4YKKA

Mnemiopsis leidyi ml032222a iglur lbd d-serine complex
Total Genus 78
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
78
sequence length
247
structure length
247
Chain Sequence
NLIGRHLRLGSVEEQPFMFFATEGCEGNDCWSGMVNDMVVKLSEDLGFTYEYIQPDDRKFGALNKTTNEWNGMIRDLLDDKTDMIAIDLSTNSARKSAIDYSFPFMDAGIKAVVKGEGTTLNQVLELLDQDKYKWGVIGSRHPETLLKTHRDSRYSRLVDEGVELKDLNHAIETLRGGLFVFIDEGPVLAHNLISDCDVFSVGEEFQSFEYAFGLPKDSPYKSLIDSHLLKFREEGFIDILWEKWSS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Glycine activated ion channel subunits encoded by ctenophore glutamate receptor genes.
pubmed doi rcsb
molecule keywords ML032222a iGluR
molecule tags Membrane protein
source organism Mnemiopsis leidyi
total genus 78
structure length 247
sequence length 247
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10613 Lig_chan-Glu_bd Ligated ion channel L-glutamate- and glycine-binding site
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ykkA01
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4ykkA02
1B32A 1D3KA 2F7CA 1B1XA 4RA1A 2OZZA 2DOJA 4JSOA 5FHNA 4AB5A 3TTKA 2Z8EA 4R9GA 5ICQA 5CMMA 1MS7A 3QUJA 1Z7ME 2XD3A 4X48A 3C31A 4H65A 5HM4B 2I3WA 1DSNA 5DYHA 2O7IA 3C34A 2P0SA 1JW4A 1POY1 1SI1A 1B7HA 1A8EA 4Z7EA 3K00A 4NF5B 2W7YA 4H67A 1DPPA 1BTJA 2ZYNA 3RPWA 1LFGA 3UORA 2DXYA 4OEUA 3K6WA 1UTBA 2HAVA 4DLDA 5I56A 1NNPA 2I58A 1ATGA 5B7DA 1MQDA 3PPPA 4TOZA 3KJTA 5TU0A 3VE1B 1NFTA 5IAIA 4EXKA 3TQLA 1UIVA 4JSDA 3ODBA 3L6GA 1ZLQA 4LUBA 1R1NA 1OMPA 3D4GA 1JW5A 4OXVA 2V3UA 3MAMA 3ZKLA 1O7TA 2Q88A 1ELJA 1QKBA 3K4UA 2WKYA 1MDQA 4IGRA 4QFLA 1JETA 4G77A 1ANFA 4U21A 4LVQA 5ITPA 3OXNA 3FZVA 1LFHA 3B6QA 3LC8A 2I0BA 1B4HA 1MDP1 1P1NA 1A55A 2F7AA 5TPAA 2F35A 2Q9TA 4YKIA 3PPQA 2QL3A 1II5A 1TT1A 3KN7A 3LR1A 5KZTA 5CMCA 3FJMA 4OMBA 4ONYA 1B0HA 3H6VA 1B51A 3S9LC 1OQHA 2PMSA 1MXZA 1I6QA 2XXHA 3TPAA 2NUVA 4QSEA 4TLMB 2F97A 4LQ2A 2F8DA 1QW0A 2G29A 5CC2A 2DE3A 2A5SA 5AA2D 1EU8A 3PPRA 2Q8JA 2R9JA 2I3VA 4DE8A 1JEUA 1N7XA 4YKPA 2P1SA 3UGWA 1LLSA 1Y3PA 1D4NA 3CRBA 3HHFA 4FE8A 3E9XA 4F31B 1FQEA 3A3CA 1R9QA 4YU0A 3VLWA 5DT6A 4F3BA 1B5HA 5L9MA 1P99A 1SBPA 4Q5TA 3H6UA 3TAJA 3S9NC 3SKPA 1BLFA 4JBZA 1L5TA 3I6VA 2UVGA 2QSXA 1SVXB 4DXBA 4HCYA 4XKPA 3PUXE 3SEWA 5EHMA 1BKAA 2Y7WA 1P1OA 1IZ1A 1POTA 1UTBB 3B6WA 5I56B 3S2VA 4XKQA 4PFYA 4IO4A 3FIRA 1A8FA 4OFLA 3H3GA 3H06B 5I2KB 3MVWA 1PC3A 1SW1A 4R6HA 4FORA 1PB7A 1XS5A 3OO9A 5FTIA 1B52A 3PMXA 4RNSA 5DVFA 5DVJA 1M5DA 1I69A 2ZYMA 4LATA 5TP9B 3KSXA 3O2AA 3S4UA 3M3KA 3TKDA 3TCHA 1ZTYA 1B58A 1B3GA 4HW8A 4Q0CA 1NNTA 3A09A 4U4XA 3SERA 2BJJX 1IUDA 2O68A 2REGA 5TPAB 1EH3A 3OENA 4ECFA 1M5EA 2Z23A 3G3IA 3E3KA 4EUOA 3C36A 3I3VA 4GIZA 2V3TA 1M5BA 3QAXA 4R6KA 4YMBA 3T9UA 2PT1A 3MBPA 5H8QA 3FJ7A 1B5IA 2RKMA 3GZGA 2UVHA 4RPNA 3BFUA 2Q2CA 4PFWA 4P0IA 1FTLA 3FVKA 2DE2A 3U1OA 4OWDA 3CFXA 1Y4CA 4R72A 1LCTA 2FYIA 3VLVA 3D4CA 4BDRA 1PB9A 2XHDA 3MQ9A 3U8QA 4EQ7A 1FTKA 4LZ5A 4BLAA 3PMVA 3TTMA 2UVIA 3CFLA 4RJZA 2VD2A 1M5FA 1NH8A 2H5YA 2I49A 4F29A 3U92A 3KJ7A 3N6TA 4KD5A 3EN3A 2F36A 3HCQA 1F9BA 4NF4A 3ONMA 3HPIA 4NF8B 3CSBA 1AL3A 4EQBA 1MM6A 5F1QA 5H8NA 2M8CA 2IA4A 1GR2A 4KYDA 2O69A 3K01A 3KFMA 1DTGA 4P11A 1AH5A 3MZ1A 2QMWA 4YKJA 3FGSA 2QJEA 2D21A 4MF3A 2XXPA 2V93A 4NF6B 1FTJA 1IXCA 2Y7KA 3OMBA 4QF9A 4MFIA 1O63A 2Z8FA 2AIXA 4R9FA 3JYRA 3IX1A 4LA9A 5KDTA 4IO3A 5ITOA 3VVEA 3KOTA 1SW4A 3TTLA 4Z0IA 4ZZEA 3G3JA 2Q89A 3FD3A 1MXXA 4H8JA 4WKMA 4OERA 4LZ7A 4EDPA 1FTMA 1B7ZA 3IR1A 3O97A 1B3FA 3MVYA 1TWYA 3MVXA 5JTYA 2OJTA 5AA3A 4OFJA 1N7WA 4DZ1A 3V83A 1S9TA 5H8SA 4LONB 3TTRA 2DWAA 1QUJA 2D3IA 2O7UA 2YPNA 1D9VA 5B70A 1B5JA 1LB8A 3F11A 3TCGA 2A5TA 2I0CA 1VFEA 2QS1A 2QMXA 1S7YA 3FVGA 4H6DA 3VDFA 3K02A 1WODA 3IORA 1QKAA 3H7MA 3LSWA 5CI5A 1SYIA 2ONKE 4DCYA 4EF2A 2FA7A 1B4ZA 1LBCA 1IXIA 5EYFA 1YPNA 4X1BA 2RCAA 3IJXB 3MUQA 4F3GA 3T93B 1FTOA 4K3FA 3IAZA 4RPOA 1VFDA 4ESWA 1NNKA 1AOVA 3IK6B 2F7BA 3MPKA 2Y84A 2KLFA 4JWYA 3GBAA 3TTNA 4KYSA 1N76A 2THIA 3PPNA 3O9PA 4XKRA 2DSFA 1P1QA 4E0WA 1IEJA 2H98A 4X9TA 4HTGA 5H8NB 5I57A 2HEUA 1H43A 3ZKKA 1XC1A 4G4PA 1N3WA 4NTLA 4GXAA 2DQVA 1DMBA 5H8FA 1JW1A 4GQOA 4C1TA 3IB2A 4GD5A 4L17A 3FASA 3PU5A 3TODA 3IJOB 3HHGA 3TEPA 1HSLA 1MPDA 1OVTA 3DP6A 5KDTB 4H8IA 4RK2A 1LFIA 3RTWB 3WAFA 4DCXA 4M1VA 3DELB 1LBBA 1GVCA 3DP8A 5FHOA 5JTYB 3TELA 2R71A 1H76A 4GOTA 1ZJLA 5FHMA 4G8HA 3TCFA 2B3FA 2GHAA 3W15C 4IY6A 4JXIA 1LAGE 4XKNA 1BP5A 2O84X 2XXVA 4KR5A 3V89B 1LAXA 4OFOA 4RK9A 4F18A 1FQCA 2A5TB 1YCJA 4ZEDA 4WEPA 1R9LA 3PD8A 3C9HA 2AL5A 1MQIA 4YB6A 2CMOA 1EZOA 5I58A 3MP6A 3CVGA 3G7WA 2VHAA 1A7LA 3TZAA 1LGBC 3FJGA 1EZ9A 1MY2A 2VP1A 3O6HA 3GBBA 1NL5A 3ILTB 3TQWA 3RNNA 4LQ5A 4POWA 3VVFA 1US4A 4G68C 1GGGA 3K6VA 3H6WA 3OSQA 1WVJA 1SW5A 4H0WA 4G8NA 4MBPA 2Y7PA 2I6EA 3EHTA 1AIVA 1MY4A 1QULA 1XVYA 3LSFB 2E1SA 2DS9A 4F2OA 4ELQA 4X1DA 4ZEKA 3C4MA 1URDA 4R75A 4XIGQ 3HV1A 2PT2A 2XX8A 5I57B 3N94A 1BIYA 3FVNA 2VOZA 4F2QA 1P1WA 1B3HA 4FEDA 4M4GA 3QUFA 1IXGA 1Y9UA 3C35A 5H8FB 3S9EA 1YAEA 4YKKA 4R2BA 2ONRA 4GRKA 3KG2A 4TQUQ 3FXUA 4GLIA 1YTVA 3HSTA 2ZNSA 1MXYA 4O3CA 1OIBA 3VVDA 3OSRA 3W9VA 5I2NA 1ZKBA 1NKXA 2DP8A 4GXSB 4OQOA 1MPCA 2QPQA 2OLBA 1B3LA 1A54A 2DXRA 3MZBA 4JWOA 4F1UA 4PFUA 3CI8A 3T9VA 3HO7A 5I84A 4KPTA 3DLNA 4NWCA 2HQ0A 3C33A 4OYVA 3EHUA 3OELA 2X7QA 3QSLA 3GLBA 2Z22A 1JVXA 3O29A 1QJMA 5KCJA 3IOWA 3JZJA 3O6GA 3OEMA 4P0GA 4DXUA 4KYEA 3IOTA 3SEYA 5CRYA 4FATA 3VXBA 1FQAA 3QK6A 5I58B 1GTKA 1HSJA 5JK4A 3H6TA 3TYHA 5AA4A 2UXAA 3PV0E 1NNFA 3K1PA 3KEIA 3G3FA 3O66A 4OVJA 4FEBA 1OVBA 2DWJA 1IITA 2VD3A 2ZMBA 3LBSA 3LSLA 3UN6A 1Z7NE 2PX1A 3DP4A 1FQDA 4E0XA 3MP1A 4PFTA 4YZZA 3SESA 3U93A 4BDLA 4F39A 4FIMA 3PD9A 4PE5B 3CG3A 3K1NA 5M2VA 1TFDA 4ZS9A 2Q2AA 1UIUA 2UYEA 4NMYA 1SW2A 2O1LA 1RKMA 2NOOA 4Q30B 4MH5A 4QSDA 3UIFA 2RINA 4G8MA 1USYH 2ZNUA 3EPEA 3FV1A 2AYSA 4U23A 3N6UA 1IXHA 4IY5A 4GL0A 1B05A 1D9YA 3TUSA 4DIGA 4NEDA 4ELOA 2DWHA 4OESA 3SEXA 1B1HA 5AE4A 3CG1A 1MQHA 2RC9A 3QIMA 5AA2A 4RY1A 2HZKA 1B46A 5I59A 3OD7A 1JQFA 5L9SA 3RT6B 1H45A 2ZYKA 1SI0A 3FUZA 3ZSFA 3I5OA 3PUYE 3W9WA 4DXCA 1Y3QA 5I2NB 2RF1A 4AQ4A 1MQGA 1PEBA 1O64A 3WAEA 1URGA 5IKBA 1B0LA 3BFTA 3KN8A 2O6AA 4IO7A 4QFNA 4G2ZA 1LSTA 4IO2A 2V3QA 2OK2A 4H1XA 1JEVA 1LB9A 5H8QB 3R7XA 2XX7A 3B6TA 4IO5A 4KCCA 3K1MA 3H4ZA 2DVCA 2D5WA 5KCJB 1LAHE 2XX9A 3EQ1A 2FNCA 3IOUA 3DM0A 3K6XA 2Z8DA 1M5CA 1OQGA 2CZLA 3FXQA 4KI0E 4Q8RA 3U94A 4F22A 2H9BA 3VFJA 5AA4B 5L8DA 2IEEA 2GH9A 3UK4A 1J1NA 4DDDA 3RLFE 3OEKA 4NF4B 1B40A 1PDAA 1SDXA 3Q25A 3RT8A 2ONSA 1MXVA 2LAOA 3SEUA 5K2YA 3T22A 3RGYA 1MG1A 1R6ZA 3TFLA 4EXLA 4ELRA 1VE4A 3EF7A 1ZU0A 3USDA 2DYXA 2NVUB 2XXWA 4QRZA 4OETA 1N84A 1QUIA 5DEXA 4THIA 2X7PA 3M8UA 3QXMA 1TXFA 2PYYA 1DOTA 3A3UA 1URSA 4QHQA 3Q29A 3R6UA 4NE4A 3Q27A 2PVUA 5I2KA 2OWSA 1QUKA 3IB1A 3FXRA 4QFKA 3PMWA 3Q26A 4EF1A 2E0SA 1B3EA 3CSGA 3VXCA 3KN3A 4GL8A 5TP9A 3CIJA 1SYHA 5AA2B 3S9MC 5HPQA 1MY3A 5I59B 4JWXA 4POXA 3EHSA 3H03A 5H8HA 2R6GE 4KHZE 2GRVA 2XXRA 2PBWA 2UVJA 1SD3A 4TLLB 3IB0A 4GWOA 3AXFA 2NWJA 2Y7IA 4JDFA 5DTBA 5CBRA 1WDNA 2X26A 3V8XB 5K2XA 1ZMGA 3KZGA 1H44A 3R26A 1FQBA 4IB2A 4WXJA 2HAUA 4G68A 3KBRA 5BWJA 4MLVA 3B7DA 3GXAA 1S50A 3RY3A 2DWIA 4ZDMA 1Y3NA 1CE2A 2HCAA 4N07A 3K6UA 4NWDA 2F34A 2H4IA 3BKIB 1PBQA 3KOSA 4C0RA 3ILUB 3E13X 1CB6A 1MH3A 4OENA 2ALUA 4GF8A 4HS7A 4KFQA 2OBGA 1MM7A 2B3BA 4ZEFA 3V5AA 2ZXTA 3PGFA 2B65A 3E4RA 1Y4TA 3SDFA 3UA8A 4ZEIA 5FTHA 2XXXA 1Q1KA 2VGQA 4EQ9A 1IQ7A 3RTFB 4U4SA 3MP8A 2XXQA 4UA8A 4YB7A 3FV2A 4NF8A 5CBSA 3THIA 2ANJA 3KSJA 4ZECA 3K2DA 1MH4A 4U2RA 1KWHA 3T96B 4OZ9A 3HN0A 5BUUA 1ZBMA 5J1DA 2F5XA 5EHSA 3KGCA 3CR9A 4N6PA 4PETA 4NF6A 1JVYA 2I48A 5JEIA 4JB7A 1UTHA 1B9JA 4LZ8A 4ISUA 1N0TA 2ESNA 2NXOA 1Q35A 5DEXB 2GFEA 1MRPA 3PUZE 5A5XA 5CMKA 4QFOA 4FECA 2QRYA 1MY0A 3M3FA 4R74A 2I4CA 4YMAA 3K0VA 4ELPA 1Y1ZA 4R73A 1T0KA 3PUWE 3MVZA 2OWTA 4IO6A 4U1ZA 1LAFE 1OLCA 3FATA 3OO8A 4RXLA 3UP9A 1H3DA 1AMFA 5F7VA 1MQJA 1B7UA 3OO6A 5DVIA 4GVOA 3BBRA 4F19A 1I6BA 5H8HB 2XXIA 4F1YA 3G3KA 1XHYA 3G3HA 5ELVA 2O51A 2YLNA 2XXUA 4RYAA 4U22A 1VSOA 4H5FA 1N04A 4ZE9A 3MWBA 4I8CA 3LSXA 5ISUA 1RYXA 2XD2A 2ABHA 4F3PA 1GV8A 3VV5A 4G68B 3SEVA 2AL4A 3JV9A 4HCWA 3P7IA 4FJPA 4PP0A 1LCFA 2DE4A 2DVZA 4ZEBA 3IOVA 3ZS6A 4O3BA 4O3AA 3RN8A 1B6HA 2QS3A 3T66A 4YAHX 3N26A 4OHNA 1SQYA 4N13A 3MW0A 1I6AA 1MY1A 2F6GA 4XTCQ 3CFZA 1N3XA 4YB5A 3QYTA 2YJPA 2HFBA 3TDJA 2ZNTA 1RYOA 4GFRA 4FAJA 2UYFA 1B2HA 3N5LA 2OCUA 4OEVA 4NF5A 1US5A 1FW0A 1USYE 4PQJA 5LOMA 3OO7A 4AB6A 5HBCA 1FCKA 3L6HA 5AA1A 4ESXA 3MJNA 1PB8A 1NMUA 3RUMA 2RC7A 1VR5A 3Q28A 1XT8A 1FQFA 4KCDA 3FVOA 1UTHB 1IIWA 3LUYA 4ND9A 3RQTA 3IO4A 5A5XB 2H99A 4F1VA 4F3SA 4YICA 1QVSA 1A99A 4BDNA 1OLAA 2P2AA 4ZZAA 2O1MA 4I62A 2I4BA 2G93A 2HXWA 3PUVE 3O6IA 5L9OA 1MPBA 4WEDA 4I1DA 4LP2B 3IL1B 4XXUA 5CM6A 4H5GA 4R2FA 1DTZA 3U72A 2XXYA 1MXUA 1JNFA 4R6YA 1TFAA 1XOCA 2F6PA 2RCBA 5CMBA 1XVXA 3OOAA 3PPOA 3M3LA 3IO6A 4ZE8A 1PBPA 3O28A 3VLUA 3T9HB 1ZIUA 3MPLA 2RC8A 4UACA 2QS4A 3T9XB 3G3GA 3TMGA 1UQWA 4BDQA 1Y20A 4QSCA 4QFPA 4BDOA 1P1UA 3C32A 4BDMA 3SETA 1MXWA 3MZ9A 1HSEA 2REJA 3ECRA 4C1UA 2Y7RA 2HZLA 2H25A 1Y1MA 4OTEA 2XXTA 4IGTA 2V84A 4MLQA 1NH7A 2QS2A 5ICTA 2F78A 1EZPA 1DPEA 3MC2A 4U1OA 4I9DA 1A40A 2V25A 2ZYOA 4KQPA 2GHBA
