4YL3A

Crystal structures of mpges-1 inhibitor complexes
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
146
structure length
146
Chain Sequence
b'VMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
molecule tags Isomerase/isomerase inhibitor
source organism Homo sapiens
publication title Crystal Structures of mPGES-1 Inhibitor Complexes Form a Basis for the Rational Design of Potent Analgesic and Anti-Inflammatory Therapeutics.
pubmed doi rcsb
total genus 63
structure length 146
sequence length 146
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4yl3A00
4JRZA 2PNOA 4WABA 3DWWA 3HKKA 4J7YA 3B29A 4NTAA 5K0IA 4AL1A 5HV9A 2H8AA 3LEOA 2UUHA 4JC7A 5BQGA 4BPMA 4YL3A 4YL0A 4YK5A 2Q7RA 2UUIA 5BQHA 5BQIA 4YL1A 4J7TA 4NTFA 4NTBA 3PCVA 4AL0A 4JCZA
chains in the Genus database with same CATH superfamily
4J30B 4YWQA 3T6GB 2L9JA 4Z9JA 2Y39A 2RSEB 4G7OF 1ZYRF 3SEOA 1M2VA 4EBKA 4HE8D 2VCAA 2KYHA 2PFDA 3LNRA 3N0TA 1QKRA 4PK4A 2XXAA 4BPMA 4ULWA 1M6TA 2QUPA 3VF0A 4I44A 1QQ3A 4MVQA 3GEIA 3U2LA 1EQ1A 3ZDLA 1UG7A 2XLHA 1HMDA 3U2MA 1JPJA 3JYHA 4FX5A 1WASA 2R05A 4AL0A 4JEBA 3M4BA 1OCCC 3W4YA 2YLGA 1RKEA 1DOWA 2EPMX 2J7PA 5FZTA 1LM3B 4LDRA 3M79A 3DJUB 4IGGA 1OKKA 3AJMA 1ST6A 1V74B 1LVKA 2R7OA 2NUPB 3DM5A 1M2OA 3S27A 1SYQA 3FAPB 5KYXA 3C63A 1T6UA 1Z23A 2KW3C 4O7GA 3AG4C 2GFHA 4LLEA 3ZQYA 4CS8C 3NRHA 2R7UA 4I3MA 3LS1A 4JC7A 1H9TA 3QVYA 4E0IA 3LAYA 1BZ4A 2L6GA 2YQYA 4OIOF 2L6HA 3RQFA 4YK5A 4R32A 3DE8A 1D0XA 5CI8A 2LIGA 3NKDA 1CGNA 2ASRA 3EG9B 4AX2A 4DVYP 3R2PA 3Q6NA 2H7VC 1MQVA 3AG3C 4MVRA 4RBNA 4HFKB 3L1MA 5A69A 4YN0B 2QTVA 3QVZA 3GANA 3U9MA 4CJOA 3MLGA 5E2QA 1YAUO 1LIHA 2J45A 3GEHA 3DWWA 4WJ0A 1NG1A 2EINC 3U5SA 4AK9A 1C03A 4E7SA 1QVXA 3DE9A 3VM6A 1OXKA 3EJNA 1I5NA 4L6RA 4NQFA 3SNHA 4EUKB 3RQEA 4G7HF 2CDQA 1E2XA 3MX3A 2Y3HA 2C03A 1HE1A 4CJGA 2J0WA 5COGA 3O39A 2Y3GA 4J32B 5COMA 1YLMA 2XLEA 3K66A 2R7SA 3K7DA 2R9RB 4OIRF 3IHUA 3UMKA 1G4US 3NG1A 3MBGA 4EWCA 2J9BA 4NTFA 3T9OA 4BJ6A 1V4AA 2XRHA 2Q3TA 2GWWA 4U5HA 3TOMA 1YJGA 1TFKB 3BRJA 4U5DE 1U0BB 3AG1C 4NC3A 1T01A 2B0HA 1E85A 1JRAA 3OEOA 3T6BA 1D1CA 1J8YF 4CDAA 2Y69C 3U8PA 2P61A 3WAQA 3UGOA 3S9OA 4YT8A 2CGEA 3OWTA 2FFHA 1E83A 1NFOA 2WZGA 4CBEA 2LK4A 2YHSA 2ZD9A 1K05A 1LS4A 1JOGA 2UUHA 3KL4A 2HMZA 4XEFA 3RKOF 1WOLA 3EG9A 4MTGA 1ZHTA 5KYYA 1FMVA 1O3UA 4P9TA 1OCRC 4GYTA 4CS9C 2Z15A 3H2UA 2AU5A 2NUTA 3U8VA 2OEXA 2UUIA 4LERA 2NSGA 3V5XA 3VYWA 3PDMP 1A7DA 2XLOA 4IAQA 3WODF 4IAOA 2MHRA 3H2VA 3KYJA 2QE9A 