4YK4C

Human antibody 641 i-9 in complex with influenza hemagglutinin h1 solomon islands/03/2006
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
225
structure length
220
Chain Sequence
b'QVQLQESGPGLVKPSETLSLTCTVSGGSISSYYWSWIRQPPGKGLEWIGYIYYSGSTDYNPSLKSRVTISVDTSKNQFSLKLSSVTAADTAVYYCARRRSDFETVDFIYHYMDVWGKGTTVTVSSASTKGPSVFPLAPSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKRVEP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 641 I-9 VLCL antibody
publication title Viral receptor-binding site antibodies with diverse germline origins.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Viral protein/immune system
total genus 36
structure length 220
sequence length 225
chains with identical sequence Z
ec nomenclature
pdb deposition date 2015-03-03
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yk4C02
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4yk4C01
2ZUXA 1BBDH 4PY7B 4LARL 2EC9T 3UBXB 1MIEH 4C83B 3DSFL 1TPXC 1ZANL 3BEWA 3MBXH 4HIHB 2C4FT 3RU8H 1OOAA 4OCXL 4K94C 2FZ3A 2N4IA 1AJ7L 2YZ1A 2V2TA 1S7QA 2AEPH 4X9GA 3KYAA 1LO3H 5C6TL 1ZVSA 3FO1A 4FQPA 5DFVD 3B9VA 2BNRD 1S7RA 3QFDB 2ADFL 2IQ9L 1HILB 4A6YL 4Q6YA 4IDJH 1NEZA 1QLFB 5F88A 5IVOA 2W60A 1E4KA 3NZHL 2AI0H 3BQUA 2VDQL 2RFXB 4X6CE 3TZVB 5E2VH 4QXTB 3L3OA 2J2ZA 3MNWB 1YECH 4LSUL 5EN2B 5EU5A 3BGMB 5C0RH 3EYUH 1H3PL 3EOTH 5IM7A 5AEAA 5HGHB 1XR9B 2GYSA 4WUUB 5E99L 5I2IA 1KPRB 4NP4H 2BRQA 1T66C 4XMKL 4ETQA 3O2WH 3LCYA 5C3TA 3UJJH 1REIA 1OT2A 3ARBC 1XF2B 3IDUA 1IM3A 1N8ZA 1G0XA 4MJ5A 4GG6F 2YA2A 3RWGB 3VWKD 2YHGA 1FNFA 2AQ3A 4M1GL 5DD3H 4WHTB 1K6QL 4GRWB 1JNNL 4HK0A 4LMQE 4X4XA 5CWSA 3MLWH 3R06B 2B0SH 1NBVH 1L9MA 1YNTB 2EDDA 3HR6A 1LDSA 2HT3C 4JFEA 2C26A 4JRYA 3L6FA 4OI8A 1AFVH 3HC4L 1C12B 4X8JA 5DK0B 1V8HA 4RGMC 3SDDD 3V5KB 3WO4C 4EIGB 4ALAL 2DQDL 3EO0A 2F15A 3BPLC 5AYUH 2AJYL 4GKNB 2HN7A 5JLZA 4HLJA 3AREC 4WHYG 3MFFA 2XWBB 3BDYH 5IG7B 3GK8H 1HH6A 5GS0H 3IFNL 3ZO0A 3ZTNL 4KZEL 4GRMA 2VZOA 5F9JA 2HLAA 1S7WA 2UWEB 1RK1A 1KB9J 1S5IH 3F7VA 4QF1B 4LLVA 1RUAL 4XMPL 4NQTA 3OKNA 3RL2A 1J11A 4PJFB 3QWRD 3OXSB 4GAYA 1JYVA 3BT2L 3QDMA 3O8XA 3MLUL 2LQRA 1PX3A 3EIFA 1QKZL 2B20A 4LLQB 4K9EH 2E7HA 5A2IH 5IJVA 1U8MA 3MRIB 4BYHA 3WIHH 2CR3A 4RQQA 2HFEA 2DL9A 4ONFH 1QO3B 3GIZL 4ZUVA 3REWA 3RZWA 1NSNL 5E6IA 1CFTA 1QBMH 5KSVA 4IMKA 4R90H 4NZRH 3CMOH 4UT9L 5BV7H 4RFNC 2CD0A 3HN3A 3SDYH 2CJUH 1SYVB 2X42A 1T03H 3STZA 2D7TL 5K9JH 5DQ9B 4O51B 4XNQB 4NQXA 3BWAA 3TCXA 3WUWA 1V7MH 1ED3B 5ELIA 1PLGH 1MCPL 1O5DT 3RWHA 1ES0B 1FL5A 5DEGB 4NPYA 1IQDB 1P2CB 1QLRA 3HI1A 3BIBX 1XGPA 1Q9OA 5EDXA 2GJ6E 1WBXA 3WN5C 5FYLH 1PZ5A 4HFWB 3UTZA 1CE6A 3MRDB 4R8WL 4YPJA 3VFOB 1ZSDB 1EMTL 4OCSL 5DS8A 4IRZL 1HCFX 4O9HH 3C5SB 2XTJD 3QUXA 1CDJA 4NDMA 5F7DA 4IJ3B 3MRFA 3LKSB 4N0RA 3ZHDA 2VE6B 4P2OB 2R39A 1CR9L 4R7NB 1FVCB 4P4KC 3PUCA 4JDVB 4YH6A 3BRGC 2J6EA 2XA8H 3ES6A 4CN4A 5D8JH 4DEPC 1QBLH 1J18A 5K93A 3HTLX 5DSCA 2NY1C 2DQEH 4XNUL 4L8DB 5JXAL 1V5JA 4KMTH 3DX8A 1N7MH 1NMCC 2F8OA 3PWPB 4JO2L 4JY4A 3U7YH 4LMQI 1MFAH 1ERNA 4P4RB 1GC1C 2OMBA 3S5LB 4LPCA 2I27N 1L6XA 4K23L 1G9EA 4WUUE 1RJLA 4XCCL 5FB8B 1JGVL 4MAUL 3QEQD 4NQDD 3OZ9L 1DN0A 5CP3A 1UCBL 2B1AH 1G7HA 5DF0A 1FYTB 2LVEA 3V52H 3MUZ1 5KVFL 1U8LB 5DK3A 3WEXA 4D9QE 4G6AC 1G0DA 1NCCL 4U1JA 3TO4B 4XXCA 3HR5B 1OM3L 4MQ7A 3VW3H 4GRWE 1DL7L 3MJ9H 4ZUUA 2OXGA 3GSVA 5GZNC 5EOQL 2Q6WA 1VGKA 3MV7A 2P5EA 4Y4HB 1UKQA 4R4BB 3QPQD 2NXZC 3TBTB 3PV6B 1MJ7H 1GGBH 3JBG7 4WEBH 4ZD3L 3QI9D 2EYRA 5D7LA 1S78C 3BYTA 4XI5C 5CZXC 5FAAA 2ZOLA 4XC1H 4XNZC 3RZCB 4HS3B 1D7FA 4YAQB 4LKXB 1BFVH 1S9VB 4OF6A 4C58B 2ZG3A 2Z35B 3TV3L 2GSGA 3QUZC 4P9ML 4Z7WA 1LDPL 3BEVB 3EYQC 5F70A 3SE9H 4CN1A 4TOYL 2QHRH 4RISL 3JV6A 3MNVA 1MRCL 1U95B 4LDOB 5DUPH 2UWEE 2EDOA 4LCWD 5CJXA 5JW5A 3SE3C 1FZOA 4J1UB 5FUCE 1KB5H 2HWZH 1QBAA 4WW2F 4XNYL 4NQEA 1ZGLP 1S7UA 4XXDA 1I7ZB 4HV8B 4PG9B 1FQ9C 3HE6A 3FFDA 1NFIB 4U6HA 2V5RA 3KJ6H 1E6JL 3GM0A 2Y72A 4PJXA 2OJZL 3MYJB 5KVDH 4KRMB 4MJID 5HVFB 1XF5A 1WCBB 3BXNA 1F4AA 5A2KH 1TQBB 2ATPA 4PGCA 4LHUB 3D3VD 3AVEA 3FRUA 4JJHA 2Y1VA 5TJWK 4OFYD 3S37H 5D7IE 1P7QA 5IEKB 1QNZH 1KIQA 3GBNL 1CD8A 1LHZA 3T2NH 1LK2A 3ARDC 4Y88A 3EGSB 3NIFE 4OLYH 4R6UA 1FH5H 3W82A 3GMPB 3HZMA 3UBXI 2VAAA 1J1OL 3VI4F 3UMTA 3IXTA 5DC9B 1VCAA 2YD4A 3PWJA 4UT7L 4NNXB 3MBEA 3V6FB 4XZUB 5E5RB 3V6ZA 5J11B 5C0BA 3ALWA 3FCTA 5T3XD 2R0WL 1J1XH 4Q9QH 1CT8B 5DD5H 5IQ9B 2Y5EA 1NAKH 1K4CA 4EI5B 1XGQB 4G7VH 4PJEF 4R26H 4GKZB 1CLCA 1ZHNA 1R3IL 2YPKA 1FGNL 2F54A 4HS8H 1XIWD 2O5YL 2C1OA 2J12B 2F8XC 1CICA 1S9YA 1U8OA 3VFWA 2H8PB 3L3JB 5BV7B 4OJFH 3EOBA 1GOHA 3WV0A 4XP9H 4MQXC 3VG0L 2D7QA 3RHWK 2OZ4L 3S34H 3KNBB 5F89A 1BOGB 2AABL 1CDUA 3L5XH 5A2FA 5IVZB 1Z2KA 2FD6H 3CDCA 3DYOA 3LN9A 2FDBP 5DGQA 4P5TA 4N90D 1JZ6A 1FFOB 4LPTA 3O2VH 5DC0A 5JDSB 3QIUA 3PWPE 1MCOL 1WFNA 4HQQL 5FA3B 1DDHA 3BPCA 4X6CA 4ORGA 5I74C 5ITBH 3D2UA 5J89A 4N1CA 1UKTA 3C60A 4PYGA 4QGYA 4HT1L 4P5KA 4UOW0 3TVMD 5E8NB 1MRFH 3HNTH 1X4ZA 1Z9SA 3KDMB 1Z9OA 2PYED 2EDFA 1J1PL 1YEJL 2BOBA 4LKCB 4RAVA 1JPST 3U82B 2QKIA 3EZJB 3PG2A 1JGLL 3WFEH 1L7IH 3CFBB 1FYTE 1JHTB 4RMTA 2D0GA 3O6ML 3GJFK 1ZLWK 