4YJKA

Crystal structure of c212s mutant of shewanella oneidensis mr-1 uridine phosphorylase
Total Genus 83
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
83
sequence length
251
structure length
245
Chain Sequence
ADVFHLGLTKAMLDGATLAIVPGDPERVKRIAELMDNATFLASHREYTSYLAYADGKPVVICSTGIGGPSTSIAVEELAQLGVNTFLRVGTTGAIQPHVNVGDVIVTQASVRLDGASLHFAPMEFPAVANFECTTAMVAACRDAGVEPHIGVTASSDTFYPGQERYDTVTGRVTRRFAGSMKEWQDMGVLNYEMESATLFTMCATQGWRAASVAGVIVNRTQQEIPDEAVSAVSIVVAAAKKLLA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Concerted action of two subunits of the functional dimer of Shewanella oneidensis MR-1 uridine phosphorylase derived from a comparison of the C212S mutant and the wild-type enzyme.
pubmed doi rcsb
source organism Shewanella oneidensis (strain mr-1)
molecule tags Transferase
molecule keywords Uridine phosphorylase
total genus 83
structure length 245
sequence length 251
chains with identical sequence B, C, D, E, F
ec nomenclature ec 2.4.2.3: Uridine phosphorylase.
pdb deposition date 2015-03-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yjkA00
4DA7A 1OVGA 4LKRA 4F2PA 1JDTA 1RXYA 3FB1A 1A9PA 3UAWA 5KB3A 3PNSA 2A8YA 3KHSA 4GLFA 3KU4A 1A9TA 5F7ZA 1QE5A 1JE0A 1RYZA 2PGAA 4QASA 5CCEA 3PHBE 5F7XA 2AI3A 5CYFA 4NY1A 1PR6A 1Z5OA 3F8WA 1K27A 1U1DA 2OC9A 3OZBA 3OZCA 1VMKA 4M7WA 4QAQA 3ENZA 4G8JA 1Y1RA 4K6OA 5IU6A 1ZL2A 1PF7E 3OZEA 2ISCA 3D1VA 5F73A 2QPLA 4YO8A 2I4TA 2A0YA 1Y1SA 1CG6A 1LVUA 4TXLA 4NS1A 1A9QA 4QEZA 4R2WA 1U1CA 2HN9A 4BN0A 1Z5PA 4DANA 3BL6A 1I80A 1M73E 3P0EA 3U40A 4IP0A 4OJTA 4DA8A 1NC1A 1SQ6A 4TS3A 2XRFA 3BGSA 1YQQA 2QTTA 4RJ2A 5C80A 1JE1A 5F7OA 1RXCA 1K3FA 1NC3A 3KVRA 4L5YA 1TGYA 4BMYA 4TXHA 3UAVA 3FWPA 1JDUA 5EFOA 3OF3A 5CCDA 1V3QE 4L0MA 4H1TA 3PNPA 2QDKA 3DP9A 3INYA 2OECA 4R31A 4L6IA 1OUMA 4WKNA 3T94A 3OOHA 1ODLA 1JDVA 4TTAA 4FFSA 4TXNA 4DAEA 4BMZA 4DA0A 1B8OA 1PR0A 4PNPA 1JP7A 4D9HA 5EUBA 2AI2A 2A0WA 3LGSA 1A69A 3NM6B 1ECPA 4QFBA 4JWTA 3KUKA 3ONVA 4G41A 1U1EA 1PKEA 2H8GA 3EMVA 4DARA 3E9ZA 3EEIA 5F77A 5CXSA 3O4VA 3DJFA 2B94A 1B8NA 3FAZA 2IQ5A 4GKAA 3KVYA 1ZOSA 5F76A 3LBAA 1PR4A 1U1GA 3NM4A 3FNQA 3NBQA 2A0XA 1OTXA 3O6VA 1TCUA 1NW4A 1Y6QA 4F1WA 4WKBA 1VHJA 1SD1A 1Z38A 2QTGA 1YQUA 1PR2A 1XE3A 1Y1QA 4TYMA 4OGLA 5F78A 4L5CA 2GUWA 4DA6A 1ODJA 2QSUA 4F3KA 1T8RA 5K1ZA 3OZDA 4P54A 4WKOA 1YBFA 3OOEA 5B7GA 3UT6A 4TTJA 1Z39A 2RJ3A 1V2HE 3BSFA 1Y6RA 1JYSA 1JDSA 1A9OA 1FXUA 4DAOA 1ULBA 3GB9A 3OPVA 1OU4A 3E0QA 3K8OE 3DDOA 1OTYA 1RCTE 1V41E 3LA8A 3IEXA 4D8YA 3UAZA 1V48A 2P4SA 1YRYE 1T8WA 1V45E 4L5AA 2AC7A 3C74A 1U1FA 4TS9A 4X24A 4TTIA 4YNBA 4WKCA 1LX7A 4KN5A 3UAYA 4R2XA 1N3IA 3SCZA 1Z33A 5FAKA 3DF9A 3ODGA 3KVVA 4PR3A 4JP5A 3NM5A 5I3CA 4JOSA 1PBNA 4ECEA 1VHWA 1V4NA 1SJ9A 4TXJA 4E1VA 1PR5A 2OC4A 1A9SA 1JDZA 2HRDA 1RSZA 1C3XA 4YMLA 2BSXA 5EPUA 5F7JA 4I2VA 2Q7OE 5CYGA 1ULAA 1PK9A 3FOWA 4BMXA 4D98A 1A9RA 1PK7A 4LDNA 4F3CA 1RR6A 1VFNA 4D8XA 2HSWA 1Y1TA 4MCHA 1Q1GA 2HWUA 4U2KA 5B7PA 3FUCA 5JPCA 4GLJA 2ON6A 1Z36A 3GGSA 4LNHA 4LNAA 1Z34A 1RXSA 1T8SA 3K8QA 3MB8A 1Z37A 4GMHA 4UC0A 3IOMA 1CB0A 1G2OA 4QARA 1RXUA 3P0FA 4OY3A 1Z5NA 1PWYE 4OF4A 5B7QA 1SD2A 4NSNA 1RT9A 3E9RA 4YJKA 1Z35A 2I8AA 3PHCA 3DPSA 5CXQA 4DABA 4EB8A 4F2WA 4D8VA 5B7NA 3EUFA 1T0UA 2AI1A 1ODKA 1PR1A 5DK6A 5IFKA 1TD1A 3UAXA 3TL6A 3EUEA 1OV6A 1TCVA 1TGVA 3MMSA 1WTAA 4M1EA 4OGKA 1LV8A 4WKPA 1JPVA 4MARA 4EARA 1PW7A 3BJEA 1T8YA 4G89A 5ETJA 4TXMA 1RFGE 3QPBA 1YR3A 2OXFA 4QATA 1K9SA 4LZWA 4M3NA 3OCCA 1ODIA 4MCIA 4OEHA
chains in the Genus database with same CATH superfamily
3DNFA 1FMTA 3DDZX 4KHZA 1Y42X 2DBYA 2PMCA 3HO8A 1RC0A 1N5JA 3SX4A 4CCWA 2XCSB 5DT9A 3FB1A 4KAXA 3CB4A 4LQ4A 2GPAA 4NBLA 1P33A 3E15A 3PD0A 1ZH4A 4YRIA 3BD6A 3O9ZA 1YBHA 3WLIA 3JAKA 4BB0A 4CG0A 1I6MA 2FMXA 1FFGA 2PYIA 3UT5A 1Q1EA 1P9WA 3KTDA 3UIEA 1OH7A 4KPYA 2YHUA 2IU4A 4YRKA 1R0BA 1WIWA 3B5IA 4BBAA 2FEOA 5EEGA 2FETA 1N0UA 2GZ3A 4FK8A 2UUBB 4J3JA 5EWMB 4IJWA 1TZBA 1X77A 4Z9XA 1X42A 5ALOA 5J9FA 4EQ6B 5KO2A 1JDNA 1G8HA 1NUHA 3F6BX 2D13A 3DZCA 3H6GA 4ZZ2A 5HUHA 1CYEA 2NU7A 4J0EA 1E2MA 4K28A 4Y2UA 4F12A 5E1MA 4E4RA 4YUXA 1JXOA 1KDRA 3R5KA 4IHJF 4C78A 3WKAA 1AXEA 3A3KA 4HGPA 1NNI1 1R4MB 1TYZA 2O3TA 4QOFA 4RWZA 2A86A 2JKYA 4K9DA 3ENWA 4QBGB 2OCBA 2DZDA 1K2WA 3AY3A 1ZOOA 4QWWA 1QP8A 4G8JA 2O1SA 5EY5B 4K6OA 4TLCA 3ROEA 3AM1A 1PI3A 1DOAA 2D1QA 5IJ0A 2UXBB 3KKNA 2OPBA 2X19A 4QEKA 5C1BA 3A31A 4MI3A 1UZAA 1UT8A 3I4LA 3OKAA 1X1EA 2W37A 4C7XA 2EFGA 1EUDB 1YS1X 4PYRA 4CIWA 5K5EA 4B44A 4MGHA 1WQ4A 2PT9A 1LDEA 3IKVA 2ZVJA 4YP6A 3QLEA 5HFJA 3F97A 1D1SA 4ITVA 1X1AA 1JHAA 2JH8A 5HFNA 3BL8A 2P3LA 4PX9A 4YMVA 4BB9A 2V3CC 2XNSA 4CEHB 2J4CA 3K0BA 4M1KA 2W6ZA 2XYVA 4LXYA 3W2HA 3K2IA 2VT7A 3OFVA 2FP4B 4UASA 4EW3A 4QJIA 4BNDA 3M6UA 1A5BB 1P91A 1Q83A 1MA0A 2H57A 2ZRAA 3QEMB 4JIGA 4DV2B 1YASA 2GZAA 3C3YA 2F1RA 4G0NA 1L7BA 2DWUA 1E2FA 5DBHX 5U4XA 2NUTB 2VBCA 3A6LA 1ULZA 4KOAA 1X7WB 2OHGA 3QU4A 4J1TC 4P4SA 4QO7A 4UTNA 1C0LA 4WZBA 3K70B 3P2JA 3RKUA 4D99A 4L3WA 1Z7YA 1I24A 2ANCA 3CKKA 3DKRA 4D4KA 1U5BA 5KYVA 1DPFA 1RKBA 1XZBA 1CHDA 2Q9AA 3AR3A 3HY4A 1QNFA 4BP3A 4RK6A 4U9IS 4FN4A 1RWNA 2I4RA 5JMTA 5KDOA 