4YL3A

Crystal structures of mpges-1 inhibitor complexes
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
146
structure length
146
Chain Sequence
VMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Crystal Structures of mPGES-1 Inhibitor Complexes Form a Basis for the Rational Design of Potent Analgesic and Anti-Inflammatory Therapeutics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 63
structure length 146
sequence length 146
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4yl3A00
4J7TA 3PCVA 5HV9A 3DWWA 3LEOA 2PNOA 3HKKA 4JRZA 4YL1A 4JC7A 4WABA 5BQHA 4YL3A 2UUHA 4BPMA 3B29A 4J7YA 2Q7RA 2UUIA 2H8AA 4NTAA 5BQGA 5K0IA 4AL0A 4AL1A 4NTBA 5BQIA 4JCZA 4YL0A 4NTFA 4YK5A
chains in the Genus database with same CATH superfamily
1E84A 1HY5A 2J45A 1LI7A 2ZD9A 3EG9B 1G4US 4JIOA 4JTAB 2DGJA 2ZPAA 4PFPA 3EPVA 3T6JA 5HV9A 4U5EE 1Q0MA 1Q0KA 1APCA 2X0CA 3W2VA 4XTKA 4N4WA 4DRJB 4UDVA 3EFOA 3O6XA 5DQTA 4R32A 3I5QA 1J8YF 4Z9IA 2OG2A 3M4BA 2JX0A 1TFKB 2C04A 3AG4C 3EQLF 4WABA 2AWYA 2XRHA 1VLSA 4E17A 4G7HF 2E87A 2IM8A 4DVZA 1IZMA 1YA9A 4U5GA 2H8AA 1OCZC 1A0BA 4MVUA 1RMVA 3IEEA 2CNWD 4U5HA 2EPKX 2R7XA 3K33A 1YDIA 4ULVA 3SXZA 3TQOA 3AQBA 1OW7A 4EKWA 1MQVA 3TD7A 2Q9BA 4WJ0A 2XL4A 2V3CC 4Q5SF 4MVRA 1JMWA 1I4YA 2XM0A 4MQ9F 3DJNB 1HMOA 3GWLA 2XM4A 1Z63A 2CGEA 3EGXB 1ZHTA 3NKEA 1E85A 2PFDA 2J46A 4OINF 1YA7O 2OU6A 2EILC 5L3QA 2L6GA 2P6VA 3JTLO 3V5YA 2ZXPA 3HNIA 3NDBB 1VLTA 2Z15A 3SEOA 3Q6NA 1JPNA 3AG3C 4XEKA 2HMZA 3RQFA 4Q7CA 1NBBA 2XXAA 4Q4ZF 3U9MA 3F47A 5IY5C 1BZ4A 5BQHA 2HFIA 3EFOB 3QVZA 3MYIA 2J7PA 3LEVA 5JLIA 1PV3A 2J9UA 1OXKA 3GM3A 3MLGA 4HFFB 4EBBA 1RXQA 3RW0A 3VYWA 3WHNA 2Y3BA 4LACB 2J7PD 2M64A 2RD9A 2J0XA 3LS1A 3O10A 3TOMA 4JCZA 4DRHB 2VCCA 1ORJA 2QY9A 3KL4A 1YZCA 4XLNF 3DWWA 2WVOA 4IRUA 2NSFA 4A2NB 4M63A 3EGDA 4KI2A 3K1IA 1G4WR 1T01A 1W2WA 1JR8A 4I3MA 1FNTc 2R7TA 3X1OA 3HNKA 1F1MA 3RF3A 4CDAA 5COGA 3M79A 1HE1A 2BC5A 4MVMA 4OD4A 5DQZA 3K1HA 4Z9HA 5EGYA 1OCOC 1WTYA 1L3PA 3HNLA 2G3KA 1D1BA 1WWPA 4O6MA 1RCPA 4BJ5A 1Y6DA 2W4MA 4MNDA 4NCQA 3DJUB 1EA8A 1NFOA 3SNHA 5K0IA 2ZXOA 4C3EA 1UFBA 2XXAB 1ZVZA 2GFHA 1JAFA 3W8HA 4C3DA 1VTMP 2MWQA 4CX9A 4EHPA 3GEIA 4BJ1A 2HMQA 1O3UA 2OEXA 1AVOB 2Y39A 5EK0A 1FAPB 1D1CA 2KYHA 1LS1A 2F22A 3N0TA 3J06A 4U9DA 3NRHA 1GM5A 5L0DA 3NMIA 4OD5A 5D92A 2AVKA 1A41A 3DM9B 2YL7A 3DZAA 2QLAA 4MTGA 1LPEA 1S7ZA 4QI2A 2I15A 3NMJA 4PACA 5B3SC 3EJNA 1ZHZA 3AQCA 3EGDB 2OEVA 2I8BA 3NYMA 4RD9A 4ER9A 3FOPA 2GWWA 4LDKA 