4OM0H 4C4KT 2C1PA 1PY4A 3KHQA 1A14H 2R29H 5JPNA 2BHUA 3Q3GA 4U1NA 5BQ7A 3Q5TA 4Y5VA 2ADGB 2MCPH 1QQDA 4XP1L 2VDNL 3VH8B 3N50A 2AP2A 5C0IA 4HAGA 3HZVA 3V5HA 2NLJB 1M71B 4PY8J 4RAHA 1YYLL 3NFPB 1P7KB 3LDBB 1TTUA 1PJ9A 2P1YA 5EG6C 4ZNEE 3WS3B 2EE6A 3JWDL 2E7BA 1A1MB 2F74B 3LPWA 5LJYH 4GG8A 3MUHL 4TVPD 3OF6A 3OL2A 5F7EL 1IGYB 1RZIA 1SJHA 3P40A 1U36A 1TCMA 1K8IA 4MXVE 1NGQH 4LSQL 1JMXA 5L8LB 2KKQA 3SDCC 3L7FA 2NXYB 4GRLC 4PLKD 3ZE1E 5DO2C 2BOCA 5LGKA 1WLHA 1EEYB 1LE9A 1TMCB 4J8RA 6CGTA 3W39A 4YE4L 1AE6L 2P7TA 1NGYA 2DQJL 1IBGH 5EUKB 4KKLC 2UYLA 2V5SA 2YS4A 1ODAA 5IJKC 5D1QA 4DUVA 2V9RA 1J88A 1T1ZA 2VDKL 1CDBA 5IMKB 2CXKA 3ZE0F 3WXVL 2XOTA 5FIEA 4WWKB 4X7TA 1E4XL 2V2XA 4Z7NE 1A6AB 1KXVC 2APBA 1HI6B 3UPRB 3CFJA 5DJZA 4KJQC 1CXKA 5DLMH 5DHYB 2I26N 3RX8A 1KB5B 2A73B 3V0WH 3BPOC 2M26A 4YPGB 3O9WA 3HMXH 1AXSB 3PJSB 4KKAC 4KKBD 4F58H 2GJ6A 1KCLA 2BVUA 3MACH 1I7RB 3WJJC 3AY4C 3GHBH 8CGTA 1UZ8B 3P0GB 3VG9B 3PHOB 4PY7A 3UBXA 4C83A 4HIHA 4X0KA 3GJFH 2ICWJ 4KQ4L 1D9KB 2HTLC 5FO7B 1I1AB 1LO2H 1Q38A 1Q1JH 1C7TA 4ERSH 2DTML 3QFDA 4TRPH 3W5NA 1NLBL 5EORH 4M43H 5KANG 4Z7QE 3GSRB 3C8KB 4L3CB 2CGRH 2RFXA 4GBXB 2JK5B 1Q72H 3TZVA 4PJDF 4X5XB 3GSUB 3MNWA 4ZFOB 3VFNB 5D1XD 5EN2A 3DECA 5EU4B 5IWLC 3BGMA 2V5TA 4UOW1 5EBGA 3VXTB 5ACZB 4LCIH 3MXVL 5HGHA 2WUCH 1XR9A 4APQB 4WUUA 2UZIL 1KPRA 4LCUA 2UVEA 1N5AB 4M00A 2NY5L 4YHNB 5L7XH 4CJ1A 5B8CB 2GSIB 1OAKL 2NX5D 5DZLA 5EOTA 5LQBH 1XF2A 4OIIL 1QLEL 4DW2L 3IVKB 5I1IH 3RWGA 3NTCL 4OLZH 4Z77B 4M02A 1RIVH 3O3UN 4WHTA 4MQSB 3TIEB 3S36L 3EYVB 5CZKA 3BO8B 5C9KA 1R3KA 1NCBL 5E5MB 3R06A 4GW4B 4M6NL 5SV3A 5I30L 3MRNB 4KJWD 2IPUG 1UENA 1UG9A 1YNTA 1MFBH 3TYGH 4OFKA 1C12A 2KH2B 3O2DL 5DGRA 4OLWL 1X5GA 4EOWH 6FABH 4U0RB 3I3BA 4BQ8A 2F58H 4JFZL 4POZC 3T0XA 1T7VA 5IG7A 4P46D 4YBHA 2YPLD 4RRPA 2OTUB 2EXWD 5EZOL 3VGHA 3C5ZD 3MPCA 2UWEA 3JWDC 4QRUA 5J13B 1JTTA 1UWEH 4JCMA 4OIBA 3WJLA 3NABH 2RHEA 2CUMA 1VDGA 4LSSH 4XP6H 2P8PA 3D39D 3H42L 4I3SH 3O11A 1J8HB 4LRNH 1QBBA 2W07A 4PP1D 3MXWH 4XNMB 1MI5B 3P0VH 4UTBL 5DK2A 4UTAL 2DIJA 4MB5A 1N0XL 1CFSB 1R3HB 1IL1B 5D7IA 1QO3A 3QRGH 3U9PL 5BZDB 1A7NH 5B39B 3IS0X 1C5CL 3JVGC 1DLFL 3MGTA 1G7IB 5D7KD 2ADIB 1YEEL 1KYOK 3KPSD 5J56B 4MS8C 1QVOB 2AJVH 1RULL 2VC2H 2ENYA 5DQ9A 1A6UH 4O51A 4XNQA 2NY6B 3IDGB 4U6TA 1KC5L 2VABB 3ZSTA 5BS0B 1ED3A 3O6LL 3NIGE 2R4SH 4IM8A 4EVNB 5BO1H 5CHNB 5DEGA 1MJ8L 1OY3B 1IQDA 1P2CA 5FO9B 3BIKB 2R69H 4Z7WF 3TA3B 3CDYA 4FNLH 4AZ8A 4B7IA 2VZVA 4HFWA 3QUKB 1DP0A 2R4RL 1SJEB 1UKSA 1ZHBA 3MRDA 1Q8MA 1UB5B 3VFOA 4I18A 1ZSDA 1YEIL 5D2NE 5T1DH 3MRJB 43CAA 2VXUH 3GNML 3C5SA 3VGGA 1JPGB 1U3HC 1GIGH 5IB1B 5AZEH 4N9GB 1QZ1A 4ZAKB 5ACMA 2VE6A 4P2OA 2EH8L 1FPTH 4Y1AB 4R7NA 4I5BB 1B90A 5ERWB 1FG2A 4JDVA 3I6LE 2AJUH 4X6BA 4PJXF 1X6NA 1XF3B 3QJHB 4OQTH 4FFYH 4YNYB 1P84K 1LEGB 5E8DL 4L8DA 5I8CB 1DFBH 4GXUN 4LSTH 3PWPA 5F1IB 1SJVA 1JUFA 4LDEB 4P4RA 5DFTA 5HYJD 4D0CB 1IGTA 4HSQA 3S5LA 1HYSC 3O4OB 4JQIL 5FB8A 1RHHB 1RSFA 3S97C 3ZDZF 5ESVB 1KEML 2Y5TB 2RR3A 3KPRD 5BRZB 2A6JB 5EZIH 2JIXD 3GJFB 1FYTA 1BGXL 1U8LA 2YD2A 5EU6B 3TO4A 4JY5L 3HR5A 4DQOL 3V79C 3LHPL 4X8XA 2YUWA 1UACL 3WDJA 1DANU 4R4BA 2OTWA 4HJJL 1PSKH 4OI9A 1WBYA 3TBTA 3PV6A 3MRCB 5CEYA 1KXQE 2DYPD 3LQZB 3I9GL 4PG2A 4NJ9L 4HKBB 4L4VB 5CIPH 4UQ2B 3QIWD 1KTKE 4JPWL 3DRQA 1CE1L 3RZCA 4HS3A 4YAQA 4ZNEA 4LKXA 1S9VA 4JR9H 4PRPD 4WU5B 2Z35A 3VXNB 4XBPB 1YEKH 3TJHD 1XF1A 4JB9H 2N56A 4G8IB 5AYQA 3VFTA 4NWTL 5HHXL 3REVB 4WI3A 5E8OB 4L4TD 5E2WH 3SO3B 3WNPA 5ETUB 3WLWD 2PO6B 4X6CF 5EBWB 3RVWC 2NY3D 2ZPKH 3U79A 2XTJC 5GZOC 1I7ZA 4PG9A 3MOAH 1J8HE 2P8LB 4M6OL 1NFIA 3IDXH 4NQCD 5I17B 3C6LC 4N1EA 3CLFL 4F80A 3MYJA 1MI5E 5DRXB 2OI9C 5LG1A 2P45B 3LZFL 4NT6B 1QYGH 1DE4B 2AXJA 5H94B 3GSQA 1T80A 4Z7VE 4FQHB 5IEKA 3INUH 3OKDB 4WW1B 4DAGL 4DVBB 4WW2C 5C08E 1A21A 4F37K 5C3LD 3AROA 1R6VA 3F7YA 4JGUA 1EEUA 2VZUA 3OKKA 1HINL 3N1PC 5HD8C 2VUOA 4KGLA 5I73C 5BS0E 3O0RL 1KNOB 1TVHB 5GGVH 4N8VB 3V6FA 4XZUA 3FRPG 4UAOB 2R15A 3P9LB 4X99B 3FO2B 1IAKB 1N59B 1CT8A 3FO9A 4AY0A 3KR3L 3QEHA 5I71B 4R3SB 5B22A 1M05B 1P6FA 4EI5A 3AGVA 3S8WA 1GGIL 1NGWB 2HKFH 5SWQA 3EJYD 3WIHA 4L8SB 5GIRB 35C8L 4YO0B 5A3IC 1BHGA 1PDKA 2A77L 2V7HA 5D1ZA 4PB0H 3L3JA 3RKDC 3BAEH 4OLXH 1JZ5A 4PJ5B 1MLBB 2CRZA 4FQXD 3U0WH 3IAGC 4Y1AE 1Q0XH 5C7XH 3BD5A 5I1CH 3PWUB 5ISZB 4RGNB 4NN5C 1MVUB 2JB6B 1MCKA 3KNBA 3O3AB 4LQ1A 3GIVA 5IVZA 4QHKJ 4L5FH 4DUWA 4MD0B 1FFOA 5JDSA 4ETYA 1FFRA 2Q86A 5GRVL 3QPXH 2WANA 2CMRL 5FOBB 2H6PB 3T4AB 1MNUH 1OPGH 5HGGS 5FKPB 2A2QT 3NA9L 4MLSA 5E8NA 4AG4H 1BM3H 1A1NB 1ZEAL 1ADQL 3KDMA 1N6UA 4Q97A 1N64H 5BRZE 3MOQA 3TN0D 2IBGA 3UDWA 5GS1B 3B3IB 3BN9D 3L95B 4X7EC 1C5BL 1JHTA 4Y7MA 3CH8A 2BNUB 3MO1B 4F7TB 5EU6E 3UTTD 5IFHL 3RWJA 1Q9LB 5HHNB 5T1LB 4EDWH 2VKXA 4GW1B 4YDKL 5I1GH 3T2PA 4Z5RB 1TJGL 1JFQH 3QIBD 2ADGA 2Z93A 1RZ8B 3VH8A 4J7RA 3U36A 2JELH 5DVNA 4X7SL 1Q0YL 3GRWA 5B38B 1M71A 2ED8A 5CJQH 3CXHK 5EOCH 3NFPA 4L4VE 1P7KA 3QXDB 1RUQH 4N0YL 4ZTPH 5JUEL 3SOBL 5F7MC 1BVZA 5ILTL 3SE8L 1S9KC 2Z8VC 3WS3A 5FOJA 4OZFG 3VMOA 1U8KB 4OGXL 4DGIH 1T3FB 2F74A 1A1MA 2FHBA 2BMKB 1WT5C 3BE1L 1FAIH 3T0WA 1IGYA 3VD4A 4W68A 1R5WB 1HKLL 