4YK4C

Human antibody 641 i-9 in complex with influenza hemagglutinin h1 solomon islands/03/2006
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
225
structure length
220
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTDYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARRRSDFETVDFIYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 641 I-9 VLCL antibody
publication title Viral receptor-binding site antibodies with diverse germline origins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 36
structure length 220
sequence length 225
chains with identical sequence Z
ec nomenclature
pdb deposition date 2015-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yk4C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yk4C01
3MRDB 4O02L 3BRGC 3BKYH 5SX4H 2Y36H 3IDGA 3MZGB 3T77B 5EOTB 3VG9B 1RZ8B 5DEZA 4PJCB 3RU8H 2PKDA 4G6AD 4B41A 4M3JA 4LPXA 3DSFH 2H9GB 2GSIB 4U1MA 4GW4A 3VXRE 1I8MB 3BE1H 1Q94A 1FIEA 4OV5A 5C0AE 3QAZC 5ACMA 1PQZB 1H15A 1GXEA 1PG7H 3NCYP 4U6YA 1C12A 2AJSH 4UOW0 1OTUD 2IWGA 3L3KA 5LCVH 1TZHA 2VXVH 3BRDA 1A14H 2WINA 4YIQB 3HC0A 5HI4C 5KANI 5J1SC 3X3FH 1BGXL 2A6KB 4F9PA 3BVNB 4ONHA 4PJFE 1G7LB 2I07B 5IR1A 4YHNA 1WBZB 3D3VB 3FFCE 2K7QA 5E8OA 3OAZH 4X6DB 4TPRH 1QFPA 2EDTA 4XBEL 3P4MA 3CVIL 3PDOA 1RMFH 3WFBL 3T0AA 1AHWC 3V7AE 5TDOB 3U4BL 4U7MA 4R4ND 5GZND 2EE2A 1S9WA 1TCRB 4LPYA 4KDTA 4KTYA 4U33A 5CD3A 2X9WA 3M07A 5FYJL 4JZJC 2XICA 4IOIA 2FGWL 4HUWB 1B2WH 3RL1B 5HHVH 3QDJA 1LGVA 2DQHL 1YEHL 3NPSB 3MYJA 3CVHL 5CILL 3S5LA 4F33A 4KDWA 4DK3A 1DTUA 3WN5C 1UB5B 4HS3A 1P1ZB 1NMAL 4N5ED 5IOPA 2AP2A 4Q9QL 4R7NB 4GFTB 1VPOL 4LCIH 4NPYA 3OJDA 3LDBB 1SBSH 1I1RA 4GKSA 4PY7A 2GI7A 1S9XB 2DIBA 1A6TA 3WJLA 5AZ2L 2YXMA 4RCAA 3RDTB 1U8PB 4PJ8A 3SOBH 1LDPH 1FVEA 4KJPD 4MVBC 3W81A 4TUOB 1E6JL 3OHXA 1D5BA 3MLRL 1JNHA 4D9RD 1MLCA 4YBQC 4KRLB 3T3ME 1CTNA 3LKQA 1MHCB 1GGBL 1HI6A 1NKRA 5ISZD 5F7UA 4RAUB 1D6EA 2ARJQ 1REIA 5JIPA 1JPST 4Z7UE 5F21B 1WFOA 3LN5B 4PJ9A 3PHQB 1FRGH 3CK0L 2BNRD 1RPQA 4MCZA 4Z7VB 5MERA 5FCSH 1FC2D 4JFZH 1D6VH 1RY7B 5DT1L 3S37L 4QRRA 3KAAA 1OAXL 4L9LB 1HCFX 1BX2B 3HNTH 3E6FA 2BSSB 3T1FB 4NNXB 1BFVH 1WT5A 1D5MA 2L0DA 3MOAH 5CINH 5EU5B 2NCMA 2BDNL 3VD3A 3TPUB 1HXMB 4G9DB 1CGWA 1I3GH 3GSUA 3LKSA 4ZD3L 1Z0NA 4G8GD 1A4JB 2WK2A 4NO5B 1F8TH 3L3HB 5D7JC 5J13B 3GBLA 1YUHA 3SE4A 4JFPB 2VDPL 1WTGT 3LKPB 3T65A 3D2UB 3QHTC 3LQZB 1TXKA 1MVUA 3QXDA 4MAYB 1SYVB 1F4YH 5GGVL 4NZDA 3QJFB 4GMSL 5D9SA 4GQ9L 2NXZD 1P4IL 1G7QB 3G5XA 3C60D 2QQQA 5ALCH 1R5IB 2NY1B 1BQLL 4NM8H 5B4MD 5A2JH 1NAMH 4NJAH 5CJOL 4KHTL 5DJCB 2PXYD 1I1YB 3BUTA 3K8MA 4XX1G 4HFWB 3ZE1E 3MCKB 3O4LE 2HJFA 4NYLB 2GJ6D 3UO1H 4PBWD 3ZYJA 2UWEA 5HYSB 1EV2E 2P5EE 1IC5H 3FQUB 1NAKL 3EYVA 1PBYA 3BSZL 5HDBE 1H3XA 3PWLA 5LAXA 2V5YA 5GQBA 2BC4B 2CPCA 4X6DF 4NBXB 1MUJB 5IQ7H 3CC5B 5DJAA 5MENA 2AEQH 5KZCD 2D2OA 1P4LA 3LRSA 4XH2B 5I66A 4Q9RH 1R3KB 4ONFL 2D4DA 2FBOJ 4BQBA 4YHKH 2EDWA 5EBMA 5D1ZA 1QPXA 4NQCB 3IU3A 4QRPA 4PP1C 3GUTB 5JUEH 3SDCD 5A2KH 1DBJH 4G8IB 3N85H 2ORBL 3VXME 4JB9H 1KJMA 2XWBB 5ESVA 1KTRL 4DUVA 2IAMC 2WNGA 3J7HA 5JW4R 3SGKA 1CD1A 1NGQH 5KG9B 2PYEA 2FX9L 4DFIA 1A6AA 5HHQA 1CBVL 3MNZB 4OLZL 5TDNB 1KBGH 1XCQA 1AHWB 4ZFGH 5ICZB 4FQCH 4ZPTB 1Y6MR 5E2JA 2DD8L 4MNQB 4PB9H 4EXKA 4YDVA 1UYWH 3RZCA 4JZJB 3PWUB 4LSQL 3U36B 4WTXA 4BUHA 2WUBH 4Z6AT 1K9TA 3QFDA 4PRDB 3MRLB 1XCTA 5K9KA 1A7NH 4OFVA 3AMKA 4XVUD 2IG2L 2X4PB 4X9GA 3TH4T 2WUCL 5C0BE 4JFOA 1N64H 1CF8H 2PW1B 3RFZC 2NX5D 3WN5B 5C07D 3EYOB 4ZFOA 4UIMA 2X1PA 3GO1L 3SJVB 4Z78B 3IVKA 1YEJL 1RJZB 2FH8A 4WFFD 4CW1B 3CLEL 3NTCL 1NLBL 3P9WB 5GS0H 3KDMA 2HRLA 5DTFA 1T6WA 3X3GL 3O3DA 5T5FH 4YXLH 2WP3O 3MFGB 2PTUA 3WS6C 5C0JA 1AR1C 1W72L 1B0GA 5IVOA 2XWJA 2ZPKH 4WEUD 2FYYA 3OKKB 4M48L 1T1WA 4U05A 3DBXB 1UADC 3CDFA 2G60H 5DSCB 2GYSA 3MCG1 4KROD 4OB5H 5E08L 4LK4A 2K1MA 3DGGB 4JRYE 3V6FB 2C3XA 3RWFA 3GMQB 3PGFL 1KTLB 3HHRB 1QLRA 3KPLA 4W4OA 1KGCD 5EULV 5KSUB 3QB7C 4ZSOA 4AM0A 3GRWH 3PQYB 1NUNB 3PHOA 3ZKND 1A7QL 4RGOH 3RVXD 2ADIA 4YHLH 1MFCH 1T21A 1MCNA 3HMXL 3RUGE 3F58H 3MRPA 2BSRA 5IMLA 3QXAB 5I1DB 1ONQA 1DQQA 4XP1H 3QG7H 2DBLL 3MFFA 1BZ9B 4MZ3A 2WQ8A 1OAYH 4P4RA 1UZ6E 5BZDA 4QXTB 1PG7W 5I8KL 1H9VA 3OG6B 2P5WE 3O3EA 4HBCL 4YWGL 3VDCA 3KYNA 3QQ3A 4DN3L 1OAZH 4L3EB 4XBGA 3O3BA 1BFTA 1P69B 4PJ5B 5D7JB 3SGJC 2R1XB 3W9DB 1CD8A 3R0MA 5EU3A 4LRNL 5I8EB 3OXSA 2CLRA 5FECA 1U0QA 5IW1B 4OCYL 1XFPA 4N0CC 4GS7C 2P49B 3SDDC 4OZIF 4NWUL 1I3RB 2FJFA 1RUAH 3ESUF 4NQDA 3SDAC 1TJHL 1U8JB 4ZG1A 1RZ7L 3MYZA 5E7BA 3HMWH 3DOSA 3HZMB 2ZOLA 4XPFH 3ZE1F 1X5KA 4I4WA 1JWSA 1F42A 5DD5H 2ZSVA 4RIRB 3QPXL 1XIWD 3LEVH 2AJ3A 3G6JA 3S8WA 1OPGL 4OTXL 2IQ9H 2QQLL 4H1LH 5C0ND 5CHNB 5D2LE 1FNGA 2EIZA 3TO2B 2BHYA 5H8DA 3ZDYE 2XNAA 1LO3H 3MNWA 3GSXB 5BW7C 4FZEH 5D1XA 3S4SG 1X5JA 5BQ7A 2Z31D 1GC1C 4X0KB 1FL6A 1J87A 1DJSA 3ZE0E 1S8DA 1ZT1A 3VCLA 2XG4A 1KG0A 3DRTB 3MJ7B 4DVRH 1JHKL 1WFUA 5JOEA 1H3PH 3ORJA 4RDQF 4OGAD 5HVFB 1YMME 1P4BH 3HI6L 3D85B 2VZSA 4ZS7L 1KTDA 4OD2A 4KGJA 4DGIL 2OJEB 2A0LD 2DI8A 1CDHA 3TBVA 3TA3A 3O2DA 4JM2C 5F1KC 1NEZG 3F12B 4JQVA 1P7QD 3QEUA 4KVNL 4NQXA 4LLDB 