4YL8A

Crystal structure of the crumbs/moesin complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
296
structure length
296
Chain Sequence
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKAFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Phosphorylation-regulated Interaction between the Cytoplasmic Tail of Cell Polarity Protein Crumbs and the Actin-binding Protein Moesin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Moesin
total genus 93
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4yl8A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4yl8A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4yl8A01
1OQNA 2I1KA 1WX8A 3A4RA 3NS8A 2W2WA 2JP2A 3MJWA 1R4MI 1EO6A 4A20A 5L81A 4KHAA 1YIWA 1UELA 3A33B 5D6JB 5AEKB 3MPXA 2XK5B 1MK7B 4XX5A 5AZHA 2D9VA 4A6KA 3WYFB 1CMXB 4I6PA 3PLVA 4JL9A 3W1SC 4HDQA 3U7DA 4WWNA 4HK2A 3HIZA 2LULA 2ASQA 2UVMA 4WJPA 2B3AA 1MAIA 2ROVA 5GMVA 5AZFA 4HLEA 2PJHA 2AEHA 3SO6A 4GIVA 1UH6A 1WGHA 3DBRI 4KDLB 1XX0A 2FJLA 3APDA 3ZNZB 2L0FA 2PPHA 4FJVB 1ZKHA 2KQ7A 5CHVC 4K17A 1L7YA 2RGFA 1ST7A 2MBQA 3G9WA 2K8HA 5DPRA 1KZ7A 2WH5A 4EFOA 2CR5A 1NDDA 4BOSC 1WI1A 1WR6E 3KUZA 1UPRA 2HRJA 4D0NB 1HB6A 3HK0A 1TZ1A 4NJ7A 2VKIA 1Q5WB 3DXDA 4W9HA 4IWQA 2LRUA 2CRFA 4NQLB 1S1QB 2RD0A 1P6SA 3KSYA 1X05A 2BYFA 2CS4A 2D10A 3VOQA 2K00A 3H9DA 1ZC3B 1JRUA 1P5TA 4M8NA 3FM8C 3ZIMA 5LLIA 3VHTC 3ONSA 1WE7A 2C7HA 4DDID 4HVBA 4HAVB 4GU2A 2KX0A 2MP2A 1OMWA 4F7GA 5DH9B 3QBVB 1E8WA 1WJ6A 1WY8A 3JSVA 4TUUA 2GOWA 4DHZE 1XCGA 4M0WB 1X1FA 2GMIC 2BKRB 3PPAA 4FLHA 4MT7A 4XWXA 3NZSA 1WJ1A 3ZRCA 4KHOA 1WMHB 3V62A 2DYQA 3VXWA 1RRPB 4II3B 1NTVA 1DDVA 2L2IA 2DHJA 2MSED 3Q3JA 4L6EA 4LJPB 2OQBA 2BKFA 2HTHA 2XEWA 1BTNA 1TQZA 2FCQA 2M17A 2NPTA 4LDTB 4W9EA 3IFWB 2XQNM 4IAPA 2DKQA 2YS3A 2QKMA 2ZCCA 1I7AA 2KNBA 3O65B 4A6HA 5G55A 1N3HA 2KFJA 5DCNA 5FI1A 5KCVA 2KANA 1MK9B 2PEAA 5C23A 1J8CA 2ROZB 