4YK4C

Human antibody 641 i-9 in complex with influenza hemagglutinin h1 solomon islands/03/2006
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
225
structure length
220
Chain Sequence
QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTDYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARRRSDFETVDFIYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/immune system
molecule keywords 641 I-9 VLCL antibody
publication title Viral receptor-binding site antibodies with diverse germline origins.
pubmed doi rcsb
source organism Homo sapiens
total genus 36
structure length 220
sequence length 225
chains with identical sequence Z
ec nomenclature
pdb deposition date 2015-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yk4C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yk4C01
2H8PB 5L88H 2NW3A 1UXWB 1XFPA 1U8MA 2VDRH 2WM0A 1JWUB 3BGAA 4RFNB 4UQ2A 2IPUG 1UM5L 3RAJL 4BKLA 4ZNCD 3N1GC 5K33A 1A2YB 1DQDL 1IQWH 1YN6B 1IC7H 1FNGB 4N0CC 4MMZC 2PUQT 2EDXA 5EU3A 4H20H 4XNQB 3HE6D 2BSRB 5KZCB 1JYXA 4UZGA 5B39A 3S5LB 1LO2H 3O9WC 4YDLC 2L7UA 1T7ZA 2X70A 3Q1SL 4WUUA 1XF5A 3PDDA 4OZHB 4F2MB 2ZJSH 1AGDA 3JTSA 1U95B 1KIRA 4L5FL 1KGCE 1TJIH 1MWAA 5KW9L 4WJ5B 1Y0LA 1YMMD 4MNQA 2NW3B 4JRXD 2K9UA 4LSQL 4PJ8D 3CSGA 1CBVL 3MJ7A 1U8MB 3AS0A 4P0DA 3VRJB 1ACZA 1DQMH 5E7BA 4BKLB 1UEYA 5SWSA 3IETA 1Z3GL 4X4ZA 1J18A 4POUB 2HKFH 5EU3B 5CINH 2ADJB 3HR6A 2CUHA 5B39B 4LIQH 1IM9D 2GFBA 2FSEA 3MRRA 3DYMA 1G6RH 2X70B 1KN4L 4NCC2 4WUUB 1XF5B 4U6VH 5FYKL 2AI0H 1OAYL 3ARGC 3QQ9D 3H2WA 1AGDB 2EIZA 4N0YL 3P0GB 5TGBA 3HG1A 3VFRA 1Y0LB 3MBED 2F54E 4MNQB 1MHEB 1J05A 5DVMA 4ZUVA 4PRHD 3ORJA 1EMTH 2XA8H 1QOKA 4ACPA 2VDNH 5I1JH 3DVNB 1AFVL 2DI8A 4MA7L 2F5BL 3AUVA 5SWSB 4UV7L 1ZTXL 3IETB 2R4SL 3NIFE 4YFLI 2XZZA 5ICXA 4MJ5A 4ZFGH 5C08D 5K9JL 2GFBB 2FSEB 5JNYA 4POZD 5IBLD 1Q0YL 4J23A 2W0KA 3H9HA 5B3JE 3QEHA 3H42L 4IMKA 5TGBB 3HG1B 3VFRB 4TOYL 3WXVL 5C3TA 4HG4K 2NXYB 2HT3C 2AJVH 3QCUL 4CDGC 1J05B 3NA9H 4ZUVB 3K1DA 3QXVA 3SE3C 5JTWA 3DYOA 4LGRB 4LHUD 1SBBA 8CGTA 3QUZD 5LGHL 5DJDA 3HMXA 3TN0C 5AZ2H 2W38A 3KLHC 3K46A 4K7FA 3MLUH 2X4NB 1LO4L 5DT1L 5ICXB 1AGBA 1HNGA 4MJ5B 5CLTA 5AWNH 1SM3H 5ELIA 1KCUH 5JNYB 4QHNB 3G6DL 2DIBA 2DM4A 3LHPL 3GB7A 3H9HB 3DRTB 5IHBA 3VH8G 1JZ8A 2PO6C 3QEHB 5C0BD 2WW8A 3JSSA 5GJSH 5I1HH 3H9ZA 5EUOE 3QO0A 3FN9A 5HYSA 3ZHDA 4OLVL 1HXMA 3BKJL 2JB5L 3TBWA 4MNHA 5DJDB 1IGFL 4KK8D 4OSUL 4ZS7L 4R96A 1CR9L 4PRBA 2XPGA 1QYGH 4K7FB 3IDXL 4ZUWA 1TETH 4LCWE 4RQQB 3LPFA 2J3SA 4GKSA 1AGBB 3GHEL 3BQUC 5E2UH 4P4KC 1JWSA 5TQ0L 1N0XH 2XT1B 3ULVE 4HEME 5KANG 3MUJA 4OGYL 1IAIL 1FPTH 4X5WA 3VI4F 4PS4L 2ITCA 4EN3A 5FCUL 3BKCL 3QO0B 5D6DC 1V7MH 2DJSA 4YDVA 3RA7H 5HYSB 1Z9OA 1GIGH 5IM7A 1K6QL 1SJHA 3U30C 1HHIA 3PDGA 3TBWB 3W82A 4MNHB 3TCLA 5A2JH 4GMTL 4CU7A 1X4ZA 4OCXH 1MF2H 3FFDA 4HV8A 4PRBB 4R96B 4X8XA 2XPGB 4YGVA 5DDHA 3K8LA 3ZTNL 4Z6AT 3WNNA 1Q9OB 1TJHL 4EDXA 3LDBC 3DROA 1EFXA 1G9NC 4K3JH 2UZYB 4GKSB 1T89C 4CMHB 4P23C 3EYFB 3KYAA 5F9WC 3O6MH 1K2DA 1AY1L 2EICA 2FB4H 1JWSB 4PLJC 3RX8A 2NY0B 2FX7L 3RRQA 4EIZC 2WWKO 1QUNA 4H0HB 2ITCB 5L2JA 1EO8L 4K94C 4MMXC 1RJLA 3BISA 3OJVC 4EN3B 1ES0A 4HG4J 3UPRA 4OCYL 1IQDA 4YDVB 1IGTA 2G75A 2YMXL 2HFGL 3U9PL 3C09B 4P9HC 1HHIB 2W60B 3RVVC 4X8JA 3TO4C 1TXKA 2AXGA 3GRWH 2WUCH 4IJ3C 1YMHA 3FFDB 4HV8B 4YGVB 5DDHB 3IFLL 4EDXB 3DROB 1EFXB 1NUNB 2D9CA 1OF2A 1R5VB 2CGRH 2JJTC 3GDBA 4BQCA 1NEZA 1AD0A 2N7BA 4N1HB 1K2DB 2VN4A 4XP4L 5I74C 4HIXH 3QFJD 2DQCH 2CDEA 1YYMH 3VXSD 2ARWA 2CRZA 3V4UH 2GI7A 5L2JB 3CDCA 1JHTA 1RJLB 1ES0B 1FCGA 4YHZL 3UPRB 2A83B 3O9WA 1IQDB 4K23H 1IGTB 4UTAL 3DETC 2P42B 2G75B 4Q6IC 4CVXA 1MJ8H 2VLJE 2IG2H 1T66D 4X8JB 4WUKH 3MZTA 2EEAA 2AXGB 2FLBT 3V2AR 4K71C 3MJ9A 3NCCB 1YMHB 3EHBC 5K9QG 1N6UA 4OLYL 1KC5H 4DW2L 5KANI 1H0DA 4N90E 2P8PA 1I8KA 3MNWA 1OF2B 1T7YA 4RGNE 1NEZB 3TVMD 1B9ZA 1B0GA 3QI9C 1AD0B 3MV7D 4JPWH 4EUPA 4OZIF 1HK6A 4X99B 3QDJA 3TM6A 4XVJH 2LABA 2OR7A 5TPWH 4HWBL 5GGSY 4MD5B 1YEHH 1JF1A 4KMQA 2CDEB 4N0UE 2C4FU 4J3TA 1CLYL 5E0QA 5DJAA 1JHTB 3I3DA 3BAEH 3O9WB 4YDLB 5FB8A 5FM4A 4CVXB 3FB8A 2J6EH 5E99H 4BZYA 4FQ2L 2ED9A 5M95B 3ARGA 3PWLA 3DYPA 3R0NA 1MQ8A 3ZDYE 3FO9A 3LVEA 2Y7QA 1FYTE 1UH2A 1VPOL 1PX4A 1SYSA 3ZKND 1H0DB 1VEPA 2P8PB 3CK0H 3K8MA 1I8KB 3MNWB 1LK3L 5KTEL 2ZUQC 4HPYH 4PJAE 1OM3H 1B0GB 4EUPB 5GRVK 1QFUL 2W9EH 4OLXH 1PVHA 1C1EL 3RL2A 3D9AL 3QDJB 3I6LD 1JF1B 4GMSL 2I26N 1P4BL 4LP5A 4ODVH 1FNEA 5DJAB 3UMTA 2B1HH 5A2FA 3S35H 5D72H 1XR9A 4OGXH 1U6AH 5FB8B 1PQZA 5IJKC 3FB8B 4D9QE 1F3DJ 3PWLB 2QV2A 3B5GA 1CGTA 5AUMA 4OZGA 2Y7QB 2EEDA 4LFHD 4ZXBD 4UILH 1LEIA 3OAYK 1SYSB 2GKIA 1KB9K 1BEYH 4F9LC 3SE3A 3PWPE 4H0GA 3T2QA 2B8OT 4RRPG 3RL2B 2UVFA 4ZO7A 4E5XA 4F3FA 1WTLA 3TN0A 5HGDA 3VD7A 4G9FD 4JR9L 4N9GB 5FUCE 5BCAA 4FN0A 4MLIA 3RTQC 2VR9A 3WLWD 1FNEB 3WBDA 4QOKE 2VDRL 2WIIA 5F1OB 1XR9B 5K9QI 2EH8H 3DIFA 1S9VA 5CSZA 1RIUH 1KCVH 4ZUSA 4ZTOL 3K2UL 1SBSH 2ENYA 3OKDA 1PQZB 5T3ZD 1IC7L 3B3IA 3BZFA 2CRIA 4KJPD 4H20L 5D96C 2IPUK 5AUMB 2PO6A 5FHAH 5IB5A 3CFCH 4OZGB 3HAEA 4JKWA 1LO2L 5T33L 4A2MA 1LEIB 3BEWA 4CADA 3S96A 3K81A 3WNOA 2ZJSL 5ISZE 1TJIL 