chains in the Genus database with same CATH superfamily
1NUXA 1B32A 1D3KA 2F7CA 1B1XA 4RA1A 2OZZA 2DOJA 4JSOA 5FHNA 4AB5A 3TTKA 2Z8EA 4R9GA 5ICQA 5CMMA 1MS7A 3QUJA 1Z7ME 5EYHA 5ET5A 2XD3A 4X48A 3C31A 4H65A 5HM4B 2I3WA 2QFLA 1DSNA 5DYHA 2O7IA 3C34A 1LBYA 2P0SA 1JW4A 1SI1A 1POY1 1B7HA 1A8EA 4Z7EA 3K00A 4NF5B 2W7YA 4H67A 1DPPA 1BTJA 2ZYNA 3RPWA 1NUYA 1LFGA 3MYUA 3UORA 2DXYA 4OEUA 3K6WA 1UTBA 2HAVA 4DLDA 5I56A 1NNPA 2F3DA 2I58A 1ATGA 5B7DA 1MQDA 1XI6A 3PPPA 4TOZA 3KJTA 2L5VA 5TU0A 3VE1B 4GWZA 4GWXA 1NFTA 5IAIA 4EXKA 3TQLA 1UIVA 1LBVA 4JSDA 3ODBA 4HE0A 4XF5A 4FBPA 3L6GA 1ZLQA 4AS5A 4LUBA 1IMCA 1R1NA 1OMPA 3D4GA 1JW5A 4OXVA 2V3UA 4JVCA 3MAMA 3ZKLA 1O7TA 2Q88A 1ELJA 1QKBA 4PBQA 3K4UA 2WKYA 1MDQA 4IGRA 4QFLA 1JETA 4G77A 1ANFA 4U21A 4LVQA 5ITPA 2XWOA 3OXNA 3FZVA 1LFHA 3B6QA 3LC8A 2I0BA 1B4HA 1MDP1 1P1NA 1A55A 2F7AA 5TPAA 2F35A 2Q9TA 4YKIA 3PPQA 2QL3A 1II5A 1TT1A 3KN7A 3LR1A 3T0JA 5KZTA 2Y5KA 5CMCA 1LBWA 3FJMA 4OMBA 4ONYA 2WYKA 1B0HA 3H6VA 1B51A 3S9LC 3RPLA 1OQHA 2PMSA 1MXZA 1I6QA 2XXHA 3TPAA 2NUVA 1IMBA 4QSEA 4TLMB 2F97A 4LQ2A 2F8DA 1QW0A 2G29A 5CC2A 2DE3A 2A5SA 5AA2D 1EU8A 3PPRA 2Q8JA 2R9JA 2I3VA 4DE8A 1JEUA 1N7XA 4YKPA 2P1SA 1FPGA 1EYKA 3UGWA 1LLSA 1Y3PA 1D4NA 4N4UA 3CRBA 3HHFA 4FE8A 4HE2A 4MIJA 3E9XA 2CEXA 4NQ8A 4NN3A 4F31B 1YZ0A 1FQEA 2PFYA 3A3CA 1RDZA 1K9ZA 1R9QA 4YU0A 3VLWA 5DT6A 1B5HA 5L9MA 1P99A 1SBPA 4Q5TA 3TAJA 3H6UA 4F3BA 3S9NC 3SKPA 1BLFA 4JBZA 1L5TA 4LN5A 3I6VA 2UVGA 2QSXA 2ZZWA 1SVXB 4DXBA 4HCYA 4XKPA 3PUXE 3SEWA 5EHMA 1BKAA 2Y7WA 1P1OA 1IZ1A 1POTA 1UTBB 3B6WA 5I56B 3S2VA 4XKQA 4OVPA 4O8MA 1LBXA 4X04A 4I3EA 4PFYA 4IO4A 3FIRA 1A8FA 4PGNA 4OFLA 3H3GA 3H06B 4P1EA 5I2KB 3MVWA 1PC3A 1SW1A 4R6HA 4FORA 1PB7A 1XS5A 3OO9A 5FTIA 4NGUA 1B52A 3PMXA 1FPFA 4RNSA 5DVFA 5DVJA 1M5DA 3RYDA 1I69A 2FHYA 2ZYMA 4LATA 5TP9B 3KSXA 3O2AA 3NOHA 3S4UA 3M3KA 3TKDA 3TCHA 1ZTYA 1B58A 1INPA 1B3GA 4HW8A 4Q0CA 1NNTA 3A09A 2V4CA 4U4XA 2FVZA 3SERA 2BJJX 1IUDA 2O68A 2KQZA 2REGA 5TPAB 1EH3A 2FIEA 3OENA 4ECFA 1M5EA 2Z23A 3G3IA 3E3KA 4EUOA 3C36A 3I3VA 1FBHA 4GIZA 2V3TA 1M5BA 3QAXA 4R6KA 4YMBA 3T9UA 2PT1A 3MBPA 5H8QA 3FJ7A 1B5IA 4G61A 4PF6A 2RKMA 3GZGA 2OWZA 2UVHA 4RPNA 3BFUA 2Q2CA 4PFWA 4P0IA 1IMFA 1FTLA 3FVKA 2WEFA 3CHGA 2DE2A 3U1OA 1FBGA 4OWDA 3CFXA 1Y4CA 4R72A 1LCTA 2FYIA 3VLVA 3D4CA 4BDRA 1PB9A 2XHDA 3MQ9A 3U8QA 4EQ7A 1FTKA 4LZ5A 4BLAA 1FJ9A 3PMVA 3TTMA 2UVIA 3CFLA 4RJZA 2VD2A 1M5FA 1NH8A 4N6KA 2H5YA 2I49A 4F29A 3U92A 3KJ7A 3N6TA 4KD5A 3EN3A 2F36A 3HCQA 1F9BA 4NF4A 5EQ9A 3ONMA 3HPIA 4NF8B 3CSBA 1AL3A 4EQBA 1MM6A 5F1QA 5H8NA 2M8CA 2IA4A 1GR2A 4KYDA 2O69A 3K01A 3KFMA 1DTGA 4P11A 1AH5A 3MZ1A 2QMWA 4YKJA 3FGSA 4N8GA 2QJEA 2D21A 4MF3A 2QVVA 2XXPA 2V93A 4NF6B 1FTJA 1IXCA 1NV6A 1FBPA 2Y7KA 3OMBA 1KZ8A 4QF9A 5A5LA 2OX3A 4MFIA 5ET8A 1O63A 2Z8FA 2AIXA 4R9FA 3JYRA 3IX1A 4LA9A 5KDTA 4IO3A 5ITOA 4KXPA 3VVEA 5ET7A 3KOTA 1SW4A 1FPIA 3TTLA 4Z0IA 4ZZEA 3G3JA 2Q89A 3FD3A 1MXXA 4H8JA 4WKMA 4OERA 4LZ7A 4EDPA 1FTMA 1B7ZA 3IR1A 3O97A 1B3FA 3MVYA 1TWYA 3MVXA 5JTYA 2OJTA 4GX4A 5AA3A 4OFJA 1N7WA 4DZ1A 3V83A 1S9TA 4HE1A 4N81A 2ZZXA 1RDYA 4PAFA 4LONB 5H8SA 3TTRA 3LUZA 2DWAA 1NV2A 4GX6A 1QUJA 2HHMA 2D3IA 2O7UA 4I3YA 2YPNA 1D9VA 5B70A 4PCDA 1B5JA 1LB8A 3F11A 3TCGA 2A5TA 2I0CA 1VFEA 2QS1A 2QMXA 1S7YA 3FVGA 4H6DA 3VDFA 3K02A 1WODA 3IORA 1QKAA 3H7MA 3LSWA 5CI5A 1SYIA 5IZ3A 2ONKE 3FXBA 4DCYA 4EF2A 2FA7A 1B4ZA 2CEYA 1LBCA 4GX3A 1D9QA 2FIXA 3EKIA 1IXIA 2HPGA 5EYFA 1YPNA 2QVUA 4O7IA 4X1BA 2RCAA 3IJXB 3MUQA 4F3GA 3T93B 3B50A 1FTOA 4K3FA 3IAZA 4RPOA 1VFDA 4ESWA 1NNKA 1AOVA 3IK6B 2F7BA 3MPKA 1DBZA 2Y84A 2KLFA 4N6DA 4JWYA 3GBAA 3TTNA 2PCRA 4KYSA 1N76A 1NV1A 2THIA 3PPNA 3O9PA 4XKRA 2F3BA 3BIHA 2DSFA 1P1QA 4E0WA 1IEJA 2H98A 4PDDA 4X9TA 3U65A 4HTGA 5H8NB 5I57A 4P8BA 2HEUA 1H43A 1NV7A 3ZKKA 1XC1A 4G4PA 4PTKA 2WYPA 1N3WA 4NTLA 4GXAA 2DQVA 1DMBA 5H8FA 1JW1A 4GQOA 1FBDA 4C1TA 2WBBA 3IB2A 3D1RA 4GD5A 3E78A 4L17A 3FASA 3PU5A 3TODA 3IJOB 3HHGA 3TEPA 1HSLA 1MPDA 1OVTA 3DP6A 5KDTB 1YYZA 4H8IA 4RK2A 2XWIA 1LFIA 3RTWB 3HFUA 3WAFA 4DCXA 2XWKA 4GWSA 4M1VA 3DELB 1LBBA 4NAPA 1GVCA 3DP8A 5FHOA 5JTYB 3TELA 2R71A 1H76A 4GOTA 1ZJLA 5FHMA 4G8HA 3TCFA 2B3FA 2GHAA 3W15C 4IY6A 4JXIA 1LAGE 1FPJA 4XKNA 1BP5A 2O84X 2XXVA 4KR5A 3V89B 1LAXA 4OFOA 4RK9A 1NV0A 4F18A 1SPIA 1FQCA 2A5TB 1YCJA 4ZEDA 4WEPA 1R9LA 5F24A 4PAKA 4PAIA 4P3LA 3PD8A 3C9HA 2AL5A 1NUWA 1MQIA 4YB6A 2CMOA 1EZOA 5I58A 3MP6A 3CVGA 3G7WA 2VHAA 1A7LA 2ZZVA 3TZAA 1LGBC 3FJGA 5I5PA 1EZ9A 1MY2A 1VDWA 2VP1A 3O6HA 3GBBA 1NL5A 3ILTB 3TQWA 3RNNA 1Q9DA 4GWWA 1FPKA 4LQ5A 4POWA 3VVFA 1US4A 4G68C 1GGGA 3K6VA 3H6WA 3OSQA 1WVJA 1SW5A 4OANA 4H0WA 4G8NA 4MBPA 2Y7PA 2I6EA 5ET6A 3EHTA 5IZ1A 1AIVA 1MY4A 1QULA 1XVYA 3LSFB 2E1SA 2DS9A 4N17A 4MMPA 4F2OA 4ELQA 1IMAA 4X1DA 4ZEKA 3C4MA 1URDA 4R75A 4XIGQ 3HV1A 2PT2A 2XX8A 5I57B 3FBPA 3N94A 2Y5LA 1BIYA 3FVNA 2VOZA 4F2QA 4GWUA 1P1WA 3ROJA 1NV3A 1B3HA 4X8RA 4FEDA 4M4GA 4PF8A 3QUFA 1IXGA 1Y9UA 3C35A 5H8FB 3S9EA 2MKZA 1YAEA 4YKKA 4R2BA 2ONRA 4GRKA 2WX9A 3B8BA 3KG2A 5FBPA 4TQUQ 3FXUA 4GLIA 1YTVA 3HSTA 3MSTA 2ZNSA 1MXYA 4O3CA 1OIBA 3VVDA 3GYYA 3OSRA 2B4MA 3W9VA 5I2NA 1ZKBA 4MJOA 3ISPA 1NKXA 2DP8A 4GXSB 4OQOA 1MPCA 2QPQA 2OLBA 1B3LA 1A54A 2DXRA 3MZBA 4JVIA 4JWOA 4F1UA 4PFUA 5EQ8A 3CI8A 2Q8MA 3T9VA 3HO7A 4PGPA 5I84A 4KPTA 3DLNA 4NWCA 2HQ0A 3C33A 4OYVA 3EHUA 3OELA 2X7QA 3QSLA 3GLBA 4I40A 2Z22A 1JVXA 3RPLB 3O29A 1QJMA 5KCJA 3IOWA 1NUZA 3JZJA 5DW8A 3O6GA 1LEVA 3OEMA 4GWYA 4P0GA 4DXUA 1FPBA 4KYEA 3IOTA 2PFZA 3SEYA 5CRYA 4FATA 3VXBA 1FQAA 3QK6A 5I58B 1GTKA 1HSJA 5JK4A 3H6TA 2KR0A 3TYHA 5AA4A 2UXAA 3PV0E 1NNFA 3K1PA 4DI4B 2CZIA 3KEIA 2BJIA 3G3FA 4P47A 4QBAA 2DDKA 3O66A 4OVJA 4FEBA 1OVBA 2DWJA 1IITA 2VD3A 2ZMBA 3LBSA 3LSLA 3UN6A 1Z7NE 2VT5A 2PX1A 3DP4A 1FQDA 4E0XA 1IMDA 3MP1A 4PFTA 1FJ6A 4YZZA 2R8TA 3SESA 3U93A 4BDLA 4F39A 4FIMA 3PD9A 1KA0A 4PE5B 3CG3A 4XEQA 3K1NA 2FBPA 5M2VA 1TFDA 4ZS9A 2Q2AA 1UIUA 2UYEA 4NMYA 1SW2A 2O1LA 4PE3A 1RKMA 2NOOA 4Q30B 4MH5A 4QSDA 3UIFA 2RINA 4G8MA 1USYH 2ZNUA 3EPEA 3FV1A 2AYSA 4U23A 4AS4A 2GQ1A 1FBFA 3N6UA 1IXHA 4IY5A 4GL0A 1B05A 3KBZA 1D9YA 3TUSA 4DIGA 4NEDA 4ELOA 2DWHA 4OESA 3SEXA 1B1HA 5AE4A 3CG1A 4N8YA 1JP4A 1MQHA 4DI3D 2RC9A 3QIMA 5AA2A 4RY1A 2HZKA 1K9YA 1B46A 5I59A 3OD7A 4PC9A 1JQFA 5L9SA 3RT6B 1H45A 2ZYKA 1SI0A 1FBCA 3FUZA 3ZSFA 3I5OA 3PUYE 3W9WA 4DXCA 1Y3QA 5EQ7A 5I2NB 2RF1A 4AQ4A 1MQGA 1PEBA 1O64A 3WAEA 1URGA 5IKBA 1B0LA 2Q74A 1EYJA 3BFTA 3KN8A 2O6AA 4IO7A 4QFNA 4G2ZA 1LSTA 2QVRA 4IO2A 2V3QA 2OK2A 4H1XA 1JEVA 1LB9A 4MCOA 5H8QB 1DK4A 3R7XA 2XX7A 3B6TA 4IO5A 4KCCA 3K1MA 3H4ZA 4PFIA 2DVCA 2D5WA 2VPOA 5KCJB 1LAHE 2XX9A 3EQ1A 2FNCA 4PDHA 3IOUA 3DM0A 3K6XA 2Z8DA 1M5CA 1OQGA 2CZLA 3FXQA 4KI0E 4Q8RA 3U94A 4P1LA 4F22A 2H9BA 3VFJA 5AA4B 5L8DA 2IEEA 2GH9A 2B4LA 3UK4A 1J1NA 4DDDA 4O7MA 3RLFE 3OEKA 2VPNA 4NF4B 1B40A 1PDAA 1NI9A 1SDXA 3Q25A 3RT8A 2ONSA 1MXVA 2LAOA 3SEUA 3SZPA 5K2YA 3T22A 3RGYA 1MG1A 1R6ZA 3TFLA 4EXLA 4ELRA 1VE4A 3EF7A 1ZU0A 3USDA 2DYXA 1RDXA 2WBDA 2NVUB 2XXWA 4QRZA 4OETA 1N84A 5I3SA 1QUIA 5DEXA 4THIA 2X7PA 3M8UA 3QXMA 4OVQA 1TXFA 2PYYA 1DOTA 3A3UA 3T1BA 1URSA 4QHQA 3Q29A 3R6UA 4NE4A 1BK4A 3Q27A 2PVUA 5I2KA 2OWSA 1QUKA 3IB1A 2P3NA 3FXRA 4QFKA 3PMWA 3Q26A 4EF1A 4P56A 2E0SA 1FPLA 5LTCA 1B3EA 3CSGA 4H46A 3VXCA 2P3VA 3KN3A 2XA5A 4GL8A 5TP9A 3CIJA 1SYHA 5AA2B 3S9MC 5HPQA 1MY3A 3QMFA 5I59B 4JWXA 4POXA 3EHSA 3H03A 4OVTA 5H8HA 4PFBA 2R6GE 4KHZE 2GRVA 2XXRA 4OVSA 2PBWA 2UVJA 1SD3A 4TLLB 3IB0A 4GWOA 3AXFA 2NWJA 2Y7IA 1YXIA 4GBVA 4JDFA 5DTBA 4GBWA 5CBRA 1WDNA 2X26A 3V8XB 5K2XA 1ZMGA 3KZGA 2JJKA 1H44A 3R26A 1FQBA 4IB2A 4WXJA 2HAUA 4G68A 3KBRA 5BWJA 4MLVA 3B7DA 