2YKZA 3UR3C 4CDYA 4ZLDA 1V55C 5COFA 1IZMA 1VB5A 1ORSC 2PNOA 2W4BA 2XM4A 4WABA 5L0HA 5E3AA 2H7BA 4CS9A 2YWAA 4IJJA 4KNWA 3HNKA 3DXJF 4G7ZF 3UMIA 4E7ZA 1PD1A 4JTDB 2CYDA 2Y3BA 3B0VC 1YA7O 3EGXA 4MVZA 2JX0A 1OW8A 3JCUQ 3TD7A 2NPUA 3JRMO 4N06A 3RYLA 5L0CA 2XLMA 5DQZA 4IB4A 5GPGB 2R7QA 4PJNA 2XXAB 2Y3DA 3TK0A 1LKXA 1Z6AA 4JVSA 3MYIA 1ZHXA 3L0IA 2OEVA 2M64A 2DYSC 4K7BA 2ZXPA 3U0CA 5DS4A 3QZCA 1XZPA 3S29A 1I4ZA 1CGOA 2IYLD 4N4WA 4PJMA 1U6HA 3SZRA 4KNVA 2AWYA 1YA9A 4E18A 3HTKC 1TWHA 2Q00A 1M56C 3K33A 4Q4ZF 4J7YA 4DVZA 3X2QC 3C7JA 3FVYA 5E33A 1K04A 1D1AA 2AVKA 2ETSA 2PBEA 3CZ6A 4K0DA 3ZTMA 2OU6A 2VCCA 3GEEA 4MW3A 3T4RA 4QI2A 1N1CA 2RD9A 3GODA 3AGTA 4RD9A 4NCQA 1G5ZA 4P9FA 5T1DB 2EPKX 1BBHA 2OOCA 1OXBA 4F4BA 3MYFA 3UNGC 3HLZA 3V5YA 1OR3A 2R03A 4YL1A 1Y6DA 1ZZPA 3A9CA 3HJCA 4U5BE 3TQOA 1NBBA 1GGQA 1PCXA 4BEJA 4KBLA 2OJED 5AC5A 3EGDB 2KGOA 2J9WA 1ORJA 1SMYF 3CSKA 2EIJC 3CEXA 3ITFA 3KPHA 1FAPB 3GORA 4RDAA 5T3WA 4JJFA 2PX0A 1LE2A 2HJ3A 3L8JA 3RFYA 3TJ6A 5HSWA 3B71A 2Q9BA 4CIPA 3ZVRA 4BG0A 2B0JA 4PFOA 4C3BA 1NLXA 1OCOC 3S28A 3DMDA 4XLNF 1BR1A 3SYNA 2D4UA 2A1DD 4MVUA 3TULA 4YJWA 2H8AA 2EPLX 2HSBA 4D4NA 2CNWA 3N24A 3EHMA 3ZWIA 2OQMA 4A2NB 4EHPA 3POVA 2G3VA 2HSQA 1MMGA 3E9VA 4IARA 1GM5A 5KYNA 2CW0F 2XLVA 2Q7RA 5JLIA 3RVYA 2A0UA 1JPNA 3K1HA 1MMAA 4JKVA 2O9XA 4OD4A 3CAXA 3W2WA 3C62A 3QMKA 1YARO 3EPVA 1BR2A 2L6FA 4O6MA 5L3VA 2IXNA 3ECSA 4JEAA 1LI7A 4JIOA 1U89A 2WB7A 3LEVA 3H65A 4JE9A 1E86A 2R02A 3WG7C 2X51A 1YVIA 3B9QA 3DI5A 1MMDA 4WGYA 3VRCA 4IWBA 1PV3A 4Z9IA 5JP7A 3W8IA 4BJ6C 5DLJA 4MTFA 2HFIA 1W2WA 3NMKA 4QI0A 1CGME 3JYYA 4YT5A 3WHNA 1ZU4A 1ZW2A 1S7ZA 1D1BA 4D4XA 5L0DA 2EPNA 1FMWA 3EGDA 2G62A 4KC9A 5BUOA 5A6KA 4P6IC 2LSEA 3OA1A 2Q9CA 1QSPA 1WTYA 3PCVA 3ABKC 3LUTB 4CSAC 2WZLA 2NUTB 1OQCA 4MVSA 2LQGA 1Z5ZA 1HW2A 2XM0A 4WGZA 3I5PA 2P0NA 1XWJA 1ZHWA 3L34A 3R7CA 4MS2A 2VC9A 2WVQA 3LJBA 1PD0A 3ABLC 1T6IA 1LPEA 1ORYA 5DVWA 3JSEO 3EH1A 1AUEA 4CX9A 2MYSA 1VYKA 3QW0A 4XQ1A 5F28E 5A6JA 3B0UX 4AL1A 4YT4A 3LEOA 1M57C 1TWAA 2A0BA 2DGJA 2WVNA 3EZIA 3O10A 5D91A 3S84A 1FFHA 2JD3A 2XL6A 3LS0A 2F22A 1ZHYA 2LP4A 1E84A 2HKVA 2MWQA 3ZQVA 3V5ZA 4G78A 1VLTA 3SXZA 4QDLA 2YZSA 3EGXB 1YYXA 3O55A 3N2ZB 5BQIA 3G4ZA 3SXYA 1YYJA 1ZW3A 3QW1A 5L3QA 1L3PA 4FAPB 1D0ZA 4UDVA 4IRUA 4XTKA 1KTMA 2BL2A 3US6A 2GDCA 4O79A 3E70C 1G4WR 2YL3A 5CI9A 5JSLA 2W4MA 2HJMA 4MVOA 4PJLA 1AEPA 1SZIA 2EILC 2HS5A 1HE9A 3HNIA 4Z9HA 3W2VA 2W9YA 3EZHA 4XWJA 5L0GA 2VH3A 4XPWA 2A6EF 4U5EE 5EK0A 5L0JA 3ASNC 2A68F 