4YL3A

Crystal structures of mpges-1 inhibitor complexes
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
146
structure length
146
Chain Sequence
VMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal Structures of mPGES-1 Inhibitor Complexes Form a Basis for the Rational Design of Potent Analgesic and Anti-Inflammatory Therapeutics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
molecule keywords Prostaglandin E synthase
total genus 63
structure length 146
sequence length 146
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4yl3A00
5BQGA 4J7YA 5HV9A 4NTFA 4YL0A 2UUHA 4NTBA 2H8AA 4YL1A 4JC7A 3HKKA 4WABA 3B29A 4J7TA 3PCVA 4BPMA 2UUIA 4JCZA 5BQIA 4YL3A 2PNOA 3DWWA 3LEOA 4AL1A 5K0IA 2Q7RA 4NTAA 5BQHA 4YK5A 4AL0A 4JRZA
chains in the Genus database with same CATH superfamily
1I5NA 2Q9BA 1VB5A 2HSQA 5A69A 3JZ0A 4ZLCA 1M56C 1O5HA 4MVOA 3RFYA 3LJBA 3T6BA 1QKRA 4K7BA 4ULVA 1JMWA 3AG4C 4H54A 2YRFA 4UDVA 1A7VA 3CEXA 5COGA 1TKNA 2KC3A 4CJGA 1NU7D 2CDQA 2EPOA 4I3MA 4JE9A 4D4XA 5JVEA 4FAPB 1FAPB 2OG2A 4DRJB 1BBHA 1VYIA 4GQHA 2WL8A 3LLIA 4JEAA 3UR3C 2J46A 1IW7F 3WG7C 2RD9A 3EG9A 4F4BA 4YT8A 4XEKA 2BC5A 3UMKA 1Z63A 4E0IA 3B0VC 4LLEA 4YT4A 5KYUA 4LDKA 3HJCA 3N2ZB 2ZD9A 3NRHA 4IARA 4MVUA 2VCCA 3WHNA 1QLEC 1OCCC 4YT5A 2W9YA 3AG1C 1ZYRF 2EIKC 3B9QA 3KYIA 4E0HA 1DOVA 4JEBA 2I8BA 3NG1A 4MQ9F 3U9JA 1XWJA 2HMZA 4Q7CA 2ASRA 4YL0A 3L8JA 2A0UA 4XPXA 4DVZA 2YVKA 2J9VA 4CIPA 5HSWA 3L0IA 3M4BA 3AOUA 1LI5A 1H9TA 4OD5A 4JC7A 2KW3C 1MMGA 3B29A 2CCYA 3NDBB 2PFDA 3LS1A 3F46A 2FFHA 2QLAA 5EHHA 4JCZA 2Y3HA 4NY3A 3OWTA 4XEFA 2LIGA 3DJUB 5D92A 4CSAC 1W2WA 1OCOC 2KQ9A 3ABLC 2L7AA 2NUPA 4D4NA 5F5HA 2G3VA 4U5HA 3DAGA 2W4BA 2AVKA 3ASNC 1JPJA 4AL0A 4BJ6C 1HE1A 1K04A 1G8XA 2LP4A 3WODF 3FOOA 1OXBA 2VH3A 3DM9B 1AUEA 4JW1A 3X1OA 4W8PA 1SMYF 3ABKC 4AK9A 5L3VA 4K1OA 3QTHA 4PJMA 4Q4ZF 3W2WA 1QPUA 2A6HF 1H6GA 5L0GA 4I44A 2OU6A 3QMKA 2PBEA 4IRUA 4MW8A 4WABA 3U0CA 4JTDB 1KNYA 2NUPB 4BPMA 2GA0A 2C03A 2FAPB 2YWAA 2LCHA 2WZLA 4PFOA 2P0NA 3LESA 1VTMP 3EHNA 1E85A 2PP4A 5B3SC 1K40A 1CPQA 1TWAA 4PR9A 2RSEB 2F22A 4P9TA 3QW1A 2EPLX 4U9DA 3V5ZA 4G7ZF 1Q0DA 3KYJA 4ONSA 3X2QC 2R7WA 1Q0KA 3U5SA 2JD3A 4BJ1A 1M2OA 3C18A 3R7CA 1LE2A 4XPYA 5D91A 4YJWA 4J7YA 1FFTC 2Y39A 1JRAA 3OEOA 4LLCA 3RIPA 3M79A 2CGEA 2O9XA 3RVZA 3ASOC 3GORA 4E17A 1HE9A 3N24A 4IGGA 5A6KA 5KYWB 3S90A 3EJNA 2Q9AA 3GM2A 2QUPA 2J0XA 2Q9CA 1BR4A 1H9GA 4OIQF 2L6HA 2NPUA 2XL8A 4FX5A 4LACB 3TJ5A 4CDYA 5B3IA 4ANJA 1DOWA 