2NYYD 5T5NG 2OR8A 4L8BB 2QR0B 2H45A 4Y4KB 1MHPL 1XGTB 1IMHC 4LVOB 3V8OA 5T5NF 2J6EL 4NO0D 3VXPB 5C0GB 7CGTA 1FLTX 5DXWA 4PJBE 4WTWA 1XIWC 4F9LA 4R0LB 1QSEE 3MJ9A 3KYNB 2VR9A 3HZKB 3CPLB 5HYSB 2G2RB 4I0CC 3QDJB 1HQ4A 1EEYA 1X5ZA 4FQJL 5I8KL 4LARH 4LVNB 2HRLA 1YMMD 1MCEA 4JFOB 1AJ7H 1XT5A 5CIPB 2DQTH 2ATKB 3UYRH 5JOPD 4KMQA 4PFEA 4DZ8B 1GC1H 5F6IC 1E4KC 1RJYB 1T20B 3MA9H 1OF2B 2J4WL 3AMKA 3BQUC 2ADFH 1DBAL 2IQ9H 3ZKND 5IMKA 4A6YH 2Y23A 1IGFL 2QLVB 4M3JA 4OZIE 1EZVX 2DDQH 2W59A 2UY6A 4JKPH 4WWKA 2J5LC 1LO5B 4J4PA 1BFOB 1PKOA 4GRWF 4UU9B 4H25B 3WXWH 1A6AA 1TVBB 4UNTA 4CMMB 3QNXB 4ODVL 1HI6A 3UPRA 2VLKD 4PREB 4H88L 1INEL 1TETL 5DA4A 5GGRA 1RUPL 4L3ED 1KB5A 1U2HA 2A73A 1I7UB 3PHQB 1HNFA 2R2HB 3GI9L 4N68A 5FHAL 4YPGA 1JHKH 1BBJA 1U3ZA 1KCSL 2WIIB 1K4DB 4Q9BA 4NC0B 4X6DB 1AXSA 3PJSA 4BZ2L 4D2NA 2WINA 3BZEB 4AIZB 5FCSH 1U6AL 1UZ8A 4YDJA 3N1MC 2DLFH 3OAUL 4YBQD 1JNNH 1UWGL 2IG2H 3PHOA 3LKQB 4QHUA 3FFCE 4AIXA 5D2NA 3MLRL 2UWEF 2BVOB 2CO7B 2HMID 1YDPA 4OZHB 4PJ5E 5F7WC 4ZO6A 4QXGL 1D9KA 3HNVH 2GK0B 1I1AA 5FO7A 4RGNE 3DXAB 1CZ8L 5ISZE 3NAAL 4JM2B 1NMAH 1EEZB 1UA6L 4BSJA 3JUZA 3HC4H 2XN9B 2OJEB 4KI1A 3QP3A 2HFGL 1MFDH 4ALAH 1PZUB 3C8KA 3E8UL 5HI5D 4JJ5B 1F3JB 2JK5A 4GBXA 3CZFB 1I4FB 1FLRH 4GFTB 4X5XA 4BSVB 3GSUA 2JKXA 5D7IF 5FUZH 3VFNA 4ZFOA 1T2JA 1EERB 5HPMB 5EU4A 3ZTNH 4C56D 1MCHA 5HHVL 5E9DD 3NIFF 3EYSH 3FQUB 1AIFB 4YDLC 4APQA 1E4JA 2CDFB 1RUAH 4XMPH 3WO4B 1DQML 3BPLB 3VXOB 5BW7A 4YHNA 3BYYA 4KH2A 3H0TA 3N06B 3AREB 2ZP0T 5B8CA 2GSIA 4C55A 4OAWB 3IVKA 3QA3B 2Y9RT 4V1DB 3N9GH 4Z77A 4MAYB 2WUBH 5BVPL 5HHOB 4IMKC 4NFDA 5E94A 4MD5B 3TIEA 4BQCA 2HJFB 3CC5B 3EYVA 1H15B 3BO8A 5EIQA 3QFJE 1TJIH 5FYKD 4MZ3A 5E5MA 5MP6L 4GW4A 4EZMA 3MRNA 4UT9H 1RMFL 2L7UA 5D7JB 4FABL 3VE0A 1FRGH 4NNPH 1WTGT 1QFPA 5GGUB 1QG3A 2HH0H 1F6LL 3DX6B 1VEPA 1S9XA 4FZ8H 12E8L 1MJUH 3Q6GH 1EDQA 2IPTL 1WAAE 4YX2L 5E8EB 5IEHB 1MREL 4PBXA 1I1YB 1WFUA 4KHXL 5HVHB 1EXUA 4DCQB 3R0MA 3LB6D 1FSKB 3WNLA 5CBAA 1M7IB 4Z9KB 5CD5D 5HI4C 5KVMC 1AGCB 1JF6A 1JNJA 3GZKA 3VXUB 4IMLB 2E6PA 3QDJE 3TNNB 5K9OB 3QUXC 1KOAA 3UEZA 4LSRH 1EMTH 2G5BB 5M95B 1RIUH 1W8OA 1DBKL 5GJTH 1JN6A 4JG0H 5KAQF 4NFCA 1BIIB 4YHLL 3SHSA 1J8HA 1NCTA 4BFBD 5IIEB 1EAPA 4B5EA 4QRRD 2A6KB 4XNMA 5BMFH 4HUUB 4BJLA 1MI5A 3MJ8A 2VL5B 1CR9H 2Q3ZA 3RI5K 3WN5B 5KSUA 4Z7VA 5JR1L 3CFKB 2HT4D 4Z0BH 3UTSB 3P77B 1CFSA 1IL1A 1TITA 3VFSB 5BZDA 1MQKH 5B39A 5J57B 5JXAH 3KLSA 5TE7L 5C08A 3RVVD 2D9CA 5IQ7H 4XPGL 3VFVA 4MJ4A 1G7IA 2ADIA 2R9HD 2HVJB 1Z9MA 2AGJL 5DQJA 1F58L 1QVOA 2ZCKL 1BVKB 2VB5A 1KIRB 4P4KB 2VABA 4OLVH 4WUKH 4XCCH 2MQ0A 5BS0A 1OL0A 4HUNB 2JB5L 4G3YH 5EH1A 4DEPB 4FQLL 3OZ9H 1MUJA 4X6DE 2EKJA 4JFQB 4XXCC 4EVNA 4OD2B 5CHNA 1UCBH 1BOYA 3LKPA 5DDHB 3V7AE 5FO9A 3BIKA 1TZIB 1NMCB 4KRPD 3TA3A 3TC9A 4YLQT 1QACA 2A9NH 1MAML 3UO1L 3QUKA 3DTXB 2CR6A 1FFNB 2F53D 1SJEA 4TPRL 1UB5A 3LAFA 2FBJH 4MXVF 1X5YA 4A6YB 4ODHH 1G7PB 3P73B 3UYOD 4MNQE 3VWJD 4OZHE 1YPZE 3MRJA 4OF7A 3TH2T 4OIAA 1I3UA 5TPWH 3P4NA 5FUOH 5IB1A 4N9GA 4HWZB 3ZE1F 3DXAE 3U4AA 4Y1AA 5C0AE 4I5BA 5IFAH 4TSBL 5ERWA 4QTIH 1TZHB 4NIKB 1YEHH 1NPUA 1CVRA 1W0VB 4NUJB 2BFVH 3QJHA 1Z0NA 3EOAB 5B21A 3O45B 4YNYA 1LEGA 2NY2D 4M7JL 5I8CA 3VDBA 5HHMD 4P46C 4TOYH 5J7CC 1Y18B 4RISH 3VA6A 1TFHA 2R1WB 5EU7C 5I1HL 1ZVYA 1BWWA 1PG7L 4D0CA 4LAQH 5JXEA 4HIXL 3EYFB 1S3KH 2D03H 3BWUC 3HE6C 4Z7NF 4YXKL 3WS6A 1L7TL 3IJYB 5E8PA 5ESVA 2Z31A 1WZ1L 2Y5TA 4M93B 5BRZA 3F65A 4JO4H 1P9MA 2A6JA 1A4JA 4HMEA 4K71B 1CFNB 4OM1L 2X1OA 3GJFA 4OD3L 4JN1H 3QAZC 4WI5A 5D93C 3RIAF 3TH3T 2BCKA 2PN5A 3VDAA 3RX5A 4O4YL 5E00B 3V0AC 5EU6A 4H5SA 3HB3D 1OHQA 4MHHI 3RUGB 3VRJB 1KIPB 1L0XA 5ICYB 3MRKA 1IZJA 3OKOB 3ZYOA 3SDXB 3WDIA 4TSCH 4KUZH 2ZUYA 3GBNH 3MRCA 4M8QB 3DX7B 4OD1L 4ISVB 1OAYH 5GJSH 4B41A 3LQZA 5C92A 4R4ND 3EDJA 3IU4L 4L4VA 1CCZA 4UQ2A 1H8NA 4KI5D 5SWZD 2DKMA 3MBEC 1EBPA 4RDQF 4LHJB 4M5ZH 5HDBE 2WZPD 4WU5A 3ARUA 3IB4A 4ODWB 3VXNA 4XBPA 1F6FB 3CFDB 2FCBA 3X3FH 3IS1X 4G8IA 1QRNB 4ONGH 1ETZA 1RZ7L 3MCLL 2R0WH 1CU4L 1QFUL 3REVA 1OP9A 2PTTA 5FYJU 3MRQB 3MLXL 4Z7QF 1CICC 2LTQC 2EXYC 3BSZL 3VXUE 4S1DD 4I1NB 3MODL 5ETUA 3VA2C 1IEAB 2PO6A 2ZJSL 1QSEA 4Z8FH 3BKYL 5JIHA 1GGYA 4WY7L 1YEGL 3X13B 4N9OB 3MLZL 4QRPD 5A2JH 3DUSA 4KVNL 3NOIA 1ZWIB 2P8LA 4R97C 2AJ3B 5ID0B 2EC9U 1DVFD 5TE6L 5I17A 1CDCA 2C4FU 2ICEB 3P4MB 4AK1A 5DRXA 1LO0L 2E7CA 3GHEL 4P23B 4NT6A 4P5TC 3VG0H 1DE4A 2XIDA 3CSYB 2EZ0C 1GHFH 3QIUC 3UTSE 4K2UL 4FQHA 2AABH 4AEEA 3HS0B 3OKDA 3DETC 4WW1A 4DVBA 4P2RD 3W0WB 3P30L 1T2XA 5HDQL 3U7WL 3BW9B 4HQQH 4KDVA 4FXLA 4WDIA 5E08H 4I2XB 2VISB 1SMOA 5IBLD 3B2UD 3L3DA 3A6BH 1OTTD 2MJWA 3WLBA 4YHOL 3JV4B 1Q9WB 3OKMB 3G5YB 3P9LA 1P4BL 2ZKHL 3FO2A 5H37G 1IAKA 4JCLA 2DJUA 5EBLB 4PJ8D 4WCYH 4R3SA 4Y5VC 4OCMC 1M05A 3QEGL 4HZAA 4TNVF 2MPAL 1NGWA 2P42B 2EE9A 1SM3L 2HRPL 3ULVD 3BP7B 1IGML 1EA9C 4L8SA 5GGQL 5GIRA 3EHBC 4YO0A 3G9VA 1GL4B 3FFCA 1U8HB 4RA3A 4PJ5A 1MLBA 3ZHKA 5DT1H 3I02A 4F7EA 4IIQB 3NCJL 2VWEE 3PWUA 5ISZA 1MVUA 4OCWH 1IT9L 3GSOB 2JB6A 4W4OA 5C70A 5J3HC 4ODSH 2FYYB 3TJHC 3TPKA 3L3IB 3JWDH 3VRIB 5I1KH 2XXCB 2MFNA 4MD0A 3QISA 1KCRL 3ISWA 5LXGL 4UDTB 5J4MA 2H6PA 4Z6AT 2VDML 