3HG7A 3JV7A 4PLWA 4CT0A 9LDBA 1V8OA 3A04A 2Q1YA 3AV3A 2XDAA 1PG5A 3HA2A 3OM1A 4HYQA 1N1GA 1M2EA 2RGYA 4FYPA 5EP2A 2BE7A 3VYRB 5KHOC 4X1YB 1LSUA 4TTQA 4JBGA 3RIEA 1JVBA 1MJFA 1N0HA 2FMFA 5AOBA 4W5QA 2VWHA 1TMGE 2WYIA 2QROA 4QFCA 2PYDA 1W44A 4D57A 1SBNE 1DXYA 1GSHA 3OCCA 3AUAA 4JC5A 4NPHA 4ZV9A 5IKOA 3RYHB 3V4SA 1X7WA 2QVZX 5FPKA 1P3Y1 1GFWA 3KEOA 4ZVMA 1NASA 2OHGA 3T9CA 2D1SA 4I55B 4CJXA 1TYAE 3W4IA 5DCWA 1VKJA 1JFLA 3KZXA 1OZGA 3W2TA 5LFAA 3BHMA 3D5EA 4XAQA 2VK4A 5JDIA 1YZVA 1FPMA 3ESDA 4F5ZA 3IQIX 1QCDA 3UKJA 1KYYA 1Z0DA 1QG4A 2IYOA 3DAHA 2IEGA 1WNFA 2C5AA 4JBHA 4P3OA 5JCJA 5JHGB 3Q8MA 3AG6A 3PDUA 4ZEMA 1E3DA 3IE1A 3VKFA 4D96A 2FSSA 3MPUA 4E5PA 1HZZA 4PSKA 1VCNA 5F1KA 3C3CA 4F72A 3U44A 2X23A 2ZJOA 3RIYA 1SVMA 2R1VB 4MPTA 3KPYA 5KDLA 4X6XA 2BBTA 1LBQA 3LV8A 4KLZA 3WL7A 2DLNA 2PKEA 3PX3A 4WJZA 4YP1A 4H1UA 2V0NA 3IOCA 4Y7CA 5EZ5A 3UMJA 1EVIA 3ZN2A 1QFSA 1ULUA 2PX8A 4PWYA 1OH8A 1BOOA 3KD3A 5FFNA 4C1BA 3L7NA 1CQIB 1GR1A 1QVAA 2OXFA 4H7EA 4OK3A 2Q7XA 3IP9A 4Q1DA 2WYUA 5F7ZA 4YRSA 5CAEA 4E46A 4TT3A 5LB4A 5TF0A 2X4IA 1NVGA 1ODSA 4ZJPA 5AUPB 1GAJA 3BS4A 1JG1A 4MWOA 3DMTA 1IN4A 1U5AA 1XI2A 1OLUB 1UJ6A 3ETGA 2GA9A 3TQHA 3M4NA 5F9HA 4IAOA 1UAAA 4HAXA 4LF4B 3I9MA 2CNOA 1JG4A 3HR7A 3OWOA 5TQJA 1BVHA 4CTKA 4F92B 2IP2A 4IIBA 2B3TA 1Y81A 3R0ZA 4XPZA 3DL0A 1PT7A 5K2OA 4OK6A 3OO1A 4MA0A 2PUHA 1T5IA 3LVFO 4R5MA 4B4UA 4QNRA 3GJ0A 3IV6A 4N0PA 1TW2A 4HDMA 3PU6A 3MD0A 1YQ9A 4B7ZA 3MTQA 3VO2A 1HDGO 3LVBA 4HH1A 1IOZA 5AKYA 4EW2A 3VPCA 2AFHB 3F67A 1A3CA 4ILEA 2E4ZA 3LT0A 1RYZA 3GAMA 4D3FA 4Q1EA 4E5NA 3QXGA 1RFGE 2Q3MA 1F8UA 1KZYC 5HDBB 1TTTA 1W4RA 1PKEA 3DE5X 3GV0A 4D8TA 4U2GA 1K8QA 3KBBA 2FPOA 3WGNA 3VOBA 1R27A 2YWCA 1Y7TA 5H80A 3I58A 4UEWA 5IYZF 2X5JO 3BJMA 4H0NA 3T5CA 2ZUTA 4M54A 1Y3CE 4Q4DA 2F6RA 3KZVA 4GGMX 3VDXA 4LQ4A 3A6KA 1XEFA 1ZRHA 2BFBA 1HE2A 3OZUA 2YWJA 3WNZA 2E4VA 1BXRB 2GX6A 5DMXA 1B15A 1UC9A 2PQMA 4DLPA 3JVIA 4Q16A 4DARA 3KKEA 3NGLA 5EHIA 3IDOA 1U63A 4ZDWA 3REQB 4CF5A 4CV3A 3AB7A 2W5UA 2FUNB 4QXPA 4R16A 3KLPX 3B85A 4TWJA 4FFBB 3H05A 5A6VA 4K2AA 4EABA 5KNCA 1D2RA 4R7GA 1YU6A 2CMGA 2WVGA 3CHYA 2X6QA 3A36A 4N3CA 3RYIB 1ZNZA 1AHPA 1J8MF 3THYB 2P3QA 2H1VA 1V11A 2FPPA 1XR3A 4ZAWA 1U0JA 1AZSC 2CZQA 5HS4A 4CEIB 4JJ4A 4WEOA 2NPIA 4HWSA 4TRMA 4TQGA 3FB1A 1R8QA 4AXXA 1NTOA 1TMKA 1VSBA 3LM8A 2PL3A 2R60A 2Z8YA 1B6TA 1QC5A 3AZPA 4TS3A 3M3DA 2HQOA 5J2UF 3ECAA 3S40A 3CNBA 1VJDA 1JEOA 3AZOA 3R44A 2J3KA 4C29A 3JALB 4GNRA 2IXFA 3FUUA 3GBVA 1T35A 2J32A 2OR3A 3O4FA 4J0EA 3RE1A 2M6LA 4D3SA 4K6MA 1MC4A 1L8OA 1Z2PX 2CYBA 2IJGX 3ISTA 4Q0MA 1P5HA 4QEDA 2JAHA 4GM4A 3EBPA 1RLOA 5D3QA 3ZOKA 2ZVPX 3UH0A 1H2YA 1E0JA 1JPUA 2JFNA 4QLOA 1ZGGA 4UZEA 5F98A 2X76A 3ZD7A 5BR4A 4GP6A 1G5RA 1FXSA 3HNRA 3O4GA 4TN1A 5FBVB 1G3RA 3NBUA 3SPXA 1X80A 2CNWA 3GLUA 3ICVA 1S0UA 4NDNE 3L7YA 4ZEVA 2PS1A 3N0RA 3L4KA 1RAIA 3VHRA 2CVQA 2W6JD 4E1BA 2GBIA 2IYRA 4D43A 2UVDA 1YUNA 4ZVQA 2KLHA 2AS0A 2BGNA 1UFKA 1FQKA 3HP1A 3NP7A 4NULA 7ADHA 4X3OA 4BATA 3VHQA 4QKQA 3JZFA 4O2AA 3GVPA 3EGXB 2A30A 3EPPA 4JBYA 3T3PB 1G5PA 2P5UA 3A4TA 5KQLA 3ZCPA 1H2WA 2WWYA 4LZOA 4NV1A 1G4HA 3JU3A 4EENA 1OV4A 2XGOA 3JASA 3DDNA 4UPEA 3E5HA 4DPLA 1GPBA 4AQDA 1XRNA 1FTSA 2CZCA 1FVOA 1WMAA 4M76B 4O3FA 1SC4A 3CE6A 1GGFA 5DHSA 4WESA 2HSGA 2UZ1B 3OLCX 4N6NA 3AERA 1GCGA 1R7RA 2HU2A 4L16A 4OBBA 2H1WA 1E9RA 4OXXA 2HK8A 1FL9A 3AUUA 2ODNA 5ALUA 3COJA 2ZQYA 1WBBA 1XYVA 4HPXB 1M6EX 4N0QA 4DWOA 2AOWA 1KEVA 3REGA 3WDSA 2B7LA 3H9UA 3PRKE 4FYHA 4A6PA 2GTPA 1TGVA 2FQXA 3BIJA 4BBZA 1DC8A 1RYEA 3GFOA 3EVGA 3OESA 3QGMA 5ICFA 5ICSA 2COKA 3C4VA 3ETEA 4UXIA 2D5LA 3IDAA 3TTXA 7AT1A 1GG9A 4MULA 1Z5VA 2CNLA 1O7JA 3ZDDA 4H9GA 1P7WA 4PX2A 1GG2A 3OHSX 2OQVA 4L0MA 3QVGB 4F3KA 2I54A 3TDMA 4MQMA 2ZUUA 5SYAA 4MAMA 3MGCA 4OHCA 5PGMA 3ND9A 4P3KA 2ZTHA 2WSLA 5JBNA 2FGKA 4FWTA 1FC0A 3KXIA 3O2NA 4G0NA 4MQFB 2FSIA 1JEJA 1JBKA 5AM4A 1M2OB 3VU9A 2QMQA 4BB6A 4EJFA 3ESBA 2Y67A 