1YZAA 2HV6A 3H2VA 3DXJF 4U5FE 5DLJA 4BJ5A 4EHPA 1WTYA 1BR2A 5A6BA 3EG9B 4XWJA 4CSAA 4Q5SF 1KTMA 2HV7A 5K0IA 1HY5A 1LPEA 2XM0A 3T4RA 4CS7A 3AQBA 1M2VA 1OR2A 3FVYA 2AWCA 2ZXRA 4IJJA 4KC9A 5BQHA 3SXMA 1TR2A 2VASA 256BA 3I5QA 5BQGA 3S9OA 3G4XA 2ZXWC 3NMIA 3V7OA 1VMAA 2CNWA 3EZIA 2AP3A 3L34A 3QZCA 1TWGA 4WGYA 4CJOA 4DBRA 1S05A 3FHDA 5JT4A 2XL6A 1S7ZA 4EWCA 1QQ3A 3I4UA 5IY5C 2C04A 1YA9A 4XLNF 1BR1A 3T9OA 1NSGB 3HKKA 1T6UA 3S29A 4CBEA 3L1MA 4N06A 5L0JA 4Z9HA 5E2QA 3SXKA 3RQFA 3ZTMA 2PNOA 1OQCA 3M15A 1TFOB 3VF0A 2QY9A 2EIJC 4CS9A 1VYKA 3C62A 1WWPA 1C02A 5BUOA 3JRMO 3NMJA 1BDJB 3H2UA 3KKBA 5DQZA 1Q0FA 3O6XA 3NYJA 4IAOA 4U5GA 2H7BA 1ST6A 1MMAA 3H65A 3U8VA 5EGYA 2EPKX 3DKAA 2IXMA 1FNTc 1VOMA 2UUHA 4I1MA 4MVZA 3C8GD 1D1BA 1A7EA 1SR2A 3EZHA 4N4WA 3U2LA 3EHMA 4JURI 5JRAA 5L0HA 2GAQA 3U3FA 5FZTA 2OJQA 1ZHTA 3IHUA 2P6VA 2QNLA 3O55A 3U2MA 5KYYB 2PX3A 3TULA 4I1OB 2EPNA 1APCA 3LNMB 4JKVA 4B6IA 2XSEA 1V74B 4G7OF 2HZ8A 3DMDA 1EA8A 2LQGA 2NUTB 2YHSA 3HNLA 1UG7A 1GQAA 4N6CA 3ZG1A 4BEMJ 3ECSA 4PJJA 1XZPA 1OR3A 2EPMX 4MTFA 1A41A 1QSPA 3TQOA 4DVYP 4QDLA 2Z15A 1GM5A 3EGDB 2GFHA 2LSEA 4AE4B 1VK5A 1OW6A 3NKEA 2YZSA 5KYXA 1ORSC 4HEAJ 4MVRA 2DYRC 1QZXA 4AE4A 2NG1A 3ZSUA 4MW3A 2L6FA 2XM4A 1NG1A 4CS9C 1EKYA 4BEJA 4O6YA 2XXAB 1T01A 1T9KA 2HJ3A 2AU5A 4O6NA 1Z3IX 3HLZA 4PFPA 2R02A 4C7OA 3CQZA 2E87A 2YL3A 2EILC 5L0DA 2NUTA 4DRHB 4U5DE 3S0XA 4DBQA 1H7IA 3B0PA 2V3CC 4LDQA 2CYDA 2FGYA 3NYMA 4CDVA 1GS9A 4JVSA 3C8GB 2MYSA 2VCAA 3KMIA 3LNRA 4R32A 5E33A 3S27A 3UGOA 3AGTA 3QVYA 4EIYA 5JUAA 3JTLO 4E7SA 1E86A 2XLMA 3GWNA 4CDAA 2I15A 2V26A 3AQCA 3K1IA 1U6HA 3TK0A 2J7PA 1JOGA 5DS4A 2Q3TA 2R03A 4IB4A 1RKCA 3LAYA 4PJLA 3JYHA 3GM1A 1L7CA 3HNIA 2XLDA 2EINC 4C3BA 5FCLA 4DRIB 1RMVA 1D0YA 2XLHA 3A11A 1YVIA 3FAJA 4M63A 3ZC4A 3B0UX 2JX0A 3PDMP 3V5XA 2W45A 1YYJA 3ATPA 1EQ1A 4AL1A 5L0CA 1WGWA 4JCHA 5L0FA 3MYIA 2B0HA 2X51A 5COFA 3G50A 3NYLA 4YK5A 1PD0A 2IOQA 2G3KA 2OJED 1R5ID 3Q6MA 5AC4A 1E83A 2KYHA 2J9BA 3C63A 1M57C 4P9FA 3RW0A 4CIHA 3HNJA 4KBLA 2IXOA 4QI2A 4IAQA 3LEVA 3W8HA 2WVNA 1Z23A 2AWYA 4YL1A 1XZQA 2HFIA 1O3UA 2IYLD 1RKEA 1M2VB 1NBBA 3OA1A 3SXZA 5AGFA 1YA7O 3F47A 3SYNA 3UMHA 2R7XA 3MLGA 3AG3C 2VC9A 2J45A 3DE8A 3GEHA 2P7VA 2Q00A 3IQCA 1Z7Qc 1IZMA 4YL3A 4X0RA 5CIVA 4U5EE 4C3DA 1TWCA 3CAXA 3VM6A 4NCQA 1A0BA 4G0HA 1RKEB 1AVOB 1SZIA 3VAYA 1LE4A 3RF3A 1O87A 2OKUA 2Y3GA 3US6A 4U5CE 3EFOA 4JRZA 1G4US 5KYWA 2Y3BA 2M4EA 3EPVA 2YLIA 5A6AA 2R7QA 3WAQA 1PD1A 1ZU5A 3S84A 5GPGB 2HUJA 1YDIA 1PV3A 