4K7SA 5CHFA 4ANUA 4WVFB 2W9NA 4JLCA 1WI0A 4NAWB 3X0WA 3RCPA 1PMSA 4NY0A 3F0WA 1EF5A 4TYZA 2KCJA 2KMCA 2KTFA 2COAA 3ALBA 3Q3FA 3LJ3A 4MDKE 1WM3A 2O2VB 3IG3A 2LBBA 1WGUA 2GCJA 2KMAA 2R2QA 2BWES 2C9WB 2HTHB 1WIAA 3WA0A 1KZGA 3EPYA 3KUCB 2OJRA 4MGIE 5JHHA 3B0AA 3K9PB 5KHQA 4IUMB 4FJZA 4DXAB 3WAPA 3PZDA 4CHMA 1WM2A 1WMHA 2MKRA 4FADA 1OQYA 4EZLA 2YT0A 3VIAA 4IFSA 2GBRA 3HM3A 2WX1A 4HCNB 3IVFA 5C5BA 4K7WA 2W2XC 4B9KA 5KQ4A 1XD3B 2KZRA 2ZEQA 3PS6A 3TO1A 3QWMA 4DX8A 1WJ4A 1XD4A 1ZC4B 2C7MB 3QK0A 4FULA 2DLWA 1V89A 1OTRB 2MWNB 3AXCA 4G50A 2NR2A 3VVWB 2Y7BA 4LCDE 4DWFA 4WJ7A 2K39A 2COFA 2CB8A 3QJZA 2K25A 1WF9A 3EECA 4HAYB 2GBJA 2L8JA 4KZ0A 2JY6A 2DHKA 5LONB 5BO4B 4B6WA 3FEHA 1XT9B 3M1IB 1E7UA 2KJHB 2LRWA 4F8CB 2ZPNA 3H7SA 2YSZA 2IYBA 1MKEA 2K6QA 2KDBA 2DX1A 3KRXA 2NBUA 3KYCD 3VDZA 3ZNGC 3QIJA 5GOWB 5FI0A 1E8XA 1K5DB 4MELA 3UIOB 1V6EA 1I35A 1GG3A 1K5GB 4TQ0A 3TCAA 3VQIA 1V5PA 1W1HA 1WGRA 4CYEA 2M8SA 3GOEA 3VUYA 2MRPA 3M63B 1UZXB 4YL8A 4EMOA 2DX5B 5CX3A 5G2NA 1V2YA 2FUHB 3ML9A 3ODOA 5D2MB 3DVNV 3KH0A 1WZ0A 1DDMA 3NZUA 4AJYB 2OTXA 2MBEA 2KWUB 4PS3A 2X18A 2L05A 3PVUA 3OJ4B 4K2PA 2AWTA 1D3ZA 3BY4B 1HBKA 4GDLA 2VRRB 3SUZA 5J3YA 2ZNVC 4MGKE 2N9PC 2D9YA 1YJ1A 1EUVB 1HE8A 2L76A 2XBBC 2ZJDA 1ISNA 2J0KA 3ML8A 3UIPB 3IBEA 3H7PB 4GXBA 2KFKA 1K8RB 4M8MA 3WAOA 2N7DA 1FOEA 2P0FA 3PV1A 1V5OA 2DHZA 4TV3A 4BVUC 2DAFA 2N9EB 3D8DA 2NPTB 3KUDB 3QA8A 3D8FA 4DX90 1UBIA 4KVGB 3RZWC 2KKCA 2LVPA 3V61A 2V4LA 4HAXB 2IY1B 3VH3B 2O6VB 3FLVA 1TXDA 2LZ6A 3JVZX 4A3OA 1QZEA 2KHWB 2WWZA 3UINB 2LI5A 2KLGA 4OVUA 4WJOA 4ANWA 4HJKA 4I6NB 1P3RA 4FJYA 3ZLZA 1V5MA 2RUKB 4BKTA 2Z0QA 3RUIB 2FNJB 2RSGA 2KXJA 3U30A 5E6NA 3UF8A 4KSLC 1V86A 3A8QA 5KQ1A 4FBJB 3ZVVA 5L83A 1R4NI 3AU5A 2DAJA 3ODWA 2NCNA 3PVWA 5D3XA 2M14A 4B95A 2GBKA 3BJIA 1U4AA 3VTVA 1SHCA 1V5UA 4NPNA 3PRZA 3A9KB 4HXDA 1L2NA 3DCGA 1YD8U 2JT4B 1FGZA 4CHKA 3VUXA 1V88A 5LXHA 1LM8B 