4YL3A

Crystal structures of mpges-1 inhibitor complexes
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
146
structure length
146
Chain Sequence
b'VMSSPALPAFLLCSTLLVIKMYVVAIITGQVRLRKKAFANPEDALRHGGPQYCRSDPDVERCLRAHRNDMETIYPFLFLGFVYSFLGPNPFVAWMHFLVFLVGRVAHTVAYLGKLRAPIRSVTYTLAQLPCASMALQILWEAARHL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Prostaglandin E synthase
publication title Crystal Structures of mPGES-1 Inhibitor Complexes Form a Basis for the Rational Design of Potent Analgesic and Anti-Inflammatory Therapeutics.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Isomerase/isomerase inhibitor
total genus 63
structure length 146
sequence length 146
ec nomenclature ec 5.3.99.3: Prostaglandin-E synthase.
pdb deposition date 2015-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01124 MAPEG MAPEG family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.550 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Membrane associated eicosanoid/glutathione metabolism-like domain 4yl3A00
4YL0A 2Q7RA 2H8AA 5BQIA 3LEOA 4AL0A 4NTBA 4YL3A 3DWWA 4J7TA 5BQHA 4JCZA 4JC7A 5K0IA 5HV9A 2PNOA 2UUHA 4YK5A 3HKKA 4YL1A 3B29A 4J7YA 4WABA 4NTAA 4BPMA 4JRZA 2UUIA 3PCVA 4NTFA 4AL1A 5BQGA
chains in the Genus database with same CATH superfamily
4MVQA 3TOLA 2R7QA 5T3TA 3MBGA 4G7ZF 1LVKA 1OW6A 2OCCC 2LQGA 1O3UA 3T4RA 1M2VB 3B0PA 4BJ5C 3S84A 3B9QA 4NTBA 1OCRC 3SXYA 1VMAA 3U9MA 1MMGA 2D4UA 3I5QA 1HW1A 4XEFA 2AP3A 3FVYA 4IWBA 3HTKC 3J06A 2YL1A 3K1IA 1E83A 4XPWA 3C62A 1A41A 4DBRA 3RQGA 2XLDA 4I1MA 1G5ZA 4WJ0A 2DI3A 2XLOA 2EPKX 3TJ6A 1VLSA 1M57C 2HZ8A 2A1DD 3ZG1A 2PX3A 4JEBA 3AQBA 4BEMJ 3NYJA 1FMWA 3I5PA 3JYYA 3V5ZA 4QI0A 3Q6MA 4JZAA 2M64A 1E86A 3LLKA 4GEHA 3MYIA 3GWLA 3L8JA 1G4US 2Q7RA 1WATA 2W9YA 3KH2A 3GORA 2L6FA 1S7ZA 2J45A 5JP7A 2ZXPA 2P6VA 4MTFA 1OR3A 1LPEA 3C7JA 4AL0A 5KYXA 1WASA 2P1AA 1JAFA 2XL4A 2ZD9A 3FAPB 4IGGA 4O7GA 1K05A 3DD7A 5L0FA 1YYJA 2QY9A 1M56C 2GA0A 3ASOC 3POVA 3NYLA 3WHNA 5K0IA 3SYNA 3E70C 3JYHA 4CS9C 1ORSC 1IW7F 2P7VA 4HFKB 3EFOA 1RJ9B 3F46A 4PJNA 4H4KC 3T9OA 2J9BA 1MNEA 4HFFB 4D4XA 4H54A 2VASA 4HE8D 3O55A 3U2MA 2R9RB 2YZSA 1TQGA 3R2PA 1JPNA 1JOGA 1HE1A 2AWYA 3EG9A 2NUTB 2E87A 3H2UA 2QTVA 2NSGA 1T6IA 5KYUA 1Y4CA 2NUPB 2X0CA 2AVKA 3UNGC 3W2VA 3DXJF 3HNJA 4XLPF 2LIGA 2OQMA 1FTSA 3EHMA 4YT8A 3LNMB 1DOVA 3NKEA 2MHRA 4MW3A 5T1DB 1QLEC 2M4EA 4JKVA 5COFA 4Q4ZF 3S9OA 1FFHA 1OW8A 4YWQA 2XLMA 5KYYB 1FR0A 1ORYA 5BQHA 2W45A 1SR2A 4JCZA 4EBJA 1Q0DA 1JRAA 3G50A 2Q00A 4IARA 1U6HA 4W8PA 4I3MA 