4WXYB 1LEHA 3GJ7A 4GUAA 1G8SA 1O94C 2FMKA 4Z9AA 3EGCA 10MHA 1WDMA 3LQ4A 1V0JA 1OVGA 4HGNA 3MQ2A 4K88A 4LHZA 1FYDA 3A4IA 4NONA 4B6JA 4KC0A 3OFSA 3G2PA 3Q1LA 4NFSA 3TZHA 1RADA 4WIAA 2PXXA 5CLFA 4UM9B 4QGFA 3LWZA 1ZM9A 2NSJA 1J9EA 4PTLA 2IEAA 4H0FA 1G8MA 2CUZA 4WEQA 1XKLA 3HU5A 1CTQA 3KL4A 3TL3A 2P3SA 3ONEA 4OGWA 2P9FA 4XQCA 3QBDA 2VUIB 1Q0RA 1SUPA 1PNTA 4W9NC 3VMFA 4ZQHA 3R3WA 4EATA 4KVZA 3ZCVA 3W06A 1JQDA 4MLCA 1WW2A 1YAHA 3QUBA 3R3JA 4QIHA 1Z22A 5EFOA 2QU8A 1XOIA 2Y71A 3PNBA 3GUCA 3YASA 4DR4B 4LRSB 3HM2A 3Q3JB 2H18A 5CH3A 2QRNA 5E0KB 3UMFA 5LOVA 5LUBA 1HLDA 1SEVA 3ORHA 1KNQA 3RO7A 1CUIA 3T7AA 2V54A 1IG0A 4AVYA 3CLSC 2H29A 1JW9B 2AJTA 3GXOA 3VTKA 1M8JA 5BN3B 2PGAA 2A5JA 4EKYA 4N9QA 4PZCA 2HHLA 3GXBA 1FSFA 4FCWA 1DBQA 2VTKA 1PG0A 3N75A 4ZC1A 3UGKA 2OQRA 1TUIA 1TO6A 1JDTA 2A9KA 3LFHA 5REQA 3SY8A 2OB1A 4P82A 4MMZB 3QQPA 4XKJA 2BFFB 5KNBD 5HTOA 3EUAA 2DWCA 5FA8A 1R16A 4PANA 1I4DD 1OLSB 3OJXA 1DBWA 3AM3A 4L6CA 4ZRMA 4Y2JA 5DWVA 5TV2A 1ZXBA 2DFDA 5MN6A 4KCGA 4G23A 2HEGA 4MKZA 1HOTA 4MDFA 1THGA 3CUYA 3AP3A 1XCPA 1TZ2A 3RG8A 1HFWA 5BSMA 5ADUS 2I0FA 4HK4A 1SCAA 1E32A 4PHGA 4UE6A 2PV7A 1E98A 2Q9UA 4BN5A 1QLJA 1B26A 1IXRC 1OT3A 2X0KA 2V7WA 2GZ3A 2W6JA 1MT3A 3K09A 3BDIA 1U4SA 4ZOEA 5F2KA 4PGGA 5JT1A 5HTKA 4RGYA 1YE3A 3GA7A 4EI8A 4DTIA 5CPFA 5TR9A 2X8JA 4OQEA 1L4UA 1S5PA 1RPTA 4HSEA 2G17A 2FKAA 3E8MA 3EISA 1Z28A 4PZEA 5E3IA 4PONA 2I4OA 3E9QA 3HFRA 2WAXA 4YJDA 4OYLA 5K3SA 1ZKDA 2H2AA 1B0ZA 3JCZA 2HJGA 2JI8A 1G291 4UW9A 4R0VA 1ULTA 4IQFA 3IT3A 2WLSA 2CLFB 3A1TA 4CU2A 4E32A 1B76A 3L06A 3I05A 1F2VA 4YWHA 5AYVA 3UJAA 2FY8A 3KUKA 3IQFA 4GMFA 3D3NA 1PT6A 3KWMA 1EP9A 3FM9A 3H75A 4AF7A 1IZ0A 3ZK7A 2IQIA 1MIOA 3EEOA 4WZBB 5EZYF 4FOSA 2ECPA 4XRGA 3D0RA 4U00A 4YHHB 1CB7A 4YPVA 1SRRA 1N5JA 3F73A 4J1NA 5CRIA 1DEOA 1PE0A 3Q87B 3UAYA 1T0PA 2J3DA 1JEYA 1K6IA 3F46A 1WXXA 4G9EA 4U7PB 1IUPA 1PTKA 3FTCA 1EH5A 4Z8XA 1ZI9A 2BFEA 2PZFA 5FQNA 3WHIA 4YBZA 3X1YA 3QKWA 1SXJD 3H42B 3CLRD 4CI0B 3ROQA 3U62A 1R9GA 4IQ0A 1G18A 3EHDA 4JP8A 3PSHA 1ZGCA 4F56A 1QE0A 3COWA 4P35A 4IL5A 5HKOA 1YZQA 2XDWA 2FSVA 4LGCA 2O2IA 3KVOA 4W7HA 1JYSA 1A9PA 4EOGA 3AVVA 1AN9A 2WWXA 2CLEB 3E3AA 3PDCA 2ZBEA 3TUJC 3B1WA 3C3YA 6Q21A 5KNBH 1YA4A 1Z4PX 2XR1A 4NZYA 4RV9A 3V9AA 4E2YA 1E59A 1CVLA 3EWSA 1VPDA 4PW0A 1DHTA 2J5QA 2XWBF 1NZJA 3F7OA 5D6NA 2W00A 3H2JA 3ZI7A 2XHEA 3UYLA 4CUJA 4PNEA 1ZIDA 4NAVA 1G8FA 4HAZA 1O95C 1FDTA 2GRUA 2HK7A 2BUAA 2QENA 4I19A 4MB0A 4RU1A 1ZU5A 5DLDA 5FPPA 3VR5A 4D9JA 1XA0A 5I7SA 1FSPA 4YRNA 3EXEA 4H7FA 2VP2A 3M0EA 1P9NA 1Z5UA 4ZTZB 1U2GC 2CV0A 4YLEA 4C5BA 3VHXB 1OI4A 3EEQA 3HGTA 3E9YA 4HF7A 4JD5A 1I7QB 4BZPA 5ECYA 2HBRA 5HOEA 2C8VA 1STOA 4U3JB 4XOIA 4FKBA 5CW1A 4DSUA 2YVKA 3QUQA 5A9SB 4YNBA 2J5BA 1C80A 2BEWA 4RD6A 2AFRA 5CNJA 4YCDA 3UATA 2XTNA 2AN1A 2WHEA 3SC2A 4A10A 3DD1A 1TVMA 3AFIA 2WWWA 1CNMA 1OH7A 3UFXA 4YT5A 1OD6A 1W4ZA 1X2BA 4P9NA 1SIUA 1HE1C 2JIOA 1S2NA 5AKXA 9GPBA 1ZAYA 1OPRA 1TW3A 2QNRA 2XQGA 3NUGA 3NAMA 2CMHA 4P83A 4UAJA 3VI4B 3ZWPA 1M0TA 4HTFA 1O6ZA 4RK1A 2UVQA 4LKRA 1TVCA 3FMGA 4FBGA 2ZB8A 4UMEA 4P4SA 4TLMB 3AHFA 4AW9A 4IIGA 4DKJA 3MBKA 1OIWA 2ZJ6A 3HP4A 2G4VA 2HRZA 1FRZA 2GPSA 2CLMB 3ICPA 3NTOA 3WI7A 4YCLA 3C3MA 2Y3IA 2PUJA 1FYVA 2H4JA 3L1JA 4IDPA 1BFDA 4ZYZA 4KXYA 4G8CA 2B1JA 5DP2A 2XCSB 3DGEC 1CCWA 1V41E 4LGVA 4OUKX 5KNBA 3U4IA 3K0SA 3R9WA 3NONA 3PJDA 1II8B 3DWIA 2OCGA 1ST2A 2EWWA 4TOIA 1QU2A 5JMOA 5IVKA 4IHJF 2P2ZA 3L0SA 2DFPA 2X4GA 2YMMA 5J5AA 4YFYA 1ECCA 2Q07A 1THZA 5ED0A 4MW5A 3PJRA 3U4QA 4JR1A 2XB6A 3OCZA 4HN2A 3BXPA 2AYYA 4ID3A 2AQHA 3AETA 4UU7A 4I1PA 1KK3A 3RROA 4ENRA 4ZOQI 2BKVA 1SHZA 2G5CA 5D2CA 2ISSD 2RD2A 3C7TA 2PZ8A 4B40A 3TB4A 3R0XA 3K1JA 2XXAB 5JSZB 5FTKA 2GTHA 4MVCA 1COWA 4W8GA 1QK4A 2A7QA 1QGAA 4QYIA 2Y77A 1BKSB 2LV8A 1MQ8B 3LUHA 2H16A 3RJZA 4LOJA 2IT1A 3O90A 1PWHA 2QMOA 5D3ZA 3T34A 1IXKA 1YUMA 3OMXA 4DJDC 3QFCA 5J3JA 3PFFA 1W6UA 2NUTB 1V3QE 2RHGB 3EDQA 4JOCA 