4P9FA 5L0CA 4XPYA 2QTVA 3U2MA 1OR3A 4AL0A 4KNWA 4F4BA 5JVEA 1U89A 3S84A 1OKKA 1TWCA 3S9OA 1RKCA 1YJGA 3LUTB 3G50A 2YKZA 4YJWA 4LDQA 3AG1C 5A6AA 3OEOA 2A0UA 2PF4E 3PMRA 3UMKA 1I5NA 1OKKD 1RKEA 2YLDA 3C18A 3DAFA 3IQ5A 2WVQA 3WODF 4ANJA 3G4ZA 2R7OA 2WZGA 3S28A 1ZW3A 3W2WA 4O7GA 3W4YA 3F46A 4NY3A 4YL1A 3H2VA 2LK4A 2J9BA 5L3VA 3AG2C 3N24A 3RYLA 1SYQA 4DBQA 1T6IA 4JEAA 1K04A 2CDQA 2HV6A 3DKAA 5JSLA 4H54A 1BBHA 1XZQA 2D5RB 1H9TA 3PHF2 2R7WA 3LAYA 3DXJF 3S27A 3LNRA 3IPMO 3BEHA 3IQ6A 2IXPA 5DVWA 4XPXA 1CGME 5B3IA 3FAJA 3UGPA 5BQIA 2XL6A 1FR0A 2HJ3A 2Q7RA 2BL2A 3AGTA 4KBLA 2YWAA 3X2QC 2M4EA 2XL8A 2KNHA 3B0VC 3Q7GA 1JRAA 4YT2A 3RFYA 3PDMP 1YLMA 3RVZA 3HNJA 3U2LA 2VH3A 1K40A 1LKXA 2A6EF 2V26A 2QUPA 3ABMC 4EBKA 2EPLX 1CGNA 1ZW2A 4OIOF 1RKEB 2CNWA 3SXYA 4BG0A 1WATA 3GEEA 2IXNA 3GWNA 3KPHA 4JEBA 4CS8A 5KYWA 3DM5A 3H2UA 1OCRC 3M1CB 4PR9A 1QQ3A 4XEVA 1K05A 3R7CA 4AX2A 4EIYA 2OQMA 1NG1A 2Q9AA 3VAYA 4G7ZF 1TWAA 1ZHXA 2R7QA 4NTBA 2XLOA 4CIPA 3EH2A 3Q6MA 5CI8A 1M2OA 2R9RB 5F5HA 4EUKB 2R05A 3Q7LA 3ZTZA 4MS2A 1MMAA 1Q0GA 4CSAA 1QZXA 2PX3A 2JD3A 1YZAA 4JJGA 5L0JA 4MVSA 1O87A 4JRZA 1H6GA 4O6YA 1HW1A 1QKRA 2HUJA 2JPUA 2EINC 2X51A 2YQYA 1TFOB 3V5XA 4BPMA 1O5HA 4I44A 3RKOF 4CS8C 4E0HA 5L0IA 1E83A 1V74B 2DYSC 5DS5A 1LS4A 4P6IC 1LE4A 2FFHA 3EH1A 3JRMO 3MFNA 2NPUA 5KYXA 4JTCB 3KMIA 5A6JA 2HKVA 3SXMA 1MNDA 1V4AA 2H7BA 1VK5A 3T9OA 4CDVA 4CSAC 1JPJA 3EHNA 2QE9A 1BDJB 1HE9A 2XS1A 4ONSA 3ZQYA 2YL1A 4C3BA 5KYWB 4YL0A 1EI7A 3QZCA 2XSEA 3E9VA 3A11A 3SZRA 3CZ6A 4RBNA 1CPQA 1Q0FA 3DE9A 5E2QA 2RSEB 3ITFA 4QI0A 3L8JA 2LIGA 2AWCA 2YL0A 4FWVA 3B0UX 1JOGA 4BJ6A 5DS4A 1FMWA 1LM3B 1TWHA 2L6FA 3FVYA 3L34A 2KSFA 2R03A 5COFA 3O55A 2NUPA 2UUHA 1Z7Qc 4IWBA 2EIMC 3TJ6A 3ZSUA 3S90A 1LE2A 5B1BC 2MYSA 2XLDA 2IOQA 2OCCC 3QW0A 1VYIA 3B9QA 4MW8A 4DXWA 2NG1A 4K0DA 5D91A 1NZEA 1OR2A 1DOWA 4D4NA 5A69A 4DRIB 1IW7F 2D4UA 4I1OB 3IQCA 3DD7A 1KNYA 4KNVA 3U3BA 3NG1A 1GGQA 4AE4A 3LLKA 2IXOA 4AL1A 1J8MF 4E7SA 2LP4A 4BJ6C 1V55C 2IXMA 5KYXB 2J9VA 2NSGA 2FGYA 2H7VC 3QVYA 5TJ5E 4YN0B 3C63A 2PNOA 1SR2A 2DB4A 3CAXA 3C7JA 2HZ8A 3MBGA 4PJJA 3U9JA 4U5FE 3H65A 2Y69C 2HSBA 3MYFA 4IAOA 4N6HA 3T6BA 3K66A 2KC3A 2VASA 2GAQA 2VC9A 4O6NA 4PFOA 4Z9JA 5E33A 3G4XA 1SZIA 4CIHA 1Z6AA 1H7IA 3HJCA 5JP7A 4CBEA 2XLWA 1NLXA 2HV7A 2NUPB 2R25A 1Z5ZA 4JVSA 4LLCA 4MW3A 1U0BB 1AUEA 2R7UA 1WASA 2C03A 1NSGB 3US6A 3JYHA 4FX5A 2R7VA 4EBJA 1EKYA 2YL3A 3VM6A 4PK4A 4YK5A 1L7CA 3FDQA 4J7TA 4E0IA 3L1MA 1KU2A 2WZLA 1YYXA 2J0WA 2J9WA 2PBEA 