3EQ6A 3H99A 3MTDA 2Q3CA 2C8JA 1Y9EA 3DXYA 3P20A 3A6FA 4AZWA 1FRNA 1W9MA 1VRCA 1PYGA 1ZISA 2I03A 2V7TA 2HBYA 4FILA 5EIAA 1RQRA 4QVIA 4JGIA 3KYDA 4TL9A 2PKWA 3NIBA 3PRKE 2OAEA 3PDIB 4Q34A 3JV7A 2DC1A 3ORRA 4F38A 3FPBA 1E58A 2BFEA 1OZ0A 4MWDA 5JCJD 2YJ3A 1AKMA 1TK9A 3BQ9A 4DYHA 3CGWA 4HY3A 1OQAA 1YMVA 5J5VA 2VCHA 5A5VA 1U3WA 3WWCA 4YJ2A 2XA9A 1Y98A 4AQ7A 5F33A 2C42A 1NR7A 1EGMB 3G0IA 1IN8A 2A9RA 1JU9A 3UMFA 1J24A 2FEXA 2WZQA 2DSTA 3C3CA 4L0DA 2OQVA 1JIVA 3C39A 4UCXA 2EKLA 3PPIA 1ETHA 1QTNA 1JDUA 4RKQA 5KNBA 2ID9A 1BW9B 2VAXA 4FCWA 4DV7B 2E4XA 1OKKA 2W11A 1NLYA 2YXDA 2FF5A 3CF2A 2H7YA 5AP9A 1GUZA 3AHGA 3K15A 3WWYA 5EQFA 1RTTA 5A62A 1SUEA 1YOBA 3TI9A 2AN9A 1ZJ5A 3D8RA 4ANFA 3GCDA 1YE8A 4ZOAA 2YHIB 4Z1OA 3LXMA 3FVRA 4IR7A 1QQ5A 4KNYA 1V96A 3DV0B 3ZGVA 4DSAA 5ARBA 3VSAA 3TQHA 5TLSA 1S7CA 1MAAA 3LX4A 4ISBA 3PWSA 2I6TA 4L6IA 5JCZA 1EX9A 1PAUA 4IINA 3COYA 3KT3A 2FYTA 2R8BA 3UWMA 2KW5A 1LTHR 1QC5B 1QDLB 1M2EA 1TUEA 1BRMA 2ZT7A 5FULA 3PFCA 3OJ0A 4UBOA 1QRSA 5K3CA 5HKKD 1ZGZA 3QFSA 3TLKA 1A50B 4YQEA 4B40A 3CE9A 4H6PA 4BP9A 1KZ7B 3P9CA 3EGVA 4X93A 4LXUA 4NENB 2CN1A 4G8CA 3TWOA 1YZFA 3E3OA 1DEAA 2ZWPA 3IVMA 2O07A 3Q11A 4DPLA 2D3WA 1CQWA 5KMGA 2BFWA 5FI3A 1F0NA 5IUJC 1A1VA 2UUAB 3UF0A 4CETA 1J0CA 3GC6A 2NZ2A 3VNBA 2PL5A 2WKQA 3D5QA 3ETHA 2GJKA 3IR5A 1T4MA 3SC2B 5FFFA 4F5YA 3FJ1A 2QR2A 2W2OA 2K5UA 3D8UA 3MCUA 1QO7A 3JARA 5DYYA 3NGMA 1LLFA 3WLHA 1THGA 1EHIA 4KLNA 3ZK7A 3WRXC 1JG3A 2QJOA 5KYUA 3VR1A 4DLRA 4PV7A 4ENUA 3ND7A 5KHLB 3E9ZA 4AQDA 5I7AA 4HN4B 3G5MA 2OHIA 4RCVA 2WHPA 1KH2A 2AFHB 3KQVA 5BW4A 1NF8A 2IW1A 4DNPA 4NWIA 2PYDA 1QWOA 1U7UA 1HZZC 1ZDMA 2RCNA 3OUUA 3PFIA 1NVVR 1ZOSA 2D59A 3U3DA 4CDGA 2V1UA 3NW9A 5DULA 2A9PA 1AKUA 3WHLA 3P9SA 2X0FA 2C2YA 2XOXA 1KETA 4RY8A 2EF0A 5DH9A 1HORA 2VAVA 3LUKA 3NOOA 4OHVA 5B3JC 3RIHA 4LV6A 4CXMA 2FCAA 2GVDC 1GN8A 1A3CA 2Y3IA 4A8HA 1BOFA 2YX1A 4WFKA 1IXRC 1MB3A 3A05A 4GPAA 4LBWA 3AEYA 5BQ5A 1IJKA 3A1WA 2PGNA 3L4BC 3HA5A 4LJSA 4YQZA 5F3WB 1YJXA 5REQA 1PWZA 2DHEA 2Y6VA 3CSUA 2IDKA 1KXJA 4EHNA 4YUYA 4UXHA 1G3UA 2VTBB 1PFVA 3VX3A 2VPWA 1YQUA 2OWDA 1VJ1A 4M21A 3E8SA 2WQ6A 1JJVA 2WSBA 2X8BA 5IAAA 5HXAA 1XALA 3UHPA 2BGLA 2PK3A 2WWRA 2Z2XA 3KDAA 1JEYB 1JH8A 4XX1A 4QM7A 4F92B 4JX9A 3IELA 5K3FA 5BW5A 3M81A 2FW9A 3PFHA 4L5CA 5SY6A 5ITVA 4ZDIA 1TVCA 4DA6A 1YOVB 1Q91A 5HYVA 2WUEA 2RGEA 4O5OA 1XMQB 4LJKA 3FMPB 4MQMA 2EWMA 1N1MA 1DQRA 2PZJA 2ZIUB 3GT4A 5DP1A 3CVYA 5LYJB 3NTLA 3EC1A 3ICPA 8GPBA 2WU4A 2OBBA 1L4KA 4M0KA 1C30A 3DKKA 1Z4OA 1N34B 3H9JA 4C7BA 5TMBA 3OQOA 4X60A 3OEEA 3G7UA 1REQA 3FNGA 3K0EA 3QBDA 1NU6A 5C31A 1XTSA 4UNIA 4NCHA 1E2EA 4WSOA 3KSAC 3MIIA 1FFYA 2QJFA 3AR8A 3IEKA 3FCOA 4QHSA 5B7GA 2JAOA 4MQFA 1TAQA 2GN9A 1OWNA 4JI3B 1V2HE 5TF0A 4WAUA 2DTEA 2X7HA 4BGIA 4XR9A 5A7FA 2IEGA 3F7MA 3WNVA 2C8KA 5HBRA 1JYSA 1MAWA 2JF0A 2Q50A 1T3ZA 3OQPA 1A7AA 4KPFC 5LZ7A 1CZKA 1EVZA 3TDNA 2A7XA 3VHXB 3AVQA 2BT4A 3H1FA 4G1VA 1CHNA 1J09A 2C0PA 1G8YA 2OCXA 1RD4A 4HDKB 3B20A 4J0DA 4NABA 3SVZA 2ATCA 2BTEA 1H1TA 4Q9NA 3KETA 2I3DA 1KIFA 4WLUA 3ULKA 3SJCA 1SB8A 3N8HA 5AW4A 5K45A 5C81A 1M6WA 3WWDA 2A88A 5JQGB 1JKJA 3CU5A 4J0CA 3VC2A 3RBAA 5DRYA 5DEIA 1PJLA 1HM5A 1T8WA 2RGNA 3L0SA 5E6RB 1CUAA 2P8SA 3FRJA 4O02B 3T7DA 3UC9A 3UJPA 3GFSA 3UMVA 4CUJA 4ZIRA 1VCHA 3I01M 4IQ8A 1F4VA 3TLEA 3FSRA 1LU9A 4IQ0A 4OIMA 4A91A 3FVWA 3DAHA 3L0ZA 2GF2A 3PDUA 5C37A 3PDIA 3ON5A 3K8ZA 2JIZD 4INAA 2QUBA 4LECA 4YAEA 3F73A 2AW5A 2PRZA 3P9PA 3H2KA 3LCCA 3WK8A 4JROA 3UAYA 4Z0TA 3O9MA 2C3PA 3JWEA 4G85A 5JNUA 4U7JA 2BH2A 3SCZA 3DBRA 1N5LA 1Z5WA 2W6MA 3IT3A 4AULA 4BQPA 1HDOA 1F20A 2CWDA 5CA1A 3ZDAA 4KRFA 3KQUA 4FLFA 4C07A 2PKCA 4E30A 1RLIA 1Z6XA 4HWTA 3HKCA 1SUDA 5L6LB 1YACA 3L4KA 2RGXA 4D9NA 1UIRA 3JQDA 4MVJI 2NZWA 3SSAA 1KI9A 1CRLA 2CXOA 3GVPA 4P4SB 4YYZA 4ND5A 1RQLA 1E64A 4DMUB 3MWEA 4JDPA 4OD0A 3EB9A 3PYXA 1TM7E 3OTOB 4V39A 1EXDA 2PBZA 3QVJA 3CUKA 1X1BA 2D2FA 2ZYIA 4K9RA 5KI6A 2HCJB 3URKA 5C8XA 4TZ0A 3JQ9A 2OMEA 2Q28A 3S1LA 1QP0A 3ZU4A 1FXWF 1OU0A 4YRZA 1G7CA 4PBTA 3KTOA 2BN4A 1GN9A 1U3UA 5BWBA 1FMCA 1ISFA 1GG9A 2OZLB 4IGKA 3LK7A 2QTHA 4N3CA 4GOOD 1C3XA 3H65A 3WX0A 3KOUA 1IYZA 1E2UA 2LIVA 3HCAA 1II9A 4Y1EA 2CFSA 3I58A 4GP9A 5DASA 4Z0PA 3VJLA 4BWVA 4IYRA 4RPLA 4QUGA 2ZTVA 1DMRA 2AR0A 1VKHA 2QQGA 2GM5A 2Z5GA 3X3HA 1Z6YA 3KC2A 4RW0A 1G17A 2H63A 1HLPA 4FSDA 4I66A 2B7LA 3VYVA 5DTJA 3E9NA 3WGJA 1D4OA 4C87A 1N33B 4PANA 1M67A 1QBGA 4X8OA 4ABYA 2ATIA 2QAGB 3V8RA 4CTMA 2WIBA 2R5FA 3W0LB 2JFGA 4XCQA 2IX9A 3VO8A 2X77A 3CRVA 3QVOA 4LDNA 1FU4A 4FEAA 1ZMRA 2FQWA 4BAZA 4QZVA 1Z8FA 2XB6A 4ZO6A 4LPSA 3VV3A 3BXOA 1GRNA 3H3JA 1YHYA 2NXJA 4TTRA 1DV1A 2PL9A 4V0OA 1N8TA 3MBKA 3C45A 3VVCA 1QE3A 1DAFA 1VRWA 5HZGA 3V1YA 2P6NA 2RH8A 4BBJA 4KJZA 4XJXA 5HMLA 4YP7A 5G4KB 2WTXA 2OXIA 2A30A 1GQQA 2ZAOA 4G0MA 3E3MA 3FTQA 2D62A 3BCHA 4HADA 4RMIA 4ZT4A 1TAGA 3S1AA 4H31A 2RI6A 3AY0A 4JU9A 2XPCA 4F4UA 3R9XB 2NO1A 1CDEA 2CLEB 3IDAA 2Y2VA 1KK2A 4WXYB 4J1SA 1I1NA 3JVIA 1N0VC 1CQPA 1V9SA 4P53A 5DW3A 3DCJA 1GJRA 5BUQA 3CCBA 2F1HA 1CB0A 1WUJS 1Q15A 3GCWA 2FMHA 3GRPA 3L02A 5FNVF 5I7UA 3QVGA 1QH8B 2VNKA 2WD7B 5IH3A 1HURA 2O14A 3Q0EA 3SICE 3DSRA 4DJ5X 1KR5A 3T5BA 4MROA 2WHYA 