5EWIL 15C8L 4DK3A 3T4AA 4LSQH 4IRJD 4HPYL 2VQTA 4IS6B 1A1NA 4WHYH 2GITB 1M7XA 3AM8A 4KZDL 2VLRD 2EIEA 4IDLA 2IANB 3B3IA 5GS1A 1J10A 3L95A 4UV7L 1CLOL 2BNUA 1AE6H 5A1AA 2ESVD 2Q76A 3RUGE 3HAEG 1Q9LA 3ORJA 5HHNA 5T1LA 3WSQH 3NIGF 4XPTH 2NNAB 3SDXE 3SDCB 5IB2B 4Z5RA 2EH7L 3T0ED 4UUJB 1I8IB 2F5BL 1RZ8A 5FGBC 2NY7H 3QFJA 3ECBA 5B38A 5IW1B 3SKJH 1I9IL 3QYCA 4NSKB 2H2SC 4ZMAT 1WIPA 3F7PC 3TFKD 3ULVF 1CS6A 1A7BA 3GO1L 5ACLA 3CXDL 3O9WC 1KCUH 1U8KA 3WD5H 1LWRA 1T3FA 4IHOA 2PR4L 5T5FL 1IILE 3HCVA 1AC0A 2P5WD 4OGYL 4FMKA 1QRNE 3KXFB 1WAAA 5ICZB 3NACL 3QR2A 4L8BA 2QR0A 3ARGD 1NCWL 1XGTA 3VXPA 1WIOA 2D7PA 1X5FA 1IC5H 5C0GA 3BP4B 2EIBA 4QHMB 5KJRL 5I9QB 4R0LA 1PG7W 1WIUA 2WK2A 3KYNA 3BJLA 1JNLH 3HZKA 3CPLA 5HYSA 2G2RA 1HDMB 3H3KA 3QDJA 3ZT7A 3QT2A 3CNKA 4Y2DB 3BPOB 2MHAB 4FQXC 3B8YA 4LP4A 4EXPX 1BIHA 4JFOA 1AY1L 4P5MB 2I07B 1Z3GH 5CIPA 2C4XA 1KF9B 3L1OH 3C2AL 3MFGB 3MV8D 4G9FB 4DZ8A 3VGDA 1D5BA 1T20A 32C2B 1MIEL 2Z91B 3MBXL 3RU8L 1OF2A 2VLJE 1YC7A 4LU5H 5JHDB 3TZVC 2QEJA 4PJIB 4YWGH 1HHGB 3W0WE 4HWNA 4H26B 1DLHB 1CQYA 1LO3L 4KV5E 4I2XE 4UU9A 4H25A 1TVBA 3QNXA 2ZG1A 4PREA 4IDJL 5MENE 4FFZL 1JPTL 2X9WA 4LSPH 1YQ2A 4DFHA 5E2UL 2X89D 4S0TD 5C09B 1I7UA 3PHQA 4LDLB 2R2HA 3PL6D 5AUMB 2Y06L 1H3TA 2DQIH 2VZTA 3B9KD 1P1ZA 4NKQB 1YECL 2WIIA 1K4DA 5D96B 4X6DA 5C0RL 1HWHB 5D72L 1JWUB 5EUOB 3EOTL 2MOVA 2VN4A 2W65B 5E4EB 3BZEA 1C7SA 4DW2H 4RCAA 4L1HA 1FVEA 4OGAC 4XPHH 4JLRA 3O2WL 4HGWB 3UJJL 4EQ3A 1NBZB 3LKQA 4R7DA 4D3CH 3P3YA 1LEKB 2BVOA 4MNQA 4X5WA 4OZHA 1YPZA 3I50H 2DWEA 4M6NH 2EE2A 4K07A 3BN3B 1ACYH 2GK0A 3DXAA 3DYMA 1XGRB 4JM2A 5DMJB 2D31B 4YDIL 3V6OE 3WCYA 2BSSB 5C0AA 1CTNA 2DICA 1BJMA 4OLWH 4X4ME 5FK9A 1KULA 3RY6A 4JJ5A 1P69B 4LP5A 5C07B 3D48R 25C8H 1UVQA 3ZHLA 2ZSVB 3MYZA 4FXGB 1F3JA 1AFVL 4JFZH 4Z7VF 3CZFA 4WO4D 1I4FA 1FZJB 3DURA 3WJLC 5FUCC 4RFOH 5HPMA 1P4LB 3CAFA 3QDHA 5EZOH 5AYUL 2X40A 4JO1H 1U2CA 3SCMB 2XZZA 1DSFH 1LE5B 3FQUA 1NEUA 4JPVH 3NGBB 2CDFA 5GGRY 1EX0A 3BDYL 3DWTA 1K85A 3GK8L 3VFPB 3VXOA 1BZ9A 3GMLB 5K9QG 3AREA 4NQUA 4LLWB 5DZOA 5T3ZD 3UX9B 4OI7A 5DJDB 3QA3A 1INDH 1CGTA 2PW2B 1V3LA 2EDRA 4MAYA 3ZKNC 3ILQD 1HSAB 4S0SD 4UTAH 3ESUF 4B0MM 2HJFA 1JGUH 3CC5A 1H15A 2VXSL 3MRGA 1JL8A 1N2RB 4QKXB 2YN5A 1OGTB 3QCTH 1VENA 4K9EL 4I0PA 3HI5H 5D7JA 1AKJA 2X10A 4XGZB 3WIHL 4YFEA 5GGUA 4ZDHB 4ONFL 4XBGB 2BNRB 2G60L 3DX6A 3QDGE 1QBML 4R90L 2FB4H 3CMOL 3O6KH 4NZRL 4OF3A 2EE3A 4S1QL 5BV7L 3KXFE 3LOWA 4BZ1H 4PGDB 5E8EA 5IEHA 3SDYL 2CJUL 5CP7B 2A1WH 3VXSB 4DCQA 1FL6B 3O41B 1T03L 1M7IA 1MJ8H 2B1HH 1LMKA 4F7PB 4OKDA 5K9JL 1EJOL 4I18C 1U8IB 1V7ML 3ZTJH 1PLGL 3VXUA 4IMLA 3UP1A 5K9OA 2J8OA 2HMIC 3S36X 1YY9D 4JANB 3W9EA 5DHXB 2G5BA 1TZGH 4P2OC 1N6QH 1UM6H 2VSCA 1IARB 3U0PA 4LLMB 5F6HJ 4NKMB 1B9ZA 1HHJB 2OTPA 2A6KA 4G9FE 4HUUA 1A9EB 2EEDA 2EH8H 1DBMH 3ARWA 5GGSA 3FMGH 2VL5A 1ZHLB 5JHDE 3WN5A 1Q94B 3DO7B 1DUYB 1MCCA 2P24B 4PJIE 4U0QB 5HI5C 2CIIB 4O9HL 3RNKB 3UTSA 3P77A 3DGGB 3L3HA 3VFSA 3V9FA 4HKXB 5E8DH 5HVWA 5FGCB 1VGEH 3ZDXE 4PJHB 4RWHA 4NKDA 2HYMA 2FHFA 3D85D 4XBEH 3S9DB 2XA8L 2LU4A 4N0UB 3H9ZA 5GGTH 5MERB 5D8JL 2HVJA 3DIFB 3WFHB 4DZBB 2VDRL 1BVKA 3SDDB 2DQEL 1KIRA 5C09E 3QQNA 4KMTL 3GRWL 2IH1B 1N7ML 3NFNB 3NFSL 3U7YL 1MFAL 4Q7DA 4LF3A 4YQXH 3TO4C 4OD2A 2FLRT 3BRFA 5I1JH 4PTTB 5DDHA 5EUOE 5J12B 1BGXH 2LU7A 4FN0A 1AD0B 4H20H 1BPVA 4DQOH 2V17H 3DTXA 3FN9A 1FFNA 2B1AL 4CADB 4PG2C 3V52L 1G7PA 1KT2B 3P73A 3TH4T 1H3GA 1HOCB 5JQ6H 1U93B 4PJBF 1ITCA 3RZCC 2X4NB 3BISA 4HWZA 3MJ9L 1NL0H 4GH7B 1MCLA 5GRVK 2ZNXA 1OGAD 3LRSB 4JPWH 1CE1H 1II4E 1TZHA 2CUIA 1EUUA 4NKOB 1MJ7L 4YR6B 5DD6B 2QHLA 4HK3N 4WEBL 3EOAA 3SGEH 3GMOB 4XC1L 1Y18A 3EO1B 3LEVH 4R2GD 1BFVL 4KRNA 3BZ4B 2R1WA 5HHXH 4WU7B 2X1QA 4OZIF 5LWYH 1N5YL 3EYFA 1FZMA 5EO1A 2DQUH 2QHRL 5F96H 2DIAA 1HHKB 4J3VA 3O3EB 2AXGA 3B8SA 5GHWL 1CFNA 5KSAD 3IXAB 4M6OH 5I8EB 5E00A 5C0CD 1KB5L 3BKCH 2HWZL 3RUGA 3VRJA 2C7UB 1EHAA 4LGPB 4EN3A 2B5IC 3LZFH 2MWCA 5ICYA 4CAGA 5T1KB 3OKOA 1PY9A 4EXKA 3SDXA 4Q2ZB 4H8WC 2IPUK 5KVDL 4M8QA 3DX7A 1U3JA 2XTJB 3O3BB 3IF1A 4G80B 3MLSH 4AM0B 4JVPA 4W6XB 3TBWB 2EC8A 5FYJD 1OAZH 3C6LB 3S37L 2BNRE 1YNLH 2IFFH 2YD7A 3DROB 3T2NL 1Y6KR 3RAJH 2XPGB 2FIKB 4ODWA 3V7MA 3CFDA 4OLYL 1FH5L 3IKCA 1F4YH 4CRPA 4P2QD 5DJYA 4L8CB 4EI5C 1QRNA 4WW2B 1NANH 2J8UB 5IW6B 3MRRB 4K9EC 3DHJA 3UJIH 2GT9B 2VUYA 3ALXA 5E4IA 3KR3H 5LGHL 2PNDA 1HZHL 2BZDA 2G75B 4YUEH 2LV4A 5D1ZC 1GGIH 5L88H 1IEAA 2XKUA 4G6KL 4TVPH 5BV7C 4NQDB 3QEQB 3X13A 5DD5L 4Q9QL 2VKWA 3VJ6B 1IEHA 35C8H 5IF0B 4ZFOL 1ZWIA 4C59B 1QP1A 4G7VL 4R26L 3L5JA 1IFHL 4YFLI 3P4MA 4HKZB 4HS8L 5AWNH 3GB7B 4P23A 2VH5L 1I8LC 3CSYA 4P3DA 3V4VL 2VL4A 1JZ8A 2VLJA 3SDAD 1OTSC 1FNEA 3HS0A 1SEBB 4OJFL 4JHAH 4WEUD 3O4LD 5F93C 4H1LA 4K3EH 3W0WA 5FGCE 4XP9L 1RZJH 4PJHE 3BW9A 3QI9B 4LQFH 2ZZUT 1RUKH 2AKRB 4I2XA 4N0UE 3S34L 4YXLL 4L9DA 3WFZA 3L5XL 2VISA 2FD6L 3LIZH 3T4YB 5MENA 4BH7B 3O2VL 3UDWC 4NN5B 5FFLA 3JV4A 1S5HB 4X83A 1DQDL 2X7LA 3OKMA 3G5YA 2X44D 3ZE2E 5EBLA 1C5BH 3HB3C 1A7RH 2EYTA 2YN3A 1O7VA 3HNTL 2X05A 3DRTB 5IFHH 1WAAF 1T1XA 2YXMA 4NZTL 3WFEL 1L7IL 4X98B 4QXUH 1MF2H 4Y5YB 2NQCA 4PD4J 4R4NC 1OP3K 4OM0L 1U8HA 1Q0YH 