3LEOA 4AE4B 3M15A 4OIPF 3RQEA 1Z3IX 3I4UA 1AEPA 1FMVA 1I4ZA 1ORSC 2EIKC 4GEHA 4JC7A 5CI9A 3S29A 4YL3A 5HSWA 3GM2A 4XWJA 5E3AA 1XWJA 2Q4FA 2GA0A 3U8VA 3CEXA 5KYUA 3TULA 3POVA 3GODA 2KGOA 2L9JA 3KKBA 2EPMX 1KTMA 2A68F 2NUTA 5JUAA 3GEHA 1G5ZA 3ZQVA 1B68A 4JTDB 1T6QA 3U0CA 5JT4A 5COMA 4N6CA 2LFDA 1D0XA 4JJFA 1VOMA 1TWGA 4G78A 1R5ID 2MHRA 3WAQA 1C03A 1N1CA 2R02A 4I1MA 4LLEA 1FTSA 2KJGA 3NYJA 3OA1A 1NU9C 4OIQF 5FZTA 3SXKA 4NQFA 3JZ0A 4LDRA 1YYJA 1YVIA 1NU7D 4XQ1A 3SP1A 4YT4A 2B0JA 2XLVA 2XLHA 5FCLA 2BE5F 1GS9A 2FAPB 2PX0A 2A0BA 2HS5A 3I5PA 4QDLA 5AC5A 1D0YA 1UG7A 3L8IA 2A69F 4IJJA 2P7VA 2XLMA 2R7RA 2YHSA 3IQTA 5JRAA 2EPOA 1EQ1A 2LCHA 2VCBA 3QW1A 3NMKA 2CCYA 3T4RA 2HJMA 3KH2A 4O79A 1U6HA 2ICWG 3UMIA 5F28E 5KYUB 4JZAA 3RH3A 3UNGC 2LD6A 4J32B 1NFNA 1QLEC 2ZXRA 4BEJA 2NUTB 1WGWA 1ZU5A 3PCVA 2G62A 1A7DA 5CIVA 4U9EA 2CW0F 4ZLCA 3DAGA 1TQGA 3ZG1A 4YWQA 3QTHA 4E7ZA 1DOVA 1BR2A 2WVNA 4IGGA 1LVKA 1SF8A 5L0HA 2YRFA 2IYLD 1ZHWA 1OXBA 3B29A 3KYJA 4MTFA 4LERA 1RJ9A 4YT5A 2CYDA 3C8GA 2P1AA 2YZSA 3N2ZB 3B71A 4MVQA 4K1OA 1XZPA 4E18A 4DOZA 4PJLA 3T6GB 5T3TA 1CGOA 3LNMB 3WG7C 5KYYA 2Q00A 1YAUO 3EZIA 1R4TA 3C8GD 2Y3GA 4X0RA 1S05A 1MNEA 4K7BA 1WOLA 5DLJA 2LQGA 3HKKA 2QNLA 1M57C 2P0NA 1H9GA 4HEAJ 4XLPF 3L0IA 1FFHA 2OJQA 1ZHYA 3ABLC 3EHMA 1M2VA 1VB5A 4IB4A 4W8PA 4AK9A 1VMAA 1YARO 2WZFA 3GANA 4BJTA 3U5SA 3OWTA 1G8XA 2J8WA 3ASNC 4JURI 1T9KA 4NC3A 3A9CA 1OCCC 1SMYF 3ZIBA 4BEMJ 3UGOA 2IBFA 5EHHA 4U5DE 3CSKA 3ZC4A 1C02A 3JSZA 2Q3TA 2VB6A 4CS7A 1OW8A 2AP3A 2VCAA 4JKVA 4IARA 4ZLDA 1FFTC 2OKUA 3IHUA 3RQGA 2HSQA 1PCXA 2P61A 4XPWA 1BR4A 2YEVA 3LLIA 2WL8A 3C8ZA 2OOCA 1RJ9B 3AOUA 4U5BE 5B1AC 3U3FA 3V7OA 3DE8A 1A7VA 4MTOA 5GPGB 3C8GB 3FOOA 5DS6A 3GM1A 3VF0A 3RIPA 4CJOA 2AU5A 1LI5A 2H7OA 2DYRC 1HMDA 5T3WA 5KYYB 2KQ9A 3K6BA 2OJED 3FAPB 3LS0A 1HW2A 5L0GA 4C7OA 1PD1A 2LFFA 2ASRA 3HTKC 2O9XA 4DJ9A 5A6BA 4EWCA 4MVZA 3TOLA 5JS5A 3DMDA 2WB7A 3S0XA 1M56C 2Q9CA 5L0FA 1M2VB 3M4CA 1ST6A 4J7YA 3JSEO 1Z23A 1Q0DA 1E2XA 3JYYA 3QMKA 2XLEA 4JE9A 4PJMA 4RDAA 5A6BD 1D1AA 2DI3A 3FXHA 4DBRA 1MMDA 4KC9A 4PJNA 5T1DB 3UMHA 3C62A 3JT1A 3ABKC 4G7OF 3KYIA 2YLIA 3AGUA 2Y3DA 4WGYA 4MVOA 3K1IC 2G3VA 4JCHA 1ZYRF 3BRJA 1CPRA 1ZU4A 1ZZPA 4GQHA 2R7SA 3B0PA 1ORYA 1Y4CA 3HLZA 5AGFA 3DI5A 4L6RA 3ZTMA 4GYTA 2W9YA 1PD0A 4CDYA 2KW3C 1LIHA 1TR2A 4XEFA 1A7EA 3R2PA 5F5FA 4BJ5C 4N06A 1GQAA 1QPUA 4G0HA 3ZVRA 2YVKA 4FESA 4IAQA 1T5OA 4H4KC 4P9TA 4W8KA 5A6KA 2ZXWC 2PP4A 2XS8A 3ZDLA 5KYNA 4C7OB 2L7AA 2UUIA 3GORA 