3MPCA 1UG9A 3ZDXF 4E5XB 4F3FB 3TN0B 5HGDB 4KK6D 5KOVC 4PYGA 1CTNA 2XQBH 4XPGH 1A9BA 5EH1A 2YRZA 4NZUL 5DUMH 4NBYB 2WIIB 4KROC 4FXLA 4YHLH 5C0EB 1DQML 3QJFA 3DIFB 1S9VB 5CSZB 1WJ3A 4ZUSB 1AKJA 4YFDB 3BQUA 3P3YA 3OKDB 2APTA 3TH4T 2BDNL 2X5PA 4EJ1C 3B3IB 3EDKA 4P4KA 3BZFB 5CINL 4R2GC 1A7NL 2PO6B 5IB5B 5KN5A 3HAEB 2WBJD 3VG9C 4UBDD 3BEWB 4CADB 1DLHA 4U6VL 5D6DA 5HTSA 4XC3H 3NBNA 3S96B 1Y6MR 5I8OL 2I9TA 3RI5K 2AEIT 1JV5A 2H45A 3CDYA 4GO6B 5I30H 4X4ME 5E08H 1VCAA 4N5EC 2BOBB 3MGOA 4ZOBA 1OAXH 4Y2OA 5HHXH 1A9BB 1RZKC 5DHYA 1EMTL 3VXMB 3DMMC 2B1AH 1JNNH 2X9XA 4PJGF 1YNKL 4G9DB 5L8KB 4RSVA 2GSGA 3QJFB 4P23A 3SEPA 2V5SA 1AKJB 1BWWA 3BQUB 3HRPA 3VFUA 4P4KB 1XH3A 3T0BA 5KN5B 4ZFGL 1P7HL 4Y4FC 2OX5A 4PRIA 3O2WH 4RRPA 4ZAKD 1DLHB 2HA1A 4KJWC 4RBPK 3BZEA 2I9TB 5E95B 1KB9J 5IGXH 3EJYC 3KLDA 3U30B 1JV5B 4I0CC 1FFNA 4IOFC 3TO4A 4LL9A 1SVCP 4NQEA 4EI5C 4W68A 4ZO6A 3MGOB 1FIGH 2EIEA 1V3LA 3B2VL 2F8XC 3NA9L 1J8KA 1RV6X 5DHYB 4PJ9D 2PW1A 3LDBB 4AM0A 1WV7T 1M05A 2OL3A 2JJTA 3MLPA 3PABB 3QQNA 2J8UA 2V6HA 2GSGB 4P23B 4UNVA 3ULUE 5F9WB 2NY1D 4PJ5D 5AZ2L 4P5TD 3PWNA 4XMLH 3VFUB 5BS0E 1MQKH 1CF8H 3MGAA 5BOPA 2Q76B 1T0PB 1JZ5A 2VDMH 4DKEL 1KCUL 4PRIB 4W6XB 3P30L 3HMWH 5FYJD 5BMFH 4LMQE 3BZEB 4Q6IA 5I19L 5EUKA 1FFNB 2VN7A 1KTKE 4NQEB 3OZ9L 4IJ3B 4P49A 5KVFL 1YY8B 2VB5A 3E3QE 2PW1B 2X6MA 1I8IA 3X17A 5KSAC 1HINL 2OL3B 1F42A 2J8UB 2DQUH 3QI9A 5HVGB 4Q9RL 5I74B 3PWNB 3HA0A 3RIAK 1QYGL 4OUUA 5IVXF 1TETL 1ZA3A 5LWYH 4OBRA 3EBAA 2A6IA 3BP5A 4OIAA 3CSYA 5DC9B 5E2UL 1XGPA 1KJ3H 3MRKA 4Q6IB 4YUEL 1ZEAH 2DM3A 4L3EE 5EUKB 5CGYD 2YXMA 3LY6A 3EUUA 4K71B 3RA7L 1GIGL 4HGKC 3TH2T 4YH6A 1I8IB 4Q9QL 3MLYH 3QI9B 2DF3A 4OCXL 1RAMA 4UTBH 1HQ4A 3PE9A 5DUPH 2NY4C 2MKLC 4LGPB 4OUUB 2FIRT 1ZA3B 2ED7A 5DVOA 2A6IB 2FZ3A 1NLBH 3BP5B 3CSYB 1FP5A 2FB4L 2R1WA 5CEZD 1XGPB 4IRJD 3MRKB 5IJKA 3FZUD 5CILH 1ZLUK 3SJVE 2CLRB 5DGRA 4C4KO 2XN9E 2J8HA 1MFDH 4UUJB 2OJZL 5CS7A 2WLYA 4U1HB 4BK5A 4JM2D 1BD2D 1LO3H 1T5XA 3OKMA 4F9LA 5B38A 1NAKL 4XNXH 4YWGH 4F7MA 2WUCL 1UM6H 4GSDL 1HQ4B 1OT2A 1JPSH 3RTQA 2DTSA 2CGRL 1UXSA 1BAFH 4PJDF 2FZ3B 4W70A 3S97C 4HIXL 4D0DA 5C0AB 2R1WB 2DQCL 5E8DL 4XVSL 1MFCL 1E4WH 3GIVA 4HS6A 4GBXC 1YYML 1OAKH 3ZMRA 4YPGA 5C0CA 4OF3A 3V4UL 2IGFL 1RK0A 4CJ0A 3RHWK 2LV4A 3F7RA 3VW3L 2CKBH 2K7PA 1MJ8L 4Z78A 3NIDE 2IG2L 1WSST 1T5XB 5B38B 4X5XA 5EOCL 1RMFH 3ZYZA 4WI3A 4DGVH 4F7MB 2NTSP 2Z9TA 5AG8A 4HUXA 2JCCE 1N4XL 1WQVT 3IS0X 3TP4A 3NA4A 3LN5A 3RTQB 4FNLH 5IT2H 1UXSB 1YEJH 1T1XA 1ACYH 4GFTB 1C08A 3CVIH 5FOJA 1OAUH 2WQ8A 4X9HA 2H2PC 2XQYG 4D0DB 4K7PH 3MR9A 2J7LA 3QDMD 3ARDD 4OD2A 3UTSE 1GOGA 3GIVB 4HS6B 4YPGB 5C0CB 1NC2D 5I1KL 1RK0B 5D96B 5DD3L 2HT4C 5FA4A 2IQ9H 2VDLL 3GGWB 1MCWW 3BAEL 1IZJA 3EYQD 3LQAC 4TNVK 2QTEA 5E99L 5KJRH 2ZUTA 4AEIH 5ABDE 5BZWA 4HK0A 4X5XB 3ZYIA 1OLLA 3PGCA 4NKMA 5E8OA 3EO9H 1R3JA 4BYHA 3C9NA 5C07A 1BIHA 2CMRH 4DCQB 4HUXB 4UNTA 4LLWA 1CGYA 3CCHB 4RDQG 1CZ8H 1IGCL 5I0DA 3LN5B 2FEEL 2VZ1A 4TSBL 2Z8VC 3RUGF 3MROA 3NH7H 1CICA 1T1XB 2F53E 3HPJA 3MNVA 3T2OA 3DMMA 4MB4A 4POYA 2W9EL 4OLXL 4YXKL 5FECA 3MR9B 4OD2B 4ZS6D 3QIUB 1U36A 2A0LD 1QBBA 4ODVL 1JFQL 1IAOA 5EBWB 1EEZA 1AH1A 2B1HL 4QWWC 3S35L 5FA4B 3V6OC 3VXRA 5D72L 4HDIA 4OGXL 4Y4FA 3VG9B 2E7HA 3WD5H 4NPYA 1EGJA 4CVWA 2DQGH 4LNRA 3BUYA 5BZWB 4HK0B 3VDCA 3UTQA 3PGCB 4NKMB 1R3JB 3C9NB 5C07B 3H8NA 5IBUG 4EI5A 4LLWB 1UZ8A 3U48A 4UILL 1N8ZB 5MP6H 1TTFA 1BEYL 3ARGD 4HCRA 3MROB 1CICB 3MNVB 3HPJB 2D9QB 3VI3F 3DMMB 1QPXA 1CU4H 3X3FH 1MCCA 5C09E 4BFIA 5FECB 1KCRH 3MQIA 3K4DA 4RAUA 3Q5TA 1WK0A 4UB0H 3MXWL 4NSKA 1IAOB 1EEZB 2CRYA 3VXRB 3ZO0A 1WBXA 4HDIB 3DOSA 1RIUL 1KCVL 3AREC 4Y4FB 1QG3A 3PIQB 4NPYB 3CDGA 5F21B 4LNRB 3BUYB 3OKKA 1EBPA 1QLFA 4FS0A 4NQCD 4PGCB 3ETBF 5FHAL 4X6DF 3CFCL 5D7JD 1X5FA 4EI5B 4HSQA 1UZ8B 1CD1A 4XPHL 5EZOH 3BRGC 4QHKJ 4GRWE 4PJFE 1ZT7B 5IUSA 4M5YH 1S5IH 2RFXA 1XGYH 4TVPE 1X5XA 4BFIB 4JRYA 1V3MA 4PJHA 2V9RA 3DXAE 2CKNA 4RAUB 4OT1L 2XQBL 5EU5B 4NSKB 4KI5F 3QEQA 4JFEE 5DUML 1YPZF 4YHLL 1WBXB 4JEGB 4E42B 3MV9A 3GSOA 3BESR 3CDGB 5L0QC 3D85D 4KGJA 4YHYB 1T1ZA 4LVNC 1JN6A 3OKKB 1QLFB 3O4LD 4GRLD 1B88A 2PF6A 1XIWD 3VXUE 4GOSA 3VFPA 4P48A 1DBMH 1BP3B 1CD1B 5IR1A 1N0LA 3TA3D 3NN8B 1T6VN 2RFXB 3HR5A 5FO7A 1SY6H 1KT2A 3WHE1 4JCLA 4U3XA 4JRYB 3ULVH 2FJHA 4TN9A 5F96L 4XP5L 3QXDA 1JNNL 2JJSC 4GG8A 3B6SA 3LD8B 5HHMD 2C3VA 3GIZL 3MV9B 4LEXH 1QFWL 3OQ3B 3P9LA 3N9GL 4HX1A 3MV8D 4ZPVA 1T1ZB 1JN6B 2PR4L 5DMGD 4ALAL 5E8NA 3VFPB 1T0MA 1CLCA 4M8QA 1IRAY 5IR1B 2PTTA 3O2WL 3OB0H 1YECH 5IGXL 4PRPA 1J0HA 5EIVA 1RY7B 5HDQH 5A2LH 3MJ8A 3HR5B 5FO7B 5TJWK 4ZNEE 1KT2B 2FX9L 4LAJH 4FZEL 1IKFL 2AQ3A 1FRGL 3ZE1F 3VRLF 1E4KC 2FJHB 2R0ZH 3CPLA 3TIDA 1PKQA 2L0DA 3D3VA 2NY4B 4UINH 3WNLA 3QXDB 4OV5A 3N06B 1CDYA 4MNGA 4GG8B 1MI5D 3B6SB 3NFSL 2C3VB 4ZD3H 1FO0H 1ZVYA 5F7NC 3QDGE 4NWTH 2R4RH 3P9LB 3H9SB 2BVUA 4KTYA 4HX1B 4XMLL 4ZPVB 3JUYA 4X7SL 3B9EA 3WFEH 4GBXA 1CF8L 5BO1L 4L4VE 1T0MB 5H37H 4M8QB 4MZ3A 2VDML 1TZHB 2PTTB 4XHJC 3HMWL 5BMFL 3VGDA 5FM5O 1JRHI 3IDJB 4LCUA 2E5EA 3MJ8B 2JJUA 1UWXH 3ZYOA 4DN4H 2QSQA 3RU8L 2BJML 4Y19D 3FB6A 4Z95H 2W07A 2FO4A 4Z7UE 1A14H 1MOEA 4JZJC 