5CFHA 4K3DH 4XTRD 1A14L 2R29L 4MJIB 4CNIB 1PGRB 4IIQA 4OLEA 4UIMB 2MCPL 3V6OA 3D3VB 3GSOA 3RGVD 1BF8A 2FYYA 4I0KA 3L3IA 4OGXH 3VRIA 4XH2B 4KFZC 4X4MA 4TVSa 2EO9A 3OAYK 2DQGH 2MTPA 3BH8B 4JFFB 1RI8A 4F9LC 4UDTA 1UFUA 1BJ1H 4QT5B 4HS6A 3ROLA 4JG1H 1AGBA 1OW0A 3DBXB 4HIJA 2GITA 3WNNA 3VXMD 4LOUC 4R4FL 1NGQL 2VQ1B 5I8KH 4NZJA 1JZ4A 5F3BB 3BOVA 3S7GA 1MCNA 5IBTH 1ZA6B 4TTDD 5KG9A 4UBDD 3OR6B 1A7PH 1P5VA 2YD8A 3NH7L 5GRWA 2EDKA 3B5GA 3WYRA 4WWKC 2NNAA 2Z0BA 4X6DF 3E3QE 4J4PC 1XIWB 1I8IA 4UUJA 2J4WH 4OCNC 5I16B 5GRUH 4U6VH 1B0GB 3CVIH 1IBGL 2W91A 5IW1A 3MRHA 4HKJA 2XWTB 2DQHH 3QEUB 5FF6B 1ZVSB 1P7HL 3MRBB 3B2UC 4ODVH 5J9PA 1YPZF 3QXWA 3ZL4L 4KK5D 5F88B 3NN8A 3D6GA 3OR7A 2W60B 5F6IB 4HGKC 4PV8B 3QDGA 3GI9H 2AV1B 4JM2F 3KXFA 4PJ8C 2J8UE 4PBWD 5ICZA 3FTGA 3MLYH 1W0YT 2Y6SC 4AYFA 5E6YA 5DLML 5CS7A 2Y4SA 4KK9C 3VG9C 4QHMA 3TVMB 5AZ2L 3ULVC 5D2NC 5I2IB 1OTUC 1FC2D 4KKCC 2PYEB 4RFEA 4NQDE 3QEQE 2CLRA 5HYEA 3JWOL 1HDMA 1D9KC 2VLMD 3OAUH 1IEBB 1HIML 1INQB 1T7XA 1UWGH 4Y2DA 2BC4B 2YD3A 2MHAA 3M17B 4F15C 5IBUG 4F58L 4RZCB 2PXYA 4QXGH 4P5MA 5E1AA 3MACL 2I07A 3LD8B 4HEPG 3HE7D 2HKHH 5JA8B 1CZ8H 3FQXB 3VGEA 3NAAH 4G9FA 1Y6NR 4QNPE 4XP5H 2Z91A 1IGJA 1OAUH 4GBXC 5JHDA 4PJIA 3VCLB 2A0LD 1HHGA 2HFGH 5DD1H 2YRLA 4H26A 1DLHA 2K7QA 3OKLB 1LO2L 1E4WL 1Q1JL 4ERSL 4AEHH 4TRPL 4IRJC 3D69B 4APQC 5EORL 3OSKA 3QZWG 5HYQB 1WBZB 3BMVA 4M43L 4DGYL 2JJTA 3TESA 3FB7B 3DNKA 5HHVH 3OAYH 2CGRL 5GPRA 3QQ3A 5C09A 1YN7B 2H1PH 1Q72L 4NC1E 5ENWB 5AUMA 4YHMH 5F7YC 3W9DA 5JW3L 1DQMH 2VMFA 4KUCD 3S96B 5HDBF 4MA3B 1RJZB 3FB8B 4RSVA 1NDGB 1JWUA 3LN4A 5EUOA 4LCWE 2DBLH 2W65A 4LCIL 4IEFB 4LLVB 2J7LA 2B8OT 2PYFB 2LE9A 4KU1A 1S7TB 1D6VL 3RL2B 2Q7NA 4Y4HD 1FP5A 5L7XL 1H3UA 1NBZA 4YDLB 1LEKA 4OLUH 3W11C 4OLZL 5MP6H 4MJIE 2Z8RA 2FX8H 4NCDA 2YXFA 1U8MB 5HXMA 1WGOA 1XGRA 2D31A 3D3VE 4PJDB 3CZJA 2BSSA 5L2KD 4ZUVB 12E8H 4HGMA 3BKMH 3QHFH 3CGTA 3TYGL 4LCYB 3DUHA 2R23B 1HH9B 1TXKA 3IDIB 4FMFA 2ZSVA 3O81A 4FXGA 5F44A 3V95A 4Q9RH 3SGJA 5I1EH 5J13C 1A6ZB 1FZJA 4F37F 3RIFF 1JGDB 5F3HB 3TBYB 1OSZA 4EOWL 4RX4A 4P3CH 6FABL 3RP1A 3BWAB 5HHPB 1A6VH 3SCMA 2F58L 1LE5A 1CLZH 4ZS7H 3RWHB 5IKCB 1FL5B 4NPYB 4O2EB 4B53A 5I6XB 5T3XE 5M7QA 1QLRB 3HI1B 1T6VN 3VFPA 1XGPB 2X9YA 3GMLA 5CLTA 2E6QA 1KBGL 1UWEL 2PW2A 4O58H 4LHUD 3AMLA 3MV9D 4CVXB 2M1KA 1HSAA 3FL7A 1MPAL 4XP6L 3N85H 5JR1H 1YN6B 4LRNL 3QUXB 4NDMB 4LFHD 2I25N 3MXWL 1OGTA 1HQRB 2XY1A 5GS0D 1HCVA 1RZFH 5CSBA 3V2AR 3PWLB 1F2QA 4J3WA 1YJDL 4ZDHA 4DWHA 4NO2B 2BNRA 3B43A 3HA0A 3QRGL 3CDFA 4RMVA 3PL6C 1F4WL 4N90E 5B3JE 4BSWB 1CN4A 4PGDA 1XEDA 2OQJB 5CP7A 5GGVY 1FL6A 3O41A 1WF5A 4F7PA 2AJVL 2VC2L 4OFIA 5D1XB 3JVGA 3TM6A 1U8IA 3S3SA 2PYEE 3ARXA 3UO1H 1KPUB 3TT1H 4OBSA 4PBVC 5F7LB 4YBLB 3CX5K 1FN4B 1NGPH 4JANA 2V2WB 5SWSD 1EH9A 1OP5K 1NGZA 1A5FH 4FNLL 1HNGA 1T83C 4MQ7B 4LLMA 4P48A 1I8KA 4NKMA 3VDCA 1HHJA 4PJCE 3OJDA 3GSVB 1A9EA 3VWKA 1JP5A 4UZGA 4UB0H 2GW5A 1ZHLA 2P5EB 3QRFM 4TSBH 5T1DL 5EC2B 1Q94A 3DO7A 1DUYA 2D9QB 1NUNB 3JWOC 1NDMA 2VXUL 2CIIA 3RNKA 4K3JH 3GGWB 3RY5A 1GIGL 3DGGA 3RUGF 1AP2B 1K3IA 4HKXA 4K7PY 1GJIA 2W9EH 1VB9A 5JXEC 4XNXL 4JVWA 4K3HA 5TH2A 3SDXF 2ZOLB 4MVBD 4PJHA 5L2JB 4U1MA 3O4OC 1ND0B 3WS6C 4LFHG 4GOSA 2AJUL 4N0UA 3ZKQD 3CLEH 1LILA 1PG7H 2Z31C 3DIFA 5FYLD 3WFHA 4DZBA 4JPKL 4F8QA 1P9MC 4HIXH 3SDDA 4Z7WB 2AK1H 4TVPE 3RRQA 1QFWH 1I3VA 4NM8H 4WFHD 2IH1A 3NFNA 4M9PA 4YXKH 1V05A 3SBWC 3U30C 4PJ9D 1EIBA 1WZ1H 1URLA 4JZOB 5DTFB 3D5OF 4PTTA 2F19L 4P46B 2YUXA 4KK8D 1JYNA 2YPLB 1EFXD 4YK4C 1YQVL 1AD0A 4XMLH 1FZOB 1D5ZA 3OKEB 3ILQC 3RVTC 3B6SA 3TJEH 4PP2A 1S7UB 2E8ZA 4CADA 2HVKB 2WSKA 1JI1A 3FFDB 1HOCA 2MCG1 2X70B 3QWRA 3D39B 2H41A 4UOJA 2X4NA 4OD1H 3HKFA 5D93B 3IU4H 4PJDE 4JFDD 3VI3E 5LBSH 1P7QB 4HBCL 5GS3A 5DMIL 5GGSY 4NKOA 4ELKB 1AR2A 5DD6A 4YR6A 4NHCL 3VFGH 1NFDE 3MA7B 3GMOA 4H1LG 3EO1A 4OZFH 3P11H 3SGEI 3SO3C 4JR9L 2PO6C 4WU7A 4LVHC 3DVFA 1U91B 3KPSB 3C9NB 2NXYD 3LS5H 3BSZH 4KV5F 3MODH 2ZJSH 3FZUD 1F97A 1HHKA 3FCTB 3O3EA 4KTEH 2DLIA 4DUXA 2GKIA 1J0IA 1KXTB 1XCQB 4D0DB 4P57B 1K4CB 3IXAA 5E2WL 4LIQE 5I8EA 4AEIH 5TE6H 5T33L 4QO1A 1TNNA 2WWKO 3KPPB 2YPKB 4Y16D 2C7UA 2APVA 5HSFA 2ZPKL 5BJTB 3ULSA 3S3JA 2MSPA 2JLLA 3QHTC 4Q2ZA 4CMHC 3VFWB 1OP5H 3IDXL 4FP8L 2F5AL 3EBAA 1AR1D 3EOBB 3QG6B 3O3BA 1QYGL 4AM0A 4S2SB 2ZNWA 3TBWA 1IKNC 3LMJH 5F89B 4QWWC 4GSDL 1PG7X 1BVLA 3INUL 4D9LL 3DROA 2OLDA 5KTEL 2XPGA 5I18L 2FIKA 1M7DB 4ZXBD 4I9WD 5CGTA 1TNMA 1I3RB 5D6CA 4L8CA 4X6CB 4OCYH 4ZG1A 4WW2A 2ZKHH 2J8UA 3HC3H 4H0HB 2P4AB 3MRRA 4PJAE 4G8EB 2DI9A 2CRYA 2GT9A 3NCMA 5HYJB 4L8SC 1VFBB 1YJDC 1NANI 5A2LH 1NLDH 3IRZA 4OF8A 2G75A 5GGVL 4DKDC 3HNSH 4CBPA 3HPLB 4QTHB 1IVLA 3PQYD 3STBA 2X4QB 4NQDA 3QEQA 4MJ2A 3VJ6A 1GGCL 2ARJB 4HLZH 4X9IA 2JIXB 5IF0A 1IC1A 2NX5E 4RGNC 4RMRA 2DD8L 3VXRD 2XACC 3OB0K 2EICA 4W4OC 2HKFL 2C1PB 2MQCA 5DEZA 2EDNA 5JPNB 4HKZA 3Q3GB 3QHZL 4U1NB 4KJPD 3NCJH 4Y5VB 3MCG1 4MMXC 5CEZD 2NZ9D 4OLXL 5DZNA 4YGAB 2HT2C 2J3SA 3U0WL 1QSFD 1Q0XL 4NGHH 1KCRH 3QI9A 4DKEH 3RWIB 2AKRA 2OMNA 3FT2B 3WNOA 4K7PL 15C8H 3AM8C 1W8NA 4GG8B 3T4YA 4PRPB 4L5FL 2EDJA 1ZAGA 5F9WC 5HI3C 5KANI 1S5HA 5CMAB 1MFNA 4RBPK 3QPXL 4MB4A 