1NBFC 2L3ZA 3KZ1A 4E71A 1ZM0A 2C5LC 2RPQA 4LJOB 4J6IA 5DI9B 2LG1A 2DN6A 3ZTDA 3MDBC 2ZZPB 4MGZE 3ZKJC 4BBNC 3OANA 3T8MA 3DDCB 3V5WA 2KD0A 4HCPB 2MCNB 5D94A 4IW0A 1G6JA 2CU1A 4XZ4A 1ZW7A 3ZUNA 4DHJB 3HQCA 4ASWC 1Z87A 3ODXA 2LGXA 1KOTA 5LOPB 3A1QA 5C1ZA 2IO3B 4IWOA 2V3SA 4HATB 1W1GA 2COCA 4C0AA 1P9DU 2CHZA 2MX2A 4FHKA 4G3XB 4URKA 5J3TA 1I2HA 2M1MA 1FGYA 4HAZB 1WJNA 1EF1A 3V6EB 4W9CA 5CLQB 5DHAB 3APCA 1Q1OA 2HJ8A 1U2BA 2W2XD 3ENEA 2YT1A 2GBNA 1RJ2A 2KOXA 1NVLA 3WANA 2V1YA 4MJSB 2DYBA 2MFQA 4HB2B 3N32A 2KWVB 4MEMA 4CHJA 5DPTA 3UGBB 5IJMA 3P6AA 3KYDD 3M62B 2K8CA 3PTFC 3ZRFA 1U5GA 1XKEA 3A9KA 1WXMA 3CSTA 2DYOA 1FAOA 2CY5A 3PLUA 3WIMA 1RLFA 2KX3A 1H10A 2ZNVB 1H8CA 4ZRIA 1M7RA 1MIXA 2KLCA 4EJNA 2G4DB 2LUEA 2N4FA 3VTWA 1ZVRA 4BKSD 3UQBA 2N1VA 2R2OA 4PYZA 3ML4A 3PP2A 2YRYA 4GZUA 2LJ5A 3AI5A 4ZRJA 4KHBB 2YVCA 2A5UA 2MWSB 4EEWA 3PRPB 3EHVA 3VH4B 1J19A 2KDEB 1MG8A 3H1UA 1V80A 3P2BA 4AWJA 2Z0OA 4WSFA 4E3CA 1KLVA 1FHOA 1U27A 4JGHB 2KJRA 3SDLC 1S3SG 2O6VD 4ZRKA 3ZW3A 2YS5A 4JIOU 3ZO5B 2XK5A 5KHOA 4HB3B 2K1FA 2LGDA 1W1DA 2GCLA 2WYQA 2FIDA 4A5KA 4F7ZA 4A3PA 4K81A 1WGGA 2JVCA 1LQBA 1MIZB 3D32A 4EUTA 2DKPA 1OY2A 2DYNA 2H7DA 1OGWA 1U29A 2IY0B 2L0TA 1Y19B 1Q0WB 2BWFA 2Z0PA 2J7QB 3RZFA 2YS1A 2ABDA 5D7GA 2JPHA 2M38A 2PE9A 4DBGA 2FJ9A 2IFSA 4IG7B 4HAWB 2ELAA 2LXAA 1M94A 2I5CA 4GDKB 2YLMA 3DBSA 2IZVB 1WJUA 2Q13A 2K2JA 3L17A 3AULA 2G4SA 2CHWA 2JF5A 1WGYA 1ZSQA 1KI1B 3GYOA 4WJNA 1OEYJ 1WX7A 1E7VA 1WYWB 3ECIA 4G11A 3PHWB 3JYUA 4BKGA 2DYMA 4MH0E 2OOBB 5CTRC 1E90A 2Y8GA 2IO2B 2KTRB 4DHJD 2KO3A 2RVBB 1YX6B 3VAWA 2KK8A 4HPMB 5DPWA 4EZJA 5JP4A 1EGXA 4ANXA 4AJWA 2I5FA 1DDWA 5DHFB 1IPGA 2MP2B 1RAXA 3QHTA 3AJ4A 4W9KA 3KVFB 4EZKA 1FHWA 2R09A 1VD2A 3PRMB 4II2B 2MDXA 2HD5B 2QHOA 3DBLI 1IP9A 1IYFA 1HB8A 3FP5A 2FCNA 2JXXA 2DFKA 2D9WA 2RLOA 4F7UP 2MA9B 2FCMA 3DXEA 2BF8B 3L10B 3RYTA 2EMSA 1NTYA 2A4ZA 3L0WB 5AZGA 1C3TA 1WVHA 2J0JA 