4MQ9F 2HV6A 2LP4A 4MNDA 4AX2A 3M4CA 1KNYA 3Q6NA 2VC9A 2WZLA 3JT1A 3QVYA 1OCZC 1EQ1A 1R5ID 1YA7O 3C18A 1J8MF 3GODA 3L8IA 4LDQA 1LE4A 1LM3B 1Y6DA 256BA 1CPRA 1TWHA 3GANA 3IPMO 3N24A 3N0TA 3V7OA 3UGOA 4KI2A 3I4UA 4MTGA 4YL0A 3OWTA 5AGFA 3MYFA 3FOOA 5D91A 1BZ4A 1IZMA 4K0DA 2YKZA 4CDAA 4BG0A 3W8IA 1M2VA 1PCXA 5JS5A 2HMQA 3QVZA 4P6IC 4FAPB 1ZHWA 4XEKA 2EPNA 3AGUA 2HSQA 2KW3C 5IY5C 5COGA 2LK4A 1D0ZA 1HY5A 2XLHA 2XS8A 2Q9CA 2O9XA 2R7OA 4DRIB 4CSAC 4JEAA 1PV3A 3QW1A 2R7RA 1APCA 4MS2A 1O87A 3DE8A 1Q0FA 3OA1A 4WGZA 5L3QA 2XXAB 3EHNA 2ETSA 4BJ5A 3HJCA 2IOQA 3HNKA 3S27A 4B6IA 1LS1A 2JPUA 4C7OB 4XLNF 1XWJA 4ANJA 2R7TA 2WVOA 1A7EA 1G8XA 4Z9JA 5KYWB 3L0IA 2CYDA 5F5HA 3IQCA 2YLGA 4LDRA 2R03A 3K6BA 3U3FA 3B0VC 1YZAA 2A0BA 2YL3A 3RQEA 3U2LA 1E85A 5E3CA 4LERA 1LI7A 2Z15A 1AUEA 2QUPA 1VLTA 1T6UA 4JC7A 3TK0A 4C3BA 5DQTA 5B1BC 3SZRA 4DOZA 3TD7A 1I4YA 3NMIA 3ZQVA 3NG1A 4CDVA 2PX0A 1ZHZA 1RJ9A 2J0XA 4U5CE 5EHHA 4Z9IA 3AG2C 4JE9A 4YK5A 4MVSA 1Q0GA 3WAQA 2Q3TA 4JW1A 1M6TA 3PMRA 4JRZA 2EILC 2Y3HA 3CZ6A 3EQLF 2ZXRA 3LAYA 1UFBA 3DKAA 4G78A 2KQ9A 4PACA 3GM2A 4Q7CA 2GAQA 5COMA 2NUTA 2WL8A 1YJGA 4IRUA 1E84A 3DAFA 2HMZA 1HMDA 4CS9A 3C8GA 5TJ5E 3CEXA 1LKXA 1U89A 1VB5A 1VK5A 2H7VC 3BRJA 4KNWA 4IJJA 1Q0MA 3DM5A 4P9FA 4Z9HA 3RFYA 5A6BD 1JMWA 2HJMA 1GQAA 2WB7A 5JVEA 5KYYA 4LACB 3SXMA 4AE4A 3W8HA 1RKEB 2G3KA 2Y3DA 2PNOA 5HSWA 1TR2A 3LNRA 2PFDA 2CNWD 2W4BA 3O39A 3DM9B 1YARO 4D4NA 4JTCB 4CIPA 2R02A 1F1MA 5DLJA 2Y3GA 4CJOA 5T3WA 4U5DE 2Y3BA 4N6HA 4CBEA 2QNLA 5JSLA 4MVUA 4A4AA 1XZPA 3ZSUA 2XM0A 2L81A 1OXKA 2P61A 2Y69C 4JVSA 3KPHA 4NY3A 1I4ZA 2XS1A 3K7DA 4AL1A 4CS8A 3S0XA 3AG1C 3RIPA 2YHSA 3JZ0A 4ULWA 1CGOA 3AJMA 3F47A 4GQHA 2Y39A 2B0JA 4LLEA 1FNTc 4DBQA 3AG3C 3U8VA 3KMIA 3W2WA 1RXQA 1TFOB 2G62A 2J7PD 2PF4E 3NKDA 1K40A 1EA8A 2OKUA 2OEVA 3DWWA 4J30B 4YJWA 4EIYA 2YRFA 5JLIA 4EUKB 3K1HA 4PJMA 1N1CA 2HV7A 4BJ6C 2YQYA 2DYRC 2OOCA 4LLCA 5EK0A 5BUOA 2XXAA 2L7AA 3FOPA 4IB4A 2HJ3A 1AVOB 4JJGA 2UUIA 3ASNC 4NTFA 2IM8A 2ZXWC 3RYLA 1LI5A 3FXHA 3V5XA 4E18A 3DMDA 4KNVA 4CS7A 4C7OA 3QW0A 5BQGA 4E0HA 5DS6A 2LFDA 3DZAA 3EJNA 3LEOA 5KYWA 1NLXA 2LSEA 4CSAA 2R25A 5A6BA 4N06A 4CDYA 1ZU5A 1VYIA 2L6HA 2KSFA 4QI2A 2B0HA 2XLVA 3LUTB 1M2OA 4NQFA 4OD4A 3FDQA 3ITFA 3EH2A 4A2NB 5JT4A 3VM6A 4K7BA 4ZLDA 1VOMA 3GWNA 2OU6A 3AGTA 3JTLO 2EPLX 4G7HF 1VTMP 3UGPA 3RVZA 1HE9A 1QVXA 3HKKA 2EPMX 2ICWG 2QE9A 2KJGA 2XLWA 4OD5A 3BEHA 2LFFA 2XSEA 1NU7D 1SYQA 2AU5A 3VRCA 1TWAA 4G0HA 2OJED 1ZHXA 2GFHA 4U5FE 5L0CA 1GGQA 1YDIA 2H8AA 2WVQA 2YVKA 1W2WA 4MW8A 3VYWA 4DRHB 5BQIA 