3GXAA 1S50A 3RY3A 2DWIA 4ZDMA 4MX6A 1NV5A 1Y3NA 1CE2A 2HCAA 4N07A 3K6UA 4NWDA 2F34A 5EYGA 5IZ3B 2H4IA 3BKIB 1PBQA 3KOSA 1AWBA 4C0RA 4NF0A 3ILUB 3E13X 1CB6A 1MH3A 4OENA 2ALUA 4GF8A 4HS7A 1FTAA 4KFQA 2OBGA 1MM7A 2B3BA 4ZEFA 1KA1A 3V5AA 2ZXTA 3PGFA 2B65A 3E4RA 1Y4TA 3SDFA 3UA8A 4ZEIA 5IZZA 5FTHA 2XXXA 1FPDA 1Q1KA 2VGQA 4EQ9A 1IQ7A 3RTFB 4U4SA 3MP8A 2XXQA 4HXVA 4UA8A 3PTYA 4YB7A 2XWVA 3FV2A 4NF8A 5CBSA 3THIA 2ANJA 4N15A 3KSJA 4ZECA 3K2DA 1MH4A 4U2RA 1KWHA 1G0HA 3T96B 4OZ9A 3HN0A 5BUUA 1ZBMA 5J1DA 2F5XA 5EHSA 3KGCA 3CR9A 4N6PA 4PETA 4NF6A 1JVYA 2I48A 5JEIA 4JB7A 1UTHA 1B9JA 4LZ8A 4ISUA 1N0TA 2ESNA 2NXOA 1Q35A 5DEXB 2GFEA 1MRPA 3PUZE 5A5XA 5CMKA 4QFOA 4FECA 5ESYA 2QRYA 1MY0A 3M3FA 4R74A 2I4CA 4YMAA 3K0VA 4MEVA 4ELPA 1Y1ZA 4R73A 1T0KA 3PUWE 3MVZA 5LDZA 2CZKA 2OWTA 4IO6A 4U1ZA 4MNIA 2CZHA 1LAFE 1OLCA 3FATA 3OO8A 4RXLA 3UP9A 1H3DA 1AMFA 5F7VA 1MQJA 1B7UA 3OO6A 5DVIA 4GVOA 1IMEA 3BBRA 4F19A 1I6BA 5H8HB 2XXIA 4F1YA 3G3KA 4MNPA 1XHYA 3G3HA 5ELVA 2O51A 2YLNA 2XXUA 3KC0A 4RYAA 4U22A 3IFCA 1VSOA 4H5FA 1N04A 4ZE9A 3MWBA 4I8CA 3LSXA 5ISUA 1RYXA 2XD2A 2ABHA 4F3PA 1GV8A 1DCUA 3VV5A 4OVRA 4G68B 3SEVA 2AL4A 4JVDA 4XFEA 3JV9A 4HCWA 5IM2A 4NX1A 4OA4A 3P7IA 4FJPA 4PFRA 2XXKA 4PP0A 1LCFA 2DE4A 2HXRA 2DVZA 4ZEBA 3IOVA 5T3JA 3ZS6A 4O3BA 4O3AA 3RN8A 1B6HA 2QS3A 3T66A 4YAHX 3N26A 4OHNA 1SQYA 4N13A 3MW0A 1I6AA 1MY1A 2F6GA 4XTCQ 3CFZA 1FSAA 1N3XA 4YB5A 3QYTA 1G0IA 2YJPA 2HFBA 3TDJA 2ZNTA 1RYOA 4GFRA 4FAJA 5J16A 2UYFA 1B2HA 3N5LA 2OCUA 4O94A 4OEVA 4NF5A 1US5A 1FW0A 4MAGA 5EQAA 5IGAA 1USYE 4MHFA 4PQJA 5LOMA 3OO7A 4AB6A 5HBCA 4N91A 1FCKA 3L6HA 5AA1A 4ESXA 3MJNA 1PB8A 1NMUA 3RUMA 2RC7A 1VR5A 3Q28A 1XT8A 1FQFA 4KCDA 3FVOA 1UTHB 1IIWA 4P9KA 3LUYA 1FBEA 4ND9A 3RQTA 3IO4A 5A5XB 2H99A 4F1VA 4F3SA 4PBHA 4YICA 1NV4A 1QVSA 1A99A 4BDNA 1OLAA 1LBZA 2P2AA 4ZZAA 2O1MA 4I62A 2I4BA 3KC1A 2G93A 2HXWA 3PUVE 3O6IA 1EYIA 4NHBA 5L9OA 5I7IA 1MPBA 4WEDA 4NG7A 4I1DA 4LP2B 3IL1B 4XXUA 5CM6A 3A29A 4H5GA 4R2FA 1DTZA 3E79A 3U72A 2XXYA 1MXUA 1JNFA 4R6YA 4H45A 1TFAA 1XOCA 2F6PA 2RCBA 5CMBA 1XVXA 3OOAA 3PPOA 3M3LA 4UABA 3IO6A 4ZE8A 1PBPA 3O28A 3VLUA 1QGXA 3T9HB 1ZIUA 3MPLA 2RC8A 4UACA 2QS4A 3T9XB 3G3GA 3TMGA 1UQWA 4BDQA 1Y20A 1CNQA 4QSCA 4QFPA 4BDOA 1P1UA 3C32A 4BDMA 3SETA 1MXWA 3MZ9A 1HSEA 2REJA 3LV0A 3ECRA 4C1UA 2Y7RA 2HZLA 2H25A 1Y1MA 4IR8A 4OTEA 4MNCA 2XXTA 4IGTA 2V84A 3IFAA 1FRPA 4MLQA 1NH7A 2QS2A 5ICTA 1FPEA 2F78A 1EZPA 1DPEA 4QXDA 3MC2A 4U1OA 4I9DA 1A40A 2V25A 2ZYOA 4KQPA 2GHBA 3BIGA
chains in the Genus database with same CATH topology
1B32A 1D3KA 2F7CA 1B1XA 4RA1A 2OZZA 2DOJA 4JSOA 5FHNA 4AB5A 3TTKA 2Z8EA 4R9GA 5ICQA 5CMMA 1MS7A 3QUJA 1Z7ME 2XD3A 4X48A 3C31A 4H65A 5HM4B 2I3WA 1DSNA 5DYHA 2O7IA 3C34A 2P0SA 1JW4A 1POY1 1SI1A 1B7HA 1A8EA 4Z7EA 3K00A 4NF5B 2W7YA 4H67A 1DPPA 1BTJA 2ZYNA 3RPWA 1LFGA 3UORA 2DXYA 4OEUA 3K6WA 1UTBA 2HAVA 4DLDA 5I56A 1NNPA 2I58A 1ATGA 5B7DA 1MQDA 3PPPA 4TOZA 3KJTA 5TU0A 3VE1B 1NFTA 5IAIA 4EXKA 3TQLA 1UIVA 4JSDA 3ODBA 3L6GA 1ZLQA 4LUBA 1R1NA 1OMPA 3D4GA 1JW5A 4OXVA 2V3UA 3MAMA 3ZKLA 1O7TA 2Q88A 1ELJA 1QKBA 3K4UA 2WKYA 1MDQA 4IGRA 4QFLA 1JETA 4G77A 1ANFA 4U21A 4LVQA 5ITPA 3OXNA 3FZVA 1LFHA 3B6QA 3LC8A 2I0BA 1B4HA 1MDP1 1P1NA 1A55A 2F7AA 5TPAA 2F35A 2Q9TA 4YKIA 3PPQA 2QL3A 1II5A 1TT1A 3KN7A 3LR1A 5KZTA 5CMCA 3FJMA 4OMBA 4ONYA 1B0HA 3H6VA 1B51A 3S9LC 1OQHA 2PMSA 1MXZA 1I6QA 2XXHA 3TPAA 2NUVA 4QSEA 4TLMB 2F97A 4LQ2A 2F8DA 1QW0A 2G29A 5CC2A 2DE3A 2A5SA 5AA2D 1EU8A 3PPRA 2Q8JA 2R9JA 2I3VA 4DE8A 1JEUA 1N7XA 4YKPA 2P1SA 3UGWA 1LLSA 1Y3PA 1D4NA 3CRBA 3HHFA 4FE8A 3E9XA 4F31B 1FQEA 3A3CA 1R9QA 4YU0A 3VLWA 5DT6A 4F3BA 1B5HA 5L9MA 1P99A 1SBPA 4Q5TA 3H6UA 3TAJA 3S9NC 3SKPA 1BLFA 4JBZA 1L5TA 3I6VA 2UVGA 2QSXA 1SVXB 4DXBA 4HCYA 4XKPA 3PUXE 3SEWA 5EHMA 1BKAA 2Y7WA 1P1OA 1IZ1A 1POTA 1UTBB 3B6WA 5I56B 3S2VA 4XKQA 4PFYA 4IO4A 3FIRA 1A8FA 4OFLA 3H3GA 3H06B 5I2KB 3MVWA 1PC3A 1SW1A 4R6HA 4FORA 1PB7A 1XS5A 3OO9A 5FTIA 1B52A 3PMXA 4RNSA 5DVFA 5DVJA 1M5DA 1I69A 2ZYMA 4LATA 5TP9B 3KSXA 3O2AA 3S4UA 3M3KA 3TKDA 3TCHA 1ZTYA 1B58A 1B3GA 4HW8A 4Q0CA 1NNTA 3A09A 4U4XA 3SERA 2BJJX 1IUDA 2O68A 2REGA 5TPAB 1EH3A 3OENA 4ECFA 1M5EA 2Z23A 3G3IA 3E3KA 4EUOA 3C36A 3I3VA 4GIZA 2V3TA 1M5BA 3QAXA 4R6KA 4YMBA 3T9UA 2PT1A 3MBPA 5H8QA 3FJ7A 1B5IA 2RKMA 3GZGA 2UVHA 4RPNA 3BFUA 2Q2CA 4PFWA 4P0IA 1FTLA 3FVKA 2DE2A 3U1OA 4OWDA 3CFXA 1Y4CA 4R72A 1LCTA 2FYIA 3VLVA 3D4CA 4BDRA 1PB9A 2XHDA 3MQ9A 3U8QA 4EQ7A 1FTKA 4LZ5A 4BLAA 3PMVA 3TTMA 2UVIA 3CFLA 4RJZA 2VD2A 1M5FA 1NH8A 2H5YA 2I49A 4F29A 3U92A 3KJ7A 3N6TA 4KD5A 3EN3A 2F36A 3HCQA 1F9BA 4NF4A 3ONMA 3HPIA 4NF8B 3CSBA 1AL3A 4EQBA 1MM6A 5F1QA 5H8NA 2M8CA 2IA4A 1GR2A 4KYDA 2O69A 3K01A 3KFMA 1DTGA 4P11A 1AH5A 3MZ1A 2QMWA 4YKJA 3FGSA 2QJEA 2D21A 4MF3A 2XXPA 2V93A 4NF6B 1FTJA 1IXCA 2Y7KA 3OMBA 4QF9A 4MFIA 1O63A 2Z8FA 2AIXA 4R9FA 3JYRA 3IX1A 4LA9A 5KDTA 4IO3A 5ITOA 3VVEA 3KOTA 1SW4A 3TTLA 4Z0IA 4ZZEA 3G3JA 2Q89A 3FD3A 1MXXA 4H8JA 4WKMA 4OERA 4LZ7A 4EDPA 1FTMA 1B7ZA 3IR1A 3O97A 1B3FA 3MVYA 1TWYA 3MVXA 5JTYA 2OJTA 5AA3A 4OFJA 1N7WA 4DZ1A 3V83A 1S9TA 5H8SA 4LONB 3TTRA 2DWAA 1QUJA 2D3IA 2O7UA 2YPNA 1D9VA 5B70A 1B5JA 1LB8A 3F11A 3TCGA 2A5TA 2I0CA 1VFEA 2QS1A 2QMXA 1S7YA 3FVGA 4H6DA 3VDFA 3K02A 1WODA 3IORA 1QKAA 3H7MA 3LSWA 5CI5A 1SYIA 2ONKE 4DCYA 4EF2A 2FA7A 1B4ZA 1LBCA 1IXIA 5EYFA 1YPNA 4X1BA 2RCAA 3IJXB 3MUQA 4F3GA 3T93B 1FTOA 4K3FA 3IAZA 4RPOA 1VFDA 4ESWA 1NNKA 1AOVA 3IK6B 2F7BA 3MPKA 2Y84A 2KLFA 4JWYA 3GBAA 3TTNA 4KYSA 1N76A 2THIA 3PPNA 3O9PA 4XKRA 2DSFA 1P1QA 4E0WA 1IEJA 2H98A 4X9TA 4HTGA 5H8NB 5I57A 2HEUA 1H43A 3ZKKA 1XC1A 4G4PA 1N3WA 4NTLA 4GXAA 2DQVA 1DMBA 5H8FA 1JW1A 4GQOA 4C1TA 3IB2A 4GD5A 4L17A 3FASA 3PU5A 3TODA 3IJOB 3HHGA 3TEPA 1HSLA 1MPDA 1OVTA 3DP6A 5KDTB 4H8IA 4RK2A 1LFIA 3RTWB 3WAFA 4DCXA 4M1VA 3DELB 1LBBA 1GVCA 3DP8A 5FHOA 5JTYB 3TELA 2R71A 1H76A 4GOTA 1ZJLA 5FHMA 4G8HA 3TCFA 2B3FA 2GHAA 3W15C 4IY6A 4JXIA 1LAGE 4XKNA 1BP5A 2O84X 2XXVA 4KR5A 3V89B 1LAXA 4OFOA 4RK9A 4F18A 1FQCA 2A5TB 1YCJA 4ZEDA 4WEPA 1R9LA 3PD8A 3C9HA 2AL5A 1MQIA 4YB6A 2CMOA 1EZOA 5I58A 3MP6A 3CVGA 3G7WA 2VHAA 1A7LA 3TZAA 1LGBC 3FJGA 1EZ9A 1MY2A 2VP1A 3O6HA 3GBBA 1NL5A 3ILTB 3TQWA 3RNNA 4LQ5A 4POWA 3VVFA 1US4A 4G68C 1GGGA 3K6VA 3H6WA 3OSQA 1WVJA 1SW5A 4H0WA 4G8NA 4MBPA 2Y7PA 2I6EA 3EHTA 1AIVA 1MY4A 1QULA 1XVYA 3LSFB 2E1SA 2DS9A 4F2OA 4ELQA 4X1DA 4ZEKA 3C4MA 1URDA 4R75A 4XIGQ 3HV1A 2PT2A 2XX8A 5I57B 3N94A 1BIYA 3FVNA 2VOZA 4F2QA 1P1WA 1B3HA 4FEDA 4M4GA 3QUFA 1IXGA 1Y9UA 3C35A 5H8FB 3S9EA 1YAEA 4YKKA 4R2BA 2ONRA 4GRKA 3KG2A 4TQUQ 3FXUA 4GLIA 1YTVA 3HSTA 2ZNSA 1MXYA 4O3CA 1OIBA 3VVDA 3OSRA 3W9VA 5I2NA 1ZKBA 1NKXA 2DP8A 4GXSB 4OQOA 1MPCA 2QPQA 2OLBA 1B3LA 1A54A 2DXRA 3MZBA 4JWOA 4F1UA 4PFUA 3CI8A 3T9VA 3HO7A 5I84A 4KPTA 3DLNA 4NWCA 2HQ0A 3C33A 4OYVA 3EHUA 3OELA 2X7QA 3QSLA 3GLBA 2Z22A 1JVXA 3O29A 1QJMA 5KCJA 3IOWA 3JZJA 3O6GA 3OEMA 4P0GA 4DXUA 4KYEA 3IOTA 3SEYA 5CRYA 4FATA 3VXBA 1FQAA 3QK6A 5I58B 1GTKA 1HSJA 5JK4A 3H6TA 3TYHA 5AA4A 2UXAA 3PV0E 1NNFA 3K1PA 3KEIA 3G3FA 3O66A 4OVJA 4FEBA 1OVBA 2DWJA 1IITA 2VD3A 2ZMBA 3LBSA 3LSLA 3UN6A 1Z7NE 2PX1A 3DP4A 1FQDA 4E0XA 3MP1A 4PFTA 4YZZA 3SESA 3U93A 4BDLA 4F39A 4FIMA 3PD9A 4PE5B 3CG3A 3K1NA 5M2VA 1TFDA 4ZS9A 2Q2AA 1UIUA 2UYEA 4NMYA 1SW2A 2O1LA 1RKMA 2NOOA 4Q30B 4MH5A 4QSDA 3UIFA 2RINA 4G8MA 1USYH 2ZNUA 3EPEA 3FV1A 2AYSA 4U23A 3N6UA 1IXHA 4IY5A 4GL0A 1B05A 1D9YA 3TUSA 4DIGA 4NEDA 4ELOA 2DWHA 4OESA 3SEXA 1B1HA 5AE4A 3CG1A 1MQHA 2RC9A 3QIMA 5AA2A 4RY1A 2HZKA 1B46A 5I59A 3OD7A 1JQFA 5L9SA 3RT6B 1H45A 2ZYKA 1SI0A 3FUZA 3ZSFA 3I5OA 3PUYE 3W9WA 4DXCA 1Y3QA 5I2NB 2RF1A 4AQ4A 1MQGA 1PEBA 1O64A 3WAEA 1URGA 5IKBA 1B0LA 3BFTA 3KN8A 2O6AA 4IO7A 4QFNA 4G2ZA 1LSTA 4IO2A 2V3QA 2OK2A 4H1XA 1JEVA 1LB9A 5H8QB 3R7XA 2XX7A 3B6TA 4IO5A 4KCCA 3K1MA 3H4ZA 2DVCA 2D5WA 5KCJB 1LAHE 2XX9A 3EQ1A 2FNCA 3IOUA 3DM0A 3K6XA 2Z8DA 1M5CA 1OQGA 2CZLA 3FXQA 4KI0E 4Q8RA 3U94A 4F22A 2H9BA 3VFJA 5AA4B 5L8DA 2IEEA 2GH9A 3UK4A 1J1NA 4DDDA 3RLFE 3OEKA 4NF4B 1B40A 1PDAA 1SDXA 3Q25A 3RT8A 2ONSA 1MXVA 2LAOA 3SEUA 5K2YA 3T22A 3RGYA 1MG1A 1R6ZA 3TFLA 4EXLA 4ELRA 1VE4A 3EF7A 1ZU0A 3USDA 2DYXA 2NVUB 2XXWA 4QRZA 4OETA 1N84A 1QUIA 5DEXA 4THIA 2X7PA 3M8UA 3QXMA 1TXFA 2PYYA 1DOTA 3A3UA 1URSA 4QHQA 3Q29A 3R6UA 4NE4A 3Q27A 2PVUA 5I2KA 2OWSA 1QUKA 3IB1A 3FXRA 4QFKA 3PMWA 3Q26A 4EF1A 2E0SA 1B3EA 3CSGA 3VXCA 3KN3A 4GL8A 5TP9A 3CIJA 1SYHA 5AA2B 3S9MC 5HPQA 1MY3A 5I59B 4JWXA 4POXA 