2L6HA 3ASOC 1VYKA 4NTAA 2W45A 5BQGA 3EG9A 3W8IA 2EPNA 1MMNA 1TKNA 2W4BA 4D4XA 2Y3HA 4OIRF 1OQCA 1QVXA 3V5ZA 4JW1A 1C17M 4J30B 3TK0A 4CS9A 4FAPB 3NYLA 3VRCA 3ATPA 1T6UA 3U8PA 3E70C 1M6TA 2ETSA 4DVYP 4U5CE 2GDCA 3ZWIA 3LESA 4YT8A 3LJBA 1OW6A 1BR1A 2B0HA 3NKDA 4ULWA 4A4AA 4HFKB 2A6HF 3UR3C 2LSEA 1QSPA 5BUOA 3ECSA 3AJMA 2TMVP 4B6IA 256BA 3FHDA 2YLGA 3O39A 2KK1A 3FMSA 3RVYA 3JCUQ 2L81A 2A1DD 3JRTA 4WGZA 4CS9C 3EZHA 2EIJC 3SYNA 3EGXA 1D0ZA 3K7DA 3TJ5A 5AC4A 1E86A 1WN0A 3MX3A 5E3CA 4HE8D 1V54C 4CJGA 3CQZA 1MMGA 4NTFA
chains in the Genus database with same CATH topology
4J7TA 3PCVA 5HV9A 3DWWA 3LEOA 2PNOA 3HKKA 4JRZA 4YL1A 4JC7A 4WABA 5BQHA 4YL3A 2UUHA 4BPMA 3B29A 4J7YA 2Q7RA 2UUIA 2H8AA 4NTAA 5BQGA 5K0IA 4AL0A 4AL1A 4NTBA 5BQIA 4JCZA 4YL0A 4NTFA 4YK5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4J7T A;  3PCV A;  5HV9 A;  3DWW A;  3LEO A;  2PNO A;  3HKK A;  4JRZ A;  4YL1 A;  4JC7 A;  4WAB A;  5BQH A;  4YL3 A;  2UUH A;  4BPM A;  3B29 A;  4J7Y A;  2Q7R A;  2UUI A;  2H8A A;  4NTA A;  5BQG A;  5K0I A;  4AL0 A;  4AL1 A;  4NTB A;  5BQI A;  4JCZ A;  4YL0 A;  4NTF A;  4YK5 A; 
#chains in the Genus database with same CATH topology
 1E84 A;  1HY5 A;  2J45 A;  1LI7 A;  2ZD9 A;  3EG9 B;  1G4U S;  4JIO A;  4JTA B;  2DGJ A;  2ZPA A;  4PFP A;  3EPV A;  3T6J A;  5HV9 A;  4U5E E;  1Q0M A;  1Q0K A;  1APC A;  2X0C A;  3W2V A;  4XTK A;  4N4W A;  4DRJ B;  4UDV A;  3EFO A;  3O6X A;  5DQT A;  4R32 A;  3I5Q A;  1J8Y F;  4Z9I A;  2OG2 A;  3M4B A;  2JX0 A;  1TFK B;  2C04 A;  3AG4 C;  3EQL F;  4WAB A;  2AWY A;  2XRH A;  1VLS A;  4E17 A;  4G7H F;  2E87 A;  2IM8 A;  4DVZ A;  1IZM A;  1YA9 A;  4U5G A;  2H8A A;  1OCZ C;  1A0B A;  4MVU A;  1RMV A;  3IEE A;  2CNW D;  4U5H A;  2EPK X;  2R7X A;  3K33 A;  1YDI A;  4ULV A;  3SXZ A;  3TQO A;  3AQB A;  1OW7 A;  4EKW A;  1MQV A;  3TD7 A;  2Q9B A;  4WJ0 A;  2XL4 A;  2V3C C;  4Q5S F;  4MVR A;  1JMW A;  1I4Y A;  2XM0 A;  4MQ9 F;  3DJN B;  1HMO A;  3GWL A;  2XM4 A;  1Z63 A;  2CGE A;  3EGX B;  1ZHT A;  3NKE A;  1E85 A;  2PFD A;  2J46 A;  4OIN F;  1YA7 O;  2OU6 A;  2EIL C;  5L3Q A;  2L6G A;  2P6V A;  3JTL O;  3V5Y A;  2ZXP A;  3HNI A;  3NDB B;  1VLT A;  2Z15 A;  3SEO A;  3Q6N A;  1JPN A;  3AG3 C;  4XEK A;  2HMZ A;  3RQF A;  4Q7C A;  1NBB A;  2XXA A;  4Q4Z F;  3U9M A;  3F47 A;  5IY5 C;  1BZ4 A;  5BQH A;  2HFI A;  3EFO B;  3QVZ A;  3MYI A;  2J7P A;  3LEV A;  5JLI A;  1PV3 A;  2J9U A;  1OXK A;  3GM3 A;  3MLG A;  4HFF B;  