4YK4C

Human antibody 641 i-9 in complex with influenza hemagglutinin h1 solomon islands/03/2006
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
225
structure length
220
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTDYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARRRSDFETVDFIYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Viral receptor-binding site antibodies with diverse germline origins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
molecule keywords 641 I-9 VLCL antibody
total genus 36
structure length 220
sequence length 225
chains with identical sequence Z
ec nomenclature
pdb deposition date 2015-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yk4C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yk4C01
4F7MB 3PE9A 4JFDD 3KLHD 3U30B 1N2RA 5ECJE 2GITA 3KYMA 2Z91A 4K71C 1HXYB 3OF6D 3Q3GA 4Y4KB 3R4DA 4U7SA 3MLRH 3HMXL 4UV4H 4OQTL 4U0RC 2EDWA 3LKPA 4PJCB 1NUDA 1CGWA 3X17A 5ID1A 4KDTC 4G6MH 4LSPH 5KAQG 1WFOA 1P7KA 4W70A 1HXMB 2DQFB 3GIZH 4PY7B 3VH8B 4GMSH 3MLWL 4CU7A 3IGAB 4ZXBC 5CD5D 4E41B 3GHEH 5IVZB 5I71B 5IK3A 3NCJL 2WV3A 4I9WD 2NY3D 1DEDA 2ICWI 2YEZA 1KPRB 2BNQB 4R2GB 1AI1L 1HINH 3CSYB 3ARUA 3QIBD 2AEPL 2VISA 3GHBL 3OPZH 1NDMB 4TTDC 2G9HB 2J88L 2PTUA 2VE6B 3EUUA 4RIRA 5SWQB 3BP5B 3UYPA 4P9ML 2AEWA 3QJFA 1KCLA 2Q3AA 1WWCA 2YD2A 5DJXB 5DRZB 3TBVA 3HNVH 1NGQL 3LB6C 3TH3T 3MV01 2DWEA 4MMZC 2PYEA 5KOVC 3R0MA 5EZOH 2HVKB 4DGIL 3WKNA 4LARH 5ANMB 2Y36L 3ET9F 3ULSB 2XPGB 1H3XA 3MJ9L 4WWKB 3U46A 3OBAA 3RWEA 4R96B 2OJEB 5E6IC 1QSEE 4X9BA 2VXVL 3HE7D 1IILE 2NY3B 3GRWA 3IS0X 5CEZD 3M17A 4P46B 3MV7B 4P23B 1B6DA 4HWZA 3FT4B 2X89D 1NCWL 2XNAB 5E99L 5TDNB 3O4LD 1D5ZB 3WJJC 1I8MA 3L3IB 3TFKC 4L4JA 3PNWA 5C70A 4KI1A 1YEDB 3IRPX 4M9PA 5F3HB 1D9KA 1MVUA 1OAUL 3KWWB 3QUMA 3OR7B 2W59A 4XHJC 5I8KL 3RKDD 1IFHL 4Y2OA 1ETZB 3UBXB 2FX9L 1IGTA 2O26U 2X4TB 2XWTB 5ICZA 3B3IB 1JGLL 3MRFA 3FOLB 1OAQL 5GRJL 3ARTA 3WIHH 1IT9H 1FCCA 4K3GA 1CDJA 3UTZA 1QFUH 1CLCA 5T3XE 3QZWG 4LQ1A 2R56H 3RI5K 2CXGA 1EAJA 2ZCLH 1OW0A 3GMNA 3QCUH 4WI2A 5FECB 5HSFA 1KT2B 1GGCH 1G7LB 4P48A 4X9FA 5AG8A 3FQNA 4O51A 4U6YB 3HMXH 4JRXE 2LAAA 1C5BL 3GMLA 1B88A 4ALAL 1QBML 3X3FH 4HD9A 3S4SG 1U8PA 1CFQA 4IRJD 2MQ3A 3TJHC 1KBGL 1N0XH 3ORJA 1K5NA 4XBPA 4OUUA 4HULB 5CKGA 1MAMH 1RK1B 5ESQA 4OLYL 3QQ3B 1UWEL 4OLVL 1YEKL 3L3OA 1RUKL 3IFOB 4NSKA 3TO4C 5H94A 3UMTA 4YC2C 4C56E 4ELKB 4HWEH 1CVRA 2PYFA 2XA8H 2Y5EA 3ROLB 2XTJC 3LDBC 3T0AA 2M26A 1JZ6A 2E7MA 3EJZD 2YPVL 4NQEB 1YN7B 3ES6B 1IAOA 1WQVT 1UM5L 4NN7B 4HG4J 5JHLL 1F97A 1TZHB 4WFEE 1HH9A 4KK8C 4K7PL 1MIML 3TP4A 4LFHD 5EOQL 1RQ5A 5TGBB 3HNTL 4FQXB 1CLYL 3LEVL 5IBTL 2J4WL 4NHUB 5GGTH 1NGYA 1VERA 5T1KA 3ALPA 1CIUA 4Y5XA 1BJMA 5E5RB 2VQTA 3ZE0F 4C56A 5I75C 1IRAY 3KYNB 4Z5RA 3DVIA 5D1ZB 4HZAA 2CGRL 1OP5H 3MV9E 1IMHC 4QRPD 2ADIB 1XF2B 3SGKA 1TCRA 1JZ3A 5I2IB 4A2MA 2X1QA 3OKOB 3LIZH 1VKXA 1RFDL 2EKJA 4AH2B 1A4KB 3MRQA 4OIIL 4M5YH 1KN4L 3WUWB 2UVEA 3ZKND 3KHQA 5E5UB 1AH1A 5IT2L 3MXWH 2DYPA 5F44A 4IOSD 2AXJA 4JRXA 4RBPK 4K23L 5IB1B 5JW4N 2EE2A 4OZGB 4TSBH 4X5XA 5ANME 3TBSB 3E8UH 2H45A 2B4CL 2C3XA 4LSVH 2Q87A 5C0CD 1W0WB 3H42H 3QUYB 4NRZA 2C3HA 3Q48A 1PG7H 1E6OH 3MGOA 3BPLC 2HJKB 5LXGH 4HMCA 1ZA3A 1BFOA 3JWOC 5CZXD 4GUPB 4IRZL 4EXPX 1CFNB 4AEHL 4YZFE 4Q7DA 1G9NL 3KPSB 3QUXC 5FO7A 1HHHA 1VGKB 5HHPB 5C0BB 3X13B 4KZEL 1L0QA 1D5MB 2NTFA 1Q72L 1IEBA 2H26A 4XCEA 3D0VB 5DGRA 3NABL 3BRDA 3T0DA 2F19H 2WUCL 5C0AE 1U8QA 2JB6A 4FTVB 4U2YA 2ADJB 3GJEA 1RZKC 5EOQH 2F53D 5SWSA 2R1WA 1P7QB 3LMJH 4PG9B 1JHLH 3DX8A 4L3CB 1J5OL 4YHKH 1TVDA 3GDBA 4PJEA 3E0GA 3EZ8A 3OAZH 4P3DA 4PJBB 5EO9B 3WNKA 5C6PB 3HG1E 1LP9E 1QNZL 4H26B 5CJBA 5E7FA 3PWPD 2R4RL 2BDNL 2J7LA 4KVCL 5I15L 1MHPH 4F7PA 4JFQB 5IW1B 1NL0L 2PYED 1S9YA 5IKCB 1XIWC 2DQCH 4Y5YB 4WJ5A 1A9EB 4PRPD 4KHXL 5DD1H 3V8CA 3QIBC 4JJ5B 4OLYH 4U6HA 2AJZA 3MZTA 3MLTA 1HDMA 4ISVB 3NPSB 4NN5B 3I6LD 4GKNA 1UG9A 5CWSB 4OGZA 3MFFB 1T7YA 4ZS7H 4HZLB 4MDJB 2P7TA 2EH8H 1DVFB 1KPVB 4JB9H 4GQPH 2VLKA 3QPQD 4OAWB 2DBLL 2GK0A 5CJXA 5BRZD 4G6AC 4JGUA 1Y0LB 4BM7A 1IGJB 2IADB 5BS0A 1R5VB 2HH0H 1IAMA 1YYLL 2CUIA 2VQ1A 4CN4A 1IGYA 2WBJB 3BI9X 4X98A 2IMNA 4WO4A 3TBTA 1KIRB 4OSUL 4HKJB 3WFCH 4JFFA 2F54D 2UY7A 3EOAB 1F58H 2PNDA 3GHBH 1A5FL 2FWOA 3JV6B 1WC7A 5SWZE 2IC2A 4KKAC 3ILQD 4F33B 1FL3B 1M1SA 1WWBX 2C1PB 5HHMB 2A9MH 4MA7L 1H8SA 4YXKL 5JO5A 1CWVA 3S3PA 1JFQL 3HZKA 4ZAKB 1GGTA 2OR9H 1DQDH 2GAZB 2W60B 2OL3H 3DXAA 1Q9LA 4I0PB 4FXGA 4UUJB 4NN6B 3UTTB 2FO4A 4M03A 3LN4A 4PJHE 4LEXL 1RK0B 2IAMB 3FB7A 1V7ML 1CL7H 3ZKNC 3PF2A 4BSVA 3IJSA 1QOKA 5GSRB 1E28B 4CGTA 4YBHA 2CRYA 3VXSA 3V4PL 3GBNL 3OG4B 1UYWL 2UWEA 2KKQA 5F6HJ 2Z4QB 3EGSB 2XKNB 1Y6NR 1A4JB 1EAPB 5JPNB 2R4SH 4DKFL 1NCBH 3JV4A 1MJJA 3T04D 4CDGC 1Y18A 3Q5OA 5ESVB 4WI4A 4MD0A 3KLSA 5BO1H 3DARA 5JXEC 3SCMC 4JPKL 1U91A 3PQYA 2J88H 2AP2A 4ZAKC 3THMH 4RBPH 4XPAH 1E4WL 3VMNA 4O2EB 1G7IB 1TENA 1IC4H 1N3NA 2A73B 5A2KH 1G9MH 3P2TA 1MHHB 4PRHD 1MWAA 4FTVE 5HYEA 4TRPH 5F8RC 1RMFH 4CL7A 2DIJA 2JJWA 4AEHH 2A6KA 3HMXA 5F9AC 3MRGA 2C4XA 2XOTA 1BZ9B 4PY8J 1HSBA 4JY6B 1FGNH 3E3QC 3BQUC 1I85C 