2Q4FA 2YQYA 1CPRA 4HE8D 1FTSA 3O10A 4U9EA 1YAUO 1ZHZA 4XQ1A 4A2NB 3JT1A 1V4AA 1WOLA 1VLTA 3RH3A 4DXWA 3K33A 1OW7A 4YN0B 4EBKA 5F5FA 4E7ZA 3KH2A 4BJ6A 1WASA 2J8WA 2XRHA 4ER9A 5AC5A 2DYSC 4J30B 4AX2A 1D1CA 4KNVA 3SXYA 4BJ5C 4OIOF 3LEOA 3CSKA 2YL1A 3BEHA 2Q7RA 5JP7A 2XS8A 2YKZA 1D0ZA 2R7UA 2G62A 3GODA 1SF8A 1WN0A 1FMWA 3ITFA 4PK4A 2IXPA 2YL0A 3IEEA 1RJ9B 4IWBA 4MVQA 1LVKA 1YARO 1ZHXA 5EK0A 2LFFA 2MWQA 3U9MA 1MNDA 3V5YA 4H4KC 4YT2A 3FDQA 4W8KA 3T6GB 1TWHA 3TJ6A 3ABMC 1E2XA 1NU9C 3NMKA 2ZPAA 4JJGA 2KK1A 4OINF 4YWQA 4U5BE 2GDCA 4HFFB 4MNDA 4OIPF 3MX3A 2M64A 5TJ5E 1LKXA 3UNGC 4OD4A 4ZLDA 3HTKC 3K66A 3FXHA 1Y4CA 2A69F 2DB4A 1LI7A 3MBGA 3JSEO 2IM8A 4K0DA 4C7OB 1R4TA 2XLEA 3W8IA 3GEIA 3W2VA 4A4AA 2A1DD 2IBFA 3MYFA 3Q6NA 4LERA 2OCCC 2OOCA 2YLGA 3EGXB 2LD6A 3Q7LA 3GEEA 4NTAA 5T1DB 4EBJA 4ULWA 1Z5ZA 1JR8A 2P61A 3JRTA 4GEHA 1J8YF 2EIMC 5B1AC 3AGUA 1HW1A 1LS4A 2Y3DA 1ZZPA 1TQGA 3ZTZA 1ZW3A 5KYXB 5L0IA 1FFHA 5JLIA 1T6IA 3FOPA 4NQFA 1LM3B 1Y6DA 3U3BA 3EGDA 1HW2A 2A0BA 4NTBA 3EFOB 4N6HA 1SYQA 3TOMA 2LK4A 2W4MA 1HMDA 4Z9JA 1OKKA 3QVZA 2UUIA 4PJNA 2HJMA 1YLMA 2QTVA 1MMDA 1ZU4A 3AJMA 3E9VA 3EH2A 1U89A 3IPMO 5KYUB 2IXNA 3DWWA 3VYWA 3PMRA 5COMA 3JCUQ 5F28E 4PACA 2L6GA 3GWLA 3TD7A 2CNWD 4XPWA 3R2PA 2L81A 3E70C 1D1AA 3GM3A 1ZVZA 1LIHA 1Q0MA 3HNKA 4KNWA 4L6RA 1EI7A 4J32B 3M4CA 2R7RA 3EH1A 3VRCA 3DAFA 4O79A 5DS5A 2GWWA 2X0CA 3K1IC 1NLXA 3LS0A 3RQGA 3S28A 3PCVA 1ORJA 1FMVA 2B0JA 5T3WA 3ZWIA 2XLWA 2KGOA 4EKWA 4G7HF 3QW0A 5E3CA 3ZDLA 1WATA 3J06A 1I4ZA 1YZCA 2BL2A 3FMSA 1GGQA 1BZ4A 1ZW2A 4MTGA 2HS5A 2R9RB 1MQVA 2YL7A 1A7DA 1G4WR 1LS1A 1RCPA 1T6QA 2VB6A 2WVQA 2WZFA 3DM5A 3DZAA 5CI9A 1C03A 3RYLA 1JPNA 3SEOA 1G5ZA 3T6JA 3LUTB 2H7OA 2HMQA 2WVOA 3BRJA 3A9CA 3MFNA 4G78A 3POVA 1VLSA 2XS1A 4NTFA 1KU2A 4MVSA 1D0XA 2A68F 1JAFA 2R25A 2R05A 3C7JA 3GANA 3TOLA 4CS8C 1F1MA 2DGJA 3I5PA 2H8AA 4JTCB 2HSBA 2J0WA 2OQMA 4HFKB 3Q7GA 1V54C 4NC3A 1OCZC 3C8GA 4O7GA 3SZRA 5DVWA 5L3QA 3DE9A 2J9WA 2KNHA 3IQTA 4J7TA 3U8PA 4WJ0A 3EQLF 4WGZA 1MNEA 4EUKB 4KI2A 1J8MF 4MTOA 3M1CB 3NKDA 4C3EA 4DOZA 1OCRC 3CZ6A 1E84A 2HKVA 2XL4A 2TMVP 4MS2A 2XXAA 5DS6A 3DI5A 4GYTA 3ZVRA 2KJGA 4FESA 2OEVA 4JZAA 3L8IA 1NZEA 1V55C 1HMOA 1ZHYA 2XLOA 3C8ZA 3JYYA 4JTAB 3UMIA 5DQTA 1CGNA 2Y69C 3ZIBA 1T5OA 1QVXA 4RBNA 3UGPA 3IQ6A 1N1CA 1TFKB 2WB7A 3B71A 3EGXA 3N0TA 1FR0A 1CGOA 2YEVA 2J9UA 2PF4E 4CS8A 4QI0A 4XTKA 3SNHA 2P1AA 2H7VC 2MHRA 1CGME 3DD7A 2NSFA 1I4YA 3RKOF 1U0BB 4RDAA 4OIRF 3ZQVA 1YJGA 3RVYA 5JS5A 5BQIA 1K05A 