4JKKA 4RX4A 1CI5A 2EEBA 3CPLB 3D3VB 1FVCA 5J6HB 3RVVD 3RX7A 4I3RL 4OV5B 4X7DC 4U05A 3MA7A 4MNGB 3Q6GL 2GJ6A 5IBTL 3CUPA 4I48B 3G04A 2DQUL 3RDTD 4NO0A 5GGQL 4J3SA 1LD9A 3RGHA 2EXWC 4GBXB 4M9OA 2BHYA 4MAUL 1OW0C 3JVGC 3BN9C 3F8UB 4PJCE 2EDFA 1PZUB 4CL7A 4HFWA 1EO5A 3C5JA 4RGOH 1AIFA 2Q8BH 4LCUB 4NO2A 2YN3A 4FRWA 2Q1EA 3VFTA 2VWEC 4IRSD 1CFSA 4G6KL 2AEQH 1YC8A 3FB6B 2FO4B 1JGEB 4Z76A 4S10A 2XRAL 3OR6A 1ITCA 3QUYC 3QH3B 1NFDA 1FVCB 1BHGA 1YMME 3MA7B 4PY8I 3UCRA 3HZVA 1J88A 2IBGA 2X05A 3FMGH 2GJ6B 2FJGA 3CUPB 2NY2C 3G04B 2Q86A 1C5BL 1X4YA 4NO0B 4HMEA 1IGML 1U3HD 3MFGB 1LD9B 3RY6C 3IJSA 4G7VH 2HWZH 5C9KA 2E9IA 1NLBL 2GAZA 3I84A 3SO3B 5HYEA 3V6OA 5C2BH 4NQDD 4HFWB 1GC1L 4QNPF 5B8CC 3C5JB 3VXOA 3H3BC 1Z6JT 1AIFB 2EH7H 2ADFL 4NO2B 3VFTB 5DWUH 3GKWL 1CFSB 3O81A 2D7PA 4HBCL 2G60L 3SKOA 1F6AA 1MFDL 4UT9H 4Z76B 3O6LL 3OR6B 4K9EH 1NFDB 4ODSL 1H8OA 2DTMH 3HZVB 1LO3L 4O00A 2FJGB 4PRHE 3HFMH 4NQTA 4YLQT 5J1AA 2Q86B 1UM6L 3EZJB 1F02I 1OAQH 4F7EA 1I7TA 1MCOL 3IJSB 1M7DA 3NAAH 1QSED 2F9BT 3Q0HA 5BV7L 4UV4L 3RVTC 3CVHH 2XZAH 3RVXD 4OQTA 3SE9H 3R0MA 3CMOH 2UYLA 3ABZA 3FOLA 3S37X 1W0VA 2EC9U 3AREA 5DJYA 1E4WL 2X4TA 5F1KC 5C08E 3VXOB 4PJIA 4N0RA 1OAKL 5FUOH 4YC2C 4X80H 1QSFA 5JOFA 3SKOB 2XA3A 1VA9A 1F6AB 2CKBL 4I0PB 4RFEA 1CLZH 3RVUD 4BJLA 3MLSH 3GBLA 3LPWA 3TWCH 1RMFL 5J1AB 3QWRD 1GZQA 5TE4H 2B5IC 4TULH 1XCTA 1WIOA 1I7TB 3AC0A 1M7DB 3QISA 4FZ8L 2HT2D 3PQYA 1W0WA 2J88L 4LLYA 4OM1H 4NKIH 2VLKE 3KPSD 5IT2L 1YEJL 3ZLQC 1ZGLP 2ZCKL 3CVIL 2W0FA 1QHPA 2UYLB 4MDJA 3FOLB 1W0VB 5DJYB 3BPOC 3MLRH 4J1UA 4PJIB 5DO2C 4APQB 1UC6A 2E9WA 1QSFB 5JOFB 3LZFH 2IQ9L 3PWUA 4YJZL 2EKJA 3IAGC 1AQKH 3DECA 4RFEB 4XGZA 3DWTA 5MEOA 4Z7QF 5IG7A 4R4NC 2UZIH 5KJRL 1A4KA 4AEIL 1MJUH 1TMCB 5CD3A 3EO9L 1GZQB 2NR6C 3GMMA 4L4TD 2CMRL 1D9KC 3L5WA 1XCTB 4NZTL 3MXVH 1Q0XL 1TJGH 2QL1A 3PQYB 1W0WB 4LLYB 1MEXL 4KKAC 3B2UD 5JHDE 4KRLB 2JJSA 2W0FB 5GGRY 2DIAA 4MDJB 1A3RH 5DFVC 4OZIA 4QRPD 4J1UB 5L0QB 1IEAA 4LVNB 4HC1L 2V5YA 5EZLA 3DTXA 2PN5A 3PWUB 4XXCC 2WINB 3GBNL 3V95A 3OXRA 2R9HC 3WFBH 4XGZB 3U0PA 3GSXA 2QSCH 5MEOB 4L8BA 4XVUC 5IG7B 2BFVL 4KQ4L 4RMVA 1A4KB 3MCKA 4R2GD 5JA8B 4G6MH 3MCLH 5CD3B 3CXHK 2J5LC 4NFDA 3D39A 3GMMB 5CWSA 3L5WB 5HJ3A 2BRRL 3L3DA 3HUJE 4HIEA 1IJ9A 1E4KA 2EC8A 2KPNA 3C8DA 1KPRA 2CRMA 4HQQH 1CU4L 3X3FL 5ILTH 3HI6H 4I9WD 4YDKL 1JZ6A 4OZIB 3PP3H 1MCPH 4Q0XH 4NHUA 1BM3L 1UB5A 1IEAB 3ARVA 1TZGL 3U1SL 3QQ4A 5DJXA 5EZLB 4MVBD 3DTXB 1UVQA 2R56H 3V52H 1X5IA 2VXQH 3OXRB 1L7TH 3U0PB 3GSXB 1S7VA 4L8BB 1O0VA 1VGKA 1PY9A 3MCKB 4PLKC 5DZLA 2BY0A 3BE1H 1A0QH 3MYJA 4QGTA 3SGEI 3VWJA 2GYSA 2Y6SC 3WS3A 3ULUH 3D39B 4GG6F 5CWSB 3C5SB 4YE4H 4ZOAA 5HJ3B 5C0DA 3FFCA 3L3DB 1T1WA 1X7QA 4JZJA 1BJ1J 1BREA 3MO1A 4M5YL 2BVTA 3RJQB 4RZCA 4O02H 3BT2H 4J3VA 4PY7A 5H37G 3OB8A 1IVLA 3P4NA 4QRRA 5IHLB 1EPFA 5D2NE 5L2KE 4NHUB 1S78C 4DKDC 1UB5B 4OZFH 2D0FA 5DJXB 5I76A 1ONQA 1UVQB 5HVWA 1VFBA 1J5OL 3BFOA 1OW0A 3JVGA 3JWOH 1S7VB 1DL7H 1VGKB 2BVPA 4I0KA 4IEFB 3MYJB 3CH1A 3VWJB 3WS3B 4YZFE 1R0AL 4LDOB 1D5MA 4B0MM 5C0DB 3FFCB 4AEHL 2FBJH 3JTTA 5CJ5A 2A74B 1T1WB 1X7QB 4JZJB 3QZWA 4NJ9L 3QUYA 3OAUH 5TF1H 3MO1B 1A22B 5CD5D 4RZCB 3W0WD 4MYWB 3MUHL 1F8TL 1D7FA 3P4NB 3HNTH 2X1OA 4QRRB 2AEWA 2ZOKA 3R8BB 1AR2A 4LLMB 1F4AA 1TVBA 1K3ZA 2ADIA 4M7LT 1ZHBA 5KSAD 3RY6A 4FTVE 4FABH 5I76B 1ONQB 1VFBB 4FQCH 4KMLB 4WU7A 4FQQA 5FGCB 3QEQD 2BVPB 4Y5XB 1K5NA 5B8CA 5DZOA 4XAKD 4LARH 5GGSA 5D7KE 3CH1B 5D70L 4RWYL 1PGRB 2Z31C 2FECL 1UGNA 2Y5EA 1KEGH 1D5MB 3D1MC 3IGAA 1DBAL 5KG9A 1I9RH 4GXVH 4OLWL 3VFOA 1INDH 3JTTB 3B9DA 3QZWB 5GS0C 2IH3B 1FG2A 3QUYB 1PY4A 3KDMA 5EOTA 1YECL 5HGAA 1T80A 4M93C 5HDQL 3DBXA 3EFDH 3HN3A 3B43A 3VFSA 1CVSC 4OUOA 3BJ91 4RMSA 2NY2B 2ZOKB 1UCTA 4DAGH 3MX0A 2R0ZL 2YR3A 4IDLA 1TVBB 2ADIB 2NXZD 3OGCA 5DTFB 5DQJA 1ZHBB 2P5ED 3EO0A 3RWFA 5HVFB 1I3GH 3I2CH 4MQXC 4WFGD 2B4CL 3WFCL 4CVUA 3QIBC 5D7LE 2DWDA 3L3IA 15C8H 1FO0L 3K80A 4PJGA 4WWKC 3STLA 3QHFH 4NWTL 5EPMB 3S3PA 2E8ZA 2R4RL 3SQBA 4WU7B 4FQQB 1K5NB 2WK2A 2XWJA 4OLUH 5B8CB 2R8SH 3EGSA 4XCEA 5GGSB 2D03H 2H2SD 2R2EA 3BP7A 4JKPH 3IGAB 5KG9B 3VFOB 3SDCC 4PUBH 3D6GA 1OP5K 1FG2B 3KDMB 5EOTB 5HGAB 1SVZA 2YWZA 5KVGH 3DBXB 1DZBA 1XF2A 3VFSB 4XBEH 4KY1L 3W2DH 1W8NA 4D9RD 3P73A 5HHPA 2M1KA 2RR3A 4PRPD 3OGCB 5DQJB 3RWFB 4ODHH 1XMWA 2IC2A 2VZTA 1MPAH 4JFDB 3L3IB 3STLB 4PJGB 4P2RA 4PG2C 2ENSA 1ORQB 5CBEA 1IC4L 3RBGA 5I1DA 1KLFA 3F7QA 2XWJB 4OFYA 3D5OF 3W11D 3EGSB 4XCEB 5E6IC 3X13A 2R2EB 2V2XA 3FHQA 1CGWA 3BP7B 5F70A 5GJTL 4GKOA 4NRZB 5DC4B 1RZJH 4V2CB 2OM5A 2Q8BL 2R2HA 5CZXD 3QG7L 4NC0B 1XF2B 5KBNC 1QBMH 4QXTA 5C0ND 5DVLA 3P73B 4Q2ZA 2B5IB 5HHPB 1D9KA 1JJUA 5I18L 4GLRI 4TRPH 2Q8AH 5DVKA 1J0KA 3ARPA 2DL2A 1FNSL 4OZHE 4JN1H 3UAJC 4JB9L 2YUWA 1RJYB 5CUSH 4N8VA 5I1EH 3KYMA 7FABL 4P2RB 5F9OH 5ADPL 3IJHA 2DL9A 2JTDA 5I1DB 1OD7A 3L5XL 3V0VA 1GHFH 2HWZL 2QQQA 1RFDH 5EA0H 4DKAA 4KPHH 3X13B 2M26A 2V2XB 2C7UA 1X5AA 2YUXA 5IVXA 1WZ1L 1Z9MA 3DVIA 1R3IH 4XXCA 2VO5A 4BSVA 2F5AH 2EH7L 2R2HB 3UJIH 5GRJL 5BZDA 5DWUL 1GOFA 1IGIH 4QO1A 4QXTB 1EJOH 1OPGH 1Q94B 1MFBL 3F62A 4Q2ZB 3RY4A 3A6CH 1D9KB 1MLCA 3QQ3A 4WUUE 2D4DA 1CXLA 3ARFC 