4RA3A 5BXFB 5IMMB 1LILA 4K23H 4EDXA 1QNZH 1R5IB 1EBPA 5FXCH 3EIFA 1IL1B 2X4QA 4U1IB 4UILL 4YHML 4G5ZH 2ITCA 4Y4FC 4PJAA 1MLBA 4HH9B 3CD4A 4D0CB 2AGJH 1N8ZB 3QIBB 2J6EL 5HPMA 4OFDA 5CJOH 3ZTNL 3BQUA 1TQBC 1JZ2A 1KJ3L 1A0QL 4DN4H 1S9WA 4N8VG 5GPRA 5GS0H 5B4MC 4X7FC 3ZHKA 5DJAB 3L5IA 3EDFA 3SGDH 5BVJB 3I6KB 1OGAA 3D39A 4QXTA 2QQKH 3VH8A 1H0DB 3MLXH 1TETL 1UCBL 1EO8L 3MCLL 3TJEL 1KTLA 4RAVA 4MB4A 3WFDL 4G8IB 2FBJL 2MHAA 4QWWC 3MLUL 3PWVA 3C09C 4N0YH 3JBG7 4X6BB 1XGQA 3AU1B 2YEZB 5C1MB 1JTOA 2EIBA 3RVUC 3NGBB 2IQ9H 5DJCA 1OARH 2HKFH 3WL9B 5J6GB 1TJIH 4Z7UB 5DJZB 3EJZC 1M05A 3QO0B 3QXDB 5DK2B 1IEHA 4IOIB 4M62L 3FB8B 2MOVA 2VLKD 3VXQB 5EORH 3WBDA 3V5DB 4PJGE 4KRPB 4P4KC 5J3HC 5MHSD 2WW8A 3TN0B 4LP5A 4F15B 1RJZB 5D8JH 2HTKD 3O6FD 4LSDA 2YPLD 3BPLB 4AQ1B 1B4RA 5I17B 3DTXA 1F3DJ 4LPXA 4ZOBA 2HVKA 5HI5D 4S1SH 5E0QA 5ANMA 4HGMA 5DO2D 3RWJB 1BEYH 4WWKA 4R90L 3HZMB 1YPZB 5EA0L 3DX7B 4IRSD 5CBAA 2OTPA 4PB0H 3LD8C 1UYWH 4E41D 4MJIE 1CLYH 3LEVH 3HC3L 1ZGLA 2DS4A 4P23A 2XNAA 1FGNL 2OMBA 3K46A 1D5ZA 1TZGH 1B0GA 1V7MH 2FECI 2QSQA 4K7PY 3ZLQC 3REWB 5SV3A 4D9LL 1IAIM 4L9LA 5GZNC 3QFJB 3SN6N 1NGPH 4TQEH 1D9KB 4JKKA 3QUMB 5DO2C 5AUMB 2DMKA 1S7WA 5EU3B 3VFWA 5I30H 4OFYA 5I75B 1ITCA 1R24A 3VDAA 1LP9B 2OTWB 4BZ1H 2XZCL 2AXGB 5ENWB 3V0VB 3S35H 5GISL 4KMTH 4ELMB 4KGLA 5CIPB 4JQIH 2FJFA 1KT2A 2NX5E 1LEIA 1G7LA 4OSUH 1DCLA 4Y19A 1WFTA 1HI6B 1LO0H 3AAZA 3IVKA 1A6PA 3BEVB 1DQJA 1XGRA 2BY3A 5FF6B 4F7EA 5C0GB 1L6ZA 4LARL 5E2VL 4F3FA 2ZWLT 4Z7QE 1CS6A 4OUUB 2YN5A 4LSRL 4H0HB 4K55A 2DN7A 5MENE 4Y4HA 3VA6A 2F5AH 3GGWA 5E6ZA 5C0DB 3W39B 2BSSB 2YSSB 4PJFA 1AXSA 2I9TB 2GQHA 3FQUA 2IQAB 1JF1A 1RU9L 4MNQA 3V7AG 5IG7A 4K9EC 1B90A 3HS0A 4KDWA 5D1ZD 4KQ3H 1O5DT 4AG4L 2DQIL 2CQVA 1NCUA 2EYSA 4PGBB 1U3HB 5FO9A 3OPZL 4WFHD 5C9JA 2XZAH 3ARGB 3IDJB 3GNML 4NWUL 1WZKA 2YBRB 2VQUA 3LSOA 1YMHA 3K0WA 3MRIA 4HIXL 5HYSG 2VZVA 3PWLB 3W9DB 1TTFA 1ZOXA 4OD1L 5J7CC 4H8WC 3HI1B 2ED9A 3WFCL 3RGVC 4LKCB 4MXWL 3BX7C 1XIWA 1T7WA 1CICA 1YJDL 4QKXB 3DROA 5I18L 1EEZA 3U4EB 3O3DA 4YO0B 1UXSA 1UC6A 3VI3F 1KXTB 3QUYD 2A38A 1AHWC 3QDGD 3IETB 1TPXC 4HMEA 5CBEB 4R9HA 1TCRB 4PJCF 1X6LA 2GW5A 1OWRM 1LEGA 3OKOA 5E2TH 4DWHA 1AXTL 3LKNA 1OM3L 1R3KB 4D9RD 5F88B 4BFBD 1Q0YL 3BT2L 4M7LH 1J10A 4K3DH 4PIRF 5LBSL 3PIQA 4NDMB 5DVOA 1VFAA 1XCQB 2QSVA 4JM2A 3UTQA 1J1OL 1KB9K 4YDLC 4A6YH 4JPVH 5HI3C 2PCPB 1KJ2B 3P40A 3QUYA 3BW9B 4L3EE 4JE4B 1BFSA 4X83A 2XXCB 5E4EC 4GUPA 1CFNA 1DL7L 3HG1A 1ORQB 1SEQH 1IEAA 3G08B 2DRUA 1KTRL 3EO0A 4YX2L 3LEYL 5FA4B 1FVDB 1WK0A 5EN2A 2W9DH 4YHOL 5DWUL 4Y5YC 2UYLA 5GQBA 2CD0A 3UPRB 1AO7A 5FUOH 3U6RA 3S5LA 2E9IA 3VFOB 1IAKA 4GG6A 4U1GB 1NAML 5TE6L 4PG9A 2D31B 4L3CA 3ZL4H 1ZT1A 3QQ9D 4WFGE 3HNTH 2VLJA 1MFAL 5CSBA 1BD2D 1HHIA 4XP1H 2WBJC 3NZHH 2GTWB 2ZUWA 4WW1A 2X89A 4Q9RL 3QBTB 1EFXA 3ARRA 4NUGL 3TV3L 1AQKH 4EIZC 3HB3D 1C08B 2AS5M 4XBEH 3MYJB 4WJ5B 4M8QB 5DLML 1SQ2N 5DQJB 4PTUA 5D96B 4P2QA 5J11B 1A7BA 2ICWJ 4Z95H 5EZLA 3ISWA 5HJ3B 3QUXB 3S6CA 2IBZY 1H3WM 2FB4H 2H41A 3O9WD 1J87A 4MX7B 3IFLL 3BD5A 3UBXI 3VFGL 5IGXL 1EEYA 2DDQH 2PW2B 4RRPG 3SKMA 1AP2A 3DHJA 4PLJD 4N5UA 1MFCL 2VXQL 2YRPA 2YD5A 3DGGA 1P84J 3DV6B 43CAB 4YDKH 1ZLWK 1L0YA 1G9NH 4ETQB 4MHHI 3TBTB 2QHRL 3AREC 4HKJA 1BQLL 1UZ8A 3TBYB 5DDHA 1DE4A 4KTYA 1NGXA 4Q6IB 3TIEB 1PX4A 1MI5D 1SY6H 4J23A 2DAVA 5ICYA 1J88A 4EBQL 1T1YA 2H8PA 1BGXH 5T33H 3E8UL 4HKZB 1DLHB 3MNZB 1NCBL 1MIEL 3WEXA 1LDPH 1ZHNB 3ZSTA 3EJYC 4ZAKA 2Q7YB 1I7ZA 3LRSB 5EUOF 1JRHH 5E6IA 1G0XA 1QBBA 1KN4H 1KXVC 1OW0C 4TNVK 4QHMB 2YC1B 2DKMA 5IMLB 1LDSA 3Q0HA 5F1IA 2R0LH 4KY1L 3IJSB 2X9YA 3PV6A 3FO9A 5DUBA 4P9HH 3OXSA 4GBXB 4XMLL 3W2DL 4LL9A 1GZQB 2P8PA 5I1CL 2AI0L 1K4CA 3WO3B 3CFIC 1EAPA 2YA1A 2EDKA 3TH4T 4NRYA 5DEFB 1T20B 3TC9A 2A74A 3LKRB 5I19H 4F7TA 3WXVL 2FGWH 4KJYA 5C07D 2EKSA 5GGTL 4G7VH 3WS6A 1G7PA 2NY0C 4HUXB 3PWPE 3PQYB 5IB3B 3MCKA 4FMKA 3WFBH 1GRWA 4NT6B 1M71A 1FIGH 5B22A 3C9NA 3U0PB 3V4UL 4QYOA 1SJXA 2OS7A 4NM4L 3CFEA 1DBAL 4X99A 3S88L 4MJ2A 2BVQB 1N3NB 4JFZL 1FNAA 1SM3H 4JZOA 1MHHA 4LIQL 3SDXB 3SQOL 1XGTA 1MWAB 2B1AL 5TE7L 4M4RA 5HD8D 2OP4L 4FXLA 3FT2A 2XT1B 2NY0D 5GRWA 4HIJA 1PKQE 3VE0B 4YK4B 1QBAA 2DLIA 4JHAL 4MJIB 3KR3H 1NGQH 2UZIH 4JM4L 3P4NB 1A3LH 4MDIB 3CVHL 2H6PA 4NQTA 2ZUYA 4CBPA 4L4VA 4P2OA 2NY1C 1QFWL 4JN2B 1T4KB 4YIQA 3VWKD 4RSVA 3QRGH 3FO1A 4KUCD 5H37H 1XGPB 3GEWB 1KJMB 2X4QB 3PQYD 1J1OH 4A6YL 4W4NA 2QJDA 3OAYK 2FCBA 1O7VA 2X70A 5L88L 4EI5C 5CUSL 1I7TA 3BEWA 2C5DC 5D7IF 1J86A 3JTTB 3ZHDA 5HPMB 5D2LF 2ICEB 2X4RA 1S9WB 4H20L 5H37G 4RGOH 4HUUA 2EXWD 4PP1D 2IALA 1F11B 5I76B 5KSVB 2KUTA 3WFEL 4GW1B 4PPTA 3HE6B 3EAKA 1II4E 4W81A 3GRWH 1OAXH 4HBCL 3LV3B 2HN7B 4YHIA 1YNLH 1CE6B 4NPYA 4PYHA 4X5LA 1W0YT 3CNKA 4ENED 5BZDB 5D72L 1VFBA 2X10A 2H32A 3MRPB 3BESR 1L4IA 3PHQB 4S10A 2HT3C 3D9AL 3I02A 1RUMH 1PBYA 2HFGH 2PN5A 4KXZI 2HFGL 5KJRH 4RAUB 1MFBH 4ONHB 1ZVSA 3OAZK 4PJ5D 4X7TA 1G7QA 1JWSB 3PP3K 3M8OH 3WL9A 5C0FA 1VEOA 1OLZA 1MQ8A 4N8VB 5HVFB 1FVEB 4P2YA 1M05B 4HEME 4YBQD 1NCDL 2AJUL 3GO1L 1KENH 1QSZA 1M7IB 2I9LB 4AG4H 2NY6B 1CFVL 3BIAX 5I17A 3UC0L 3VD7A 3VFNB 2P47B 5EU6E 3SO3C 1F6FB 4LAJH 