4MSUA 1RI2A 1YQXA 3WRWA 3CNHA 4DTIA 3OPYI 5JRJA 4M49A 2EQ5A 3MT0A 2PR7A 1EM6A 2HK6A 4ODIA 4YQFA 3E9RA 3HYLA 5JU6A 2AA3A 2AMFA 3BB3A 4GYYA 1TI7A 2WMNB 3VU0A 1PO7A 4KQMA 4Q9IA 2BJVA 1XT6A 1BXRA 3FTDA 3GZTB 4F21A 3WIVA 5P21A 3ZUPA 4R2MA 2PO7A 4EB8A 4D8VA 5CLHA 1PLKA 1DS6A 2JI8A 4HPWA 4PZUA 4W9RA 3QVLA 3GGDA 1P74A 1L6IA 2EYQA 2J8ZA 4WNYA 5HA5A 4KBYA 2CHVA 4DPMA 5CT5A 1GU7A 4JMLA 3G6KA 1H65A 2VDWA 2VTEA 2GZRA 4DC9A 2HA2A 2QVZX 1E1DA 4LJ8A 1LC0A 2CZCA 4RJTA 1A5ZA 1SZJG 1C3VA 3CNQS 1NNUA 2ACWA 1ZH2A 4FFPA 1RJEA 3DE2X 3NCTA 1TC1A 2W6OA 2H5JA 1D1PA 2HSEA 5CA0F 1N9ZA 2VN8A 5DN6A 5K8TA 3MMSA 1U2RA 2WMOB 4HYTA 3FNFA 3S2ZA 2C9BA 3SOPA 1QH8A 3PUIA 4B8ZA 1NVDA 5F52A 4C06A 5D00A 1C9EA 1OLXA 2XYGA 4UNNA 3FFTA 2OYRA 1W9HA 2XITA 4QTUB 4WKPA 3R8CA 1N6PA 1F3OA 1L4FA 1PW7A 5CBPA 5HSGA 3WKCA 3AJDA 2HX1A 5ETJA 1GPLA 1ZSYA 2GA8A 4JQZA 5D1HA 3SC6A 3V4ZA 2IXTA 4HI0E 4PONA 1AK1A 3DMNA 3PIDA 4C3OB 4LNUB 4CU5A 3QNUA 2XCLA 2YW9A 5AM4A 4X64B 4PN7A 4UDXX 2QBYA 1S2DA 1DO0A 2FSVC 5A71A 2WKPA 4JT8A 2N75A 5A05A 5LXTA 1B2RA 2W8BA 4ZMBA 1W36D 3E53A 1I6WA 3HCDA 1OYWA 2HY7A 5CNKA 5LMNB 3ZEIA 3BHIA 1EGQA 2Y9MB 3IUSA 4KXWA 3X0DA 4D97A 3HCWA 3KUDA 3T3HA 4L8GA 5IEBA 3USZA 4JUFA 3MW8A 2OESA 1RM4A 5I4CA 3O8OA 4PC7A 3PP8A 1J2EA 4QPNA 1PJ2A 1KO5A 4WN3A 3G9UA 4QDKA 4URFA 3ROPA 3BSYA 2UUPA 4P7FA 4DLVA 2YJ4A 1V4BA 1QH1A 1WXDA 4NCNA 3RTGA 4FZJA 4M4SA 5FBKA 3GLTA 3A58B 3WDMA 2R6DA 1C14A 1BA3A 5IXSA 3DTVA 1PEAA 4EHBA 5JLJA 1S5PA 3HRKA 3IODA 2WSYB 5CLGA 4YFVA 3WFZA 4C6RA 3GV0A 2JLSA 4M38A 1Q44A 4GXNA 4U7FA 4JJGA 1P7WA 2Z98A 2GB4A 4JR0A 1U65A 2QRHA 3V42A 4YFYA 3OIGA 1WB5A 1ZKDA 2PS9A 3H6KA 4PYQA 2Q3BA 4BQOA 1TECE 4YMTA 3TQCA 1IEVA 2UKDA 4TQUS 1N7IA 2EGGA 1TPZA 4GE3A 4MOWA 4H27A 4KXVA 4XQ9A 1LSOA 1WHSA 1E89A 4URZR 4DT1A 1VBNA 1VSQA 4G6ZA 4A6EA 3M4JA 4FJ2A 2J5RA 2V7EA 2VPZA 4DSOA 4JYMA 1L7NA 4QOGA 3S2UA 2XNKA 3JZDA 5M2QA 1NR1A 1MF7A 2I65A 2WR8A 3B6MA 4N41A 3OZEA 1X1SA 5JAHA 1JFRA 3Q8MA 1RYNA 2GCNA 3CJRA 3MJSA 2BI8A 2O8EA 2NQ8A 3P0IA 4ED9A 2R87A 3OLCX 2DRIA 1NVXQ 1TT5A 1G6OA 1ZIOA 1CIJA 1LVUA 2EVWX 1Z4JA 3IMCA 1N2CE 3MAJA 4LHVA 1WCIA 5EJMA 3SN6A 2RJOA 2Z83A 1CY4A 3L8DA 3ZGZA 4MYDA 3GL9A 1M66A 2DTXA 2E4VA 3IOBA 3B60A 4HMOA 4P4NA 3MMZA 3LVBA 3T3OA 4FMPA 3SZ3A 4PYJA 5JSQA 4AL4A 1J8DA 3A1EA 4U6NA 4MVWA 4RK7A 5G1OA 2W6NA 4N5IX 5FOXA 1BWRA 2HN9A 2HK7A 3ED1A 4I4LA 3W34A 1JQLB 2GKSA 2HC9A 4KWCA 3RVPA 3R4VA 1ZJYA 2O3SA 3JRWA 1RWPA 1THTA 2QTAA 3FH0A 1ZESA 4RZXA 4FR5A 3U6KA 1QCDA 1M73E 2C1XA 2H1RA 4YDSA 3QIVA 3B3QA 3D0KA 4A0GA 1FYDA 2QG6A 4ND8A 4RENA 5BQXA 5CDHA 1EIWA 1IAQA 5F9FA 1GPBA 1NW3A 1TK3A 1EGAA 1YS6A 2PX0A 4P4UA 3I2FA 3NPMA 3UWSA 2H18A 4NH4A 3D4LA 3V2GA 3X44A 1DE0A 1GA1A 4YT2A 2YYZA 4FOPA 5C5EA 1A72A 3B3FA 5H7XA 3AEQA 3BSSA 3L4EA 4E7OA 1TQHA 4LOJA 1Z22A 4TTTS 2F67A 3BMQB 3SG0A 1KMMA 1VXRA 1R15A 4MB2A 5H81A 4GKVA 2UDPA 3AHIA 5E0KB 3T9DA 4R81A 1W35A 2CFTA 3VTFA 4WFJA 2FF7A 1QHXA 2XMBA 3KM0A 4LJ9A 1W5EA 2G76A 3WL5A 2QAGC 4Q18A 2EX1A 3SEFA 2IHBA 4I50F 3D6UA 2B5WA 4LBYA 4UEJA 1P31A 3T6KA 4BOYA 3THYB 3HKDB 1AUXA 1E7RA 1ZGCA 3EGXB 1H3EA 3W5AA 4RACA 4I14A 2CZQA 1R0SA 2BGKA 4I6EA 1Q7TA 4MULA 5CCBA 2BD0A 2NPIA 4YJGB 4YV2A 2M98A 3WG9A 1J8FA 4N4AA 3PA8A 4RD1A 4D4JA 3SS7X 1BX3A 2COEA 4BECA 4EITA 4RMNA 5E3JA 4JAVC 2F43A 2HPHA 1XG5A 2PJUA 4M0FA 4Z8YA 2GPBA 5AVVA 3ZHYA 2VP3A 5CDTA 2IKQA 3DBVO 3LHKA 1JKIA 3PVCA 5K3FB 1QTIA 3L6UA 1P4GA 2W2VA 5CT8A 1JA0A 4DCSA 2HMSA 4C01A 4YJDA 2R11A 3K9NA 4BFLA 1CS4C 1TYDE 1H2HA 2VZLA 4KRXA 4RABA 4OATA 4RK0A 4RPIA 5K51A 3U26A 4RAOA 4E0BA 2GDJA 1BHO1 4JZKA 1USVA 4IJVA 4P4GA 4L95C 3DLTA 3B9PA 4R2HA 5FR2A 3T41A 3WLRA 3ZG6A 4BMZA 4OYHA 1LKZA 3DE3X 3F6PA 3Q3CA 4K8RB 2TYSB 3CEJA 1RBMA 4L28A 4GL2A 3ZHOA 2YHBA 3EWIA 1DCKA 2AI2A 1P5RA 2YV3A 1FRFS 1XTQA 3GWZA 4PSUA 4RPHA 5D5QA 2QVYX 1SHJA 4CNBA 5C8YB 4QDZA 3S81A 1K7CA 2VKQA 2K2QB 2YC2C 4ZVOA 4JI7B 1ESDA 4MUIA 3VZRA 1ABFA 1JEAA 1R8XA 3Q0TA 3WWOA 1D1QA 3BE4A 3I4CA 3W4KA 2HUPA 3KUKA 1E94E 5BT8A 4D45A 1K5GA 2BFEB 2Z9DA 2VDVE 1FFAA 2VPTA 4DDVA 3H2ZA 2M6RA 2B2NA 1HFEL 2H8GA 1GGHA 2Y76A 3KYDB 1FU8A 3NVMB 4REQB 4EYKA 1M5TA 4AMVA 8ATCA 2G9NA 5B3AA 3IAXA 2RONA 3TD6A 4AJ2A 1VP3A 2GM4A 1KI8A 4I1YA 5ICMA 4IMIB 1HTBA 3EDCA 5AJVB 1H8HD 3FAZA 1NBEA 1G59A 1UFQA 2IOYA 1J56A 4HAUA 2CVQA 5MFZA 4Q9DA 1NI4B 3B5EA 3QSGA 2ACVA 1OCEA 1Z07A 1U02A 3NP7A 2GM9A 3Q98A 2C07A 4GPD1 4MDHA 5EPEA 1GHTA 4BMPB 4OLAA 3ONFA 1JHUA 2OKCA 2BMVA 5LKAA 2A0XA 2QVBA 4M99A 4YAOA 1Z18A 1IZ7A 2ASEA 3WYBA 2DQYA 1G8MA 4OU4A 3ZGXA 3GUUA 1DC3A 3FKSA 1XU7A 1ORHA 1WETA 4F1WA 2RD2A 1QRTA 3BTSA 1F9EA 1M2VA 2QW1A 3QW2A 1AMNA 1CEEA 1EZ4A 1II8B 1G291 2YWGA 4LG1A 1ZSVA 2FPGA 3GJ6A 4B84A 3HDHA 2REBA 3OT5A 1KYWA 1AUPA 4Q4AB 4B6JA 2G63A 3IQEA 3N74A 1QGED 3UKJA 1AN0A 1JIIA 2V98A 4BUCA 1CERA 3R9WA 2DPLA 2JJQA 3UUFA 5EOVA 4J4BA 3OURA 3SJZA 5L3SB 4KIGA 1NVFA 5EGNA 1T6ZA 1F0YA 4RCZA 3DD5A 1ZGBA 1BH2A 1AUQA 2XWPA 3FWKA 4XOIA 2CYBA 3ZV4A 1W0KA 2AK2A 5LBUA 3ABSB 2TMGA 2XE7A 1QV7A 3OHMA 1CNEA 3MVEA 1RZRA 2A0FA 1VI2A 3S55A 3Q7IA 3IUNA 2A5FA 5CX1B 1UK9A 1ZD2P 4DM4A 4P93A 1U8EA 2ZUEA 4RQUA 4I4TA 2EBUA 1XHFA 5JH7F 4O4LA 2AD1A 1KJQA 4JB8A 3P71T 4B48A 4DUGA 4B1FA 2XECA 3RO7A 