4EBB A;  1RXQ A;  3RW0 A;  3VYW A;  3WHN A;  2Y3B A;  4LAC B;  2J7P D;  2M64 A;  2RD9 A;  2J0X A;  3LS1 A;  3O10 A;  3TOM A;  4JCZ A;  4DRH B;  2VCC A;  1ORJ A;  2QY9 A;  3KL4 A;  1YZC A;  4XLN F;  3DWW A;  2WVO A;  4IRU A;  2NSF A;  4A2N B;  4M63 A;  3EGD A;  4KI2 A;  3K1I A;  1G4W R;  1T01 A;  1W2W A;  1JR8 A;  4I3M A;  1FNT c;  2R7T A;  3X1O A;  3HNK A;  1F1M A;  3RF3 A;  4CDA A;  5COG A;  3M79 A;  1HE1 A;  2BC5 A;  4MVM A;  4OD4 A;  5DQZ A;  3K1H A;  4Z9H A;  5EGY A;  1OCO C;  1WTY A;  1L3P A;  3HNL A;  2G3K A;  1D1B A;  1WWP A;  4O6M A;  1RCP A;  4BJ5 A;  1Y6D A;  2W4M A;  4MND A;  4NCQ A;  3DJU B;  1EA8 A;  1NFO A;  3SNH A;  5K0I A;  2ZXO A;  4C3E A;  1UFB A;  2XXA B;  1ZVZ A;  2GFH A;  1JAF A;  3W8H A;  4C3D A;  1VTM P;  2MWQ A;  4CX9 A;  4EHP A;  3GEI A;  4BJ1 A;  2HMQ A;  1O3U A;  2OEX A;  1AVO B;  2Y39 A;  5EK0 A;  1FAP B;  1D1C A;  2KYH A;  1LS1 A;  2F22 A;  3N0T A;  3J06 A;  4U9D A;  3NRH A;  1GM5 A;  5L0D A;  3NMI A;  4OD5 A;  5D92 A;  2AVK A;  1A41 A;  3DM9 B;  2YL7 A;  3DZA A;  2QLA A;  4MTG A;  1LPE A;  1S7Z A;  4QI2 A;  2I15 A;  3NMJ A;  4PAC A;  5B3S C;  3EJN A;  1ZHZ A;  3AQC A;  3EGD B;  2OEV A;  2I8B A;  3NYM A;  4RD9 A;  4ER9 A;  3FOP A;  2GWW A;  4LDK A;  4P9F A;  5L0C A;  4XPY A;  2QTV A;  3U2M A;  1OR3 A;  4AL0 A;  4KNW A;  4F4B A;  5JVE A;  1U89 A;  3S84 A;  1OKK A;  1TWC A;  3S9O A;  1RKC A;  1YJG A;  3LUT B;  3G50 A;  2YKZ A;  4YJW A;  4LDQ A;  3AG1 C;  5A6A A;  3OEO A;  2A0U A;  2PF4 E;  3PMR A;  3UMK A;  1I5N A;  1OKK D;  1RKE A;  2YLD A;  3C18 A;  3DAF A;  3IQ5 A;  2WVQ A;  3WOD F;  4ANJ A;  3G4Z A;  2R7O A;  2WZG A;  3S28 A;  1ZW3 A;  3W2W A;  4O7G A;  3W4Y A;  3F46 A;  4NY3 A;  4YL1 A;  3H2V A;  2LK4 A;  2J9B A;  5L3V A;  3AG2 C;  3N24 A;  3RYL A;  1SYQ A;  4DBQ A;  1T6I A;  4JEA A;  1K04 A;  2CDQ A;  2HV6 A;  3DKA A;  5JSL A;  4H54 A;  1BBH A;  1XZQ A;  2D5R B;  1H9T A;  3PHF 2;  2R7W A;  3LAY A;  3DXJ F;  3S27 A;  3LNR A;  3IPM O;  3BEH A;  3IQ6 A;  2IXP A;  5DVW A;  4XPX A;  1CGM E;  5B3I A;  3FAJ A;  3UGP A;  5BQI A;  2XL6 A;  1FR0 A;  2HJ3 A;  2Q7R A;  2BL2 A;  3AGT A;  4KBL A;  2YWA A;  3X2Q C;  2M4E A;  2XL8 A;  2KNH A;  3B0V C;  3Q7G A;  1JRA A;  4YT2 A;  3RFY A;  3PDM P;  1YLM A;  3RVZ A;  3HNJ A;  3U2L A;  2VH3 A;  1K40 A;  1LKX A;  2A6E F;  2V26 A;  2QUP A;  3ABM C;  4EBK A;  2EPL X;  1CGN A;  1ZW2 A;  4OIO F;  1RKE B;  2CNW A;  3SXY A;  4BG0 A;  1WAT A;  3GEE A;  2IXN A;  3GWN