3C8GD 2R7WA 1A7EA 3F46A 2A69F 2QY9A 4JCHA 1T6QA 1YZCA 3LNMB 2ZXWC 1HW1A 4FESA 4JTCB 1LI5A 2YVKA 2HZ8A 3G50A 3DKAA 4XLPF 5CIVA 1C17M 3LLIA 2PX3A 5BQHA 4LLCA 2HV7A 1Y4CA 1OR2A 4J7TA 5DS6A 3FOPA 4U9DA 1V54C 2PP4A 2KSFA 1H6GA 1OCZC 3AQBA 1IW7F 3SP1A 3AQCA 3QTHA 4LDQA 4DBQA 5T3TA 4DRHB 5E3CA 2IM8A 4JRZA 4JW1A 4AE4B 2I8BA 4Q5SF 4U5CE 3Q7GA 3ZG1A 3M4CA 4W8PA 3RF3A 4CS8A 2R7TA 2XL8A 3FXHA 5HV9A 1KNYA 1RJ9B 1FFTC 1S05A 4EKWA 1CPRA 2AP3A 3K1IA 2G3KA 2OCCC 1HMOA 4K1OA 5DQTA 2DYRC 3NKEA 1SF8A 3VAYA 2OJQA 5JVEA 3SXKA 3X1OA 2IOQA 3HNJA 3EQLF 1NFNA 1BDJB 2YLDA 1OW7A 1F1MA 3ZC4A 256BA 3EFOB 3JTLO 4ZLCA 3DD7A 4C7OB 4JTAB 1JR8A 1O5HA 2YL1A 4C3EA 1O87A 2R25A 4PJJA 3GM2A 3ASOC 2YLIA 1T5OA 5A6AA 4I1OB 3GM3A 3GWNA 4DBRA 5F5FA 2C04A 4FWVA 3ZTZA 1LE4A 2VASA 3ABMC 1L7CA 2WVOA 1K40A 2WL8A 2ZXOA 1WGWA 4NTAA 4EIYA 3GM1A 1TFOB 3C18A 3FOOA 1SR2A 3JRTA 3RQGA 3IQ5A 5K0IA 1DOVA 2XLWA 1T9KA 1Z3IX 1VLSA 2L81A 3LLKA 1J8MF 4BJ5C 2YL0A 1EKYA 4U5FE 2BC5A 2IBFA 3DJNB 3FMSA 1R4TA 1EI7A 3ATPA 1R5ID 4OIQF 1Q0FA 1ZU5A 2EIMC 2KC3A 4LDKA 4XEVA 3TJ5A 2R7VA 4CS7A 4OINF 2P6VA 1RXQA 4MW8A 4ULVA 1Z63A 1MNEA 1TKNA 1H9GA 2CNWD 1HY5A 2OG2A 5TJ5E 4AE4A 4DXWA 4E0HA 3C8ZA 4BJTA 4I1MA 2YRFA 5JS5A 1JMWA 4ER9A 1YDIA 4O6YA 4CSAA 5B1AC 1CPQA 2A6HF 3KKBA 3NMIA 4GEHA 4JJGA 2ZPAA 1FR0A 1YZAA 1A7VA 2NG1A 1Q0KA 1XZQA 2BE5F 3W8HA 3UGPA 1RMVA 2J7PD 1D0YA 4G0HA 4JZAA 5JUAA 3EFOA 4W8KA 4BJ1A 1A41A 3TOLA 5DS5A 2GA0A 2CCYA 2XSEA 3T6JA 1Q0MA 1RKEB 3F47A 1ZVZA 2QNLA 4U5GA 1VYIA 1WWPA 2FGYA 4JURI 5EGYA 4NTBA 2PF4E 2KJGA 1NU7D 5JT4A 4NY3A 3DZAA 4N6HA 3K6BA 3O6XA 3IQCA 3Q6MA 2IXMA 3KMIA 3ZSUA 3GWLA 2V26A 1NSGB 1Q0GA 4ANJA 1VTMP 4HEAJ 4PFPA 2J8WA 3I4UA 4GQHA 5IY5C 2DB4A 2YEVA 3HKKA 5B3SC 4O6NA 1LS1A 3B29A 3DAFA 1OKKD 1RKCA 3K1IC 3LESA 3CQZA 1OW6A 3U9JA 3IQ6A 4N6CA 1A0BA 2Q9AA 3NMJA 4PR9A 5D92A 4DJ9A 3DM9B 5KYUB 1FNTc 1VOMA 3EH2A 2KK1A 2TMVP 2LD6A 1FTSA 1H7IA 3RW0A 3M1CB 3NYLA 2LCHA 2XS1A 2JPUA 2IXPA 2FAPB 3G4XA 1C02A 4X0RA 1MNDA 4H4KC 3U3BA 2KNHA 4HFFB 2R7RA 4B6IA 3AG2C 4BEMJ 1WATA 2M4EA 5F5HA 2ZXRA 4EBBA 4MTOA 4LACB 1QZXA 2J46A 1AVOB 2I15A 2HV6A 2LFDA 1GQAA 1MMNA 3AGUA 1VMAA 3C8GA 3I5QA 3L8IA 3SXMA 4A4AA 2Q4FA 2YL7A 3NYJA 4M63A 2HUJA 4OIPF 1Q0DA 4E17A 5KYWB 2P1AA 3IPMO 2AWCA 1QPUA 1NZEA 3EHNA 5BQGA 4OD5A 3JZ0A 1ZHZA 3MFNA 3ZIBA 3NDBB 2VB6A 4XEKA 1M2VB 5L0FA 1TR2A 1RJ9A 1KU2A 4MVMA 4YL0A 3NYMA 4H54A 3UMHA 1Z7Qc 3KYIA 4DRJB 4YT2A 5AGFA 5FCLA 3HNLA 3S90A 1APCA 4KI2A 3RH3A 1NU9C 2QLAA 2R7XA 3RVZA 5B1BC 5A6BD 