3AEXA 3LX8A 1YZUA 4P9NA 4PZ0A 2RJ3A 3GNQA 4RETA 3VYSB 2QQFA 5JATA 4JEMA 1CQJB 2QTFA 4JNKA 3QM1A 3Q40A 1C7ZA 4H6VA 4EI9A 3ADPA 4WCFC 3CVWA 3U3OA 2FUEA 4YRQA 1WBDA 2QRVA 1OXUA 3I76A 4EJ6A 3ISJA 5E3IA 1JDJA 1HLGA 2RAVA 1QVAA 2AFHA 2PN1A 5T57A 4A23A 2NAFA 2CNBA 4LYGA 3JAKB 2IE8A 2J30A 1WSBA 2C31A 2YWBA 2PD6A 3QE0A 4RL6A 3MCTA 4KFTA 3A06A 4MO9A 3I9OA 4A82A 3N0WA 4BNMA 1U4SA 4MPPA 3A2NA 4CV2A 3G2QA 3H4VA 2G5PA 1HFKA 1QCZA 2ZDGA 3D3NA 1ETUA 1YRYE 2EFYA 4KRYA 3JSXA 4IXWA 3AF0A 1I3NA 4PPGA 2ZIAA 4HGNA 4LS3A 1IXKA 3M6AA 3KXPA 1KQNA 1IN4A 3FPKA 4X65B 3K9GA 4EGAA 4MS1B 1P9RA 3KSUA 1NASA 3UICA 5EQJB 4LF7B 4PYLA 3NR2A 5E4YA 2NUTA 2OG2A 2WD8A 4TS1A 1W46A 2QROA 4O4JF 3IBGA 4P5PA 3M6MD 1NXTA 1UJ6A 2AXPA 2F17A 1MLDA 3NC1C 4S0ZA 4AKHA 1MO3A 1VOTA 4YCBA 1E2IA 2HPAA 2O2EA 2X5NA 4GWLA 3DF9A 3HCNA 4CKCB 2FMFA 4H3VA 5L3SA 1JAYA 3QLVC 1WBBA 1J07A 3C43A 4XWKA 3KT8A 3MUOA 4LSWA 4PTYA 3EIFA 2JFQA 3DAGA 1ILEA 1V11B 5I3CA 1O3YA 5GJWC 1D0SA 3ANXA 3Q7EA 3V1UA 1BVRA 2J07A 5HKAA 3CEAA 3GRAA 1R1DA 2O7NA 3FMIA 2VXCA 1KI7A 2HA5A 4IRMA 1J97A 1JSZA 5EA2A 4CWAA 1RXVA 4EMBA 4BKMA 4OG2A 4QBHA 4OA5A 1GTL1 1YKGA 3CLKA 4JLDA 4KIUA 3Q4GA 1PNTA 1Z5GA 5FUYA 4BB5A 1FDOA 3QUQA 3PKJA 2PMKA 4LJRA 1VSVA 3NTRA 3AR4A 2ILVA 4KE8A 5T41A 2NUPA 3O8DA 4G37A 4Z2YA 3UXMA 4GQIA 4PZPA 3OC0A 4IDAA 4E31A 2YXLA 2ZRPA 3R5TA 2ZSUA 4Q4HA 1XZEA 1W5SA 3MFQA 3WYNA 2QRVB 1E6LA 2ANBA 1DQSA 1VPWA 3AZOA 1GNVA 2QZPA 5JCXA 1FS4A 2OZKA 4LHEA 4I55F 3K6JA 2VUTA 2Q7OE 1ULAA 4J8PA 1P39A 2Q9CA 2XGOA 1E6EA 3R2JA 2WT9A 1T6NA 3EGOA 3EIXA 3LHSA 5TQ0A 4Y7CA 4BMXA 4DKXA 3T0GA 2XD4A 4D1YA 3GGJA 3EDMA 1ZK3A 1C0KA 1MQAA 1NIJA 1GXSA 2ZG6A 3A25A 4Q82A 5D7BA 1EINA 1TM2A 4B4KA 4DLBA 3QU7A 2XT0A 3AR7A 4FD2A 4D92A 2PKQO 3VTZA 1TM5E 3AR9A 2FA9A 1G42A 1Y8CA 4EJSC 2HSWA 3PC4A 3C6BA 1YB5A 3QKSB 2N1MA 1TU4A 3VR5A 1EFAA 4RA6B 4WBNF 3ZX5A 2QTVB 4RGYA 5AVJA 4YRPA 1O6GA 3T5PA 1L9XA 2IHTA 1XOIA 5BXQC 3UMYA 1EFTA 4X97A 1RLJA 4WBSA 1CQXA 3DF7A 4YJ3F 1X8KA 4C4ZA 3UJNA 4L0QA 4BIMA 2HCBA 3U62A 3B48A 2A3RA 3AVYA 3LZ6A 4R9SA 2GYWA 2X9VA 1D03A 1CWUA 1FVXA 3KJIA 2HRZA 2IXEA 2XNJA 5KSWB 5J2TF 5B1HA 5ENDA 2VYFA 4CMHA 5A4JA 1AMUA 9ABPA 3VAZA 1T4CB 1E9FA 2Y1FA 4GMHA 3GPDG 2H5LA 2D2IA 1CE8B 2WMDA 3A9VA 4M1WA 2XIQA 4PAMA 3QEKA 1YI8A 2C2KA 5BMVA 3RAFC 2X6RA 1IG0A 1NRXA 2ETXA 2OP1A 4PHHA 4S0XA 4HQLA 1X7XB 1CR6A 1N25A 4NBKA 4A0QA 1ZNXA 4E6EA 2P5TB 1ATIA 1DRJA 2EP5A 1KFJB 4P92A 3RR2A 2DBQA 3WOVA 4JVLA 5AQEA 5JDIC 1YL5A 2ZAIA 1E2LA 4FYPA 1E9AA 4QDJA 1GT6A 3QKUA 1NIPA 1NI4A 1YB4A 3A8TA 1T2VA 1ZVMA 3HNOA 3NHZA 4RMHA 1PQPA 3C5HA 4X1KB 4KH1A 4G97A 3U44A 2V5VA 1F8GA 2JGJA 3K2BA 3K0FB 3R0XA 4D8UA 4GQAA 3L7BA 5KVSA 4N49A 1O96B 2VK4A 5H5JA 4FNAA 2ZBFA 3VVLA 3G1UA 1T6XA 3ZQ4A 3QJ5A 4AUNA 4CMIA 1Z6ZA 3AEKA 3ESQA 1GU1A 4YIHA 5JROA 5J47A 3RW9A 1V6CA 5GINE 1ODKA 2XDYA 1UP6A 3EVCA 3O8RA 3CMCO 4ARZB 1RAGA 4ND7A 4ZI5A 1ENYA 3NQ41 1AHIA 1ONPA 3PHHA 4UPDA 2F1JA 3L8CA 2ID7A 3QFCA 3ZJYA 2BDTA 5EWMA 2GSDA 2R7KA 2WMYA 3L3BA 4AY2A 3EDYA 5ERYA 3RIMA 3IKLA 1RVDA 1F8UA 1OWLA 3QHAA 3EUEA 4B2YA 3M6VA 3SKVA 3VOBA 4O0MA 3C7CB 1EP3B 2XWBF 3SWWA 3HZOA 4KQHA 4XWYA 1RLTA 4ON9A 2XQIA 2BSQA 3VPGA 3E3LA 5IKXA 1BOOA 5ESRA 3ELWA 4IFIA 1VHDA 2RB4A 2VWQA 2ZU6A 4AY5A 1NTRA 2ENWA 3TSWA 3IP3A 2BEWA 3HXPA 4DLAA 3LT5A 4TXMA 4CLOB 1RFGE 3K70C 1YR3A 3AO0B 3PPVA 5FA5A 1FTNA 2I7TA 3LO8A 5M7EA 1C1HA 3WMGA 2GGSA 4Z7QB 2FAXA 4BFTA 1KJYA 4KNWA 3DQZA 2HF8A 2ZSKA 2YMLA 5CVTA 1NVVQ 2IIVA 1NI3A 5CAEA 4R40A 1FF9A 1AQYA 3VH4A 4PC3A 4LCJA 4PSKA 2LGJA 1JDTA 3MT7A 4PN3A 1ANKA 4HUJA 4DUGD 3RK0A 4MKZA 2CNWD 1P8AA 4KZPA 1DLJA 2QN2A 3CSSA 4UOQA 3MFYA 1EP2B 3H2YA 4BFWA 1US8A 1U7OA 3DKPA 4P83A 2ERYA 4MI6A 3ERCA 1DBRA 1KYXA 1EVLA 1W5BA 3BAFA 3VPBA 4ER5A 5JRDS 3FCSB 3I12A 4HH4A 4ZCPA 1RYZA 1R74A 1NUSA 1W0KD 4QASA 5ENZA 5CCEA 1ZUNB 3O8NA 2P4UA 4OV6B 4AJOA 3RWMB 5CB4F 4F91B 5FBRB 3QX3A 1JKXA 3AR5A 4NY1A 4QGHA 5DLYA 2QX9A 2CLIB 2YVQA 3KPUA 1JNYA 4BVHA 3EBOA 3AEQB 1F12A 1UBJS 2C7RA 7MHTA 3ZUGA 2VFAA 1ILWA 1NQ5A 1WNTA 4HK4A 3LUHA 1CV2A 3TVYA 5E7QA 1AMOA 1OXTA 2EZUA 3BN3A 2VJKA 4F7DA 3N7AA 5K3OA 3O26A 3TCKA 4BFUA 2P3OA 1VZ3A 1UPBA 2GNPA 3ZV3A 5AKGA 4EL5A 2W4QA 5K3EA 1SULA 1X70A 2GHIA 2ZUCA 2IFTA 2GO1A 4JHXA 3C4QA 5HCIA 3RUEA 3DTVB 1QO0A 1FE8A 3W6OA 4CM9A 3DXXA 1DAEA 5DNCA 1O94C 3QEJA 3RRZA 2Z6UA 1NQTA 3O0DA 2MYPA 2Q5LA 3CUUA 4XWGA 2EIHA 1ZCJA 1R3DA 3O31A 3RC3A 1P77A 1SBCA 3BFXA 4U4AA 4D8WA 9GPBA 2QPLA 2GEJA 2GZHA 2ICAA 3U17A 3GLFB 1KAHA 3B1KA 3OP1A 5HGJA 2AV6A 4K2AA 4JA0A 6ABPA 2AD5A 4NYJR 4NU0A 2YZMA 4KXFB 3OJEA 5K3SA 3Q8KA 4GXQA 2J32A 2D1SA 2TECE 2YHAA 3NYIA 2A59A 1QOPB 1YA4A 1WDLA 1XTZA 1MEOA 3O93A 2YCLA 1ODFA 3KPWA 2DUJA 5CT6A 3RB8A 4YAFA 2QT9A 3CISA 4G9EA 3H17A 4TT8A 1M1NA 3KAQA 1ZMBA 3KQQA 2ZDHA 2VBGA 2HWKA 4P1ZA 4QYXA 4TKVB 3CF4A 2XHZA 4PYMA 2ORED 4XEHA 4XSGA 3PJGA 1I7NA 4AJIA 2AVDA 4PWYA 2O19A 3OP4A 2UXCB 2W48A 4KIFA 1P7CA 4ZA2A 1ZEMA 3CZ4A 3GAAA 5EQTA 1QYWA 4CF5A 2VPPA 1D4AA 1ITZA 4WXEA 1TEHA 1XVVA 3SC3A 3NTUA 1K08A 2C83A 2ZTHA 3GF4A 2P62A 1WSAA 2IEBA 3X1DA 1QKJA 1CNFA 4JJ4A 3H42B 4NMHA 3GJ0A 3JQ8A 5DHUA 1KDPA 3EISA 3JTEA 3RBVA 4DIMA 4BQIA 4LQDA 1PNRA 1C4XA 2PVPA 4U0KA 2XKKA 1YE5A 