3ZDTA 3GZNI 4HB4B 2JRHA 1H4RA 3PGEA 3BINA 3ZVRA 3JW0X 3K9OB 4HPLB 1BWNA 2Y8FA 2KJ6A 2D9XA 4NQKE 4DDGD 5J2RA 5J3QA 1F9JA 3L16A 3TMPB 3A4SC 2DX5A 2DA0A 1P1AA 1Y5OA 2LOXA 2CQUA 3A1QB 4P7IA 4IC7B 1KM7A 2K6DB 2PZ1A 2CHXA 4HWIB 2M4NA 4IOYX 4BBNF 2UZRA 4GB9A 3TIXA 2GBMA 2JWZA 1X86A 2M0XA 4PNKA 2Z59B 3M3JA 4MM3A 1VCBA 2GJYA 4RM8A 2HE7A 1M7EA 5JLJB 3MHSD 4GDKA 3NOBA 4W9DA 4GMXB 5D3YA 3TL5A 2C60A 4GOCA 3O96A 3TJPA 1XR0B 3DXCA 4K2OA 2PE6B 3KY9A 3WAMA 2EMTA 3SYXA 3C0RB 2CAYA 1X1GA 3P7ZA 2YF0A 5JHAA 1GC7A 2IO1B 4MGYE 4IM3A 2EC1A 2LWPA 2ZCBA 2D11A 2G3QB 5EFXA 2WX0A 1U5DA 1ZGUB 4A6FB 1TGZB 2MW5A 3L54A 1WXSA 2ZPYA 2H7EA 3OLMD 4W9FA 5E6OA 5JZEB 1NU2A 1GC6A 4MK0A 2DZJA 2RSUA 3KW5B 2ZVNA 3DOWA 5JHBA 1J0WA 2NS5A 4GPTB 1XQQA 1RRBA 1YQBA 4KIKB 5IA7A 1Q67A 4AUQC 3CXBB 2IBIB 1KJTA 3MTNB 1TTNA 3QCAA 1QC6A 3QQ8B 4IM0A 2DHIA 4W9IA 3PVLA 3RD2A 3TBLD 1X11A 3R3MA 5HE0A 3R7QA 1V5TA 4YONA 1PQSA 3GYPA 2BYEA 4RM9A 5E6PA 2D4QA 4K1RB 2K2UA 2L7RA 2DZKA 2KN5A 3F5RA 4Z2NA 2KTRA 1BTKA 1LB1A 2LVOA 2RGNB 2MBHA 2UWQA 3OAWA 2NBVB 4OVVA 5JH5C 1V49A 3HM6X 2EJ8A 5JHGA 1C1YB 2REXA 3VUWA 1UNQA 2KGXB 5TR5A 3DQVA 1UEFA 2FAZA 3RCZA 2NVUI 2DTCA 4FA6A 3PREA 2L1CA 3NSUA 1ACAA 2CKHB 2I1JA 4MY6A 5C79A 3UZTA 1UGMA 2UYZB 4FHJA 2KQSA 3H7PA 4GN1A 1TJ6A 3ULCA 2BYVE 4W9LA 4WJQA 2ELBA 1Y8RC 2LASA 4WQOB 1FHXA 2EKEC 3CMMB 4HDOA 4IM2A 4MJSA 3H6NA 4BKSA 3QWZB 4RMAA 4X57B 1GNUA 1UNPA 2N23A 2ZVOA 3U8ZA 3KRWA 3IHPC 2UZSA 4MSMB 3FSSA 2AL3A 2N9XA 2D2QA 2LKOA 4LDTD 2JUOA 3ZDMC 1V81A 3CSFA 4GDLB 3LDZE 1UPQA 2GS0A 1X1MA 4TKNA 1V61A 3ZNHB 1I42A 3CF6E 1NTIA 1V9JA 2MQJA 3QARA 4EOYA 2CY4A 3PSCA 4G0NB 4ZYNA 3AU4A 1SGHA 1WX9A 4N9F4 1SIFA 3V60A 1UBQA 5EDSA 1WFYA 1AQCA 3DVGY 3TVVA 1NI2A 1P0RA 3PT2B 4ANVA 1TBEA 2DZIA 2Y5BB 3DBHI 3ZNID 2AYOB 1FXTB 3A9JA 1GUAB 5DIFB 4PS7A 4W9JA 3RULA 4Y94A 3JSVB 4ZDVA 2JZ3B 1PFJA 5HE2A 1U5EA 2O6VA 2J59M 2MBBB 1J0GA 2AL6A 1YX5B 4KIKA 