3EHSA 3H03A 5H8HA 2R6GE 4KHZE 2GRVA 2XXRA 2PBWA 2UVJA 1SD3A 4TLLB 3IB0A 4GWOA 3AXFA 2NWJA 2Y7IA 4JDFA 5DTBA 5CBRA 1WDNA 2X26A 3V8XB 5K2XA 1ZMGA 3KZGA 1H44A 3R26A 1FQBA 4IB2A 4WXJA 2HAUA 4G68A 3KBRA 5BWJA 4MLVA 3B7DA 3GXAA 1S50A 3RY3A 2DWIA 4ZDMA 1Y3NA 1CE2A 2HCAA 4N07A 3K6UA 4NWDA 2F34A 2H4IA 3BKIB 1PBQA 3KOSA 4C0RA 3ILUB 3E13X 1CB6A 1MH3A 4OENA 2ALUA 4GF8A 4HS7A 4KFQA 2OBGA 1MM7A 2B3BA 4ZEFA 3V5AA 2ZXTA 3PGFA 2B65A 3E4RA 1Y4TA 3SDFA 3UA8A 4ZEIA 5FTHA 2XXXA 1Q1KA 2VGQA 4EQ9A 1IQ7A 3RTFB 4U4SA 3MP8A 2XXQA 4UA8A 4YB7A 3FV2A 4NF8A 5CBSA 3THIA 2ANJA 3KSJA 4ZECA 3K2DA 1MH4A 4U2RA 1KWHA 3T96B 4OZ9A 3HN0A 5BUUA 1ZBMA 5J1DA 2F5XA 5EHSA 3KGCA 3CR9A 4N6PA 4PETA 4NF6A 1JVYA 2I48A 5JEIA 4JB7A 1UTHA 1B9JA 4LZ8A 4ISUA 1N0TA 2ESNA 2NXOA 1Q35A 5DEXB 2GFEA 1MRPA 3PUZE 5A5XA 5CMKA 4QFOA 4FECA 2QRYA 1MY0A 3M3FA 4R74A 2I4CA 4YMAA 3K0VA 4ELPA 1Y1ZA 4R73A 1T0KA 3PUWE 3MVZA 2OWTA 4IO6A 4U1ZA 1LAFE 1OLCA 3FATA 3OO8A 4RXLA 3UP9A 1H3DA 1AMFA 5F7VA 1MQJA 1B7UA 3OO6A 5DVIA 4GVOA 3BBRA 4F19A 1I6BA 5H8HB 2XXIA 4F1YA 3G3KA 1XHYA 3G3HA 5ELVA 2O51A 2YLNA 2XXUA 4RYAA 4U22A 1VSOA 4H5FA 1N04A 4ZE9A 3MWBA 4I8CA 3LSXA 5ISUA 1RYXA 2XD2A 2ABHA 4F3PA 1GV8A 3VV5A 4G68B 3SEVA 2AL4A 3JV9A 4HCWA 3P7IA 4FJPA 4PP0A 1LCFA 2DE4A 2DVZA 4ZEBA 3IOVA 3ZS6A 4O3BA 4O3AA 3RN8A 1B6HA 2QS3A 3T66A 4YAHX 3N26A 4OHNA 1SQYA 4N13A 3MW0A 1I6AA 1MY1A 2F6GA 4XTCQ 3CFZA 1N3XA 4YB5A 3QYTA 2YJPA 2HFBA 3TDJA 2ZNTA 1RYOA 4GFRA 4FAJA 2UYFA 1B2HA 3N5LA 2OCUA 4OEVA 4NF5A 1US5A 1FW0A 1USYE 4PQJA 5LOMA 3OO7A 4AB6A 5HBCA 1FCKA 3L6HA 5AA1A 4ESXA 3MJNA 1PB8A 1NMUA 3RUMA 2RC7A 1VR5A 3Q28A 1XT8A 1FQFA 4KCDA 3FVOA 1UTHB 1IIWA 3LUYA 4ND9A 3RQTA 3IO4A 5A5XB 2H99A 4F1VA 4F3SA 4YICA 1QVSA 1A99A 4BDNA 1OLAA 2P2AA 4ZZAA 2O1MA 4I62A 2I4BA 2G93A 2HXWA 3PUVE 3O6IA 5L9OA 1MPBA 4WEDA 4I1DA 4LP2B 3IL1B 4XXUA 5CM6A 4H5GA 4R2FA 1DTZA 3U72A 2XXYA 1MXUA 1JNFA 4R6YA 1TFAA 1XOCA 2F6PA 2RCBA 5CMBA 1XVXA 3OOAA 3PPOA 3M3LA 3IO6A 4ZE8A 1PBPA 3O28A 3VLUA 3T9HB 1ZIUA 3MPLA 2RC8A 4UACA 2QS4A 3T9XB 3G3GA 3TMGA 1UQWA 4BDQA 1Y20A 4QSCA 4QFPA 4BDOA 1P1UA 3C32A 4BDMA 3SETA 1MXWA 3MZ9A 1HSEA 2REJA 3ECRA 4C1UA 2Y7RA 2HZLA 2H25A 1Y1MA 4OTEA 2XXTA 4IGTA 2V84A 4MLQA 1NH7A 2QS2A 5ICTA 2F78A 1EZPA 1DPEA 3MC2A 4U1OA 4I9DA 1A40A 2V25A 2ZYOA 4KQPA 2GHBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1B32 A;  1D3K A;  2F7C A;  1B1X A;  4RA1 A;  2OZZ A;  2DOJ A;  4JSO A;  5FHN A;  4AB5 A;  3TTK A;  2Z8E A;  4R9G A;  5ICQ A;  5CMM A;  1MS7 A;  3QUJ A;  1Z7M E;  2XD3 A;  4X48 A;  3C31 A;  4H65 A;  5HM4 B;  2I3W A;  1DSN A;  5DYH A;  2O7I A;  3C34 A;  2P0S A;  1JW4 A;  1POY 1;  1SI1 A;  1B7H A;  1A8E A;  4Z7E A;  3K00 A;  4NF5 B;  2W7Y A;  4H67 A;  1DPP A;  1BTJ A;  2ZYN A;  3RPW A;  1LFG A;  3UOR A;  2DXY A;  4OEU A;  3K6W A;  1UTB A;  2HAV A;  4DLD A;  5I56 A;  1NNP A;  2I58 A;  1ATG A;  5B7D A;  1MQD A;  3PPP A;  4TOZ A;  3KJT A;  5TU0 A;  3VE1 B;  1NFT A;  5IAI A;  4EXK A;  3TQL A;  1UIV A;  4JSD A;  3ODB A;  3L6G A;  1ZLQ A;  4LUB A;  1R1N A;  1OMP A;  3D4G A;  1JW5 A;  4OXV A;  2V3U A;  3MAM A;  3ZKL A;  1O7T A;  2Q88 A;  1ELJ A;  1QKB A;  3K4U A;  2WKY A;  1MDQ A;  4IGR A;  4QFL A;  1JET A;  4G77 A;  1ANF A;  4U21 A;  4LVQ A;  5ITP A;  3OXN A;  3FZV A;  1LFH A;  3B6Q A;  3LC8 A;  2I0B A;  1B4H A;  1MDP 1;  1P1N A;  1A55 A;  2F7A A;  5TPA A;  2F35 A;  2Q9T A;  4YKI A;  3PPQ A;  2QL3 A;  1II5 A;  1TT1 A;  3KN7 A;  3LR1 A;  5KZT A;  5CMC A;  3FJM A;  4OMB A;  4ONY A;  1B0H A;  3H6V A;  1B51 A;  3S9L C;  1OQH A;  2PMS A;  1MXZ A;  1I6Q A;  2XXH A;  3TPA A;  2NUV A;  4QSE A;  4TLM B;  2F97 A;  4LQ2 A;  2F8D A;  1QW0 A;  2G29 A;  5CC2 A;  2DE3 A;  2A5S A;  5AA2 D;  1EU8 A;  3PPR A;  2Q8J A;  2R9J A;  2I3V A;  4DE8 A;  1JEU A;  1N7X A;  4YKP A;  2P1S A;  3UGW A;  1LLS A;  1Y3P A;  1D4N A;  3CRB A;  3HHF A;  4FE8 A;  3E9X A;  4F31 B;  1FQE A;  3A3C A;  1R9Q A;  4YU0 A;  3VLW A;  5DT6 A;  4F3B A;  1B5H A;  5L9M A;  1P99 A;  1SBP A;  4Q5T A;  3H6U A;  3TAJ A;  3S9N C;  3SKP A;  1BLF A;  4JBZ A;  1L5T A;  3I6V A;  2UVG A;  2QSX A;  1SVX B;  4DXB A;  4HCY A;  4XKP A;  3PUX E;  3SEW A;  5EHM A;  1BKA A;  2Y7W A;  1P1O A;  1IZ1 A;  1POT A;  1UTB B;  3B6W A;  5I56 B;  3S2V A;  4XKQ A;  4PFY A;  4IO4 A;  3FIR A;  1A8F A;  4OFL A;  3H3G A;  3H06 B;  5I2K B;  3MVW A;  1PC3 A;  1SW1 A;  4R6H A;  4FOR A;  1PB7 A;  1XS5 A;  3OO9 A;  5FTI A;  1B52 A;  3PMX A;  4RNS A;  5DVF A;  5DVJ A;  1M5D A;  1I69 A;  2ZYM A;  4LAT A;  5TP9 B;  3KSX A;  3O2A A;  3S4U A;  3M3K A;  3TKD A;  3TCH A;  1ZTY A;  1B58 A;  1B3G A;  4HW8 A;  4Q0C A;  1NNT A;  3A09 A;  4U4X A;  3SER A;  2BJJ X;  1IUD A;  2O68 A;  2REG A;  5TPA B;  1EH3 A;  3OEN A;  4ECF A;  1M5E A;  2Z23 A;  3G3I A;  3E3K A;  4EUO A;  3C36 A;  3I3V A;  4GIZ A;  2V3T A;  1M5B A;  3QAX A;  4R6K A;  4YMB A;  3T9U A;  2PT1 A;  3MBP A;  5H8Q A;  3FJ7 A;  1B5I A;  2RKM A;  3GZG A;  2UVH A;  4RPN A;  3BFU A;  2Q2C A;  4PFW A;  4P0I A;  1FTL A;  3FVK A;  2DE2 A;  3U1O A;  4OWD A;  3CFX A;  1Y4C A;  4R72 A;  1LCT A;  2FYI A;  3VLV A;  3D4C A;  4BDR A;  1PB9 A;  2XHD A;  3MQ9 A;  3U8Q A;  4EQ7 A;  1FTK A;  4LZ5 A;  4BLA A;  3PMV A;  3TTM A;  2UVI A;  3CFL A;  4RJZ A;  2VD2 A;  1M5F A;  1NH8 A;  2H5Y A;  2I49 A;  4F29 A;  3U92 A;  3KJ7 A;  3N6T A;  4KD5 A;  3EN3 A;  2F36 A;  3HCQ A;  1F9B A;  4NF4 A;  3ONM A;  3HPI A;  4NF8 B;  3CSB A;  1AL3 A;  4EQB A;  1MM6 A;  5F1Q A;  5H8N A;  2M8C A;  2IA4 A;  1GR2 A;  4KYD A;  2O69 A;  3K01 A;  3KFM A;  1DTG A;  4P11 A;  1AH5 A;  3MZ1 A;  2QMW A;  4YKJ A;  3FGS A;  2QJE A;  2D21 A;  4MF3 A;  2XXP A;  2V93 A;  4NF6 B;  1FTJ A;  1IXC A;  2Y7K A;  3OMB A;  4QF9 A;  4MFI A;  1O63 A;  2Z8F A;  2AIX A;  4R9F A;  3JYR A;  3IX1 A;  4LA9 A;  5KDT A;  4IO3 A;  5ITO A;  3VVE A;  3KOT A;  1SW4 A;  3TTL A;  4Z0I A;  4ZZE A;  3G3J A;  2Q89 A;  3FD3 A;  1MXX A;  4H8J A;  4WKM A;  4OER A;  4LZ7 A;  4EDP A;  1FTM A;  1B7Z A;  3IR1 A;  3O97 A;  1B3F A;  3MVY A;  1TWY A;  3MVX A;  5JTY A;  2OJT A;  5AA3 A;  4OFJ A;  1N7W A;  4DZ1 A;  3V83 A;  1S9T A;  5H8S A;  4LON B;  3TTR A;  2DWA A;  1QUJ A;  2D3I A;  2O7U A;  2YPN A;  1D9V A;  5B70 A;  1B5J A;  1LB8 A;  3F11 A;  3TCG A;  2A5T A;  2I0C A;  1VFE A;  2QS1 A;  2QMX A;  1S7Y A;  3FVG A;  4H6D A;  3VDF A;  3K02 A;  1WOD A;  3IOR A;  1QKA A;  3H7M A;  3LSW A;  5CI5 A;  1SYI A;  2ONK E;  4DCY A;  4EF2 A;  2FA7 A;  1B4Z A;  1LBC A;  1IXI A;  5EYF A;  1YPN A;  4X1B A;  2RCA A;  3IJX B;  3MUQ A;  4F3G A;  3T93 B;  1FTO A;  4K3F A;  3IAZ A;  4RPO A;  1VFD A;  4ESW A;  1NNK A;  1AOV A;  3IK6 B;  2F7B A;  3MPK A;  2Y84 A;  2KLF A;  4JWY A;  3GBA A;  3TTN A;  4KYS A;  1N76 A;  2THI A;  3PPN A;  3O9P A;  4XKR A;  2DSF A;  1P1Q A;  4E0W A;  1IEJ A;  2H98 A;  4X9T A;  4HTG A;  5H8N B;  5I57 A;  2HEU A;  1H43 A;  3ZKK A;  1XC1 A;  4G4P A;  1N3W A;  4NTL A;  4GXA A;  2DQV A;  1DMB A;  5H8F A;  1JW1 A;  4GQO A;  4C1T A;  3IB2 A;  4GD5 A;  4L17 A;  3FAS A;  3PU5 A;  3TOD A;  3IJO B;  3HHG A;  3TEP A;  1HSL A;  1MPD A;  1OVT A;  3DP6 A;  5KDT B;  4H8I A;  4RK2 A;  1LFI A;  3RTW B;  3WAF A;  4DCX A;  4M1V A;  3DEL B;  1LBB A;  1GVC A;  3DP8 A;  5FHO A;  5JTY B;  3TEL A;  2R71 A;  1H76 A;  4GOT A;  1ZJL A;  5FHM A;  4G8H A;  3TCF A;  2B3F A;  2GHA A;  3W15 C;  4IY6 A;  4JXI A;  1LAG E;  4XKN A;  1BP5 A;  2O84 X;  2XXV A;  4KR5 A;  3V89 B;  1LAX A;  4OFO A;  4RK9 A;  4F18 A;  1FQC A;  2A5T B;  1YCJ A;  4ZED A;  4WEP A;  1R9L A;  3PD8 A;  3C9H A;  2AL5 A;  1MQI A;  4YB6 A;  2CMO A;  1EZO A;  5I58 A;  3MP6 A;  3CVG A;  3G7W A;  2VHA A;  1A7L A;  3TZA A;  1LGB C;  3FJG A;  1EZ9 A;  1MY2 A;  2VP1 A;  3O6H A;  3GBB A;  1NL5 A;  3ILT B;  3TQW A;  3RNN A;  4LQ5 A;  4POW A;  3VVF A;  1US4 A;  4G68 C;  1GGG A;  3K6V A;  3H6W A;  3OSQ A;  1WVJ A;  1SW5 A;  4H0W A;  4G8N A;  4MBP A;  2Y7P A;  2I6E A;  3EHT A;  1AIV A;  1MY4 A;  1QUL A;  1XVY A;  3LSF B;  2E1S A;  2DS9 A;  4F2O A;  4ELQ A;  4X1D A;  4ZEK A;  3C4M A;  1URD A;  4R75 A;  4XIG Q;  3HV1 A;  2PT2 A;  2XX8 A;  5I57 B;  3N94 A;  1BIY A;  3FVN A;  2VOZ A;  4F2Q A;  1P1W A;  1B3H A;  4FED A;  4M4G A;  3QUF A;  1IXG A;  1Y9U A;  3C35 A;  5H8F B;  3S9E A;  1YAE A;  4YKK A;  4R2B A;  2ONR A;  4GRK A;  3KG2 A;  4TQU Q;  3FXU A;  4GLI A;  1YTV A;  3HST A;  2ZNS A;  1MXY A;  4O3C A;  1OIB A;  3VVD A;  3OSR A;  