4BNFA 4AZ0B 1BEZA 3LH5A 1O5IA 5CFNA 3VDMA 2JEZA 1KK3A 2JCBA 3ZHBA 1KY2A 3T0FA 2EARA 4ES6A 4IUBS 2HJRA 3EY9A 1D2EA 3UOGA 3M3DA 4BNGA 2FSFA 3AXTA 4LDZA 1TVMA 1X1TA 3C85A 3A9WA 1XMPA 2IYOA 3PUXA 3L7NA 1TKRA 1CK4A 1UC5B 3NPAA 3LWBA 3Q8LA 2WTNA 3P52A 3G7SA 3QVSA 4DJFC 2DQSA 4RLQA 4TWAA 3ZCRA 1IEQA 3GO4A 1G41A 2EIXA 4UBMA 2QE7A 121PA 3KWFA 3PUVA 3H2SA 2HHAA 1MJFA 4XTCS 1LTQA 4CM5A 2WD7A 2G8NA 3H1BA 4Q93A 3DBHB 1SG9A 1FJ2A 1H2XA 3VDXA 5KYKA 1ODLA 3N5CA 3GP3A 4JBGA 3KHTA 4CN9A 1DTWB 1I51A 2YVAA 3V4OA 2AKEA 1AGNA 3G0DA 1KMQA 2XVXA 4I4IA 2CVPA 4EX6A 2ZPTX 3KEGA 1A4XA 2HM7A 4QWMA 1NZDA 4Z4GA 3ZWNA 3I9MA 1L5HA 2A1UA 1G21A 3OT1A 5DZSA 4N48A 4WCDA 1PWXA 2BELA 3WLFA 4G1EB 1UZUA 1IY9A 4TL7A 2OZVA 1RVV1 1GZ5A 1M54A 1CP2A 1ELOA 3NM6B 1TVKB 2EWVA 3CLTC 3LWZA 1TM3E 4LXIA 3FDZA 3KFXA 4U6QA 1PJAA 1H0KA 5F35A 4F3TA 3ONVA 2JIZA 3HA7A 3SS9X 2QJWA 3V9AA 2ZJ6A 5KNDH 5LFAA 4TV9F 4TUYA 1MP0A 4ENVA 1JF8A 5AOCA 1SUFA 3VSBA 2DAPA 1OXBB 2DWQA 3M8KA 3HSKA 4GBJA 1M0TA 4KQ1A 3NU1A 3U7QA 3OFSA 4FBGA 5KYWB 3CVUA 1OIXA 2BGJA 3M83A 3L9WA 3A1VA 3KZVA 1KNQA 3L6RA 2ZI9A 3IQFA 1QIGA 2B98A 3F3YA 3LF2A 5I9BA 3ASYA 4X7RA 5T6BA 4LN1A 3LUDA 4HAZA 3H8SA 4B74A 4E5KA 1U9IC 5F21A 1L9KA 2R44A 1LRKA 5TS2A 5F76A 1KDYA 3PGLA 5MDHA 2OILA 2P9QA 2Q6TA 5ALHA 4B4OA 1ZYUA 4LIPD 3K53A 3GJ8A 4PBSA 1UOPA 1KJ9A 2N47A 2VRCA 4NV0A 1T2NA 1VJCA 4CKBA 4LE0A 3S70A 5FPYA 4E21A 3DT9A 4C0AC 5AHOA 1NGSA 4UVEA 1AKRA 4W9NA 3WIDA 4MB6A 5F3DA 1YBMA 4AZ0A 4K9SA 2WE7A 4BVBA 4AXBA 2ZEJA 2FW8A 3O95A 1NJ2A 2JK1A 4FCCA 4UM5A 1RJWA 1E3LA 3CFYA 3LKBA 5EMNA 5TPWB 3RFUA 3ZWMA 3EULA 2GRJA 2VKTA 5L45A 1IQPA 3B70A 1TD9A 2AUMA 1PQUA 3LP6A 2P7HA 4KPUA 1YR6A 4OHCA 2IYSA 2H16A 1KJZA 3W3AD 2V4ZA 1WZEA 3C0KA 2E0IA 4HEA1 3I37X 4CMGA 2FMKA 2YTZA 2IA5A 1DRUA 4XGRA 1UC9A 1M8FA 2B8EA 2O57A 2QRPA 2OFXA 5BUZA 1IDOA 4D56A 4ZPXA 3FGOA 3RV4A 4WINA 3S7ZA 2G71A 3AFHA 4WGFA 2VWGA 4F1KA 3O73A 1K8XB 4UNPA 1WPRA 4PLFA 4C4SA 4HPXB 4PG8A 5JC8A 5LMCA 1WTCA 2WYUA 3AB8A 3IP9A 3N8KA 2WAMA 1SBTA 4KDEA 2RGBA 1Y7HA 4RSGA 4YALA 4OQEA 4POAA 5ESDA 4KGXA 5CVVA 3PI6A 4GNKA 4I5FA 1QAMA 2JFPA 5DWQA 5ELMA 5F2EA 2FE4A 1S0UA 1DAMA 1V7PC 2OCAA 1IC6A 3LYUA 3OU2A 3WP0A 1XDBA 2YDYA 3E7PA 3GGOA 2VNSA 2NVOA 3B9QA 4GC9A 4UQPA 4Q9JA 5B37A 3TBHA 3U3XA 4BHTA 3Q3HA 1IRXA 5JNLA 1HRKA 4ATNA 3QPWA 1E7QA 1OAAA 4NATA 2FWAA 2XV1A 2EFDB 4X3CA 1A9OA 4AECA 3NJRA 1OZFA 4DAOA 5BQ3A 2GBPA 1P7PA 2BHSA 4WA7A 3RCBA 1QG0A 3B1FA 3ZS8A 5AVYA 3FPEA 2PT5A 5AVXA 3DDOA 4L78A 1A2KC 5B2FA 3DVRX 1WXIA 4EAAA 3F90A 3LC2O 4QQNA 3K09A 2EKQA 3WK5A 4E13A 1SKQA 1EGHA 4OKIA 4MZDA 1AS3A 1Q3TA 2CMDA 1L7RA 4BU0A 8ADHA 3RFCA 1DIOB 1R12A 5HJ2A 3C3WA 4B6GA 3EVZA 3F9CA 3M7IA 1JTVA 4B9EA 1N5IA 1CUGA 3ZHTA 3R6GA 4X24A 1YCFA 2CV2A 1GGJA 3QUBA 4YQYA 2J0UB 1COWD 4J1NA 4KGZA 1PL7A 3H9BA 1YJCA 2ONZA 3UJHA 5FIUA 1MB2A 4YXFA 4DHEA 1JJFA 1R8YA 1U2SA 5IBPA 2C61A 3IIKA 3ZLVA 4D0NA 2YQ5A 3TR5A 4O8ZA 2R8ZA 5KOHB 3V5NA 3ZNNA 3UJ8A 4U2EA 4HYYA 1LXCA 1O77A 3OCWA 3GH3A 5EKXA 4G0WA 3TSAA 4UAJA 1FUUA 3DBRB 2JK0A 2WHQA 3ODGA 4GEGA 1Z7BA 1FNMA 1VJ5A 1IUPA 2NU9B 1AE1A 1AVTA 3II6X 4GECA 4NICA 1AGPA 5K0FA 3AVWA 5LLSA 2ONJA 2IYLD 4KN9S 1PVDA 4ZQFA 3DMDA 1Z2EA 2QOEA 1IPHA 7ABPA 2QN1A 4Y2XA 1WVIA 3EK2A 3WV4A 4YWHA 3TL3A 3PUYA 3WLTA 1V9LA 4I1OA 3RYHA 3WQHA 4A8PA 4AO6A 4MINA 2PUBA 1OX5A 2CBZA 2PZGA 3EIQA 1HYEA 4BWGA 3T4PA 5UKDA 2E2WA 1QE0A 1KL7A 3FRIA 2X0RA 5CVDA 3ZN2A 2WTBA 3HDYA 5G02A 3NZEA 1DL5A 4MVJH 3NYRA 1OXXK 4TV8F 1ECJA 2OGTA 3K0CA 5DSZA 1EDDA 4LQLA 4NJOA 3UTDA 4II3A 2HIGA 1GG5A 4O4IB 1GGMA 2ZPUA 4Q03A 4N7RA 5EPUA 2KM1A 3RGWS 3MAAC 1Y9DA 3PQCA 5CGQB 1NVWQ 2B1IA 2OP0A 2B20A 1SPBS 1NMZA 2HLHA 4I1UA 4JJKA 4E12A 1MDFA 1NXPA 1N2EA 3MWKA 4D5GA 2CY0A 1JMYA 3OZGA 4ZVTA 4MQFB 1SCQA 1ORRA 4B3RB 3SX0A 2B8TA 5IRCD 1PK7A 4RIEA 1IHPA 2IZ1A 2Q41A 1EX7A 5DX1A 1Z16A 4JSTA 3WGGA 2Q5QA 2XUHA 1G16A 2OFFA 4YR9A 1N3BA 3SC2A 5ER6A 5EIXA 3R3WA 2PMFA 3FTPA 3NATA 4OI4A 3IO5A 2CK3A 1VSUA 3WFIA 3PXDA 3CX4A 1KJIA 3RIEA 4BNYA 3KNZA 3PPYA 3P45A 5LQUA 3MJDA 4MPDA 1TTHA 1H1LA 1UH5A 1WB6A 4UTZA 2G80A 1PL0A 2F43B 2HBRA 2RHGB 2YWXA 3GN2A 3LUJA 3MWJA 3KHKA 3PHGA 3R77A 2BE9A 3UUGA 1B7GO 1IJBA 1HYHA 2YJGA 3QP9A 2ZB7A 4EVQA 4EY7A 1Z36A 3KKOA 1G9TA 2FHPA 1B3BA 2E82A 2FPIA 3O92A 5DYTA 1KMHB 3GVIA 4CGZA 2RC6A 1E0KA 1R9MA 1BMDA 4ZRMA 4HTFB 5DXAA 2F62A 3IV9A 1XQ9A 2Q4TA 4GMGA 4XGKA 3PFGA 2PAAA 2ILTA 4ZU1X 2XZDA 1X80B 4GMFA 4RUKA 2QN8A 2V0CA 3OF5A 3WMEA 3E2PA 2NP6A 3D0QA 4KO4S 5CA1F 1U11A 4KR6A 1SU7A 3ZU5A 3ROXA 3ASZA 1GAQA 3WQSB 5E9QA 2P4QA 4KI0A 5DHRA 2NADA 5ARDA 3TSZA 2A4KA 1EHCA 2H4HA 2LKCA 4KSYA 4D4HA 4QM6A 1Q19A 1ZUIA 2BFCA 3N8GA 3QE3A 4ZEMA 2VQEB 2XNDA 1D3AA 1NONA 1RT9A 2JKZA 1OMOA 5B3KA 4RM2A 2GERA 3VO9A 1ACLA 1CZUA 4P7BA 3UAGA 2HYDA 1IUNA 1RHJA 4BNJA 1B6RA 1KORA 5CH5A 5CFPA 1YQWA 1HMYA 2QAIA 3OZRA 3R0VA 4LJ7A 2JHGA 1E9BA 4ZFNA 2ISSD 5KTRA 1PNVA 3T9FA 2YXEA 4DFDA 1KI6A 4WJLA 4UTPA 1J5PA 2QU7A 3R6DA 4JOQA 1I2CA 4CF7A 3TG8A 4ALJA 4MIKA 3N2ZB 1OB2A 5DX0A 5DBOA 1IMOA 4M8IA 1FP6A 3PYMA 3QE9Y 3S3TA 1CP3A 1MAUA 3R7FA 1SQSA 4Y1GA 1Q0QA 2FZWA 4IIUA 3KD2A 4KVAA 1KNXA 3ZWQA 4L15A 3FNEA 2FSIA 3MLEA 4FHCA 3WVNA 3Q88A 1BNCA 3T0IA 3RPEA 4EBFA 2XJ4A 