3MJGX 4DOHB 1YPZA 2V2XA 5IUSA 3EFFB 3LS4H 2YPLA 5HHQA 4K8RH 2DLFL 4FQIH 4NOBA 2YOCA 1LQSR 5GGUB 4HIIB 5I16A 1HYSC 5I18H 4XP4L 5T5FH 1LO0L 1YDPA 3IU3B 1J0YA 3T4AA 4MXVF 3VXOA 5JXAL 4MLSA 4PJFE 4K2UH 1A6TA 3DMMB 4N9GA 5AUMA 4LLVA 1IQDB 2IH3B 2W91A 4PP2B 5IHLB 4YBLC 3VI4E 2B2XL 3N85L 3WDIA 5IOPA 4XCYB 3CDGA 1WAAE 5M94B 4Y4FD 5DGQA 1CDBA 4N5EC 4ELMA 4PLNC 1SM3L 3WFZA 2EDYA 1N6UA 2W0KA 4H0GA 2APTA 2FGZA 5CIPA 4LRIA 4CKVX 4JQXC 1ZXQA 3H3PH 5JUEL 3L3DB 4OCNC 2NY1D 3WXWH 4OF3A 4XCCH 4BH8B 1DBML 4DGVH 4F7EB 1QLEL 2G75B 4JO1L 1DSFH 4JFHD 4OB5L 5T3XH 4Z77B 1J8HE 4F3FB 3BISA 1SEBA 5IEHB 3ARFA 2X44D 2DQGL 5KAQF 3SQOH 2QV2A 4GH7B 1K2DA 4NO3A 4U0RB 1MIEH 4RFEB 4DKEL 4P23D 1G84A 3F8UB 2GITB 3KYMB 4TNVF 4R3SA 4IMLB 2IQAA 1NC4B 4KKBC 1TCMA 2DQJH 5D5MA 1FE8H 1SMOA 5F7FA 3D3VE 4UAOB 4JREC 3MA9H 3QZWA 3MV8B 4QO1A 1YY9D 5AD0B 4PLKD 3MXVH 2D03L 5IFAH 4TVPD 3KJ6L 5JHDA 3IGAA 1UKQA 1SBBA 3W9DA 2XQYG 1BM3H 4I18B 1LDPL 4Y5VC 2FNBA 2FATL 4D9QE 2XTJE 5K9KA 1NGPL 4TQEL 3OHXB 3R06B 1IGCL 3P11L 4MNGB 1FV1A 4KKAD 4R4ND 1U8OB 2APBA 4S11A 3RGVB 1KELL 4BSJA 5JNYA 4R26H 3QJFB 5L9DL 3A6BL 3OWEA 1IGML 4ONFL 4RMSA 2Y07H 3UYOD 1FG2B 5AZEH 3MRMA 3QDME 5SX4I 2K7QA 4OM0L 4U1LB 2FO1A 4YNYB 3BP4B 3BWAB 1R3KA 4NJAL 5B39A 1KGCD 3IKCB 3O2WL 2ZOLB 4KXZH 5EZOL 5K9QG 4YGVB 4KKCD 4DN4L 2SEBB 4MZ2A 4RMUA 1FNSL 4RMQA 3ULSA 4PR5A 3PIQB 4QHNA 5DRXA 4OCYL 3RWEB 1UM6L 4UOJA 2IG2L 3F6LA 4JN1H 1RURH 4JZNB 3ARBD 1OQXA 4POZC 4U3XA 1EO5A 3PXJA 4LHUA 3E2HC 3W0WB 2J12B 3MV7A 2YWYA 5DUML 5C07E 1LO4L 4P5MB 3VFPA 1CXLA 4LIQH 1JPST 5BMFH 2JF1A 4X6CA 3PNWB 3EOBA 2F8OA 1QZ1A 2WWKO 2C3VA 1FORL 3FRPA 5C86A 1MVUB 2CPCA 3GMRA 1CGXA 4RMVA 2XG4A 2NY4B 3G08A 4FQQA 2EO1A 5DJ8B 3RNKA 1IGTB 2X4TA 4U3HA 1BPVA 5EOTA 3GSOB 2HJFA 3IS1X 3P30H 4JRWA 4UT6H 2D7TH 3T2NH 1JHKH 5JQ6L 4JKPL 5CP7A 3SOBH 4M7ZC 1V8HA 3UPRA 3V6FA 2Z92A 3MUGB 3N50A 3VFOA 1DDHB 4GG6B 5DJDB 4GXVH 1KIQB 4TYUA 4M93C 1MY7A 3GRWL 4Q9BA 5E4IA 5C3TA 3GMLB 1NBVL 4X6EA 3O41A 4ZSOA 3MBXL 5ICXB 4QEGA 1I1FB 4Z76A 4PJ9B 2NY2C 4G6JH 3LQAC 5KSUA 1ZV5A 3ARDA 3QQ3A 1IQWL 1HHJB 5E2TL 4FABH 3L3OB 5C71A 2HFFA 1QEWB 5L8JB 4JPVL 3MRLA 1NCDH 3GO1H 1ORSB 1A6UH 2X1XR 3AVEA 4B53A 4KKBD 5D7JB 5FYLD 5ISZA 4UDUA 4K3JL 5FYJD 1I8KA 3FCTB 1JMZA 1F90H 1UM4H 3IDGB 3MV9B 3NCEB 3SDDA 5GGRA 3C5ZB 4IS6B 5C07A 5HPOA 5F70A 2BNQD 5T3ZH 3H3BC 1O7SA 1QD0A 5IFJB 3WFHB 4EI5B 4KROD 5GS0C 1U3ZA 2NR6D 3V6OA 4ZOAA 5ERWB 4UIMA 2P5WB 4PJDA 1MREH 4JO2L 3PUCA 4JHAH 3QI9C 3V0AC 1Q94A 1EEQA 5F7WC 1KTDA 3QHZH 2HMID 5JIKA 4ETQA 4PFEA 4EN3D 3QO1B 1N4XL 4CADB 3QEQE 1QHPA 2GJ6E 4MNQD 2XACC 4Q6IA 3TIEA 1I1AA 4RDQG 1INEH 1UQSB 5IR1B 4U1NB 3MLVL 4F58L 5ADOH 3HC4H 3F7YA 4B7IA 5C8JB 2ADIA 3ZKXB 1BBDH 5F1SA 1QA9A 5DURB 4ZXBB 2E8ZA 2VZ3A 2J8HA 5I2IA 2J8UA 1VKXB 4OF8A 3TV3H 4PRPB 5FUZL 4PJDE 4JO3L 3C2SA 4JR9H 3ARFD 5DUPL 3G04B 1FJ1B 3O45A 3CSPA 5DR5L 2BK8A 1MFAH 3PV6B 3RGHA 2GKIA 4UINL 3OXSB 5LG1A 5ITBH 4WUUD 2P8PB 2FJHB 4F80A 2CMRL 4B7LA 1ZT7A 3QEHB 4DVRL 5IB2A 2I24N 1MVFA 4JVPA 4MXQD 4NRZB 3BKJL 4WW2B 1E4XL 4ZUUB 5GISH 5FUOL 2AKRB 2D7PA 5AAWA 1QSVA 4MWFB 2O5YL 4KJYB 4DCQB 1KCSL 2IPUG 4ZFOL 1VGKA 4OCSL 3SDCD 1HK6A 4JQXA 3OJ2C 3C5JA 3X13A 2VSCA 4XMPH 5IB3A 3MCKB 4U1JB 5EZIL 2XWBB 3QQ4B 3QUMH 1M71B 5HGHA 1CBVH 2D2OA 4V1DA 2EDEA 3NIDF 2KL6A 4CAGA 3T3PE 2OK0L 1AD0A 5L88H 4JRYE 3B5GA 4LPWA 2EDBA 4BK4A 3IYLW 1MRDL 5FOBB 3DSNA 3RJQB 4PJEB 2I5YL 1QR1B 4QXGL 1MJ7H 1NCCL 4PJXA 4MJIA 4WFED 3QDGE 5C09B 3LRGA 3HFMH 1UEYA 4OZIF 4MDIA 4U1HB 1CGVA 2WNGA 3VRJA 3BIBX 5T3XL 4P2OB 2C1OB 5IGXH 3UEZA 5B8CB 1QO3A 4ODUA 1KG0A 4QTHB 4MA1C 5DK0B 4P4RA 1MCFA 1YYML 4BSWA 3F12A 3CFKB 4R4FL 5EORL 1XGPA 3BP6B 3DX6A 4P99A 2V2WA 3QA3B 1FFNB 1T21B 4ERSH 2ORBL 4WW2F 4S1QL 2X70B 1NAKH 3CXDL 2FZ3A 1TXKA 3BEWB 2HG5B 1MCOH 3T1FA 2VC2H 2VIRA 3V52L 4E5XB 4K9EH 4J3UA 1CDGA 2ICEA 4KU1A 3MCG1 4WCYL 4C57C 5JW3H 4JCMA 4K7FB 1U8JA 1LK3H 4D8PB 1HH6A 2OXHA 5CEXB 1QP1A 1KELH 2AK4A 3VXPB 3VD9A 3LOWA 5KSVA 3R0NA 1WZ1L 4OI8A 6FABH 5INDA 3VG9C 4GFTB 5I74C 3BSZL 3PL6C 3RY6A 1CE1L 2Q20A 4HXBH 2H32H 1PSKH 3H9SD 1FLRL 5BZDA 1GC1C 3CH1A 1CLOH 1EGJL 1NEUA 4EXKA 4HJGA 1HYRC 2FWOB 4YDIH 2R0ZL 3O0RH 1A0QH 4G8EA 3RU8L 1B3JA 2C1PA 4L9DA 3SJVD 1AKJD 4ZUTA 1H9VA 1RUPL 2ZSWB 1KUMA 3FQXA 4DAGH 1I1AC 1QKZH 4YXLL 3HUJB 1UH4A 1ZVHA 5EBMB 1Q9LB 2X4OB 2YZ1A 3O6FC 1KGCE 1FE8L 2HTKC 5MEPB 5HGDB 5IW6B 1RUAH 4GRLB 1KTKE 4LF3B 4QHLA 3T0ED 5FHAL 5K9JH 4MVBC 1ACZA 4TOYH 5FYKD 3VXSB 1T2JA 5CMAA 1A6VL 2R15A 2W9LA 4HGKC 3VFNA 3B9KA 2Z4QA 1AGFB 5ETUA 4X4ZA 3OB0K 5JPNA 4JLRB 2COQA 5E4EB 1A7RL 4Y16B 3TJEH 3JV4B 4ZNCD 2ZNWA 3IJHB 1MFNA 4W4OC 2XZCH 1G0DA 2BXYA 4MD0B 3BH9B 2AV1B 5TE6H 4KI5E 4X6CE 5GGUA 1P84K 3QQNA 4KTDL 5GGSB 1KCRH 3KNBB 3D2UB 1BFVH 3ULVE 4XPAL 4JJHA 4FZ8L 2FSEA 5A2LH 5SX4H 4H5SB 1J0ZA 5TQ0L 2E9WA 3X3GH 5D7IB 4CVZA 1GCFA 4LLVB 5E6ID 4GRLD 1MCNA 5K93A 1EGJA 4FQJH 3BIKB 5KG9B 3ZT6A 1Q9KA 5D6CA 3DYPA 3PP3H 2A6KB 4HLJA 3ABZA 3VH8G 5JZ7D 2BXZA 5MERA 4Y2DD 4RMWA 1OVZA 4O5LL 3CK0L 3O2VH 2DM2A 1OTTD 1YQVL 5FHBL 3MMEA 2BY1A 3L3JB 3L3DA 2UWEE 1SJHA 3H7LA 4KUZH 1UWEH 1ZHKB 3QJHB 5IHUL 1C8PA 2ITCB 5LJYH 1SYSB 