5AC4A 2OKUA 3AOUA 5JRAA 2HMQA 3FDQA 2ICWG 4JCZA 2KQ9A 3M15A 4XPYA 4C3DA 3PHF2 1BR4A 4U9EA 2LFFA 4ONSA 2VCBA 4MQ9F 4DRIB 4C7OA 4CDVA 1TQGA 2NSFA 5KYUA 2J9UA 1TWCA 3BEHA 3V7OA 5B3IA 2P7VA 3PMRA 5KYYB 3DAGA 2EPOA 2NUPA 4MNDA 2XLDA 2EIKC 2H7OA 2E87A 3FHDA 3Q7LA 4CIHA 5KYXB 3FAJA 3KH2A 1TWGA 1QLEC 4PACA 4EBJA 3IQTA 2D5RB 5A6BA 4YL3A 2X0CA 1B68A 2DI3A 3U3FA 5L0IA 5EHHA 3S0XA 3JSZA 3B0PA 2V3CC 2L7AA 1GS9A 3J06A 3JT1A 1UFBA 3C8GB 2XL4A 1EA8A 1G8XA 2J9VA 2GAQA 3RIPA 1VK5A 1I4YA 2IXOA 2WZFA 4XPXA 2J0XA 1WN0A 2XS8A 4Q7CA 4DOZA 1JAFA 5KYWA 3A11A 3IEEA 2W45A 1RCPA 4BJ5A
chains in the Genus database with same CATH topology
4JRZA 2PNOA 4WABA 3DWWA 3HKKA 4J7YA 3B29A 4NTAA 5K0IA 4AL1A 5HV9A 2H8AA 3LEOA 2UUHA 4JC7A 5BQGA 4BPMA 4YL3A 4YL0A 4YK5A 2Q7RA 2UUIA 5BQHA 5BQIA 4YL1A 4J7TA 4NTFA 4NTBA 3PCVA 4AL0A 4JCZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JRZ A;  2PNO A;  4WAB A;  3DWW A;  3HKK A;  4J7Y A;  3B29 A;  4NTA A;  5K0I A;  4AL1 A;  5HV9 A;  2H8A A;  3LEO A;  2UUH A;  4JC7 A;  5BQG A;  4BPM A;  4YL3 A;  4YL0 A;  4YK5 A;  2Q7R A;  2UUI A;  5BQH A;  5BQI A;  4YL1 A;  4J7T A;  4NTF A;  4NTB A;  3PCV A;  4AL0 A;  4JCZ A; 
#chains in the Genus database with same CATH topology
 4J30 B;  4YWQ A;  3T6G B;  2L9J A;  4Z9J A;  2Y39 A;  2RSE B;  4G7O F;  1ZYR F;  3SEO A;  1M2V A;  4EBK A;  4HE8 D;  2VCA A;  2KYH A;  2PFD A;  3LNR A;  3N0T A;  1QKR A;  4PK4 A;  2XXA A;  4BPM A;  4ULW A;  1M6T A;  2QUP A;  3VF0 A;  4I44 A;  1QQ3 A;  4MVQ A;  3GEI A;  3U2L A;  1EQ1 A;  3ZDL A;  1UG7 A;  2XLH A;  1HMD A;  3U2M A;  1JPJ A;  3JYH A;  4FX5 A;  1WAS A;  2R05 A;  4AL0 A;  4JEB A;  3M4B A;  1OCC C;  3W4Y A;  2YLG A;  1RKE A;  1DOW A;  2EPM X;  2J7P A;  5FZT A;  1LM3 B;  4LDR A;  3M79 A;  3DJU B;  4IGG A;  1OKK A;  3AJM A;  1ST6 A;  1V74 B;  1LVK A;  2R7O A;  2NUP B;  3DM5 A;  1M2O A;  3S27 A;  1SYQ A;  3FAP B;  5KYX A;  3C63 A;  1T6U A;  1Z23 A;  2KW3 C;  4O7G A;  3AG4 C;  2GFH A;  4LLE A;  3ZQY A;  4CS8 C;  3NRH A;  2R7U A;  4I3M A;  3LS1 A;  4JC7 A;  1H9T A;  3QVY A;  4E0I A;  3LAY A;  1BZ4 A;  2L6G A;  2YQY A;  4OIO F;  2L6H A;  3RQF A;  4YK5 A;  4R32 A;  3DE8 A;  1D0X A;  5CI8 A;  2LIG A;  3NKD A;  1CGN A;  2ASR A;  3EG9 B;  4AX2 A;  4DVY P;  3R2P A;  3Q6N A;  2H7V C;  1MQV A;  3AG3 C;  4MVR A;  4RBN A;  4HFK B;  3L1M A;  5A69 A;  4YN0 B;  2QTV A;  3QVZ A;  3GAN A;  3U9M A;  4CJO A;  3MLG A;  5E2Q A;  1YAU O;  1LIH A;  2J45 A;  3GEH A;  3DWW A;  4WJ0 A;  