3IAEA 3LQ2A 2R5NA 1WU8A 4NH0A 4HDCA 1U9JA 4FKBA 4ALNA 4BO2A 1H4SA 2PZAA 4QT4A 3JYHA 4I8DA 1QGAA 2FX3A 2IGBA 2R00C 3PQ8A 1W48A 4M1EA 1I2AA 2B36A 4MCJA 4EHLA 3RSLA 4O2AB 4BVGA 4TRNA 5F2KA 1BMTA 2FK8A 2ZJYA 3M9LA 4G89A 1BDHA 3TJRA 2I2DA 1DQNA 4ZEOA 2WAOA 1TT5B 3CMMA 3KZKA 1O94A 4YRBA 1XAJA 3M6WA 3RU7A 3DAFA 3WL3A 4JLMA 3KLMX 1E3QA 1D2MA 1L6RA 1LJ8A 3BUSA 1U3TA 3EXHB 3PGVA 5A4IS 4OIFA 5AK3A 4IAOA 2IBMA 1M6EX 1Y1KE 4JYCA 4MW5A 3EQ8A 1TOAA 3K73O 4LKRA 3ACDA 1W85B 3OE7A 2ZM5A 2R6GA 3U2QA 4CJXA 4R98A 1ZAYA 1U63A 2P67A 1WHSB 3TPFA 1PV1A 2AWOA 2ZJFA 2A8YA 4BVLA 3KR0A 1JNXX 1VYHA 3KFLA 1BWSA 4R8SA 3EGDB 2YZKA 3OEED 2Q1YA 2ZJ4A 1T0JB 5KYXB 1GQOA 5AIAA 3PEYA 3VZDA 4BBZA 4TWRA 1E2DA 3ZY6A 2HREA 3K31A 3PFBA 4RE5A 1L8XA 2FUG6 1QR2A 1E9VA 3LLVA 3Q5DA 2OO7A 4WOJA 2H29A 3H86A 4LAFA 1U5AA 4IQGA 1E6WA 4LC1A 3UHFA 1RTKA 2GD6A 3E61A 4R9VA 4ESHA 1ISPA 4QPDA 3SQWA 5JFGA 3R3UA 1XR3A 3MGBA 4CEIA 5PGMA 2DM6A 2LPMA 4N01A 1Q3HA 4FSXA 2O1XA 4NZPA 4B71A 3OO1A 4WN9B 2NNWB 3KVNA 2MHCA 2UVDA 1EQUA 2CLFB 2PL1A 3WRYA 4MJXA 4N3AA 2PPLA 2Q5IA 1MJHA 3NHSA 4P4LA 4MV0A 4ZYZA 5C7IO 4B6QA 2XGGA 1NPYA 4XZ3A 2AE2A 1UF9A 3EIWA 3QRWA 3P32A 3O2JA 1YVEI 3OMWA 1G55A 5IARA 5FLEX 4RVDA 2IH4A 5IKMA 4MPJA 1VLMA 4ZV4A 1N7JA 2N46A 4WLOA 4GOJA 4LZOA 5D84A 1RQ2A 1Y1RA 2P27A 2JIBA 3DZFA 1SURA 3RTCA 3L4JA 3LOPA 4JJFA 3ZW9A 4R6WA 3LKVA 1OHHA 1W2HA 3EGIA 5CR9A 5E0OA 3L06A 5U9CA 4D9BA 1PRYA 1RYMA 1I4LD 4MUJA 4U9HS 2BRUC 1GZVA 2UYGA 4QXOA 3SEQA 1MC5A 3V7UA 4Z7NB 4J6EA 3L8GA 1Z17A 3R76A 5F73A 1LSSA 4KQEA 2XXAA 4WMLA 3CNOA 1RIFA 3S29A 3AERB 5EEHA 4Y2JA 3U3JA 2ZIEA 1JT2A 2R1VB 2V7VA 3O8BA 2RBEA 3THWB 1RLOA 3QEMA 5BYAA 1PKXA 1ZL0A 5AVKA 5BW6B 3KB6A 1E3DA 3NAZA 4DIKA 1N5KA 3RYIB 4Z1MD 4QEZA 3D4OA 3UV6A 3REFA 5L3RA 3FJYA 4Y2VA 10MHA 1YQDA 1FZQA 2EOAA 1SIUA 1QIMA 4M6WA 3ACBA 1P61B 2R84A 1U94A 1QZ3A 1OFVA 4O29A 1DG1G 3B8HA 2QMOA 1NVBA 1OLSA 4PVDA 3WWZA 1EPUA 2CFOA 1ZI9A 1XQYA 1L7XA 3ZWXA 4F46A 1MVOA 4RIHA 2ZYDA 1QKKA 1LX6A 1K75A 2XSZA 4NBTA 2ZE5A 4UKDA 4K6GA 3BX1A 3BL6A 4Q48A 2GJ4A 3LUBA 4MQLA 5SZKB 4IIVA 4U5XA 1MRNA 2GXAA 2GUGA 4LYAA 2IYFA 2B34A 4PNZA 4BNVA 1USIA 3H0EA 3IO3A 3WBKA 4O0LA 5I7VA 3TQQA 2GD2A 3DEJA 5ECGC 1ADYA 5J4HA 5F64A 5EJGA 3LZCA 1U7PA 3NBAA 3RV3A 1WZUA 3VKFA 1KRXA 1HETA 2GPSA 2BF7A 1YQQA 3ESAA 4KXUA 4N7MA 1TNDA 2F8SA 4ZC1A 1CZNA 4DRXB 1AC5A 2VNAA 1YVRA 4HDNA 1SVSA 3SHQA 1LK0A 1AK9A 1I0IA 5JSFA 4OCZA 4B81A 1YZHA 2G5CA 3RI3A 4IIBA 2VQDA 4GBED 1KPIA 1ZIYA 1E99A 2C7GA 3TZ6A 3UOAB 2UZIR 5C0OE 4UPVA 4R01A 4X63A 5DXFA 2VPIA 3NNDA 4G4JA 2PQ0A 1DX6A 1FDSA 5LQKA 2OSVA 3BEDA 2PV0A 2GF9A 3E05A 3IQIX 2Z3VA 2VF8A 5J1SB 1DWOA 1GADO 2RHLA 3OF3A 3RAJA 2AOUA 2NU8A 1RRPA 1CU1A 1R0YA 1V5IA 3NBUA 1ESZA 3H5TA 3RRYA 3SVLA 5EIBC 1SC1A 2H4XA 1Y0BA 4Y6LA 3PJDA 1DFIA 3S8EA 2WZBA 4GRAA 3QA3E 5K20A 1GEEA 2CXSA 3HYRA 3L04A 1VL0A 2KE5A 5EESA 2BGWA 4NBUA 5G4KA 5KPJA 1N7GA 4GHWA 4J0FA 4XEUA 3WR5A 3K1JA 1G66A 5DLPA 4KWHA 4ROTA 5CEFA 1GITA 2DPHA 5ITWA 3TGWA 3ENKA 3PFNA 3R3VA 3JAWB 4LV5B 5FOUA 1T0IA 2GBGA 3GLKA 3TIGA 3PWTA 3HYSA 4U00A 1RMQA 1VIYA 1JLMA 3KALA 4A73A 1QJCA 1D7AA 4EIWA 2BM1A 3PSAA 2BMAA 2A5YB 3EZLA 3KPYA 4LOLA 4CMEC 2D2XA 1GPKA 4AKIA 1DQYA 5B53A 4JUIA 1N2SA 1PR0A 1PHPA 2MMCA 4J07A 4M1QA 4ZAZA 3UMGA 4H7KA 4S1TA 3E18A 3PRYA 3WZLA 3I01A 1UBEA 5FT9A 3A4IA 4DG9A 2A35A 3COJA 2J9ZB 4NPAA 2QPAA 1C9NA 3LGSA 3V8PA 4Z3KA 4H35A 2V9CA 5TX7A 1JXMA 2CHFA 1AKNA 3JY6A 1R6DA 3N8DA 2PKQP 3U4GA 5JZMA 3L4SO 1IY1A 5K8LA 4UM7A 5DWDA 3EMVA 4B8YA 2MSWA 3JQ8B 4H7EA 4XAQA 1DO2A 3DAOA 3K2QA 3LY5A 1FTSA 2VAWA 3CKYA 3OQIA 3PNQA 4DARA 5AUOB 4DV6B 1AG9A 1TZJA 1FFXA 4WERA 3SAJA 2RGWA 2ZE6A 3ABIA 3GEPA 1KJNA 2GR9A 2IQ5A 2PDAA 3GRKA 4KI7A 2VNJA 3NETA 2O3QA 3OT4A 3PPXA 2B78A 2AJDA 4CHTA 4E46A 4C1NA 3DWIA 1RQNA 3JYNA 4RTMA 5BSHA 2Z56A 1E0SA 2RI0A 1C2YA 3CH5A 5CXUA 3FZQA 4WY2A 1ZD3A 1TMGE 4PCUA 3GDFA 1JR4A 2F8LA 1RZ3A 4JXXA 1V16B 1G20B 1YUNA 2R7MA 2Z58A 1Z2OX 2P6PA 3R3ZA 2HBQA 4G0XA 1BMFA 2VSFA 1Z56C 2WQZA 4RVOA 3ZWAA 2D1YA 3R5SA 3U13A 5L53A 1CDZA 1EUZA 4QLOA 3ZJTA 4HLCA 5AI4A 2CDBA 5C18A 3PDHA 1KWGA 5K0BA 3H5IA 2PFGA 1PP4A 4XQEA 3U31A 1RPZA 1XE3A 4NQZA 1SKYE 1WQ3A 4GS5A 4B4UA 4D4LA 3N3BC 5L4NA 2XUZA 4QQKA 4TYMA 3U39A 5F51A 1Q0TA 2FPKA 2KI5A 3L07A 3U4QB 5HUJA 1VIDA 4IIDA 4MV1A 1IHXA 3ZKWA 4AP5A 1RZVA 2JBWA 4XPIB 2H1LA 1XF1A 3EXHC 3OF2A 5FOQA 5KNLA 2F7SA 4KREA 2VSQA 3W3AA 4QRDA 4TRMA 4ER0A 4G84A 5DLQC 4CKEB 2OSBA 4Y18A 3HXOA 2WVJA 4C4TA 1S2MA 2QENA 2WFLA 4K5QA 5FBLB 1JQEA 1NMSA 1U5CA 1L3CA 4BO1A 2G04A 3GLVA 1XPOA 4ZOQI 4V1CA 3G1TA 4PFKA 1XPRA 1E63A 4NBRA 4OX9B 1LZKA 4PXYA 1OX6A 3DTNA 3R23A 1XCJA 3F7NA 2JGAA 4BFYA 4DCNA 1PLJA 4JC8A 1I14A 5TVGA 3ECCA 1LNSA 1JSRA 2GTIA 4JEHA 1H6BA 2VDLB 3LKZA 4WLVA 1GQ2A 2VRCD 2PGLA 4Y3UA 2GETA 1BE8A 3UJ9A 3UTCA 3K0AB 4GGMX 4KQCA 3VU9B 1AO0A 2BV3A 1AGXA 1NJSA 1XCBA 1O95A 2FWPA 2PT6A 2ZYSA 3FLMA 3OAAD 4IDGA 4N6GA 5CJPA 3T3PB 5U4QA 5AESA 3I0NA 4YACA 3UFXA 3QF4A 1T1GA 4BKPA 4XB2A 1CR0A 1A9YA 1JHPA 2IP2A 4B3DA 1C30B 3KT6A 1NOKA 5MGNA 3W2EA 3ZV7A 1TJ4A 4WUVA 1G20E 5CFQA 3TOCA 1K5DA 1T6YA 4MGYR 5HIKA 1JTEA 3GFGA 1T9GR 3F3KA 3UC5A 4D9GA 2SCUA 3WNCA 1K8ZB 1JFFB 4I1RA 4HXYA 4YP9A 1CY2A 