5GSVA 3OGCA 3V2AR 1M7IA 3DI3B 1AI1H 5BRZB 3ULVD 3LIZL 3ISWA 1SJEB 3PGCA 4AH2A 2NYYD 3BZFA 3WJJA 2GUOB 4I18A 4Y19B 4XI5D 1H8OA 5JPNB 4O2CB 3SN6N 1DQMH 3MUHL 4TUKH 1T04A 4HJJL 3KNBA 1JK8B 3KLDA 2IPTH 5DWUL 4UT7H 4WUKL 1AC6A 1VFOA 1Q38A 2WBKA 3R0NA 3P40A 1OTUC 1IBGL 4RWYH 3D39E 3KPRB 4ONGL 4DUXA 3GJFK 4G42B 1C7SA 3ARWA 4Z77B 1H0DB 2VDNH 2HT3C 1M05A 5JHDB 5DD1H 1ACZA 3OF6A 4Q2ZB 3SCMA 4BELD 1SEQL 3NCCB 1S7SA 5EU7C 1AXSB 1LD9A 5J9PA 1A3LH 1AKJA 5D7LE 3L3JB 4WUUE 3MLXL 4R4NC 1ZSDB 4X4YA 2C1OA 5BVPL 4CADA 5ID0A 3RVVD 1WC7A 2BMKA 1A9BA 3UBXG 4JPKH 1WCQA 5K9OB 4RGND 3DTXA 3ARZA 3VWKA 5BS0D 5FOBB 1ZMYA 4GOSA 1ZLVK 4K94H 12E8H 4LSVH 4Q6IC 2FATL 3KYMA 3OV6A 1HYSD 4HF5L 5C3LD 2P7TA 3RX7A 4NOBA 2B4CC 1BHGA 3F7QA 2GEEA 3KPQB 4NRZB 1LK2A 4ZXBC 3RIAK 1SQ2N 2R29H 1RZJC 3MRMA 1LO2L 1ZS8B 2P24A 4M8VA 1GJIA 1MNUH 2YKLL 2AAVA 3RNKB 4LLAA 4NKIH 1MRDH 2VH5L 3CFJA 1CGXA 1XT5A 3MA7B 4POZD 4O2FB 1IAKA 3G04A 5HVHC 3MXVL 4HQQL 3O2DL 2W1NA 2I26N 3A67H 5LQBL 2DTSA 3X14A 2OYPA 5IVXB 3SDDB 4BH7A 4RFNC 1D9KA 5I75C 1TVBB 3SDAB 4XVTL 4K55A 3WL9B 3RY6C 3WUWA 5HYQB 3BEVA 3O2WH 5HHOD 2VXTH 2M8XA 4YPJA 1YMHA 5FK9A 3ZL4H 3EOBB 4Y0GA 1RU9H 1IGFH 5DJYA 3H9HA 5I30H 3C2AH 2VR5A 2JJTC 3QDJE 1Q1JH 2EEAA 4MD5B 1NCCL 4L9DA 5FYLE 1CCZA 3BPOC 2XKUA 5JDJA 4ODUB 5IB2A 3ARDA 3MRJB 2BFVH 2IBGA 4K71C 5DJ8A 2QSQA 3B43A 4M1DH 1FGVL 4YDIL 1S7TA 1JF6A 3INUH 5IB3A 1QOKA 4JEGB 3UTSB 5JLZB 3MV9B 4JFQA 4XNUL 1OTSD 5DQJB 3TBYB 4TVSa 2FWOA 4G6JH 1WBXB 4N9GA 3FB6B 3TBTB 2SEBA 3Q6FA 2R0ZH 1QA9B 4GG6A 1IM3B 1SVCP 1XF4B 2Y07H 3DARA 1K2DA 4G6KL 4NT6A 4OZFB 1E4KA 5FO7A 1SEBB 3QI9C 5HJ3A 5FKPB 4P46D 3QG6A 5FV1L 3FB8B 4JM2B 5L2KA 2PXYC 4HK3J 3S36H 5D5MB 5DC0A 1NCAH 1Y0LB 5EOQH 2MKWA 4QTHB 1RIUH 4XRCA 3K8KA 3S3JA 5DD3L 1ZLSH 3IAQA 5IBLD 3QUYD 4LKCA 4Q9BA 1TENA 2E9JA 3D18A 4QRRE 7FABL 2I5YL 2ESVD 4ODWA 4YQXH 2CDFA 1YYML 1CDBA 1J88A 1P2CB 1L9NA 3UTTA 5F3HA 4PRPA 4WW2A 2VIRB 3F62A 3PV6A 4WTWA 5DURD 3F8UB 3OZ9L 1U93B 4OCLC 2EE3A 1EUTA 2X4UA 3HZYB 5DJ6A 3UP1A 4N0YH 4ALAL 1HK6A 4MA3B 2X70A 3OKNB 4W70A 1K5NB 43C9B 1MCWM 5C0DB 4HPYL 3SDCC 2XT1B 3ULVL 3KPSD 1T03L 2J4WL 5FHBH 2EYSA 3FQNB 4EI6B 1KV3A 3BMWA 3SBWC 3L5XL 5TF1L 1FVDA 5E7FA 1OCWL 2HG5A 1UJTA 1QSFD 1RUQL 4MHHI 2YN3A 2E7BA 5DMIH 1BVKA 2JJWA 2V5SA 3WLWD 2XOTA 2X4TB 5DRZB 4OF5A 2EDBA 2NY4D 3J8F7 1BQUA 1HINH 2CK0L 3ME0A 5T1LD 3NFNA 4JFXA 4OM1L 4I9WE 1KCRL 4D0BB 2UWEE 5DVLA 4HLZH 3K0WA 4K7PX 5CUSL 4Q6IB 1I7RA 3JV6B 4Y1AD 4NO0D 1FYTA 4XVUC 3OB0K 1YN6A 1ZGLM 3L3DA 2Q7YB 2P8LB 3ZSTA 5F7DB 5GGTH 5MENE 1D5XB 1IC7L 3P9MA 4JDZA 3AUVA 3WMSA 2PETA 3TT3L 5GGRY 4ZXBB 1DE4A 1A1OB 3DETD 4B53A 4QRPE 5BJTA 4U2YA 4NUJB 3WLBA 4FNLL 5TF0A 1IEAA 1CI5A 3KYKH 1RJLA 3HPJA 5IW6A 3WXVH 4MQ7A 4KUZH 3E0GA 1BD2A 3JUZA 3HE7D 4KROC 5HVHB 1MPAH 3DIFB 4L8SA 2PYEE 4LGRB 4RFNB 1B9ZA 5I75B 4PJBB 4V2CB 1CLYH 1R3JA 2YPKB 3UJIH 3DV4B 4ZFFA 5ISZB 4O58L 2VZUA 1A7OL 2Q76B 1VGKB 3BD3A 3VH8A 1MFDL 3QIWD 3AC0A 1LP9B 1G9EA 3V6ZB 2F8XC 4OQTH 3NGBC 4XCNB 1UM5L 1Y18B 2AJUH 4EUPA 1XF2B 5FGSA 3I84A 2IFFL 3BPOB 5EIIB 5DFTA 4FQIH 1Z2KA 4HH9A 3FONA 5IG7B 1UH4A 4U1IB 5B22A 3CCHA 3CNKA 3C8KA 4K71B 3T04D 3VW3H 5F7KC 1CDIA 2BNUA 1RK1B 2IMMA 4KTDH 1NANI 2HLFD 2HWZL 3ZT6A 4F9LC 3IXTA 1EFXA 3D69A 4DQOL 5C0FA 5MI0C 4ZYKB 3WHE1 3Q48A 1JBJA 5E03A 5EBWA 2Y1VA 2Z92B 4TNVK 1L0QA 3O0RL 2VZ3A 5BOPA 5HGAA 5T3XL 1KCVH 3IAGC 2KL6A 3F6IA 4MGXA 3IXAA 3NIDE 2M2DA 2JKXA 1FGNH 1W0WB 3FAWA 1H3WM 3GBNL 4NQVA 3VXSB 2WLYA 3UTZA 1T1XB 4P5KA 1ZHKB 3QI9B 1XR9A 1T5WB 4F8QA 1TZGH 4CVUA 1LNUB 5TPWL 4YDKH 3MRHB 3OQ3B 2PXYB 2BY1A 3D48R 4D0DA 1A22B 1S7UA 2FSEA 2GJ6B 3DMMD 3QWRA 4KVCL 2DQGH 3B4NA 5E2TL 4OI7A 4OLYL 4LOUD 3DWTA 4OLWH 4WI9A 3EKCA 2E27L 3I50H 1CICC 2V2TA 1AIFA 3HR5B 3RHWK 2YWYA 3WSQH 5C8JB 3HNSH 5KSVB 4I0PA 3QEHB 1ED3A 4PV9A 4Z7WA 5KZCB 1I8LA 4YGAB 1B4JL 4FQ1L 5INDA 4R4FH 4WNQA 2PYFB 3V6BR 5C0IA 1RFDH 1SM3L 4Y2DC 4ZTOL 4YHZL 1WIUA 3SDCB 5A43C 2DQCL 1YN7B 3R8BB 3DX7B 3FMGL 2QQNL 4G8EA 2WWKT 2GIYA 2QSCH 1Z9MA 1EEYB 3B83A 4PJAF 4ELKB 1B3JA 3DVGA 3MREA 4ENED 2KZ1B 3CDGA 3L1OH 5HI3D 4NJ9L 4OZHA 1CLOL 3NPZB 1A7PH 1S5HA 1U8QA 1UJ3A 2VL5A 3N1GC 2V9TA 2ITCA 3BGMB 4NQDE 4UT6H 1QR1A 4J4PD 4FQHA 1P7KB 3VXQA 4C83A 1G6VK 3CLFH 2O61A 3U2SB 1QR4A 1LO0L 4WV1C 5C0RL 2UWEF 1OL0A 2YSSA 1J5OH 1OQOA 2ARJA 4JPIA 3G6JE 4FMFA 5L88H 5L2JB 3QDGD 1JZ8A 3AS2A 5BO1H 5E9DD 4EDXA 1ZA3A 4GO6B 2YR3A 4AENB 4BFEA 3O6KL 4NDMB 1QD0A 2D7QA 5ENWA 4NCC1 1A5FL 1A4KA 4ZAKA 4F2MB 4ZUVA 2NX5B 4OT1L 5C07B 4G7VL 3AY4A 4I48A 3QUXD 4X7TA 3I2CL 3QULB 4FN0A 2AV7B 3SDXA 4L3AA 3ALXA 1F3JA 1E27A 2V2WA 4OKVA 4PIRF 1T7VA 4XC3L 2HVJB 4PGCA 2QADD 5TQ0L 2CIKB 5AYUL 3I6KA 4LSPL 1TQCC 1NJ9B 2AKRA 2EYTA 3FOMB 4KY1L 3JV5A 2DQJH 3RVUC 4XMLL 2X10A 3MACH 4OLVL 4JO2H 2MCPL 3O3AA 5EIVA 3TIDA 3RWHA 3C6SB 4JE4B 5E2VH 1U8OA 4UBDD 4K7FB 4KROB 4NO2B 1UXWA 4CU6A 3AFLA 1U8MB 4ZQKA 4EDWL 4MA8H 1FO0B 4R26L 5J12C 4WI5A 5I2IA 3RVVC 1JTTA 1NGWA 4C4KT 4D0CA 2FJGB 4RGNC 3TYGH 4W4NA 1BZ7A 2GSGB 1IQDB 4YNYA 3VD5A 2G75B 3AB0C 3CVIH 3VFPB 4F57H 1JNLL 5D7IA 3NGBB 3WFBH 1HYSC 4L4TD 4PJHB 1VFBA 4R90L 1UKTA 1KIRA 4LEOA 3VD4A 4TTGA 3DO7B 1WZ1L 