1UFBA 5E3AA 5KYYA 5KYNA 2ETSA 1Z6AA 4CX9A 1C17M 1MMNA 1OXKA 2JPUA 4JJFA 5A6JA 1ORYA 1PCXA 1M6TA 4XLPF 4E18A 1ZHWA 2ICWG 3SP1A 2LFDA 3K1HA 2D4UA 4JIOA 3PHF2 1RJ9A 2VCBA 2R7VA 5HV9A 4EBBA 3G4ZA 2KSFA 4BJTA 1OW8A 2R7OA 1AEPA 3ZQYA 2QE9A 2J7PD 2CW0F 3W4YA 3JSZA 5T3TA 3AG2C 2R7TA 3KPHA 2R7SA 2DI3A 2WZGA 3KL4A 5CI8A 4MVMA 3LLKA 1B68A 1RXQA 4LDRA 1OKKD 5B1BC 2ZXOA 2L9JA 2PX0A 4DJ9A 1NFNA 2D5RB 3K6BA 5A6BD 4RD9A 3DJNB 3O39A 1YYXA 1NFOA 3FAPB 3IQ5A 4O6MA 2BE5F 2XLVA 4FWVA 1Q0GA 5JSLA 2NSGA 3K7DA 4XEVA 4BG0A 4P6IC 2ZXPA 2OEXA 3RQEA 1L3PA 2A6EF 4Z9IA 2YLDA
chains in the Genus database with same CATH topology
5BQGA 4J7YA 5HV9A 4NTFA 4YL0A 2UUHA 4NTBA 2H8AA 4YL1A 4JC7A 3HKKA 4WABA 3B29A 4J7TA 3PCVA 4BPMA 2UUIA 4JCZA 5BQIA 4YL3A 2PNOA 3DWWA 3LEOA 4AL1A 5K0IA 2Q7RA 4NTAA 5BQHA 4YK5A 4AL0A 4JRZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5BQG A;  4J7Y A;  5HV9 A;  4NTF A;  4YL0 A;  2UUH A;  4NTB A;  2H8A A;  4YL1 A;  4JC7 A;  3HKK A;  4WAB A;  3B29 A;  4J7T A;  3PCV A;  4BPM A;  2UUI A;  4JCZ A;  5BQI A;  4YL3 A;  2PNO A;  3DWW A;  3LEO A;  4AL1 A;  5K0I A;  2Q7R A;  4NTA A;  5BQH A;  4YK5 A;  4AL0 A;  4JRZ A; 
#chains in the Genus database with same CATH topology
 1I5N A;  2Q9B A;  1VB5 A;  2HSQ A;  5A69 A;  3JZ0 A;  4ZLC A;  1M56 C;  1O5H A;  4MVO A;  3RFY A;  3LJB A;  3T6B A;  1QKR A;  4K7B A;  4ULV A;  1JMW A;  3AG4 C;  4H54 A;  2YRF A;  4UDV A;  1A7V A;  3CEX A;  5COG A;  1TKN A;  2KC3 A;  4CJG A;  1NU7 D;  2CDQ A;  2EPO A;  4I3M A;  4JE9 A;  4D4X A;  5JVE A;  4FAP B;  1FAP B;  2OG2 A;  4DRJ B;  1BBH A;  1VYI A;  4GQH A;  2WL8 A;  3LLI A;  4JEA A;  3UR3 C;  2J46 A;  1IW7 F;  3WG7 C;  2RD9 A;  3EG9 A;  4F4B A;  4YT8 A;  4XEK A;  2BC5 A;  3UMK A;  1Z63 A;  4E0I A;  3B0V C;  4LLE A;  4YT4 A;  5KYU A;  4LDK A;  3HJC A;  3N2Z B;  2ZD9 A;  3NRH A;  4IAR A;  4MVU A;  2VCC A;  3WHN A;  1QLE C;  1OCC C;  4YT5 A;  2W9Y A;  3AG1 C;  1ZYR F;  2EIK C;  3B9Q A;  3KYI A;  4E0H A;  1DOV A;  4JEB A;  2I8B A;  3NG1 A;  4MQ9 F;  3U9J A;  1XWJ A;  2HMZ A;  4Q7C A;  2ASR A;  4YL0 A;  3L8J A;  2A0U A;  4XPX A;  4DVZ A;  2YVK A;  2J9V A;  4CIP A;  5HSW A;  3L0I A;  3M4B A;  3AOU A;  1LI5 A;  1H9T A;  4OD5 A;  4JC7 A;  2KW3 C;  1MMG A;  3B29 A;  2CCY A;  3NDB B;  2PFD A;  3LS1 A;  3F46 A;  2FFH A;  2QLA A;  5EHH A;  4JCZ A;  2Y3H A;  4NY3 A;  3OWT A;  4XEF A;  2LIG A;  3DJU B;  5D92 A;  4CSA C;  1W2W A;  1OCO C;  2KQ9 A;  3ABL C;  2L7A A;  2NUP A;  4D4N A;  