1NG1 A;  2EIN C;  3U5S A;  4AK9 A;  1C03 A;  4E7S A;  1QVX A;  3DE9 A;  3VM6 A;  1OXK A;  3EJN A;  1I5N A;  4L6R A;  4NQF A;  3SNH A;  4EUK B;  3RQE A;  4G7H F;  2CDQ A;  1E2X A;  3MX3 A;  2Y3H A;  2C03 A;  1HE1 A;  4CJG A;  2J0W A;  5COG A;  3O39 A;  2Y3G A;  4J32 B;  5COM A;  1YLM A;  2XLE A;  3K66 A;  2R7S A;  3K7D A;  2R9R B;  4OIR F;  3IHU A;  3UMK A;  1G4U S;  3NG1 A;  3MBG A;  4EWC A;  2J9B A;  4NTF A;  3T9O A;  4BJ6 A;  1V4A A;  2XRH A;  2Q3T A;  2GWW A;  4U5H A;  3TOM A;  1YJG A;  1TFK B;  3BRJ A;  4U5D E;  1U0B B;  3AG1 C;  4NC3 A;  1T01 A;  2B0H A;  1E85 A;  1JRA A;  3OEO A;  3T6B A;  1D1C A;  1J8Y F;  4CDA A;  2Y69 C;  3U8P A;  2P61 A;  3WAQ A;  3UGO A;  3S9O A;  4YT8 A;  2CGE A;  3OWT A;  2FFH A;  1E83 A;  1NFO A;  2WZG A;  4CBE A;  2LK4 A;  2YHS A;  2ZD9 A;  1K05 A;  1LS4 A;  1JOG A;  2UUH A;  3KL4 A;  2HMZ A;  4XEF A;  3RKO F;  1WOL A;  3EG9 A;  4MTG A;  1ZHT A;  5KYY A;  1FMV A;  1O3U A;  4P9T A;  1OCR C;  4GYT A;  4CS9 C;  2Z15 A;  3H2U A;  2AU5 A;  2NUT A;  3U8V A;  2OEX A;  2UUI A;  4LER A;  2NSG A;  3V5X A;  3VYW A;  3PDM P;  1A7D A;  2XLO A;  4IAQ A;  3WOD F;  4IAO A;  2MHR A;  3H2V A;  3KYJ A;  2QE9 A;  2YKZ A;  3UR3 C;  4CDY A;  4ZLD A;  1V55 C;  5COF A;  1IZM A;  1VB5 A;  1ORS C;  2PNO A;  2W4B A;  2XM4 A;  4WAB A;  5L0H A;  5E3A A;  2H7B A;  4CS9 A;  2YWA A;  4IJJ A;  4KNW A;  3HNK A;  3DXJ F;  4G7Z F;  3UMI A;  4E7Z A;  1PD1 A;  4JTD B;  2CYD A;  2Y3B A;  3B0V C;  1YA7 O;  3EGX A;  4MVZ A;  2JX0 A;  1OW8 A;  3JCU Q;  3TD7 A;  2NPU A;  3JRM O;  4N06 A;  3RYL A;  5L0C A;  2XLM A;  5DQZ A;  4IB4 A;  5GPG B;  2R7Q A;  4PJN A;  2XXA B;  2Y3D A;  3TK0 A;  1LKX A;  1Z6A A;  4JVS A;  3MYI A;  1ZHX A;  3L0I A;  2OEV A;  2M64 A;  2DYS C;  4K7B A;  2ZXP A;  3U0C A;  5DS4 A;  3QZC A;  1XZP A;  3S29 A;  1I4Z A;  1CGO A;  2IYL D;  4N4W A;  4PJM A;  1U6H A;  3SZR A;  4KNV A;  2AWY A;  1YA9 A;  4E18 A;  3HTK C;  1TWH A;  2Q00 A;  1M56 C;  3K33 A;  4Q4Z F;  4J7Y A;  4DVZ A;  3X2Q C;  3C7J A;  3FVY A;  5E33 A;  1K04 A;  1D1A A;  2AVK A;  2ETS A;  2PBE A;  3CZ6 A;  4K0D A;  3ZTM A;  2OU6 A;  2VCC A;  3GEE A;  4MW3 A;  3T4R A;  4QI2 A;  1N1C A;  2RD9 A;  3GOD A;  3AGT A;  4RD9 A;  4NCQ A;  1G5Z A;  4P9F A;  5T1D B;  2EPK X;  1BBH A;  2OOC A;  1OXB A;  4F4B A;  3MYF A;  3UNG C;  3HLZ A;  3V5Y A;  1OR3 A;  2R03 A;  4YL1 A;  1Y6D A;  1ZZP A;  3A9C A;  3HJC A;  4U5B E;  3TQO A;  1NBB A;  1GGQ A;  1PCX A;  4BEJ A;  4KBL A;  2OJE