4WFHE 4G8GD 3HFML 4N8VB 3KYMB 4FQIL 4KV5E 1AP2A 4HW6A 1AGFA 1KIUA 1T5WA 1TCMA 3IJHB 4MNQE 1T7VA 1F4YH 2JK5A 3V0VB 4NN6C 3CVHL 3QFDA 2XZAL 3ARYA 2C7UB 4PJBF 5IVXB 2NY3C 4XNMA 3SE9L 3S8WA 3KPRB 2XACC 3CMOL 1K4CA 4BSVB 5SWSE 3MA9H 3QULA 3ARXA 5D8JH 3GZKA 4X7CC 5LQBH 3C6SA 4QWWD 4AQ1B 5BZDB 1K8IA 1CE1H 1AD9A 5BRZD 3K4AA 5C7XH 1F4XH 1CLZL 1MLCB 3QQ3B 4ORZC 3MLSL 1IILE 1FC2D 3AXLA 5LCVH 1YC7A 2E6PA 4MS8C 2DBLH 4NCC1 5TE4L 3HG1E 4G6JH 1FHGA 4TULL 1AP2B 1BQLH 5TDPA 1T5WB 3B9VA 4JO1L 4UOW1 1YY9D 4KUCD 5E5RB 4OM1L 4MJ4A 3JXAA 4NKIL 4X7EC 4F80A 1OB1A 1P5UA 2Z92A 4P9MH 4XNMB 4MX7A 1I1RA 1I7ZA 1YEFH 3E6FA 1K4CB 4PJDA 4GRWH 2YPLD 3DV4A 1WWWX 4HUNB 3QULB 4M62H 2R2CA 3MLRL 1LEGB 1YJDL 4TVPH 3C6SB 3CD4A 1K8IB 5FYJE 1AD9B 3LZFL 3UJTL 3ARED 4OZFG 5CSGA 3GHBH 5JO5A 1JYVA 2APBA 5SWQA 4Z7OE 3AXLB 4PP1D 1BVZA 2GHWB 3S3SA 2M2DA 2DD8L 5TDPB 4MB3A 2NZ9D 3MXVL 2K3TA 1GSMA 4GW1A 5CEYA 3AS1A 2Z92B 2VDPH 2H26A 4MX7B 4WVRA 1I7ZB 1KCSH 1MIEH 3P40A 3E6FB 4LF3A 4PJDB 4ENED 3DV4B 5FKAA 3QUKA 1N7MH 1FC1A 2YS4A 3E2HC 4TNWK 1HQRA 5I1CH 4C54A 2Z31A 2EYSA 1BFVL 4QRTA 5HVHC 5JO5B 3WFBL 1KGCD 4NQXA 2QSTA 3V6BR 4DQOH 5SWQB 4GAJL 2DQEH 5JW4R 2ED8A 3MCLL 9CGTA 2J4WH 1CFVH 3ZSSA 3W9DA 3WNKA 4LBEA 4RWHA 1AXSA 4GW1B 4M4PA 1JMXA 4KH2A 4U1KB 4PRDA 3V0WH 4F15B 3EZ8A 2NY6D 1E4XL 2H26B 4HQQL 1A4JA 5DEGA 5ACZA 3ZHLA 4K55A 3RUGA 3QIBA 5GGUA 1P4IL 1F90L 3HI6L 4LF3B 5ILTL 4G3YL 4EDWH 3EJZC 5FKAB 4WWKA 2Z35A 4Q0XL 3QUKB 3BEVA 5CEZE 1HQRB 3I02A 4MJID 2EYSB 4QRTB 6FABL 2VXQL 4QTIH 1MUJA 1CXHA 3SOBH 1L7TL 3OWEA 5ALBL 3SDCA 4NQXB 4N8CH 2VQ1B 4M7LH 3SHSA 4MZ2A 2CUMA 2I24N 1B6UA 2F54D 4FQXC 3GSVB 3ULUL 4YE4L 1OSPH 5DJCA 5J7CC 4WO4C 3W9DB 1ZLWK 1AC0A 4LBEB 2JJWA 1WWAX 5JORA 2VQUA 3AFLA 5F71A 5I1GH 4PRDB 2WP3O 4JPKL 4OF7A 4JFOB 4O02L 3BT2L 2RIKA 5DEGB 1A4JB 5ACZB 3RUGB 3BN3B 3QIBB 5GGUB 2A1WH 4NBZB 4AZ8A 4B7IA 5CHNA 4WWKB 1BGXL 4PG2A 2Z35B 3LAFA 3BEVB 4G6FB 3QO1A 5E6IA 4Y8DC 3I02B 1CDJA 4ONOA 1MUJB 2OXGA 1S7WA 1FZOA 2W9DL 4OZHF 1JPTH 2AJ3A 3SDCB 2DIJA 5I17A 4IMLA 2H32A 1XEDA 3HNVL 2IBZX 3KXFA 1LE9A 5J3HC 4P2OC 4B53A 2VE6A 1UKSA 5DJCB 2W92A 5GQBA 4BQBA 1A1MB 3FRUA 2FBJL 5JW3L 5JORB 3V9FA 3MSPA 5IFJA 4XNZB 2GCYA 3PUCA 1H8NA 3HNTL 1TQCC 5CHNB 1UYWH 4RFOH 3FCTA 3PDOA 3O6KH 3HB3C 1IC5H 4KXZH 3QDME 4S1RH 5E6IB 2ZUWA 1ZGLA 2VIRA 4K3GA 1DFBL 2I60L 1OHQA 4S1DD 1S7WB 1FZOB 1D5XB 2AJ3B 3GK8H 1MCQA 1PBYA 4IMLB 4TTDD 3S36H 5CZKA 4LARL 1LE9B 4XPAH 3RKDD 2VE6B 5IFAL 2HAZA 4Y1AA 3SKMA 5J8OA 5E9DA 1INDL 4Y5VC 5IFJB 1W2KT 5J12C 2GCYB 3HC0A 1A7RH 2OTPA 3ESVF 1AXTH 4KKBC 3ARFA 1AE6H 1FN4A 4RCAA 1CFNA 4LCWD 3FCTB 3PDOB 4DAGL 5FCSH 1BF2A 1JUFA 5IHZA 5JOPD 2C26A 2ZP0T 2HKHL 5E7FA 1DQLL 4JGUA 3T3PE 2UWEE 1ZGLB 2VIRB 5EN2A 3DUUA 5EU4B 3ULVD 15C8L 3QHFL 3QDJE 4FP8H 4HFUH 1IL1A 3K74B 1YEGH 5L8JB 4Y2DD 2WWKT 1SJXA 4Y1AB 4JKPL 5FIEA 4P46D 3WV0A 4AIOA 3RWEA 6CGTA 4LSUH 4BH7A 3LB6D 3DPBA 3HC0B 5KVGL 4GRMA 3ARFB 1FN4B 4B7LA 1EZVX 1CFNB 4HJJL 1KSRA 4RGMC 2HTLC 2IANA 5CJQH 1JUFB 1IC1A 3RWIB 5IHZB 1MRFH 1RUQH 5EDXA 3ZKMC 1GAFL 2IH1A 4LRNH 1VDGA 2NY3B 5EN2B 3DUUB 43CAA 4Z7OF 4KHXL 1IL1B 2YK1H 3MTRA 4JG1H 1BQHA 3IU4L 4N9OB 4WV1A 5C92A 2DYPA 1DQTA 3QNXA 4B5EA 4J3WA 5CJOL 1N6VA 1S5HA 5BV7C 5ERWA 3RWEB 4NQCE 4BH7B 1XGTA 3PV6A 3L5IA 1IMHC 3UO1H 3VWKC 1P9MC 3P77A 4GRMB 1N3NA 32C2A 1GGIH 2IANB 4OZGE 3IFNL 4OAWB 4TRPL 1LWRA 2Q8AL 2AERT 1FVDA 4YPJA 4MWFA 4MB5A 2WIMA 1I4FA 2IH1B 5I1EL 43CAB 3LN4A 1I8LC 4I2XA 3RWHB 2HJKA 3VG0H 2PW2A 4HH8A 4BM7A 1BQHB 1P84K 4WV1B 2DYPB 1RFDL 3QNXB 2XXMB 3U6RA 4K07A 3WO4B 4S1SL 5DZNA 1NC4A 1S5HB 5ERWB 4OGZA 5HI4D 2VLJD 1LMKA 2Q6WA 3CZFA 1XGTB 3PV6B 1ZHNA 2LU7A 2V5TA 3P77B 3UJIL 4P3WA 2ZPKH 1N3NB 1NCCH 1SEQL 3L95A 4N90D 5IB1A 32C2B 3RI5F 3O3DA 4LP4A 3A6CL 3QNZA 4RGND 4R4ND 4P59H 3S37H 4MWFB 1C5CH 4O2CA 5F97E 2AQ1A 1K9TA 4WI6A 1N6QH 3RQ3A 3MBXH 5DQ9A 1I4FB 1J8HB 3A6BH 3LN4B 1G0XA 3OPZH 3L3JA 2HLFC 4I2XB 2PW2B 4J6RH 1UCBL 4LEOA 4XPTH 1F4YL 1IT9H 4FFVD 4Z7WF 2Y5TA 1GGCL 3CLEL 3U6RB 3E2HB 3ZKXB 1I7RA 1NC4B 1MAMH 4QY8A 3BH8A 5DFVD 1U2CA 1NDGB 2Q6WB 5ALCH 3CZFB 4I4WA 5HVHB 2ARJQ 2AK1H 5IHUH 1QFWI 1CXKA 1ZHNB 4Y89A 2NX5A 3AVEA 1T83C 1R5IA 3E8UH 4GAGH 4I13B 4M02A 1FYTD 3IKKA 4U0QB 2APWA 3S4SB 4FQXA 5J11C 3L95B 2FGZA 3EYUH 4NGHH 1B4JH 3O3DB 3QNZB 4XVUD 5C7XL 4WO4A 2ZOLA 3TGXA 1FFPA 4O2CB 2IAMD 1X5KA 3MFFA 4WFFE 5DQ9B 5LCVL 2YN5A 5DC0A 2D7OA 3QUMH 2DBLL 5F8RC 4JANA 1EBAA 3L3JB 5IMMB 3ESUF 5J6GA 2YA1A 4HKZA 3UBXA 5A43C 3P4OA 4LEOB 1DEEA 2P5EB 1PAMA 2I07A 4KKCC 4HEPG 4M48H 4KZDH 1IAMA 2Y5TB 3LKSA 1CK0H 4HWZA 2HJFA 3PHOA 1I7RB 4QY8B 3BH8B 3QAZB 2PXYD 5LXGH 2VXSH 5FO9A 4I4WB 4D9QD 3TT3H 2LFGA 3O6FC 1BBDL 4XX1E 1U8JA 2NX5B 3D48R 2F15A 4I3GA 1R5IB 4XBGA 5JR1H 4TVPL 5FEBA 1VFAA 5IF0A 4FQXB 3LEXA 1FSKC 1L9NA 5SWZA 3GSNA 4M6OH 3WUWG 3GHBL 3PWPD 4WO4B 2ZOLB 4PRIE 4Y16C 1FFPB 1J1OL 5H35A 4R8WH 1A7OL 3MFFB 3S88L 3B9KC 1TZIA 5DD0H 4FMKA 1Y6KR 4PJ7A 5D1XD 1U41A 4JANB 4Y4KD 2NCMA 4NQEE 5J6GB 3UBXB 4HJ0C 4QOKD 4NO5A 1U3YA 3P4OB 4DOHE 1DEEB 2I07B 4LLQA 3BIBX 2DDQL 1VGEH 1P84J 3KYNA 3LKSB 4M6ML 4HWZB 3PHOB 4D3CL 1FE8H 1ZLVK 1FAKT 2J8UE 1MIEL 4DZ8A 1IFHH 3UJJH 