5F5H A;  2G3V A;  4U5H A;  3DAG A;  2W4B A;  2AVK A;  3ASN C;  1JPJ A;  4AL0 A;  4BJ6 C;  1HE1 A;  1K04 A;  1G8X A;  2LP4 A;  3WOD F;  3FOO A;  1OXB A;  2VH3 A;  3DM9 B;  1AUE A;  4JW1 A;  3X1O A;  4W8P A;  1SMY F;  3ABK C;  4AK9 A;  5L3V A;  4K1O A;  3QTH A;  4PJM A;  4Q4Z F;  3W2W A;  1QPU A;  2A6H F;  1H6G A;  5L0G A;  4I44 A;  2OU6 A;  3QMK A;  2PBE A;  4IRU A;  4MW8 A;  4WAB A;  3U0C A;  4JTD B;  1KNY A;  2NUP B;  4BPM A;  2GA0 A;  2C03 A;  2FAP B;  2YWA A;  2LCH A;  2WZL A;  4PFO A;  2P0N A;  3LES A;  1VTM P;  3EHN A;  1E85 A;  2PP4 A;  5B3S C;  1K40 A;  1CPQ A;  1TWA A;  4PR9 A;  2RSE B;  2F22 A;  4P9T A;  3QW1 A;  2EPL X;  4U9D A;  3V5Z A;  4G7Z F;  1Q0D A;  3KYJ A;  4ONS A;  3X2Q C;  2R7W A;  1Q0K A;  3U5S A;  2JD3 A;  4BJ1 A;  1M2O A;  3C18 A;  3R7C A;  1LE2 A;  4XPY A;  5D91 A;  4YJW A;  4J7Y A;  1FFT C;  2Y39 A;  1JRA A;  3OEO A;  4LLC A;  3RIP A;  3M79 A;  2CGE A;  2O9X A;  3RVZ A;  3ASO C;  3GOR A;  4E17 A;  1HE9 A;  3N24 A;  4IGG A;  5A6K A;  5KYW B;  3S90 A;  3EJN A;  2Q9A A;  3GM2 A;  2QUP A;  2J0X A;  2Q9C A;  1BR4 A;  1H9G A;  4OIQ F;  2L6H A;  2NPU A;  2XL8 A;  4FX5 A;  4LAC B;  3TJ5 A;  4CDY A;  5B3I A;  4ANJ A;  1DOW A;  1YZA A;  2HV6 A;  3H2V A;  3DXJ F;  4U5F E;  5DLJ A;  4BJ5 A;  4EHP A;  1WTY A;  1BR2 A;  5A6B A;  3EG9 B;  4XWJ A;  4CSA A;  4Q5S F;  1KTM A;  2HV7 A;  5K0I A;  1HY5 A;  1LPE A;  2XM0 A;  3T4R A;  4CS7 A;  3AQB A;  1M2V A;  1OR2 A;  3FVY A;  2AWC A;  2ZXR A;  4IJJ A;  4KC9 A;  5BQH A;  3SXM A;  1TR2 A;  2VAS A;  256B A;  3I5Q A;  5BQG A;  3S9O A;  3G4X A;  2ZXW C;  3NMI A;  3V7O A;  1VMA A;  2CNW A;  3EZI A;  2AP3 A;  3L34 A;  3QZC A;  1TWG A;  4WGY A;  4CJO A;  4DBR A;  1S05 A;  3FHD A;  5JT4 A;  2XL6 A;  1S7Z A;  4EWC A;  1QQ3 A;  3I4U A;  5IY5 C;  2C04 A;  1YA9 A;  4XLN F;  1BR1 A;  3T9O A;  1NSG B;  3HKK A;  1T6U A;  3S29 A;  4CBE A;  3L1M A;  4N06 A;  5L0J A;  4Z9H A;  5E2Q A;  3SXK A;  3RQF A;  3ZTM A;  2PNO A;  1OQC A;  3M15 A;  1TFO B;  3VF0 A;  2QY9 A;  2EIJ C;  4CS9 A;  1VYK A;  3C62 A;  1WWP A;  1C02 A;  5BUO A;  3JRM O;  3NMJ A;  1BDJ B;  3H2U A;  3KKB A;  5DQZ A;  1Q0F A;  3O6X A;  3NYJ A;  4IAO A;  4U5G A;  2H7B A;  1ST6 A;  1MMA A;  3H65 A;  3U8V A;  5EGY A;  2EPK X;  3DKA A;  2IXM A;  1FNT c;  1VOM A;  2UUH A;  4I1M A;  4MVZ A;  3C8G D;  1D1B A;  1A7E A;  1SR2 A;  3EZH A;  4N4W A;  3U2L A;  3EHM A;  4JUR I;  5JRA A;  5L0H A;  2GAQ A;  3U3F A;  5FZT A;  2OJQ A;  1ZHT A;  3IHU