4WUUA 5B21A 4D0CA 4NYLA 3GM0A 5D96C 2BNUA 1N8ZA 3QIBA 3ARGC 3WO4C 3N1PC 4XVJH 4DK6A 1HWGB 3PJSA 1RZKH 3ULUC 3K2UH 5TH2A 1FYTA 3KS0H 2P5EA 5JDJA 1OSZA 5EFIB 3PDOA 2FLBT 1A3RH 5FGBC 1OF2B 4S0TD 4ZS6C 3MRBA 1FBIL 1OGAB 1TJGH 2D3VA 5LGKA 4KV5E 5FGCE 1S8DB 3MV8E 3PHOB 1DBKL 5HD8C 5ACZA 2JB5H 4XPFH 1YC8A 3NTCL 1LE5A 4H25B 3F5WB 3BKCH 1EPFA 4I18A 3TO4D 4NZTL 4L8BB 1RUQL 2ADFL 3QEQD 5ALBH 5CSZA 1R5WA 2FLRT 1XGQB 4G9FE 5K9KB 3P0YL 3QIUA 4EVNA 5TDPA 4XHQA 4UNVA 4FFYH 4LPUA 4U4BA 4MNGA 4KTEL 3CFBB 1FV1B 4C54A 4YEEA 5FYKL 3BP7A 2EXYC 4RDQF 1FFRA 2CK0H 3B9EA 5F7HA 4HX1B 3MRRA 4IOIA 1FL6B 1LE9A 5DJ2B 3VXQA 5I73C 1NAMB 2EDHA 1GIGH 1YZZA 1TZGL 4ODVL 2VDQH 2XN9B 2LV4A 2PYEE 5FV2A 1RJZA 2JTDA 4YNYA 4G8GA 3IKCA 2ZOLA 3CVHA 3I75B 4LRNL 3DVGB 1JYXA 5GGVL 1RVFL 4J6RH 4NC1E 4NQDB 3MUHL 2FHCA 3IDIB 4JZNA 5T33L 4HUVB 1BZ7A 5D70H 1RZIA 4G80A 3D18A 5CJQH 4TRPL 1A47A 4XHJD 2BSTA 3E6FA 3P9LB 4J3TA 3RHWK 2R2HA 3F7RA 3EOBB 4KTEH 3WO4B 2PXYC 1L9MA 2X5PA 2HT3D 3STBA 4LHUD 2BDNH 4KVCH 5EU3A 2BRRH 2EDLA 2ED8A 4LDLB 4HGWA 3VFWB 5I30L 2V5SA 2NY5L 3ARFC 4KVNH 1PQZB 1T5WA 1J8HD 4PJGF 4X80H 4NUJB 3A6CH 3LH2H 3S88H 1PZ5B 4MZ3A 1X5AA 4KHXH 1AY1L 2AXGA 5DD1L 4O2FA 5ENWA 2YMXL 2JK5A 1DTUA 1ZSDA 5IQ7L 3SKOB 4NQCD 2FJFB 1ZLVH 1JN6B 2ILLA 4MA8H 4C59B 4OCLC 4Y19B 5HY9A 2AJSL 3MREA 4GRLC 1FAIH 3S34H 4UIKL 5ICXA 4WHYG 3BKJH 3TF7C 2DQHH 1CDHA 5FA3A 3JXAA 5C6TL 5C0AB 5ALCL 5JW4Q 4B0MM 4NRXB 1FAKT 5C0NC 2Y6SD 5I1CH 3QR2A 4F7MA 5I1DA 4Y2DC 3RAJL 3NVQA 5JMRA 4KUZL 3W39A 1J1XH 2I9TA 2CRMA 4GJTB 4Y4KA 1JF1B 4MNQB 2A0LC 2HAZA 5E7BA 4APQB 3JSSA 1NCTA 3GK8L 3X12A 1VGEL 2YXMA 1FPTL 2W0PA 1PJ9A 4UDUB 5J4MA 3LAFA 2WBKA 5ID1B 4CN6A 1U3HA 5IMOA 3H0TB 3QAZB 5IFJA 2ZP0T 3ULVD 4M6NL 2WIIA 4MA3B 1KC5H 5IVZA 3VWKA 3EOTL 2P46B 1CK0H 1X5ZA 3EDKA 1LO3L 5JLZB 2VDLL 5DQDL 2LU7A 4KROC 5GS0D 1MOEA 1KPUB 1S9VB 4CVXB 1P5UA 1XIWB 3QO1A 3MRHA 1NDMA 2KQNA 2WQ8A 1I1AB 5F97E 3D3VB 3V7MA 3BGMA 3F7YB 3TBVB 4WI9A 3W5MA 2AK1H 2LAGB 4XNUL 5D7LE 4WVRA 1OAYH 1BF2A 5E9DA 1U2CA 5TDOB 4ZXBA 4EOWL 1LEGB 3CX5J 5GZOD 2AERT 4L8DB 1GOHA 3KGRA 4JPKH 3N1GC 1TVBB 3G5ZB 2PYEB 4PRPA 5A1AA 1A6UL 3RZCB 3W81A 1KNOA 4AQOA 1K9TA 1QSFD 1FGVL 2XPGA 5FDWA 4NDMA 2R39A 5JOFA 4OD3L 3ZTJH 1VHPA 6CGTA 1I75A 3ARXA 1U93B 2APWA 4LCIH 2VITB 2JKXA 5E24E 1LO3H 1BHGA 4N90E 4X7SL 5IB2B 2PCPA 4FQJL 2CDGB 2VH5H 1PZUB 3P9WB 2HFTA 3VWJC 1YEDA 2NZ9C 4K94L 3VXTB 4D9RE 3WLWD 1UWGL 1MAJA 5JW5B 2ZCKL 1AGDA 1XZ0B 4POUB 1IEAB 5KSBA 2ERJC 1MCWW 1JRHI 2R0WL 3TCLB 4JG1L 1YQ2A 2KZ1B 2L0DA 1IFHH 4FFYL 3MRFB 4C4KO 3OJDB 1WT5A 4M43L 5EN2B 2OMNA 2Z8SA 3NCYP 2IAMC 2W65B 1FFPA 3HI5L 1OSPH 3DETC 4XB7A 1GGIH 4V1DB 1IARB 3L5XH 2WP3T 5E99H 3GMNB 1CL7I 1AGBB 1YEGH 1UZ6E 3FQNB 4O51B 3MC0A 4U6YA 2XRAH 1HQ4B 1KLGB 3SGDI 3NH7L 1QR1A 3RWDB 1R3IL 2CKBA 1VFMA 1U8PB 1EJOL 4DGYH 4ZFGL 3ZKMD 2BNQE 2NY5H 3NFNB 1HHIB 4DKDC 4HFUL 5KSBE 2R2EB 1RZJH 2C1OA 1QQDA 3DX9A 4OKVA 5FCUL 4ODUB 4XPGH 4NKDB 5F7KC 4YDVB 3F12B 3MYJA 5JPMB 1LP9F 5FIEA 1T22B 3FQRB 3WIIL 3P73B 3BT2H 2X4UB 1B0RB 3GMMA 4MQ7A 2HMIC 2DTML 3N06B 2A6JB 3UCRA 1CLOL 2HG5A 4UIKH 3R8BB 4ACPA 3BGFB 1RVFH 1JZ7A 1K3ZA 4UQ3A 1OHQA 4R0LC 1HH6B 2AEQL 3DJ9A 4FQXA 1BVLB 3QPXH 1YMMD 1NGYB 2VLRD 1A7QL 4G9FD 1CGSL 4YPGB 4NN6C 5HDQL 3IXTA 4L4TB 4C56B 3RX7A 1I9RL 1L6XA 1X5HA 4ZD3L 1WZMA 1NCAH 2R29L 1HINL 2BVPA 1DFBH 1Q72H 5EA0H 5IB5A 1AQDA 3MNZA 1F4XH 3HPJA 4EIGB 4K3EH 1G7MA 5EUOB 4KI5D 1E4KC 4DVRH 1NCWH 1LEKA 4HWBA 3GSXB 4TUKH 1HSAA 2X4OA 3RVVD 5JQHC 4QHMA 4PJDF 3EBAA 3HUJE 3DXAE 5F1IB 2ZKHL 4JRXB 3AROA 5F93C 4OCWL 4LGPB 3BMVA 3AC0A 1GZQA 5CMAB 3LQZB 3D1MC 1I9IH 3B9KB 3HMWH 1A5FH 1W0WA 3BKCL 1YNTA 4OV6F 3F7QA 5DHVH 1JPGB 5DEFA 1HYSD 1P53A 4HJ0C 1BBDL 4Y4KD 4NKMB 1XF4B 2KPNA 2IANE 2VRAA 4Y1AA 1CN4A 2E6QA 5C0BA 3ZYIA 3O8XD 2OL3A 5GGSA 3V0WL 1H8OA 4ZFZB 3KNBA 4NT6A 4UV4L 1O0VA 4XCFH 4QYOB 5EU5A 2FSEB 2NY7L 4LCWD 4FTVA 5F71A 4PJ5B 1MCCA 5C2BL 1P7QA 1XGTB 2R23A 1FFOA 4NQEE 1IM9D 5EBLA 4OLZH 3RJDA 1WZ1H 3T0EB 3BZEB 4HPOL 4O02L 3UX9B 2CO7B 3PWNA 4ZO9A 3C2AL 3IDXL 2R1YA 1S7SA 1L7IH 4QRRB 2L7JA 3QQ9C 2OSLB 5BS0E 4I0CC 2D0FA 3CCHA 1CGTA 2B4CH 3QSKB 1G1YA 2VC2L 1J8HA 3V52H 2ZCHH 2R4RH 4M7LT 1MFDL 1S9YB 5IKCA 5K9JL 4OD3H 1JGEA 3QUXD 4JFED 4A2LA 5EPMB 4GS7C 3VFUA 3QJHA 4YHKL 2AJZB 3RUGA 3TPUA 4JM4H 3RY4A 3ECBB 2DL2A 3JWNC 5ELIA 2DQUH 3CDYA 3FB6A 4XPTL 4P3CH 4PJHA 5J12B 3KPOA 2P24A 5JOEA 2JCCA 3PJSB 2B1HH 1T03H 5FYJE 2Z8WC 3PDOB 1C1EH 3FJTA 4OCXH 1RZ7L 4K7PX 4NZDA 2WP3O 1IGYB 1OF2A 4GW1A 3HE6A 5D6DC 5HI4C 1AC0A 2EIZA 5IHZB 3FN9A 5C08D 3UTSD 1T5XA 2ZG3A 2NQCA 5D6DA 5C0RL 2IF7A 3FFDB 4JFFE 2AXFA 3NCMA 5DMYA 3VXUA 3JV6A 4ZOCA 2BNRE 3RU8H 3GMPA 2XWJB 5E8DL 4RAHA 4RAUA 5HYSA 1XGUA 2APFA 2FX7H 4X7TB 4QF1A 4IBLT 1G9NC 2O5XH 4PG2A 3ROOA 3V8OA 1R0AL 2APVA 1RZGB 4EKXA 4HX1A 4JFHE 5DJ2A 3QPQC 2YRZA 4XVSL 5CJXC 3OXRA 5D5ME 1AE6H 1GAFH 3MBEA 5IF0B 3CUPA 1BAFL 1AGCB 3CVHB 1FRGH 3I75A 4FQCH 5IFHH 4WFFE 5IMKB 2H3NA 4KQ4L 2CDFB 4LCYB 4NJ9L 4Y7MA 1MCLA 3KS0J 2H2PC 2MCPL 2EICA 1PY9A 3GKWH 3SDDD 2M8XA 1FNFA 3EFFA 3WNNA 1ZHLB 4HDIA 3WD5H 4R6UA 1GC1L 5EO0A 4G80B 4P49A 3RPKA 3D18B 1LO2H 2BSTB 3KPSE 3CLEL 