1W8OA 1U8JB 4XBGB 3V7MA 1ZK9A 3WN5C 1VFAB 5IF0B 4OIBA 3LEXB 3KJ4C 4ZFFA 3GSNB 1ZLSL 3BPCA 3VD9A 5ISZD 3ZL4H 4Y5VA 5H35B 2DLHA 5C0FA 1ADQH 25C8H 2J4WL 1TZIB 1NLDH 3TZVD 3UTPE 3EW3B 4PJ7B 5FGBC 3OAZK 4XBPB 3FO1A 1J12A 4NO5B 1TQCB 4LQ1A 3C8HA 1A6UH 3MRMA 12E8H 4FQPA 4MCZA 1EXUA 4LLQB 5LVEA 1T2JA 5IWLC 1NGWA 3KYNB 1MVUB 2VR5A 4MDIA 1F45A 1QLRA 2M8XA 3GMLA 2VZOA 4DZ8B 1HHJA 3T4AA 2R29H 2IJ0C 4GAYA 1D6EA 4XI5D 2AJYH 4NQDE 3KR3H 2Y06L 4NHCL 2WNGA 4ZFFB 1ODAA 2MWCA 3BPCB 3I9GL 4LSTL 4QTIL 3SOBL 4M6NH 2IMMA 5C0RL 3BP6A 1KN2H 4PJXE 4LKCB 4M7LL 3N85H 5C0FB 5J12B 2X7LA 2Z31D 1NAML 1WAAF 2FX8H 1E6JH 1I9IH 4XH2A 3FO1B 3O0RH 4N68A 4PGEA 2XNAA 1OCWH 1FL6A 3MREA 4HWNA 3MRMB 1EXUB 2GY7B 5AYUL 5DURB 5EOQL 3SKJH 5I1GL 1NGWB 5A40E 4MDIB 4KVCH 4XXDB 1QLRB 3WFDH 2A77L 4BZ1H 1J1PH 2A1WL 3DO7A 3GMLB 1HHJB 3T4AB 3EOYG 4H1LG 3QHTC 4GAYB 1D6EB 2ARJA 2P24A 3GBMH 1OWWA 5D5MF 2R1YA 4WCYL 1RVFH 1JPTL 4F8QA 2B4CC 5D1QC 3RHWF 2CDGA 4AIZB 2AAVA 3BMVA 3BP6B 1MCWM 4EBQL 2KKQA 2X7LB 3VWKA 1P9MA 5JW5A 4YHKH 3FQUA 1A21A 1T04A 4LLUA 2FYYA 1ZV5A 5T5FH 4XH2B 4L8DA 3I85A 1HHHB 1F3DH 4PGEB 2XNAB 1WVZA 1FL6B 5FK9A 4HXAL 4E41A 1FH5L 1ROWA 1KJ2L 4RGMB 3U4AA 4DVBB 3ULUD 2DQTH 5EU6A 4D94A 1WGOA 3P4MA 2BVOB 2VNCA 1BPVA 1KELH 4JRWA 5BS0D 3DO7B 2G5BA 4WY7H 2VXVH 1I8LA 4V2BA 4HWEH 4Q9CA 2MMXA 5T1LA 3VGAC 3IDIA 5DJ2A 2P24B 4NM4H 3LIZH 4X9FA 3RJDA 5HI3D 3UZEA 3BDBA 4S1RL 4OJFH 3O45A 1WCQA 5BV7B 4G6AC 3MOAH 5HY9A 1WUNT 5D4QA 4FXGA 4U1IB 3VWKB 4ZFOA 2BNQA 5JW5B 3FQUB 1T04B 4LLUB 1NBVH 1S3KH 2FYYB 4MHHG 1Z5LA 5C0CE 2HFTA 4L8DB 5AD0A 4IOIA 4E41B 1UWGH 3ROLA 1A7RL 1R3KB 5EU6B 3SDXA 4ODWA 1X5ZA 3P4MB 4PLOB 4OLZL 2YKLH 5E8PB 4L1HA 4OFKA 4OD1H 2YPVL 2DJ4A 2FWOA 2FDBP 5T1LB 1C12A 2HYMA 3IDIB 5DJ2B 2FIKB 4QTHA 5IEKA 2YZ1A 2KDGA 5EBGA 4NYLA 3QUXD 1VEOA 1C8PA 2D0GA 5HY9B 4HFUL 1P7KA 5GGRA 4FXGB 1YEGL 1ZAGA 3L7EB 4X7FC 4KI5D 4ZFOB 2BNQB 1T83A 2AJZA 1MWAH 5K59E 4KTEH 3FQWA 4LCIH 1Z5LB 3QRGL 1EEYA 2HVKA 4LLDA 4IOIB 4MA3A 5IOPA 1RIVL 4OKDA 1BBJA 2DQJL 4ZTPH 1AGEB 3ROLB 4PLNC 2I25N 4HC1A 1WLHA 5KOMC 2Z0BA 3HC3H 1OARH 4H1LA 4JY4A 2HMID 3SDXB 2O61A 4ODWB 2CPCA 5E9DD 4YXHL 2W9LA 5F7EH 5K9KA 1NGPH 2AVGA 5C07E 1O7VA 5CJQL 1C12B 4MXWH 4QTHB 5IEKB 3W5NA 1E6OH 5CIPA 1Q1JL 3T3MF 4LRNL 1TIUA 5B22A 3JV5A 2ICES 2LVEA 3CFJA 5I0ZA 4G7YH 1P7KB 3SJVD 3RWJA 4F7PA 5GGRB 4C56A 4FQLH 1QA9A 1U93A 3O6FA 4JG1L 4ZPTA 4WNQA 2XN9D 2AJZB 4O2FA 5C0GA 1EEYB 1NGXA 2HVKB 5J11B 3VXRE 5JW4N 4LLDB 4MA3B 5IOPB 4DTGH 1BBJB 4JJ5A 1KBGH 2EE3A 4Y16A 5CGTA 4H1LB 4JY4B 1NGQH 1T03L 2CK2A 4OGAC 3RWDA 4H8WL 5I8EA 5K9KB 3OAYH 3B9KA 3P0YL 1GGIL 3VXTA 2X4OA 3WKMH 1GPOL 2WWMC 5KVEH 5E03A 5CEXA 3DSNA 5F7UA 1TVDA 5CIPB 4MHHI 1DTUA 3B5TA 1QZ1A 2YD3A 2ZG2A 4L8SC 2W0LA 1QQDA 4F7PB 3VG0L 4C56B 1M6OB 1QA9B 1U93B 3O6FB 4IOSD 5F7MC 3UYOD 1QFHA 4ZPTB 4O2FB 3GMQA 1P7QA 3WN5A 3BD5A 5C0GB 1NGXB 5FDWA 2P45B 4JJ5B 4Y16B 5FOBA 3RWDB 1KLUA 1NCCL 5GRUL 5I8EB 2BNRA 3G5VA 3HMXH 5FGBA 2ESVD 3VXTB 2X4OB 4U3HA 1YJDC 5CEXB 3OKNA 5D9SA 3S37L 3BKML 5EULV 4QLRA 1N6QL 5IWLA 5T5NF 3UTSD 3V8OA 4KC3B 4WI4A 2NY5C 1ND0A 5L6YH 1QQDB 4PJHE 3SDDD 4MXVE 2MKWA 4XPTL 3PNWA 2FD6L 4QT5A 5DFTA 1OT1A 1WFTA 1AR1C 3GMQB 1P7QB 4L4JA 4X4XA 3WN5B 3QEQE 5E70A 1MJJA 3B8SA 3KJ4B 5FDWB 4OB5H 1NUFA 4HK3J 1HYSC 2MHAA 5H8DA 3WFHA 3VGHA 1HILA 1OP9A 5FOBB 3E8UL 4GAGL 4YBQD 5ITFA 3C08H 3Q3GA 1HZHL 2BNRB 3G5VB 3G6AA 4LSPL 5D7IF 4BH8A 4NGHL 1PX3A 2MNUA 1B4JL 3UROR 4JJHA 2F53D 3OKNB 2GK0A 1KENH 3QYCA 1RZ7H 3G6JF 3TNNA 3LQZA 1JBJA 5DLMH 4K8RH 2VAAB 2R1XB 4R9HA 4XVTH 2FR4A 1P1ZA 2C3WA 3QUML 5EWIH 1ND0B 1MCSA 1QSVA 3RY5A 3N1FC 3T65A 3DX6B 4BUGA 3FN0H 4QT5B 4KQ3L 1XCQA 4WI9A 5IW3A 2JLLA 4XAWL 4X4XB 5C6WH 1MJJB 1J9CT 2GK2A 3FTGA 5LXGL 2VXSL 4PJBA 4P4RA 4L9LB 3TT3L 2MHAB 3WNMA 5D1QA 3WFHB 1HILB 4GXUN 5TQ2H 5JR1L 3H9YA 5ITFB 2R0WH 3Q3GB 4BH8B 3G6AB 4FFZH 4M6OL 4RBPH 3SGKC 2EDQA 2ATKA 2DQHH 2GK0B 3RNQB 3EOBB 4MJ2A 4W81A 1U8IA 2VXTL 3OG6B 1F3RB 5C09D 3TNNB 3LQZB 4R8WL 4P3CH 5FYLE 4OCRH 2QHRL 4PRPE 1FIEA 3LMJL 5DD0L 2FR4B 1P1ZB 3TNMA 5LAXA 5IQ9B 2GT9A 4HF5H 3CLFH 4M7ZC 3T65B 3LH2H 3M1BA 3MUY1 1PKQE 2YPKA 4OCWH 3D3VE 2MTPA 2VITA 4NQSA 4O58H 5JQ6L 1VKXA 1VGEL 1KXQE 4MNGE 1FE8L 3DJ9A 4HPOL 2AP2A 3HLAA 3FTGB 2BVQB 4JE4B 4PJBB 1MFEL 4QHLA 4P4RB 4ELMF 1DQQA 3P11H 1EERB 3UJJL 1FL5A 1MNUH 5D1QB 1LQSR 4MGXA 2GTWA 2VDOL 4IMKC 3H3PH 5T1KD 4HZLB 4XCFH 5EO1A 2UY7A 4JFPB 3QRFM 1JIBA 1MCNA 3ZL4L 3LSOA 2ATKB 5D1ZC 3G08A 1U8IB 2ERJC 2HH0H 3AY4C 4P2OD 5SWZD 3S5LG 4F7CA 1OVZA 1ZWIA 4TUKH 3DXAD 1NLDL 3TNMB 5LAXB 1LILA 4JY5L 4J8RA 2BX5A 3G5ZB 1WFUA 2GT9B 4JFED 3V6FB 1A6UL 4KRPC 12E8L 2LQRA 3QXAA 4O5LL 2YPKB 4AY0A 1EJ6A 4NQSB 2QADC 2VITB 5E00A 3VGAB 1VKXB 3A67H 4IIQC 3RBSA 3S34L 2E7LA 3HLAB 1N2RB 2GJ6E 1DQQB 2R29L 2KBGA 2XG4A 1HWGB 4B50A 3LKQA 1HI6A 1BLNB 2AJYL 5ICYA 3UP1A 5B4MC 4JFFA 3MJ9H 5EO1B 4XWOC 1A7QL 4HH9B 2FEDC 2VOTA 1DBBH 2G9HA 1GZPA 3LSOB 5IW6A 3GMRA 1J1XH 3DLQR 3F5WA 4QCIA 4W4NA 1KN2L 3G08B 3PG2A 3QIWD 3N85L 4YHPA 5F7DA 5B39G 2AKRA 4F7CB 5BVPH 4UT7L 4EUPH 1ZWIB 1F6FB 1E6JL 5DMKA 1W72L 3ZE2F 3EDJA 3O0RL 4J8RB 4UAOC 5DD5H 1F11A 4FG6D 3SKJL 4BSJA 5E00B 4ZFZA 