3W9V A;  5I2N A;  1ZKB A;  1NKX A;  2DP8 A;  4GXS B;  4OQO A;  1MPC A;  2QPQ A;  2OLB A;  1B3L A;  1A54 A;  2DXR A;  3MZB A;  4JWO A;  4F1U A;  4PFU A;  3CI8 A;  3T9V A;  3HO7 A;  5I84 A;  4KPT A;  3DLN A;  4NWC A;  2HQ0 A;  3C33 A;  4OYV A;  3EHU A;  3OEL A;  2X7Q A;  3QSL A;  3GLB A;  2Z22 A;  1JVX A;  3O29 A;  1QJM A;  5KCJ A;  3IOW A;  3JZJ A;  3O6G A;  3OEM A;  4P0G A;  4DXU A;  4KYE A;  3IOT A;  3SEY A;  5CRY A;  4FAT A;  3VXB A;  1FQA A;  3QK6 A;  5I58 B;  1GTK A;  1HSJ A;  5JK4 A;  3H6T A;  3TYH A;  5AA4 A;  2UXA A;  3PV0 E;  1NNF A;  3K1P A;  3KEI A;  3G3F A;  3O66 A;  4OVJ A;  4FEB A;  1OVB A;  2DWJ A;  1IIT A;  2VD3 A;  2ZMB A;  3LBS A;  3LSL A;  3UN6 A;  1Z7N E;  2PX1 A;  3DP4 A;  1FQD A;  4E0X A;  3MP1 A;  4PFT A;  4YZZ A;  3SES A;  3U93 A;  4BDL A;  4F39 A;  4FIM A;  3PD9 A;  4PE5 B;  3CG3 A;  3K1N A;  5M2V A;  1TFD A;  4ZS9 A;  2Q2A A;  1UIU A;  2UYE A;  4NMY A;  1SW2 A;  2O1L A;  1RKM A;  2NOO A;  4Q30 B;  4MH5 A;  4QSD A;  3UIF A;  2RIN A;  4G8M A;  1USY H;  2ZNU A;  3EPE A;  3FV1 A;  2AYS A;  4U23 A;  3N6U A;  1IXH A;  4IY5 A;  4GL0 A;  1B05 A;  1D9Y A;  3TUS A;  4DIG A;  4NED A;  4ELO A;  2DWH A;  4OES A;  3SEX A;  1B1H A;  5AE4 A;  3CG1 A;  1MQH A;  2RC9 A;  3QIM A;  5AA2 A;  4RY1 A;  2HZK A;  1B46 A;  5I59 A;  3OD7 A;  1JQF A;  5L9S A;  3RT6 B;  1H45 A;  2ZYK A;  1SI0 A;  3FUZ A;  3ZSF A;  3I5O A;  3PUY E;  3W9W A;  4DXC A;  1Y3Q A;  5I2N B;  2RF1 A;  4AQ4 A;  1MQG A;  1PEB A;  1O64 A;  3WAE A;  1URG A;  5IKB A;  1B0L A;  3BFT A;  3KN8 A;  2O6A A;  4IO7 A;  4QFN A;  4G2Z A;  1LST A;  4IO2 A;  2V3Q A;  2OK2 A;  4H1X A;  1JEV A;  1LB9 A;  5H8Q B;  3R7X A;  2XX7 A;  3B6T A;  4IO5 A;  4KCC A;  3K1M A;  3H4Z A;  2DVC A;  2D5W A;  5KCJ B;  1LAH E;  2XX9 A;  3EQ1 A;  2FNC A;  3IOU A;  3DM0 A;  3K6X A;  2Z8D A;  1M5C A;  1OQG A;  2CZL A;  3FXQ A;  4KI0 E;  4Q8R A;  3U94 A;  4F22 A;  2H9B A;  3VFJ A;  5AA4 B;  5L8D A;  2IEE A;  2GH9 A;  3UK4 A;  1J1N A;  4DDD A;  3RLF E;  3OEK A;  4NF4 B;  1B40 A;  1PDA A;  1SDX A;  3Q25 A;  3RT8 A;  2ONS A;  1MXV A;  2LAO A;  3SEU A;  5K2Y A;  3T22 A;  3RGY A;  1MG1 A;  1R6Z A;  3TFL A;  4EXL A;  4ELR A;  1VE4 A;  3EF7 A;  1ZU0 A;  3USD A;  2DYX A;  2NVU B;  2XXW A;  4QRZ A;  4OET A;  1N84 A;  1QUI A;  5DEX A;  4THI A;  2X7P A;  3M8U A;  3QXM A;  1TXF A;  2PYY A;  1DOT A;  3A3U A;  1URS A;  4QHQ A;  3Q29 A;  3R6U A;  4NE4 A;  3Q27 A;  2PVU A;  5I2K A;  2OWS A;  1QUK A;  3IB1 A;  3FXR A;  4QFK A;  3PMW A;  3Q26 A;  4EF1 A;  2E0S A;  1B3E A;  3CSG A;  3VXC A;  3KN3 A;  4GL8 A;  5TP9 A;  3CIJ A;  1SYH A;  5AA2 B;  3S9M C;  5HPQ A;  1MY3 A;  5I59 B;  4JWX A;  4POX A;  3EHS A;  3H03 A;  5H8H A;  2R6G E;  4KHZ E;  2GRV A;  2XXR A;  2PBW A;  2UVJ A;  1SD3 A;  4TLL B;  3IB0 A;  4GWO A;  3AXF A;  2NWJ A;  2Y7I A;  4JDF A;  5DTB A;  5CBR A;  1WDN A;  2X26 A;  3V8X B;  5K2X A;  1ZMG A;  3KZG A;  1H44 A;  3R26 A;  1FQB A;  4IB2 A;  4WXJ A;  2HAU A;  4G68 A;  3KBR A;  5BWJ A;  4MLV A;  3B7D A;  3GXA A;  1S50 A;  3RY3 A;  2DWI A;  4ZDM A;  1Y3N A;  1CE2 A;  2HCA A;  4N07 A;  3K6U A;  4NWD A;  2F34 A;  2H4I A;  3BKI B;  1PBQ A;  3KOS A;  4C0R A;  3ILU B;  3E13 X;  1CB6 A;  1MH3 A;  4OEN A;  2ALU A;  4GF8 A;  4HS7 A;  4KFQ A;  2OBG A;  1MM7 A;  2B3B A;  4ZEF A;  3V5A A;  2ZXT A;  3PGF A;  2B65 A;  3E4R A;  1Y4T A;  3SDF A;  3UA8 A;  4ZEI A;  5FTH A;  2XXX A;  1Q1K A;  2VGQ A;  4EQ9 A;  1IQ7 A;  3RTF B;  4U4S A;  3MP8 A;  2XXQ A;  4UA8 A;  4YB7 A;  3FV2 A;  4NF8 A;  5CBS A;  3THI A;  2ANJ A;  3KSJ A;  4ZEC A;  3K2D A;  1MH4 A;  4U2R A;  1KWH A;  3T96 B;  4OZ9 A;  3HN0 A;  5BUU A;  1ZBM A;  5J1D A;  2F5X A;  5EHS A;  3KGC A;  3CR9 A;  4N6P A;  4PET A;  4NF6 A;  1JVY A;  2I48 A;  5JEI A;  4JB7 A;  1UTH A;  1B9J A;  4LZ8 A;  4ISU A;  1N0T A;  2ESN A;  2NXO A;  1Q35 A;  5DEX B;  2GFE A;  1MRP A;  3PUZ E;  5A5X A;  5CMK A;  4QFO A;  4FEC A;  2QRY A;  1MY0 A;  3M3F A;  4R74 A;  2I4C A;  4YMA A;  3K0V A;  4ELP A;  1Y1Z A;  4R73 A;  1T0K A;  3PUW E;  3MVZ A;  2OWT A;  4IO6 A;  4U1Z A;  1LAF E;  1OLC A;  3FAT A;  3OO8 A;  4RXL A;  3UP9 A;  1H3D A;  1AMF A;  5F7V A;  1MQJ A;  1B7U A;  3OO6 A;  5DVI A;  4GVO A;  3BBR A;  4F19 A;  1I6B A;  5H8H B;  2XXI A;  4F1Y A;  3G3K A;  1XHY A;  3G3H A;  5ELV A;  2O51 A;  2YLN A;  2XXU A;  4RYA A;  4U22 A;  1VSO A;  4H5F A;  1N04 A;  4ZE9 A;  3MWB A;  4I8C A;  3LSX A;  5ISU A;  1RYX A;  2XD2 A;  2ABH A;  4F3P A;  1GV8 A;  3VV5 A;  4G68 B;  3SEV A;  2AL4 A;  3JV9 A;  4HCW A;  3P7I A;  4FJP A;  4PP0 A;  1LCF A;  2DE4 A;  2DVZ A;  4ZEB A;  3IOV A;  3ZS6 A;  4O3B A;  4O3A A;  3RN8 A;  1B6H A;  2QS3 A;  3T66 A;  4YAH X;  3N26 A;  4OHN A;  1SQY A;  4N13 A;  3MW0 A;  1I6A A;  1MY1 A;  2F6G A;  4XTC Q;  3CFZ A;  1N3X A;  4YB5 A;  3QYT A;  2YJP A;  2HFB A;  3TDJ A;  2ZNT A;  1RYO A;  4GFR A;  4FAJ A;  2UYF A;  1B2H A;  3N5L A;  2OCU A;  4OEV A;  4NF5 A;  1US5 A;  1FW0 A;  1USY E;  4PQJ A;  5LOM A;  3OO7 A;  4AB6 A;  5HBC A;  1FCK A;  3L6H A;  5AA1 A;  4ESX A;  3MJN A;  1PB8 A;  1NMU A;  3RUM A;  2RC7 A;  1VR5 A;  3Q28 A;  1XT8 A;  1FQF A;  4KCD A;  3FVO A;  1UTH B;  1IIW A;  3LUY A;  4ND9 A;  3RQT A;  3IO4 A;  5A5X B;  2H99 A;  4F1V A;  4F3S A;  4YIC A;  1QVS A;  1A99 A;  4BDN A;  1OLA A;  2P2A A;  4ZZA A;  2O1M A;  4I62 A;  2I4B A;  2G93 A;  2HXW A;  3PUV E;  3O6I A;  5L9O A;  1MPB A;  4WED A;  4I1D A;  4LP2 B;  3IL1 B;  4XXU A;  5CM6 A;  4H5G A;  4R2F A;  1DTZ A;  3U72 A;  2XXY A;  1MXU A;  1JNF A;  4R6Y A;  1TFA A;  1XOC A;  2F6P A;  2RCB A;  5CMB A;  1XVX A;  3OOA A;  3PPO A;  3M3L A;  3IO6 A;  4ZE8 A;  1PBP A;  3O28 A;  3VLU A;  3T9H B;  1ZIU A;  3MPL A;  2RC8 A;  4UAC A;  2QS4 A;  3T9X B;  3G3G A;  3TMG A;  1UQW A;  4BDQ A;  1Y20 A;  4QSC A;  4QFP A;  4BDO A;  1P1U A;  3C32 A;  4BDM A;  3SET A;  1MXW A;  3MZ9 A;  1HSE A;  2REJ A;  3ECR A;  4C1U A;  2Y7R A;  2HZL A;  2H25 A;  1Y1M A;  4OTE A;  2XXT A;  4IGT A;  2V84 A;  4MLQ A;  1NH7 A;  2QS2 A;  5ICT A;  2F78 A;  1EZP A;  1DPE A;  3MC2 A;  4U1O A;  4I9D A;  1A40 A;  2V25 A;  2ZYO A;  4KQP A;  2GHB A; 
#chains in the Genus database with same CATH topology
 1NUX A;  1B32 A;  1D3K A;  2F7C A;  1B1X A;  4RA1 A;  2OZZ A;  2DOJ A;  4JSO A;  5FHN A;  4AB5 A;  3TTK A;  2Z8E A;  4R9G A;  5ICQ A;  5CMM A;  1MS7 A;  3QUJ A;  1Z7M E;  5EYH A;  5ET5 A;  2XD3 A;  4X48 A;  3C31 A;  4H65 A;  5HM4 B;  2I3W A;  2QFL A;  1DSN A;  5DYH A;  2O7I A;  3C34 A;  1LBY A;  2P0S A;  1JW4 A;  1SI1 A;  1POY 1;  1B7H A;  1A8E A;  4Z7E A;  3K00 A;  4NF5 B;  2W7Y A;  4H67 A;  1DPP A;  1BTJ A;  2ZYN A;  3RPW A;  1NUY A;  1LFG A;  3MYU A;  3UOR A;  2DXY A;  4OEU A;  3K6W A;  1UTB A;  2HAV A;  4DLD A;  5I56 A;  1NNP A;  2F3D A;  2I58 A;  1ATG A;  5B7D A;  1MQD A;  1XI6 A;  3PPP A;  4TOZ A;  3KJT A;  2L5V A;  5TU0 A;  3VE1 B;  4GWZ A;  4GWX A;  1NFT A;  5IAI A;  4EXK A;  3TQL A;  1UIV A;  1LBV A;  4JSD A;  3ODB A;  4HE0 A;  4XF5 A;  4FBP A;  3L6G A;  1ZLQ A;  4AS5 A;  4LUB A;  1IMC A;  1R1N A;  1OMP A;  3D4G A;  1JW5 A;  4OXV A;  2V3U A;  4JVC A;  3MAM A;  3ZKL A;  1O7T A;  2Q88 A;  1ELJ A;  1QKB A;  4PBQ A;  3K4U A;  2WKY A;  1MDQ A;  4IGR A;  4QFL A;  1JET A;  4G77 A;  1ANF A;  4U21 A;  4LVQ A;  5ITP A;  2XWO A;  3OXN A;  3FZV A;  1LFH A;  3B6Q A;  3LC8 A;  2I0B A;  1B4H A;  1MDP 1;  1P1N A;  1A55 A;  2F7A A;  5TPA A;  2F35 A;  2Q9T A;  4YKI A;  3PPQ A;  2QL3 A;  1II5 A;  1TT1 A;  3KN7 A;  3LR1 A;  3T0J A;  5KZT A;  2Y5K A;  5CMC A;  1LBW A;  3FJM A;  4OMB A;  4ONY A;  2WYK A;  1B0H A;  3H6V A;  1B51 A;  3S9L C;  3RPL A;  1OQH A;  2PMS A;  1MXZ A;  1I6Q A;  2XXH A;  3TPA A;  2NUV A;  1IMB A;  4QSE A;  4TLM B;  2F97 A;  4LQ2 A;  2F8D A;  1QW0 A;  2G29 A;  5CC2 A;  2DE3 A;  2A5S A;  5AA2 D;  1EU8 A;  3PPR A;  2Q8J A;  2R9J A;  2I3V A;  4DE8 A;  1JEU A;  1N7X A;  4YKP A;  2P1S A;  1FPG A;  1EYK A;  3UGW A;  1LLS A;  1Y3P A;  1D4N A;  4N4U A;  3CRB A;  3HHF A;  4FE8 A;  4HE2 A;  4MIJ A;  3E9X A;  2CEX A;  4NQ8 A;  4NN3 A;  4F31 B;  1YZ0 A;  1FQE A;  2PFY A;  3A3C A;  1RDZ A;  1K9Z A;  1R9Q A;  4YU0 A;  3VLW A;  5DT6 A;  1B5H A;  5L9M A;  1P99 A;  1SBP A;  4Q5T A;  3TAJ A;  3H6U A;  4F3B A;  3S9N C;  3SKP A;  1BLF A;  4JBZ A;  1L5T A;  4LN5 A;  3I6V A;  2UVG A;  2QSX A;  2ZZW A;  1SVX B;  4DXB A;  4HCY A;  4XKP A;  3PUX E;  3SEW