1O5HA 1ZYRF 2HSBA 1ZVZA 3TOMA 4WGYA 3RH3A 2EINC 2J7PA 2ASRA 2D5RB 4C3DA 4MVZA 1FFTC 5F5FA 2GDCA 5FZTA 2RSEB 2CCYA 1EKYA 1RKEA 1SZIA 2VH3A 5E33A 3UR3C 5B3IA 3K66A 4OIPF 3FMSA 3KL4A 4IAQA 2H7BA 3FAJA 1YYXA 3EZIA 4EKWA 1VYKA 4J7YA 4MVOA 4NCQA 4WABA 1NBBA 1OW7A 1PD0A 2BE5F 3FHDA 3LLIA 3MFNA 3SEOA 3UMKA 3ZDLA 1T9KA 2JD3A 5L0DA 3U3BA 4F4BA 5DS5A 4JURI 1YAUO 3ATPA 4KC9A 2J8WA 3LESA 4PR9A 2TMVP 3O10A 3M4BA 4O79A 4P9TA 3ZC4A 1QSPA 4RD9A 4PK4A 3X2QC 1UG7A 2C04A 3IQ5A 3LS1A 5AC4A 4UDVA 3JSEO 3UMIA 5A69A 2HUJA 3ECSA 4DXWA 4OIOF 1XZQA 3M1CB 2XRHA 1JPJA 2NSFA 2YWAA 1CGME 1Z6AA 1V4AA 2RD9A 4J7TA 2I8BA 4YT5A 4OIRF 1YLMA 2MWQA 1PD1A 1ORJA 3U5SA 3UMHA 2YEVA 3QMKA 2EIJC 3EGXB 3LEVA 1ST6A 4E7ZA 1H6GA 3DAGA 4XPXA 1LIHA 2A68F 3G4ZA 1FMVA 3JSZA 5CI8A 3WODF 1WN0A 2X51A 2V26A 3M15A 1NFNA 3B29A 3T6GB 1YVIA 2L6GA 3A9CA 1C03A 4DJ9A 4L6RA 5FCLA 1RMVA 3OEOA 4Q5SF 1ZHTA 2KNHA 1OKKD 1Z7Qc 3Q7LA 1Z63A 1V74B 3IQTA 4E17A 2NUPA 1T01A 1OCOC 1WOLA 3JCUQ 2J9UA 1R4TA 2PBEA 2QLAA 3VF0A 1SMYF 1H7IA 2CGEA 2V3CC 4CJGA 4E0IA 4PFOA 3GEEA 4E7SA 1J8YF 3EZHA 3S29A 1L7CA 2F22A 2PP4A 1BR4A 1BR1A 3ZIBA 4JTDB 4X0RA 1D0XA 5D92A 5B1AC 4ZLCA 5KYNA 2J46A 2R7XA 3V5YA 2KGOA 2BL2A 1A7VA 3EGDB 4MVRA 3H2VA 3N2ZB 4HEAJ 2HFIA 3SXKA 3SNHA 2Q9AA 1CGNA 2P0NA 4GYTA 3S28A 3TJ5A 2JX0A 4K1OA 3ZQYA 3IEEA 3LS0A 2KC3A 4N6CA 3NRHA 3US6A 2VCAA 1NSGB 2VCBA 2YLDA 3RF3A 1YZCA 3PCVA 1NG1A 4CIHA 2R7UA 3NYMA 5DVWA 1CPQA 3KYJA 3RVYA 3ZTMA 1TWGA 2KK1A 5B3SC 3ZWIA 2YL0A 3CQZA 1NFOA 4ULVA 3X1OA 2GWWA 1D0YA 3T6JA 2A0UA 2IYLD 1L3PA 1NZEA 2ZXOA 4O6MA 3HLZA 2DYSC 3NMJA 3KYIA 1AEPA 1V54C 2WVNA 4I44A 4XQ1A 3EH1A 5A6AA 3U0CA 1H9GA 3GM3A 3MLGA 1B68A 2LCHA 2I15A 4YT2A 1TFKB 3PDMP 2Q4FA 4XWJA 1ZW3A 1TKNA 3DE9A 4G7OF 3TQOA 1OKKA 5A6KA 5DS4A 1LS4A 1I5NA 2L9JA 4YT4A 3CSKA 1GM5A 1DOWA 5JUAA 4XPYA 1A7DA 1ZU4A 3LJBA 4C3EA 3NDBB 1BBHA 1RKCA 2NPUA 2IXOA 1OQCA 3L1MA 1OXBA 3QZCA 5L0JA 5A6JA 1Z5ZA 1HW2A 5CIVA 5E2QA 1NU9C 1RCPA 2WZGA 3IQ6A 4NC3A 3DJNB 1QPUA 4BEJA 4CX9A 2HKVA 2XL8A 5HV9A 5F28E 2CNWA 4QDLA 3EGXA 2FAPB 3GEHA 2R7VA 1D1BA 1T6QA 4LDKA 1HMOA 4YL1A 2BC5A 1KU2A 3WG7C 4DVYP 2CW0F 2R05A 3K1IC 1BDJB 2R7WA 1V55C 1BR2A 2DGJA 3RW0A 4EBKA 4EHPA 1EI7A 3C8GB 3CAXA 1D1CA 1OR2A 3IHUA 4IAOA 2HS5A 2ZPAA 4FX5A 1E2XA 4U9EA 1ZZPA 2XM4A 4R32A 3ZTZA 2XL6A 3U9JA 4CS8C 3A11A 4AE4B 1FAPB 4EWCA 1MMDA 2IXPA 2OG2A 3G4XA 4OIQF 3SXZA 2G3VA 2DB4A 3HNIA 3QTHA 2NG1A 4I1OB 3PHF2 3EGDA 2UUHA 1WWPA 1MQVA 4BJTA 3B71A 3GM1A 4MTOA 4O6YA 4XTKA 1Q0KA 2J0WA 2EIKC 4BJ1A 1KTMA 1QQ3A 4M63A 3L34A 3JRMO 3E9VA 1T5OA 5AC5A 2FGYA 