4KKBD 2YHGA 4N0FA 1I1AD 1WICA 1J0YA 3CGTA 3WFDL 3PHQA 4BZ1L 1J1PL 3DUHA 5GRXG 3GJEA 2EDOA 3QWOA 2QSVA 1CGUA 3LKQB 1MJ7L 3HZMA 1HI6B 5GRZA 5ICYB 4JY6A 4JFFB 3VDAA 4U1LA 3IJYA 3KPMA 3O11A 3V6OE 1RVFL 3JWDL 5FYJU 4JG0H 2G9HB 4MA1C 1GZPB 3SDAC 5IW6B 3F5WB 4QCIB 1ZLUH 3OR7A 3T77A 1YUHB 1T4KA 4YHPB 5F7DB 5HHOD 2AKRB 4YHKL 3U9UA 5DMKB 1JYNA 4Y4HD 5F44A 4JVUA 3VI4E 1F11B 4PJAB 1G0DA 2H8PA 5CKGA 1MCFA 3VFVA 1I3VA 2Z8WC 4ZFZB 5T3ZL 1KUMA 1T2QH 4N0FB 4X7TA 2DQTL 3QDGD 4LOUD 3KNBA 5GZND 3PHQB 3HE7D 3IAPA 4G43A 2OZ4A 4PGJA 5SV4A 3QWOB 2VXVL 4L8SA 3AAZA 4L4VD 4LK4A 4O51A 4U49A 3U4BH 5IB2A 1LE5A 2E3VA 4JY6B 4PJEF 4U1LB 2A73A 3IJYB 1FNLA 3KPMB 3PP4L 5IVOA 3MOAL 4TYUA 1HKLH 1NL0L 3OR7B 3T77B 1T4KB 3BDXA 2BXZA 5CLWA 1U95A 5D2LF 3U9UB 2BZDA 1S3KL 5SX4H 4MXVF 4XRCA 3O8XD 4KKLD 4J4PC 5JZ7C 1QSFE 4WW2F 1DLFL 3PWPB 1QVOA 3D2UA 3VFVB 1ZANL 4X7TB 4XNYH 5T3XD 4HKXA 3KNBB 2P5WA 3VRJA 1N5YH 4G43B 1DANT 4OD1L 3QWQB 3T0ED 4L8SB 3DURB 1AO7D 4KVNH 3U82B 3AAZB 5E2VL 5ESAA 4KI1A 4KAQH 4O51B 3PQYE 1C5DA 2ADJA 5IB2B 1LE5B 2XV6B 3B5HA 3I3BA 3R8QA 1L6ZA 1OQOA 1KEMH 1YEEH 3EYVA 4YBLC 3HAEH 5JXED 2A73B 2A9NH 4QF1A 1OP3K 2X1QA 4IM8A 1MWAL 5J1SC 1G9ML 1L7IH 4KTEL 4PIRF 4XRCB 1RULH 1CXFA 1NFKA 5HHVH 1MHEA 1TDQA 1QVOB 3D2UB 4ZTPL 4D9LL 5JIPA 3OKLA 3ALXA 4HKXB 3WSQH 3EOTH 4I18B 2P5WB 1INEH 3CFEA 5HYSG 3DVNA 5F7EL 1NGPL 5I15H 4PGZA 2ZKHH 4LVOC 3RL1A 1G7HA 3T09A 1S8DB 1S7TB 2ZZUT 3TYFA 3O2VH 5ESAB 4PGDB 1KCLA 3CU1A 1C5DB 4P2QD 1E6OL 2C4XA 1RUKL 2EXYD 3WXWH 4CW1A 3EYVB 4XP6L 2HLFD 1ED3B 4QF1B 4G7YL 3QP3A 3MODH 4FQLL 4MJIE 5IESH 4OZIE 3MOBH 3F7PC 4JHWH 4LSRL 1UWEH 4AK1A 3RZCC 3BX7C 3I75A 5D7SL 2X10A 5B21A 3SGKA 4DTGL 3OB0K 3OSKA 3OKLB 1KBGL 5I16A 1G9NH 5HYQA 4NCDA 1BVKA 3CFEB 2AGJH 4HAGA 1H3PL 5DF0A 4NFCA 3RL1B 1G7HB 2B0SL 3K8KA 3WKML 2CIKA 2Z8RA 3DGGA 3TYFB 5ENWA 2X4NA 5KAQF 1NSNL 3LPGA 3V79C 3ET9F 1QRNA 4YHNA 5GZOD 1MELA 5FYJL 1HIMH 2JIXB 2YBRA 4CW1B 1R3LB 4K94H 2O5YH 4QHNA 4AQOA 3DRTA 4P9HH 3QNYB 2V17H 1WEJH 2RHEA 4OI8A 5A1AA 3A0OA 3I75B 1DVFC 2Z4QB 3SQOH 3DSFH 5I16B 1RURL 5JHLH 5D1ZA 1YNTA 2OL3H 1MIMH 5HYQB 3AY4A 5EZIH 1BVKB 3TJHC 5JIIA 1FGNH 5I8KL 3HMXL 3LKOA 4M1CC 2VLKD 1D5IH 2CIKB 3V5KB 2QQLH 3DGGB 1EHXA 3FFCE 5ENWB 3TT1H 5I73C 4M7ZB 1JGVH 1QRNB 4RQQA 4YHNB 2DLGA 5BW7C 3KS0H 1PEZA 1FAIH 2OCFD 4NT6A 3HHRB 2YBRB 5CAYB 4IIQA 4PBVC 5L6YL 5I66A 2AABL 1NEZG 1JE6A 4PB0H 1TNMA 4JGJA 4XCNA 4AG4L 2D7TL 2WAHA 1OTSD 1F2XK 4PGBA 1NFDF 4OB5L 4UDTB 2CXKA 2CJUH 4L3EA 2N56A 3AS2A 1UZ6F 3UTZA 4TSCH 5D1ZB 1YNTB 3ZTJG 4RA0C 2ERJB 5IJVA 1KJMA 3D25B 2DQIL 2JJVA 3C08L 3LKOB 2VWEE 2FH6A 5JHDD 1YDPA 1Q9OA 3WIIH 4KRPB 5CEZL 1KENL 1RZ7L 1MCDA 2QADB 2WLZA 4LRIC 2VSCA 4NT6B 4XPBH 4FQHA 5JOPE 4IIQB 4TVSa 3EYFA 1OGAA 5EWIL 4R90H 3SDYH 3V7AG 4R26L 4AJ0A 5I66B 4YDIH 4EUPG 3ZDXE 3R1GL 1RUAH 4XCNB 4NUGH 1CL7L 4Z7WA 4PGBB 4NJAH 4L3EB 3UTZB 3SDAA 3N1MC 2XOTA 2BNUA 5IJVB 2W60A 1KJMB 2R0WL 3CH8A 4PYHA 3ZDZF 3V4VH 4BQ9A 1J10A 4FFZL 1T22A 4IS6B 4UAOB 2YZ8A 1YDPB 5A3IC 5FHBH 4MXQD 2DQHL 4Y8AA 1CDIA 4Q97A 3FO0H 1R5VA 1LGVA 4PREA 3C5ZD 4FQHB 1FCCA 2XTJD 1OGAB 5IROC 4LVEA 4PJIF 4HF5L 4JDZA 2A6KA 2B2XH 2VC2H 3LH2L 4I3SH 1QEWB 3GI8H 4O58L 4KTDH 1BJMA 4Z7WB 1A5FH 2A83A 2JF1A 4PJGE 3EFFA 1SMAA 4FQJL 2N7AA 4MA1B 3SDAB 35C8L 1YQVH 4X6FA 2BNUB 1O5DT 3H3PL 1FLRH 1T22B 3QEGH 3U4EA 4KFZC 4J4PA 2BY1A 7CGTA 1JYWA 1HSBA 5ID0A 3GM8A 4NNXA 4Z0BH 4PREB 3FHAA 2NNAA 3BMWA 3LEYL 4P5MB 2R0KL 5L2KD 4X99A 1SHMA 2PYEA 4JDZB 2A6KB 3NCJH 4JPVL 4ONGH 4MD5A 3NACH 3A67L 1UM4H 4XPFH 3UTTA 1F4HA 2VDKH 5CMAA 1UFUA 3EFFB 2V9QA 5DHVA 5GSVB 4AEFA 2XYCA 3ARBD 4X6FB 3HE6C 1V7NH 1KNOA 3ZE0F 4MAYD 3MJ9L 5HDOA 1KV3A 3VGEA 3U4EB 5IV2A 1F97A 1GGUA 1JTTA 1LNUA 2JELH 3EYSH 1CFBA 1HSBB 5CZVL 3SCMD 5ID0B 4NNXB 4PBWD 3HAEG 3O3BA 2NNAB 3C6LD 3CZJA 3LOWA 5T1DH 5DD5L 2PYEB 4PJ8C 3FKUS 1J0ZA 4FTVD 1PG7W 5ESQA 3PGFH 2VZ3A 5CCKH 5C86A 3UTTB 3PL6D 3C60D 1ULVA 3MRLA 5JDJA 4YBLB 5CMAB 2IBZY 5D7KD 1JPST 5DHVB 3L6FB 5MHSE 1KNOB 3MACH 2ZCLH 3T2NL 4Z7VF 1JHKH 1FVEA 5IV2B 5IVXE 3VE0A 1IZKA 3RZCA 1LNUB 2V5MA 4JM2F 4JG0L 3QQ9C 1EAJA 4LQFH 2H3NB 2DAVA 1EHLH 1RZKH 4JREB 2IPTH 4PTUA 1CLOH 3R4DA 3O3BB 4U7KA 3UC0H 2HRLA 3KPOA 3QHZL 2BMKA 5MENA 1WAAA 4LVOB 4N9GA 5IVZA 2GSIA 2EDNA 4JFYA 5CJBA 5D7LD 5ESQB 4AYFA 5T1MA 4U6HA 4X9IA 2VLRD 3NFNB 2I9LA 5I1IL 2H1PH 3NIGE 3MRLB 3BIKA 2D7MA 2EDRA 1EGJH 4UU9A 2IALA 4MSWB 3U4BL 4GQ9H 3U0WH 5GGTH 4XX1G 4FFWD 1FVEB 1F00I 3VE0B 5HYJA 3RZCB 4POZC 4DVRH 5D5MA 4XNUH 1DVFA 4OD3H 5IBLC 1HKLL 5SX4I 4BZ2H 3O3AA 5DMYA 2X9WA 4QYOA 4HCRH 5HD8D 1ZVHA 1J0JA 3RGVB 4PTUB 3FRPG 5JUEH 3KPOB 4X6CA 2O5ZH 5ITBL 3CX5J 2DI7A 4Q7DA 3CFBA 2FHBA 5L9DL 2BMKB 5MENB 4D0BA 4OF8A 4QHKI 5IVZB 2GSIB 5L88L 4JFYB 4XNYL 3QUZC 5T1MB 4U6HB 5BW7A 2I9LB 1HHGA 2E27H 2QR0A 4ZQKB 1KPUA 3GUTA 5C0EA 5HBBA 1N5YL 4X5LA 3BJLA 3BIKB 1CD0A 4YEEA 2W59A 1IQWL 3VA2C 4H8WC 4UU9B 2IALB 2LE9A 4KAQL 3RWCA 1NEUA 4K2UH 1RK1A 1FORH 1KEML 1CFTA 4DGYH 4OFPA 5HYJB 5D71H 5D5MB 4ZUUA 4TNWF 1DVFB 4PJDE 3O3AB 4YXLH 4QYOB 1EZVY 1U8NA 5KZCD 4JN2A 2CR6A 4HWUA 1YYLH 4X6CB 1RULL 3CFBB 4ODXA 1ZMYA 1MCJA 2BOBA 4D0BB 2KL6A 2J8OA 3UYPA 3WEXA 4BFBD 