1YEDB 5KVGL 3KLHD 3FB6B 1MNUL 2NY0D 2K3TA 3TLRA 2YPLE 1UADC 4AG4L 1CLOH 1E28A 1BM3L 3Q5OA 1KFAH 3U83A 4LCWA 1N64L 4L4TB 4KK6D 3ARFD 3MV11 2D2OA 4M7LH 2NY3B 4X98A 1H5BC 4ZPVB 5CJ5A 2AK4D 4Y5YA 3W39B 1F02I 3D39E 2BVPB 4HC1H 1OCWL 4EDWL 3B9EA 4NQCB 5I1GL 4MJIA 1Y0LB 4CNIA 1JFQL 5GGTA 4UIMA 1RK0A 1YEFH 3QUYD 4M5YH 4TNWK 4U1IA 3MLPA 3GO1H 2JELL 3CXDH 3D3VA 1G84A 2ID5A 4OFYA 2PR4H 4XH2A 5CJQL 2IF7A 3K74B 5EOCL 2D7MA 2DLHA 3IFOB 2V2XB 2X2YA 4XAWH 3KLAB 3RI5F 1HSBB 2HLFD 5ADOH 3ULUD 4R0LC 5D7KE 4PGJA 3QNZB 1JV5A 4PJIF 5C9JB 2W38A 3KPSE 1FAIL 3MUY1 1GZQB 3DBXA 5KJRH 4N5EC 4LVNC 3O9WB 3RIAK 4XB7A 3ZDXF 4M7ZC 2BY3A 1I9RL 5IB3A 4XPAL 5EZLA 5F3BA 1E6OH 1DJSA 4LPUA 4ZOAA 2C9AA 1ZA6A 3OR6A 1AY1H 1NCAH 4YFLF 1FE8H 3QWOB 4D8PA 2UUDK 3C2AH 4EDXB 1CDIA 5BXFB 4O02H 4WTZG 1XIWA 3DLQR 4E41D 5EUOF 5KN5A 5I16A 1D3CA 4X0KB 4YEFA 1WC7A 1B0GA 2VIRB 1FNHA 2DQTL 4DTGH 3I75B 3OB0H 3UYRL 3TCLB 5FF6A 2XWTA 3QEUA 4OZFB 4FQXB 1G9MH 1GC1L 2HJKB 1OAQH 3MRBA 3MA9L 4OSUH 4FFZH 1JPTH 2DDQL 4JKPL 3FAXA 3P4OA 3K3QA 5E2UH 4RMSA 4PV8A 2NCMA 3MOBH 3KYMA 5GS2H 2AQ1A 5EO9B 3WXWL 2AV1A 1N26A 4NRYB 2Y06H 3RA7H 3STLB 5HYJE 4ZS6C 2DLEA 5D72H 2X4SB 3FN3A 3TVMA 4RBPH 3PP3K 1JHKL 3LS4H 2PYEA 2KL6A 4LCUB 3KPRE 3TN0B 2E9IA 1IEBA 1KELL 4RWYH 1INQA 2APXA 2BC4A 5EOTB 3M17A 4JM2C 4JHBA 4KQ3H 3LRHA 4RZCA 4ZAKD 3UTTB 3T8XA 2DQFA 1EBAA 4OB5H 3RGVC 2DLFL 3FQXA 1AI1H 1BD2D 4PJCA 2IG2L 4FFWC 4U31A 4YDIH 3RY6C 1JRHH 4FQQA 1CFVL 2DMBA 1R3KB 3QIBB 1WFTA 2AQ2A 5C0DB 1MVFA 4JM4H 2GY5A 3VCLA 3MV01 1S9WB 3HNVL 2H2PD 3OKLA 4LL9A 1NMAL 4M4PA 4X6FB 1CXEA 4KROD 2FJFA 4KGJA 3D69A 3B5TA 4PRPE 4Y4FD 5HYQA 1WBZA 1MFDL 1ZLUK 1IM9D 3FB7A 5IP4A 5TGBB 1YN7A 5ENWA 4H8WH 2R0ZH 1FLRL 4X4YB 1BZQK 5FUZL 1QHOA 4TNVK 3S96A 2PF6A 3LQAL 4MA3A 4MAYC 1RJZA 3FB8A 1EGJA 1NDGA 4NO0B 4L4TE 3EYSL 4QRUB 4X7CC 1JTPA 5I1LB 2PYFA 5JA9A 1WITA 1S7TA 4HIEA 2VRAA 3IFPB 4K8RD 1NUFA 2P8PB 5B3NA 3O11B 2WWMD 4I0PC 5D7JC 2EDEA 1AH1A 3DVNB 2VXSH 4NQCE 5CJOL 5SX5K 1YMMB 3N9GL 4LRIA 2WUBL 2UUDH 5DK2B 3G6DH 2NR6C 4PJDA 5MI0B 3GSXB 5D7IB 1TJIL 5HVHC 1M1SA 2G60H 1FSKC 1VKXA 4PTUB 3T0BA 3S35H 3BRDA 4OQ1A 4S1QH 1NFDA 2EDQA 4LCYA 2R23A 3MGTB 1FRGL 4NNPL 1HH9A 3IDIA 5E5UB 4TUOA 2EO1A 4BA8A 2HH0L 1A6ZA 2VLKB 1JGDA 4FZ8L 5F3HA 1CGVA 1EJOH 3TBYA 1J5OH 1MJUL 3Q6GL 4MCZB 5HHPA 3IDJA 2HA1A 4L3EB 1JZ2A 4PJHF 1VEOA 5IKCA 1AHWB 4O2EA 4PLNC 5ABDE 3IT8D 1JPSL 4XHQA 2C5DC 4IRSD 4Z7OE 3MLTB 1BREA 1EO5A 3HE7C 4TYUA 3FQRB 4PLJC 3EO9L 1ZHBB 3PP3H 3QO0B 3G5ZB 3LQMA 4I18B 4LSRL 3ZE2F 2ZUVA 1XF4B 4CVXA 3VMNA 3CUPB 5DYOB 1RIUL 43CAB 5GJTL 4JG0L 1ORQB 1YN6A 5JW4R 1K3ZA 1WSST 2XYCA 5ADPL 3LKNB 3IJHB 5BMFL 1HQRA 2UZXB 1BZ7B 1A8JH 1B0RB 1FG2B 1F13A 2IBBA 3TIDB 2YPVH 2FECI 3PWLA 4Z0BL 4X6BB 4NO2A 2DM4A 2VDRH 4ZOCA 1FNSH 2R0KH 1MQKL 2X4RB 5CSGA 3GRWH 4BSWA 3T08A 3NFSH 4XVTL 5IQ7L 2OQJA 3QUMH 1SQ2N 3U2SB 1JUFB 4JFPB 1NAMH 3VRLE 1IGTB 4OV5B 4TUKL 3IYLW 4PJAA 5D1XA 1NC4D 1YMHB 2IFGA 1ZLUH 4G5ZH 4F2MA 4P2YA 5D70H 4OLVL 4C56B 4WUKL 3UROR 5E9DB 4G3YL 1KPUA 5H37H 1CDHA 1MLCB 1FN4A 2VYRE 2V2WA 3CJJA 1XMWA 1WV7T 2YA1A 2A9NL 3UTTE 2VWEC 2NX5A 4XVSH 1UEMA 3FKUS 2Y7QA 3U7AA 1QPPA 5EO0A 2FBJL 3BZDA 4ODHL 4AMKH 3ELAT 4LLAA 2I24N 5EC2A 5SV4A 2OTWB 1WBYB 3WHE0 5HYFA 5TPWL 3RDTD 5FUOL 5CEYB 3SKMB 3GGWA 5SX5H 1AP2A 3S88L 5JOEA 2GK2A 1MWAH 2BHZA 3RWDB 3RVUC 5IFAL 3DRQB 4M6MH 3RL1B 5DC4B 5L2JA 4Z95H 4QTIL 1G7MA 1YEHL 3GMNB 1ND0A 3PE9A 1X4YA 5DVKA 2XFXB 2BFVL 1NCNA 1RZGB 3FHAA 1EO8L 3G5XB 4M93C 4R9HA 1N5YH 4UINH 5JNYB 3BJ91 4K71C 1HKFA 1CF8L 3L3GA 3VFTB 3PGFH 5D5MB 1NCDL 1QFWI 1QR4A 4JZOA 5DTFA 5GHWH 4LAQL 4EN3C 3CFCL 3MJ6A 2VR4A 3UAJC 4P46A 4ACPA 1S3KL 5JIPA 1NKOA 4M1CD 2YPLA 2D03L 3OX8B 3C5ZA 3OKEA 4YXHH 2J8UF 4JO4L 4JN1L 2HVKA 1XR8B 1T0NB 4WGVB 2X70A 3LQAC 1YMME 3D39A 1KGCD 3DV4B 4Y19D 4M3KB 2FEDC 1JTOA 1IZKA 5E24E 5JOPE 3K7UA 1HHHB 3A67H 3GSQB 1RQ5A 1RUML 4OBRA 2IQAB 4TSCL 3RQ3A 4HXBH 4KUZL 3DYPA 2B5IB 4ELKA 3ULVH 4HAFA 1NC2D 3QCUH 1OAYL 5GJSL 4HJGA 4DGVH 2I9TA 1SVZA 2GUOA 3MA7A 3F7YB 5ECJE 1TQCB 4QNPF 3OKKB 4M5ZL 3OGCB 4Y4KD 2R2CA 1TJHH 2VLKE 3IGAA 4D0BB 4CVUA 2M8XA 1EAJA 4Z76B 1U91A 3KPSA 5LGHH 1HZHH 4GMTH 3C9NA 4L3EE 3X3FL 1RV6X 4ONGL 3HFMH 4G6KH 3Q5YA 5DMGD 5MEQB 3FO9B 1XCQA 5FM5M 4D0DA 3QEHB 4P57A 1EPFA 4ENED 4P23C 1BQLL 3VFMB 5C6PB 1IFHH 5SWQB 4Z8FL 3FQNB 3KPPA 2JCCE 1DN2A 2V7NA 5BJTA 2VH5H 3A0OA 2F53B 3EZ8A 4HUKB 2Q8BL 3V4VH 1UYWL 5D1ZB 2V7HB 1QTYT 4XPFH 3VWJB 4E0RB 2PW1B 3QG6A 3I3DA 4K7FA 4MB3A 4S2SA 5MHSD 1GHFL 4ONHB 4YXLH 1GZPB 3H7BB 3GIVB 5CSZB 4LCCA 3LKOB 5INCB 4JKLA 5J06A 1VERA 1ZT1B 4PJ9C 3S4SG 3GBML 1M7DA 3NMEA 2KBGA 4NJAL 2Q86B 5E08L 1DQDH 4HFUH 1I3RA 2NY2B 4YJZL 5HHMB 4M48L 5JIIA 1X6LA 4G8EA 5FA4B 5F9OH 3A6BL 5B4MD 4JFXB 5HYJA 2Q7YB 4EQ2A 4C56E 3EJJX 1ZS8B 2FSEA 1VFBA 3WUZA 5IMMB 2AJXH 3D87B 2XQYK 3HLAA 5E9DE 3BPNB 3KLDA 3H8NA 3HPLA 4NZTH 1OSPH 4QTHA 4HX1B 2X4QA 3KPRA 2ARJA 2EECA 2JIXA 3V4UL 4WCYL 4IIQC 3ARPA 1FG9C 1T66D 3RWJB 3V6OC 4HH9B 4JREB 2QSCL 3ARBD 4XB8A 1MH5B 3BGAA 3AXLB 4OCLC 3S37X 2DM3A 2Z93B 4FQCH 2OL3A 2XN9D 2DLTA 3U36B 3X3GH 3E6HB 2EDHA 5FYKE 2ADJB 3WHE1 4G6FD 3P4LA 3OXRA 3QUMB 5DT1L 1OW0C 2DYPA 