3KKBA 4U5HA 3S90A 4JTAB 1MMNA 5EGYA 2W4MA 1WTYA 3H65A 3T6BA 4FWVA 3C8GD 3O6XA 1S05A 5KYXB 2MYSA 1Z23A 3ZVRA 1K04A 2J9WA 4EBBA 1WGWA 5CI9A 4YN0B 2IBFA 3SP1A 5L0GA 4KBLA 4U5GA 2YLIA 3RKOF 4DVZA 1C02A 1OCCC 1Z3IX 4JIOA 3C8ZA 2EPOA 4XEVA 3B0UX 4O6NA 1YA9A 3EFOB 2EIMC 1G4WR 4OINF 2KYHA 4U5BE 4PFPA 4JJFA 4RBNA 1A0BA 3DJUB 1ZW2A 4NTAA 2Q9BA 2OEXA 3HNLA 3EG9B 5KYUB 5L0HA 1JR8A 3K33A 4RDAA 3R7CA 2A69F 3AQCA 2A6EF 4N4WA 1QKRA 1TWCA 3EPVA 4AK9A 2VB6A 4ER9A 4U5EE 2J9VA 3W4YA 3AOUA 2AWCA 4ONSA 1C17M 1LE2A 2H7OA 1H9TA 1ZHYA 2XLEA 3M79A 4U9DA 2VCCA 3TULA 1QZXA 4PJJA 3JRTA 4YL3A 4BJ6A 1MNDA 2IXMA 2WZFA 3MX3A 3U8PA 5L3VA 2A6HF 3AG4C 3ABMC 5GPGB 1GS9A 3VAYA 1U0BB 2FFHA 3ABKC 4FESA 2IXNA 2YL7A 4DRJB 3C63A 2C03A 3ABLC 5JRAA 2OJQA 3GEIA 3Q7GA 4PJLA 1SF8A 4J32B 2LD6A 5DQZA 4MVMA 4BPMA 5E3AA 1MMAA 2R7SA 4JCHA 5L0IA 3DI5A 1D1AA 4W8KA 3RQFA 3NMKA 2CDQA
chains in the Genus database with same CATH topology
4YL0A 2Q7RA 2H8AA 5BQIA 3LEOA 4AL0A 4NTBA 4YL3A 3DWWA 4J7TA 5BQHA 4JCZA 4JC7A 5K0IA 5HV9A 2PNOA 2UUHA 4YK5A 3HKKA 4YL1A 3B29A 4J7YA 4WABA 4NTAA 4BPMA 4JRZA 2UUIA 3PCVA 4NTFA 4AL1A 5BQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YL0 A;  2Q7R A;  2H8A A;  5BQI A;  3LEO A;  4AL0 A;  4NTB A;  4YL3 A;  3DWW A;  4J7T A;  5BQH A;  4JCZ A;  4JC7 A;  5K0I A;  5HV9 A;  2PNO A;  2UUH A;  4YK5 A;  3HKK A;  4YL1 A;  3B29 A;  4J7Y A;  4WAB A;  4NTA A;  4BPM A;  4JRZ A;  2UUI A;  3PCV A;  4NTF A;  4AL1 A;  5BQG A; 
#chains in the Genus database with same CATH topology
 4MVQ A;  3TOL A;  2R7Q A;  5T3T A;  3MBG A;  4G7Z F;  1LVK A;  1OW6 A;  2OCC C;  2LQG A;  1O3U A;  3T4R A;  1M2V B;  3B0P A;  4BJ5 C;  3S84 A;  3B9Q A;  4NTB A;  1OCR C;  3SXY A;  1VMA A;  3U9M A;  1MMG A;  2D4U A;  3I5Q A;  1HW1 A;  4XEF A;  2AP3 A;  3FVY A;  4IWB A;  3HTK C;  3J06 A;  2YL1 A;  3K1I A;  1E83 A;  4XPW A;  3C62 A;  1A41 A;  4DBR A;  3RQG A;  2XLD A;  4I1M A;  1G5Z A;  4WJ0 A;  2DI3 A;  2XLO A;  2EPK X;  3TJ6 A;  1VLS A;  1M57 C;  2HZ8 A;  2A1D D;  3ZG1 A;  2PX3 A;  4JEB A;  3AQB A;  4BEM J;  3NYJ A;  1FMW A;  3I5P A;  3JYY A;  3V5Z A;  4QI0 A;  3Q6M A;  4JZA A;  2M64 A;  1E86 A;  3LLK A;  4GEH A;  3MYI A;  3GWL A;  3L8J A;  1G4U S;  2Q7R A;  1WAT A;  2W9Y A;  3KH2 A;  3GOR A;  2L6F A;  1S7Z A;  2J45 A;  5JP7 A;  2ZXP A;  2P6V A;  4MTF A;  1OR3 A;  1LPE A;  3C7J A;  4AL0 A;  5KYX A;  1WAS A;  2P1A A;  1JAF A;  2XL4 A;  2ZD9 A;  3FAP B;  4IGG A;  4O7G A;  1K05 A;  3DD7 A;  5L0F A;  1YYJ A;  2QY9 A;  1M56 C;  2GA0 A;  3ASO C;  3POV A;  3NYL