4UXHA 1KH2A 3Q6MA 4RACA 5F5NA 4V03A 1XQWA 3IP1A 3TVYA 3CVYA 1EFVA 1XKXA 5CMLA 4P8RA 1L1EA 3I5YA 2M1XA 3PJGA 4Z9XA 1PEAA 2HK6A 2P1ZA 2HLHA 3JD1A 4Q9JA 1BQ3A 1DZ3A 1FUYB 4NCKA 3EY9A 1OXKB 1ZQ1A 2TS1A 2W6OA 4L4RA 1QV6A 1ORHA 3VH4A 2FCAA 2ZW9A 4EHFA 2I2AA 2PRYA 4M88A 1HNWB 2OXRA 3UK6A 1QQAA 3VM6A 1T2VA 1AZTA 2WV7A 1KY2A 4B4KA 3VAYA 4JX9A 3F7TA 5AW6A 3OHPA 4MI3A 3HJHA 1SXJA 5ALEA 3MEQA 5D6OA 2H00A 4MS3B 3A1SA 3BQ9A 2BR3A 2D8AA 4LDPA 4WY8A 5JO9A 1L5GB 3V3KA 4AECA 3H11B 3GW8A 4FFSA 4I50B 13PKA 1C8LA 3GJYA 3CONA 4NH0A 4DABA 2J3IA 1FP1D 3A1VA 3NYWA 5KTKA 2QV0A 4DNPA 3W5JA 3WYDA 4A8TA 4M1ZA 4H35A 2ODWA 2OK7A 1S3IA 4LGYA 4ZAZA 2Q2WA 2HWXA 3BWXA 1Z6XA 2XYHA 4D9MA 3VVMA 4X84A 2JJYA 2ENUA 3EG9A 3WWPA 3IAXA 3BTVA 5NULA 4JVMA 3U16A 1SWVA 1M8PA 3H0CA 3OSZA 4AYTA 2C4WA 1CR6A 2C5GA 2C2KA 2J45A 2WKWA 2GGSA 2EFDB 2ZP1A 1A8IA 2QY9A 3VJRA 5CIYA 2CCKA 3OE1A 1UOOA 3QVXA 1N2CA 1HXHA 1UKYA 1WJGA 2GN1A 2XYQA 4IR7A 4C1NA 1B16A 3ZHTA 1AKUA 1EZZA 4RFSA 1VECA 2B36A 3P4UA 2YHSA 5ALMA 5FPHA 3WNQA 1T8WA 2WBLC 3ELWA 4TLAA 1NE2A 4AMVA 2GS9A 1DSSG 4PX9A 2ZSEA 1X13A 1F6DA 1TC1A 1UJNA 4PE5B 2I8AA 4QE3A 2Z6AA 4AKTA 1Q0QA 1SHJA 1ZCJA 3QPCA 3C4JA 3IB3A 2FSHA 4WI1A 3ZY3A 4QG7A 3O4RA 1ESMA 4IY1A 1I6KA 4NJMB 2PMCA 1C30B 4QT4A 3GUYA 1K27A 2PXAA 4PO8A 5GGYA 2AXNA 3U4GA 1RIFA 3I28A 3VPSA 4BU1A 3N7TA 4WK0B 1KVTA 2EKZA 2J7PD 1NRJB 4RELA 1WCXA 3QTBA 4B47A 3I53A 4B6RA 3G0DA 3VYWA 4D56A 4DA6A 5K9ZA 4YAIA 5JVDF 5SZIA 4AJOA 1TYDE 1UBTS 3HJUA 4UDOA 2BHSA 1RCTE 2I71A 3COPA 3H9GA 4OQZA 4ZO8A 1MW8X 4TKUB 5FXMA 2XKKA 2Q5IA 1G20E 2DFVA 4HVAA 2ZQZA 1ZGJA 3JZAA 3N6VA 4LRWA 3GEMA 4IDNA 1YQEA 3V6MA 4E21A 4V0QA 4INPA 3W7BA 1A95A 2GEKA 2YTZA 2AOTA 4PGFA 3LZ6A 2DHCA 3K05A 1N2HA 3KLNA 4X60A 3RVMA 1J24A 1HDIA 4J16C 1LW6E 3WRYC 4DV0B 3WQHA 1SQ5A 4EMTA 3B5EA 1R4AA 1RJ9A 1YRBA 1W5TA 2WWTA 4ER3A 4MH0R 3SZRA 2H08A 3ZXYA 3PG5A 2IYEA 2ZCJA 3DKPA 4MW9A 2I3DA 4ZJYA 4A0GA 4UE2A 3O2QB 4L3OA 3VSDA 1GARA 1E4EB 4Y2QA 1WS6A 4OSOA 4CKBB 1EGVB 1RVDA 4F3CA 5ALKA 1VHDA 1RI5A 2AW3A 2FUG1 2XOKA 4MKRA 5CJJA 5BRNA 4DADA 4F2DA 1HL3A 2W42A 4H59A 1F0YA 3RS5A 4ENSA 2KS6A 4IH1A 3F9IA 3H6HA 4IUCS 2XUPA 3WAGA 1D04A 4BKQA 3CU5A 5EWJB 4HRAA 1NG1A 3I9KA 4QOIA 5AKLA 4BV2A 3KSUA 4UTRA 2O3RA 1KYTA 1E77A 3RYFB 5A3QA 1N2BA 2HFJA 1OOEA 2YHIB 3ID6C 5LB2A 3SVZA 1M72A 1ZVQA 4DRZA 3EDOA 1KBQA 4UUQA 4MRMA 2QTWB 3PEWA 4LW8A 1P75A 1CJVC 3FIJA 2BAGA 3VC2A 1T9GS 2ERXA 3GROA 2IOQA 3IKTA 1VHQA 2J9GA 4JI6B 4FOLA 2OA0A 2WU8A 1OI2A 1Z17A 2UYYA 1OWNA 2BBOA 3BVPA 3NLLA 4FT2A 1PFQA 2DVMA 2IF2A 3T7EA 1L5SA 3IL2A 1K6MA 3ZE8A 2XNDD 1BMFD 2AC4A 2W90A 1EK1A 3K5WA 1CY1A 3D7SA 4QPDA 4WOCA 3WL3A 4IMRA 1V5IA 5SZHB 4Q3KA 4DC1A 1WP4A 2FEMA 3UJBA 3SZGA 1P2BA 2FPIB 3I73A 3NPMA 4LI0A 1HTBA 1O6BA 2WABA 5CXQA 1ICIA 3ETLA 1I2ZA 4LCJA 2EG5A 3PTLA 1BH2A 1N6RA 3CQ9A 2QZZA 1SOWA 1Z2AA 2PAAA 4O25A 3UT6A 2ANBA 5CDFE 3DEIA 1E6EA 1ECFA 2O5VA 3BF8A 3IMGA 3O73A 4X8HA 4WBNB 4EA9A 2O07A 3BE6A 4B2LA 1NVKA 1QFYA 2R68A 4F45A 4O63O 3CXUA 4EJSC 5KVVA 3Q10A 1TYBE 2MCFA 1DFGA 3GJ6A 3R6DA 1CERA 2FW6A 1M34E 2W4MA 3EUWA 4JVOA 4GOKA 4UUMA 1C8KA 4AJIA 4I4CA 2BKEA 5T3YA 3GEBA 5LN1A 3QVVA 5JQGF 3CX6A 3IJEB 4L5JA 4UPVA 4HMOA 4Q3NA 4D7AA 1CUHA 2ZSJA 1MOSA 4OP3A 3WTCA 3PXAA 2PZKA 2OLKA 2MJLA 1FFCA 3DPSA 4ALKA 5DM60 5JU6A 2YN2A 3DUFB 3RF7A 8LDHA 3UUFA 1YQGA 5IKXA 1KS9A 3GDHA 3DDCA 1KYVA 2P9HA 3LH5A 4LYAA 4ZO6A 1DCKA 3REFA 3VX4A 1E7WA 4CKCB 1C0EA 2N42A 2O8CB 3L8DA 3RFVA 4R8KA 2XUHA 3L1IA 4CM4A 1YVPA 5H70A 1IY9A 2AKAB 1FA9A 3JS5A 5DYGA 5J4HA 1T8SA 2Y27A 3O92A 3M81A 2O19A 4PAOA 1OSNA 2F9FA 3RWMB 1L5HA 1GTL1 4O29A 1TQDA 1HEYA 3DP7A 4Y1GA 4CLOA 1FFHA 3KHSA 5ALRA 2WILA 4OHFA 4M9UA 3ZEIA 5PNTA 2J7PA 4WDRA 1XVLA 1JHDA 4WK4B 2PA3A 3AIIA 4OHZA 4NOMA 3T1HB 3KIPA 3KL2A 3R3SA 1VE5A 1Z5OA 3AESB 3GD5A 3M6AA 5LZ7A 3DM5A 1MX3A 3QW2A 1ODCA 1NNSA 4UD2A 1GEEA 3UK0A 4R2MA 3GJZA 3FNRA 1F6BA 1Q1ZA 2E48A 2X1HA 2KMLA 3EZ2A 3I2KA 5EPOA 