A;  5EHM A;  1BKA A;  2Y7W A;  1P1O A;  1IZ1 A;  1POT A;  1UTB B;  3B6W A;  5I56 B;  3S2V A;  4XKQ A;  4OVP A;  4O8M A;  1LBX A;  4X04 A;  4I3E A;  4PFY A;  4IO4 A;  3FIR A;  1A8F A;  4PGN A;  4OFL A;  3H3G A;  3H06 B;  4P1E A;  5I2K B;  3MVW A;  1PC3 A;  1SW1 A;  4R6H A;  4FOR A;  1PB7 A;  1XS5 A;  3OO9 A;  5FTI A;  4NGU A;  1B52 A;  3PMX A;  1FPF A;  4RNS A;  5DVF A;  5DVJ A;  1M5D A;  3RYD A;  1I69 A;  2FHY A;  2ZYM A;  4LAT A;  5TP9 B;  3KSX A;  3O2A A;  3NOH A;  3S4U A;  3M3K A;  3TKD A;  3TCH A;  1ZTY A;  1B58 A;  1INP A;  1B3G A;  4HW8 A;  4Q0C A;  1NNT A;  3A09 A;  2V4C A;  4U4X A;  2FVZ A;  3SER A;  2BJJ X;  1IUD A;  2O68 A;  2KQZ A;  2REG A;  5TPA B;  1EH3 A;  2FIE A;  3OEN A;  4ECF A;  1M5E A;  2Z23 A;  3G3I A;  3E3K A;  4EUO A;  3C36 A;  3I3V A;  1FBH A;  4GIZ A;  2V3T A;  1M5B A;  3QAX A;  4R6K A;  4YMB A;  3T9U A;  2PT1 A;  3MBP A;  5H8Q A;  3FJ7 A;  1B5I A;  4G61 A;  4PF6 A;  2RKM A;  3GZG A;  2OWZ A;  2UVH A;  4RPN A;  3BFU A;  2Q2C A;  4PFW A;  4P0I A;  1IMF A;  1FTL A;  3FVK A;  2WEF A;  3CHG A;  2DE2 A;  3U1O A;  1FBG A;  4OWD A;  3CFX A;  1Y4C A;  4R72 A;  1LCT A;  2FYI A;  3VLV A;  3D4C A;  4BDR A;  1PB9 A;  2XHD A;  3MQ9 A;  3U8Q A;  4EQ7 A;  1FTK A;  4LZ5 A;  4BLA A;  1FJ9 A;  3PMV A;  3TTM A;  2UVI A;  3CFL A;  4RJZ A;  2VD2 A;  1M5F A;  1NH8 A;  4N6K A;  2H5Y A;  2I49 A;  4F29 A;  3U92 A;  3KJ7 A;  3N6T A;  4KD5 A;  3EN3 A;  2F36 A;  3HCQ A;  1F9B A;  4NF4 A;  5EQ9 A;  3ONM A;  3HPI A;  4NF8 B;  3CSB A;  1AL3 A;  4EQB A;  1MM6 A;  5F1Q A;  5H8N A;  2M8C A;  2IA4 A;  1GR2 A;  4KYD A;  2O69 A;  3K01 A;  3KFM A;  1DTG A;  4P11 A;  1AH5 A;  3MZ1 A;  2QMW A;  4YKJ A;  3FGS A;  4N8G A;  2QJE A;  2D21 A;  4MF3 A;  2QVV A;  2XXP A;  2V93 A;  4NF6 B;  1FTJ A;  1IXC A;  1NV6 A;  1FBP A;  2Y7K A;  3OMB A;  1KZ8 A;  4QF9 A;  5A5L A;  2OX3 A;  4MFI A;  5ET8 A;  1O63 A;  2Z8F A;  2AIX A;  4R9F A;  3JYR A;  3IX1 A;  4LA9 A;  5KDT A;  4IO3 A;  5ITO A;  4KXP A;  3VVE A;  5ET7 A;  3KOT A;  1SW4 A;  1FPI A;  3TTL A;  4Z0I A;  4ZZE A;  3G3J A;  2Q89 A;  3FD3 A;  1MXX A;  4H8J A;  4WKM A;  4OER A;  4LZ7 A;  4EDP A;  1FTM A;  1B7Z A;  3IR1 A;  3O97 A;  1B3F A;  3MVY A;  1TWY A;  3MVX A;  5JTY A;  2OJT A;  4GX4 A;  5AA3 A;  4OFJ A;  1N7W A;  4DZ1 A;  3V83 A;  1S9T A;  4HE1 A;  4N81 A;  2ZZX A;  1RDY A;  4PAF A;  4LON B;  5H8S A;  3TTR A;  3LUZ A;  2DWA A;  1NV2 A;  4GX6 A;  1QUJ A;  2HHM A;  2D3I A;  2O7U A;  4I3Y A;  2YPN A;  1D9V A;  5B70 A;  4PCD A;  1B5J A;  1LB8 A;  3F11 A;  3TCG A;  2A5T A;  2I0C A;  1VFE A;  2QS1 A;  2QMX A;  1S7Y A;  3FVG A;  4H6D A;  3VDF A;  3K02 A;  1WOD A;  3IOR A;  1QKA A;  3H7M A;  3LSW A;  5CI5 A;  1SYI A;  5IZ3 A;  2ONK E;  3FXB A;  4DCY A;  4EF2 A;  2FA7 A;  1B4Z A;  2CEY A;  1LBC A;  4GX3 A;  1D9Q A;  2FIX A;  3EKI A;  1IXI A;  2HPG A;  5EYF A;  1YPN A;  2QVU A;  4O7I A;  4X1B A;  2RCA A;  3IJX B;  3MUQ A;  4F3G A;  3T93 B;  3B50 A;  1FTO A;  4K3F A;  3IAZ A;  4RPO A;  1VFD A;  4ESW A;  1NNK A;  1AOV A;  3IK6 B;  2F7B A;  3MPK A;  1DBZ A;  2Y84 A;  2KLF A;  4N6D A;  4JWY A;  3GBA A;  3TTN A;  2PCR A;  4KYS A;  1N76 A;  1NV1 A;  2THI A;  3PPN A;  3O9P A;  4XKR A;  2F3B A;  3BIH A;  2DSF A;  1P1Q A;  4E0W A;  1IEJ A;  2H98 A;  4PDD A;  4X9T A;  3U65 A;  4HTG A;  5H8N B;  5I57 A;  4P8B A;  2HEU A;  1H43 A;  1NV7 A;  3ZKK A;  1XC1 A;  4G4P A;  4PTK A;  2WYP A;  1N3W A;  4NTL A;  4GXA A;  2DQV A;  1DMB A;  5H8F A;  1JW1 A;  4GQO A;  1FBD A;  4C1T A;  2WBB A;  3IB2 A;  3D1R A;  4GD5 A;  3E78 A;  4L17 A;  3FAS A;  3PU5 A;  3TOD A;  3IJO B;  3HHG A;  3TEP A;  1HSL A;  1MPD A;  1OVT A;  3DP6 A;  5KDT B;  1YYZ A;  4H8I A;  4RK2 A;  2XWI A;  1LFI A;  3RTW B;  3HFU A;  3WAF A;  4DCX A;  2XWK A;  4GWS A;  4M1V A;  3DEL B;  1LBB A;  4NAP A;  1GVC A;  3DP8 A;  5FHO A;  5JTY B;  3TEL A;  2R71 A;  1H76 A;  4GOT A;  1ZJL A;  5FHM A;  4G8H A;  3TCF A;  2B3F A;  2GHA A;  3W15 C;  4IY6 A;  4JXI A;  1LAG E;  1FPJ A;  4XKN A;  1BP5 A;  2O84 X;  2XXV A;  4KR5 A;  3V89 B;  1LAX A;  4OFO A;  4RK9 A;  1NV0 A;  4F18 A;  1SPI A;  1FQC A;  2A5T B;  1YCJ A;  4ZED A;  4WEP A;  1R9L A;  5F24 A;  4PAK A;  4PAI A;  4P3L A;  3PD8 A;  3C9H A;  2AL5 A;  1NUW A;  1MQI A;  4YB6 A;  2CMO A;  1EZO A;  5I58 A;  3MP6 A;  3CVG A;  3G7W A;  2VHA A;  1A7L A;  2ZZV A;  3TZA A;  1LGB C;  3FJG A;  5I5P A;  1EZ9 A;  1MY2 A;  1VDW A;  2VP1 A;  3O6H A;  3GBB A;  1NL5 A;  3ILT B;  3TQW A;  3RNN A;  1Q9D A;  4GWW A;  1FPK A;  4LQ5 A;  4POW A;  3VVF A;  1US4 A;  4G68 C;  1GGG A;  3K6V A;  3H6W A;  3OSQ A;  1WVJ A;  1SW5 A;  4OAN A;  4H0W A;  4G8N A;  4MBP A;  2Y7P A;  2I6E A;  5ET6 A;  3EHT A;  5IZ1 A;  1AIV A;  1MY4 A;  1QUL A;  1XVY A;  3LSF B;  2E1S A;  2DS9 A;  4N17 A;  4MMP A;  4F2O A;  4ELQ A;  1IMA A;  4X1D A;  4ZEK A;  3C4M A;  1URD A;  4R75 A;  4XIG Q;  3HV1 A;  2PT2 A;  2XX8 A;  5I57 B;  3FBP A;  3N94 A;  2Y5L A;  1BIY A;  3FVN A;  2VOZ A;  4F2Q A;  4GWU A;  1P1W A;  3ROJ A;  1NV3 A;  1B3H A;  4X8R A;  4FED A;  4M4G A;  4PF8 A;  3QUF A;  1IXG A;  1Y9U A;  3C35 A;  5H8F B;  3S9E A;  2MKZ A;  1YAE A;  4YKK A;  4R2B A;  2ONR A;  4GRK A;  2WX9 A;  3B8B A;  3KG2 A;  5FBP A;  4TQU Q;  3FXU A;  4GLI A;  1YTV A;  3HST A;  3MST A;  2ZNS A;  1MXY A;  4O3C A;  1OIB A;  3VVD A;  3GYY A;  3OSR A;  2B4M A;  3W9V A;  5I2N A;  1ZKB A;  4MJO A;  3ISP A;  1NKX A;  2DP8 A;  4GXS B;  4OQO A;  1MPC A;  2QPQ A;  2OLB A;  1B3L A;  1A54 A;  2DXR A;  3MZB A;  4JVI A;  4JWO A;  4F1U A;  4PFU A;  5EQ8 A;  3CI8 A;  2Q8M A;  3T9V A;  3HO7 A;  4PGP A;  5I84 A;  4KPT A;  3DLN A;  4NWC A;  2HQ0 A;  3C33 A;  4OYV A;  3EHU A;  3OEL A;  2X7Q A;  3QSL A;  3GLB A;  4I40 A;  2Z22 A;  1JVX A;  3RPL B;  3O29 A;  1QJM A;  5KCJ A;  3IOW A;  1NUZ A;  3JZJ A;  5DW8 A;  3O6G A;  1LEV A;  3OEM A;  4GWY A;  4P0G A;  4DXU A;  1FPB A;  4KYE A;  3IOT A;  2PFZ A;  3SEY A;  5CRY A;  4FAT A;  3VXB A;  1FQA A;  3QK6 A;  5I58 B;  1GTK A;  1HSJ A;  5JK4 A;  3H6T A;  2KR0 A;  3TYH A;  5AA4 A;  2UXA A;  3PV0 E;  1NNF A;  3K1P A;  4DI4 B;  2CZI A;  3KEI A;  2BJI A;  3G3F A;  4P47 A;  4QBA A;  2DDK A;  3O66 A;  4OVJ A;  4FEB A;  1OVB A;  2DWJ A;  1IIT A;  2VD3 A;  2ZMB A;  3LBS A;  3LSL A;  3UN6 A;  1Z7N E;  2VT5 A;  2PX1 A;  3DP4 A;  1FQD A;  4E0X A;  1IMD A;  3MP1 A;  4PFT A;  1FJ6 A;  4YZZ A;  2R8T A;  3SES A;  3U93 A;  4BDL A;  4F39 A;  4FIM A;  3PD9 A;  1KA0 A;  4PE5 B;  3CG3 A;  4XEQ A;  3K1N A;  2FBP A;  5M2V A;  1TFD A;  4ZS9 A;  2Q2A A;  1UIU A;  2UYE A;  4NMY A;  1SW2 A;  2O1L A;  4PE3 A;  1RKM A;  2NOO A;  4Q30 B;  4MH5 A;  4QSD A;  3UIF A;  2RIN A;  4G8M A;  1USY H;  2ZNU A;  3EPE A;  3FV1 A;  2AYS A;  4U23 A;  4AS4 A;  2GQ1 A;  1FBF A;  3N6U A;  1IXH A;  4IY5 A;  4GL0 A;  1B05 A;  3KBZ A;  1D9Y A;  3TUS A;  4DIG A;  4NED A;  4ELO A;  2DWH A;  4OES A;  3SEX A;  1B1H A;  5AE4 A;  3CG1 A;  4N8Y A;  1JP4 A;  1MQH A;  4DI3 D;  2RC9 A;  3QIM A;  5AA2 A;  4RY1 A;  2HZK A;  1K9Y A;  1B46 A;  5I59 A;  3OD7 A;  4PC9 A;  1JQF A;  5L9S A;  3RT6 B;  1H45 A;  2ZYK A;  1SI0 A;  1FBC A;  3FUZ A;  3ZSF A;  3I5O A;  3PUY E;  3W9W A;  4DXC A;  1Y3Q A;  5EQ7 A;  5I2N B;  2RF1 A;  4AQ4 A;  1MQG A;  1PEB A;  1O64 A;  3WAE A;  1URG A;  5IKB A;  1B0L A;  2Q74 A;  1EYJ A;  3BFT A;  3KN8 A;  2O6A A;  4IO7 A;  4QFN A;  4G2Z A;  1LST A;  2QVR A;  4IO2 A;  2V3Q A;  2OK2 A;  4H1X A;  1JEV A;  1LB9 A;  4MCO A;  5H8Q B;  1DK4 A;  3R7X A;  2XX7 A;  3B6T A;  4IO5 A;  4KCC A;  3K1M A;  3H4Z A;  4PFI A;  2DVC A;  2D5W A;  2VPO A;  5KCJ B;  1LAH E;  2XX9 A;  3EQ1 A;  2FNC A;  4PDH A;  3IOU A;  3DM0 A;  3K6X A;  2Z8D A;  1M5C A;  1OQG A;  2CZL A;  3FXQ A;  4KI0 E;  4Q8R A;  3U94 A;  4P1L A;  4F22 A;  2H9B A;  3VFJ A;  5AA4 B;  5L8D A;  2IEE A;  2GH9 A;  2B4L A;  3UK4 A;  1J1N A;  4DDD A;  4O7M A;  3RLF E;  3OEK A;  2VPN A;  4NF4 B;  1B40 A;  1PDA A;  1NI9 A;  1SDX A;  3Q25 A;  3RT8 A;  2ONS A;  1MXV A;  2LAO A;  3SEU A;  3SZP A;  5K2Y A;  3T22 A;  3RGY A;  1MG1 A;  1R6Z A;  3TFL A;  4EXL A;  4ELR A;  1VE4 A;  3EF7 A;  1ZU0 A;  3USD A;  2DYX A;  1RDX A;  2WBD A;  2NVU B;  2XXW A;  4QRZ A;  4OET A;  1N84 A;  5I3S A;  1QUI A;  5DEX A;  4THI A;  2X7P A;  3M8U A;  3QXM A;  4OVQ A;  1TXF A;  2PYY A;  1DOT A;  3A3U A;  3T1B A;  1URS A;  4QHQ A;  3Q29 A;  3R6U A;  4NE4 A;  1BK4 A;  3Q27 A;  