1E6JH 5CJ5A 1ZAGA 1HEZB 4BUGA 3MUJA 1G7IA 4NFBA 2R0ZH 3O0RL 3RY6C 1INEL 2GJZB 3ARDC 2A73A 1IQDA 4X5WA 4X4YB 5HHXL 2YPLE 4LU5H 5BV7C 4OGAD 1DANT 4L1DA 4IM8A 3HRPA 2GJ6B 1AJ7L 1MCPH 1OT2A 3SO3B 4O2FB 3MJ8A 1HSBB 1PAMA 3VFSA 4UTAL 2LVCA 5IB4A 4PUBL 3ME0A 3SKJL 2BMKA 4OZHE 4X6DE 1X5GA 1TNMA 4X8XA 5D2NC 3IJYA 4WI3A 5DI8B 1RAMA 2YD4A 2J5LB 4G6ML 4LSPL 4LCWE 3MJ9H 1I85A 4FFVC 1IL1A 4ZQKB 1EHNA 4LLWA 2JJSA 2GT9B 4Y5VB 3QRFM 2XYCA 5J13C 4U1SB 5C09E 1NSNH 1BOYA 1ZWIA 3Q1SL 1C5DA 1G6RL 4R3SB 4JM2C 5CLWA 1F3JA 3HA0A 1G7HB 1NLDL 5D5MB 4WU7A 1RSFA 3C6LD 3H3PL 2EEDA 2R69H 4MJ4A 2BC4A 5T1LB 3I2CL 3EYQC 1JNNH 5IHBA 5C0CB 5DJAA 1N4XH 5BVJA 1JZ4A 1QBLH 5IMOB 4HH8A 1DZBA 2XZQL 1FZJB 2JJTC 3H0TA 3U4BL 4L3EA 2ITDB 1YN6B 5GRYA 2IWGA 1NEZB 4G8IA 5AG9A 2EC9U 3T3MF 2P48B 2MHAB 4NZTH 4KMQA 1A6WH 4OF7A 3PWVB 3WN5A 4RRPA 4ZFOB 4HV8B 4M1DL 3AU1A 5DVLA 1FZOA 3OHXA 4EUPA 5T1MB 1MHEA 4OQ1A 5CS7A 3U7YH 3VD3A 4XAWL 5DHYA 1MELA 1SYVB 2HKHL 4RWYH 3MRHB 3QNYA 3V5KB 3LHPH 2XKUA 1AR2A 3SE9L 1KCUL 1A6ZA 4YDJB 1WBZA 4WTZA 2D7OA 3HUJF 1S7TA 3WE6B 1P9MA 4MD4A 4R7NB 4HAFA 1Z3GL 2F74B 2VDRL 3H9SA 1KLUB 1EMTL 5E9DB 5TDOA 5T1LD 2MSPA 3TN0A 4YAQA 1IKFH 1A7NL 3IDNA 5MENB 2YUXA 2N56A 3PWPB 4YGVA 1AXIB 3O11B 2MQ0A 4OCYH 3QWRD 2Z35B 3RWJA 2P5WE 5CEZL 2DLEA 3DX7A 5CBAB 4PJ8D 3MRNB 4X7DC 1PYWB 3S5LG 1JTPA 5AWNH 3PL6A 3PG2A 4QY8A 3HLAB 4EUPG 4G6KH 5C0JA 5HGBB 3BXNA 4E42B 4P59H 5IIEA 3QFJA 3TM6A 1DVFD 2WAHA 4QCIB 1HQRB 1WLHA 3B2UC 4OF5A 5JW5A 2I07B 3RNKB 1TZIA 3L95A 4JFXA 3SY0A 3RNQB 1Z0MA 3JWOH 2A77L 2NY7H 1R24B 2V7NB 3LVEA 4AT6B 4YHYC 1LP9A 1N5AA 4R0LA 5JHDD 4JRYA 1FDLL 2NY1B 1CF8H 4O4YL 4KTDH 4LPTA 3U36A 3AUVA 1DDHA 1AGBA 4YHZH 4G42B 5DFVD 1LEIB 4PREA 3U7YL 1C7SA 4ODTH 2CIIB 1WFUA 5DVKA 3DV4A 1MCEA 2A9NL 3HI6L 4XP6L 3BEVA 3CFDB 4ZSOB 5FF6A 4WFHE 4K8RC 5C0GA 8FABA 4OZ4A 3P4LA 4KC3B 3ZDXF 1E27A 1IAIL 4I18C 1RIVH 5CAYB 1KV3A 2IFGA 4Q97A 3S4SA 5C0DA 1HXYA 3HE6C 2R0KH 1QEWA 2DJUA 4PJGB 3Q3GB 4KKLC 5FGBA 2H1PL 3QG7H 4HC1A 2BVUA 4UZGA 4ZUVA 5I9QC 4ZSOE 3FN0H 4Z7UE 3VRLF 4P9HL 3W2DH 4GKSA 1WZLA 4QOKE 4J4PD 3DURB 3HZYB 2EYSB 1P7KB 4OFYD 4IS6A 5C07B 1HXMA 3W0WE 4PY7A 4HBQA 3T2OA 2BOBB 2CKNA 1YMHB 4W6YB 1PX3A 3U83A 2I60H 3KYAA 3CPLA 1YY9C 3P0VH 4LU5L 4UQ3B 2DLGA 3EDJA 3VDCA 1PGRB 4TPRL 1IE5A 1Q94B 5C9KA 1KTDB 4GOSA 3KPPB 3GM8A 1KPRA 2BNQA 1EJ6A 1VEMA 4FP8L 1B4JH 3DNKA 2H9GB 5MEOA 3O3AB 4I3GA 4CADA 2XQBL 3BP5A 3U4EA 1BLNA 1UXSB 1A1OA 3ZSSA 4U1NA 5GJSH 3HG1D 3LEXA 3OR6B 1MFEL 4K2UL 4XPBL 1A6VH 2BHUA 5DJXA 4TOYL 1EA9C 1FVCB 3QWRA 4R90H 1P6AB 3H8NA 4LFHG 3LKNB 1U3YA 1GJIA 3ZMRA 4YBLB 1FNHA 4O58L 3ZKSD 4LSQH 4XPTH 4GAFB 3WNMA 5JXEA 3ZKXC 3U46B 1JNLL 3I3EA 3IDYB 3OTTA 4R96A 1JNLH 4W6WB 3O6LL 5IESL 1TVHB 3QIWA 2FX8H 2EEBA 3LQZA 4YDIL 4HFUH 2Q76A 3L5HA 3GKWL 2R0KL 4J3XA 2IQ9L 4W4OA 5T1KD 2BFVL 5A43C 5J12C 5EBWA 4UNUA 5F3HA 1QVOB 3HG1B 2V5MA 3KWWA 1ORQA 3OR7A 3SQBA 4NKMA 1XF4A 5D1QC 3NCJH 2Q6WA 2IMMA 2F15A 4Y1AB 3GFUA 2XQBH 3IDUA 4BK5A 3C5JB 1A2YB 5HYQB 1NKRA 4GS7B 1FVDA 1NFDA 3QQ4A 3BZDA 1Z5LB 4HC1H 5DRWB 1KCKA 2UYLB 1OAQH 3OX8B 4K9EL 5GRJH 1AO7B 5FYLE 1GOGA 2ZSVA 2KBGA 3QH3A 4PY8I 5E8NA 4PG2C 5JXED 1B0WA 2PO6A 2VLJB 4PJ7E 5F9WB 1FLTX 3PWNB 5F6IB 1INQA 3N1FC 1C5CL 4XBPB 4JPIB 4WW1B 3EFDH 1RK1A 4Q6IC 2OSLA 5ESQB 2PTTA 5DQ9B 4IIQC 3RWFA 5D7JD 4YHMH 5LVEA 4D3CH 1YMMA 2VLRA 5K59E 1C08A 4CU8A 1CICD 1RZ7H 1CF8L 1ZLUK 1BEYL 4XPHL 5DHXB 3BP6A 3DX6B 5HHME 1I9IL 2V2WB 3KXFB 2PKDA 5DT1H 1JK8A 1N7MH 3H7BB 1FZKB 5KVFH 5HJ3A 3MOQA 4G7YH 3ES6A 1Q9WA 4E5XA 4MAYB 1MPAH 4LCWB 2PW2A 1BJ1J 3MOBH 3MOAL 1X5JA 3GSNB 1TZHA 3SE8H 1HH9B 1OCWH 4LDEB 5F7NC 4D8PA 2R8SL 4TSAL 3FFCA 1MCSA 2AQ3A 2AK4B 3VXPA 4WRLA 2NTSP 5BV7B 5IV2A 5FYLH 4NHUA 2B8OT 5FYLL 3BKML 4HS6B 4FNLH 1NBYB 4Y5XB 2OQJB 1KCVL 3E2HB 2HLAB 3CH1B 2GUOB 5DA0B 4PBXA 3KYNA 4UT9L 2LE9A 2AXFB 1ZT4B 2HKHH 3VFMB 3IAGC 3VXUB 1FIGL 3GMPB 1DL7H 5E2UL 3IU4H 5F1KC 4PLKC 2D7QA 1PY4A 3RDTD 4D2NA 4QF1B 5E8EB 4AH2A 2CLZA 3L5WA 2WMPA 3ROOB 1PFCA 1Y6KR 2E27L 1BWMA 3PWUA 3TA3B 2AABL 2X4NA 4Z18A 3BHBA 2YC1A 3WFEH 2ZKHH 3C2AH 1V3KA 4LF3A 1YEFL 3OXRB 4KK8D 2AGJL 5BOZG 1MCDA 1PG7W 4X5XB 3TBSA 1ADQA 4WHYH 3STLA 3ZL4L 4I77L 4XVUC 1Q38A 5AYUL 5M7QA 1ND0B 4FQLL 3GI8H 5F1NA 2ZNXA 4X9IA 2F5BH 4XP9L 4AMKL 4F7TB 1KYOJ 1CGYA 2AV1A 4YZFF 2NW3B 3L5JA 1BIIB 4XXDA 3E1F1 4PJAE 1HEZA 1IEBB 3C9NB 1KACB 1VENA 3D0VA 5D2NE 1HNGA 4X99B 4EBQH 4MXWH 4H5SA 5KVDL 2ADJA 3GJEB 4IRSB 1BMGA 5SWSB 1EVTC 1T6VN 5LCVH 4JZOB 4Q2ZA 1Q9KB 3SDAC 3QUKB 2VL5B 3Q5TA 1V7NL 3ARDD 2OJZL 4NNYA 5EO9A 3MJ8B 5I8OH 2AEIT 3BN3B 2ESVB 5MERB 4JVUA 2XN9D 3FO0L 3I2CH 3ZE2E 4AZ8A 1WEJH 3ZO0A 1GZPB 1WTGT 3DRQA 4YR6B 3L3JA 4XXCC 1EZVY 2FB4L 1SJHB 3DSFH 4KJPC 1VB9A 2VKXA 5KVGH 4FXKA 1C7TA 4O2CA 5ILTH 3NAAL 2GT9A 4Y5VA 5CD5C 4RGNB 3MFFA 3L1OL 3M45A 2YD8A 3DI2B 1IM3B 4HZLA 4MDJA 1FQ9C 5SWSD 5HDOA 1REIA 1QPXA 1F3JB 3U1SH 2X4RB 4M7KL 5CHNB 5DFVC 2GK0B 3B8SA 5TH2B 3TYGH 2QADD 4PJIE 3DUHA 3IAQA 2IADA 5BS0B 3SGEI 4XPGL 4XAKE 3HAEG 3NABH 3S35L 3AY4A 3QULA 1CR9H 5BQ7B 3NIDE 2HN7A 1YN6A 3BDYH 3TEUA 1NEZA 1UVQB 4OZGE 1AKJB 3PGFL 4P5TB 2VJXA 1D5BB 2V17L 2H32B 3MRPA 3PHQA 1BM3L 