4F7CB 4MLIA 3T2QA 4JY6B 5IFAH 2OZ4L 5FYJH 4S2SB 4WFHE 4BFGA 1E6OL 2FGWH 4NFCA 4OGYL 4QXWA 3O2VH 5EO9A 4ODBD 1Q9LB 2I60H 2DQHH 3WFHB 3LH2H 4WDIA 1CU4H 1KJVB 4X98B 5MI0B 1RIHL 4ELME 1JGVH 1C5CH 3BP6A 2EICA 3MRFB 4ZS6C 4X4ZA 1NMAH 2V17H 4LGPB 2HJKB 1H5BA 2GT9B 5H35B 3F6LA 4CN4A 5H2BB 1VPOH 1AGDB 3AREA 4MXWH 4XGZB 1F58H 1RUPH 2LTQC 1J9CT 4LNRA 1FIGL 4A6YB 1E28B 1PZ5A 5GRWA 2X1QA 4HWBA 4NM4H 1VFAA 4IRJD 4NKMA 4U1KB 1V3JA 4I2XA 3O11A 1S3KH 1QFWH 5CP3A 5GRJL 4S1SL 2DL9A 4C56A 4PRHA 4Y4FA 4F15C 1CICB 4WY7L 1JZ3A 2XY1A 4XPBL 1NEUA 5EU6D 3U7YH 1ZLUH 1G6RL 2AEWA 3BAEL 4HHAB 1S5IL 1PZUB 5J3HC 3CK0H 1GH7A 2C3GA 3FO1A 2AK4A 4NOFA 3PGDB 2GCYA 3TM6A 2QKIA 2GTZB 2ZUVA 5DT1H 1S7XA 2R1YA 1U8LA 2F19L 2EDFA 2ZUYA 1J0HA 4Y2DB 1LE9B 4OD3L 3V52L 4PJFB 1OTSC 5CMAB 5ADOH 1U2HA 3GM8A 3VWJA 1FP5A 1KC5L 1QSED 2R23B 4KKBD 1DN2A 1H3TA 5DI8B 2BDNH 4WRLA 1I85C 1Y6NR 1FJ1A 1CVSC 4O2EA 1UKSA 4WJ5A 1TNMA 1ZLUK 2BCKB 3P11H 4ZD3H 4H0HB 5LXGH 4P46C 4KZEH 4NO3A 2QEJA 5EORH 4DCQA 2GJZA 4B7IA 2IC2A 5T5NG 1P7QB 4KTEL 4JRXD 2FO4A 4WV1B 4BK4A 1SBBA 1HSAB 1NCDH 1H8SA 5FGCE 4GAYA 2EDOA 1QQDB 1MWAA 1J1OL 4PG2C 2C7UA 5IIEA 2CJUL 1OARH 3NCJL 4AEFA 5ID1A 3DX6A 4ERSL 4QCIA 1BQLH 3VXPA 1KIPA 5DJDA 3RWEA 2X4QA 5D2NE 1W2KT 3MR9B 4XP4H 1GC1H 4KHTH 5B21A 1NUDA 3ARQA 1WSST 1T1YA 4U1NB 4HIXL 5IGXH 4KU1A 4ODHL 3HUJA 3BW9A 3MLPA 5LGJB 5C08A 1OQXA 2DQTL 4Z95H 1NAKH 1CS6A 3TIEA 5FO9A 3BSZH 2AQ1A 3O41A 1BBDH 4P99A 1BVLA 5EUOA 2R69H 1TQCB 5DJ2A 3D1MC 2DLFH 4OZFH 1DCLA 2DLHA 1ZA6B 2KDGA 3QA3A 3M1BA 5CJXC 4ZUUB 4X6CB 2XQBH 5E56A 1T66C 4GG6E 1QNZH 2HT2C 3TO4A 3EGSB 1BVZA 1KLUB 3I3BA 5GS2D 4HWBL 5J12B 4Y8DC 3WLWC 5F7LB 2XZQL 2YD6A 4OZ4A 1DDHA 3I02A 4Z7UB 5L2KE 2R1WA 1BF2A 4M7KH 1FFQA 4RGNB 1CFTA 2JELH 5I1EL 4OCSL 4MCYB 1HILA 5BS0B 3FQRA 4BZYA 3GKZA 2EH8H 5HYSG 3AB0B 2FX9H 5HY9A 1YNTA 3KJ4C 3QUML 4GKZB 4OLZH 1CT8A 1MJJB 4E41D 3E3QC 4GT7A 1WWCA 2HN7A 1WWBX 4HLZG 4X8JB 3UTTE 3LKRB 3ARGD 3SE3C 4XNMA 2DD8H 4PRPE 4S1QH 3HPLB 1IAOB 5D6CA 3TN0C 1I9IH 1GYAA 3KGRA 3MLZL 1G9ML 4KJQD 1EUUA 1BBJB 3WIFA 3WEXA 4ELMF 4U1GC 4LLQB 4LVNC 2CDEB 2VABA 2MWCA 3KPOA 4N1HB 3QEGH 1CDGA 3H2WA 5DHYA 4QY8A 3FOLB 1PLGL 1CTOA 4HS8L 2PCPB 2NW2A 5DHVA 4P2OD 3VGEA 2QV2A 4Q9CA 1R3IH 2N7BA 2EIEA 3W5NA 5T3XE 1W72H 3B9KC 5GGSB 5AG8A 2LTQB 1N7ML 1MWAL 2EDNA 3WUZA 5I18L 5I1GL 3DHMA 5ETUA 3VMNA 3O4LB 4XZUA 4QGTA 3HC4L 4MDJA 2C1PA 5K59E 4UU9B 3HCVA 3OWEA 3W5MA 2XTLA 3PWVB 1EPFA 4LQ1A 4M3KB 4HIEA 1HKLH 4D8PB 4F15B 5AEAA 1FYTE 3FB7A 4CAGA 4QRSB 1S9VB 3TCLA 3MRNA 1BIIB 1K4DB 4OQ1A 4LSRH 1MRCL 3IETB 2FHBA 3GZKA 1A7QH 4HCRA 1MLBA 2FB4L 3TJHC 2XZZA 1G0XA 1OY3B 2HLFC 3HMXH 1MRFL 3BQUA 3K3QA 5SWSA 1JZ4A 1BFSA 3GMLA 4HV8B 4OLXL 4MNHB 2ZCHL 4G43B 4X6BA 3PP3H 3NA9H 1A1MB 1SHMA 4PJDB 3VXMB 2DBLH 3GSWB 3JTSB 3ULVF 5E1HB 5IMOA 1BD2E 5EFIA 1ADQA 4OZGA 5ADPL 5I8KH 1EERB 5FAAA 3JVGC 4YH6A 2EDEA 1MCKA 4HBCH 4YWGH 3VXOA 2H32A 4EIGB 1AP2A 4R97C 3BP7B 3MJ8B 4JFEA 3C5JA 4P46B 2XFXB 4Z7QE 3ROLA 4PJGA 3UCRA 3TZVA 1IGIL 2RQ8A 3V0WH 1S7VB 1NC4B 4OCWL 3WXWH 2A74B 2AXGB 4FZ8L 4PRAB 3EDDA 3QNYA 4Z18A 4LOUC 2WSKA 3PXHA 3PP3K 2VLMD 1X7QB 1AXIB 2C26A 1IGJB 1UEMA 1QHOA 4MS8D 4QHMA 1RZ7H 3EYQD 3C9NB 3G08A 1A6UH 4CVZB 1DEEB 5C0BB 4OUOA 1XF3A 3DUSB 1U36A 3OJ2C 1FNFA 4IMLA 3GSNB 1FCCA 2EZ0D 3HG1D 1CG9B 1I1AD 1RZKC 2VDQL 2YD4A 4I3SH 3RJQB 4LCWA 1DUYB 5HHMD 4PR5B 1IQWL 2NPLX 4UINH 1Q0XH 3VFTB 1KYOK 3NABL 5EPMA 1Z9LA 1N5YH 3PWPD 4LHUD 2DQDL 2XN9D 4YXKH 4MWFB 3KPSB 3VXNA 1RUKL 5F8RC 3MUJA 1ETZA 2E7MA 1LHZA 4WU5B 4XPTH 3RVWD 1RHHA 2X4NA 5KVFL 3RPIA 4P4KA 4EN3A 1QSFB 1J0YA 1YDPB 1NFDE 3STBA 5M7QA 1HHGB 4LLYA 4UNVA 4MJIE 4J4PC 1A64A 2A9NL 1AGFB 2LAAA 4L4VD 3G5ZA 4NRXB 3MO1A 1F4AA 3GI8L 2ICEA 5T1LB 2BNQA 3SKOA 3ZYIA 5IKCA 5TJWK 3Q6GL 2DLEA 5EBLB 4JKPL 1P84J 1FZKA 3OR6B 4GG8B 1JGLL 3WIIL 1CL7H 3BHBB 4NCC2 3RUGB 5D72H 3U46B 5C0CA 2VLRA 3KJ4B 1EXUA 4NO0B 4HCRL 1BFOA 1FAIH 1YNLH 4LPVA 2AK1L 1ZVHA 3NACL 3MOBH 4KVNH 1U3ZA 3FO0L 4Z7WE 3QUXC 3CDCA 1FLRL 1CFNB 5IMKA 4DJMA 3TN0B 2P5WB 5F89B 4JVPA 1GSMA 4DKFH 2X2YA 1LEGB 1QZ1A 2QADC 3VXTB 4AT6B 1HHKB 1LE5A 1ADQL 2Q1EA 4U1GB 4XCYB 4LVNB 1W0VB 5DEFB 4HK0B 3QFJA 4TSCH 3K2UL 4HJJH 3GHEH 2HFGH 5JXAL 3HRZA 2YC1A 3O8XA 1KCUL 3S88L 2Z4QB 5FXCH 3DI2B 1MAKA 1R5WB 1UVQA 4UBDC 2CKBA 1NL0L 5FUOL 4MXVF 2J88H 5BV7L 1R24B 4ONGH 4OZHE 1MCDA 1N2RB 1J8HD 1G0DA 4GW5B 4PRBA 1CZ8L 3NBNA 4WEBH 1RJYB 4K23H 4LRIC 5TDPB 3AS3A 3B9KB 5DYOB 4L5FL 3L3OA 4BA8A 3DXAD 1GGCL 4KDTC 4S0TD 4QTIL 5K59F 1RZGB 2UUDK 3KPPB 4NKOB 4XNXH 3P77A 4PG9B 1ORQB 4UT9L 1YY8B 4AG4L 3OKDA 3U1SH 1N0LA 4OM0L 4OFYD 3AM8A 3MLXH 4J2XA 4QHKJ 5BVPH 2V7HA 5D2LB 1MFBL 4JFDA 4DEPC 3HI5L 4HPOH 1NDMB 3R06A 1VA9A 4E5XA 5IEKB 3X13B 5EZOH 4K8RC 1INEH 5C3TA 4WI2A 3C5ZA 1I4FB 2FIKA 4MJ5A 4HMEA 4NCDA 3SDXE 2FJHA 4BQCA 2P8PB 1Z5LA 4N0UA 1CGTA 2DAVA 3LV3A 1F97A 4K9EC 5JZ7C 1F2QA 1GOGA 4PJ8C 1EVTC 4DN4L 4QYOB 5CJ8A 1WBYA 4LQFL 2P48B 1FO0H 3EJZD 4R2GC 1FFPA 1BREA 3K2MC 3UPRA 1CK0L 1V3LA 4R97B 5E8PA 3KPNB 2UZIH 4Z7NE 4NSKA 5C6TL 2YKLH 3QDAA 1KJ3L 15C8L 5CIPB 3PL6D 1FORL 4UTBL 4CNIA 2H6PB 3E6HB 4PJ9C 3V8CA 3V4VL 3S4SA 1WZLA 5JHLL 3BMVA 