2PVU A;  5I2K A;  2OWS A;  1QUK A;  3IB1 A;  2P3N A;  3FXR A;  4QFK A;  3PMW A;  3Q26 A;  4EF1 A;  4P56 A;  2E0S A;  1FPL A;  5LTC A;  1B3E A;  3CSG A;  4H46 A;  3VXC A;  2P3V A;  3KN3 A;  2XA5 A;  4GL8 A;  5TP9 A;  3CIJ A;  1SYH A;  5AA2 B;  3S9M C;  5HPQ A;  1MY3 A;  3QMF A;  5I59 B;  4JWX A;  4POX A;  3EHS A;  3H03 A;  4OVT A;  5H8H A;  4PFB A;  2R6G E;  4KHZ E;  2GRV A;  2XXR A;  4OVS A;  2PBW A;  2UVJ A;  1SD3 A;  4TLL B;  3IB0 A;  4GWO A;  3AXF A;  2NWJ A;  2Y7I A;  1YXI A;  4GBV A;  4JDF A;  5DTB A;  4GBW A;  5CBR A;  1WDN A;  2X26 A;  3V8X B;  5K2X A;  1ZMG A;  3KZG A;  2JJK A;  1H44 A;  3R26 A;  1FQB A;  4IB2 A;  4WXJ A;  2HAU A;  4G68 A;  3KBR A;  5BWJ A;  4MLV A;  3B7D A;  3GXA A;  1S50 A;  3RY3 A;  2DWI A;  4ZDM A;  4MX6 A;  1NV5 A;  1Y3N A;  1CE2 A;  2HCA A;  4N07 A;  3K6U A;  4NWD A;  2F34 A;  5EYG A;  5IZ3 B;  2H4I A;  3BKI B;  1PBQ A;  3KOS A;  1AWB A;  4C0R A;  4NF0 A;  3ILU B;  3E13 X;  1CB6 A;  1MH3 A;  4OEN A;  2ALU A;  4GF8 A;  4HS7 A;  1FTA A;  4KFQ A;  2OBG A;  1MM7 A;  2B3B A;  4ZEF A;  1KA1 A;  3V5A A;  2ZXT A;  3PGF A;  2B65 A;  3E4R A;  1Y4T A;  3SDF A;  3UA8 A;  4ZEI A;  5IZZ A;  5FTH A;  2XXX A;  1FPD A;  1Q1K A;  2VGQ A;  4EQ9 A;  1IQ7 A;  3RTF B;  4U4S A;  3MP8 A;  2XXQ A;  4HXV A;  4UA8 A;  3PTY A;  4YB7 A;  2XWV A;  3FV2 A;  4NF8 A;  5CBS A;  3THI A;  2ANJ A;  4N15 A;  3KSJ A;  4ZEC A;  3K2D A;  1MH4 A;  4U2R A;  1KWH A;  1G0H A;  3T96 B;  4OZ9 A;  3HN0 A;  5BUU A;  1ZBM A;  5J1D A;  2F5X A;  5EHS A;  3KGC A;  3CR9 A;  4N6P A;  4PET A;  4NF6 A;  1JVY A;  2I48 A;  5JEI A;  4JB7 A;  1UTH A;  1B9J A;  4LZ8 A;  4ISU A;  1N0T A;  2ESN A;  2NXO A;  1Q35 A;  5DEX B;  2GFE A;  1MRP A;  3PUZ E;  5A5X A;  5CMK A;  4QFO A;  4FEC A;  5ESY A;  2QRY A;  1MY0 A;  3M3F A;  4R74 A;  2I4C A;  4YMA A;  3K0V A;  4MEV A;  4ELP A;  1Y1Z A;  4R73 A;  1T0K A;  3PUW E;  3MVZ A;  5LDZ A;  2CZK A;  2OWT A;  4IO6 A;  4U1Z A;  4MNI A;  2CZH A;  1LAF E;  1OLC A;  3FAT A;  3OO8 A;  4RXL A;  3UP9 A;  1H3D A;  1AMF A;  5F7V A;  1MQJ A;  1B7U A;  3OO6 A;  5DVI A;  4GVO A;  1IME A;  3BBR A;  4F19 A;  1I6B A;  5H8H B;  2XXI A;  4F1Y A;  3G3K A;  4MNP A;  1XHY A;  3G3H A;  5ELV A;  2O51 A;  2YLN A;  2XXU A;  3KC0 A;  4RYA A;  4U22 A;  3IFC A;  1VSO A;  4H5F A;  1N04 A;  4ZE9 A;  3MWB A;  4I8C A;  3LSX A;  5ISU A;  1RYX A;  2XD2 A;  2ABH A;  4F3P A;  1GV8 A;  1DCU A;  3VV5 A;  4OVR A;  4G68 B;  3SEV A;  2AL4 A;  4JVD A;  4XFE A;  3JV9 A;  4HCW A;  5IM2 A;  4NX1 A;  4OA4 A;  3P7I A;  4FJP A;  4PFR A;  2XXK A;  4PP0 A;  1LCF A;  2DE4 A;  2HXR A;  2DVZ A;  4ZEB A;  3IOV A;  5T3J A;  3ZS6 A;  4O3B A;  4O3A A;  3RN8 A;  1B6H A;  2QS3 A;  3T66 A;  4YAH X;  3N26 A;  4OHN A;  1SQY A;  4N13 A;  3MW0 A;  1I6A A;  1MY1 A;  2F6G A;  4XTC Q;  3CFZ A;  1FSA A;  1N3X A;  4YB5 A;  3QYT A;  1G0I A;  2YJP A;  2HFB A;  3TDJ A;  2ZNT A;  1RYO A;  4GFR A;  4FAJ A;  5J16 A;  2UYF A;  1B2H A;  3N5L A;  2OCU A;  4O94 A;  4OEV A;  4NF5 A;  1US5 A;  1FW0 A;  4MAG A;  5EQA A;  5IGA A;  1USY E;  4MHF A;  4PQJ A;  5LOM A;  3OO7 A;  4AB6 A;  5HBC A;  4N91 A;  1FCK A;  3L6H A;  5AA1 A;  4ESX A;  3MJN A;  1PB8 A;  1NMU A;  3RUM A;  2RC7 A;  1VR5 A;  3Q28 A;  1XT8 A;  1FQF A;  4KCD A;  3FVO A;  1UTH B;  1IIW A;  4P9K A;  3LUY A;  1FBE A;  4ND9 A;  3RQT A;  3IO4 A;  5A5X B;  2H99 A;  4F1V A;  4F3S A;  4PBH A;  4YIC A;  1NV4 A;  1QVS A;  1A99 A;  4BDN A;  1OLA A;  1LBZ A;  2P2A A;  4ZZA A;  2O1M A;  4I62 A;  2I4B A;  3KC1 A;  2G93 A;  2HXW A;  3PUV E;  3O6I A;  1EYI A;  4NHB A;  5L9O A;  5I7I A;  1MPB A;  4WED A;  4NG7 A;  4I1D A;  4LP2 B;  3IL1 B;  4XXU A;  5CM6 A;  3A29 A;  4H5G A;  4R2F A;  1DTZ A;  3E79 A;  3U72 A;  2XXY A;  1MXU A;  1JNF A;  4R6Y A;  4H45 A;  1TFA A;  1XOC A;  2F6P A;  2RCB A;  5CMB A;  1XVX A;  3OOA A;  3PPO A;  3M3L A;  4UAB A;  3IO6 A;  4ZE8 A;  1PBP A;  3O28 A;  3VLU A;  1QGX A;  3T9H B;  1ZIU A;  3MPL A;  2RC8 A;  4UAC A;  2QS4 A;  3T9X B;  3G3G A;  3TMG A;  1UQW A;  4BDQ A;  1Y20 A;  1CNQ A;  4QSC A;  4QFP A;  4BDO A;  1P1U A;  3C32 A;  4BDM A;  3SET A;  1MXW A;  3MZ9 A;  1HSE A;  2REJ A;  3LV0 A;  3ECR A;  4C1U A;  2Y7R A;  2HZL A;  2H25 A;  1Y1M A;  4IR8 A;  4OTE A;  4MNC A;  2XXT A;  4IGT A;  2V84 A;  3IFA A;  1FRP A;  4MLQ A;  1NH7 A;  2QS2 A;  5ICT A;  1FPE A;  2F78 A;  1EZP A;  1DPE A;  4QXD A;  3MC2 A;  4U1O A;  4I9D A;  1A40 A;  2V25 A;  2ZYO A;  4KQP A;  2GHB A;  3BIG A; 
#chains in the Genus database with same CATH homology
 1B32 A;  1D3K A;  2F7C A;  1B1X A;  4RA1 A;  2OZZ A;  2DOJ A;  4JSO A;  5FHN A;  4AB5 A;  3TTK A;  2Z8E A;  4R9G A;  5ICQ A;  5CMM A;  1MS7 A;  3QUJ A;  1Z7M E;  2XD3 A;  4X48 A;  3C31 A;  4H65 A;  5HM4 B;  2I3W A;  1DSN A;  5DYH A;  2O7I A;  3C34 A;  2P0S A;  1JW4 A;  1POY 1;  1SI1 A;  1B7H A;  1A8E A;  4Z7E A;  3K00 A;  4NF5 B;  2W7Y A;  4H67 A;  1DPP A;  1BTJ A;  2ZYN A;  3RPW A;  1LFG A;  3UOR A;  2DXY A;  4OEU A;  3K6W A;  1UTB A;  2HAV A;  4DLD A;  5I56 A;  1NNP A;  2I58 A;  1ATG A;  5B7D A;  1MQD A;  3PPP A;  4TOZ A;  3KJT A;  5TU0 A;  3VE1 B;  1NFT A;  5IAI A;  4EXK A;  3TQL A;  1UIV A;  4JSD A;  3ODB A;  3L6G A;  1ZLQ A;  4LUB A;  1R1N A;  1OMP A;  3D4G A;  1JW5 A;  4OXV A;  2V3U A;  3MAM A;  3ZKL A;  1O7T A;  2Q88 A;  1ELJ A;  1QKB A;  3K4U A;  2WKY A;  1MDQ A;  4IGR A;  4QFL A;  1JET A;  4G77 A;  1ANF A;  4U21 A;  4LVQ A;  5ITP A;  3OXN A;  3FZV A;  1LFH A;  3B6Q A;  3LC8 A;  2I0B A;  1B4H A;  1MDP 1;  1P1N A;  1A55 A;  2F7A A;  5TPA A;  2F35 A;  2Q9T A;  4YKI A;  3PPQ A;  2QL3 A;  1II5 A;  1TT1 A;  3KN7 A;  3LR1 A;  5KZT A;  5CMC A;  3FJM A;  4OMB A;  4ONY A;  1B0H A;  3H6V A;  1B51 A;  3S9L C;  1OQH A;  2PMS A;  1MXZ A;  1I6Q A;  2XXH A;  3TPA A;  2NUV A;  4QSE A;  4TLM B;  2F97 A;  4LQ2 A;  2F8D A;  1QW0 A;  2G29 A;  5CC2 A;  2DE3 A;  2A5S A;  5AA2 D;  1EU8 A;  3PPR A;  2Q8J A;  2R9J A;  2I3V A;  4DE8 A;  1JEU A;  1N7X A;  4YKP A;  2P1S A;  3UGW A;  1LLS A;  1Y3P A;  1D4N A;  3CRB A;  3HHF A;  4FE8 A;  3E9X A;  4F31 B;  1FQE A;  3A3C A;  1R9Q A;  4YU0 A;  3VLW A;  5DT6 A;  4F3B A;  1B5H A;  5L9M A;  1P99 A;  1SBP A;  4Q5T A;  3H6U A;  3TAJ A;  3S9N C;  3SKP A;  1BLF A;  4JBZ A;  1L5T A;  3I6V A;  2UVG A;  2QSX A;  1SVX B;  4DXB A;  4HCY A;  4XKP A;  3PUX E;  3SEW A;  5EHM A;  1BKA A;  2Y7W A;  1P1O A;  1IZ1 A;  1POT A;  1UTB B;  3B6W A;  5I56 B;  3S2V A;  4XKQ A;  4PFY A;  4IO4 A;  3FIR A;  1A8F A;  4OFL A;  3H3G A;  3H06 B;  5I2K B;  3MVW A;  1PC3 A;  1SW1 A;  4R6H A;  4FOR A;  1PB7 A;  1XS5 A;  3OO9 A;  5FTI A;  1B52 A;  3PMX A;  4RNS A;  5DVF A;  5DVJ A;  1M5D A;  1I69 A;  2ZYM A;  4LAT A;  5TP9 B;  3KSX A;  3O2A A;  3S4U A;  3M3K A;  3TKD A;  3TCH A;  1ZTY A;  1B58 A;  1B3G A;  4HW8 A;  4Q0C A;  1NNT A;  3A09 A;  4U4X A;  3SER A;  2BJJ X;  1IUD A;  2O68 A;  2REG A;  5TPA B;  1EH3 A;  3OEN A;  4ECF A;  1M5E A;  2Z23 A;  3G3I A;  3E3K A;  4EUO A;  3C36 A;  3I3V A;  4GIZ A;  2V3T A;  1M5B A;  3QAX A;  4R6K A;  4YMB A;  3T9U A;  2PT1 A;  3MBP A;  5H8Q A;  3FJ7 A;  1B5I A;  2RKM A;  3GZG A;  2UVH A;  4RPN A;  3BFU A;  2Q2C A;  4PFW A;  4P0I A;  1FTL A;  3FVK A;  2DE2 A;  3U1O A;  4OWD A;  3CFX A;  1Y4C A;  4R72 A;  1LCT A;  2FYI A;  3VLV A;  3D4C A;  4BDR A;  1PB9 A;  2XHD A;  3MQ9 A;  3U8Q A;  4EQ7 A;  1FTK A;  4LZ5 A;  4BLA A;  3PMV A;  3TTM A;  2UVI A;  3CFL A;  4RJZ A;  2VD2 A;  1M5F A;  1NH8 A;  2H5Y A;  2I49 A;  4F29 A;  3U92 A;  3KJ7 A;  3N6T A;  4KD5 A;  3EN3 A;  2F36 A;  3HCQ A;  1F9B A;  4NF4 A;  3ONM A;  3HPI A;  4NF8 B;  3CSB A;  1AL3 A;  4EQB A;  1MM6 A;  5F1Q A;  5H8N A;  2M8C A;  2IA4 A;  1GR2 A;  4KYD A;  2O69 A;  3K01 A;  3KFM A;  1DTG A;  4P11 A;  1AH5 A;  3MZ1 A;  2QMW A;  4YKJ A;  3FGS A;  2QJE A;  2D21 A;  4MF3 A;  2XXP A;  2V93 A;  4NF6 B;  1FTJ A;  1IXC A;  2Y7K A;  3OMB A;  4QF9 A;  4MFI A;  1O63 A;  2Z8F A;  2AIX A;  4R9F A;  3JYR A;  3IX1 A;  4LA9 A;  5KDT A;  4IO3 A;  5ITO A;  3VVE A;  3KOT A;  1SW4 A;  3TTL A;  4Z0I A;  4ZZE A;  3G3J A;  2Q89 A;  3FD3 A;  1MXX A;  4H8J A;  4WKM A;  4OER A;  4LZ7 A;  4EDP A;  1FTM A;  1B7Z A;  3IR1 A;  3O97 A;  1B3F A;  3MVY A;  1TWY A;  3MVX A;  5JTY A;  2OJT A;  5AA3 A;  4OFJ A;  1N7W A;  4DZ1 A;  3V83 A;  1S9T A;  5H8S A;  4LON B;  3TTR A;  2DWA A;  1QUJ A;  2D3I A;  2O7U A;  2YPN A;  1D9V A;  5B70 A;  