A;  3WHN A;  5K0I A;  3SYN A;  3E70 C;  3JYH A;  4CS9 C;  1ORS C;  1IW7 F;  2P7V A;  4HFK B;  3EFO A;  1RJ9 B;  3F46 A;  4PJN A;  4H4K C;  3T9O A;  2J9B A;  1MNE A;  4HFF B;  4D4X A;  4H54 A;  2VAS A;  4HE8 D;  3O55 A;  3U2M A;  2R9R B;  2YZS A;  1TQG A;  3R2P A;  1JPN A;  1JOG A;  1HE1 A;  2AWY A;  3EG9 A;  2NUT B;  2E87 A;  3H2U A;  2QTV A;  2NSG A;  1T6I A;  5KYU A;  1Y4C A;  2NUP B;  2X0C A;  2AVK A;  3UNG C;  3W2V A;  3DXJ F;  3HNJ A;  4XLP F;  2LIG A;  2OQM A;  1FTS A;  3EHM A;  4YT8 A;  3LNM B;  1DOV A;  3NKE A;  2MHR A;  4MW3 A;  5T1D B;  1QLE C;  2M4E A;  4JKV A;  5COF A;  4Q4Z F;  3S9O A;  1FFH A;  1OW8 A;  4YWQ A;  2XLM A;  5KYY B;  1FR0 A;  1ORY A;  5BQH A;  2W45 A;  1SR2 A;  4JCZ A;  4EBJ A;  1Q0D A;  1JRA A;  3G50 A;  2Q00 A;  4IAR A;  1U6H A;  4W8P A;  4I3M A;  4MQ9 F;  2HV6 A;  2LP4 A;  4MND A;  4AX2 A;  3M4C A;  1KNY A;  3Q6N A;  2VC9 A;  2WZL A;  3JT1 A;  3QVY A;  1OCZ C;  1EQ1 A;  1R5I D;  1YA7 O;  3C18 A;  1J8M F;  3GOD A;  3L8I A;  4LDQ A;  1LE4 A;  1LM3 B;  1Y6D A;  256B A;  1CPR A;  1TWH A;  3GAN A;  3IPM O;  3N24 A;  3N0T A;  3V7O A;  3UGO A;  4KI2 A;  3I4U A;  4MTG A;  4YL0 A;  3OWT A;  5AGF A;  3MYF A;  3FOO A;  5D91 A;  1BZ4 A;  1IZM A;  4K0D A;  2YKZ A;  4CDA A;  4BG0 A;  3W8I A;  1M2V A;  1PCX A;  5JS5 A;  2HMQ A;  3QVZ A;  4P6I C;  4FAP B;  1ZHW A;  4XEK A;  2EPN A;  3AGU A;  2HSQ A;  2KW3 C;  5IY5 C;  5COG A;  2LK4 A;  1D0Z A;  1HY5 A;  2XLH A;  2XS8 A;  2Q9C A;  2O9X A;  2R7O A;  4DRI B;  4CSA C;  4JEA A;  1PV3 A;  3QW1 A;  2R7R A;  1APC A;  4MS2 A;  1O87 A;  3DE8 A;  1Q0F A;  3OA1 A;  4WGZ A;  5L3Q A;  2XXA B;  3EHN A;  2ETS A;  4BJ5 A;  3HJC A;  2IOQ A;  3HNK A;  3S27 A;  4B6I A;  1LS1 A;  2JPU A;  4C7O B;  4XLN F;  1XWJ A;  4ANJ A;  2R7T A;  2WVO A;  1A7E A;  1G8X A;  4Z9J A;  5KYW B;  3L0I A;  2CYD A;  5F5H A;  3IQC A;  2YLG A;  4LDR A;  2R03 A;  3K6B A;  3U3F A;  3B0V C;  1YZA A;  2A0B A;  2YL3 A;  3RQE A;  3U2L A;  1E85 A;  5E3C A;  4LER A;  1LI7 A;  2Z15 A;  1AUE A;  2QUP A;  1VLT A;  1T6U A;  4JC7 A;  3TK0 A;  4C3B A;  5DQT A;  5B1B C;  3SZR A;  4DOZ A;  3TD7 A;  1I4Y A;  3NMI A;  3ZQV A;  3NG1 A;  4CDV A;  2PX0 A;  1ZHZ A;  1RJ9 A;  2J0X A;  4U5C E;  5EHH A;  4Z9I A;  3AG2 C;  4JE9 A;  4YK5 A;  4MVS A;  1Q0G A;  3WAQ A;  2Q3T A;  4JW1 A;  1M6T A;  3PMR A;  4JRZ A;  2EIL C;  2Y3H A;  3CZ6 A;  3EQL F;  2ZXR A;  3LAY A;  1UFB A;  3DKA A;  4G78 A;  2KQ9 A;  4PAC A;  3GM2 A;  4Q7C A;  2GAQ A;  5COM A;  2NUT A;  2WL8 A;  1YJG A;  4IRU A;  1E84 A;  