4EI6A 4FFYH 2L4OA 4M3JA 5GXBB 5I73B 2APFA 3VXMA 3BRFA 3S9DB 3WSQL 3ARZA 1HHGB 4G9DA 4LRIA 4U6YA 2QR0B 1G9EA 1KPUB 4KK8C 2Y9RT 5F7KC 3GUTB 4NQVA 3QIUC 1NKRA 4X4YA 3O2VL 2HKFL 4NWUH 3RWCB 1JI1A 2YD2A 1RK1B 1CFTB 1RU9H 3OGOE 4LIQL 2AXFA 2W91A 4ZUUB 1G6RL 2W1NA 1NCAH 1UACH 3VXUB 2AI0L 1U8NB 4JN2B 4OZ4A 5T5NG 3FQRA 4ODXB 3QPXH 1MRCH 4WUUD 3WEXB 4EI6B 2C9AA 3O41A 1LDSA 4WFHD 3CSPA 1CICC 2XA8L 2X4UB 3PABA 4U6YB 2AGJL 1T2XA 2VDNL 4MNQD 5I1JL 4NQVB 3ALPA 4QRUA 5IROA 1CXEA 4X4YB 2ICEB 3WDHA 3SPVA 1NAMA 3P0VH 5E6YA 2C1OA 4Y0GA 5LBSH 4H5SA 5SWSD 2Q76A 4K94L 2AXFB 5KS9F 3RUGE 1ERNA 3FRPA 4IBLT 1MCKA 2AK4A 4V1DA 4S2SA 2O5YL 1LHZA 5FYLH 4Q58C 3S6CA 1F4WH 4OZ4B 2OBGA 4O4YH 2V17L 1E4JA 3FQRB 2UUDK 2AJVL 3FT2A 3O41B 3I3EA 1YY8A 3SKNA 1EVUA 3HG1D 4Z7UA 2OMBA 1H3UA 2NXYD 1FGNL 4HKJB 5J13C 1BZ9A 1VSCA 3OF6A 1UH4A 3U46A 4WHCA 4QRUB 2QQLL 4AMKH 5B38G 4MQTB 3DX9A 3F7VA 1AXIB 3MLUL 4NZRH 5DQDH 1NAMB 5F6HJ 3SPVB 2OI9C 1FG9C 1FAIL 4H25A 5DMJB 2C1OB 4H5SB 1KG0A 1KJ2A 2UZXB 3FAWA 1I1FA 5AWNL 1SM3L 1QKZH 4D8PB 5K93A 3JV4B 2AK4B 4V1DB 4S2SB 3VI3E 1JPFA 2GEEA 4YHYC 4PB0L 3U7WH 2N4IA 4ORGA 3GSRA 3HE6A 2MPAH 5I1HL 4OQ1A 1UENA 5GJSL 5DUBA 1JRHH 1XF1A 2XKUA 3FT2B 2CJUL 1GGYA 1PW3A 2ZNWA 3SKNB 1T66C 4TSCL 1TITA 3UDWC 1ZSDB 1QNZH 4Z7UB 4F7TB 3T2PA 3HC4H 3KXFE 1XGQA 2CDFA 3ES6A 3RVWD 1BZ9B 5FUZH 3U46B 1YMMA 3EYOA 1UEMA 3AB0C 4AEEA 4WW2C 4X6DE 1F58H 3DX9B 4JRXA 4PJ8A 3F7VB 3D69A 3WIIL 4WHDA 3TVMC 4NNYA 3C87A 3KLAA 3LD8C 4H25B 3TYGH 1KG0B 1A6ZA 1KJ2B 2EYTA 1I1FB 2PETA 2YRLA 3HPLA 2NYYD 1BOGA 4R90L 5DS8A 1JPFB 2DOCA 3A6OA 5CFHA 1N0XL 3LQAH 4P57A 4H26A 1FPTL 4ORGB 1MAJA 3GSRB 3HE6B 4LPVA 4AT6A 1UM5H 2CLRA 1KIQA 3GJFA 1DQDH 1IM9A 4F9PC 5DUBB 1AI1H 4KI5E 4UUJA 5H2BA 1V7ML 1YPZE 3EAKA 5C71A 4U1HA 2FH8A 3VFMA 4BSWA 3NIGF 5INCA 5EC2A 1XGQB 2CDFB 3ES6B 5TH2A 1YMMB 3EYOB 3Q1SH 3UTOA 1J11A 4Y1AE 1MCLA 2X4SA 1Y18A 3VFWA 3ZKNC 2HVJA 1MF2L 1AQDA 5D7IA 5E9DE 3QR2A 2KZ1B 4PRHA 4JRXB 4L5FH 4PJ8B 3D69B 5FHBL 4KDVA 4DFIA 4NNYB 1B2WH 4K3JL 3FO0L 3KLAB 3VXNA 1EH9A 4DGIH 5TDNA 1A6ZB 2EYTB 3G6JA 3O6ML 3HPLB 4LSQH 3NTCH 1CBVH 1BOGB 5DS8B 5C0AA 4H0IA 2B2XL 2VC2L 3HCVA 5CP3A 3ZYJA 3ARUA 4URTB 4K8RD 3GI8L 1Q9LA 4H26B 4P57B 4AT6B 1SMOA 2ILLA 1B3JA 1KIQB 3GJFB 1IM9B 1EFQA 5F7YC 2NY0D 5H2BB 3VFMB 4BSWB 5ACLA 5INCB 1YQVL 1A6TA 4E9LA 4EN3D 3UZVB 5EC2B 1QFPA 5TH2B 3IXTB 3GRWL 3MBEB 1KN4H 4ZXBC 2X4SB 5FYKH 1Y18B 1OP5H 3VFWB 2HVJB 1AQDB 4XB8A 5D7IB 4PRHB 4KK5D 4LHUA 4WTZA 4Z0BL 4OQTH 3JWDC 3QUZA 3VXNB 5TDNB 4KK9D 3G6JB 2ITDA 1EFXD 1BQUA 1N59A 3HCVB 3NCJL 5DA4A 2IQAA 1Q9LB 2WMPA 3ZE1E 3VRLE 5I1AA 4YAQA 2ZWLT 4XPFL 3TFKD 5C08B 4FHBD 3GGWA 3ISWA 3C2SA 3G5YA 4K23L 4KJPC 4ELMA 1V7NL 5C0BA 1A6TB 4WUKL 1F13A 4GW5A 4WFEE 4LKXB 1KPVA 4DCQA 2ATPA 5E4EC 2JELL 3CCHA 1KC5L 1H3GA 3EYSL 2J1KA 3KJ6H 1OTUC 3H42H 2BSTA 4LHUB 2ESVE 3CFKA 4OCNC 3QUZB 3QCUH 4JPWL 5T1DL 2EDYA 2ITDB 4KK6C 3K4ZA 4XVJL 1M7XA 5TPWL 1N59B 1YEHL 1QFOA 2IQAB 3QIUA 3PGFL 5LGHH 5I1AB 5CCKL 5EBWA 2NLJA 4YAQB 1REIA 2COQA 4Z0XA 1M1SA 3SO3C 3RP1A 4N1CA 3G5YB 5E1AA 2EIBA 1D6VH 2ZSWA 4I2XE 4N0CD 3VMPA 4ELMB 2J6EL 5C0BB 5EO0A 3BSZH 3L3HA 4XP1H 4GW5B 4UT6H 4UBDC 1JHKL 3O9WD 3G6DH 5K9OA 1KPVB 2ATPB 4X83A 3W9EA 1N8ZA 3TESA 2E9BA 2BSTB 3CK0L 1EHLL 1RZKL 1JPGA 3WL9A 2IPTL 1U91A 3CFKB 5HI5C 4HPYL 1OM3L 4WEUD 1WZKA 5I71C 1MCBA 2CIIA 4OLVH 4U2YA 2C3GA 1G9MC 3BKJH 4D2NA 2NLJB 3FJTA 3HZYA 3QDJD 4Z0XB 5A16A 2MSPA 4GKZA 3WJJC 5E1AB 2ZSWB 1U6AL 3PIQA 3GHEH 4ZO9A 3PJSA 3U0WL 5GGTL 2B7DT 5EO0B 2GJZA 3L3HB 4NO3A 4PGCA 3MV11 2V2TA 5K9OB 4GS7C 4ZAKC 4I0PC 4XNUL 2P46B 3W9EB 4OD3L 4PG9A 5E8EA 4BZ2L 2RQ8A 4CDHA 3MJ6A 4HCRL 1JPGB 3WL9B 3WE6A 1DBKH 1ZT7A 1U91B 2NX5E 5JUEL 4QNPE 5FCUH 3BKCH 2PTUA 2CIIB 1DSFH 3H6JA 3Q5YA 4PJ9C 1EHNA 3CIQA 1YEDA 3NFPA 2EDTA 5EU5A 4GMTH 3HZYB 4HGWB 3P9MA 5A16B 4GKZB 2NY1C 3TPUA 2EH8L 4E42A 1TJHH 4P5TC 1L4IA 3GMOA 5GRYA 2XIDA 3QFJA 1SBSL 1A9EA 4C83A 3VXSA 2IF7A 3PJSB 4APQC 4PRAA 1AY1H 2GJZB 2VXUH 4NO3B 5FFLA 2V2TB 4DGYL 3RZWA 3GM0A 1HSAA 4BQ6A 5SX5K 3HS0A 3MV01 4PJEA 4PG9B 5E8EB 3SGEH 4YXLL 5KAQG 3WE6B 1EO8H 3NN8A 5EO9B 3UDWA 1YYLL 4OCYH 2HT3D 5D2LA 5SWZE 3TBYA 5J13B 1FL3A 2HFGH 2VDQH 1U2HA 4U6TA 8FABA 1YEDB 4XPGL 4WW2A 2P44B 3NFPB 4XB7A 3TVMA 2OI9B 3L3OA 3MGTA 1K3IA 3MV7A 3P9MB 3TN0D 3TPUB 3GMOB 4PJ7E 1N64H 3KLHD 3QFJB 4OCLC 1S9WA 4HKBA 1A9EB 1B4RA 4C83B 4Q9BA 5HYIA 3VXSB 1PLGH 4PRAB 4L8CA 4TTGA 4OI9A 3C8KA 1HSAB 2RJMA 5CBAA 4F9PA 3HS0B 4PJEB 4DUVA 1QHOA 4JDTH 1UACL 4XC3L 3ARBB 2PO6D 3WIHA 3IRPX 4G8EB 1JK8A 1FNFA 1S9YA 2BY2A 5I30L 1PZ5B 2H9GA 4UTAH 3MRNA 5E08L 4TQEH 5D2LB 3TBYB 1NGYA 1FL3B 8FABB 1OAXL 3AB0B 3NABH 4RMWA 5HHXL 4WW2B 1NJ9A 3TVMB 2B1AL 3L3OB 3MGTB 3MV7B 4OLYH 4Z7QE 1U42A 4DW2H 4KGLA 3MRDA 1NQBA 2HJLA 3GJFK 1S9WB 4HKBB 3H9SA 3VXMD 1KB5A 1W72A 2X9YA 4L8CB 1AKJD 5LBSL 3BQUD 3C8KB 1MY7A 1B0WA 5CBAB 4P4KD 5IP4A 4IRJC 1CLYH 1TZHA 3D0LA 4OBSA 5F88A 4U1GC 1JK8B 3IDJA 1F4WL 1S9YB 4O4YL 4PP2A 2DBJA 2H9GB 3MRNB 5ANMA 4QXWA 5HHOE 1NGYB 1FIGL 4ZXBA 3AGVA 4WFFD 4JM2C 1GYAA 3S36X 3IU3A 2IFFH 5J6HA 1NJ9B 1JGDA 4ZSOE 3FL7A 1VPOH 1ZLWH 1K4DA 4I48A 3MRDB 3WIFA 2HJLB 3QEUB 1I8MA 