A;  2P6V A;  2QNL A;  3O55 A;  3U2M A;  5KYY B;  2PX3 A;  3TUL A;  4I1O B;  2EPN A;  1APC A;  3LNM B;  4JKV A;  4B6I A;  2XSE A;  1V74 B;  4G7O F;  2HZ8 A;  3DMD A;  1EA8 A;  2LQG A;  2NUT B;  2YHS A;  3HNL A;  1UG7 A;  1GQA A;  4N6C A;  3ZG1 A;  4BEM J;  3ECS A;  4PJJ A;  1XZP A;  1OR3 A;  2EPM X;  4MTF A;  1A41 A;  1QSP A;  3TQO A;  4DVY P;  4QDL A;  2Z15 A;  1GM5 A;  3EGD B;  2GFH A;  2LSE A;  4AE4 B;  1VK5 A;  1OW6 A;  3NKE A;  2YZS A;  5KYX A;  1ORS C;  4HEA J;  4MVR A;  2DYR C;  1QZX A;  4AE4 A;  2NG1 A;  3ZSU A;  4MW3 A;  2L6F A;  2XM4 A;  1NG1 A;  4CS9 C;  1EKY A;  4BEJ A;  4O6Y A;  2XXA B;  1T01 A;  1T9K A;  2HJ3 A;  2AU5 A;  4O6N A;  1Z3I X;  3HLZ A;  4PFP A;  2R02 A;  4C7O A;  3CQZ A;  2E87 A;  2YL3 A;  2EIL C;  5L0D A;  2NUT A;  4DRH B;  4U5D E;  3S0X A;  4DBQ A;  1H7I A;  3B0P A;  2V3C C;  4LDQ A;  2CYD A;  2FGY A;  3NYM A;  4CDV A;  1GS9 A;  4JVS A;  3C8G B;  2MYS A;  2VCA A;  3KMI A;  3LNR A;  4R32 A;  5E33 A;  3S27 A;  3UGO A;  3AGT A;  3QVY A;  4EIY A;  5JUA A;  3JTL O;  4E7S A;  1E86 A;  2XLM A;  3GWN A;  4CDA A;  2I15 A;  2V26 A;  3AQC A;  3K1I A;  1U6H A;  3TK0 A;  2J7P A;  1JOG A;  5DS4 A;  2Q3T A;  2R03 A;  4IB4 A;  1RKC A;  3LAY A;  4PJL A;  3JYH A;  3GM1 A;  1L7C A;  3HNI A;  2XLD A;  2EIN C;  4C3B A;  5FCL A;  4DRI B;  1RMV A;  1D0Y A;  2XLH A;  3A11 A;  1YVI A;  3FAJ A;  4M63 A;  3ZC4 A;  3B0U X;  2JX0 A;  3PDM P;  3V5X A;  2W45 A;  1YYJ A;  3ATP A;  1EQ1 A;  4AL1 A;  5L0C A;  1WGW A;  4JCH A;  5L0F A;  3MYI A;  2B0H A;  2X51 A;  5COF A;  3G50 A;  3NYL A;  4YK5 A;  1PD0 A;  2IOQ A;  2G3K A;  2OJE D;  1R5I D;  3Q6M A;  5AC4 A;  1E83 A;  2KYH A;  2J9B A;  3C63 A;  1M57 C;  4P9F A;  3RW0 A;  4CIH A;  3HNJ A;  4KBL A;  2IXO A;  4QI2 A;  4IAQ A;  3LEV A;  3W8H A;  2WVN A;  1Z23 A;  2AWY A;  4YL1 A;  1XZQ A;  2HFI A;  1O3U A;  2IYL D;  1RKE A;  1M2V B;  1NBB A;  3OA1 A;  3SXZ A;  5AGF A;  1YA7 O;  3F47 A;  3SYN A;  3UMH A;  2R7X A;  3MLG A;  3AG3 C;  2VC9 A;  2J45 A;  3DE8 A;  3GEH A;  2P7V A;  2Q00 A;  3IQC A;  1Z7Q c;  1IZM A;  4YL3 A;  4X0R A;  5CIV A;  4U5E E;  4C3D A;  1TWC A;  3CAX A;  3VM6 A;  4NCQ A;  1A0B A;  4G0H A;  1RKE B;  1AVO B;  1SZI A;  3VAY A;  1LE4 A;  3RF3 A;  1O87 A;  2OKU A;  2Y3G A;  3US6 A;  4U5C E;  3EFO A;  4JRZ A;  1G4U S;  5KYW A;  2Y3B A;  2M4E A;  3EPV A;  2YLI A;  5A6A A;  2R7Q A;  3WAQ A;  1PD1 A;  1ZU5 A;  3S84 A;  5GPG B;  2HUJ A;  1YDI A;  1PV3 A;  2Q4F A;  2YQY A;  1CPR A;  