3DAF A;  2HMZ A;  1HMD A;  4CS9 A;  3C8G A;  5TJ5 E;  3CEX A;  1LKX A;  1U89 A;  1VB5 A;  1VK5 A;  2H7V C;  3BRJ A;  4KNW A;  4IJJ A;  1Q0M A;  3DM5 A;  4P9F A;  4Z9H A;  3RFY A;  5A6B D;  1JMW A;  2HJM A;  1GQA A;  2WB7 A;  5JVE A;  5KYY A;  4LAC B;  3SXM A;  4AE4 A;  3W8H A;  1RKE B;  2G3K A;  2Y3D A;  2PNO A;  5HSW A;  1TR2 A;  3LNR A;  2PFD A;  2CNW D;  2W4B A;  3O39 A;  3DM9 B;  1YAR O;  4D4N A;  4JTC B;  4CIP A;  2R02 A;  1F1M A;  5DLJ A;  2Y3G A;  4CJO A;  5T3W A;  4U5D E;  2Y3B A;  4N6H A;  4CBE A;  2QNL A;  5JSL A;  4MVU A;  4A4A A;  1XZP A;  3ZSU A;  2XM0 A;  2L81 A;  1OXK A;  2P61 A;  2Y69 C;  4JVS A;  3KPH A;  4NY3 A;  1I4Z A;  2XS1 A;  3K7D A;  4AL1 A;  4CS8 A;  3S0X A;  3AG1 C;  3RIP A;  2YHS A;  3JZ0 A;  4ULW A;  1CGO A;  3AJM A;  3F47 A;  4GQH A;  2Y39 A;  2B0J A;  4LLE A;  1FNT c;  4DBQ A;  3AG3 C;  3U8V A;  3KMI A;  3W2W A;  1RXQ A;  1TFO B;  2G62 A;  2J7P D;  2PF4 E;  3NKD A;  1K40 A;  1EA8 A;  2OKU A;  2OEV A;  3DWW A;  4J30 B;  4YJW A;  4EIY A;  2YRF A;  5JLI A;  4EUK B;  3K1H A;  4PJM A;  1N1C A;  2HV7 A;  4BJ6 C;  2YQY A;  2DYR C;  2OOC A;  4LLC A;  5EK0 A;  5BUO A;  2XXA A;  2L7A A;  3FOP A;  4IB4 A;  2HJ3 A;  1AVO B;  4JJG A;  2UUI A;  3ASN C;  4NTF A;  2IM8 A;  2ZXW C;  3RYL A;  1LI5 A;  3FXH A;  3V5X A;  4E18 A;  3DMD A;  4KNV A;  4CS7 A;  4C7O A;  3QW0 A;  5BQG A;  4E0H A;  5DS6 A;  2LFD A;  3DZA A;  3EJN A;  3LEO A;  5KYW A;  1NLX A;  2LSE A;  4CSA A;  2R25 A;  5A6B A;  4N06 A;  4CDY A;  1ZU5 A;  1VYI A;  2L6H A;  2KSF A;  4QI2 A;  2B0H A;  2XLV A;  3LUT B;  1M2O A;  4NQF A;  4OD4 A;  3FDQ A;  3ITF A;  3EH2 A;  4A2N B;  5JT4 A;  3VM6 A;  4K7B A;  4ZLD A;  1VOM A;  3GWN A;  2OU6 A;  3AGT A;  3JTL O;  2EPL X;  4G7H F;  1VTM P;  3UGP A;  3RVZ A;  1HE9 A;  1QVX A;  3HKK A;  2EPM X;  2ICW G;  2QE9 A;  2KJG A;  2XLW A;  4OD5 A;  3BEH A;  2LFF A;  2XSE A;  1NU7 D;  1SYQ A;  2AU5 A;  3VRC A;  1TWA A;  4G0H A;  2OJE D;  1ZHX A;  2GFH A;  4U5F E;  5L0C A;  1GGQ A;  1YDI A;  2H8A A;  2WVQ A;  2YVK A;  1W2W A;  4MW8 A;  3VYW A;  4DRH B;  5BQI A;  1O5H A;  1ZYR F;  2HSB A;  1ZVZ A;  3TOM A;  4WGY A;  3RH3 A;  2EIN C;  2J7P A;  2ASR A;  2D5R B;  4C3D A;  4MVZ A;  1FFT C;  5F5F A;  2GDC A;  5FZT A;  2RSE B;  2CCY A;  1EKY A;  1RKE A;  1SZI A;  2VH3 A;  5E33 A;  3UR3 C;  5B3I A;  3K66 A;  4OIP F;  3FMS A;  3KL4 A;  4IAQ A;  2H7B A;  3FAJ A;  1YYX A;  3EZI A;  4EKW A;  1VYK A;  4J7Y A;  4MVO A;  4NCQ A;  4WAB A;  1NBB A;  1OW7 A;  1PD0 A;  2BE5 F;  3FHD A;  3LLI A;  3MFN A;  