1B5J A;  1LB8 A;  3F11 A;  3TCG A;  2A5T A;  2I0C A;  1VFE A;  2QS1 A;  2QMX A;  1S7Y A;  3FVG A;  4H6D A;  3VDF A;  3K02 A;  1WOD A;  3IOR A;  1QKA A;  3H7M A;  3LSW A;  5CI5 A;  1SYI A;  2ONK E;  4DCY A;  4EF2 A;  2FA7 A;  1B4Z A;  1LBC A;  1IXI A;  5EYF A;  1YPN A;  4X1B A;  2RCA A;  3IJX B;  3MUQ A;  4F3G A;  3T93 B;  1FTO A;  4K3F A;  3IAZ A;  4RPO A;  1VFD A;  4ESW A;  1NNK A;  1AOV A;  3IK6 B;  2F7B A;  3MPK A;  2Y84 A;  2KLF A;  4JWY A;  3GBA A;  3TTN A;  4KYS A;  1N76 A;  2THI A;  3PPN A;  3O9P A;  4XKR A;  2DSF A;  1P1Q A;  4E0W A;  1IEJ A;  2H98 A;  4X9T A;  4HTG A;  5H8N B;  5I57 A;  2HEU A;  1H43 A;  3ZKK A;  1XC1 A;  4G4P A;  1N3W A;  4NTL A;  4GXA A;  2DQV A;  1DMB A;  5H8F A;  1JW1 A;  4GQO A;  4C1T A;  3IB2 A;  4GD5 A;  4L17 A;  3FAS A;  3PU5 A;  3TOD A;  3IJO B;  3HHG A;  3TEP A;  1HSL A;  1MPD A;  1OVT A;  3DP6 A;  5KDT B;  4H8I A;  4RK2 A;  1LFI A;  3RTW B;  3WAF A;  4DCX A;  4M1V A;  3DEL B;  1LBB A;  1GVC A;  3DP8 A;  5FHO A;  5JTY B;  3TEL A;  2R71 A;  1H76 A;  4GOT A;  1ZJL A;  5FHM A;  4G8H A;  3TCF A;  2B3F A;  2GHA A;  3W15 C;  4IY6 A;  4JXI A;  1LAG E;  4XKN A;  1BP5 A;  2O84 X;  2XXV A;  4KR5 A;  3V89 B;  1LAX A;  4OFO A;  4RK9 A;  4F18 A;  1FQC A;  2A5T B;  1YCJ A;  4ZED A;  4WEP A;  1R9L A;  3PD8 A;  3C9H A;  2AL5 A;  1MQI A;  4YB6 A;  2CMO A;  1EZO A;  5I58 A;  3MP6 A;  3CVG A;  3G7W A;  2VHA A;  1A7L A;  3TZA A;  1LGB C;  3FJG A;  1EZ9 A;  1MY2 A;  2VP1 A;  3O6H A;  3GBB A;  1NL5 A;  3ILT B;  3TQW A;  3RNN A;  4LQ5 A;  4POW A;  3VVF A;  1US4 A;  4G68 C;  1GGG A;  3K6V A;  3H6W A;  3OSQ A;  1WVJ A;  1SW5 A;  4H0W A;  4G8N A;  4MBP A;  2Y7P A;  2I6E A;  3EHT A;  1AIV A;  1MY4 A;  1QUL A;  1XVY A;  3LSF B;  2E1S A;  2DS9 A;  4F2O A;  4ELQ A;  4X1D A;  4ZEK A;  3C4M A;  1URD A;  4R75 A;  4XIG Q;  3HV1 A;  2PT2 A;  2XX8 A;  5I57 B;  3N94 A;  1BIY A;  3FVN A;  2VOZ A;  4F2Q A;  1P1W A;  1B3H A;  4FED A;  4M4G A;  3QUF A;  1IXG A;  1Y9U A;  3C35 A;  5H8F B;  3S9E A;  1YAE A;  4YKK A;  4R2B A;  2ONR A;  4GRK A;  3KG2 A;  4TQU Q;  3FXU A;  4GLI A;  1YTV A;  3HST A;  2ZNS A;  1MXY A;  4O3C A;  1OIB A;  3VVD A;  3OSR A;  3W9V A;  5I2N A;  1ZKB A;  1NKX A;  2DP8 A;  4GXS B;  4OQO A;  1MPC A;  2QPQ A;  2OLB A;  1B3L A;  1A54 A;  2DXR A;  3MZB A;  4JWO A;  4F1U A;  4PFU A;  3CI8 A;  3T9V A;  3HO7 A;  5I84 A;  4KPT A;  3DLN A;  4NWC A;  2HQ0 A;  3C33 A;  4OYV A;  3EHU A;  3OEL A;  2X7Q A;  3QSL A;  3GLB A;  2Z22 A;  1JVX A;  3O29 A;  1QJM A;  5KCJ A;  3IOW A;  3JZJ A;  3O6G A;  3OEM A;  4P0G A;  4DXU A;  4KYE A;  3IOT A;  3SEY A;  5CRY A;  4FAT A;  3VXB A;  1FQA A;  3QK6 A;  5I58 B;  1GTK A;  1HSJ A;  5JK4 A;  3H6T A;  3TYH A;  5AA4 A;  2UXA A;  3PV0 E;  1NNF A;  3K1P A;  3KEI A;  3G3F A;  3O66 A;  4OVJ A;  4FEB A;  1OVB A;  2DWJ A;  1IIT A;  2VD3 A;  2ZMB A;  3LBS A;  3LSL A;  3UN6 A;  1Z7N E;  2PX1 A;  3DP4 A;  1FQD A;  4E0X A;  3MP1 A;  4PFT A;  4YZZ A;  3SES A;  3U93 A;  4BDL A;  4F39 A;  4FIM A;  3PD9 A;  4PE5 B;  3CG3 A;  3K1N A;  5M2V A;  1TFD A;  4ZS9 A;  2Q2A A;  1UIU A;  2UYE A;  4NMY A;  1SW2 A;  2O1L A;  1RKM A;  2NOO A;  4Q30 B;  4MH5 A;  4QSD A;  3UIF A;  2RIN A;  4G8M A;  1USY H;  2ZNU A;  3EPE A;  3FV1 A;  2AYS A;  4U23 A;  3N6U A;  1IXH A;  4IY5 A;  4GL0 A;  1B05 A;  1D9Y A;  3TUS A;  4DIG A;  4NED A;  4ELO A;  2DWH A;  4OES A;  3SEX A;  1B1H A;  5AE4 A;  3CG1 A;  1MQH A;  2RC9 A;  3QIM A;  5AA2 A;  4RY1 A;  2HZK A;  1B46 A;  5I59 A;  3OD7 A;  1JQF A;  5L9S A;  3RT6 B;  1H45 A;  2ZYK A;  1SI0 A;  3FUZ A;  3ZSF A;  3I5O A;  3PUY E;  3W9W A;  4DXC A;  1Y3Q A;  5I2N B;  2RF1 A;  4AQ4 A;  1MQG A;  1PEB A;  1O64 A;  3WAE A;  1URG A;  5IKB A;  1B0L A;  3BFT A;  3KN8 A;  2O6A A;  4IO7 A;  4QFN A;  4G2Z A;  1LST A;  4IO2 A;  2V3Q A;  2OK2 A;  4H1X A;  1JEV A;  1LB9 A;  5H8Q B;  3R7X A;  2XX7 A;  3B6T A;  4IO5 A;  4KCC A;  3K1M A;  3H4Z A;  2DVC A;  2D5W A;  5KCJ B;  1LAH E;  2XX9 A;  3EQ1 A;  2FNC A;  3IOU A;  3DM0 A;  3K6X A;  2Z8D A;  1M5C A;  1OQG A;  2CZL A;  3FXQ A;  4KI0 E;  4Q8R A;  3U94 A;  4F22 A;  2H9B A;  3VFJ A;  5AA4 B;  5L8D A;  2IEE A;  2GH9 A;  3UK4 A;  1J1N A;  4DDD A;  3RLF E;  3OEK A;  4NF4 B;  1B40 A;  1PDA A;  1SDX A;  3Q25 A;  3RT8 A;  2ONS A;  1MXV A;  2LAO A;  3SEU A;  5K2Y A;  3T22 A;  3RGY A;  1MG1 A;  1R6Z A;  3TFL A;  4EXL A;  4ELR A;  1VE4 A;  3EF7 A;  1ZU0 A;  3USD A;  2DYX A;  2NVU B;  2XXW A;  4QRZ A;  4OET A;  1N84 A;  1QUI A;  5DEX A;  4THI A;  2X7P A;  3M8U A;  3QXM A;  1TXF A;  2PYY A;  1DOT A;  3A3U A;  1URS A;  4QHQ A;  3Q29 A;  3R6U A;  4NE4 A;  3Q27 A;  2PVU A;  5I2K A;  2OWS A;  1QUK A;  3IB1 A;  3FXR A;  4QFK A;  3PMW A;  3Q26 A;  4EF1 A;  2E0S A;  1B3E A;  3CSG A;  3VXC A;  3KN3 A;  4GL8 A;  5TP9 A;  3CIJ A;  1SYH A;  5AA2 B;  3S9M C;  5HPQ A;  1MY3 A;  5I59 B;  4JWX A;  4POX A;  3EHS A;  3H03 A;  5H8H A;  2R6G E;  4KHZ E;  2GRV A;  2XXR A;  2PBW A;  2UVJ A;  1SD3 A;  4TLL B;  3IB0 A;  4GWO A;  3AXF A;  2NWJ A;  2Y7I A;  4JDF A;  5DTB A;  5CBR A;  1WDN A;  2X26 A;  3V8X B;  5K2X A;  1ZMG A;  3KZG A;  1H44 A;  3R26 A;  1FQB A;  4IB2 A;  4WXJ A;  2HAU A;  4G68 A;  3KBR A;  5BWJ A;  4MLV A;  3B7D A;  3GXA A;  1S50 A;  3RY3 A;  2DWI A;  4ZDM A;  1Y3N A;  1CE2 A;  2HCA A;  4N07 A;  3K6U A;  4NWD A;  2F34 A;  2H4I A;  3BKI B;  1PBQ A;  3KOS A;  4C0R A;  3ILU B;  3E13 X;  1CB6 A;  1MH3 A;  4OEN A;  2ALU A;  4GF8 A;  4HS7 A;  4KFQ A;  2OBG A;  1MM7 A;  2B3B A;  4ZEF A;  3V5A A;  2ZXT A;  3PGF A;  2B65 A;  3E4R A;  1Y4T A;  3SDF A;  3UA8 A;  4ZEI A;  5FTH A;  2XXX A;  1Q1K A;  2VGQ A;  4EQ9 A;  1IQ7 A;  3RTF B;  4U4S A;  3MP8 A;  2XXQ A;  4UA8 A;  4YB7 A;  3FV2 A;  4NF8 A;  5CBS A;  3THI A;  2ANJ A;  3KSJ A;  4ZEC A;  3K2D A;  1MH4 A;  4U2R A;  1KWH A;  3T96 B;  4OZ9 A;  3HN0 A;  5BUU A;  1ZBM A;  5J1D A;  2F5X A;  5EHS A;  3KGC A;  3CR9 A;  4N6P A;  4PET A;  4NF6 A;  1JVY A;  2I48 A;  5JEI A;  4JB7 A;  1UTH A;  1B9J A;  4LZ8 A;  4ISU A;  1N0T A;  2ESN A;  2NXO A;  1Q35 A;  5DEX B;  2GFE A;  1MRP A;  3PUZ E;  5A5X A;  5CMK A;  4QFO A;  4FEC A;  2QRY A;  1MY0 A;  3M3F A;  4R74 A;  2I4C A;  4YMA A;  3K0V A;  4ELP A;  1Y1Z A;  4R73 A;  1T0K A;  3PUW E;  3MVZ A;  2OWT A;  4IO6 A;  4U1Z A;  1LAF E;  1OLC A;  3FAT A;  3OO8 A;  4RXL A;  3UP9 A;  1H3D A;  1AMF A;  5F7V A;  1MQJ A;  1B7U A;  3OO6 A;  5DVI A;  4GVO A;  3BBR A;  4F19 A;  1I6B A;  5H8H B;  2XXI A;  4F1Y A;  3G3K A;  1XHY A;  3G3H A;  5ELV A;  2O51 A;  2YLN A;  2XXU A;  4RYA A;  4U22 A;  1VSO A;  4H5F A;  1N04 A;  4ZE9 A;  3MWB A;  4I8C A;  3LSX A;  5ISU A;  1RYX A;  2XD2 A;  2ABH A;  4F3P A;  1GV8 A;  3VV5 A;  4G68 B;  3SEV A;  2AL4 A;  3JV9 A;  4HCW A;  3P7I A;  4FJP A;  4PP0 A;  1LCF A;  2DE4 A;  2DVZ A;  4ZEB A;  3IOV A;  3ZS6 A;  4O3B A;  4O3A A;  3RN8 A;  1B6H A;  2QS3 A;  3T66 A;  4YAH X;  3N26 A;  4OHN A;  1SQY A;  4N13 A;  3MW0 A;  1I6A A;  1MY1 A;  2F6G A;  4XTC Q;  3CFZ A;  1N3X A;  4YB5 A;  3QYT A;  2YJP A;  2HFB A;  3TDJ A;  2ZNT A;  1RYO A;  4GFR A;  4FAJ A;  2UYF A;  1B2H A;  3N5L A;  2OCU A;  4OEV A;  4NF5 A;  1US5 A;  1FW0 A;  1USY E;  4PQJ A;  5LOM A;  3OO7 A;  4AB6 A;  5HBC A;  1FCK A;  3L6H A;  5AA1 A;  4ESX A;  3MJN A;  1PB8 A;  1NMU A;  3RUM A;  2RC7 A;  1VR5 A;  3Q28 A;  1XT8 A;  1FQF A;  4KCD A;  3FVO A;  1UTH B;  1IIW A;  3LUY A;  4ND9 A;  3RQT A;  3IO4 A;  5A5X B;  2H99 A;  4F1V A;  4F3S A;  4YIC A;  1QVS A;  1A99 A;  4BDN A;  1OLA A;  2P2A A;  4ZZA A;  2O1M A;  4I62 A;  2I4B A;  2G93 A;  2HXW A;  3PUV E;  3O6I A;  5L9O A;  1MPB A;  4WED A;  4I1D A;  4LP2 B;  3IL1 B;  4XXU A;  5CM6 A;  4H5G A;  4R2F A;  1DTZ A;  3U72 A;  2XXY A;  1MXU A;  1JNF A;  4R6Y A;  1TFA A;  1XOC A;  2F6P A;  2RCB A;  5CMB A;  1XVX A;  3OOA A;  3PPO A;  3M3L A;  3IO6 A;  4ZE8 A;  1PBP A;  3O28 A;  3VLU A;  3T9H B;  1ZIU A;  3MPL A;  2RC8 A;  4UAC A;  2QS4 A;  3T9X B;  3G3G A;  3TMG A;  1UQW A;  4BDQ A;  1Y20 A;  4QSC A;  4QFP A;  4BDO A;  1P1U A;  3C32 A;  4BDM A;  3SET A;  1MXW A;  3MZ9 A;  1HSE A;  2REJ A;  3ECR A;  4C1U A;  2Y7R A;  2HZL A;  2H25 A;  1Y1M A;  4OTE A;  2XXT A;  4IGT A;  2V84 A;  4MLQ A;  1NH7 A;  2QS2 A;  5ICT A;  2F78 A;  1EZP A;  1DPE A;  3MC2 A;  4U1O A;  4I9D A;  1A40 A;  2V25 A;  2ZYO A;  4KQP A;  2GHB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...