4M4PA 3MXVH 2EH7H 2J1KA 3VFVB 2O5ZH 1QFWM 5JDSA 4R96A 5IP4A 2ZUQC 5D7IE 4P3CH 1XF5B 1S9KC 1UB6B 3GSRA 5AWNH 1UENA 4XVTH 1HOCA 1FH5H 1OGAD 4NQEA 4RFEA 4FG6C 4FTVD 4MJ6B 3RVTD 3O9WA 4P2CG 2EC8A 5T3ZE 1WT5C 4WO4D 4HC1H 5FIEA 1HH6B 4XBPA 5MHSE 2GK0A 2JCCF 4OCRL 4ETQB 3VFUB 1NEZA 5MEQB 4Y4KA 3MLVH 4Q0XH 2EDXA 2Z8RA 5E8NA 1DN0B 2YK1H 3ZKMD 1BQHB 2FHFA 3UZEA 3QIBA 5EUKB 3MA9L 4KKBC 2H26A 1I9RL 2X4OB 1NFDF 1MCFA 2WWKO 3OMZA 5GGRA 4CL7A 4DOHE 1F4WH 3B5GA 5DUMH 3JWDL 3C87A 4A6YH 1QYGL 1C5BH 5IB1A 2DIAA 2VLJA 3L5IA 2J8OA 3VGBA 5D7LB 5E9DE 4GXUN 5FGRA 1T0NA 4KV5E 2BOCB 3STLB 4HFUL 4HWEH 1U3YA 4X4XB 5DMKA 3STZA 2Z93B 1FZMA 3VRJB 3IDGB 5F96H 3MLUL 4I0KA 2CKNA 3CUPA 4I2XE 3QDGB 3UEZA 2F9BT 5HXMA 4C56E 1A02N 4PRHE 3QEQA 5E24E 2EECA 3P73A 4HEPG 4U1MB 4GW4B 5CLWA 4U0RC 1Q94B 3FKUS 1H15B 5EH1A 3QUXB 4U6YB 1RAMA 2AK4E 1M6OA 4H0IA 4AMKL 1OP9A 5LWYL 1ITCA 4F7MA 5D1ZC 1TZHB 5HI5D 3EYFA 2QADB 2WINB 7FABH 2I5YH 4GXVL 3UBXA 4BSWA 5KS9F 5IROC 3QH3A 1S78D 4KXZI 2UYLA 4XCEA 3P4LA 3AU1A 4YHNB 3WFCL 1ZKAA 4GSDH 4DAGH 5E8OB 2FIRT 3IGAA 3GI9H 2W9EH 4OCXL 4ALAH 3JSSA 4BFIA 1A2YB 3H9ZA 4HGWB 3P4MB 1IGYA 2F5AL 2VLKA 1RI8A 2FX8H 3PDOB 4KGLA 4OZFG 2C3VA 5D71H 1I3UA 1B6UA 5DQDL 2D7TL 3M8OH 4M43L 2VAAB 4QHNA 5IK3B 4PS4H 4C4KO 1J86A 3RZCC 2ZUTA 4EIZC 2VLLA 4IOIB 1AD9A 4ONOA 1GPOH 1JYXA 1FFNB 1BJ1H 5C7XH 4D9QE 1NSNH 3CAFA 3MV7A 4L4TB 4WI6A 5KVGH 4XNYH 4IRZL 1OGTA 1RUMH 1YEEL 3FO2B 5DEGA 5E5MA 3S5LB 4ZO9A 4E42B 4DEPB 1YEIH 4G6ML 4Z0BL 4XAWH 4KKLD 1TZIB 2E7HA 2F74A 2F54A 4OM1H 1TLKA 5F72S 2R2EA 3MLWH 4JLRA 1CIUA 3VXUD 4HZLB 4P2QE 2FZ3A 3JWOC 2BOBA 3QPQC 5CUSH 5C08E 2W9DH 2APFA 2Y36L 4M62H 3FHAA 5DVKA 3QDHA 4KK8D 1WGOA 4PJ8B 1I75A 5INCB 3SKMA 3S98A 1FVEB 3VG0H 3RX5A 1I8KA 1NCBH 1HEZB 2E9BA 3LOWA 3TVMD 1D5BB 4P2OC 4R2GB 5BVJA 3DSFL 1PVHA 3TT3H 3ZYOA 5FO8A 1T7YA 2C4XA 5KVEH 1MLCB 4H26B 2F5BH 4K3HA 3LKQB 5JQHC 1HI6B 5L8LB 4I77H 1PG7L 3QWQB 4W4OC 4APQA 4JG0H 2CLZA 5JXED 1FDLL 2R9HD 2DYPD 1SMAA 5D7KD 5EC1A 4AEIL 5LCVL 5AUMA 5L6YH 2VXVL 1A14L 4MCZB 2MNUA 3AGVA 3X3FL 4PRIA 5MERB 3ZE2E 3L3IB 1RQ5A 2D0HA 2ZUQB 4HAGA 3B9DA 5EU6B 2CGRL 4TPRL 3E6FB 4YHYC 3TESA 1NFKA 1ZVSB 1HHIA 4PYHA 5HHXH 1RMFL 5ICYB 4R7DA 5K9QG 2ZCKH 3VDBA 1ZVYA 3GMOA 2OS7A 4K7PH 4ZUWA 3T3PE 3O6FD 2I27N 3KXFD 1JUFB 5SX4I 3VRIA 4HULB 5DDHA 2L7JA 3LKSB 1FG2A 1UM5H 2Y25A 3O6LL 1TTUA 4EQ2A 1JPFA 3NFSH 3T65B 1B2WL 1CXKA 1NAMA 1QSEB 3QXDB 1MVUB 3QWOA 4HXAH 4KI1A 5HHVL 3WNKA 5JPMA 1UCTA 4G9FD 5D9SB 5DJZA 2RHEA 3EHBD 2VB5A 4M5YH 3ILPB 3G5XB 1VADB 5KSAA 3GIVA 4KZDH 3TC9A 3V5KA 4G7YL 3O0RH 4LCIL 4HUNB 4M7JL 3ARTA 2HJFB 4FQPA 4DTGH 2YPLD 2YRLA 4MS8C 1TVHB 4FFWD 4XVJH 1DQJA 1O5DT 3B6SA 1CYGA 5DRWA 5LAXB 2GITB 4U0RB 3UBXI 3JV0A 4NFBA 2XIDA 1XZ0A 2B2XH 1DVFD 5GRZA 1MCBA 1P4LB 3MRIA 3LRSB 5I66B 3GMMB 4OFDA 2C3WA 2PF6A 1TVDA 1QG3A 5ABDE 2FL5A 2J12B 5SWSE 43CAB 1U3HD 3A6BH 2E27H 5D1ZB 5C9JA 4QRPB 4PV8A 3IU3B 4QHUA 5FFLA 2EDKA 1AGEA 2NY7H 4JFZL 4EI5D 2BY0A 4OZGE 4OUUB 2NXYD 3HNTL 3GDBA 4FQ1H 4P2YA 1JZ6A 2PYEB 3AAZA 5DK0A 3QDMA 1SM3H 4JFEE 1EO8H 1XCQB 2AABL 2HMIC 4KKCD 3MOAL 5CINL 2X89A 3TA3C 2DQCH 2ADFH 4JQVC 3FMGH 4PJGE 3HS0B 1ZGLA 4TVPE 1I3GL 3ETBF 1I8IB 3NCFB 2NZ9D 4N8CL 1T22A 2HFTA 4L29B 1F8TL 1CGSH 5A3ID 3MV8D 4NJ9H 1K8DA 3WJJC 4I18C 1E0OB 3GSNH 4JG1H 3QCUH 4E41B 3G9AB 3FTGA 4JO1H 4AZ8A 1F4YL 2DQEH 3MUZ1 1JN6A 5SWZA 4JFOB 1J1XH 3BT2L 2F53A 3C5SB 5C0RH 3BO8B 4ZFOB 5KOMC 3T08A 3MNVB 2XKNA 3SGEH 4FFVD 4LCWE 4PJXF 1ZHNB 1JYWA 5DD6A 3LZFL 5ALCL 1C16A 4NM8L 1QRND 5DTFB 3IFOA 1NAML 4FXLA 4CMMB 4NJAL 3FO9A 5GGVY 5FB8A 1JHLL 4YGVB 3IJYA 3O6KH 1AJ7L 5C0JB 5GRVK 4A2LA 1CIDA 3OBAA 1A5FH 2APVA 4UI2A 1T1WB 3WNNA 2B8OT 4ORGA 3QUZD 4P48A 2Z91A 3B5HA 2NZIA 3WHXB 3GRWA 4CJ0A 1KJ2L 1IC5L 5C9KA 1HQRA 1RURH 4JRWA 4P2OB 1QBMH 4NHCL 5I1AA 5TGBA 1TITA 5IQ7L 3RWFB 5T1MB 1J0JA 3MLYH 2AEQL 3OX8B 1QLRB 4Q9RL 4KY1H 3N1FC 4ZSOB 4XMLH 4LAQH 2NY5C 4NHUA 1A9EA 5D1QD 2BNQE 4YHKL 1KNOA 4LPTA 5JUEL 2ADIB 1DBJL 3QIUD 4G3YH 3N85L 3W0WA 2XKSA 5EZLA 3IDIB 3SO3C 2VLRE 5EBGA 3GSQA 2AXFA 2J3SA 3H7BB 1ONQB 1DQQB 4YHYB 4Z8FH 2JB6B 3T3PF 4P4RB 2CK2A 4PTUA 3ARPA 2BJMH 5BZDB 2AEPH 3GKWH 3QRGL 4ZFGL 2JIXD 4FQCL 4GKNA 5HYEA 4JZNA 3KYNB 4NC1C 1KULA 3GMPA 5D96C 4M02A 2EC9U 1M4KA 4XBGB 3O3BB 3QFJE 1JI1A 1UYWL 5I71C 1MCJA 5TH2B 5DRXB 1G9NH 4LDOB 2WUBL 4QHLA 3TF7C 2OZ4H 5BXFB 3OXSB 2CLRB 2OMNA 5FECB 1XR8B 3TP4A 3VRLE 1N4XL 5TE6H 5GGUB 4V1DD 4JO3H 5GPRA 2VLME 1N64L 2VXUH 1CF8L 1QVOA 2ZZUT 4H1LA 4NQDB 4Y16A 5IWLC 1RIHH 1IKNC 3MJ9H 1G7IA 1E4WL 5E6IA 3FN0H 4I4WB 1WVZA 5GS0L 1JWSB 2RAMA 5T5FL 2CRZA 3W9EB 3G9VA 4YR6A 3VFRB 2ZPKL 3CH1A 2Y5TA 1M71A 5C86A 4MA1C 1AFVH 2G60L 1EHXA 3NIFE 4JFDE 2EIZB 1FIGH 5IT2H 4OB5L 5IBTH 2JE8A 1KIQA 2ED9A 3QO0A 4LCYA 1WTLA 3D6GA 3HG1B 5C6PB 2XNAB 4GMTL 5HHNB 3TT1H 2IH1A 2X1OA 2AJZB 3OAYH 5MEPA 1LMKA 3RRQA 1FL6B 3OKEA 5DF0A 2EXWD 3B8YA 4LHUB 4N0UE 1L7IH 4PTTA 4ZOEA 1A21A 1S8DB 3RJDA 3PV7A 3W2DH 3VCLB 3ZKMC 1KG0B 4YHLL 1EBPA 3DX8A 1JHTB 1PY4A 1S5IH 3HAEA 1N5AB 1G7MB 5HYJD 1ZT4A 3FQTA 2VE6A 2B0SH 3F58L 1C08A 1L6XA 5B39B 2XPGB 5CIPH 4FQ2L 1EAPA 4XP9H 3ILQD 2J6EH 1KTDB 3DX9A 4X9BA 3QG7L 