3SEO A;  3UMK A;  3ZDL A;  1T9K A;  2JD3 A;  5L0D A;  3U3B A;  4F4B A;  5DS5 A;  4JUR I;  1YAU O;  3ATP A;  4KC9 A;  2J8W A;  3LES A;  4PR9 A;  2TMV P;  3O10 A;  3M4B A;  4O79 A;  4P9T A;  3ZC4 A;  1QSP A;  4RD9 A;  4PK4 A;  3X2Q C;  1UG7 A;  2C04 A;  3IQ5 A;  3LS1 A;  5AC4 A;  4UDV A;  3JSE O;  3UMI A;  5A69 A;  2HUJ A;  3ECS A;  4DXW A;  4OIO F;  1XZQ A;  3M1C B;  2XRH A;  1JPJ A;  2NSF A;  2YWA A;  1CGM E;  1Z6A A;  1V4A A;  2RD9 A;  4J7T A;  2I8B A;  4YT5 A;  4OIR F;  1YLM A;  2MWQ A;  1PD1 A;  1ORJ A;  3U5S A;  3UMH A;  2YEV A;  3QMK A;  2EIJ C;  3EGX B;  3LEV A;  1ST6 A;  4E7Z A;  1H6G A;  3DAG A;  4XPX A;  1LIH A;  2A68 F;  3G4Z A;  1FMV A;  3JSZ A;  5CI8 A;  3WOD F;  1WN0 A;  2X51 A;  2V26 A;  3M15 A;  1NFN A;  3B29 A;  3T6G B;  1YVI A;  2L6G A;  3A9C A;  1C03 A;  4DJ9 A;  4L6R A;  5FCL A;  1RMV A;  3OEO A;  4Q5S F;  1ZHT A;  2KNH A;  1OKK D;  1Z7Q c;  3Q7L A;  1Z63 A;  1V74 B;  3IQT A;  4E17 A;  2NUP A;  1T01 A;  1OCO C;  1WOL A;  3JCU Q;  2J9U A;  1R4T A;  2PBE A;  2QLA A;  3VF0 A;  1SMY F;  1H7I A;  2CGE A;  2V3C C;  4CJG A;  4E0I A;  4PFO A;  3GEE A;  4E7S A;  1J8Y F;  3EZH A;  3S29 A;  1L7C A;  2F22 A;  2PP4 A;  1BR4 A;  1BR1 A;  3ZIB A;  4JTD B;  4X0R A;  1D0X A;  5D92 A;  5B1A C;  4ZLC A;  5KYN A;  2J46 A;  2R7X A;  3V5Y A;  2KGO A;  2BL2 A;  1A7V A;  3EGD B;  4MVR A;  3H2V A;  3N2Z B;  4HEA J;  2HFI A;  3SXK A;  3SNH A;  2Q9A A;  1CGN A;  2P0N A;  4GYT A;  3S28 A;  3TJ5 A;  2JX0 A;  4K1O A;  3ZQY A;  3IEE A;  3LS0 A;  2KC3 A;  4N6C A;  3NRH A;  3US6 A;  2VCA A;  1NSG B;  2VCB A;  2YLD A;  3RF3 A;  1YZC A;  3PCV A;  1NG1 A;  4CIH A;  2R7U A;  3NYM A;  5DVW A;  1CPQ A;  3KYJ A;  3RVY A;  3ZTM A;  1TWG A;  2KK1 A;  5B3S C;  3ZWI A;  2YL0 A;  3CQZ A;  1NFO A;  4ULV A;  3X1O A;  2GWW A;  1D0Y A;  3T6J A;  2A0U A;  2IYL D;  1L3P A;  1NZE A;  2ZXO A;  4O6M A;  3HLZ A;  2DYS C;  3NMJ A;  3KYI A;  1AEP A;  1V54 C;  2WVN A;  4I44 A;  4XQ1 A;  3EH1 A;  5A6A A;  3U0C A;  1H9G A;  3GM3 A;  3MLG A;  1B68 A;  2LCH A;  2I15 A;  4YT2 A;  1TFK B;  3PDM P;  2Q4F A;  4XWJ A;  1ZW3 A;  1TKN A;  3DE9 A;  4G7O F;  3TQO A;  1OKK A;  5A6K A;  5DS4 A;  1LS4 A;  1I5N A;  2L9J A;  4YT4 A;  3CSK A;  1GM5 A;  1DOW A;  5JUA A;  4XPY A;  1A7D A;  1ZU4 A;  3LJB A;  4C3E A;  3NDB B;  1BBH A;  1RKC A;  2NPU A;  2IXO A;  1OQC A;  3L1M A;  1OXB A;  3QZC A;  5L0J A;  5A6J A;  1Z5Z A;  1HW2 A;  5CIV A;  5E2Q A;  1NU9 C;  1RCP A;  2WZG A;  3IQ6 A;  4NC3 A;  3DJN B;  1QPU A;  4BEJ A;  4CX9 A;  2HKV A;  2XL8 A;  