4HE8 D;  1FTS A;  3O10 A;  4U9E A;  1YAU O;  1ZHZ A;  4XQ1 A;  4A2N B;  3JT1 A;  1V4A A;  1WOL A;  1VLT A;  3RH3 A;  4DXW A;  3K33 A;  1OW7 A;  4YN0 B;  4EBK A;  5F5F A;  4E7Z A;  3KH2 A;  4BJ6 A;  1WAS A;  2J8W A;  2XRH A;  4ER9 A;  5AC5 A;  2DYS C;  4J30 B;  4AX2 A;  1D1C A;  4KNV A;  3SXY A;  4BJ5 C;  4OIO F;  3LEO A;  3CSK A;  2YL1 A;  3BEH A;  2Q7R A;  5JP7 A;  2XS8 A;  2YKZ A;  1D0Z A;  2R7U A;  2G62 A;  3GOD A;  1SF8 A;  1WN0 A;  1FMW A;  3ITF A;  4PK4 A;  2IXP A;  2YL0 A;  3IEE A;  1RJ9 B;  4IWB A;  4MVQ A;  1LVK A;  1YAR O;  1ZHX A;  5EK0 A;  2LFF A;  2MWQ A;  3U9M A;  1MND A;  3V5Y A;  4H4K C;  4YT2 A;  3FDQ A;  4W8K A;  3T6G B;  1TWH A;  3TJ6 A;  3ABM C;  1E2X A;  1NU9 C;  3NMK A;  2ZPA A;  4JJG A;  2KK1 A;  4OIN F;  4YWQ A;  4U5B E;  2GDC A;  4HFF B;  4MND A;  4OIP F;  3MX3 A;  2M64 A;  5TJ5 E;  1LKX A;  3UNG C;  4OD4 A;  4ZLD A;  3HTK C;  3K66 A;  3FXH A;  1Y4C A;  2A69 F;  2DB4 A;  1LI7 A;  3MBG A;  3JSE O;  2IM8 A;  4K0D A;  4C7O B;  1R4T A;  2XLE A;  3W8I A;  3GEI A;  3W2V A;  4A4A A;  2A1D D;  2IBF A;  3MYF A;  3Q6N A;  4LER A;  2OCC C;  2OOC A;  2YLG A;  3EGX B;  2LD6 A;  3Q7L A;  3GEE A;  4NTA A;  5T1D B;  4EBJ A;  4ULW A;  1Z5Z A;  1JR8 A;  2P61 A;  3JRT A;  4GEH A;  1J8Y F;  2EIM C;  5B1A C;  3AGU A;  1HW1 A;  1LS4 A;  2Y3D A;  1ZZP A;  1TQG A;  3ZTZ A;  1ZW3 A;  5KYX B;  5L0I A;  1FFH A;  5JLI A;  1T6I A;  3FOP A;  4NQF A;  1LM3 B;  1Y6D A;  3U3B A;  3EGD A;  1HW2 A;  2A0B A;  4NTB A;  3EFO B;  4N6H A;  1SYQ A;  3TOM A;  2LK4 A;  2W4M A;  1HMD A;  4Z9J A;  1OKK A;  3QVZ A;  2UUI A;  4PJN A;  2HJM A;  1YLM A;  2QTV A;  1MMD A;  1ZU4 A;  3AJM A;  3E9V A;  3EH2 A;  1U89 A;  3IPM O;  5KYU B;  2IXN A;  3DWW A;  3VYW A;  3PMR A;  5COM A;  3JCU Q;  5F28 E;  4PAC A;  2L6G A;  3GWL A;  3TD7 A;  2CNW D;  4XPW A;  3R2P A;  2L81 A;  3E70 C;  1D1A A;  3GM3 A;  1ZVZ A;  1LIH A;  1Q0M A;  3HNK A;  4KNW A;  4L6R A;  1EI7 A;  4J32 B;  3M4C A;  2R7R A;  3EH1 A;  3VRC A;  3DAF A;  4O79 A;  5DS5 A;  2GWW A;  2X0C A;  3K1I C;  1NLX A;  3LS0 A;  3RQG A;  3S28 A;  3PCV A;  1ORJ A;  1FMV A;  2B0J A;  5T3W A;  3ZWI A;  2XLW A;  2KGO A;  4EKW A;  4G7H F;  3QW0 A;  5E3C A;  3ZDL A;  1WAT A;  3J06 A;  1I4Z A;  1YZC A;  2BL2 A;  3FMS A;  1GGQ A;  1BZ4 A;  1ZW2 A;  4MTG A;  2HS5 A;  2R9R B;  1MQV A;  2YL7 A;  1A7D A;  1G4W R;  1LS1 A;  1RCP A;  1T6Q A;  2VB6 A;  2WVQ A;  2WZF A;  3DM5 A;  3DZA A;  5CI9 A;  1C03 A;  3RYL A;  1JPN A;  3SEO