5DNUA 4ARIA 1Y6JA 3H6GA 1LDNA 1ZJWA 2YN4A 3DKKA 1J2EA 2EFJA 2ZRCA 1FTYA 1P7ZA 5F73A 4TV9F 3RJ5A 2I78A 3MJCA 3G9ZA 5DTQA 4BCCA 1EDEA 4U2DA 5EUMA 3K72B 4BFYA 2R6DA 1PGQA 1TA0A 3A3YA 2QR2A 1DQZA 1MRNA 1GKUB 1UXGA 2PL9A 4WKOA 5IFLA 1EB9A 4EEKA 5DPMA 1OFVA 3UW3A 3U81A 4G67A 5CVTA 3TIVA 5LZ9A 4LJLA 2JFHA 3WNBA 3OECA 3ZWNA 2XTJA 2Y92A 3WWDA 1J7KA 4QNMA 4CM5A 3V1KA 3IOMA 2JCGA 1UP4A 2F43B 2DPXA 2ZGVA 4MV7A 2AHRA 4NOJA 4BVHA 3LQFA 4BN0A 1KR2A 2QLMA 5ICMA 3L93A 3D31A 2IL1A 1P45A 4GQAA 4M49A 1OJ7A 4OHWA 5CDHA 4U8HA 1CZRA 1XRPA 4E07A 2FN3A 4RENA 1UK9A 2ZVQX 3O93A 1GU1A 1QKKA 3BPSA 1PQYA 4FUQA 3RSFA 4DDHA 1Z16A 3LPAA 2QW1A 7YASA 4U39A 4IXWA 4QRDA 4R2IA 1Y5IA 2C1EA 1DJPA 1T9CA 2AEEA 1FYEA 2JGLA 2VYFA 3D7KA 4TPKA 3WC4A 4CV0A 2OPBA 4XWWA 2ZE5A 2Y9PB 4B43A 1PYOA 2REQA 2BOVA 3PPVA 2R6R1 3MC1A 2XB9A 3EK2A 3H8WA 1IPHA 3LGXA 3GHYA 4FC7A 5ES4B 3BJIC 1CIPA 1GUFA 3UAXA 2M32A 4WCFA 3TEFA 3RADC 3LYUA 2XNDA 1BMFA 3SE7A 1YE8A 3V1NA 2VPIA 2C61A 1OWPA 1W47A 2VRWA 1XMJA 2WMOB 4BO4A 1TM4E 2GZHA 1N2XA 3GNQA 1C7EA 1DAPA 2JFPA 3NBKA 4G5SA 4U7HA 4ZP1A 3T3GA 3AF4A 1OU0A 4D9HA 3ODGA 5LLTA 2CDNA 2NP7A 1J42A 3WXMA 3P9IA 5IW8A 1L4BA 1N5OX 1U99A 4YBRA 4S05A 2BJHA 5A7GA 2ZRFA 1LLUA 4URUR 4R84A 1S7GA 3N28A 3ZU4A 5KOJB 2CUKA 1NW5A 5GM1A 4HTAA 5ALVA 4HV4A 3WB1A 1PJZA 1ZOOA 5AICA 4PXAA 1VB5A 8GPBA 1NI4B 4NK5A 3VOAA 3U4CA 4OH7A 2NO1A 1LQ2A 4QSHA 1RWMA 4G1MB 1XMVA 1V39A 3OZEA 3EIQA 2W2PA 1TLLA 1IZZA 3C3WA 3C2QA 5KPDA 1TOAA 1QPZA 4EX7A 4JUDX 3EZLA 5A0TA 5CK5A 4EW6A 3K8OE 5FTLA 1K63A 2CLIB 2AHOA 5KYUB 4AUKA 5BOSB 4Z53A 1DJOA 2OVFA 1NM5A 1ZGBA 4BNDB 1NYRA 5TQ0A 1DKUA 4HZUA 2Y0EA 4V0KA 1NR5A 4HUQA 3E9NA 1X7XB 1JQ5A 4JCOA 4PC1A 1PJ4A 4QLBA 3LMKA 4CM6A 4HS9A 4B3IA 1EFAA 2ATXA 2C3PA 4IJWA 4RZIA 5K0GA 2GYVA 5KAMA 4ZEOA 3M70A 4QRHA 4Q9AA 4HKTA 2BZSA 4P58A 3ZV7A 3K9CA 5ER6A 1M9NA 2ZB7A 5FOTA 4N76A 1VJ5A 3SWWA 1QS0A 5LDDC 1CRLA 1WLSA 3PUHA 4JP5A 2XE8A 5LA6F 4G0QA 1YA6A 1PW5A 4XJSA 3WQRA 5BWBA 5AESA 1B1AA 1O96B 1BE6A 2QM7A 2WM2A 3EQ7A 4YJGB 1SXQA 2XOXA 1T8UA 3OP4A 3VUFA 4XWOA 2ZUEA 5K8JB 1H2BA 4D3DA 4IH4A 1MABA 3AHJA 2M6RA 2ZS7A 4ARZB 5TLSA 5BN5A 3S28A 2IHNA 5CNIA 3IA7A 2WJIA 4PPFA 4DHEA 1KETA 5JMTA 2V9CA 4RM3A 3IT0A 3T3EA 2B8TA 1ICEA 1SKAA 1M2FA 1IN7A 4J1TC 4BMSA 1ECJA 1W48A 4IF4A 3ZHSA 4TRRA 3M5DA 1TGYA 5ENZA 4BC1A 3V97A 2GCIA 121PA 2GILA 2HDWA 4IOJA 4QEZA 5B1IA 2HK9A 3HB0A 4X7PA 2FXIA 1U2QA 2XGGA 1IH8A 2H54A 2RJOA 1R0LA 3CSSA 3GLKA 3H65A 3PGA1 4MKXA 4D3ZA 1U28C 4DQ0A 1A9RA 5DBGA 3N86A 1EHYA 4H1VA 3ESZA 2BHTA 2LD4A 1A8QA 2J9RA 3EEFA 3IESA 4I08A 3TX6A 2CJWA 3A6DA 1JVSA 1FLNA 4G5OA 1N2GA 2XVMA 3E2PA 4ZYVA 4R1OA 1OV6A 3BXXA 4CM9D 1CXZA 3IXMA 4FGKA 3BZUA 5F7XA 5JTTA 3HXMA 1VHLA 5TJHA 5UKDA 4F1WA 2ISQA 2XQKA 4HG2A 1UFQA 2LP4Y 2WWRA 5A06A 2VQEB 1EI9A 2IX9A 4R1QA 4LBVA 4EYGA 1RAEA 4XVUA 2HA2A 2O3TA 2DFLA 5TMEA 3U2QA 3KV1A 2I87A 1U9YA 3T4PA 3ESYA 5JS2A 2WC1A 2DM6A 4PQYA 5FTWA 4QOHA 2ZROA 1D6MA 4LDRA 5B7PA 5FF9A 3N8DA 1JU3A 3F7NA 3L84A 4FEAA 4E15A 3CM0A 1GA1A 3TUIC 1PGOA 1S01A 1XEXB 1XEWY 2G1UA 2GNOA 2VK1A 3DSRA 5T3UA 2A4KA 1MU0A 5EESA 4CW7A 4EIWA 2ZZKA 4KR0A 5C4MA 1O03A 3C6ZA 4AL4A 2HNBA 4C3OB 4P80A 1GAEO 5JRJA 4G81A 3PQ8A 1FBTA 3HN7A 5A2QA 2O6HA 3L0OA 5ERGB 3L82B 4LX8A 3ADOA 3PF9A 4OFBA 4ZQBA 1DTSA 3TKAA 3CR8A 4MRPA 3DZHA 4J0DA 3SGLA 5D7BA 3PPIA 3TNFA 4GXQA 3WJ7A 3LPMA 1QIGA 1TKRA 4RVUA 1P4RA 3BIFA 5AP9A 3ZBQA 4NQRA 4UMDA 1R4ZA 2Z2JA 3R6TA 3SU8A 4YT8A 3KZOA 2QRVA 3ANMA 4KO2S 3X1ZA 3PNOA 1AQ6A 3HB5X 3CB4A 1UPFA 4KO1S 3RRYA 1T6BY 1WMSA 3EC2A 1KOJA 3HU2A 1P73A 1WZNA 4Z8YA 2X4DA 4UBMA 3SXUA 1NN5A 4B6OA 2DY0A 2WF9A 4OHUA 1YS7A 3C87A 2XCRB 1GA6A 3K1AB 2IW3A 3ABSB 4UVDA 1X9HA 4P92A 4CL3A 1WVGA 4QJ4A 5C8YF 2WTNA 5DXAA 2Z1NA 3HCNA 1E3WA 4KVGA 2Z5LA 3BXFA 4LE2A 4Q9NA 1Z8HA 3Q6NA 3AU8A 1TVEA 1XZPA 1BHSA 3L0IB 4MRRA 4PRKA 5B6IA 3G49A 3F5SA 4N3AA 1FUKA 3BSYA 2JGMA 5CURA 2V59A 1JJAA 3RAGA 8AT1A 1JAZA 1GTJ1 4AJJA 5IXYA 