5LUAA 4DB4A 2VA8A 2O7RA 4FU0A 3OQJA 3N7UA 2EC5A 1P5JA 5DWVA 3Q2IA 1E7MA 4C89A 3H1PA 5IDQA 3U4CA 3LQKA 2W90A 4TTIA 1PFYA 1GSIA 2IUEA 1CQIA 3T12A 1SB9A 3AINA 3DZBA 4Y1RB 1QK5A 4YHHB 2GN2A 2VP4A 3KQMA 4M7PA 2BUCA 3AONB 1POXA 2G83A 3KYCB 3VXKA 4LJ4A 2BKUA 1H66A 3QKWA 3R0ZA 5FB3A 5FI5A 4CLXA 1WZ2A 1MXFA 1HDXA 2NVUA 4N5LA 1Q84A 4GYJA 3IDFA 4PQGA 3S8MA 1MXHA 1XN1A 4YT4A 2NXEA 1HDZA 3GLSA 2Q2NA 2X0JA 2ZI7A 4RQTA 1PYOA 3KVVA 4LMPA 1FY2A 1PVVA 4IW3B 4KO1S 5BWLA 4N47A 3VYWA 4JOSA 1RJ9A 2Q3LA 3LSYA 3RHTA 3WNQA 4QFDA 2X86A 5K4GA 3IEMA 2I2FA 2O7QA 4MUYA 1EM8B 2XGSA 4GFDA 1OYVA 2HTEA 5LP6F 2Z8YA 2ERCA 1BDBA 1RI3A 3ISTA 3KR1A 3Q12A 4QUDA 4CT0A 2ZYHA 4LDJA 3QTLA 4UHDA 4DLKA 1ORDA 4IIEA 4YMLA 1ONSA 1H6DA 2G07A 2I34A 1RQGA 2LR0A 2YWDA 2PWZA 5EZYB 5F2NA 3OJFA 4XVQA 3OO0A 4GMKA 4MXDA 1VL1A 3OIVA 1NUPA 2ZULA 4LVNA 4Q02A 1KRHA 3I09A 4MR8A 5HE9A 3K6SA 3QJYA 4EY6A 1GVHA 1Z0SA 3AFIA 3FPSA 4GXRA 5KQRA 1HNWB 1LDGA 3L7YA 2RHHA 3O82A 1NP7A 4RVHA 1ZK0A 4L85A 1F3LA 3B1WA 3F4KA 1F2TA 1RKVA 3BL5A 3EXEB 3E5HA 1W73A 4MITA 1NT4A 4OQXA 1T2DA 2ORWA 5D5HA 2IRWA 2V6FA 2RGGA 4PGAA 1XF9A 2QM7A 1MV5A 1TA4A 4PGMA 3ZGOA 2NUBA 3DMHA 2OPHA 2NVWA 4D4GA 4MCHA 5EXXA 3UJ6A 5FEMA 1QGUA 2B3TA 2F8TA 2D7JA 3D54D 3HC7A 3ETLA 3PXXA 2IZ6A 1PJ4A 1UK6A 2AFIA 2PUVA 4MYRA 4HX9A 2J3QA 2Z08A 3QWAA 5D85A 5ULLA 5JMOA 4BEJA 2IYEA 2PZ8A 1Q0HA 1YONA 2IL1A 1BDMA 5HKBA 2Z43A 3I1JA 3JPWA 2HJVA 4HL6A 2JI7A 3L18A 4YRMA 5KOJB 2C57A 2C88A 5CNIA 3ADOA 5BV0A 1Y1PA 4Z2AA 1P0PA 3ZZNA 3S1SA 1ORWA 2GEBA 2C2GA 4NE9A 4OTZA 3U3ZA 3C41J 2NSJA 3NWEA 3PIRA 3TW8A 2H2FA 3NWOA 4J7CA 3QYAA 2GK4A 5CTJA 1Z5NA 5C46F 3EW7A 2AX4A 2I7VA 3E9EA 4X20B 4C6TB 1BZYA 1FTWA 5F1PA 4TSFA 4ZT7A 3JQ7B 5FBZA 3RS4A 1RAFA 5JISA 3LU1A 1J8YF 3UHAA 2VHQA 2E48A 1JIXA 1PW5A 2Y1OA 3DZIA 4QXMA 1IWPB 3VFDA 3FPCA 1BYIA 3MQ2A 3P1JA 5FBQB 2CT8A 5CXQA 4D96A 4DCCA 2H11A 1NDQA 2FSGA 4JBLA 2X9QA 4KB5A 5EKSA 4EY3A 4RDHA 2VDRB 4HLUA 4MHOA 5JLAA 1QO0D 3A26A 5KOJA 3WB0A 3TQRA 3HDGA 3B38A 3C98A 3AI1A 1JLLA 3TJMA 1U0SY 1H9AA 3V00A 3UCXA 2CGEA 5IULC 3LAWA 4DB2A 1N3LA 1X74A 2PS0A 4GNRA 4DC1A 2ORVA 1V47A 2M2IA 4GSKA 2YVLA 1RC1A 4PLPA 4RZIA 1T8TA 1PDOA 1TD1A 4JT9A 1OLUB 1ODSA 1L8LA 3CVOA 2O8DB 4CF3A 4RS4A 2QUAA 1NJ1A 4XB1A 4C43A 4TV9A 3D5EA 2PD4A 3CV3A 4OM7A 1JXQA 2BLNA 2ZT6A 3H83A 4PZEA 1H2WA 4Q0MA 5BW8A 2EX4A 2PLAA 1UPAA 4X1IA 5DNAA 2WK1A 1SVMA 1K4KA 1I32A 4LRQA 5CT9A 4DRYA 5J58A 1U2EA 4G36A 3G0OA 5JJ5A 4EARA 1ZK4A 1ORVA 3HEAA 3D4PA 1TXGA 1OYYA 1RW4A 2I80A 1T5DX 5LP6B 2QB5A 2IYNA 3L49A 4JU8A 2XKAA 5A6SB 5DNYB 3Q9LA 4C0JA 2FR8A 5JJBA 5JT1A 2AUTA 1Z63A 4C2BA 5LZ5A 3DC7A 5IK2D 3BXPA 4LZLA 1ZNYA 3HEBA 3EPLA 4BMNA 3NUZA 4H59A 1AKYA 4BMVA 1WMBA 3KXDA 1LK5A 1R6TA 1WG8A 1XYGA 2EV9A 2JRLA 4QYSA 4R1OA 3AF1A 4V3BA 4RTLA 1C7FA 1T35A 2VZ0A 5AW6A 2WNSA 2X5KO 3BRWA 5JDCC 5FTWA 3TBKA 3PNSA 1AUVA 1FP1D 3N6XA 3IMKA 1M0SA 1ZIDA 3CNNA 4E88A 5IXJA 3AF5A 3A7DA 3I1YA 4NOJA 4A27A 1EBFA 3H2HA 4Y9DA 4G4SO 4ER3A 1F5SA 3D7NA 4WJKB 421PA 2I2BA 4FMDF 4I36A 4DS3A 1MX3A 2ZRHA 4GUAA 4FNMA 3GJ4A 3WB1A 4C30A 2AE1A 1GZHB 2W2QA 3KBOA 4PC1A 5HRCA 2JAUA 1O08A 3WLOA 4WDQA 3R44A 3B2EA 2MSDB 5IKEA 3E2MA 3CPJB 3VR3A 1T1IA 1N6IA 2YY5A 3CUEF 3EASA 4MPTA 4A6XA 1NUQA 2I1QA 4EGFA 2HJHA 2DWPA 4HVCA 3ESCA 3UANA 2FUCA 3LHDA 3R0QA 1SHUX 2IP1A 3NEJA 3JQBC 4IGAA 5BXYA 4MX8A 1I7SB 4FXPA 4G5YA 2JD2A 5JS7A 3BWMA 4ECAA 3WJ7A 2BFPA 1CF9A 1DVRA 4V0MA 5H82A 4M7WA 4WZBE 5KVVA 3UFBA 3CZCA 2BYTA 2VA9A 3G5AA 3KAPA 4QU8A 4CIAA 2OVFA 2UV8A 4DMLA 5JANA 5JS1A 4RV4A 4RKYA 4ROSA 4N82A 5CJJA 1ZGHA 4EOGA 2H65A 3QY0A 5A5EA 2QLNA 4HGZA 1J2RA 1LJLA 2FZKA 4YCJA 1DINA 1WZNA 1Z0JA 2A94A 2LP4Y 2OO5A 2A1TS 1XJWA 4KSCA 5A2GA 3U1TA 5EP2A 2ZUVA 1RQPA 3E58A 1G5FA 2I1WA 4LXQA 1SZCA 1M9NA 2ZQ5A 4Q3DA 5E4FA 2J09A 1Q3KA 1EA5A 3R7BA 2IPAB 2ZIXB 2COKA 3DO8A 3IHTA 1TDJA 1HE1C 2XSZD 2TMKA 4QPZA 4IJKA 3NBFA 4HXFB 1UKZA 4EG7A 4AK9A 1Y34E 4I9NA 2Q0XA 4TQ9A 4UMEA 2DPXA 2ZI3A 3OM8A 2P9JA 4MRMB 3PGMA 5ALZA 1SXQA 1E1YA 1YNSA 2XUDA 4JIMA 4EUNA 4QLAA 5TNXA 2KSQA 1I2MA 3E5RA 1N2CB 1R37A 1ZGGA 4MUAA 4TMWA 4X1YB 4JOCA 3VU8A 5AXDA 4Z1MA 5BN5A 2YFQA 2QG9A 4CF6A 2AQHA 1WW3A 1UMBA 2HHCA 2O20A 3ABOB 3NP9A 3G2IA 4NHEA 4DANA 4Z53A 3DOIA 1EFRD 3TVTA 2PMEA 3WBFA 2Q7DA 5L6MB 2QRZA 2QYTA 4RHYA 3KOWA 5HS6A 3A04A 1GG8A 1QYVA 2VJNA 1NYQA 4Q4DA 3SE0A 3GZNB 1D6MA 4MWSA 2VJLA 2YWCA 4NAUA 3RYFA 3K9LA 3ZY5A 1U7HA 2GXSA 4TS3A 1P0CA 2ODBA 3DW3X 4Q37A 5A3SA 2W9XA 3RSSA 2XRFA 2UZ0A 2O9JA 3NVAA 5ALUA 1OY1A 2J9FB 5HX7A 5DMXA 3RG8A 4NULA 4CQMD 3ASUA 3FLAA 3U9LA 4AAYA 1KI1A 1NZJA 4ILKA 3GJZA 2TSYB 4MV9A 1XRMA 4D3YA 1K3FA 2C8VA 2NN3C 2VHVA 3B6KA 2JZCA 4TROA 5JMPA 2YKGA 2UXDB 1JDPA 1U4NA 5BPFA 3LYLA 3EPRA 4DV0B 3OEHA 2WNHA 1PUXA 4U7GA 4OBWA 1WPXA 1P6QA 1K3UB 2D8AA 4IIJA 4X44A 1QH9A 1WXHA 3KWMA 3QMPA 4EKNB 1JVNA 3VVMA 1JHRA 4FCVA 2RJNA 3D8SA 1QFSA 3Q9UA 1DNPA 1YK1A 3DUFA 4O2BA 2ADFA 4IKPA 5FV4A 3L0IB 1QIJA 2H06A 4FFOA 5SV2A 3BGOS 3F5QA 3VTAA 5IMBA 2CYAA 1BE1A 1MKYA 2QXTA 1EB8A 1X9IA 3HKBA 1UUFA 4A8JA 1RHMA 1ZVVA 1I6KA 4L0CA 3EZGA 3T1VA 3AUAA 2DMRA 1W52X 4ZVNA 5KZMB 2K2WA 2BY4A 3LLSA 1AJEA 3JQAA 2W2NA 4DLTA 1VMDA 3RREA 4D0GA 4F4HA 4ZYLA 2ONYA 2Y71A 1UC4B 