3SHQA 1LFDA 2NZ8B 5D27A 3APFA 1FB8A 3M95A 4FN2A 4IWPA 4HB0B 4NNJB 1BT0A 2V76A 1T0YA 5C5BB 3B08A 2MBOA 3EFUA 4WWOA 4GGQA 3R7RA 2KWCA 3SV1A 2IYDB 3NY5A 3I3TB 2DZMA 3SU8X 2N1WA 2MLBA 3T06A 1WXVA 2LVQA 3A9JB 4KSKC 2VSZA 2KC1A 4WAAA 2KDFB 3VFKA 3W1YA 2P0HA 3VTUA 4F1SA 5FR6A 1EAZA 2RNRB 4NJ6A 4E74A 5CLLB 3DVGX 4GMVA 4DBBA 3LJUX 3CIKA 1WZ3A 2KC2A 4ICUA 3D8EA 1Z5SB 4EKUA 2BPSA 1MPHA 2FCSA 2G45B 2ADZA 4KV2A 4XC2A 3SNHA 3ZTCA 1WRDB 3DPDA 2N0YA 4WWPA 4AP4C 4BFRA 2J0MA 1DYNA 4HAUB 4B6HA 1P98A 2KDIA 3ULBA 5C6RA 3PG7A 2D07B 3EC8A 3QC8B 4W9GA 3X23A 1Z2MA 2RR9A 5HE3A 3W1SA 1WGQA 1LXDA 3T9LA 3A98B 1OEYA 3PSEB 2COPA 1RFAA 1SE9A 2O2VA 5IAAC 5J17A 3PHXB 3PEGA 1E8YA 2CODA 1WGDA 5L95C 3S2AA 4F7HA 3A8PA 2G35A 4DHZB 1WXAA 2KVRA 2P0DA 2Z0DB 3N30A 1E8ZA 4MSQB 4BOZB 4CO7A 2KUPA 1WE6A 3L08A 2BGFA 1AWEA 3QAQA 1EVHA 1LW3A 2P8VA 4NSWA 5C16A 4PYUA 5HKHA 4Z2MB 1UD7A 5LXIB 2NMBA 2LXCA 1WJMA 3QX1A 1UNRA 4AOFA 5HE1A 1PLSA 4TQ1A 2NBWB 3R66C 1U5FA 4KAXB 1BAKA 5D3WA 2FIFA 2R0DA 4KDIC 3RT3B 2E2XA 4BBKA 3NHEB 3B1LX 2Z0EB 4DK5A 1WR1A 2FDQA 1QQGA 2WDTB 2LYDA 5D3VA 1WH3A 3HW2B 4KZCA 4PS8A 2D3GA 2JRIB 3WALA 1A5RA 4H8SA 5DPSA 2N7EA 3L13A 2BCJA 2LD9A 2K8BA 4HHVA 3SD5A 2LGYA 1GJZA 3N7CA 1AARA 1IRSA 2L00B 1B55A 3DVNU 3N3KB 3OJ3A 2RQ1A 2IO0B 1E5WA 1P3QU 4I6LB 4K7UA 2C7NB 5J18A 4NAWA 4ICVA 2D9ZA 1WG7A 2JZZA 2QKLA 3HHMA 3V6CB 2VRWB 4JQWC 1DBHA 4PQ0A 3TW1A 4GSWA 1XODA 3TFMA 5CHWA 1DROA 2KFKB 2LOZA 3UQAA 4A6FA 2DENB
chains in the Genus database with same CATH superfamily
2OJWA 3MJWA 2RRFA 1YIWA 4A20A 2XK5B 3NZ3A 1MK7B 4A3OA 1CMXB 1KBLA 3PLVA 3U7DA 1TYGB 2WXKA 4HK2A 4WJPA 2ROVA 3SO6A 3RNBC 4KDLB 3ETRA 1XX0A 4RCOA 3ZNZB 4JKHA 2WXRA 1OFFA 1TS2A 4K17A 1ST7A 1KZ7A 4BAXA 1NDDA 4BOSC 1T3QA 1WI1A 1WR6E 5BYSA 1HB6A 3HK0A 1TZ1A 2JZPA 1Q5WB 1SJED 5LNK1 3DXDA 1IBXA 2LRUA 2RD0A 4WH4A 1GAQB 3VOQA 2K00A 4DDID 3RNFC 3QBVB 4DHZE 1X1FA 4XWXA 4ARCA 4KHOA 