4IRXA 5GADl 4BFUA 4I2VA 2PVPA 1ZRMA 5FQOA 2VZ0A 2PGLA 1KVUA 3GLGE 3L6RA 2R25B 1KZ6A 3OF2A 4TTVA 3KBOA 1AS3A 4R1SA 521PA 1E1QA 4GWLA 5CB4B 1OA1A 5CB8A 1E7MA 2P27A 1NRXA 4P22A 1MC5A 2EKPA 2HGSA 3MINA 2GB4A 4X8MA 3S7ZA 4KNYA 1DGQA 3VBEA 4XX0B 1C81A 3IQEA 3D7RA 1Z68A 2A5FA 2D1RA 3ODPA 4PGHA 5HE8A 4D99A 3KSAC 3ZBUA 2CXXA 2W4QA 2P9GA 1TIPA 1U8ZA 2JHCA 4MW6A 3NG1A 1EX1A 5ALSA 4UHFA 2LR0A 3EMKA 4IINA 3TW8A 2OV8A 3G7NA 5IJXA 4X62B 3SFZA 5KQSA 5F9FA 2DFKB 1R0SA 5COAA 4NU8X 3WZLA 5A9RA 1SU6A 1YB5A 5J63A 1FMJA 3K0CC 1NMYA 4MB2A 1K6XA 1R6TA 2W83A 1EP2B 3WQBA 1GTG1 5A3SA 1JWAB 4S0XA 4ZZ3A 3D8HA 2CLLB 3PGLA 1QHFA 2EF1A 4YT4A 1JHQA 2HA3A 1M1YA 1BN7A 3BMXA 4KQFA 1FDIA 2BL4A 1FS5A 2C2BA 4N8EA 4UNNA 3K2QA 4CNQA 1BRMA 3TQTA 3ZVLA 1V1RB 3PVSA 2HRRA 3LO8A 5DGDA 2PO5A 3KX2A 4PPQA 1LUAA 3H8VA 2BW0A 4DN6A 3NTLA 1H2XA 1P5JA 4V2UA 4FGJA 3K5HA 3LUKA 2OM6A 4CM9A 4Q1CA 3Q11A 3UEOA 3ZWWA 4BVEA 3G2KA 1CPYA 3ADPA 3MT7A 4KVFA 1EFPB 2VJOA 5CX1B 5AUNB 1GVHA 3EBLA 4NENA 3DDSA 3E58A 1WL8A 4ZZIA 3UKOA 1NBMA 1NVFA 3LWNA 5FL3A 4ZVKA 3H5NA 4A0SA 3B82A 3RSHA 1O5OA 3OTIA 4YALA 4ECAA 5AKZA 1VGQA 3NWBA 5L7YA 2RHJA 3LBFA 1E6UA 1W30A 2B1RA 3F3KA 1II0A 2DBRA 3IIEA 3NDJA 3U3OA 5L51A 3IEXA 4ZVUA 4HUJA 4Q93A 1FFBA 4LYYA 1QTNA 4U1RA 3HY4A 2AW5A 3ZE2B 3BKWA 2GO7A 5KOYA 3SG0A 1VPVA 3WLEA 4H31A 3MCTA 1P5RA 4FYIA 2AEJA 1NXOA 1Q3TA 4B6QA 2XJ9A 4AIIA 3AYZB 3G9TA 3W5UA 1RHUA 2HA4A 2FF7A 2WFLA 3P26A 2NVOA 4G9GA 4EA6A 2XMGA 1L4MA 1W34A 4LXQA 1Z5GA 2FPRA 3KKQA 4KXFB 1H2RS 2HC9A 3SAJA 1AMUA 4E13A 4DEYA 2B4QA 2Z9DA 2LRHA 2W2QA 2VCHA 4WN9B 4CMEA 3QI2A 3VPHA 1NBEA 4DGSA 5IJWA 3KKLA 1ZH6A 3WMGA 3ILXA 2JAPA 3HBAA 4YUYA 5EHXA 2E89A 2JBHA 4D3XA 1R5JA 2V45A 4IFIA 4W99A 1JFFB 3QWHA 4BMPB 3BB3A 5HVNA 4Z1OA 3DMFA 3JR7A 5HGXA 3WLOA 2V5UA 3HU3A 1UZAA 3EXIA 3IE2A 5C35A 4R41A 2B2XA 3W4KA 1ETHA 1CUDA 1TCBA 5CDGA 4MYCA 1M8GA 4W5TA 4EKNB 3X2FA 1ILEA 3WOVA 1SZJG 3QVTA 2Z3ZA 2QR3A 3C85A 3QE3A 1NVAA 3LI2A 4IJKA 4YGYA 3WZMA 3D3JA 3E35A 1SVSA 4XYGA 4AC9A 1PFKA 1XFAA 4TTAA 1F7UA 3ZNNA 3CEHA 3OOEA 1NY6A 2D6FA 1MF7A 4PRZA 2DFTA 4IGIA 2AR0A 5I6DA 4DF3A 3IVAA 2EL7A 1OKKD 3LWBA 1UDBA 3AR8A 2QZSA 1XALA 2Z09A 4KMSA 4D26A 4F12A 3MMSA 3A32A 5EERA 4FFNA 4ZYTA 1Q7RA 4LNUA 4DILA 3RVBA 4FWIB 3HYSA 4KXXA 4JQSA 5K3AA 1LBTA 5JCOA 1XMPA 3RRBA 3OT1B 1ZWKA 3RS2A 3CNLA 4UXJA 3WO1A 1R6BX 3QV1A 5HRCA 4BO6A 1SOAA 4KK3A 1CUGA 3ROTA 3SFTA 3TIXB 3QUSA 5CVCA 1XQYA 4IIDA 1TYCA 2JH3A 3FBWA 2C3YA 3T41A 1PJAA 5K5EA 3UXHA 2C5BA 3EHEA 9LDTA 2PKQP 4FEYA 2GF0A 1CE8B 4V0ME 4XW2A 4YDRA 3HNPA 1OAAA 4QC2A 5IX8A 4FOTA 4H1WA 2OFXA 4KFTA 3HDYA 4L8YA 1KRHA 1RXIA 3IP7A 3NCTA 3L5KA 1JR2A 3OZDA 5B37A 3GK3A 3QNWA 4FMPA 4BWVA 4G1UC 4PYKA 3AEKA 3PQ6A 3S2SA 1JB1A 1Q7BA 1M1ZA 3I30X 1DQYA 4Q4HA 3OM0A 3VUEA 2QTGA 1QHSA 2QNBA 4M87A 4JI4B 1KOGA 3DHEA 4YAUA 4N5IX 3VO8A 5JD5A 5EP1A 1YJ8A 3O8DA 1BE0A 1SURA 3BBLA 3CLHA 5BWCA 1P0CA 4GD3Q 1XBTA 4FLMA 1B3BA 2N1MA 4ZI7F 4TQUS 2HV8A 2WFZA 3DBLA 5T4HA 2UXDB 4OHVA 1DUSA 2VSNA 4MW1A 4CDRA 5JNRA 4AD8A 2AUNA 2C2OA 2P35A 1RRPA 1KO1A 2QD2A 5EWLA 4A03A 1PFGA 1Q91A 5DHUA 2Q2QA 5BSHA 1YK0A 2K5UA 5BWLA 5AW4A 3HB9A 4H7IA 2GAAA 1K8ZB 3N0WA 2G72A 3OLYA 3ZVRA 1VFPA 2R4QA 1F2TB 3C4QA 3OFKA 4R05A 4A8JA 2AOVA 2PBFA 2WU4A 3AC0A 4GRIA 4NTZA 4KX5A 1LY1A 4B09A 3KELA 2ZATA 1KKUA 4JGGA 4O4JB 1TZJA 3OU2A 2OHOA 3JQGA 4NWIA 4AWAA 4ZKDA 3LPDA 2LTAA 2D2VA 2WAAA 3H1FA 3MUFA 3DE7X 4OHPA 1P6UA 4YJ2F 4AS2A 4ZOLA 1HQDA 4ROSA 2Y0PA 4EM6A 1LPNA 1RXVA 2W0MA 1R15A 3HR4A 1YONA 1E9SA 1US8B 1Y63A 2QTRA 3F0TA 2IUSA 3JARB 4TV8A 4B73A 3TTYA 1U6IA 5I7VA 4NZ9A 4MWCA 4TTPA 1NR1A 4WXRA 3RC7A 1J7JA 4AS3A 1KORA 1TUEA 1RYFA 4O4LB 2A3RA 2VRCD 3C1TA 2WJVA 3D6VA 3LIIA 5JXGA 4TRNA 2PRSA 3RSCA 2PR2A 4ZC8A 3PTAA 1GV1A 4P33A 2D00A 1XTKA 3TYXA 3JQBC 4Z0TA 4JXJA 3C3AA 4Y2SA 2RAUA 4EDFA 1C4XA 3IERA 4LPSA 4D9NA 2GEBA 1ML3A 1YXMA 5HUJA 4MJLA 1G7RA 4LMRA 3S99A 4G36A 3EH1A 3KTOA 4XM2A 1I2AA 5BQ3A 1E2MA 1BOFA 