1E4KC 5FA4A 3TNMB 2B7DT 3H7LA 3JTTA 2F19H 3MLTA 1OAYL 2V9RA 4JDVA 3P0GB 3TA3B 3WFEL 4HS6A 3VFSA 3U0TA 4MLSA 4QLRA 3QEUB 4NQXB 5GSVB 3SKUD 3OGCB 3U9UA 2XTJE 1L6ZA 1T3FA 3F7VA 5SWQB 5J6HB 4HKXA 1J05B 5ILTH 3DGCR 2CMRH 3PGCB 5B3JE 4E0RA 2IADA 4J8RB 4AH2B 4I18B 4DZBA 1M7DB 1KEMH 2BVQA 2AV1A 3GNMH 2ZOKA 3MROB 3QHZH 1UC6A 4ISVA 4QXGH 3KNBB 4LEXH 4NQEE 4PJEB 4LLVA 4J3VA 1DQLH 5I9QC 4KTEH 1F5WA 1ND0A 2EDHA 2H3NA 4FP8H 4GRWF 1RUAL 5EZJB 4C58B 4PREB 3ARUA 3KPMA 3C8HA 4J7RA 4XXCC 3RDTD 5IMMB 4XCCH 4XPFL 4JN2B 2PW2A 5FM5O 3MRDA 1MCCA 5DD5L 3QR2A 1S78C 2WWMC 2DM7A 2D9CA 1SJVA 3BKML 2MQ0A 3T77A 6CGTA 3T0ED 3BKJH 3RP1A 4N8PA 4XPAH 1M05B 4PJCA 3OGOE 3LCYA 4U3HA 5JORB 4WI4A 4XWOD 4HWZB 1J1PH 2GSIA 1S7SB 1J8HB 1I8MA 1LD9B 4AJ0A 2VLJE 4QHKI 3BH8A 3V7AG 3OKOA 4NN7C 5FYJU 1PQZA 3IDMA 2UZXB 3FQXA 4CADB 5E99H 4PY8J 4F8TA 4LPUA 2OL3B 3RI5K 4JGJA 3MV01 5FOJA 3O6ML 1I1FB 4LF3A 2A6KA 1QP1A 1V7MH 2I07A 3KYMB 3SO3B 3D3VA 3QEQE 1H3PL 1JJUA 4JPWH 1BJMA 4X6DA 2P7TB 1P4BL 1QFHA 5GGQH 4PD4K 3CFEA 2FLRT 4LSDA 1WQVT 2E6PA 2P47B 2H2PD 1JVKA 3KLHD 2KPNA 3MRMB 3TJEH 5D96B 1C5DB 1GIGL 5I71B 1HQ4B 1G7HA 3CFJB 4XWGL 1KPRA 3UTOA 3HKFA 2WIIA 3TVMC 3IKKA 3RL1A 1IAKB 3G04B 1DQML 4JREC 4TUKL 5EO1A 1RZIB 2VZ1A 4L8SC 2MQCA 4IEFB 3X14B 3ABZA 2VLKE 2IPTL 4BH7B 3EOAA 3CFBA 1HZHH 1QFUL 1U8KA 3CZFB 4UT7L 5JXEC 4WWKA 3LKOB 4RRPA 4RWYL 1PLGH 4HS8H 5FK9B 4Y4HA 2X9YA 5I15L 3OG4B 2YD9A 3I9GH 2DMBA 3KWWB 1S9XA 3PABB 1GZPA 4QWWC 3D9AH 3DURB 5DJYB 3H9HB 1U8PA 4X5WA 4XHJC 1O7SA 4C57C 1ZANH 1MQKH 2VDNL 1PGRB 3MV7E 4K8RH 1OGAB 4MA1B 1FHGA 4FTVB 4KK5D 1QBAA 3R1GL 5ERWA 2R0WH 3ZHLA 4RBPK 2F54E 1VGEL 1A3LL 1WJ3A 4NQCD 5DJ8B 3O6FC 4K9EH 1MHCA 4S10A 1X5FA 3PIQB 2FX7L 2P45B 1HH9A 3KYOA 3FAXA 2D03H 2UV3A 1PKQE 5E1AB 2Q20A 4JPKL 3LN5A 3V5HA 3H0TA 1QTYT 3PJSB 4JFQB 2FWOB 12E8L 4LSVL 4U1LB 1ZK9A 3ES6A 3Q6FB 4L9LA 4GG6B 1O0VA 3EHBC 4KK9C 1K2DB 4X7FC 4NT6B 5FO7B 2OJZH 2DQFA 5HJ3B 1CD0A 2WZPD 4I13B 3QG6B 5EU5A 4C54A 4EQ3A 5A1AA 1CFQB 3OAUL 4KAQL 3TPUA 1HXMA 2R29L 4B7LA 4G9DA 1M1SA 4XRCB 1UXSB 1EJOL 4JZOA 4NO5A 3ZKSD 4N90D 1MNUL 5E2UH 4PRIE 3L3HA 3VFOA 2WIMA 2C4FT 2IANA 3SGDH 1IC1A 4LDLB 1ZGLP 3LKPA 1QACA 3D2UA 3LQZA 4ODWB 2CDFB 5CD5D 4I3GA 4PB0H 2FDBP 2I9LB 5DXWA 3A67L 5F3HB 4I0PC 5I9QB 3QJFA 1KENH 2OP4L 2NY6D 4I3RH 3PV6B 1FCGA 4FZ8H 5ESQA 1G7QA 1K85A 4ZMAT 3OXRB 2X4UB 5DJ6B 3REVA 4WCYL 3B3IA 5IFHL 3O2WL 1OAKL 2VN4A 4G5ZH 2VXTL 4O4YL 1AGBB 5CJBA 1XH3A 5DJCA 1I1YA 1BIHA 3ZL4L 3MCKA 2EYSB 1RU9L 4MMZC 2VQ1B 2ADJA 3MRQB 5HYSA 5I30L 3P0YL 3C2AL 4YBQD 1OT2A 4IDLA 1JWUA 4OZIA 3C6LA 4XC1H 4EN3D 4NZTH 5JQ6L 4PP2A 1UJ3C 3FT3B 2BC4A 4JQIH 3PQYD 3BN9C 1AO7A 1BVKB 2BFVL 3CC5A 4KKCC 4NN7B 5I76A 3HZKB 2QSTA 1JF5A 1NGZB 1R3KA 5FM5M 2NZ9C 1MJUH 2XXMB 1IZKA 4IRSD 3NFNB 1L4IA 4JFXB 4M1DL 4WHTB 3CXDH 4K2UL 5KVFH 3BJ91 3INUL 4YLQT 3VXUE 3QNZB 4G8IA 1MIEH 1I7RB 4JPVL 4LDEB 4G6JL 1P5UA 3TH2T 4ZAKC 4OV6F 2JB5H 3NZ8A 2Y07L 1MELA 3I3DA 3WIHH 1FL3B 5KG9A 1R3LB 2G5RA 4FFVC 2C5DC 3B2VH 4JDZB 3DYPA 1JGLH 4HWNA 2X4RB 3WIIH 4QRQB 1DE4B 4PJ7B 1NH6A 4ZPTA 4YE4L 3S36L 3QCTL 1NCAL 4MNQA 3EJJX 5EOQL 1RIUL 3VI4E 4Z7OE 5IBUB 4JZJA 1ZLSL 5GSRB 3PWUA 3QUZC 5GS2H 3IDYC 3FO0H 1BD2B 1L7TL 1PAMA 3TVMB 2ZCLH 3MRKB 5DFWH 3SKNA 3MRLA 3MXWH 5EC2B 3F7PC 2E9IA 2R56H 4JREB 1WICA 4P23D 4L8SB 5FUZH 3QDME 3U7WH 2PW1A 1R3JB 3WN5A 3K2UH 4PPTA 3H9SA 4X8XA 2DYPB 3SJVA 4Z78A 4HKBB 3GB7A 5D1QC 4YDJB 2E7CA 1HWGB 4CW1A 3S88H 2H2SC 4MX7A 4HJ0D 4QO1A 1WEJH 1MI5A 1TNNA 3UTQB 5BV7H 5FHBL 1AXTL 3OKKA 2EDQA 1EIBA 1J18A 4ZPVA 1OB1B 3ZO0A 2HTKC 3DBXA 1IM9D 2VR9A 5DSCA 1MVFA 4HH9B 1MY5A 2F53E 4I1NB 4P5MB 3DGGA 3V6FA 2IF7A 1EDQA 5DMIL 5JW3H 4W68A 3O6FB 1G0YR 3KXFB 1KTLA 4AG4H 1UA6H 1KB5B 4X7DC 1HINL 1EFXB 3DV6A 2R15A 3QHFH 2JK5A 4NQUA 2IAMD 4GRWH 4HD9A 2YHGA 2AJYH 5E4EC 1DQDL 4ZDHB 4JRYA 4M5ZH 5F44A 5AAWA 5FDWB 2OXGA 4R8WH 1KYOJ 4G9FB 1H5BC 1KEGH 4LSSL 4NQVB 2FR4A 3QXAA 5I1DA 4LKXA 4WFGE 3UTZB 5GGTL 4P5KB 1XR9B 3KS0H 5BRZD 4QXTA 4DN4H 4Y5XA 4Y19D 2FSEB 4OSUH 3V6OA 4L3EA 1CK0H 3W0WE 2QLVB 4PJ5A 1QBBA 5D7JA 3KYKL 3TBWA 4KUZL 5C6TH 1DP0A 1LQSR 1AIFB 3PDDA 1KJ3H 15C8H 2DLGA 4MQXC 2G2RB 1FORH 2ADGA 1MPAL 3HZVB 5F7YC 4I0PB 3V4VH 1BAFL 3KPRD 2V7NA 2OI9C 4Z7WB 2YMXH 3B5TA 3BZ4B 1I3RA 1X6NA 5JHLH 4UDUB 4YFLF 5FYKD 4KUCF 3UJIL 1U8JA 1OM3H 1AR1D 5GS1C 3ECBA 1N26A 5INDB 1DLHA 2VISA 3HZMA 1BM3H 5C0IB 3LN9A 2VZVA 1X44A 4RIRA 3U7AA 1SYSA 5JHDD 3WE6A 2Y6SD 2E6JA 1XGQB 4OQTL 4ZODA 3VWJC 1EEUA 1JPGB 2BK8A 2AJUL 3ILQC 5FKAB 4OZHB 1PX4A 1LEKA 5CKGA 1UJ3B 3FB5A 3TO2A 2NNAA 3NCYS 1UCBH 2ITCB 1QR1B 4F58H 3LS4H 2DQUL 5I16A 4FQHB 4W6WB 4JFHD 1X5AA 3VXQB 3TCXA 1B88A 2PTTA 3GSXA 4LCUA 2BVOB 4KTDL 1MHHB 2YSSB 4P2RA 4X0KA 3T2NH 2ARJB 1MEXL 3C08H 3IJHB 3MV8B 1FBIH 2EE6A 5HGBB 3BOVA 1YEKL 1ZA3B 3MJ7A 5J8OA 3L7FB 4HX1B 4QT5B 1NBYA 3CD4A 1MAMH 5SX5K 1FGNL 3D85A 4ZAKB 2EEDA 1RIVH 1YEDA 5J1AA 9CGTA 4X7TB 3IKCA 3SDXB 1F3JB 1E27B 1QRNB 4OKVB 4YDKL 3U48A 3ET9F 2X05A 4OKDA 4Z7OF 5ACZB 3IDJB 5GJTH 1IGML 4LLDA 2VZTA 2DQGL 3T0EC 1A6VL 2EYTB 4NKQB 3QUZB 4N0CD 4HG4K 4UTAH 3IDYB 1FLTX 4XWOC 5JPNA 1U8OB 2YD2A 3MMEB 1UXWB 2OBGA 2VAJA 2IMNA 