1P4LA 4Y16C 3QCVL 2R69L 2YXFA 3KYOB 4HSQA 3ARED 5E8DH 1H3GA 4F33A 4EVNB 2Q8BL 4EUPB 1FL3A 5HHOD 1OY3B 1BAFH 4N0YL 5EU6D 3W82A 5JO5B 1JJUA 3MLUH 1G7QB 3V5HB 1R3HA 4NQED 4QXUH 1S7TB 3QG7L 4UUJA 1FL6A 1LE9B 1XF1A 4P3WA 1RK0A 2IAMA 3FB7B 4RNRA 3T09A 1F6LL 4BSVB 5GS2D 3TT3H 2NXYB 3NH7H 1T2QH 4G8GB 3V4VL 2ID5A 1QYGL 4JGJA 5IFHL 2ESVE 3HHRB 3LCYA 3NCCB 4OIIH 1KYOK 1X5IA 4ZUWB 3C6LA 1HIML 4K94H 5E2JA 2NMSA 4NQDA 5ID0B 2J8OA 3GSVB 5JHDE 1KULA 3AB0B 3SDYL 5GGRY 2FHBA 4PRIE 1MHPL 1HCFX 3WS3B 2YD1A 5DLMH 3DGCR 3PL6B 2Y4SA 2PXYB 3LD8B 4P46D 4YQXL 1MQKL 2CRZA 2KDGA 4LLDB 2NYYD 3V2AR 1KSRA 5JA8B 4O2EA 4MNHA 2QQQA 5H35B 1L7IL 4YBQC 4HWBL 3NACH 1CZ8H 4GRMB 4PP2A 4BELD 2B2XH 3L95B 4WY7H 5I1GL 2P49B 3H9SE 1FZMA 1WUNT 3SY0B 1GGBL 3GSRB 4BQ9A 1EDQA 2V7NA 4L4TE 4HK3J 2QQKL 1DEEB 4R0LB 3U4AA 3VGFA 5FYJU 2BERA 4NO2A 3H9ZA 4P57A 5D2LA 1N59B 4AL8L 1UADC 2WIMA 3FKUS 3NZHL 3MREB 3QIUD 2ATKA 3SDYH 4LK4A 2Z31A 4M1GL 1MNUH 4MS8D 1HHGB 4U1IA 1VADB 8FABB 5C0AA 1S7UA 2GTZB 2DBJA 3BRGC 3ARFB 5HHMD 1RZ8B 1XR8A 4HH9A 3S4SB 4NO3B 3WKMH 3TT3L 4N8CH 1EK3A 4F7CB 2HJLB 1YEIH 5J1AB 4L9LC 1X3DA 4PJGA 2OYPA 5D93C 4OI7A 4RISH 2AABH 1VGEH 4MA8L 3X12B 4ZUVB 2D4DA 3VA2C 4GKSB 3QZWB 3T08A 3HZYA 1A7PH 4RWYL 5D7LA 3AMLA 5JHDB 4YFDB 1Q8MA 1H0DA 4PRNA 2CH8A 4GAYB 2WIIB 4V2BA 3CPLB 3HC0B 7FABL 4N1CA 1WV7T 5JLZA 1NUFA 4X6BA 5EC2A 2JE8A 4Z0XB 1T0NA 4LHJB 4G6AD 1CCZA 4OZIE 1K6QL 3CZJA 1XR9B 1PW3A 2CLRB 5GGQL 2H9GA 5MEOB 2AQ1A 3AS3A 4NM8H 1U8OA 1T89C 3HR5A 2ARJA 3V95A 5JNYB 4OLXL 1FG2A 5DK2A 5HDLA 2P5ED 3CFCL 3V5DA 2ED7A 4WHCA 2AEQH 3VGGA 3BWAA 1HE7A 5KZCB 3O6KH 4WTXA 2EDOA 1R3LB 3UZEA 3QB7C 5JW4M 4LEOA 2DIBA 2E9JA 2SEBA 2GCYA 1MI5B 1PDKA 1KNOB 3B2UD 3BN9C 5TQ2H 5DRXB 3SGJA 3UTPE 5L0QB 3H2WA 3I9GL 4I13B 5TJWK 3UTTE 1TVHA 3QIWB 1MLCA 3ARQA 3A67H 3MRDA 4LHUB 3W0WA 2Q76B 3ILQC 4NNPH 4P5MA 1PLGL 4RZCA 4X6FB 4K3EL 3P9MA 4P9HC 3GJFB 5BJTB 4XAKD 3GUTA 2C3VB 3QT2A 1C5BH 5LAXB 3GMRB 5KSBB 5ITFB 2VN4A 1I9RH 4ZD3H 2BOCB 2V9TA 3NN8A 3GHEL 5EOTB 3TCLA 1U0QA 2HJFB 4YXHL 4L8SB 4OGYH 2W92A 1JTTA 2WLZA 2OTWA 1VFUA 1FFPB 4FOMA 3V6FB 3T4YB 1JGLH 4DQOH 5LWYL 3BKYL 3MUGA 1GGIL 1JF6A 5B38G 3J7HA 3D69B 5BV7H 1LK2B 2W0LA 2E5EA 3DBXA 5K33A 1K6QH 2NX5D 3EYOB 1H5BA 4X6EB 3AAZB 3IFNH 3NGBC 1TLKA 3RTQD 3IVKB 3LKQA 4ZFGH 3NIFE 5TE4H 4AJ0A 1INQB 4S1SL 3I6GB 4JPIA 1QUNA 2Y23A 1G9MC 3B4NA 4YHNA 2FX8L 3RWFB 1K85A 1JE6A 4XC3H 2VXUL 1BP3B 3DX9B 3G5YB 2VR5A 3GSUB 1AXSB 3L5XL 4X6CF 3H42L 5CGMA 5FCUH 1N64L 2FHFA 3BVNB 5KOMC 4XVTL 1P7HL 1P5VA 4RX4D 3F58H 1A7OH 4OTXL 3ZDYF 3P73A 1JVKA 4O58H 3HS0B 2Y7QA 5FUZH 4UILH 5D7JA 5ISZB 1JK8B 1EUUA 3H7BA 3G6JF 3C6LC 5JORB 2A6JA 4UT7L 1I1YB 2FECL 4FQXC 4KROB 4DGYL 5C9JB 3F65A 3ARGA 3MBEC 1BD2E 2YBRA 3DHMA 4LCWA 1EV2E 1G0YR 3PWLA 4EI5A 1BJ1H 4JG0H 5ERWA 5F9JB 2P5WA 5FYJL 1U8MB 3FFCB 4P9MH 4CNIB 2N4IA 1NDGB 5IV2B 1L7TH 1K8IB 2VSDA 1MCQA 3HI5H 4NZUL 1BVLA 3RTQA 1CD0A 4OZHF 4X6DF 4E9LA 4PB0L 3EYQD 2IJ0C 1D7FA 4YPGA 1B6UA 1HKFA 1CXKA 3UBXG 3IXTB 3O3DB 4GXUM 3JV0A 4WUUE 1D9KD 3Q6FB 1ZT4A 5L2KD 4NKQB 1INDL 2KH2B 3ZE0E 3IKKA 1CFTB 5D1ZC 4K7PH 3ULUL 5GRZA 4MHHG 4KK6D 4QRSB 1ZLVK 5GJTH 1MCJA 3PWUB 2A0LD 2WSKA 1HSAB 2JLLA 1AD9A 3CK0H 3BHBB 4X4MA 1G1CA 2DQEL 4OZFA 4B5EA 1KEML 2DQEH 4G9DB 4HUWB 1T83C 5I1EH 2F8XC 2CRIA 4UTBL 5DQDH 4N0UA 2FEEL 4MB5A 4Q58C 1ZT7B 4PRID 4WY7L 2GEEA 3BW9A 1NJ9A 1ND0A 3LIZL 3MBXH 4UQ2B 3ARYA 4ZMAT 4H0IA 4LGRB 2AK1L 2AKRA 4OLZL 5C0CE 4C4KT 4DZBA 3BDBA 4QRRE 1I7UB 3AS0A 3UZVB 3KPRD 1JFQH 3QDJA 3MACH 3U7WL 5GRUH 4XI5D 2OL3B 3O3UN 1IZKA 4ZFZA 4U1JA 4HC1L 2LTQB 1JYNA 4OCRH 5IBTH 5E6YA 3K81A 43C9B 1FIEA 5CKAA 3KPQB 1AD0B 4Q2ZB 2EYRB 4HIEB 3MJ7A 1YECH 3FAXA 1FFOB 5F7LB 2NW2A 5EBLB 5FOBA 4NNYB 1YYLH 4NCDA 5F7MC 2BFVH 4M9OA 2DQDH 3S97C 1FN4B 4UT7H 4PJXB 1ZANH 4CDHA 4HXBL 2E3VA 4QRTA 5B39G 1OAUH 5JR1L 1NH6A 3CU1A 3P4OB 4HUMB 2B39A 3DRQB 4QTHA 5DK0A 3ULUH 3KPRB 1MCIA 3F6IA 3LKOA 5DQJA 4I3SH 4QRUA 4TUKL 1T7VA 3K4AA 4N5ED 2NY5C 3RUGB 3WJLA 4FZEH 3QUXA 2V17H 2FZ3B 3IB4A 3QP3A 1U8IB 3BZ4A 3FB6B 4MX7A 4CMMB 4J6RL 4ZPTA 1IGFL 1NAKL 5FKPB 3FQTA 3SKMB 4YHOH 5B38B 2XFXA 4FG6C 3LEYH 3LN5A 1LO5A 5KVDH 3C5ZC 4ODXB 3L9RB 5INDB 4BQCA 5L2KA 2ICWB 4LSSH 1NLBH 5K9OB 2EIZB 5H8DA 2XXMB 1UVQA 1DE4B 4TPRH 4PV9B 4LLUA 2H2SD 1OP9A 2AQ2A 4MD5A 4HJGB 3OKLA 1P4LB 4GG8A 2BHYA 4XZUB 1RULH 4WDIB 5L6YL 5D7KE 4HKZA 4JAMB 4KRLB 1ZHNA 5SV4A 3SKNA 2BP3A 2MWCA 2CSPA 5KS9F 1VSCA 5IWLA 1WFNA 5DS8B 1P4BH 4GRLA 1E6OL 5T3ZE 5C0AD 1OM3H 2DQCL 4QHLB 2EIEA 3ZDYE 3CUPB 1T1ZB 3QXUA 4DGIH 3VXRB 3WUWG 4EDWH 1QHOA 3GZKA 3RGVD 3C6LB 4P0DA 2ADFH 4FHBD 4WHDA 5IMKA 3RVWC 5KANI 4JLRA 5E08H 5E1AA 4NRYB 4KPHH 3QUYC 4QOKB 1EUTA 3A6CL 2VXSL 1FNEB 3WS3A 4HUXA 2OCFD 1OAZL 5SWZA 3G6DL 4KMTL 3VXMD 1MWAH 5GGQH 3D2UA 1AFVH 5EO1B 2O5YH 3CFEB 1OTUD 4WV1C 1OB1A 4XVJL 5L6YH 5D7IA 1IC5L 4CVZB 5H35A 2GJZA 2VLLB 4GRMA 4JHWL 5EIVA 5IVXE 1NUNB 2DI8A 1JL8A 4I77H 1JMXA 3GSRA 3G5VA 3FT2B 2D7TL 5F6HI 3HKFA 5D70L 1U8NA 1H15A 1FBIH 1TJGL 4QHUB 1KIPB 1PG7L 4LBEB 4L5FH 4NNXB 4M93B 1N59A 4PJBE 5DRNA 1ADQH 1OTUC 3OKDB 3FTGB 3O3BB 4L4VB 3O8XA 3RVXD 2WANA 5D1QA 1T4KA 1YY8A 4P2RB 1ES0A 