5LQDA 3E22A 5FX2A 1X1BA 1IRIA 3L3BA 4AJEA 1UDRA 2DQ4A 3LUFA 4LQDA 3F6CA 2HTFA 5ENDA 4IZ6A 3NAGA 4MPRA 2X6RA 3WGGA 2YWDA 4EPXA 4DDTA 3WWZA 4IDEA 4Q9HA 2F7SA 1E3LA 4YUXA 2XTZA 4JOBA 4YRIA 4TRJA 2JH9A 4BX8A 2NU6B 1QX4A 2PFSA 1MAHA 4N9WA 4YHBA 5FA5A 2GR9A 5D86A 2J7KA 5C0OE 1I14A 3Q6IA 1KOFA 4L4UA 2AR9A 1EWYA 2P90A 3ESRA 2FG6C 1OKKA 1BRTA 2RBKA 4CFZA 3V34A 4K46A 3ZYZA 3UWPA 2G8NA 1E3TA 4V38A 3CPJB 5SYNA 3JQEA 3WKBA 4Y30A 3A4NA 3SJAA 4DGQA 1G5QA 2FG5A 1VIMA 1VMAA 1BU5A 2EXXA 1OW3B 4C87A 2ZXEA 3LTNC 1DQPA 3CGWA 2BP7B 6REQB 1T5SA 3EQ8A 1JJ7A 3EPRA 1EDZA 1F0NA 4JC0A 1QU3A 1DC3A 4JUAA 1DRUA 4HLUA 4XCQA 3RRXA 3ZW8A 5EIXA 1YRYE 2YQ4A 1JXOA 4MX8A 1G98A 4MWEA 2O5EA 1BCSA 2X40A 3PGXA 3L8ZA 3G89A 5I5EA 2WTXA 3QVLA 3UC5A 2QORA 3VZQA 2YN0A 4IJ6A 1P4GA 2RAPA 1JUDA 4NYIR 5IKPA 2H2FA 2ZXFA 3L0ZA 2H9IA 3UB2A 5J1SB 4NARA 4QM6A 2EP7A 5CDSA 2WF8A 4RZXA 5DW0A 3C1AA 2B4YA 2X2OA 3FTFA 3PFCA 4ZCIA 3M6IA 3OA2A 2IU4A 1DEHA 3GAFA 3R3VA 1AC5A 1YACA 3PFNA 1UADA 3ZLVA 1EAYA 1P4JA 4M36A 3U0VA 3UJ7A 5E2AA 1GQFA 3A6JA 1IWBB 3BWVA 1QMGA 1BE8A 5CT4A 3E7WA 3CT4A 4EFKA 3D3WB 2A84A 2PMDA 4KR7A 2BSAA 1FQJA 1GPLA 1Y4ZA 3JXEA 3KZKA 1FP4A 3MXTA 5EYPB 5EJ4A 1B6SA 2DSNA 2Q41A 3TZBA 4CM1A 1D9ZA 2WUDA 2QTBA 3KDSE 4ND7A 4DLNA 4LRTB 3NETA 3NRBA 1USIA 1RYHA 5DM4A 2X3YA 4K2HA 3PQ3A 5FWNA 2FOLA 3NC4A 1Y8QB 1IHPA 1R4NA 3UB4A 1IM8A 1VCIA 3QRWA 5K6AC 1QJCA 3LG2A 4DDKA 1ZH2A 1HDEA 1NF2A 2XITA 1J8FA 4KL8S 3GUUA 4MS4B 4AY2A 1EESA 3IRVA 4IV0A 2NU8A 2Q0QA 2C7QA 4FGSA 1ZG3A 3W8EA 2NG1A 2NXWA 2OHIA 1EFUA 4WBSA 1H9AA 4FMDF 2QGZA 4F4DA 2CYAA 3JAKA 4FFVA 4LRXA 4RL4A 5JZOA 3H9BA 3VR3D 1OXUA 3AHCA 3D6MA 3E27A 5JEEA 2WA1A 5JY1A 4CKEB 2HDOA 2WI8A 4G56A 4POOA 1VSVA 2VRCA 3D43A 2JIRA 3IAS6 4DA9A 1GCIA 1L4KA 2OHJA 5HMLA 2BE9A 1SOVA 4TMTA 5JUWA 1N8TA 3P45A 5FEUA 5T4BA 1KQGA 1V5FA 3H1AA 2QPLA 1I1QB 2VZ8A 3U4AA 4CCSA 5L40A 2B4KA 4UFNA 3RTBA 3BQMB 1DLJA 3BXGA 2WG2A 3FTPA 3RC3A 1ZN9A 1H93A 1R1DA 2DR0A 1Y33E 3A06A 1K2WA 2C7VA 3NHMA 1C3LA 1VPLA 2IIBA 2VZLA 1EFLA 2AE2A 2FYTA 3L01A 1DKPA 2B37A 3AUTA 5CUQA 1Y5RA 3IDQA 1MOZA 1EG7A 3A1EA 4E5MA 3OOSA 1ZW6A 3LHDA 1SCUA 2D3WA 2EF0A 3LHIA 4FDLA 4RTMA 3PENA 4MLPA 1P1HA 3W8RA 2XLBA 5DHAA 4FMCF 1EX7A 4K3UA 4M1SA 4HT3B 1LA2A 4DIDA 2XRFA 3MCZA 1Y8ZA 2OBNA 4JU8A 2WHPB 2OSVA 4RKRA 3KO8A 4RAQA 3RUIA 1T5TA 4YN3A 3ZDBA 3URMA 2B98A 2YFKA 3LA8A 1T5DX 4TXNA 4EYKA 3RYHA 1E0KA 3M49A 3AFNA 1N5LA 3ZCTA 1EVKA 4I55A 3LQRA 3HZOA 3B51X 1M66A 3F5DA 5ALYA 1U3DA 3NRJA 3ZBPA 3KVRA 4H60A 4QUEA 3I3SR 1GZUA 4YJFB 2KI5A 3JQPA 1QX3A 3QBVA 1Q84A 5F2EA 5A3VA 3TDKA 4OKNA 5I9NA 2EBFX 3ZU6A 5AW8A 1ONBA 3P2JA 4B3SB 1A8PA 3QVMA 3Q8WA 3AT1A 3MXOA 2VATA 1EA5A 3B89A 3USES 1ZCZA 1H6AA 4G8DA 3ZGLA 4B2PA 3NBAA 5A4AA 2R1VA 2VEOA 2G08A 2Q28A 4EEXA 1XTPA 2VSFA 4LUCA 1GPMA 1WHTB 1XB2A 2HNAA 1RJWA 3BMQA 3QA9A 5A5DA 2CY0A 3RK1A 2AQKA 5E3JA 4HAIA 1I9CA 4KQIA 1S4MA 4DFDA 3T5PA 1OWLA 3DYIA 2C03A 2O3JA 2YVAA 1V37A 4U6QA 5IHPA 1CQIA 1MH1A 3HV2A 2VO1A 1WF6A 3L4SO 4HNTA 1YB7A 3R3XA 2R6FA 2R4TA 3IQXA 4LSMA 4RADA 2J9YB 4CMJA 5ABPA 2VAVA 1T6YA 5TVKA 1S2DA 4X45A 4B4DA 2O0LA 3QELB 4M86A 3MMXA 4DBLC 1OX6A 3P4XA 4IZOA 1E5QA 5GIOE 2BV3A 3LUGA 5EJFA 4CR7A 3B8HA 5ALJA 2YJGA 2XIJA 2BBWA 4E3ZA 1OC4A 2Q45A 2GO1A 1Q14A 4P0PB 1ENPA 1TAGA 3R4VA 4JJ7A 1N2ZA 1L7EA 1P60A 4YRTA 2Q7OE 1D6JA 1WLYA 3NOXA 2D7CA 2OQIA 2ZI6A 3GG2A 2R6HA 1J25A 2AN5A 3Q2KA 4FX2A 4HFMA 4O59O 3GLQA 4WFIA 5FUWA 4B85A 3WSVA 1ZX1A 2DY1A 3D02A 4YXFA 1FLAA 2JG3A 3TNYA 1MAWA 1WSAA 3IMFA 3TAUA 5SICE 2LXNA 4KIFA 3FRHA 1KGSA 2ONJA 3GUZA 3HB4X 5IVPA 2Q0XA 2ZWVA 4N82A 3V1UA 2AFHA 2ZQ5A 3FWYA 4YMGA 1DINA 5CFNA 1IM5A 1L5RA 3MMPA 3DA8A 4G0ZA 5DNCA 3BA1A 2JLVA 3VZCA 1Q1EA 3IKLA 2AOXA 5LZ8A 4R2HA 9ABPA 1VXOA 4CR6A 1L4FA 4QPJC 4IDFA 4HDOB 5FBQB 1SG9A 2B35A 4CBVA 4D9GA 1FDSA 4C7OB 1B2RA 2CSUA 2XY4A 1Z0SA 2YHBA 4Q34A 4UHJA 3VR3A 3ON5A 4WLEA 5B1HA 3PPYA 2BFCB 2AZXA 3FNEA 4JEMA 2I3GA 2EVWX 5G1NA 1PF7E 