3H7LA 5A3ID 4G9FA 4KJYA 5KTEH 4AMKL 3VDBA 1CWVA 1MQKL 4UQ3A 3X3GH 1KB5B 1W72B 3D9AH 4P23D 4U7SA 3O2DA 3JZ7A 3NZ8B 1ZGLM 4PLJD 3D0LB 4NKOA 3VD5A 5F88B 4I8DA 3U7WL 3VD4A 1FZMA 3VWJC 1JMZA 4PP2B 3O3UN 3QDAA 4M1DH 5ANMB 2MPAL 4PRID 4WWID 1JRHL 4ZXBB 4ESKA 1JGEA 4AH2B 5BQ7A 1JNHA 3QH3A 3IU3B 4U4BA 1RHHA 1VFOA 3KAAA 3TO4D 2P47B 1JGDB 1QNZL 5I9QC 3CX2A 4NQED 5I75B 1K4DB 3ZSTA 5FUZL 3WIFB 5T3XE 1I8MB 4TPRH 2K7QA 4G9FB 4KJYB 4JGMA 1F58L 4E41E 4GG6E 3VGBA 3QSKB 4UQ3B 3T0EE 2IWGA 3ZKQD 5LWYL 1AO7E 3TYGL 4JR9H 4NC2B 1MH5A 3ARDC 3UX9B 1CQKA 4NKOB 2B39A 3QXWA 4KDTC 4Y5XC 4WIQA 1KJ3L 3LQAL 1FZMB 1HWHB 2RCSH 1ZEAL 4ZTOH 1JGLH 1KOAA 2BHUA 2WBJA 3K2UH 2CK0H 3K2MC 4RDQF 1AI1L 3EYQC 3DETD 3OXSA 4HUMB 5E4EB 1UQSA 5BQ7B 1JNHB 1RHHB 1B0RA 3UTPD 4U6XA 1Q9KA 3KG5A 3MLYL 5T33H 4GLRH 2BNQE 2LU3A 3EHBD 4LLAA 5TFSH 4UTBL 3QT2A 5DUPL 1B2WL 1FLTX 1V3JA 3QI9D 3DNKA 3SDXE 4DGIL 3D18A 5F7WC 4P2QE 1MH5B 3NTCL 4ZS6C 3WJJA 2WBKA 4NZUH 2A0LC 1W0YT 4NC1C 5CP7A 5D93C 2ZSVA 2KQMA 3GSQA 1JVKA 3VU2A 4HS8H 5CILL 4UQ2B 4M00A 2WBJB 2BDNH 4HBQA 1JP5A 2QEJA 3MRHA 4X9BA 3OXSB 1I9EA 1RZIA 1UQSB 4ZAKA 4I0PA 4JFHE 3ROOA 1A7NH 1B0RB 3MNZA 4K3DH 4U6XB 1Q9KB 4WEMB 4XNXL 5KSBF 3CJJA 4YWGL 3LRHA 3F6LA 5I71B 4ODTH 3MRJA 5I8OH 3JTSB 1KIRB 4PJ9A 1MWAB 1JPSL 3AS3A 4OQTL 1BAFL 5FM8A 1Z0MA 3D18B 1MCRA 1F5WA 1URLA 4PJ5A 1LP9F 3IDYC 4P5TA 3MJ7B 5CP7B 1IARB 2ZSVB 4DK3A 1YNKH 3GSQB 1X5YA 1V3KA 2EDEA 5JMRA 4APQA 2X09A 2O93L 5C0AD 5F9AC 3MRHB 4GS7B 1RZIB 4ZAKB 3ROOB 3MNZB 4C56E 2HTKC 4PJ7F 5D7JC 3MRRB 5F7LB 4DGVL 4M3KB 5GIRA 3KPPA 1P6FA 3U83A 3MRJB 3IDNA 1IGJA 2EIZB 5EORH 1G1CA 3KJ6L 4PJ9B 4FNLL 3F65A 2HLAA 1ACYL 5F93C 2RAMA 3B2VH 1M4KA 3M07A 2EDHA 1OAUL 2HRPH 2NY1B 4PJ5B 5JLZA 4KWUA 4P5TB 3BYTA 4K7PL 3RTQD 4K7PY 2APVA 5LJYH 2K1MA 4Z7NF 2WINA 4CRPA 3GNMH 1V8HA 1EK3A 1D6VL 2A38A 3VFGH 5C0CD 1P69B 1QLEH 3S98A 4GRLC 2EDJA 3VFNA 3VJ6A 1XIWC 4JO3H 3BSZL 3FOMA 4XP1L 4DKEH 4UT6L 3P30H 4CN6A 5GIRB 3KPPB 5F8QC 1BWMA 4LLVA 1QFWM 2WBWB 3IDNB 3THMH 1IGJB 3TA3C 2CLZA 1IEBA 5I19H 1CZ8L 2BK8A 3NH7L 2HLAB 3OZ9H 3BPLC 5KVFH 3H3KA 1EDQA 3QZWG 5JLZB 2BNRE 1HNFA 5DA0B 1HINH 1RHFA 5B3NA 4KROD 4I1NB 3WJLC 3UZQA 4OI7A 1VESA 4Q9RH 2FATH 3CXDH 4J2XA 3W81A 3HZKA 1MCEA 3QIUD 3WD5L 2VLME 5DMGC 4IRJA 2DQGL 5GS0H 1G7LA 3VFNB 1AHWC 3VJ6B 3FOMB 1IAII 1NBZA 1CL7I 3KPTA 1G7MA 3C5SA 4LLVB 3GB7B 4ZODA 4Z7VA 2CLZB 5E4IA 2QQKH 5MP6L 5F1IA 4YUEH 1IEBB 4OIIH 4JM2A 1DBKL 4LCYA 1BD2A 3WLBA 5C07D 1U9KA 3TBVA 4N5ED 2E9JA 4KUCF 1OOAA 1DSFL 1KCRL 3VCLA 4QGYA 3IDGA 2XTJE 4Q9QH 1HXMB 2WUBH 1NCUA 1CICD 3DVGA 4UB0L 4Q74A 4JHAH 3DMMD 3T8XA 1JCKA 4HS3A 43C9A 1JGUH 1NANI 2DRUA 4HHAA 3CMGA 2ZUXA 2FHFA 3HZKB 2DMKA 4ZUWB 4CMMA 3LN9A 4IRJB 1PG7X 1G7LB 5EB9A 2V2WA 4U1GB 3VXRD 1S7XA 1NBZB 2VXUL 1CT8A 3PF2A 2X4RA 2GQHA 1CGSH 4Y4FD 1G7MB 1QBAA 2A6JA 4Z7VB 1NUGA 4NUJA 4PJBE 4KJWD 2A74A 5EZOL 5F1IB 4X5WB 3T0AA 5IK3A 3EJYD 4JM2B 4LCYB 1BD2B 3WLBB 1S5IL 1TVHA 4IOFD 3TBVB 3PV7A 1DE4A 1XGYL 4EI5D 2OJZH 4DJMA 5IM7B 1HH9A 3VCLB 1SJHB 4WRLA 3IDGB 2VDQL 1IE5A 5DRWA 4LLMA 1NAKH 3DVGB 3T8XB 3TCLB 3O4OC 4HS3B 4GSDH 43C9B 3RDTC 2G5RA 4HHAB 1N64L 4CMMB 3QDMA 3ARDA 1NCWH 2H32H 4KDTA 4Y5XA 2V2WB 4IDJH 1ZLVH 1PLGL 3VH8A 1NC2A 1S7XB 1CT8B 2X4RB 1MAKA 3U7AA 5E8DH 4XVSH 1EVTC 1MFCH 2A6JB 1DBML 3BO8A 4NUJB 5LGKA 4JDTL 3SDXF 2IGFH 5IK3B 2IH3A 3ZT5A 1KTRL 4W4OC 2EECA 4IRSC 1TVHB 3NCFB 5I9QB 3VW3H 1DE4B 2QLVB 1SY6L 1CD9B 4TQEL 1HH9B 1MHCA 3ULVL 5DRWB 4LPWA 3NABL 5EOCH 2BP3A 1KLGA 3BGFC 5DTFA 4F15C 1N26A 3OAZH 4JRYD 1N4XH 1WT5C 4KUZH 2AS5M 1U3HC 4LEXL 4OFVA 5EPMA 1CGXA 3QDMB 3LCYA 3ARDB 2UWEA 4N8VG 1WWBX 3VH8B 1NC2B 1T1YA 3MV9D 3SY0A 4DEPC 4HWBA 3BO8B 1XGUA 1HCFX 5I1KH 5DD3H 3ARWA 5JIHA 2VDLH 4JFFE 1HXYA 1MHCB 4F37F 1KLGB 1RQ5A 3BVNA 3NIFF 4UINL 2IFFL 3N1PC 1G7PA 1MFAH 4I77H 4JFDA 2A6DA 4NN7C 1MHHA 2NY7H 4ZD3L 1IGCH 3F12A 4TSBH 2VLRE 1ORQA 2NY4D 2UWEB 2CH8A 5GPRA 1RD6A 5D93B 5I1LA 3RVXC 3WFEL 4YXKH 1CDCA 3X3GL 1T1YB 1EEUA 3SY0B 5B3JF 3BRDA 3H9SD 4HK3N 4W6WB 5E2TH 1JFQH 1XGUB 5KS9A 4NRZA 1MREH 4JFQA 4NQCA 4DN4L 5D7JA 4M1DL 1JZ4A 3O3EA 1HXYB 3RVUC 4Z95L 1A14L 5FYLD 3ARGB 3IYLW 4F57H 3BVNB 4XNZC 4BK4A 3FO9B 1G7PB 3EO1A 4KHTH 1RJYA 2A6DB 2GUOA 1MHHB 4NP4H 3F12B 1JZ2A 3D3VD 4TPRL 4ETQA 2HT2C 4N5UA 2V7HA 3IDYB 1RI8A 2XZCH 4YX2H 4DK6A 5I1LB 5ECJE 5HXMA 3EJJX 4R6UA 3MXWH 4ZUTA 5KS9B 4GBXD 1A7BA 3D85A 5EUOF 4JFQB 4RGOL 3O4LA 3IB4A 4GRLA 2RCSL 4NQCB 5A2KH 2WV3A 5D7JB 1XIWA 1JGLL 1Q94A 2CK0L 2AEQL 3O3EB 5EZJA 3TA3A 4P5KA 4XTRC 1XAUA 3FMGL 3EO1B 2GUOB 4XPHH 4RX4D 1G7IA 2D7NA 5TFSL 4ZMAT 4ETQB 1QBLH 2V7HB 1OTUD 4C59B 2AEPH 4G7VL 3B2UC 2GJ6D 4RAVA 5DEFA 3ULVF 5FAAA 4CGTA 3WJLA 2XTLA 4NO0D 2P5WE 2H2PD 4JQXC 3KPRA 4OT1H 5C2BL 1HE7A 4ZUTB 5ID1A 3MV8A 5DXWA 3D85B 1E28A 3O4LB 2ZUYA 4GRLB 3QPQC 4HS8L 4OF6A 1AHWA 2Q7YA 3IFOA 5GS1C 2HT4D 1XIWB 4EOWH 2Z8SA 4UT9L 5EZJB 4K9EL 3TA3B 4P5KB 4QRQA 5A2IH 4K3DL 1YEIH 2DTML 4QKXB 5JOEA 1HCVA 3BPLB 1RZ8A 1G6RA 2DLFH 1G7IB 4KRNA 4ODTL 1OAQL 1FNAA 1XT5A 3NAAL 2Y1VA 4HLZH 5HI5D 4RAVB 5DEFB 2CO7B 2H41A 1MI5A 2KH2B 5HHMB 3L9RA 5C3LD 3TIEA 5F96H 4EKXA 4XP5H 5ID1B 1HDMA 3MV8B 1E28B 1T89A 1X5GA 4U33A