4XX1G 3AS2A 4ZG1A 1ZANL 4JGMA 3S96A 5AYUH 3I84A 1R3JA 1OCWL 3F7PC 5CILH 4ODWB 4HJ0D 1RZ8A 4PJ7F 2RFXB 4AY0A 2WWKT 4I4WB 1SYSA 5IHUH 4P2OC 4D94A 1DBBH 1I7TB 1AE6L 1GAFL 1YC7A 3EYUH 1ZWIB 4MCZA 5FDYA 3JTTA 4F7CA 3FZUD 2VDRH 2L7UA 3VGDA 1S9XA 3MNWA 4IRJA 2Y1VA 2JJVA 3QUZB 4WU7B 5JR1H 3T0XA 3VXSE 3A6OA 2P5EB 4KZEH 2DWDA 1OSZB 5EFIA 3HE7A 1TQCB 2MFNA 2IALB 5A16A 4N9OB 1MCRA 4L3EB 2P45B 2D4FA 4BKLA 4PRNB 5ACZB 3C87A 4YHIB 4DAGL 1IKNC 3IT8D 1CE6A 3F5WA 5F89B 3IF1B 5FKAB 4L8BA 2UV3A 1LD9B 3WN5B 2F53E 2CKBL 4L8SC 2QSTA 5CSZB 4QNPE 2N7AA 1TETH 2UY6A 1FZOB 3D25A 3QIUB 4PLJC 4CVWA 1XR9A 2X05A 1SYVA 3CFBA 4NZJA 4WNQB 4M1CC 2ARWA 1EGJH 4OV5B 1A6ZB 4YDJA 1WBZB 3S36L 3EDEA 5GSVB 4N8VA 4FQXD 1PEWA 3WE6A 4MJ6B 3EYVB 3UDWC 3WIFB 1F4WL 4BFIA 2B1HL 1T03L 1M7DB 3VGAB 2D03H 5D71H 4S1RH 4BFGA 5CUSH 3QIWC 1RPQA 35C8H 4Q0XH 4ZNEE 1U9KA 3S37X 3DVGA 3PWPA 4OFIA 5EU7C 2IFFH 4M1CD 1FO0H 2RCSL 4Z7WF 1IGIL 1MI5A 3ALXA 12E8L 1QFWM 1W72L 4OUOA 5FHAH 3MUY1 1PSKL 3CXDH 4HG4K 1EFXD 1MH5B 2RHEA 4ODBD 4LVNB 5D93B 5E03A 4HUVA 1KIUA 2VERN 3OL2A 5HDBF 1N5YH 3MRNA 1RZIB 5FK9B 3MRDB 4IJ3B 4JREB 4UAOC 4FN0A 1JI2A 4GRWH 3REVB 3D39D 2IG2H 4JN1L 3MLPA 3B9AA 1NCNA 1YDPB 3HLAA 3IU3A 3BPNC 1P4IH 1D6EB 5LKNA 2XZZA 4TNWK 3OAUL 3BXNB 1IT9L 2D9CA 4KK6C 2GFBA 4N9GB 3LY6A 4QT5A 2I07A 4JO4H 2IH3A 3VGAC 2PETA 1F45A 3UDWA 4Q9CA 3TT1L 3FQWB 3BYYA 2XA8L 4PJEE 4AENA 4WGWB 5L2JB 1N5AB 2UZXB 1IGMH 2JK5B 2VDML 5LCVL 2FYYA 2ATPA 3TZVA 2B0SL 5SX5K 3U36B 1ZGLM 1ZEAL 3WSQL 3D69A 4UOW1 4LKXB 4NQSB 3INUH 4PREB 2ZPKH 2N1KA 1T6WA 4Y88A 3DV4B 4GRWB 5HY9B 2EDTA 2V2TA 3K2MC 5D7JC 1A8JH 3SDAD 2JIXB 1W8OA 2E7CA 1P7QD 5FA3B 3FFCD 3VMPA 3CZFA 1M6OA 3HE7C 1NKOA 3IFPA 1DQLH 1K2DB 5I1DB 5CSGA 2DTSA 3G5YA 4C55A 5AAMA 2ENSA 4Z7QF 4M6MH 3O2DA 4IMLA 4LNRA 5ADPL 2DIAA 1FSKC 4APQA 3B9KD 5DEZA 3EYSH 2WQRA 4MLIA 1G7JA 4Y5XC 3FO0H 4UB0H 2VOTA 5M95B 2HT4C 3U0WH 3DURA 2YA0A 2JJSC 3UO1H 4F37K 3NA9L 5AEAA 4JR9L 1IC4L 3P77A 3BPOB 4KZDL 1NCAL 5F9JA 3QHTC 3VWKB 3NFPA 5BVPL 4HK0B 1YPZF 5IWLC 1XIWD 2IANB 3CMOL 5EU4A 1K8IA 3QNXA 2R9HD 3R06A 4YWGH 3RTQB 2H1PH 1DBJH 3ULUF 3UTPD 3UJJH 3CX2A 5DMIL 1S7RB 3C6SB 1BOGB 4DZ8A 5TQ2L 3SE3A 3Q6FA 2DD8H 3OKEB 2YPKB 3BGMB 3EYFA 4Z8FH 4ENEC 2J8UF 3K8MA 4FFWC 2QR0B 3IFLH 3VCLB 4Z7UF 5DJ0B 3VRLE 1E4XH 3WKML 1MREL 4JO2H 4KK5D 3L6FB 3OZ9L 3HNVL 5E8OA 1CTOA 1PEZA 3G5ZA 4HLZH 3I50H 3BFOA 5JIIA 3CVIL 2OL3L 1JHTB 5GRXG 4QHNB 1M4KA 3V6ZB 1XF3A 1HKLH 3RWCB 1KENL 4C83A 5F7UA 4RFNC 2J1KA 2EH7L 2PO6D 2EH7H 1CGUA 3P0YH 4PRDB 3JWOL 4K94C 4AL8H 1UACH 2VLMD 4XH2B 4FABL 1UB6A 4UQ2A 5DD5H 5GS3A 5EBWB 1NMCC 1QVOA 3BJ91 4XNQB 4NO0D 1AGDB 1J7VR 2VDOH 1BVZA 3SEPA 4XP4H 4MVBD 4NBXB 3QDMB 5T5FL 2QL1A 5D2NA 4NM8L 2HT2D 1IC1A 3PDDA 4J4PA 1NANH 3UXFA 2FJGB 3W9EA 1NFDB 2AJVL 5FGRA 3PWJA 2DD8L 2AJVH 4UBDC 1PG7X 4HWUA 1BECA 43C9A 5D1XB 2BJML 2FBOJ 2Z92B 3VGEA 4I2XE 2QLVB 3QH3B 4PS4L 3KPQA 3SE8L 4DUWA 2AJYH 1KIQA 3TO4B 3JTSA 2F54A 4HQQL 3B2VL 1HQ4A 1KLGA 5B8CC 2PO6B 2K9UA 3TA3D 2OI9B 5HVHC 4G6KL 1Q9OA 4G3YL 4OJFH 4U1MA 5F72S 1I1FA 2EZ0C 4HW6A 1N6VA 4EI6B 3K4DA 1XGYH 5T1DH 4GRWE 2VO5A 3C5SA 4Y89A 5BRZA 4NBYB 2PTTB 3VWJD 2R2EA 4LCIL 1HHJA 4OKVB 4M3JA 1KCUH 4YGAB 5A40E 1A1MA 1HNFA 2HFFB 1QRNE 1S3KL 1IQWH 1S7VA 4HJJH 4JRYD 5E8PB 5HGAB 1GGYA 1I8KB 3FCTA 3SDDB 1AGEA 5F1OB 2IBGA 2I26N 1T66C 15C8L 1BZQK 4ZPTB 2YD3A 2VR9A 4GSDL 4G43B 4WHTA 3WNLA 3OSKA 2E7LA 3VDBA 2XFXB 2C7UA 2VABB 2IPTH 3T77A 3SGEH 4GMTL 3C8KB 5TPWL 5GZND 4JFYB 3HCVA 3DUUA 4JKPH 4ODXA 2G60L 3Q6GH 5GS1A 1J0KA 5EUOE 4HS6A 5FB8B 4OLEA 1A7RH 3SKJH 3S36X 3MSPA 4I9WE 2ESVD 1CZ8L 1V3LA 4ZFFA 1DN2A 2BVPB 3U1SL 5D9SB 1UZ6F 1FORH 3V4VH 4M5ZL 3UO1L 3NPZB 3HPJB 5IROC 2IBZX 4Q6YA 4MGXA 3FONA 1F00I 2CLZB 3L5WB 4V1DE 1NFKA 4JPWL 3U9UB 1XFPA 3I85A 4I3SL 4KRPC 4P4KB 3VFRA 1UA6L 3VXMB 2X4NB 2R2BA 4I0KA 4M5YL 2PUQT 1UH2A 3GMQA 4UI2A 4WUKL 3OGCA 1ZHBB 1H8NA 1LO2L 2W0FB 3P11H 1T1ZA 4XI5C 1UCTA 1PVHA 1EIBA 3QDAA 3RWGB 3QEHA 5C6TH 1S3KH 3EJJX 2FX7L 4KK9D 1YNTB 1EJOH 3KPMB 4KQ4H 1YEJH 3BDYL 4XVUD 1EO7A 4RMRA 3T2NL 2RB8A 3BD4A 2Y06L 5E5MA 4EN3A 5GRVK 1YEGL 3T0EC 4D0BA 2B0SH 3QYCA 3DMMC 4TTGA 4XXDB 1MIMH 1WF5A 3HI6H 4XP6H 2R56L 3EW3B 3W11C 3T0EE 2X4PA 4OCRL 1WIPA 4NQDD 5EO1A 1F5WA 5EU5B 3D0LB 3VGBA 1NAMH 1OB1B 4JPWH 4JG1H 4E0RB 4X80L 1OOAA 4PJAF 5DZOA 1IJ9A 2XV6B 1W72B 2VL5A 4S2SB 1JV5A 1F4YL 4IMKC 1WBXA 2F5BL 2L4OA 4XP9H 3HAEA 1JWUB 4BZ2H 4M48H 3T0EA 1AR1C 1KIPA 4LBEA 1FG9C 3RTQC 4NNXA 2JCCE 5C09A 5C0EA 3VXRD 1S7SB 4Z7NE 3SE3C 4WEUD 4FFVD 2V9RA 3D3VD 1DQMH 3GSWA 4GW4B 3B43A 3VRJB 4GKZA 1GZPA 1N5YL 1J8HB 1WEJL 4V2CB 4YR6A 5DR5H 1QO3B 1ES0B 3HN3A 3HRZA 4CMHB 2ADGA 3CFKA 3S96B 3STZA 1MFDH 3X3FL 3KPTA 4O2CB 3UAJD 3VFUB 3SHSA 1D5IH 3FO2B 1V7NH 1XCTB 3LS5L 3TPUB 2VZTA 4I4WA 5GXBB 1GHFH 5CD3B 4DW2L 3ECBA 3BH8B 2DQUL 3OG6B 4YUEH 4P2CG 4MCZB 1E4XI 2XTJD 2ICCA 4R8WL 4F9PC 3CFJB 2X40A 2DQTH 1S9XB 3JWDC 3MNWB 4IRJB 2JCCB 2EE6A 5F6IC 4FFWD 4KDTA 5CHNA 4I3RH 2MTPA 3NCYS 3BAEH 5DMKB 3MLVH 4F58H 1A21A 1U8JB 3JUYA 5AZ2H 4XMPL 2DWDB 4CN1A 1CD1A 4NKIL 1ZTXL 5K59F 5C0ND 5F7DB 4Z8FL 3V9FA 3S7GA 3QULB 3RX5A 1KB5A 5BQ7A 3FRUB 1BD2B 1AKJA 