1VE6A 5DBFA 4PS0A 3T1VA 2H4FA 4S24A 1S7CA 2V7QA 4IO1A 4ZQGA 1L5VA 3TLJA 1BXRA 1P1KA 2PWBA 3CCCA 1Z35A 3NGMA 1KMHB 2ASEA 4LCEA 2BKXA 2RHTA 3WYEA 2VJYA 4K9RA 3REQA 3M83A 3OD5A 1XU9A 1YD7A 2VYNA 4KSYA 1LXCA 4X1IB 3DAOA 3JWPA 3T9DA 1G55A 4FFBA 4HH0A 4GI2A 4XIIA 4DR3B 4MDEA 4ZYWA 3RYIA 2YOGA 1VG1A 3THYA 4XR4A 4L78A 2NUAA 5KYYB 4HS4A 2YL2A 2AFIB 3CUTA 3BH6A 3HA5A 3U1VA 4GIBA 2XMRA 3PS9A 3DBRA 1P31A 2BKAA 1DQRA 2PSEA 1U3CA 1XF9A 1DDGA 4CTMA 1UL1X 1T1SA 3HVKA 1HPLA 1IIBA 1PSZA 2VNJA 1RHQA 2ZIEA 4BLWA 4TYYA 2HLPA 4WTOA 4I46A 4TTRA 1G7TA 3JALA 4IDAA 1KZ7B 1XTVA 4KKVA 4LE0A 3UWDA 1J4AA 4AP5A 3CRVA 1NLMA 3O8CA 4N48A 1CF4A 3DYBA 2ZYSA 3RTDA 1G9XA 3MWFA 4RXTA 2RGRA 4P3YA 4X6YA 2C5HA 4DLYA 3ZZNA 4P93A 5AW7A 4MEJA 3FCCA 4RGVA 1DRJA 4OBEA 5A05A 5HHTA 2VBCA 3LCMA 3TUZC 2PVSA 1KKMA 3M33A 4FR5A 4JNCA 3HCCA 1FMLA 1QO0D 4KNWA 1QHHA 3P0JA 6LDHA 1QV7A 1MVNA 1CJBA 3GFGA 1AKRA 2UUBB 3N58A 4JL5A 1CFJA 1ZW1A 2FFBA 4X41A 3EGXA 5CVUA 4IQGA 4ETMA 2WHRA 3K4QA 4WZAB 5KTTA 3S1AA 4PSCA 4OI0A 2O8BA 4RIEA 1ZHOA 1E7RA 1KY5A 2HSEA 3EYWA 1QANA 4KGDA 3IT1A 3QEMA 2ST1A 1NF3A 2A1UA 2AJLI 2OEPA 3CEPB 4P0TA 3HDQA 4WASA 5EWMB 1TQ4A 2OMEA 3N8NA 4B80A 5ALTA 1KP3A 4FCTA 3C7AA 4YT2A 3O1HB 5E7QA 2UZ1A 621PA 1KIAA 3UTCA 5IUKC 1D07A 4DSAA 4HX9A 1S02A 3LCUA 1UK7A 2PL1A 1UFVA 1GTSA 5C5CA 2UYHA 1PT8A 3A1UA 4YDSA 4D5EA 3AHHA 1CYEA 5ITSA 3CE9A 4FZJA 4BGDA 3HEMA 2OAQ1 4HQ0A 4J2TA 1JG6A 1OBCA 1J90A 5AKJA 2QM8A 4BLOA 3VISA 2JIPA 1NL3A 1TYZA 1NMXA 3B13B 2O2ZA 3FW1A 4JOSA 1DKQA 1L5FA 1RQ7A 4P7BA 5KS2A 3WMFA 2H4HA 1NXVA 1KJQA 3CKLA 3F6PA 4OL9A 2B1IA 4PVDA 2DQSA 1QP7A 1VL5A 3QVGA 2VLBA 1XP8A 2Q5CA 2UKDA 4HL6A 1IU9A 1C7IA 2FSGA 4JJ6A 4LZNA 1GKKA 4RPJA 5K45A 1QE5A 2WRZA 1C4OA 4EPRA 3EPHA 5ALPA 4TKVB 3KUXA 2A2ZA 5T6BA 1M2OA 2ASVA 4JBLA 4MP8A 5IAOA 1U4NA 1D9XA 3B1XA 1J0BA 3OCVA 2VBFA 2BCGY 4NPAA 1U0LA 1G1AA 1I3MA 1CHNA 4E7PA 4EHJA 1JA1A 3R09A 1R37A 2KE5A 2R8PA 4WFQA 2GFQA 2PYIA 5HCNA 3S44A 3L6CA 4R2WA 5JAMA 5JO0A 4MPPA 4P5PA 3J81A 3CO5A 4NG4A 3E1KA 1YZ3A 1O95A 4QLAA 1YQQA 4P4NA 1JG2A 2H1FA 3KSMA 1VL6A 2XX3A 2CJYA 3NXKA 1Q0ZA 3CVOA 4A0RA 1F4VA 2OXCA 1KYIA 5IAAA 5IEJA 1RPAA 3I34X 4PZLA 4MIKA 4KG7A 1NKTA 3T5TA 1ORWA 4GU5A 1MO2A 3TW6A 1A8HA 1AT1A 3OKFA 2Z3WA 4Q12A 4D02A 3Q0EA 1S3SA 3R74A 1GUBA 3H17A 4J49A 3AI2A 3BFVA 2EERA 2P9QA 2Z1MA 3KB2A 1ZR4A 3FGPA 3GFQA 2VAXA 5BN3A 3C15C 4BDTA 3INNA 1PFWA 1CJMA 3K6JA 5ALGA 3DW1X 2QMZA 2O23A 5ESXA 3RS9A 3STUA 3WSTA 4PG8A 4Z4FA 3K7EA 4DCMA 2PNJA 1ZVKA 2XQIA 2P9CA 4QPCA 5AVOA 3T9BA 3SF8B 1OYYA 1P0MA 1R6UA 2OUIA 1ABBA 5FKJA 5IUJC 4PAGA 4RV4A 5KYKA 3GLHE 3B3FA 1LQTA 3L6EA 2BFFA 4GP9A 1ENYA 4ML3A 1WCYA 3BSSA 4GVLA 2GUGA 1L7PA 4JLVA 4WPGA 5DO9A 3GFPA 2RI6A 3TKLA 4TSRA 1XZCA 3HFSA 2XUGA 4X7BA 4A6XA 1HT2E 1N1DA 5DLQC 4D9CA 4G2NA 4KR3A 3AF2A 1UBHS 3NV7A 4UJ5A 4M7RA 2J3MA 2VDQB 2IZ5A 1JDNA 1NULA 1NW4A 3SICE 5JYDA 4TLLB 3GG9A 1GSOA 1M2WA 1Y3IA 2AJ8A 2DHDA 4R1TA 3CRMA 5D7NA 2Y9MB 3WFIA 4BO3A 3FGNA 5FUXA 3WIEA 2IUEA 4BV3A 1Y7IA 3QA3E 4JP2A 1K4KA 3GN1A 4L6IA 5J1TB 4AZSA 5JH7B 2IYZA 2QL7A 5JXIA 2QDKA 2VOEA 1LQUA 3EMVA 3HACA 3P2OA 2ZZNA 1V7ZA 4UQPA 1CD5A 3W5AA 3NC1C 3QU7A 4OP1A 1GV0A 3ZHCA 2JRLA 2X2EA 3ZLTA 5C18A 1M2VB 3GJ8A 1KDVA 3MJTA 5LQNA 4V3BA 2DBZA 2WMNB 3D6TB 2I4RA 5TGTA 1J1ZA 2IOFK 2NO4A 3QEAZ 4J0QA 1G17A 1M5RA 3AJ8A 3BRCA 2GRAA 1SUDA 1O2DA 2B92A 2JJ1D 4XDHA 4PBTA 4E5DA 3QOYA 1X94A 1XZAA 2PT9A 1IPFA 3V1TC 2H2WA 4PSVA 1FTWA 1LNQA 1Z29A 1C7ZA 2OTCA 2VT3A 4MUFA 2GZSA 4UU0A 1O4WA 1U1FA 2OFFA 3T12A 4C08A 5DB4A 4QHYA 5AJZA 4C0JA 4E30A 1V3VA 4WA7A 2EGHA 1ZAKA 2OZVA 4J1SA 1ZWLA 2C1XA 2ECFA 3OIUA 4QASA 3ZKAA 3TOSA 4TKMA 4DG5A 1ZIOA 1J9GA 1H0HA 5EE5B 2IC5A 1V8BA 2WYWA 3GC6A 3LOPA 3AR3A 4DB4A 1PYGA 3PXXA 4W63A 1PQUA 1Z2NX 3SVLA 3HABA 3ENWA 3DEAA 2G70A 4EA8A 4X54A 4Q1VA 1HNXB 5JD4A 3TMAA 1YJ5A 3O9ZA 5A2GA 1OF1A 3OC6A 1OFGA 4F3RA 4C30A 5TGDA 3UJNA 4TYNA 2HO4A 1RHRA 1SQGA 2GFHA 3GPDG 3MMNA 2HLNA 