D;  5AC5 A;  3EGD B;  2KGO A;  2J9W A;  1ORJ A;  1SMY F;  3CSK A;  2EIJ C;  3CEX A;  3ITF A;  3KPH A;  1FAP B;  3GOR A;  4RDA A;  5T3W A;  4JJF A;  2PX0 A;  1LE2 A;  2HJ3 A;  3L8J A;  3RFY A;  3TJ6 A;  5HSW A;  3B71 A;  2Q9B A;  4CIP A;  3ZVR A;  4BG0 A;  2B0J A;  4PFO A;  4C3B A;  1NLX A;  1OCO C;  3S28 A;  3DMD A;  4XLN F;  1BR1 A;  3SYN A;  2D4U A;  2A1D D;  4MVU A;  3TUL A;  4YJW A;  2H8A A;  2EPL X;  2HSB A;  4D4N A;  2CNW A;  3N24 A;  3EHM A;  3ZWI A;  2OQM A;  4A2N B;  4EHP A;  3POV A;  2G3V A;  2HSQ A;  1MMG A;  3E9V A;  4IAR A;  1GM5 A;  5KYN A;  2CW0 F;  2XLV A;  2Q7R A;  5JLI A;  3RVY A;  2A0U A;  1JPN A;  3K1H A;  1MMA A;  4JKV A;  2O9X A;  4OD4 A;  3CAX A;  3W2W A;  3C62 A;  3QMK A;  1YAR O;  3EPV A;  1BR2 A;  2L6F A;  4O6M A;  5L3V A;  2IXN A;  3ECS A;  4JEA A;  1LI7 A;  4JIO A;  1U89 A;  2WB7 A;  3LEV A;  3H65 A;  4JE9 A;  1E86 A;  2R02 A;  3WG7 C;  2X51 A;  1YVI A;  3B9Q A;  3DI5 A;  1MMD A;  4WGY A;  3VRC A;  4IWB A;  1PV3 A;  4Z9I A;  5JP7 A;  3W8I A;  4BJ6 C;  5DLJ A;  4MTF A;  2HFI A;  1W2W A;  3NMK A;  4QI0 A;  1CGM E;  3JYY A;  4YT5 A;  3WHN A;  1ZU4 A;  1ZW2 A;  1S7Z A;  1D1B A;  4D4X A;  5L0D A;  2EPN A;  1FMW A;  3EGD A;  2G62 A;  4KC9 A;  5BUO A;  5A6K A;  4P6I C;  2LSE A;  3OA1 A;  2Q9C A;  1QSP A;  1WTY A;  3PCV A;  3ABK C;  3LUT B;  4CSA C;  2WZL A;  2NUT B;  1OQC A;  4MVS A;  2LQG A;  1Z5Z A;  1HW2 A;  2XM0 A;  4WGZ A;  3I5P A;  2P0N A;  1XWJ A;  1ZHW A;  3L34 A;  3R7C A;  4MS2 A;  2VC9 A;  2WVQ A;  3LJB A;  1PD0 A;  3ABL C;  1T6I A;  1LPE A;  1ORY A;  5DVW A;  3JSE O;  3EH1 A;  1AUE A;  4CX9 A;  2MYS A;  1VYK A;  3QW0 A;  4XQ1 A;  5F28 E;  5A6J A;  3B0U X;  4AL1 A;  4YT4 A;  3LEO A;  1M57 C;  1TWA A;  2A0B A;  2DGJ A;  2WVN A;  3EZI A;  3O10 A;  5D91 A;  3S84 A;  1FFH A;  2JD3 A;  2XL6 A;  3LS0 A;  2F22 A;  1ZHY A;  2LP4 A;  1E84 A;  2HKV A;  2MWQ A;  3ZQV A;  3V5Z A;  4G78 A;  1VLT A;  3SXZ A;  4QDL A;  2YZS A;  3EGX B;  1YYX A;  3O55 A;  3N2Z B;  5BQI A;  3G4Z A;  3SXY A;  1YYJ A;  1ZW3 A;  3QW1 A;  5L3Q A;  1L3P A;  4FAP B;  1D0Z A;  4UDV A;  4IRU A;  4XTK A;  1KTM A;  2BL2 A;  3US6 A;  2GDC A;  4O79 A;  3E70 C;  1G4W R;  2YL3 A;  5CI9 A;  5JSL A;  2W4M A;  2HJM A;  4MVO A;  4PJL A;  1AEP A;  1SZI A;  2EIL C;  2HS5 A;  1HE9 A;  3HNI A;  4Z9H A;  3W2V A;  2W9Y A;  3EZH A;  4XWJ A;  5L0G A;  2VH3 A;  4XPW A;  2A6E F;  4U5E E;  5EK0 A;  5L0J A;  3ASN C;  2A68 F;  3C8G D;  2R7W A;  1A7E A;  3F46 A;  2A69 