5HV9 A;  5F28 E;  2CNW A;  4QDL A;  3EGX A;  2FAP B;  3GEH A;  2R7V A;  1D1B A;  1T6Q A;  4LDK A;  1HMO A;  4YL1 A;  2BC5 A;  1KU2 A;  3WG7 C;  4DVY P;  2CW0 F;  2R05 A;  3K1I C;  1BDJ B;  2R7W A;  1V55 C;  1BR2 A;  2DGJ A;  3RW0 A;  4EBK A;  4EHP A;  1EI7 A;  3C8G B;  3CAX A;  1D1C A;  1OR2 A;  3IHU A;  4IAO A;  2HS5 A;  2ZPA A;  4FX5 A;  1E2X A;  4U9E A;  1ZZP A;  2XM4 A;  4R32 A;  3ZTZ A;  2XL6 A;  3U9J A;  4CS8 C;  3A11 A;  4AE4 B;  1FAP B;  4EWC A;  1MMD A;  2IXP A;  2OG2 A;  3G4X A;  4OIQ F;  3SXZ A;  2G3V A;  2DB4 A;  3HNI A;  3QTH A;  2NG1 A;  4I1O B;  3PHF 2;  3EGD A;  2UUH A;  1WWP A;  1MQV A;  4BJT A;  3B71 A;  3GM1 A;  4MTO A;  4O6Y A;  4XTK A;  1Q0K A;  2J0W A;  2EIK C;  4BJ1 A;  1KTM A;  1QQ3 A;  4M63 A;  3L34 A;  3JRM O;  3E9V A;  1T5O A;  5AC5 A;  2FGY A;  3KKB A;  4U5H A;  3S90 A;  4JTA B;  1MMN A;  5EGY A;  2W4M A;  1WTY A;  3H65 A;  3T6B A;  4FWV A;  3C8G D;  3O6X A;  1S05 A;  5KYX B;  2MYS A;  1Z23 A;  3ZVR A;  1K04 A;  2J9W A;  4EBB A;  1WGW A;  5CI9 A;  4YN0 B;  2IBF A;  3SP1 A;  5L0G A;  4KBL A;  4U5G A;  2YLI A;  3RKO F;  4DVZ A;  1C02 A;  1OCC C;  1Z3I X;  4JIO A;  3C8Z A;  2EPO A;  4XEV A;  3B0U X;  4O6N A;  1YA9 A;  3EFO B;  2EIM C;  1G4W R;  4OIN F;  2KYH A;  4U5B E;  4PFP A;  4JJF A;  4RBN A;  1A0B A;  3DJU B;  1ZW2 A;  4NTA A;  2Q9B A;  2OEX A;  3HNL A;  3EG9 B;  5KYU B;  5L0H A;  1JR8 A;  3K33 A;  4RDA A;  3R7C A;  2A69 F;  3AQC A;  2A6E F;  4N4W A;  1QKR A;  1TWC A;  3EPV A;  4AK9 A;  2VB6 A;  4ER9 A;  4U5E E;  2J9V A;  3W4Y A;  3AOU A;  2AWC A;  4ONS A;  1C17 M;  1LE2 A;  2H7O A;  1H9T A;  1ZHY A;  2XLE A;  3M79 A;  4U9D A;  2VCC A;  3TUL A;  1QZX A;  4PJJ A;  3JRT A;  4YL3 A;  4BJ6 A;  1MND A;  2IXM A;  2WZF A;  3MX3 A;  3U8P A;  5L3V A;  2A6H F;  3AG4 C;  3ABM C;  5GPG B;  1GS9 A;  3VAY A;  1U0B B;  2FFH A;  3ABK C;  4FES A;  2IXN A;  2YL7 A;  4DRJ B;  3C63 A;  2C03 A;  3ABL C;  5JRA A;  2OJQ A;  3GEI A;  3Q7G A;  4PJL A;  1SF8 A;  4J32 B;  2LD6 A;  5DQZ A;  4MVM A;  4BPM A;  5E3A A;  1MMA A;  2R7S A;  4JCH A;  5L0I A;  3DI5 A;  1D1A A;  4W8K A;  3RQF A;  3NMK A;  2CDQ A; 
#chains in the Genus database with same CATH homology
 4YL0 A;  2Q7R A;  2H8A A;  5BQI A;  3LEO A;  4AL0 A;  4NTB A;  4YL3 A;  3DWW A;  4J7T A;  5BQH A;  4JCZ A;  4JC7 A;  5K0I A;  5HV9 A;  2PNO A;  2UUH A;  4YK5 A;  3HKK A;  4YL1 A;  3B29 A;  4J7Y A;  4WAB A;  4NTA A;  4BPM A;  4JRZ A;  2UUI A;  3PCV A;  4NTF A;  4AL1 A;  5BQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...