2VJLA 2F3QA 1PWYE 1XHEA 2NXCA 1L7VC 1XXHB 5DI3B 4AX4A 2I3ZA 3PFHA 4DNFA 3A3NA 4PG6A 4E33A 4F7WA 1AF4A 1RW4A 4Z9BA 1KDYA 5AKEA 3V7NA 4GKKB 4AROA 5B58C 1WCIB 3DZDA 3CLTC 3TXYA 3O7WA 4DDVA 5K20A 2R5WA 2ZRIA 4BKRA 2PDAA 4AUEA 3IJ5A 1O08A 4BZQA 3ZVKA 3NBXX 4RS3A 4LFCB 4XI9A 4II2A 2RAFA 3C3BA 1HBJA 3B3QA 2Z5FA 2XWPA 2VR1A 1P7YA 2FH5B 2IGTA 1NVEA 1GQSA 4ZO7A 3VR2D 3ZE9A 4E5YA 3GMDA 4IDCA 1P1JA 3U1TA 4G0VA 3JR3A 3SNKA 1YZFA 2TMYA 3VHXA 2HTEA 3UHFA 4XJVA 1K7SN 1UMBB 5JCXA 2BI8A 5K3DA 2EWVA 4U3JA 3ZZ1A 5A9SA 1M0SA 3BZWA 1Z5NA 3IOEA 4HAUA 3S4YA 1X7ZA 4EARA 4DW8A 2M98A 1V6CA 4DLRA 5KU7A 1YNOA 1OI7A 4HXGA 4JLDA 2GHRA 3GLRA 1SD1A 1DWUA 3C7DB 3LKZA 3MGBA 3OD1A 4I4TB 5EJMA 3K9QO 3Q2OA 4L3VA 3VV2A 4D79A 5EZQA 2CL0X 2LNDA 2OYSA 1JFRA 1GLGA 1UBUS 5LCXA 3L4BC 5LBUA 2OYCA 3FWKA 2NU9A 3ZWMA 2WTUA 2JBAB 3ORSA 3CF2A 3B2EA 3ESCA 3G5AA 3HCWA 2P4EA 3JYNA 4IVPA 3D3KA 2PZAA 2X4LA 3GRUA 4JLWA 5CEEA 5GY7A 2Z9CA 3DL4A 4OQDA 3FOEC 3H18A 3TE6A 5BMVF 3TL6A 2UXCB 4XIYA 3FOZA 1J1IA 1PJTA 1KWKA 3TXXA 5K4HA 2AZ4A 5MDHA 4YCAA 3BIWA 1ONNA 4KACA 4P08A 2QQ5A 3PE6A 5DOZA 3U9LA 2Q9CA 2OV6A 2I9PA 1Z3IX 3F7MA 3GMSA 1NP7A 1YBHA 1MB0A 3LC0A 2QY6A 3OTQA 4GWKA 4MVJF 3SC6A 1XZMA 4C14A 4YJ3B 1TAHA 2DH5A 1WHSB 1ID1A 3MILA 4UC0A 5K3FB 1II8A 2Y8EA 2VZ9A 5HBRA 3SQWA 1C1XB 2CDAA 4ES6A 2CMDA 4EW1A 3S29A 4X0EA 2R5NA 1S2MA 3BXHA 3HUTA 1EAMA 4B6FA 2BRUC 2A0KA 4U7TB 1DC7A 1GZ7A 4WNAA 1S2LA 4G4GA 4M9CA 1ZVVA 1N5MA 3A4MA 3AHDA 4C2AA 4EPVA 2I8LA 4K05A 4O2BF 4P32A 5C8ZA 1J2TA 2FQWA 3TBFA 1KEEB 1F8GA 2VWPA 5JPCA 2Y68A 1IVYA 2IPAB 2X1MA 5L3QA 4E5UA 3Q8KA 1DIGA 1W4CA 1S2IA 1R0YA 3D6JA 1LDEA 3HUDA 2XXAA 2XA2A 5G40A 3LZDA 2CE2X 2GMWA 1V6AA 2GBFA 3EC1A 3GGJA 5B1YA 2YZKA 5BUSA 3UQYS 3R6LA 3OJEA 1ZJ6A 4R2JA 5IBRA 3SQMA 1AU9A 3WRYA 1R6AA 4J16A 1OTXA 4PWZA 1RXSA 2WHXA 2Z8ZA 3TL2A 2Q0HA 3IT2A 3VU3A 3KJHA 1DP4A 1NUAA 5CG2A 3BGVA 3H2SA 1EFDN 2G1AA 1N2CE 2ILVA 4XLZA 4IYRA 1I1OA 2E6UX 1F48A 2JJ1A 1VKOA 3A26A 3H84A 4E3WA 3KKOA 1QYDA 4JSTA 4WLNA 1LPPA 2PD6A 3OY2A 3G02A 3EXAA 4UBKA 1YF3A 1K7EB 3U1BA 3B1JA 4QD3A 2B6HA 4L8FA 1Q15A 3QFFA 1FFDA 4O4IB 3RI3A 3VZBA 3I5XA 2C9OA 3GN2A 1K4MA 1K2VN 4X3PA 4URHA 4M46A 4EVQA 2PIDA 1LF5A 2AZTA 1KP2A 2NMVA 5BW8A 2V5AA 4I81A 4BRWA 3C5EA 3RD5A 3E7DA 4XTCS 2ZRLA 2JD0A 1V1MB 4ZFNA 1TFUA 1DG9A 1NUPA 3PQ4A 1ULHA 1RWVA 1YK1A 3AY0A 4L9AA 5CAEB 3PFGA 4MS3A 4DJEC 5IABA 3IVGA 3KG2A 4YCNA 1U1DA 1BXGB 1RIIA 4IFBA 3S5UA 1CLUA 3BFXA 3USZA 4I50A 4ZK6A 4FU0A 2R5FA 1TF2A 2VNKA 3ELBA 4M2LA 3WGTA 5BQFA 5CXUA 2P0YA 4I8DA 4MW2A 2W8ZA 1RI4A 3RTEA 4DCGA 1CZUA 3O2SB 4LWQA 5G1OA 3U7IA 1PR9A 4BNZA 2P78A 1YCHA 1G3MA 5DI9A 3HUEA 5IDXA 3RVOA 3IS3A 1D6SA 1JEQB 3KAJA 4IOMA 2ERCA 2HN9A 4B5KA 3GT0A 5AHOA 5IJ0A 1KY3A 4XFDA 1DPGA 3AJRA 3VR2A 5T64A 1I3OA 3IUNA 3IB6A 4HDMB 1RPNA 3H4MA 2CXOA 1GKIA 3RS3A 1UINA 4GMDA 1Z4QA 1ZGHA 4DLUA 2I65A 5KSOA 3HCPA 2ZSHA 1LRLA 1WEKA 1J6UA 1XJQA 1XF1A 4JLJA 3ZE6A 2JGAA 5DBEX 1L7OA 1FX0A 4NU0A 4ZJZA 2GD6A 1WETA 3CWZA 3NZEA 2IYLD 1XCMA 2O1EA 1IBCA 3DKIA 1AQLA 3O1LA 3LLUA 4D97A 2P75A 3L7DA 3MRTA 4LV6A 1U7PA 5E0OA 1QF6A 1YIAA 2R751 4KN6A 2VSYA 4G1CA 1LF0A 2OBMA 5DX0A 4ZIRA 5L8VA 3UJCA 4ZAXA 3DEFA 4IEEA 1KQ3A 3CRZA 3PRYA 4RA9B 4BNYA 1YASA 1A9ZA 5L9AA 3GVCA 1DIHA 1LDBA 4GE3A 5HJ5A 3THOA 4AP9A 1RJDA 1AKYA 2Z0MA 3PQCA 4HEA6 5AJWA 4K9LA 3W90A 5HFNA 2BFBB 3AKCA 3ZJUA 4J0FA 5H82A 3PDHA 5FA6A 4NJMA 1E0AA 1UBMS 3ZIDA 4B79A 4S3MA 2WVHA 1YFJA 4BNXA 4QHSA 5EHNA 3Q12A 3LBYA 2Q2NA 1YKFA 2QZ9A 3EDMA 4QVIA 3R40A 2ZSIA 4FGWA 3L7CA 1I0IA 2O05A 1GGVA 3MS4A 3MJ4A 4FE3A 4Q9DA 3W3ZB 1QPGA 2QPTA 1V96A 3QKSB 1KEPA 3OICA 3ORRA 4HDRB 5ARDA 3ZLJA 4TKUA 1KZHA 4KIGA 5EUQB 3CVXA 4MV0A 5DISB 3RBZA 3EVCA 4TXMA 4NHEA 5IVHA 1E2EA 5T4FA 3T7JA 2VPTA 2PM8A 5JYCA 1JAXA 4G97A 4OMFG 1P2GA 2ACVA 1E0DA 1Q0LA 1Z7GA 1O9BA 2Q2VA 2QRQA 2VPQA 3IUSA 3OBIA 2O0KA 1UKVY 3O74A 1X8XA 2K2WA 3QE4A 4PGMA 3SX2A 4C2BA 1HQCA 3MTJA 3BM5A 3C3EA 1RC0A 1JDBB 3H86A