A;  3KPH A;  4JEB A;  4CS8 A;  5KYW A;  3DM5 A;  3H2U A;  1OCR C;  3M1C B;  4PR9 A;  1QQ3 A;  4XEV A;  1K05 A;  3R7C A;  4AX2 A;  4EIY A;  2OQM A;  1NG1 A;  2Q9A A;  3VAY A;  4G7Z F;  1TWA A;  1ZHX A;  2R7Q A;  4NTB A;  2XLO A;  4CIP A;  3EH2 A;  3Q6M A;  5CI8 A;  1M2O A;  2R9R B;  5F5H A;  4EUK B;  2R05 A;  3Q7L A;  3ZTZ A;  4MS2 A;  1MMA A;  1Q0G A;  4CSA A;  1QZX A;  2PX3 A;  2JD3 A;  1YZA A;  4JJG A;  5L0J A;  4MVS A;  1O87 A;  4JRZ A;  1H6G A;  4O6Y A;  1HW1 A;  1QKR A;  2HUJ A;  2JPU A;  2EIN C;  2X51 A;  2YQY A;  1TFO B;  3V5X A;  4BPM A;  1O5H A;  4I44 A;  3RKO F;  4CS8 C;  4E0H A;  5L0I A;  1E83 A;  1V74 B;  2DYS C;  5DS5 A;  1LS4 A;  4P6I C;  1LE4 A;  2FFH A;  3EH1 A;  3JRM O;  3MFN A;  2NPU A;  5KYX A;  4JTC B;  3KMI A;  5A6J A;  2HKV A;  3SXM A;  1MND A;  1V4A A;  2H7B A;  1VK5 A;  3T9O A;  4CDV A;  4CSA C;  1JPJ A;  3EHN A;  2QE9 A;  1BDJ B;  1HE9 A;  2XS1 A;  4ONS A;  3ZQY A;  2YL1 A;  4C3B A;  5KYW B;  4YL0 A;  1EI7 A;  3QZC A;  2XSE A;  3E9V A;  3A11 A;  3SZR A;  3CZ6 A;  4RBN A;  1CPQ A;  1Q0F A;  3DE9 A;  5E2Q A;  2RSE B;  3ITF A;  4QI0 A;  3L8J A;  2LIG A;  2AWC A;  2YL0 A;  4FWV A;  3B0U X;  1JOG A;  4BJ6 A;  5DS4 A;  1FMW A;  1LM3 B;  1TWH A;  2L6F A;  3FVY A;  3L34 A;  2KSF A;  2R03 A;  5COF A;  3O55 A;  2NUP A;  2UUH A;  1Z7Q c;  4IWB A;  2EIM C;  3TJ6 A;  3ZSU A;  3S90 A;  1LE2 A;  5B1B C;  2MYS A;  2XLD A;  2IOQ A;  2OCC C;  3QW0 A;  1VYI A;  3B9Q A;  4MW8 A;  4DXW A;  2NG1 A;  4K0D A;  5D91 A;  1NZE A;  1OR2 A;  1DOW A;  4D4N A;  5A69 A;  4DRI B;  1IW7 F;  2D4U A;  4I1O B;  3IQC A;  3DD7 A;  1KNY A;  4KNV A;  3U3B A;  3NG1 A;  1GGQ A;  4AE4 A;  3LLK A;  2IXO A;  4AL1 A;  1J8M F;  4E7S A;  2LP4 A;  4BJ6 C;  1V55 C;  2IXM A;  5KYX B;  2J9V A;  2NSG A;  2FGY A;  2H7V C;  3QVY A;  5TJ5 E;  4YN0 B;  3C63 A;  2PNO A;  1SR2 A;  2DB4 A;  3CAX A;  3C7J A;  2HZ8 A;  3MBG A;  4PJJ A;  3U9J A;  4U5F E;  3H65 A;  2Y69 C;  2HSB A;  3MYF A;  4IAO A;  4N6H A;  3T6B A;  3K66 A;  2KC3 A;  2VAS A;  2GAQ A;  2VC9 A;  4O6N A;  4PFO A;  4Z9J A;  5E33 A;  3G4X A;  1SZI A;  4CIH A;  1Z6A A;  1H7I A;  3HJC A;  5JP7 A;  4CBE A;  2XLW A;  1NLX A;  2HV7 A;  2NUP B;  2R25 A;  1Z5Z A;  4JVS A;  4LLC A;  4MW3 A;  1U0B B;  1AUE A;  2R7U A;  1WAS A;  2C03 A;  1NSG B;  3US6 A;  3JYH A;  4FX5 A;  2R7V A;  4EBJ A;  1EKY A;  2YL3 A;  3VM6 A;  4PK4 A;  4YK5 A;  1L7C A;  3FDQ A;  4J7T A;  4E0I A;  3L1M A;  1KU2 A;  2WZL A;  1YYX A;  2J0W