1RFDH 1NAMB 1WJ3A 3N1GC 4NBZB 1CL7H 3RWIA 4OCWL 1G9NL 3QIWA 5SWZB 4OTXH 4ODSL 1UC6A 3FT2A 1B3JA 5ALCH 4MLIA 3WDHA 5I1KL 5DI8B 2HT3D 5KZCD 2NMSA 3FRPA 4PRPA 3FZUC 3HUJB 5J8OA 5EU3B 5CMAA 3WIFB 5D5ME 1ZXQA 1T7WA 1YEDA 1UH4A 3FB6A 3H9SD 4R4FH 5CLWA 1QPXA 4Q0XL 1D5MA 4V2BA 1XCTB 3NH7H 3Q0HA 5B3JF 1F3RB 3NIDE 4V1DD 1FFPB 3D0LB 4L4TA 5IHBA 3WFDH 4B50A 5HHOD 3BH9A 1HQ4B 5LCVH 1FL3A 5IHLB 3BVNB 4ZPVA 1IGCH 3M8OH 4QRPB 4ODUA 2BVPA 1MWAB 3C5JB 5E7FA 1A2YA 1A7OH 1WK0A 4NQCA 1DVFB 3WSQL 4XPTL 2CQVA 3JWNC 4QRRE 3OKYA 2XRAL 5FO8B 3DVGB 1Y0LA 2VN7A 2IH3A 2NY7L 3ZL4H 4QHLB 1FIGL 2XV6B 4ZXBC 4LNVA 2QTEA 4RNRB 3SKJL 4XT1C 4GAFB 4OT1H 1L4IA 2VXQH 3IFOA 3KLAA 4PJCF 4POYA 3CU1A 1HSBA 4P2RB 3K2MC 5FGBA 1ACZA 3MLVH 3ZT5A 1FV1B 4KVCH 2C3VA 1MFEH 2ICCA 5I9QC 1FHGA 1RHFA 3QNZA 1KCUL 5E2JA 2GTWA 5DJXA 3WD5L 3I85A 5C9JA 4X80L 5GGRB 4CVZB 4YZFE 4FA8A 5KS9B 1KTLB 1GZQA 4P59L 4W6WB 1EHNA 4Y2DC 5AZ2H 1AD9A 5IHUH 5C0NC 1VACB 1BBJB 2WMPA 4GQ9H 3EFFB 3HG1D 3SPVB 4X4ZA 2PXYC 3JWOH 1V7NL 1HIMH 1IC5L 2WINB 4N0FA 5IGXH 3WHXB 1UJTA 4PJ8B 4QHNB 3B2VH 2CDEB 3B9AA 5KW9H 3HC0B 4DKFL 1JNLL 4YDJB 3QWOA 3PXJA 1KJ2A 4EDXA 2F53E 4RAUB 1GAFH 5BXFA 4F7CB 4QHUB 2ZSWB 5D2NB 1YDPB 1W0WB 4FFVC 3ABZA 1Z3GL 2VIRA 3I75A 3L1OL 1MY7A 4DN3L 3KS0H 3TCLA 1MCWM 2JJTC 4OZFA 1E4WH 4FQXA 4F15B 2HJKA 3EOYG 2J1KA 4LU5L 5DD0H 4YWGL 4F9PA 4FQ1H 4DGYH 3GMQB 4P4KD 5D96C 4JEGB 2BRRH 3NCYP 4YFDB 3SY0B 3IETB 4U49A 5EO9A 3CFIC 5HHME 4NRYA 5E4EC 3QQ9C 3VI3F 4DOHB 5JW3H 1ZLSH 5FCUH 2NY1D 3UZVB 3STLA 2D4FA 3U6RB 2VXTH 4NZUH 2XZQH 4LSPL 4M7KH 3ARFC 1NFDF 2X4SA 4IRJB 1T1YA 2DQIL 4U05A 5TF1H 1D6VH 3TN0A 3H0TB 4NO3A 2VLRB 1JE6A 2I9LB 5DFWH 5HY9A 4P3WA 1VSCA 1MJJB 3EJZC 4QOKD 3RTQD 4A2LA 3UTTA 2ESVB 3KS0J 1F3DH 4HWEL 4U6XB 4XPHL 5E94B 3OJVC 1YZZA 4G6AD 5EPMB 4AIOA 1C8PA 4D3CL 1TTGA 5IHZA 3QIBA 1KEGH 3I50L 5C0DA 2EIZB 5GZND 1MHHA 3SGJC 5D7SH 1JRHI 4NKIL 1S9WA 4G8GD 3V0VB 4ESKA 2RQ8A 1ACYL 1TCRB 2NXZD 2XNAB 1CD1A 3VE0B 4X6FA 1RZKC 4KI5E 2W1NA 5SWZE 5I0ZA 2X5PA 3SCMC 4HWUA 3NGBC 1S9XB 4MNGB 1S78D 5MEOB 4XI5D 3HUJE 5CZXD 5JDJA 5FYKU 25C8L 3FT3B 3O3DB 5TGBA 2P5WB 1UGNA 1EXUB 5CBAB 4W81A 4X4YA 3QUZD 1UM5H 3EYQD 4QCIA 5DR5L 4ORZC 4RFOL 1DEEB 3DARA 3ARGB 3KGRA 1G9NC 3GJEB 4JO1L 4FS0A 2YUZA 4NO0A 1DSFL 3X17A 4G9DA 1KBGH 4JPVL 5I1LA 1H8OA 3QSKB 1AO7D 4XC3L 4HG4K 4PJAF 4QRPE 3IFPA 1MPAH 1JN6B 3PGDA 3L3KA 4BK4A 2F8VA 3DVNA 4S1SH 1EAPB 5DFVC 1YMMA 1INDL 1Y6MR 4HUWB 2IAMD 3MJ8B 1IQWL 3H6JA 4TULL 3K4DA 3MV8B 5KVEH 4MDJB 1AGDB 5KSUB 1JGUL 4Z7VB 4Y5XB 3GSXA 1YJDH 5F21B 5DQDL 4O5LH 4PTUA 2W9DH 2RAMA 1F4WH 3MTRA 3DI3B 4P2RE 3QCTL 5C08B 4NYLA 3HI5L 5JORB 3ET9F 3VFVB 2EIDA 1Q9KB 1R0AH 3ARDD 5FGSA 2FX7H 3RFZC 2ERJB 5DQJB 3TGXA 2VLKA 3GSNH 3QG7L 2W0LA 1JWSB 5KS9E 2FB4L 3O6KL 3OJ2C 5J6GB 4MCZA 4JPIA 4BZ1L 4L3EA 1P53A 1EFQA 4QRTB 2A1WL 1T5WB 1MUJB 3PL6B 4X6EA 2B1HL 1AHWA 3B9KB 1JWMA 3LKPB 4HC1A 5CZVL 3VWKC 3LN5B 1UB6B 3LPFA 3MLTA 1IC7H 3FQRA 1R3LB 4POUB 4KHTH 1JHLH 3QO0A 3G5ZA 3ULVE 2JCCA 1J05B 1XF4A 1A4KA 1TZGL 3CUPA 1UM6L 4GS7B 5DYOA 1N6QL 2FO4A 9CGTA 1NJ9B 1ORQA 3P4NB 3JZ7A 5TDOA 3EKCA 3LKNA 2P8MB 3IJHA 1OQXA 1DBML 4XNXH 2AEQL 3FMGL 1BZ7A 3SDDC 2K1MA 5AAWA 2ZUUA 1X5JA 1B0RA 3TIDA 3GMMA 3H7LA 4MQXD 2JF1A 4JPKH 1ZGLM 2X4RA 2O5XH 2OBGA 1VGEL 5J12C 4DOHE 1FDLH 3U2SA 4XBEL 4G7YH 4JFPA 5GGTL 2DWDA 4WO4B 4OV5A 5DHVH 1IE5A 5FYJH 2F19H 1YMHA 3FAWA 1MELA 4Y8AA 1YQVH 5DJ2B 4C56A 1UM4H 2A6DB 5E8PB 1MEXL 4K8RC 1A3LH 5E9DA 5BZWB 2Z31B 2WWMC 4YQXL 1A4JB 1MLCA 3QBTB 2VLRE 2YKLH 5I1JL 4P49A 2X4OA 4PUBH 3U30B 2BCKB 4H20L 3T3PE 4CJ0A 2ESVE 4H5SB 2DAVA 2V17L 1A3RH 3MRKB 2M2DA 2KZWA 4JFYA 3I3EA 1MFCL 3T0EE 4YK4B 1SVCP 4CUCA 4HBCH 4IBLT 3BP5B 4HJ0D 5DMIH 5JQ6L 5T3XL 1PKQE 3F6LA 3V5DB 1W72H 3SKMA 4NHCH 4WRLA 4CL7A 2NW3B 3CSGA 3BDXA 1WUNT 1NL0L 1I85A 3EYOB 4NRXA 4U1SB 5I19H 1A3QA 2JTDA 3RWDA 3RL1A 3W2DL 3GMNA 1IGIL 5H35B 4MNGE 3FONA 1F11B 2XFXA 1T0PB 4D9RD 1GOGA 1RZGA 3G5XA 2RCSH 1ZK9A 5EB9A 4YDVB 5JNYA 1GRWA 2P5WE 1K2DB 2ILLA 1WZLA 4WI6A 3LEVL 1ETZB 5FEBA 5AD0B 4UDUA 4IRSC 5D5MA 3SGKA 2IAND 2PTTB 1J87A 5LWYL 1B6UA 2DQUL 3OX8A 2BNQD 4AH2B 3E3QC 5LAXB 2FJGB 4PJBB 4HCRA 1DQQB 5T33H 1QSEB 3I84A 5F96L 1S7VA 1U8NA 4LVHB 3SDCD 4YC2C 4GRLD 3NCBB 3DUSB 1XR8A 1T0NA 4BFGA 4FP8H 2BVQA 2F5AH 2FWOB 1LVEA 3BKCL 3DV4A 4FHBD 5DJ0B 1HHHA 3ZMRA 3MV8E 4QRRA 3FT4B 1C1EL 3OBAA 2IQAA 4GSDH 5EA0H 4KKLD 4D9LH 4PJGB 1ZGLB 5KTEH 5I18H 4OZIB 1QHPA 3RIFK 4CMHB 3MLSL 2IBZY 4WDIB 2GJJA 1UH3A 5MEPB 1OAZL 1E0OB 1JJUA 4J3TA 1YNLL 3OGCA 2IFFL 1KYOJ 3D85B 3RAJL 3L3DB 1I9EA 4D0BA 4Z76A 1KLGB 3WLBB 1T4KA 4FXKA 1UJ3B 4KJQD 1F4YL 2HG5B 5GRJH 1A02N 2VSDA 2WBJD 3O6FD 5MEQA 3UJIL 2P47B 1GGCH 4JZJB 2FH8A 3KPQB 2AJSL 1J86A 3VFMA 2DD8H 2FGWH 4YUEL 5L88L 1YYML 3FQNA 4GQPH 3DOSA 4TVPL 3QPQC 3QHZH 3VFRB 4PB9H 3RDTC 2F53A 4XCYB 3CK0L 3QI9C 3FFCB 3VWJA 4E0RA 1EGJL 1BLNB 1F5WA 4F57H 2JJVA 3MROB 2PW1A 1KN2H 3G5VB 5AWNL 3I02B 4F7EB 3RNQB 1X5XA 2K7PA 3GSNB 2HTLD 4ONHA 4BKLA 1OGAB 1GZPA 3BGFC 3H7BA 4XVUD 4K7PH 1S7XB 5CSZA 2EYSB 3LKOA 4NC1C 4JHAL 3AAZB 2GIYA 2ZUSA 1FC1A 4K3EL 5INCA 1ZT1A 1I8LA 1P84J 4U2YA 1RZJL 2OS7A 4LQFL 5GXBB 2FBOJ 2V9TA 1RUKL 