A;  1G5Z A;  3T6J A;  3LUT B;  2H7O A;  2HMQ A;  2WVO A;  3BRJ A;  3A9C A;  3MFN A;  4G78 A;  3POV A;  1VLS A;  2XS1 A;  4NTF A;  1KU2 A;  4MVS A;  1D0X A;  2A68 F;  1JAF A;  2R25 A;  2R05 A;  3C7J A;  3GAN A;  3TOL A;  4CS8 C;  1F1M A;  2DGJ A;  3I5P A;  2H8A A;  4JTC B;  2HSB A;  2J0W A;  2OQM A;  4HFK B;  3Q7G A;  1V54 C;  4NC3 A;  1OCZ C;  3C8G A;  4O7G A;  3SZR A;  5DVW A;  5L3Q A;  3DE9 A;  2J9W A;  2KNH A;  3IQT A;  4J7T A;  3U8P A;  4WJ0 A;  3EQL F;  4WGZ A;  1MNE A;  4EUK B;  4KI2 A;  1J8M F;  4MTO A;  3M1C B;  3NKD A;  4C3E A;  4DOZ A;  1OCR C;  3CZ6 A;  1E84 A;  2HKV A;  2XL4 A;  2TMV P;  4MS2 A;  2XXA A;  5DS6 A;  3DI5 A;  4GYT A;  3ZVR A;  2KJG A;  4FES A;  2OEV A;  4JZA A;  3L8I A;  1NZE A;  1V55 C;  1HMO A;  1ZHY A;  2XLO A;  3C8Z A;  3JYY A;  4JTA B;  3UMI A;  5DQT A;  1CGN A;  2Y69 C;  3ZIB A;  1T5O A;  1QVX A;  4RBN A;  3UGP A;  3IQ6 A;  1N1C A;  1TFK B;  2WB7 A;  3B71 A;  3EGX A;  3N0T A;  1FR0 A;  1CGO A;  2YEV A;  2J9U A;  2PF4 E;  4CS8 A;  4QI0 A;  4XTK A;  3SNH A;  2P1A A;  2H7V C;  2MHR A;  1CGM E;  3DD7 A;  2NSF A;  1I4Y A;  3RKO F;  1U0B B;  4RDA A;  4OIR F;  3ZQV A;  1YJG A;  3RVY A;  5JS5 A;  5BQI A;  1K05 A;  1UFB A;  5E3A A;  5KYY A;  5KYN A;  2ETS A;  1Z6A A;  4CX9 A;  1C17 M;  1MMN A;  1OXK A;  2JPU A;  4JJF A;  5A6J A;  1ORY A;  1PCX A;  1M6T A;  4XLP F;  4E18 A;  1ZHW A;  2ICW G;  3SP1 A;  2LFD A;  3K1H A;  2D4U A;  4JIO A;  3PHF 2;  1RJ9 A;  2VCB A;  2R7V A;  5HV9 A;  4EBB A;  3G4Z A;  2KSF A;  4BJT A;  1OW8 A;  2R7O A;  1AEP A;  3ZQY A;  2QE9 A;  2J7P D;  2CW0 F;  3W4Y A;  3JSZ A;  5T3T A;  3AG2 C;  2R7T A;  3KPH A;  2R7S A;  2DI3 A;  2WZG A;  3KL4 A;  5CI8 A;  4MVM A;  3LLK A;  1B68 A;  1RXQ A;  4LDR A;  1OKK D;  5B1B C;  2ZXO A;  2L9J A;  2PX0 A;  4DJ9 A;  1NFN A;  2D5R B;  3K6B A;  5A6B D;  4RD9 A;  3DJN B;  3O39 A;  1YYX A;  1NFO A;  3FAP B;  3IQ5 A;  4O6M A;  2BE5 F;  2XLV A;  4FWV A;  1Q0G A;  5JSL A;  2NSG A;  3K7D A;  4XEV A;  4BG0 A;  4P6I C;  2ZXP A;  2OEX A;  3RQE A;  1L3P A;  2A6E F;  4Z9I A;  2YLD A; 
#chains in the Genus database with same CATH homology
 5BQG A;  4J7Y A;  5HV9 A;  4NTF A;  4YL0 A;  2UUH A;  4NTB A;  2H8A A;  4YL1 A;  4JC7 A;  3HKK A;  4WAB A;  3B29 A;  4J7T A;  3PCV A;  4BPM A;  2UUI A;  4JCZ A;  5BQI A;  4YL3 A;  2PNO A;  3DWW A;  3LEO A;  4AL1 A;  5K0I A;  2Q7R A;  4NTA A;  5BQH A;  4YK5 A;  4AL0 A;  4JRZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...