A;  2J9W A;  2PBE A;  3LEO A;  4AE4 B;  3M15 A;  4OIP F;  3RQE A;  1Z3I X;  3I4U A;  1AEP A;  1FMV A;  1I4Z A;  1ORS C;  2EIK C;  4GEH A;  4JC7 A;  5CI9 A;  3S29 A;  4YL3 A;  5HSW A;  3GM2 A;  4XWJ A;  5E3A A;  1XWJ A;  2Q4F A;  2GA0 A;  3U8V A;  3CEX A;  5KYU A;  3TUL A;  3POV A;  3GOD A;  2KGO A;  2L9J A;  3KKB A;  2EPM X;  1KTM A;  2A68 F;  2NUT A;  5JUA A;  3GEH A;  1G5Z A;  3ZQV A;  1B68 A;  4JTD B;  1T6Q A;  3U0C A;  5JT4 A;  5COM A;  4N6C A;  2LFD A;  1D0X A;  4JJF A;  1VOM A;  1TWG A;  4G78 A;  1R5I D;  2MHR A;  3WAQ A;  1C03 A;  1N1C A;  2R02 A;  4I1M A;  4LLE A;  1FTS A;  2KJG A;  3NYJ A;  3OA1 A;  1NU9 C;  4OIQ F;  5FZT A;  3SXK A;  4NQF A;  3JZ0 A;  4LDR A;  1YYJ A;  1YVI A;  1NU7 D;  4XQ1 A;  3SP1 A;  4YT4 A;  2B0J A;  2XLV A;  2XLH A;  5FCL A;  2BE5 F;  1GS9 A;  2FAP B;  2PX0 A;  2A0B A;  2HS5 A;  3I5P A;  4QDL A;  5AC5 A;  1D0Y A;  1UG7 A;  3L8I A;  2A69 F;  4IJJ A;  2P7V A;  2XLM A;  2R7R A;  2YHS A;  3IQT A;  5JRA A;  2EPO A;  1EQ1 A;  2LCH A;  2VCB A;  3QW1 A;  3NMK A;  2CCY A;  3T4R A;  2HJM A;  3KH2 A;  4O79 A;  1U6H A;  2ICW G;  3UMI A;  5F28 E;  5KYU B;  4JZA A;  3RH3 A;  3UNG C;  2LD6 A;  4J32 B;  1NFN A;  1QLE C;  2ZXR A;  4BEJ A;  2NUT B;  1WGW A;  1ZU5 A;  3PCV A;  2G62 A;  1A7D A;  5CIV A;  4U9E A;  2CW0 F;  4ZLC A;  3DAG A;  1TQG A;  3ZG1 A;  4YWQ A;  3QTH A;  4E7Z A;  1DOV A;  1BR2 A;  2WVN A;  4IGG A;  1LVK A;  1SF8 A;  5L0H A;  2YRF A;  2IYL D;  1ZHW A;  1OXB A;  3B29 A;  3KYJ A;  4MTF A;  4LER A;  1RJ9 A;  4YT5 A;  2CYD A;  3C8G A;  2P1A A;  2YZS A;  3N2Z B;  3B71 A;  4MVQ A;  4K1O A;  1XZP A;  4E18 A;  4DOZ A;  4PJL A;  3T6G B;  5T3T A;  1CGO A;  3LNM B;  3WG7 C;  5KYY A;  2Q00 A;  1YAU O;  3EZI A;  1R4T A;  3C8G D;  2Y3G A;  4X0R A;  1S05 A;  1MNE A;  4K7B A;  1WOL A;  5DLJ A;  2LQG A;  3HKK A;  2QNL A;  1M57 C;  2P0N A;  1H9G A;  4HEA J;  4XLP F;  3L0I A;  1FFH A;  2OJQ A;  1ZHY A;  3ABL C;  3EHM A;  1M2V A;  1VB5 A;  4IB4 A;  4W8P A;  4AK9 A;  1VMA A;  1YAR O;  2WZF A;  3GAN A;  4BJT A;  3U5S A;  3OWT A;  1G8X A;  2J8W A;  3ASN C;  4JUR I;  1T9K A;  4NC3 A;  3A9C A;  1OCC C;  1SMY F;  3ZIB A;  4BEM J;  3UGO A;  2IBF A;  5EHH A;  4U5D E;  3CSK A;  3ZC4 A;  1C02 A;  3JSZ A;  2Q3T A;  2VB6 A;  4CS7 A;  1OW8 A;  2AP3 A;  2VCA A;  4JKV A;  4IAR A;  4ZLD A;  1FFT C;  2OKU A;  3IHU A;  3RQG A;  2HSQ A;  1PCX A;  2P61 A;  4XPW A;  1BR4 A;  2YEV A;  3LLI A;  2WL8 A;  3C8Z A;  2OOC A;  1RJ9 B;  