3EPPA 4C4AA 5K6AA 2ODPA 1E1MA 1D2NA 1JQAA 3UXYA 3FDXA 4F5EA 3IAS6 1E8MA 2ZB4A 3DMTC 1C2TA 2HLDD 1G5QA 2V03A 1D4FA 2FZ5A 2JHFA 2PKYX 3MCWA 1P0QA 1CXZA 2OK8A 2WF9A 3FBGA 2REQB 4L3VA 2H85A 4DA0A 3G59A 4FHDA 4MVYA 1ONOA 4HLQB 5CYOA 1Z5ZA 3S40A 4RCYA 4WE3A 1SMKA 1V1MB 1NDUA 1C7EA 1N8SA 3DZJA 3KQKA 8MHTA 3ITDA 5LDDC 1C7IA 1U3FA 1UQRA 3UO8B 3R4CA 2HH9A 4ZVRA 1QHHB 5NULA 1YQGA 4QSHA 4DLWA 3TLYA 4O08A 3PTLA 2XIJA 5BYBA 1SVOA 2XUFA 1U8FO 1L4HA 1WY7A 2WAXA 3WWEA 1OR8A 3HWRA 3HUEA 2YZGA 3IH5A 4JWTA 4MVJG 1XD8A 3J7TA 4OUKX 2X41A 4OXQA 2QV0A 1MCZA 4FE3A 1DB3A 3A1NA 4FS3A 3BXEA 4YS6A 4Z3DA 4EDFA 1F7UA 1E4YA 1G0NA 4RJJA 3M4NA 2K4MA 2Q2OA 1LLQA 2XKBA 2XE6A 1GFZA 1ZICA 2G4VA 2ODWA 2ZJBA 1XQ1A 3DE5X 3NRJA 3O4VA 2ZJAA 4M0CA 2VBFA 3C8MA 3O75A 1LWOA 4OFXA 2X2OA 2A84A 2V8OA 1CJUC 2DCUA 4YONB 2GN4A 5HE8A 3U0VA 4B6FA 2C94A 3BFVA 3GLIA 2HHHB 3UMSA 4DQ0A 1TAHA 2Z2JA 1BXKA 1UFRA 2XW6A 1CJTC 3G0BA 1ZN8A 1T4GA 1TJYA 4Z9BA 3OCJA 2FPOA 4RD3A 4RBNA 1U1GA 2AEJA 2PVSA 5FFMA 3L7CA 3RHZA 1GR0A 3FNQA 3ZNQA 4E1AA 4BWYA 3T7KA 4TT3D 2BEVA 1A8UA 2ODNA 4WESB 5EJEA 1WDWB 1YR7A 3FHLA 2C4WA 3ZX4A 2H54A 1ZCAA 1U8XX 1KSGA 1SGWA 1S2GA 1G8KA 2D5CA 3RS7A 3CVVA 3HGQA 3QX8A 1G5IA 2XNDD 3OQMA 4UJ3A 3EQ2A 1EK5A 1KFKB 1VTKA 3HHEA 2NUAB 5FKJA 4JI5B 4E07A 1PNOA 2BHLA 3N86A 3PEEA 5ALQA 1U6IA 2QTGA 1QQAA 5C5DA 5ALTA 5TVKA 5IDWA 2V7WA 1GPDG 4H1HA 4MZXA 1QU2A 5GZ6A 4GPZA 1NN5A 1GAXA 2E5LB 5JNVA 4OGLA 5F78A 2WI8A 1TQDA 2Q5OA 4UNSA 2F9FA 2M32A 3RK1A 4DRXA 1T4BA 3AETB 2QWXA 3AIMA 1MOPA 3RJMA 4EGJA 2D5BA 3TD9A 4UUOA 1O7JA 4CTJA 3ND9A 3VVBA 1PZEA 2ZYWX 2GZSA 3D0OA 3ZJ5A 3GOHA 4X8HA 3T7SA 5KU1A 5LPNA 4IIJF 4HP8A 4NECA 9MHTA 1MW8X 1SOUA 4E2FA 1BCSA 2NLOA 1J0BA 3BMOA 5D8DA 1C1XB 1XAIA 1E92A 1MTOA 3ZI7A 1TJPB 4MMZB 2PHZA 2CK3D 3F67A 3EZ7A 1S8AA 2IOQA 2O4CA 3GEBA 2A3NA 3MLBA 1YRHA 2F2TA 5BN4B 2CLKB 3CW8X 1NV8A 3RUDA 2OBMA 2IF2A 4LGCA 3TK1A 1DKRA 2HNKA 2QRKA 3MMXA 5BRJA 5KTYA 3EJ6A 2C4NA 1T0BA 2FW7A 1F2VA 3NORA 2H51A 2PU5A 3EGEA 4LZZA 4RFVA 3E1GA 3SBXA 4YECA 3G2KA 3E7DA 5B57C 1U28A 4DGSA 4AC9A 4WADA 3V55A 1CDDA 1Z8HA 4MS3B 5BNWA 2QL9A 4S35A 1K8YB 1TZMA 3RC7A 1W4LA 3VYTB 1ZZEA 4DLLA 4DR2B 4OI0A 3LPMA 1B00A 3BIJA 4JP2A 1IZ9A 3AF4A 2OB2A 2C54A 2VUUA 4HFJA 1BDIA 1P18A 2CDRA 3ZIUA 1H8HA 2HJWA 4ME6A 3PA6A 5TMEA 5E1DA 5A6VA 1K3TA 3I5YA 1ZIXA 4R8RA 1CUWA 4W1RA 2MCFA 3CH6A 3V7NA 1SCJA 2HZ7A 3NGXA 4KLCA 4QQFA 1PX0A 5I9MA 4DQDA 5ALYA 3P0JA 2GAIA 1KAEA 4KTTE 5GIPE 1QQTA 2IV2X 5EJFA 2Q62A 3LIPA 2IODA 1X87A 5G53C 1Z6PA 5ICCA 2O6HA 4PZYA 2XCTB 4WI1A 4LY9A 1EFVB 3LXXA 1XLWA 1ZHHA 1N1DA 2JIRA 2CBGA 3EYWA 2MSEB 2ZJOA 3HQ4O 4KN5A 1M1XB 4Q7KA 2BLLA 1GCIA 1XYYA 2R7LA 2PGJA 3B1ZA 1NYRA 1QDUA 1YQEA 1W88B 2EKPA 3AUFA 1LW6E 3EF1A 3T52A 4M60A 3ZNOA 4BQRA 1YR8A 5B55A 5KJ6A 5LOVB 2UYCA 1NN3A 2ZYAA 3HBNA 1CR1A 1KVUA 1NM5A 1KQOA 2CL0X 2H00A 4WXRA 4F4IA 1YF3A 2YIJA 3T9AA 3WYFA 4D0LB 1SVUA 1J25A 4MNTA 5DK4A 4D46A 2LCIA 3DV2A 3EG9B 4KODA 5AKLA 1TIKA 4EPWA 1TFUA 1S96A 1GP2A 2BHRA 4UUBA 5JNWA 4FFNA 4NF2A 3K9FC 2GPJA 5BT9A 4A1FA 2AOTA 2WVGA 1A0OA 1OBFO 1VHWA 2GYYA 4BNUA 4NAVA 1QNLA 3LL4A 3OA0A 1SJ9A 5BSEA 5ECYA 4HAXA 4B6RA 4TXJA 1F17A 5LL6P 2JFFA 3HN7A 5C8DA 2GHQA 2XRYA 3DLPX 1NLFA 3IAM1 2VI5A 4JA2A 4K0RA 5EZQA 1D9XA 1UINA 3AEUA 3PT9A 5B6JA 1Y4ZA 4RPCA 4F6LA 4C7JA 1T9DA 3PR1A 1SG0A 4ALIA 5CITA 3SJUA 3HJAA 2V7UA 5BWNA 3DOCA 3AUKA 3CN7A 1OWMA 4QXQA 4X6LA 3ZCUA 2ZYVX 1Y3BE 2F3PA 4UU7A 1O89A 4MR7A 4UU0A 2CJFA 4YRFA 2G0NA 1DWPA 1A2OA 5EIEA 1G3QA 3OTQA 4Q9LA 1M5RA 1PYDA 1SR8A 3SYRA 4PAQA 5DO9A 1GU0A 1J33A 3AOEC 3R3YA 3VZQA 4D79A 4NNJA 2OEPA 3QVGB 1LF5A 4Q3CA 1UPXA 4I55B 1Y4DE 3O8QA 4AKEA 3PNVA 1M1YE 1J7JA 1ZO8A 1K9VF 3TR6A 1NX9A 1TO2E 1DPGA 2I2WA 2J08A 5K8UA 2G9VA 4P82A 5GONA 2H2GA 4ESVA 2HMUA 1NF2A 3CUWA 3KX2A 3QVXA 1GTJ1 5IF9A 4G5HA 2VAMA 1KAQA 3BM5A 1U0NA 5BR1A 1FBTA 1SXJB 3GQVA 1JEOA 2ETVA 4QYMA 4R16A 1UKBA 4EF6A 2PXAA 3QEAZ 5JZVA 1KDOA 2KJQA 2JW5A 5HJEA 3EFOA 2VP9A 4EZEA 2EKBA 3FRHA 2NO9A 5KBYA 1UPCA 3BIFA 1XMJA 2BKLA 1C3JA 4K7JA 4B34A 1Q6ZA 4K3VA 5IC5A 3WLEA 3VRHA 1SC9A 4O4HB 3D8BA 3INTA 1YZNA 3UATA 3G68A 2N9UA 4UEKA 1EP1B 4JEUA 3ZD6A 4R9RA 1A5TA 4OSEA 1JB9A 2ZU0C 2OHXA 3MTEA 1IN7A 3ONWA 5TMDA 1OH6A 3DFIA 5HOQA 3P26A 2PCJA 3C6ZA 1KZ9A 1NF3A 1NSYA 4XYMA 4G2NA 3T3MB 5DTEA 3DVAB 4COOA 5ADHA 1MB9A 1KYZA 1TMKA 1ZD4A 4FGKA 4IM7A 4J0HA 4K88A 3GG9A 2P2ZA 2RHJA 4PC6A 1U04A 5FL7D 3T5DA 1IL0A 4IBOA 2CHQA 1XK6A 4QNRA 1XEWX 3C5EA 1FDUA 2ZI6A 3BWYA 1XQ6A 4KN8A 5BUSA 5FBWB 4PRYA 1DCTA 4KR2A 1QLJA 5FNVB 1QHFA 1XMXA 3NOXA 3VZSA 1B8UA 1P4HA 2L82A 4HB2A 3EIEA 4KQ2A 4QYWA 2FSPA 2M1XA 3SOZA 4OXIA 2BTQA 3ZIAA 4HNRA 2CV1A 3ROMA 1ZITA 2BKEA 3SMVA 3O4IA 1XD2A 2YJ5A 3GR6A 3PR2B 4KQGA 4EW6A 1W7AA 5JNSA 4YRGA 2RAUA 4R8KA 5L7WA 1UOQA 4MMYB 1RBZA 2I6SA 3EYAA 3A6KA 3CF4G 3PZBA 5IVHA 3ES9A 2OK7A 4DDMA 2GD1O 5C8YF 4D9IA 1Q22A 2NT4A 1BE6A 3R3HA 2QM0A 2RK4A 1GPWB 1NLUA 3GQBA 5CA0A 3WIUA 1M0WA 5EIFA 3HCEA 1RWOA 1SUIA 3SGLA 1UWCA 2VHUA 5IJXA 5DISB 3EOBI 3D6AA 1QK3A 1TGVA 4NJMB 1DKLA 1W8DA 2C9ZA 5FWAA 2W83A 2WJZB 3NHMA 4PRKA 2NP7A 3KEFA 2A14A 1MT0A 1A5SB 2POCA 3LD9A 4IS3A 2VF2A 4RVFA 2QY9A 1JR3D 3ZWBA 4B3MB 1IUKA 4ZO9A 3VNAA 4FWBA 4EUKA