F;  2QY9 A;  4JCH A;  1T6Q A;  1YZC A;  3LNM B;  2ZXW C;  1HW1 A;  4FES A;  4JTC B;  1LI5 A;  2YVK A;  2HZ8 A;  3G50 A;  3DKA A;  4XLP F;  5CIV A;  1C17 M;  3LLI A;  2PX3 A;  5BQH A;  4LLC A;  2HV7 A;  1Y4C A;  1OR2 A;  4J7T A;  5DS6 A;  3FOP A;  4U9D A;  1V54 C;  2PP4 A;  2KSF A;  1H6G A;  1OCZ C;  3AQB A;  1IW7 F;  3SP1 A;  3AQC A;  3QTH A;  4LDQ A;  4DBQ A;  5T3T A;  4DRH B;  5E3C A;  2IM8 A;  4JRZ A;  4JW1 A;  4AE4 B;  2I8B A;  4Q5S F;  4U5C E;  3Q7G A;  3ZG1 A;  3M4C A;  4W8P A;  3RF3 A;  4CS8 A;  2R7T A;  2XL8 A;  3FXH A;  5HV9 A;  1KNY A;  1RJ9 B;  1FFT C;  1S05 A;  4EKW A;  1CPR A;  2AP3 A;  3K1I A;  2G3K A;  2OCC C;  1HMO A;  4K1O A;  5DQT A;  2DYR C;  3NKE A;  1SF8 A;  3VAY A;  2OJQ A;  5JVE A;  3SXK A;  3X1O A;  2IOQ A;  3HNJ A;  3EQL F;  1NFN A;  1BDJ B;  2YLD A;  1OW7 A;  1F1M A;  3ZC4 A;  256B A;  3EFO B;  3JTL O;  4ZLC A;  3DD7 A;  4C7O B;  4JTA B;  1JR8 A;  1O5H A;  2YL1 A;  4C3E A;  1O87 A;  2R25 A;  4PJJ A;  3GM2 A;  3ASO C;  2YLI A;  1T5O A;  5A6A A;  4I1O B;  3GM3 A;  3GWN A;  4DBR A;  5F5F A;  2C04 A;  4FWV A;  3ZTZ A;  1LE4 A;  2VAS A;  3ABM C;  1L7C A;  2WVO A;  1K40 A;  2WL8 A;  2ZXO A;  1WGW A;  4NTA A;  4EIY A;  3GM1 A;  1TFO B;  3C18 A;  3FOO A;  1SR2 A;  3JRT A;  3RQG A;  3IQ5 A;  5K0I A;  1DOV A;  2XLW A;  1T9K A;  1Z3I X;  1VLS A;  2L81 A;  3LLK A;  1J8M F;  4BJ5 C;  2YL0 A;  1EKY A;  4U5F E;  2BC5 A;  2IBF A;  3DJN B;  3FMS A;  1R4T A;  1EI7 A;  3ATP A;  1R5I D;  4OIQ F;  1Q0F A;  1ZU5 A;  2EIM C;  2KC3 A;  4LDK A;  4XEV A;  3TJ5 A;  2R7V A;  4CS7 A;  4OIN F;  2P6V A;  1RXQ A;  4MW8 A;  4ULV A;  1Z63 A;  1MNE A;  1TKN A;  1H9G A;  2CNW D;  1HY5 A;  2OG2 A;  5TJ5 E;  4AE4 A;  4DXW A;  4E0H A;  3C8Z A;  4BJT A;  4I1M A;  2YRF A;  5JS5 A;  1JMW A;  4ER9 A;  1YDI A;  4O6Y A;  4CSA A;  5B1A C;  1CPQ A;  2A6H F;  3KKB A;  3NMI A;  4GEH A;  4JJG A;  2ZPA A;  1FR0 A;  1YZA A;  1A7V A;  2NG1 A;  1Q0K A;  1XZQ A;  2BE5 F;  3W8H A;  3UGP A;  1RMV A;  2J7P D;  1D0Y A;  4G0H A;  4JZA A;  5JUA A;  3EFO A;  4W8K A;  4BJ1 A;  1A41 A;  3TOL A;  5DS5 A;  2GA0 A;  2CCY A;  2XSE A;  3T6J A;  1Q0M A;  1RKE B;  3F47 A;  1ZVZ A;  2QNL A;  4U5G A;  1VYI A;  1WWP A;  2FGY A;  4JUR I;  5EGY A;  4NTB A;  2PF4 E;  2KJG A;  1NU7 D;  5JT4 A;  4NY3 A;  3DZA A;  4N6H A;  3K6B A;  3O6X A;  3IQC A;  3Q6M A;  2IXM A;  3KMI A;  3ZSU A;  3GWL A;  2V26 A;  1NSG B;  1Q0G A;  4ANJ A;  1VTM P;  4HEA J;  4PFP A;  2J8W A;  3I4U A;  4GQH A;  