4P5TA 1H5BC 2QKIA 4NBZB 3IF1A 2UWEF 4L4VD 3MPCA 1TDQA 3UC0H 3KYOA 1YUHB 4G8EB 3D25B 2Z31C 4M1DH 3SCMA 5DJYB 3R1GH 3ARBA 1C1EL 1KXQE 2ZSWA 3SBWA 2HT4D 3FQXB 1RZGA 2DLFH 1OPGL 1U8HA 2J5LC 3LS4L 2NXZB 4QRQB 3NZ8A 3W5NA 3VXME 5A2JH 3RAJH 4I48A 3CH8A 4HIHA 4S0SD 3QUZD 3O4LA 3CVIH 2V5RA 3B2VH 1Q0YH 1QPPA 1V3JA 4G8FA 4Q74A 2VDKL 4ZUWA 4ZNEA 4JFOB 1AGFA 5ETUB 2CDFA 4QHKJ 1JGVL 1U58B 3G6AB 4JZJB 1A9BB 4OLUH 5C0IA 4Y16A 4JDTH 4N0CC 5E1HB 1ZHLA 4HDIB 3ETBF 3DUSA 3AXLB 5DD0H 1G6RA 2RIKA 5I1IL 3VW3H 4DQOL 5LWYH 5IQ7H 2PXYA 3W0WD 4H1LB 3SOBL 2VLJE 1D6EA 2VDOL 1P4BL 4J8RB 4HS8H 4K3DL 3LKSA 5LBSH 3OB8A 3PQYE 4WI6A 2X9XA 1KB5L 2W9EH 1WCBA 1CXEA 3C8DA 3EFDL 1WIOA 2F53A 1A1NA 2VB5A 4G7YL 1VDGA 3DYOA 4IOFC 2LTQC 2AJXL 1UB5B 3PGDB 2QQLL 3MNVA 5D6CB 3NACL 3MRJA 1TJHL 2R1XB 4DK3A 4AENB 4JFDA 5KS9A 2GJ6A 1DEEA 2NLJB 3VFSB 1MQKH 5CEZH 3WHXA 3PGCA 4J3WA 5JDSB 2VN7A 4P57B 5D2LB 1WT5C 3PP4H 3EYSL 1QFWH 4PJCE 2BMKB 2XY1A 4MQXC 3FAWA 4LAQL 3IJYB 3SDDC 5CGYD 2YS4A 2Z31B 2FRGP 2BCKA 4NQVA 2FH8A 2JIXA 1H3PL 5D5MF 3NMEA 1HIMH 1DFBL 4FQPA 3CZFB 3IFPB 5B3NA 5C2UB 3GB7B 4FQ1L 4JFZH 4NYLB 4ODVH 1C5DB 1GGUA 2HJLA 2WM0A 3OF6A 4JEGB 3RWIA 1MRFH 3UROR 1U95A 3OQ3B 1JHKL 5JQ6H 4WI8A 1G7HA 1DBJL 4I2XB 4PTTA 4ODSH 4GG6F 1RZJC 2OI9C 4DVBB 2BC4B 5T1LA 2C3GA 4OD1H 2UZIL 3S35X 3V7AE 4BUHA 2VR4A 4NFDA 5D7LB 3Q5YA 4PJXF 3D87B 4GT7A 3MV9D 4LQFL 1S8DA 4NC2B 2APXA 1EBAA 1EXUA 3TT1H 4DKAA 1ED3A 3QWOA 5T3XD 1F4HA 5CCKH 5FO8B 5HYJD 2MPAH 5HDQH 2IANA 1R5WB 5EC2B 3QNXB 1NLBL 4Z0XA 2ZUUA 1MHEB 5TDPB 1U8LA 2ZPKL 2CLRA 3OAUH 2NX5B 3WJLC 3WFBL 2DQTL 4WUKH 3RVXC 3D85B 3C6SA 2VLME 4QHKI 1UJ3C 2YPKA 3EYFB 4MD4B 4M7KH 4R7NA 5I1AB 1IM9B 3DMMD 2MCPH 1NGWA 1JZ5A 3IDNB 3QDMD 4M02A 3HZVA 5DURD 3VRIA 2IFFL 3R8QA 3K7UA 3RFZC 2GCYB 1MF2H 1JI1A 4U3CA 4C56D 5T3ZD 5HYIA 3ZTNH 4JQIL 1A3LL 3PL6D 4DJMA 2HP4A 2R0LL 4KY1H 1J11A 3OKNB 2A9NH 3MLYL 5GS1C 4JFEB 3VU2A 1NL0H 1A02N 1BZ7B 4JANB 5SWSE 5KVEH 4CRPA 4Q9QH 4LLQB 2QSCL 5HHXH 3MTRA 4X6FA 5HHOA 1QG3A 3D85D 5DVNA 3P9MB 4QWWD 4HCRL 4PLOB 3B6SB 3CGTA 3GJFA 4NUGH 4PGCA 5BJTA 2NXYC 3EDDA 3GUTB 4QCIA 5DMJB 4PGEB 4NCC1 4XGZA 5EZJB 4CW1B 4NN7C 4X9HA 2BOCA 3CLFL 3QDMA 1PQZA 1T5WB 1CQYA 3BDXA 2G2RB 3RNQA 4XNYH 3QHFH 3RKDC 1VA9A 4HS3A 3PWJB 5L2KE 1HZHH 5CFHA 4JRYB 4ORZC 4JHZA 4OCXL 4BQ8A 3T4YA 2BJMH 2ZOKB 1FDLH 4G42A 3SDAA 4M6OL 4TUJA 3DBXB 2OZ4L 3EYOA 1UWGH 4GSDH 4G8GE 3CFDA 3LKQB 1J1XL 2EIDA 3KLDA 1FSKB 1T1XB 1JZ8A 1YNKL 3DO7A 5DMGC 3I6GA 4LP4A 4PGJA 3D2UD 4GQ9H 5FAAA 3C5SB 5BRZB 5LGJA 4YHNB 3VG0H 4PS4H 5TF1H 3H9YA 4PRIB 4HT1H 4JFDE 5KS9E 3GI9H 3OKKB 4L29A 3MLZH 1MI5E 1QACA 1S7VB 4ESKA 1QRNA 2EDRA 3A0OA 2Y7QB 4RGNC 5E8PA 4OFVA 5JORA 1XGYL 32C2B 4NKOA 1HKLL 3G6JA 4R97C 1HHKA 1I1YA 2FD6H 3P4MA 1S7QB 4XC3L 1KFAH 1BBJB 4F37F 3D39E 4MA3A 3RIFF 1GSMA 3VJ6A 5ADOL 3O9WC 3F7VA 4KJWD 5MI0C 4ZAKD 4CNIA 2IPKA 1ULVA 3KPPA 5I66A 4LNVA 1KPUA 1S9VA 3B9VA 4JM2F 3UTTD 2HRLA 5FUCC 1MWAL 4LPVA 1U8KB 4NWTH 1NMBH 3O3AA 5IVXB 1RV6X 1ADQL 2J6EH 4FRWA 1OGTB 3QIUC 1A1OB 1KJVA 1ZK9A 3VWJB 4JFPB 2BSRB 1PKQA 3LEXB 3HE6D 3OR6A 1J0IA 5KN5B 3KG5A 4CUCA 1NBZA 4LGSB 2GJ6D 4MNQE 1MCOL 5E08L 2HWZH 3F62A 1CFTA 3FONB 4G6FD 4CJ0A 4LCCB 2AJUH 1JUFA 3VXNB 3IXAB 2YUZA 3IAPA 5DSCA 3RZCA 1N64H 2BHZA 5F8QC 4Y4FA 3G6DH 3OGCB 1YEKH 4N8PA 4G3YH 4OJFL 2VITA 1NLDH 4IDJH 1X4YA 1D5XB 1KBGH 4XNXH 4WIQA 4HWNA 5C2BH 1UT9A 1DUYA 2CDGA 2GI7A 1LNUA 2ARJQ 5I8EA 2E9BA 1UGNA 1OAKL 2A6DB 3GNMH 5E56A 1RZFH 4OBSA 4DZBB 5FEBA 4WTZG 3V79C 2NXZC 1I7UA 2Q6WB 3TVMD 3TA3C 3WDJA 3U0TB 3PABA 4RFNB 5HYQA 3MGTB 2VZUA 1CGSH 2XRAL 3QDGB 4K3HA 2W65A 4OI9A 3OX8A 4WEBL 5A2FA 3WMSA 4PB9H 5J11C 5E8NB 4QTIL 2EYRA 4Y4KC 4UTAH 5DC9B 3GBNH 1JV5B 5DTFB 1MCPL 4JB9L 4QRPA 3SGKC 1EVUA 3GI8L 2CKBB 3QFJD 2GYSA 1FN4A 5BMFL 3NFNA 4ELME 1F8TL 5C0EB 3CDFA 1TQBB 4KRNA 5C92A 2X7LB 3O3EA 5DQ9A 3D6GA 3GSWB 4Y2DB 5ISZD 2OTUA 1ONQA 3KXFD 2CIKB 3KPRA 4WO4C 4NKDA 1P9MC 4YDVA 2VAJA 4MJ5A 3STZB 5JPMA 1AIFA 1CT8A 2P8MB 3O2DH 5KVMC 4QRUB 2X4UA 4MQ7B 2DBLH 5D2LE 5MEND 1NQBA 3B9KC 5E2VH 2G5BB 4CVUA 4HT1L 1U8IA 3BZ4B 5HYFA 3NTCH 4CMMA 4MAYA 1UXWA 1SVZA 1QLFB 3T8XA 4Y0GA 3GSNA 2VXTL 2A6IB 3CXHJ 4IIQA 5DJ6A 5DHVB 3L3HA 1EHLL 1EHXA 3LN5B 3HTLX 1ZA6A 3FT3B 3L9RA 5L2KB 5IM7A 4KZDH 3P0GB 4M7JL 1KB5B 5K9OA 2OQJA 4HPYH 1VACA 1WBYB 4KRPD 4LSTL 3SE4C 1ERNA 3MACL 2QKIB 2HLAA 1RUQH 2VAAB 5CZXC 3MR9B 2GUOA 4MD5B 4IHOB 4XZUA 4WDIA 1MPAL 3G6JE 3QEQB 1GL4B 4Q0XL 4XMLH 5HHVH 3AREA 1G7MB 5EUOA 2AV7A 5MP6H 2ENYA 5C0RH 5E8EA 1F90L 1UM4L 5I0DA 5IJKA 1AO7E 4Y1AE 1LEKB 1U36A 1BJ8A 2Z9TA 1RZJL 3PHSA 4M62H 3BRFA 4N68A 3GSXA 4NHCH 2CUMA 2CLVA 3RL1B 1CDUA 1T1WA 1JRHL 1I9JH 5IEKB 3GI9L 3K8LA 2O5XL 4XWOD 3BPOC 4EI5D 1TTGA 1U3JA 3DXAD 3O4LB 4BQ6A 4EQ2A 4G8FB 3TNNA 2D0GA 2YZ8A 2OX5A 4R7DB 3MLYH 5IBUG 4AM0A 4TVPL 1U58A 1JPGA 3G6AA 3QISA 2RJMA 3WV0A 1OL0A 4QOKA 4F9LC 3AXLA 5CILL 1MHCB 4YK4C 2NW3A 3LKPB 1ZE3C 2X2YA 4AK1A 3WNPA 4JHBA 2DQFA 2ZCKH 1EFQA 3ZE2F 1JPFA 1WCBB 4XNYL 1ZS8A 4D9LH 5IVNA 4E41A 3MYZA 4IRSA 4PRAA 1MRCL 3ULVF 1IC7H 3QUKA 4TULH 2R23B 4K8RD 3G5VB 2AK4E 3CIQA 2NXZD 5TQ0H 2P4AB 5I1EL 4KAQH 4XTRD 4TSBL 3BZEA 5JOPE 2EDQA