3HNSL 1IGTA 4D0CB 2Y4SA 3UPAA 3WFCH 4OI9A 5D1QB 4P57B 4CDHA 3V5DA 1RFDL 4KC3B 1R6VA 5C09A 3WS6A 5GRUH 4RISL 1QEWB 2F5AH 5D7IB 8CGTA 1H0DA 2QSCL 5DQDH 4P9HC 4LEOB 3OKMA 4Q2ZA 1KCLA 1F45A 4TQEL 3BDYL 3S6CA 4UT6L 1F11B 3L3JA 2H2PC 3AXLA 1ZSDA 4MZ2A 2JIXB 3KLHC 1PYWA 3UTSD 2H8PA 3MV9D 3QZWG 3FT4A 2OK0H 4IRZH 4H8WC 5GXBB 1YEEH 4LARL 5K9OA 1J5OL 2YUZA 4FQXA 5I1HH 4QOKD 1JMXA 4G6MH 3D5OF 1SJXA 5FOBA 3PXJA 5L88L 5DZNA 5E4EB 4PJCE 5BO1L 1KN4L 5CEZD 3LEYL 1H5BB 4X5XB 4V1DB 4MJ2A 4JM2D 3IJSB 2OL3H 4X9HA 2ZJSH 2NY5H 4CU8A 3K46A 2J8UB 1QSZA 4LNRB 3MRRA 1HSBB 4RNRA 4FA8A 4HUKB 1PZ5B 3IU4L 3T4YA 2YD3A 4NKMB 3U4EB 4I2XB 4BZ1H 2X4SA 3O11B 5CZXD 2DQJL 2A2QT 3MACL 4C56B 3D3VE 4JO2L 1NC2A 4KK5C 3S5LG 4X6DE 5E2VL 1FDLH 4U31A 3C09C 4AEIH 2MTPA 5BZWA 2OI9B 3FO1B 4MA8L 3SDDA 5ITFA 3EZ8A 1KT2A 4RWHA 4FFZL 3SDAA 3WL9A 5I8CA 4JFFA 5GS1B 4UB0L 1TCMA 4WW1A 3WDHA 5HYQA 4O00A 2Q8BH 1S7XB 4XB7A 3WNPA 2R1YB 1U8LB 5F6HJ 3TYGL 2HT3D 3NH7L 4NIKB 2CGRH 3RGVA 3EOBA 5KW9L 2CR6A 1FV1A 2ZSWB 5HYJB 4F57L 3VWJB 1OLZA 3ESVF 4PLKC 1FJ1B 1R0AH 4HXBL 4KI5D 1FNEB 4WJ5B 5IFAL 4ODUA 3ARBA 1LEIA 1PKOA 1UWEH 3O6LH 4NO3B 3UYOD 1AD0A 2KQMA 3TZVC 1AGCB 2VL4A 1V8HA 2LVEA 4OGZA 3O2VL 2X7LA 4YO0B 3CFDA 2I60L 3SQBA 1NFIB 3LH2L 1CU4L 1JGVL 1C5CL 5JLZA 3W39A 2C7UB 5IIEB 1T80A 5CD5C 3DX6B 5T1KD 1WBXA 3FB6A 3TBTA 2V17L 5F6IC 1QA9A 4G7YH 4ZXBD 4TUJA 1VHPA 2NY6C 4JHWH 4LIQH 4M7JH 4OZFA 1UEYA 5KSBF 4MXWL 5H37G 1F58L 1RUPL 5FKPA 5C2UB 3HUJB 3FB8A 5D93C 1ZOXA 4TNWF 3TIEB 1CE1H 2CD0A 4NM4L 4NNPH 4PY8I 1II4E 2A9MH 4K3JL 3T0EB 5EUOB 3L3GA 4GAGH 1OF2B 2MKLC 4Z7VE 5DJ2B 1S3KL 2B1AH 1WZMA 1QFWL 4R0LB 3X12A 2KQNA 3M1BB 4EN3C 3RWCA 3U7YL 4DWHA 1FNLA 2NY0C 1P2CA 4RQQA 4MB3A 1MFEH 1RULH 1EJ6A 3BZDA 3RTQA 2LE9A 1NDGA 4OZ4B 3D25A 1U93A 1BJ1J 3HZYA 3BN3B 4IRSC 3RWDB 3I6LD 5DFVC 4UILH 1CFTB 2OR9H 1K5NA 4Y5YB 43C9A 4GQPH 3FQRB 2F8VA 4UAOC 1HHJA 4PRNB 5ADOL 5JOPE 4PJIB 4NRYA 2W0FB 4ODXA 2IANE 1P53A 2PN5A 4NZJA 4BYHA 4YHML 1CT8B 4UNTA 1A7BA 1B0RB 2AABH 3IS1X 4N1CA 1UG9A 2HN7B 2MCG1 4LMQI 4IHOB 4WFED 4N8CH 2IH3A 3P11L 4Y89A 5LXGL 5D6CB 4KZEL 1RSFA 5EORL 1JE6A 3QQNA 3U0PB 4M61B 2VOTA 3RIAF 2J8UF 2A83A 1BQSA 2VABB 1NCDL 1QFWI 3KPOB 4PJCF 1W72A 2DJ4A 3D0LA 2MMXA 3BT2H 1ZHLB 5DHYB 3VXSD 4QY8B 4D0BA 4PJAA 4LLUB 3NAAH 2NW2B 1OARL 4M1GH 5DHVB 4Q6IA 4B5EA 3QI9D 1UZ8B 5DJ0B 4P23C 4OZIE 3LZFH 3SEPA 1HIML 2Q7YA 3RKDC 1FZOA 4XP4L 1GC1L 1JHLH 3F7YA 3RBSA 2PR4L 1AO7E 1IZJA 5AD0A 1AJ7H 2HAZA 4GAJL 5IGXL 3BYTA 3MC0A 4NZRH 1X5GA 4HJ0C 1KJ2H 1A1OA 4Z95L 2VR4A 2CLVB 2Q87A 4XZUB 2C1PB 3UTPE 1QBLH 3HCVB 4NHCH 4NUJA 4AL8H 4CN6A 2Q8AH 5J57B 1BBDL 1OW0A 5GRXG 2R69L 2DWDB 3HMXA 4XNZC 2MHAA 1EHAA 4XP6H 5JIKA 2DLFL 1MCEA 4BSVA 3QAZB 4GJTB 1D5IH 1BF8A 4HGKC 2XQBL 4X7CC 3A6CH 1QNZL 3MRNB 3DIFA 1ZEAL 3C09B 4U6TA 3WHE0 4DGYH 1MHEB 5JMRA 5ISZA 1MJ7H 1HHHA 2AXHA 4N68A 2ATKB 1JF1A 3O4OC 3RY6A 3N0PB 3RA7H 5DMGC 3GMLB 4M7KL 4AEEA 4MNQE 1GZQB 2JELL 5IJVB 2BNRA 5F9OH 3BP5A 2EH8L 2XWTB 3BRFA 4OZGB 2AI0H 2BSED 4XCNA 2N1KA 1V7NH 1CGUA 1FFRA 3FCTB 3PP4L 3QRGH 2H32B 1AP2B 3TBSA 5EIIA 3QRFM 4S1QL 5JA9A 5IG7A 3G5VB 1EEZA 3H9SE 3ROLB 2QQKL 5TFSL 1I9IL 3ALWA 3TZVB 3SJVE 6FABH 1DQTA 1RK1A 4RGMC 3Q1SH 4G8GA 3QNYB 1FC1A 1N4XH 1MI5E 1FFOB 3QEGL 2PUQT 4LLWB 2Z92A 3MRBA 3G08B 1FQ9C 5ELIA 1U9KA 3WKNA 1E4WH 3QO1B 3O9WC 1XF3B 5F6IB 1R3IL 4IMLB 1KB5H 1W0WA 3PWNA 2NY6B 2R0LH 1ROWA 1Q0YH 2F15A 3C60A 5T5NF 1ZHKA 1T5WA 3UDWA 4J3WA 2VWEC 3RAJL 4RMTA 1LNUA 1A0QH 5D93B 1JGDA 4Z7VF 2PXYA 35C8H 2Y6SC 3VXNB 1B90A 1OSZB 2GJ6A 3V95A 4GBXD 3DRQA 4HGMA 2B4CL 3JV4A 1CFSA 4LFHD 2Z8VC 3EO9H 1IAIH 1EMTL 1RHHB 4GMTH 2XZCH 2WW8A 1EHNA 1HKLL 5DK2B 2KKQA 4EN3B 3CSGA 3V79C 5LKNA 1N6QH 1W0YT 2NY0B 2XA8L 4LLYB 5C8JA 5KSVA 4JJHA 1RZJL 4N9OB 3QEHA 1L0YA 4LSRL 1P5VA 2E6QA 2CH8A 3G5ZB 2D31A 5I1KH 2ICEB 5TE7H 4IRSB 5IKCB 5DUPH 2IQAB 3EYSL 4J1UA 4IBLT 1FZKB 1N8ZA 4FQ2H 1AQKL 3SDCA 3V6OE 4L3EE 1IC4H 3NA9L 5C0CB 4UAOB 1YN7A 4X7SH 4PJ5E 3RIFK 3DX7A 2VLRB 3RNQA 1EXUB 5CSZA 2ARWA 1BFOB 5DK3A 3MGOB 3WFEH 1EEYA 1TPXC 5CCKH 3EUUA 2AGJH 1A8JH 1XGPA 4F7PA 2X9XA 4D94A 1FAKT 5IMKB 1AQDA 3BGMA 3T2OA 2D9QB 1JNNH 4G80A 4L8BA 2D7PA 4LHUG 3DJ9A 4P59L 3V0WL 4WI3A 2YOCA 4ZFZA 3QFJB 1IILE 3WXWL 4OF3A 3CIQA 3HRZB 5K9QI 3LHPH 5L2JA 4A2MA 3B2UC 3NZHH 4J3OC 5B39G 1CR9H 1UVQB 2CKBB 3LB6C 4AENA 4OD1H 1A6UL 4LL9A 1U58B 3QISA 4P23B 5B38A 4MA7H 4PRBB 4KPHH 4F2MA 2NX5A 4I3SL 3BKMH 5EB9A 3QULA 3CSYA 4UINL 1Q0XL 3VFWB 1MOEA 5EU4B 3P77B 4P2RE 1N5YL 4WI8A 2VDKL 2HVJA 5BCAA 4JHAH 5E0QA 1CICD 4YXKL 3FRPG 1IL1B 2CUHA 3TFKD 1FL5B 3VXRD 3GIZL 1NJ9A 5C0AD 4XNZB 4U1HB 4XPTL 5CEYB 3KPTA 1IM9B 3ARFD 5GZOD 1IEBA 3N50A 3R06B 4K7FA 4NO2A 5I17A 4E5XB 4MB4A 1SMOA 2EC9T 1A6WH 3ZKXC 1FO0A 3O6MH 1N6VA 2FIKB 4Y2DD 3L5JA 1YJDC 2ED8A 3LEXB 4UUJA 3O4OB 4N0UB 3FFCD 3DVFA 3LV3B 4NWTL 2WQRA 2IAMB 2GSGA 1H3UA 1U8NB 4JN1H 1CL7L 5D72L 2B39A 3VFPA 2WBJD 4TNVF 1JZ7A 1C1EL 2A1WH 5FF6B 1FAIL 1YNLL 4PJHA 1KPUA 1FFPB 1ZT7A 3MGTB 3UPRB 4PGEA 3IDXH 4FHBD 3DO7A 4KQ3H 4F7CA 4JY6A 3MOBL 4NSKB 3GJFH 4P5TA 4F3FA 1X6LA 2O93L 3RX8A 1MIMH 1GIGH 1T20A 1ZE3C 4NKDA 4GRLA 4TTDD 4XWGH 5I1IL 1OAUL 2YPVL 