5IY5 C;  2DB4 A;  2YEV A;  3HKK A;  5B3S C;  4O6N A;  1LS1 A;  3B29 A;  3DAF A;  1OKK D;  1RKC A;  3K1I C;  3LES A;  3CQZ A;  1OW6 A;  3U9J A;  3IQ6 A;  4N6C A;  1A0B A;  2Q9A A;  3NMJ A;  4PR9 A;  5D92 A;  4DJ9 A;  3DM9 B;  5KYU B;  1FNT c;  1VOM A;  3EH2 A;  2KK1 A;  2TMV P;  2LD6 A;  1FTS A;  1H7I A;  3RW0 A;  3M1C B;  3NYL A;  2LCH A;  2XS1 A;  2JPU A;  2IXP A;  2FAP B;  3G4X A;  1C02 A;  4X0R A;  1MND A;  4H4K C;  3U3B A;  2KNH A;  4HFF B;  2R7R A;  4B6I A;  3AG2 C;  4BEM J;  1WAT A;  2M4E A;  5F5H A;  2ZXR A;  4EBB A;  4MTO A;  4LAC B;  1QZX A;  2J46 A;  1AVO B;  2I15 A;  2HV6 A;  2LFD A;  1GQA A;  1MMN A;  3AGU A;  1VMA A;  3C8G A;  3I5Q A;  3L8I A;  3SXM A;  4A4A A;  2Q4F A;  2YL7 A;  3NYJ A;  4M63 A;  2HUJ A;  4OIP F;  1Q0D A;  4E17 A;  5KYW B;  2P1A A;  3IPM O;  2AWC A;  1QPU A;  1NZE A;  3EHN A;  5BQG A;  4OD5 A;  3JZ0 A;  1ZHZ A;  3MFN A;  3ZIB A;  3NDB B;  2VB6 A;  4XEK A;  1M2V B;  5L0F A;  1TR2 A;  1RJ9 A;  1KU2 A;  4MVM A;  4YL0 A;  3NYM A;  4H54 A;  3UMH A;  1Z7Q c;  3KYI A;  4DRJ B;  4YT2 A;  5AGF A;  5FCL A;  3HNL A;  3S90 A;  1APC A;  4KI2 A;  3RH3 A;  1NU9 C;  2QLA A;  2R7X A;  3RVZ A;  5B1B C;  5A6B D;  5AC4 A;  2OKU A;  3AOU A;  5JRA A;  2HMQ A;  3FDQ A;  2ICW G;  4JCZ A;  2KQ9 A;  3M15 A;  4XPY A;  4C3D A;  3PHF 2;  1BR4 A;  4U9E A;  2LFF A;  4ONS A;  2VCB A;  4MQ9 F;  4DRI B;  4C7O A;  4CDV A;  1TQG A;  2NSF A;  5KYU A;  2J9U A;  1TWC A;  3BEH A;  3V7O A;  5B3I A;  2P7V A;  3PMR A;  5KYY B;  3DAG A;  2EPO A;  2NUP A;  4MND A;  2XLD A;  2EIK C;  2H7O A;  2E87 A;  3FHD A;  3Q7L A;  4CIH A;  5KYX B;  3FAJ A;  3KH2 A;  1TWG A;  1QLE C;  4PAC A;  4EBJ A;  3IQT A;  2D5R B;  5A6B A;  4YL3 A;  2X0C A;  1B68 A;  2DI3 A;  3U3F A;  5L0I A;  5EHH A;  3S0X A;  3JSZ A;  3B0P A;  2V3C C;  2L7A A;  1GS9 A;  3J06 A;  3JT1 A;  1UFB A;  3C8G B;  2XL4 A;  1EA8 A;  1G8X A;  2J9V A;  2GAQ A;  3RIP A;  1VK5 A;  1I4Y A;  2IXO A;  2WZF A;  4XPX A;  2J0X A;  1WN0 A;  2XS8 A;  4Q7C A;  4DOZ A;  1JAF A;  5KYW A;  3A11 A;  3IEE A;  2W45 A;  1RCP A;  4BJ5 A; 
#chains in the Genus database with same CATH homology
 4JRZ A;  2PNO A;  4WAB A;  3DWW A;  3HKK A;  4J7Y A;  3B29 A;  4NTA A;  5K0I A;  4AL1 A;  5HV9 A;  2H8A A;  3LEO A;  2UUH A;  4JC7 A;  5BQG A;  4BPM A;  4YL3 A;  4YL0 A;  4YK5 A;  2Q7R A;  2UUI A;  5BQH A;  5BQI A;  4YL1 A;  4J7T A;  4NTF A;  4NTB A;  3PCV A;  4AL0 A;  4JCZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...