3AOU A;  4U5B E;  5B1A C;  3U3F A;  3V7O A;  3DE8 A;  1A7V A;  4MTO A;  5GPG B;  3C8G B;  3FOO A;  5DS6 A;  3GM1 A;  3VF0 A;  3RIP A;  4CJO A;  2AU5 A;  1LI5 A;  2H7O A;  2DYR C;  1HMD A;  5T3W A;  5KYY B;  2KQ9 A;  3K6B A;  2OJE D;  3FAP B;  3LS0 A;  1HW2 A;  5L0G A;  4C7O A;  1PD1 A;  2LFF A;  2ASR A;  3HTK C;  2O9X A;  4DJ9 A;  5A6B A;  4EWC A;  4MVZ A;  3TOL A;  5JS5 A;  3DMD A;  2WB7 A;  3S0X A;  1M56 C;  2Q9C A;  5L0F A;  1M2V B;  3M4C A;  1ST6 A;  4J7Y A;  3JSE O;  1Z23 A;  1Q0D A;  1E2X A;  3JYY A;  3QMK A;  2XLE A;  4JE9 A;  4PJM A;  4RDA A;  5A6B D;  1D1A A;  2DI3 A;  3FXH A;  4DBR A;  1MMD A;  4KC9 A;  4PJN A;  5T1D B;  3UMH A;  3C62 A;  3JT1 A;  3ABK C;  4G7O F;  3KYI A;  2YLI A;  3AGU A;  2Y3D A;  4WGY A;  4MVO A;  3K1I C;  2G3V A;  4JCH A;  1ZYR F;  3BRJ A;  1CPR A;  1ZU4 A;  1ZZP A;  4GQH A;  2R7S A;  3B0P A;  1ORY A;  1Y4C A;  3HLZ A;  5AGF A;  3DI5 A;  4L6R A;  3ZTM A;  4GYT A;  2W9Y A;  1PD0 A;  4CDY A;  2KW3 C;  1LIH A;  1TR2 A;  4XEF A;  1A7E A;  3R2P A;  5F5F A;  4BJ5 C;  4N06 A;  1GQA A;  1QPU A;  4G0H A;  3ZVR A;  2YVK A;  4FES A;  4IAQ A;  1T5O A;  4H4K C;  4P9T A;  4W8K A;  5A6K A;  2ZXW C;  2PP4 A;  2XS8 A;  3ZDL A;  5KYN A;  4C7O B;  2L7A A;  2UUI A;  3GOR A;  2L6H A;  3ASO C;  1VYK A;  4NTA A;  2W45 A;  5BQG A;  3EG9 A;  3W8I A;  2EPN A;  1MMN A;  1TKN A;  2W4B A;  4D4X A;  2Y3H A;  4OIR F;  1OQC A;  1QVX A;  3V5Z A;  4JW1 A;  1C17 M;  4J30 B;  3TK0 A;  4CS9 A;  4FAP B;  3NYL A;  3VRC A;  3ATP A;  1T6U A;  3U8P A;  3E70 C;  1M6T A;  2ETS A;  4DVY P;  4U5C E;  2GDC A;  3ZWI A;  3LES A;  4YT8 A;  3LJB A;  1OW6 A;  1BR1 A;  2B0H A;  3NKD A;  4ULW A;  4A4A A;  4HFK B;  2A6H F;  3UR3 C;  2LSE A;  1QSP A;  5BUO A;  3ECS A;  3AJM A;  2TMV P;  4B6I A;  256B A;  3FHD A;  2YLG A;  3O39 A;  2KK1 A;  3FMS A;  3RVY A;  3JCU Q;  2L81 A;  2A1D D;  3JRT A;  4WGZ A;  4CS9 C;  3EZH A;  2EIJ C;  3SYN A;  3EGX A;  1D0Z A;  3K7D A;  3TJ5 A;  5AC4 A;  1E86 A;  1WN0 A;  3MX3 A;  5E3C A;  4HE8 D;  1V54 C;  4CJG A;  3CQZ A;  1MMG A;  4NTF A; 
#chains in the Genus database with same CATH homology
 4J7T A;  3PCV A;  5HV9 A;  3DWW A;  3LEO A;  2PNO A;  3HKK A;  4JRZ A;  4YL1 A;  4JC7 A;  4WAB A;  5BQH A;  4YL3 A;  2UUH A;  4BPM A;  3B29 A;  4J7Y A;  2Q7R A;  2UUI A;  2H8A A;  4NTA A;  5BQG A;  5K0I A;  4AL0 A;  4AL1 A;  4NTB A;  5BQI A;  4JCZ A;  4YL0 A;  4NTF A;  4YK5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...