4DKFL 4CNIB 1ACYH 3BPLC 3OB8A 4J6RH 3HFMH 1DUZA 2VZOA 4MHHG 4RGMB 4F9LA 5FYJE 3THML 4HC1A 4TSCL 2VYRE 5C09E 3GHEL 1F13A 4X98A 5CZXC 1Q8MA 2HFGL 4R96B 3SPVA 3OJMB 3MRFA 3NOIA 4IOFD 1QFUH 3MODH 1INQA 2RIKA 5T1DL 1HOCB 3KG5A 1OSPH 3O9WB 4PLJD 3OKYA 3RHWF 2J88L 3PUCA 4NC2B 4TNWK 1X5HA 5L0QC 3K8LA 5H2BA 5I15H 1J8KA 4HDIA 1AGDA 4WEBL 4XBPB 4K23L 1ZLVH 5CFHA 4ELMA 2GK0B 1BP3B 1JI2A 2HFFB 5FUCE 4A6YA 2N7AA 3RVUD 2EXYD 4XNXL 3MX0A 1IEHA 5A40E 5E8NB 5L7XH 1KFAH 1MF2H 1YPZB 3R1GH 4LMQE 4TOYH 1CQKA 1XIWA 3JUYA 2H26B 2FEEL 3EFDH 5SV3A 3U1SL 5I1CH 1DL7H 1VGEH 5GGRB 4H88L 4KI5C 5D7SH 4M9OA 5IM7A 5F93C 2FX7H 4XTRD 3LMJH 2DBJA 4HPOL 2VLJB 4HHAA 1KACB 1QPPA 1URLA 1WAAF 1F6AA 5EZOL 1S9YB 4FQQA 5KSAC 1INEL 1OP3H 1T0NB 1JV5B 3PGDA 5DMKB 1FZMB 4MB5A 2Z31A 2FEDD 2V2XB 5CP3H 4M93C 1EGJH 3TH3T 2VXQL 5KAQG 1UWXK 1LE9A 1FNAA 4U2ZA 3Q2CA 5EWIL 3QEQB 1FO0L 5E95B 2FH6A 3U83A 3P73B 4DKEH 1KCSH 1A3RL 1N0XL 3HI1A 1TPXB 3OAUH 4KAQH 3QXTA 3LKNA 5CZKA 1OLLA 2UZIL 4JY5L 3BXNB 1EJOH 1M6OB 5IF0B 4S1DC 2GKIA 1OP3K 3VI3F 4JFFE 2OTUB 2HRPL 4ZS6D 5E4IA 1P7QA 3CU1A 4YK4C 4JKMA 4PD4J 3QH3B 3MCLH 4RZCB 4WV1A 1CE6A 4XCEB 2FEEI 1G7JB 2DL2A 2EH7L 2DN7A 3AU1B 2IALB 2O5ZL 1QQDA 4GS7B 4XVSH 1OAQH 2QR0A 3IGAB 2OP4H 3OL2A 4P3CL 4MDIA 5C0EA 5AWNL 4O9HH 4YDLC 1FH5L 4WCYH 4TULH 4BFIB 5IFHH 4WHCA 1OAKH 1JYNA 2EDJA 4NNYB 2C3VB 1S7QB 4O4YH 4EOWL 1NMCC 3RBGA 3O4LD 4HC1L 4U1NA 3Q3GB 1E4XH 3P0YH 4MSWB 2P5ED 5LGJA 4LVHC 4LU5H 4HUVB 1AD9B 2NR6D 1RK0A 3MLVL 4Q0XL 3ULUC 5JQ6H 2E3VA 2YK1L 5D2NA 3MV7B 2JJUA 2RFXA 3IDNA 5J3HD 5DEGB 3FRUA 3VMPA 1F4WL 3TWCH 4X6CA 5DUML 5B3NA 1I7TA 4A6YL 5JW4N 4HKJB 1YEGL 3IRPX 1C5BL 2HKHL 2F74B 3EGSA 4K2UH 4QXUH 2R2EB 3ZKXB 2HLAB 2Z35B 4HWEL 2FZ3B 2BOBB 2VDOL 3VXMD 4X6FB 4S11A 4JPVH 5AAMA 4CDGC 5IHUH 5F96L 5D5ME 3T0WA 4QOKB 1BZQK 5BS0A 5FGBC 2D0FA 1HXYA 4I5BA 5T33H 3VMOA 1JPSL 2E8YA 5FO8B 1Z9SA 5C70A 4JY4B 4X8JA 4YE4H 3QCTH 1NC4D 5IVZA 3HPLA 5HHPB 3A6OA 1CGVA 1IAOA 4CBPA 1FPTH 4J3SA 5JTWA 3BPLB 3S3PA 1L7TH 1A1NB 3FN9A 5AUMB 3HLAA 1BBJA 2Y9RT 3CFCL 4U6XA 3OR7B 4LLQA 4P9HH 2M26A 2YBRA 3GHBH 5CWSA 3OKLA 1F3DH 4K3EL 5C0BD 4OIIH 5F6HI 1IMHC 4YHOH 4GSDL 1DFBL 4ODTH 4DAGL 4JM4H 1JGEB 3F65A 3GI9L 1BLNB 2WANA 2PCPA 2W9EL 1U95B 4OAWA 1CWVA 2EKSA 1HHIB 2FX8L 5D71L 5L0QB 3S96B 5EU7E 4ZUWB 4IJ3C 3M8OL 3NVQA 1KCKA 2BVEA 5GGSA 5DDHB 1AXTH 3CX5K 3P4NA 4PS4L 5HHOA 3OB0H 5J06A 4OJFH 1RZFL 4YPGA 5IBUG 3HC3H 1JPFB 4UU9A 1GPOL 1T66D 2NY3D 1FG9C 2IFGA 3QNXB 5C7XL 2HT2D 4PJAE 4B0MM 1NSNL 4CVXA 5IFJA 3L5HA 5KVGL 4XNYL 5JPMB 1RUML 5CBEB 1EH9A 5DJZB 2UZYB 4FS0A 4X4ME 1YEIL 2P43B 4XAWL 4Y16C 4M6MH 4YXHL 2MPAH 1BIIA 3L6FB 5KSAB 1XGTB 1K4DA 1TTGA 5D6DA 3GIVB 3T4AA 5CSBA 3MLWL 1ES0A 4YHIB 3V5KB 1DQDH 5E5RB 2IPUK 4LSUH 4M93B 1QKZH 2W9DL 4X9IA 4M62L 5F9AC 4OF6A 4LSSH 3VE0A 1A1MA 4PJDA 1O7VA 3GSWA 1FZJA 1W8NA 1DQJB 3VG0L 1NCBL 3B6SB 1EHLH 5T1KB 5IVXF 4YAQB 3TN0D 2P5WD 1P7HL 4U1SB 5KBNC 2ICWB 1DLFL 4D9RE 5KVEL 1XZ0B 2FBJH 1KF9B 2F5BL 2ZKHH 4UQ2A 3SHSA 3MRIB 5HD8C 1QLEH 2HJLB 3BP7A 1U42A 3S34H 3MJ8A 3CMOL 4I77L 1ZWIB 4P46A 5MP6H 3BIKB 3MBED 4JG0L 2XFXA 1JFQH 5ISZE 2DLTA 1N6UA 2FL5B 1VSCA 1PSKH 2YRZA 1TMCB 2A6JA 4Y2OA 4PV8B 4QHUB 5L6YL 4F7EA 4YK4B 4GBXC 2BNRE 1AGEB 1EZVY 4HJGA 1AC0A 3E8UL 3QUYA 1BAFH 2NLJB 4KJWC 2ZNWA 1X7QA 2LABA 1IGJA 3U82B 4PG2A 4YDLB 2ESVA 3P9LA 3C9NA 3B9KD 2OSLA 5DK0B 3V4PH 4L3CB 3P4OB 4X9FA 3QDMB 3LS5H 2DRUA 3DUSA 3LY6A 5HHXL 2DI9A 4GH7B 1NMCB 5HVGB 3RWGB 1HNFA 4RMUA 2ZCKL 1CG9A 4MQTB 4K7PL 2QTEA 3HE6D 1DUYA 1E4JA 5F97E 5F1IA 1ZGLB 5ALBH 2F58H 3SDYH 4LVHB 4G8GE 32C2B 3LRHA 3KPSA 4JANA 3NFSL 3CXHJ 2AW2A 4PGBB 2VXSH 4YX2H 5F3BB 4HXAL 1XF1A 2DQUH 1NGPL 1V05A 3K4ZA 3PWJA 5SWZB 2NMSA 4C55A 3TJHD 1QSFA 2LV4A 1HHGA 3ZT7A 4M5YL 2R8SL 1C8PA 2R2BA 1S7RA 1K8IA 1MEXH 4JM2F 5CP7A 5F1OB 2JCCA 1AGFA 5DRNB 5D5MF 4KZDL 4NQSB 1YEKH 5FB8B 3FO9B 5IJKA 1LK3H 3IJYB 5T1LA 2CIIB 1TFHA 5M94B 1YMMD 2R4SH 3CJJA 5EBLA 2E9WA 2GJ6E 3LQAC 4X7EC 4M8QA 1NFDA 4DTGL 4B50A 1T6VN 1JNJA 4XP5H 1HQRB 4MJIA 4XVJL 1LO5A 1BOGB 1GOFA 5M95B 4Y1AA 4UNUA 5TGBB 2H41A 1QO3B 4K94C 1NCUA 3CFKA 1IGMH 2B2XL 1Q9WA 2R0KH 2I24N 1A6VH 2O5YH 4U3CA 1CFNA 4ORZC 1QRKA 4NHUB 1A9EB 4D3CH 3A6BL 3QYCA 3VXTA 1HHKA 4XCYA 4JDTH 4QRTA 3TFKC 5DEFA 4HK0A 1JCKA 5C0GB 3VA2C 5EZLB 2NY7L 3OTTA 3BIBX 4ZNCD 4UQ3B 2Z4QA 3D0VB 3GK8H 3GSQB 3HE7A 3P0VH 3ARFC 3MLSH 5GZOC 2AXFB 4W81A 1R5WA 4XAKD 1TJIH 3D39D 1R24A 4KI5F 1N2RA 2VRAA 4GW5A 2OZ4A 3DHJA 1EO8L 2DLIA 4IJ3B 1RJYA 3CPLB 1FN4B 5HDQH 2ADFL 4RISH 5DYOA 4O51A 2XRAH 4Q7DA 3QQ4B 4UDTB 3ZDXF 5KS9A 5GRVL 2X1XR 4PG9A 5F1NB 3QIWA 1CGSL 3MJ9A 1YY8A 4QHLB 2WBJC 3GSNL 4JG1L 4TQEH 3BDYH 4UV4L 3QCUL 1PY9A 3KS0J 5D7LD 4WUUD 1DBKL 4DZ8A 4JO1L 2DQEL 5HPMB 2YEZB 1J1XL 5C6WH 1QVOB 25C8L 4H1LB 2NX5E 3X13A 2HH0L 4LARH 5C07E 1NBVH 4WWKC 3NCEB 3RGHA 4TTDC 1G7IB 4QF1A 3GMNB 2ZUSA 4J23A 5ANMA 4U6HB 4WFFE 1YQVH 3EDFA 4Y4HC 4M6NH 1KN4H 4HAFA 1KELH 3LEYH 4YR6B 3CH1B 3REWA 4IOFC 2Y5TB 1M71B 2W0PA 2BVPB 2NW3A 2O5XH 2Z0BA 1RURL 1UM6H 4PLJC 1QBML 1OT1A 4LCCA 1G6RA 4X6EA 5E8DH 3VGGA 2EO1A 4PJBF 4LCYB 3QO0B 3IU4H 4Q6YA 4KHXL 4D2NA 3KPNA 5IB5B 3MLYL 1WZKA 