4GAJL 4KC3B 5KVGH 1H3WM 1S8DB 3C08L 2D4DA 3LIZL 5FA4A 4ZNCD 4JFXA 2Q7YA 5EIIB 1ZS8A 5IMMA 4Y5YC 2XXMB 1KB9K 3UTOA 3RPIB 1KSRA 1DBBH 4HX1A 4J3SA 2KQMA 5F9WB 1ZHKB 3DO3A 1A7RL 3VD5A 4KAQH 5KSAB 3QQ4A 2Q76B 3ZT6A 1X7QB 5T3ZE 1OCWH 1PYWB 1BQHG 4HH9A 5C0CB 2QQLH 1MH5A 3BHBA 3AXLA 4HXAL 4QXUL 1MF2L 5F9DC 5F8RC 3E6HA 4Z7OF 3QFJB 3ECBB 2ADJA 3HZYA 4K3DL 1GGUA 1H5BB 4WJ5B 3G6JB 3QUMA 4UNUA 5C07D 3PGCB 3BI9X 4LIQL 1ZA3B 1NAMA 5I76A 5DHVB 3VD7A 5SWZA 1L0YA 3GDBA 4IHOB 2X9XA 5DI8A 3TBSA 2BX5A 1CL7I 1I9JH 1TVDA 3HCVB 3SO5A 4QLRA 2CK0H 4XCEB 5FXCH 2DQGL 3HUJA 5EU3A 3THMH 3WIFA 1X9QA 4P2QB 5I66B 4IOIA 1I9RH 4HK3J 1AXTH 5KOMC 4XPAH 1CQKA 3OQ3B 4JG1L 3ZZ1A 2IGFL 3DMMD 4POZD 4LVEA 1H0DB 1XCTA 1FFPA 3D0LA 3GKWH 5DJCB 5EIVA 4UV4H 3LH2H 1N0LA 2Q1EA 3VRLF 3BVNA 2N7AA 3SQOL 1W72B 5IBTL 4QRPA 4M7ZB 1A7PL 1MWAA 3C5JA 3KPOA 2OK0H 5K9QI 4Z0XB 5EOCJ 2B39A 4ODTL 2ITCA 3LEYH 1DVFA 5EULV 5FO8A 3LV3A 4TTGA 1D5BB 3DVGA 4JRXD 1D6EB 1YY8B 5IOPB 4K7PX 4PJGE 2D7OA 4JO3H 5GRUL 3WE6A 5CCKH 4QHLA 4U6VL 4CW1A 1EO7A 3SJVD 3CVIL 3QXAB 3SDAB 4RNRA 2DQHL 5T1MA 3O4LB 5CKGA 4PJ7B 4P2RA 2MNUA 3WFCL 1FGVH 4YGVA 3VXSD 1FV1A 2C3WA 3TVMC 5B4MC 4LK4A 2DN7A 1LO4L 1MIMH 5DWUL 1LP9B 2EDBA 4CVZA 4NO5B 1RU9L 5KS9A 1KTLA 4LPXA 3FB5A 3P9MB 4MS8D 1KIUA 1VACA 1P1ZB 3SPVA 3EFFA 3MLYL 3I2CH 2FIRT 4BQ9A 3LD8C 1EHLL 5C71A 1KELH 3HAEA 3A6CH 5C2BL 4FQIH 3WHXA 4PJ8A 3DX9A 4U3XA 4QHNA 4X5LA 1WWWX 2CDEA 5CBEB 1FVEB 1QFOA 2WQ8A 3HC0A 1XZ0B 4RAUA 4JLRB 1J0KA 3NPSC 4F7CA 3QJFB 4HUMB 4R7DB 4LASH 2ZSWA 4MNHB 1CFVH 4L29B 4MNQB 4X5WB 5DUML 4F33B 1YPZB 1W0WA 4JHWH 2DWEB 3IDMA 2A9MH 1F42A 1KG0B 1KJ3H 2HKHL 4PYHA 3KG5A 1WWBX 4LNRB 4XP5L 1U3HD 1OGAE 5C0AB 5DJ8B 1OAUL 3ETBF 5FK9B 4NN7B 2V5YA 4HUVA 3RGVB 5DD1L 4LPYA 2QADD 3GMQA 3K8MA 3IRPX 2FL5A 3X11B 1UVQB 2HJLB 3EAKA 3SY0A 4KKNA 3IETA 3KWWB 4HPOH 4AEHL 1JVKA 5F7FA 3DURB 3MJGX 3PXHA 4E42B 3LQAH 3U6RA 4PRHD 4OFVA 4PLKC 3G08B 4LLUB 3KPLA 4J23A 3ZYZA 1CGSH 4IRJA 2H1PL 4YHML 3F58H 1FNAA 1RZJC 5IBUB 5TQ2H 4DVRH 1HYSD 2VDLH 3QO1B 3X14B 4LRIC 4AL8H 1BZ9B 3VXMB 2NTSP 2VLRA 1AQKH 5D71H 2I9LA 2MQ3A 2DBLL 3GFUA 3WMSA 2E9JA 4OZ4B 5CJOH 4S1RH 1CLYH 5J0BA 1MJJA 3LPGA 3DHMA 5C0CE 3F62A 2ESVA 1SEQH 3E2HB 4UIKH 4U4BA 4U6XA 4ZTOL 1MCBA 5EPMA 5EZJB 4U3CA 4XAKD 1F4XH 2RGSA 3RJDA 3T0EA 4Z18A 4JRWA 5GRZA 1N4XH 3MRGB 5C0FB 3PABA 2EIZA 4OLUL 1SBSH 3E6FA 3G6JE 1PKQA 3CXHJ 1ADQA 3V0VA 1U58B 1NMBH 5JPMB 2FX8L 4I0PB 2JCCF 1TCRA 3FO0L 1A47A 3QZWB 2XNAA 1AKJB 4Q58C 5FYJE 4MNGA 3BKML 5MEOA 5I6XC 1AXIB 1A64A 3QHFL 1EEQA 2FO1A 4H1LH 3FT3A 3O3DA 1ZT4B 4P2QE 1R24B 2P5WA 4HIIB 4MGXA 4Q9RL 5I1EL 4KKBC 2R0LL 1JPSH 1YUHB 1T1WB 3F12B 1DEEA 4P3CL 3ARGA 3GJEA 1XGYL 1A6VL 2B4CH 2B2XL 1CLZL 4ELMF 4ZS7L 1VADB 3EO9H 4W70A 4YHKL 5T1KD 3S3PA 3W9EB 1T22B 1UXSB 4XHJD 5DMYA 3RVWD 3U0PB 3ZKMD 2EEAA 3ARSA 1DQLH 5ADPH 5GZOD 1JGEA 2DI8A 3LKRB 4O58L 4J12A 4HUWA 5GGSB 3RPKA 3HE7B 3C6LD 3N85L 3MV8A 4MDJA 1AGDA 4Q9CA 3MRLB 4Y5XA 3L3HB 3O4LE 2FECL 4ZUTB 4PJ7E 5D1XC 1DQTA 4XCFH 3NCYS 1TDQA 4NKDB 4XVTH 3CU7A 5IB5B 1RZFL 5JORA 4HMDA 1Q9KA 3UTQA 4CDGC 4JGMA 4JVUA 1CFQB 2QQNL 1LP9E 2OL3L 4TUKH 4QGTA 4YBLC 5HBBA 1JWSA 5J6GA 1ULVA 4NCC2 2JJUA 4QRTA 5HD8D 2X89A 1T5WA 2YD6A 4LF3B 4BZYA 3PL6A 5F1NA 2P44B 4MCYB 2L4OA 3B9KA 1GPOH 3RTQC 3LN5A 1UB6A 5KSBB 3RKPA 4NC2B 2X6MA 1NBYB 4J3XA 1R3LA 3TT1L 5C0EB 5D5MF 1F6AB 1NGPL 1J05A 5D2LB 3LSOB 4KJWC 3MR9B 1NJ9A 1A5FL 3BIAX 5E70A 1KJMB 4JY6B 1HK6A 3NIDF 1BQUA 3S88H 2VZ1A 2P8MA 4WENB 5A3ID 4WI7A 1LK3H 4UB0L 3RKDD 3K2UL 3P9WB 1T83A 1N6VA 4HWBH 4MD4B 4K3JL 4NN6C 1QD0A 5L2KB 1EO8H 3DUUB 4LEXL 1Z5LB 2W9EL 1FO0H 1JMZA 4TNWF 1CF8H 3T04D 5IB4A 4ZPTA 1QSVA 2EXWC 3C5ZC 2DKUA 1NCDH 5IT2L 3CLEL 1CBVH 4WO4A 4PGEB 4WV1C 3CFCH 2AK1L 1FZMB 5EO1B 1QFWL 4NM8L 4M1DH 3U4BH 5DJ2A 2A6DA 5FGRA 5BZWA 2AXGB 4U7SA 2EKSB 3U1SL 3VXME 4PP1C 5JOFB 4PJFE 3SBWA 5BVJA 4JFHD 2HAZA 2IAMC 4YZFF 4XMLL 4WFGD 3TJEL 4EN3B 4Z7UB 4M62L 4GT7A 1RUMH 4PRID 4NUGH 4P9HH 2XZAH 2VDPH 1KCKA 3MV9B 3BP5A 3NBNA 2DTSA 2E9BA 1DUZA 1FVDA 2XKNB 3V5DA 1EVTC 1G6VK 2NW3A 1RJCA 3IF1B 2Y07H 4ZFZB 3EFDH 5DVMA 3EYOA 4JFFD 4U1SA 2HTKD 4FTVD 2I60H 4XVJL 1KJ2L 5LBSL 1OAXH 1PQZB 5H35A 1F11A 3VFGL 2OSLA 4ONOA 3NPZB 4YDVA 3IKCB 3VD9A 5CEZH 1MRDH 1FZKB 5DJYB 1K2DA 4RGOH 4WHDA 1IKFH 4KTYA 3P11L 5AD0A 3ZTJG 2YK1L 1ZLVK 2AXFB 4JQVA 1BQLH 2WV3A 5L0QB 3LS5L 4AH2A 1FJ1A 2FJGA 4PJBA 5LAXA 1DQQA 3PP4H 4KTEL 2VLME 4HUXB 1IJ9A 1DR9A 4HZLB 2Q8BH 1X4XA 1UYWH 3CX2A 1J9CT 1XFPA 5SWSB 1T0MB 5HDOA 1OLZA 4AEIL 2FWOA 3UXFA 2FHCA 4LCCC 2IALA 4MXQD 1SYSB 2RB8A 2BSRB 5DJ0A 2WM0A 3FT4A 4P3DB 3CDGB 2FNBA 2VLJB 1AC6A 4N8CH 1FNEB 4PJGA 1ZGLA 3CCHB 4H1LB 4OZIA 1QSZA 1SY6A 3BQUD 2YEZB 3GBMH 1UT9A 4GAGH 4NJAH 5MEPA 3LMJL 1R5IB 3DV6A 2EDLA 4M48H 3UTPD 3T65B 3D85A 1CXIA 2BXYA 5MENB 3RWFB 1KLGA 1JF1A 2R8SH 3G9AB 1IKNA 1UJ3A 5F7UA 4O00A 2HG5A 2X7LB 5DMKB 4OCYL 5J6HB 1JK8B 3F7RA 4KI5F 1I7TB 4U1HB 4I13B 4PJ9B 3HC3L 3JXAA 3IU3B 4MX7B 4I77H 4JZJA 2EYTB 1IAIH 3KPQA 5KSBE 3ULUH 4I48B 3HUJF 3V4UH 3SGDH 5DEFB 1NLDL 3HNSL 2ITDB 3E0GA 1T1XB 1EFXB 1RZKH 3RY4A 2QSCH 2QJDA 4HJ0C 4EUPA 3VFRA 1KCVL 5D2LE 4XCYA 5DJAB 1CGUA 3PWVB 2R56H 2LU3A 1BLNA