4M9PA 2IH1B 5CIPA 1KGCE 2J6EA 2EXYC 4LAQL 4GXUM 1JTPA 3I85A 4H0GA 3SY0A 2H6PA 3E6HA 1LP9F 3DMMA 4GBXB 5AYQA 3VFVA 3HAEB 4G3YL 3WS3A 1ZT4B 2VE6B 4P9ML 1C08B 3BWUC 1XF5A 3RL2B 5HYIA 4FFZH 4H5SB 4PJHE 1EAPB 4XTRC 4UB0H 3DX9B 4MJ6A 3SGEI 5FA4B 4Z8FL 5EIQA 2QL1A 3O45A 3NH7H 5JOFB 3VFMA 2BJML 2X5PA 4NP4H 5KW9H 4HG4J 4HS6B 3U0TB 2AEPL 3GKWL 1Z3GH 3LSOA 2FEDC 3N9GH 3VFNB 4ODVL 4NGHL 5F7EH 3QDJD 4ACPA 1T3FB 1WCBA 3F7VB 5MEQA 4HXBH 5FYLD 3EO1B 4N0FB 1DN0A 5KN5B 2YWZA 3KR3H 4IMKC 1G9NL 3X11A 3EBAA 5EUKA 4DGVL 2ZOKB 4K8RD 2ENYA 3L9RA 2APXA 2X4OA 5FYKH 4ISVB 4DKDC 4ZTPL 4LLVB 4LNVA 1G7PA 2H3NB 5TE6L 1MCHA 4JO3L 3TV3L 2VXUL 2NTSP 1F90H 5GHWH 4OCNC 2DJSA 5JZ7D 3T0VA 3IFPA 3MJ9L 4J4PA 4IS6B 2WBWB 3FN0L 4PJ8D 2BOCA 3UJJH 3ZT5A 2Z93A 3H6JA 2N56A 3VRJA 4R2GD 2NTFA 1WWWX 2OQJB 4ZUSB 5DLMH 3QDGA 2DKSA 5E9DA 1TDQA 3C6LC 1AFVL 5CJQH 1CGYA 3BEWB 5IT2L 3TPKA 5IBTL 3BH8B 3OKOB 4PJ9D 3RTQD 3IDMB 3FQXB 3QUXA 4K3JH 3TT1L 1SY6H 2D7OA 4QRRD 3QZWA 1L7IL 2NR6C 3MBXH 3W2DL 1CN4A 4LF3B 3VXRB 4FG6D 5C0AB 3QUMA 4AEHL 2YUXA 2B0SL 5I1JL 3ARFB 4XP9L 2J6EL 3CFEB 1F4XH 1A2YA 1RJCA 2BERA 4HGWA 4JGMA 5A16A 1KLGA 2IPKA 4M6OH 1ZTXL 3OPZL 4LRIA 2R4RH 2VAAA 4FQJH 5IK3A 3FFCB 4YHMH 1T83C 3DUUA 3M17B 1JYVA 3GM0A 3L5WA 5IQ9A 3TYFB 1G7HB 3ULVE 1KPRB 5ILTL 2CMRL 1FFNA 2WIIB 2WBJB 1UFUA 1KEML 3CFIC 2DICA 3GNML 4L4TA 3TLRA 1RZKL 3QHZL 3FO2A 1OWWA 5EO1B 2LAGB 3OAZK 4QXGL 4LEXL 3S37X 2DB8A 1DQLL 3EOAB 2ITDB 4E42A 3CFBB 4H25A 4ZNEA 2A73A 4GW1B 1U8KB 4EVNA 1TZIA 2VUOA 4FP8L 2B1HH 4I9WD 5DVMA 4WWKB 2MFNA 1D5ZB 5IHZA 4HZLA 3IF1B 4XCCL 4HIHB 1JTOA 4K07A 4Y4HB 1XGUB 1KN2H 3QP3A 1NCNA 4X99B 3G6AA 1GZPB 1NCWL 1HIMH 3BKJL 4X5WB 1QUNA 5INCA 4XPAL 2IBZY 2PR4H 2C4FU 5MEND 1MJ8L 1NMBH 4R9HA 4GAJH 1P9MA 1HEZA 2PO6A 2HKFH 2EYRB 4X6CE 5ERWB 1YJDH 4P2QA 1J1PL 2AQ3A 5F70A 3DVIA 3KHOA 4H26A 4PJXA 3ZSSA 2VC2H 1CXEA 5D1ZD 4QRPD 5DD0H 2W65A 5EG6C 1EO5A 2JTDA 5E99L 1GL4B 1HH9B 1MAJA 3KYOB 5FM8A 4BQ6A 4CN1A 3N1PC 3WD5L 1X5LA 2DDQL 1OWRM 2BRQA 3H0TB 3V5HB 1ERNA 4RGNE 5CEZH 2IPUG 4RMWA 1MH5A 4IRJA 2NY3C 5BS0E 1U91B 1H8NA 4NZUL 2PYED 1ZEAH 3L3IA 4PJHF 1VKXA 1V7ML 3P3YA 1WFTA 3ES6B 4JPWL 4BKLB 5EU6A 4HIJB 5GGQL 2Y7QB 2DQFB 1ZVSA 1JWMB 4GKOA 5ICYA 4U49A 3RZCD 1V5JA 3ZZ1A 4Y5XC 4PLOB 1JUFA 1V3MA 3TJEL 4JZOB 2R2CA 4XMPH 3V6OC 3ZTNH 3PP4H 4PGDB 5B8CC 3VFOB 5TE4H 2IANB 1YNKH 3ARVA 4HLJA 1ZHBA 5FDYA 4M1CC 1QSEA 4POUB 2KBGA 3BWAA 2QQKH 5TFSH 2HT4C 5CAYB 1HZHL 3QPQD 5CSGA 5ESQB 3NCMA 4RMRA 3ILPA 3MBEC 2XZAL 5D8JL 3REVB 4OBRA 1VADA 3VFGH 3B3IB 3ZHDA 5IV2A 5HHOE 4JRXA 2Z8WC 1XH3B 5CBAB 3RPKA 4UMGA 1UH2A 4KJYA 5FYLL 2FRGP 3I9GL 1AY1H 1TETH 2ADJB 3D9AL 4KKAC 1ZANL 1MQKL 4MXVE 1TVHA 2R2HA 1JWUB 4K8RL 5FA3B 2DF3A 4OZIB 3C6LB 4BM7A 3RAJH 4ODSH 1J12A 4PP2B 3BPCA 2GITA 2R0WL 3D87B 1AO7B 5I76B 4IIQA 5CLTA 3HE6C 4CJ1A 4LBEB 4K9EL 3GMMA 2B4CH 1DR9A 2P5EB 3WIHA 1EMTH 2D03L 4PJFF 43CAA 3UMTA 2OXHA 1NCTA 5IROA 1QLFB 2XA8H 2I9TA 2ZG3A 4PJDE 1RZJH 2WLZA 5J7CC 3ARYA 5ACLA 3W82A 3TNNB 5E70A 4PBXA 1LWRA 1T1ZB 3NZ8B 4OUUA 4TN9A 2P1YA 1FVCB 1NGYA 3EYSH 2OJZL 1CDCA 1HDMA 4P3DB 1AQKH 5JIIA 4Z76B 3HS0A 1I8IA 3IFNH 1UGNA 3H3KA 4L29A 3H3BC 5E2UL 3DROB 5DQ9A 4JO4H 1U8HB 4LPWA 4NQDD 4PUBH 5DO2C 3SKNB 4E41A 4U1JB 2ESVE 3UJTL 5HGGS 4PB0L 4MD0A 3FQWB 2JJSA 4RAVA 1S7WB 3ARGA 3GGWB 4P59H 1KENL 3C5SA 1HN1A 4I3RL 3H9SB 3BO8A 4C59B 3MNVA 5EZIL 1DBMH 3ULUH 1ZHNA 3GB7B 4WVRA 4G5ZL 4CMMA 1FNHA 4MX7B 3FHQA 4YGVA 2DM4A 3QUKB 4MD4B 1MI5B 5CEXA 3KPSE 2RCSH 1MCOL 4GAFB 4X6CF 2FD6H 1K4CB 1FNSH 3PE9A 4ZPVB 4CUCA 4ZUTA 1UWGH 3WHXA 4X5LA 3K81A 4ZO6A 3T3MF 4P2OA 4XC1L 2GTWA 2RBLA 5D1XD 4NZTL 4M00A 1QSFE 1ORSA 1VACA 1H3VA 1P84K 3UC0L 2VDKH 4JQIL 3PF2A 4TYUA 5T1MA 3KVQA 4Z7UF 2OTWA 2XACC 3U6RB 3LVEA 3OX8A 2JCCE 1VEOA 3GIZH 5FUCC 2P8MA 4DW2H 8FABA 1MJUL 3DV6B 1JGUH 2DWEA 2VITA 3CXDL 3KLSA 2JK5B 4FQXC 1JPTH 2AVGA 2RB8A 2J7LA 3CDYA 3SGDI 2VNCA 2ATPA 5ESAB 4M6AA 5I0DA 2NY3B 2YA2A 5F88A 3UAJC 4JRYB 4YZFE 2BVTA 5JA8B 1MIEL 3IDIA 3AS1A 1RVFH 1U6AH 4Y1AE 2BSTB 2HMID 2FR4B 3TA3D 3K1DA 3E3QE 4K3DH 3H7BA 2JB5L 4LKXB 3U4AA 3WIHL 2JB6A 3GJEA 2W60A 2CDGB 4BZ2H 4NWTH 1A3QA 2VQTA 4P5TD 1T0MA 4GRMB 3B2VL 3Q5TA 2DJUA 4GRLD 3E2HC 4Y5XB 4XNQB 4R6UA 2R39A 4NFDA 4FXKB 1C1EH 5JW5A 1KPVB 5BOZG 2ZUXA 3IDUA 4JVUA 5B8CB 2A6DA 3U0WH 4L4JA 2GAZB 1U3JA 5TH2A 5DRXA 3TBWB 2VSDA 2ZCLL 4CGTA 4WFHD 5BXFA 5I1IH 3MXWL 2ADGB 1OAUH 2R56L 2UUDH 2YPVH 3QXUA 1XR8A 1FYHB 3U79A 2V7NB 1BJ8A 5GGUA 5FUZL 2HYMA 3U7WL 5AZEL 3THMH 4UOJA 3JZ7A 4FRWA 4F9PC 1JRHH 3MBEB 3H9YA 4N8VB 3MUGB 1N3NA 3ECBB 1DLHB 2VISB 4U7SA 5HGDA 4KK6C 4AIZB 5KS9E 5T1DH 1T7WA 4PGZA 3ROOB 1SYSB 3RGVC 3WE6B 3OF6D 5GRYA 3W9EA 1WEJL 1IFHH 3SCMD 1U8IA 2QJDA 3VJ6A 3VFRA 5EN2B 4ZOCA 5DVNA 4GUPA 3KJ6H 5HDBF 4M7LH 3FT2B 1KUMA 3HB3C 1AKJD 4KRMB 4ZFOL 4YHPA 4X80H 3QT2A 5IUSA 2OTPA 1SJHA 2W59A 1G1YA 3UPCA 1UACL 1LEKB 3FB5B 3ARBC 3L95B 2NNAB 3JWOL 4JHBA 2VDMH 3HG1A 1I1AA 5HGHB 5I16B 2IBBA 4YBLC 3HE6B 3VWKD 5JW3L 2PTTB 4JKKA 5HHNA 5ANME 4LCUB 5F9JA 1UA6L 2AJZA 4P2RB 4K3GA 4H88H 3ULSA 3PWPA 4LHUA 2LQRA 2YA1A 4PJDF 5DS8A 2XN9A 3QHFL 4LP5A 3MRCA 1X5YA 2AJYL 5TQ2H 1JHTA 4M5ZL 3B9EA 1N5AA