1WMHB 2R82A 3VXWA 4GLSC 5FKAC 1NTVA 2MSED 4LJPB 2OQBA 1IUEA 5I2MA 2FCQA 3AH7A 2NPTA 3IFWB 2XQNM 2QKMA 1JWAD 1K51A 4A6HA 3KWVA 1UNSA 5G55A 4US9A 2VZKD 2Z8LA 2KANA 1J8CA 3MHZA 4WVFB 2LMCA 3V05A 3RCPA 3F0WA 2KMCA 3DWGC 4ZYSA 4MDKE 2CJOA 1N5XA 1WM3A 4WIPA 1WGUA 2C9WB 2HTHB 1I7HA 2BT6A 3KUCB 5G5GA 4IUMB 4CHMA 1WM2A 1C4AA 3Q3OC 2YT0A 3VIAA 4LDTB 1BMLC 2WXHA 2V3NA 1D4BA 2KZRA 3BVMA 1XCTL 3TO1A 3QWMA 1XD4A 2C7MB 2MWNB 4NZLB 4LCDE 2L8JA 1SJHD 1ACCA 5BO4B 1XT9B 2ZPNA 3H7SA 2YSZA 2IYBA 1MKEA 2K6QA 3P42A 3KRXA 4IM3A 1K5DB 1I35A 1K5GB 4TQ0A 3ZXVA 1V5PA 3E9PA 1WGRA 2GRIA 3M63B 4EMOA 2DX5B 3VRBB 5G2NA 2ON8A 3DVNV 2OTXA 2MBEA 4PS3A 1CJEA 4K2PA 1D3ZA 4B0EA 1ZDXA 4W9CA 4GDLA 3SUZA 3WAPA 3Q14C 2N9PC 1YJ1A 1EUVB 1HE8A 1ISNA 4M8MA 2KFKA 1FOEA 4TV3A 3PV1A 2WXNA 2SEBD 3NS1A 2LVPA 1KRHA 3JVZX 3FLVA 3RNEC 2MJ3A 3NG0A 1XLQA 4HJKA 1ZOYB 3DBRB 4FJYA 3B2FA 2Z0QA 3BWUD 2RSGA 3U30A 5KQ1A 1TT5B 1R4NI 3ODWA 2M14A 3C19A 2GBKA 1U4AA 2UU7A 1V5UA 3ABVB 4LNKA 1LGRA 5LXHA 4E71A 4JWUC 4LJOB 1QLBB 4J6IA 2LG1A 4MGZE 3ZKJC 2KD0A 4IW0A 4XZ4A 3ZUNA 3I57A 1L0VB 4O1NA 1Z87A 3ODXA 2QILA 1KOTA 5LOPB 5C1ZA 2GI9A 1JWMD 4HATB 1W1GA 4G3XB 2W3RA 1WJNA 5MPOA 3V6EB 3L4PA 5CLQB 1WGKA 2W54A 2KWVB 1ESFA 5DPTA 1U5GA 2YEPF 2JXTA 3PLUA 3WIMA 1MPEA 3FVCA 1MIXA 3VTWA 3ML4A 2IDYA 2LJ5A 3AI5A 3BVZA 2WXGA 3Q8CA 3RPFC 2KDEB 3URYA 1GPXA 2AX5A 1FRRA 1FHOA 3EA6A 3SDLC 2J42A 4ZRKA 3NW8A 2BQQA 3IXSA 2K1FA 2WXFA 1W1DA 4YSZB 4A3PA 1WGGA 1JRPA 2DYNA 1JWUD 1Y19B 2BWFA 2Z0PA 2HJ1A 4DBGA 3V3XA 4IG7B 1M94A 2NMQA 2WHIA 2K2JA 2G4SA 2JF5A 4WJNA 4QAYA 3PHWB 2DYMA 4MM3B 1IGCA 5DPWA 4HPMB 2MJEA 3ZJUA 4EZJA 1L4ZB 4ANXA 2I5FA 1DDWA 1SB3C 2MP2B 5TSSA 1L4DB 1R4NB 3SEBA 2FCNA 4D2KA 1FEHA 4F7UP 3P63A 2EMSA 1UWMA 2K0PA 3JW0X 3Q3MC 2Y8FA 4NQKE 5J3QA 2DX5A 2WDVB 4IC7B 2RDBC 1KM7A 2PVGC 4HWIB 4GB9A 2WNMA 2GBMA 2JWZA 1X86A 1KF6B 1VCBA 3GB1A 4KGRA 4GMXB 4K3CA 1XR0B 2PE6B 4RGOS 3KY9A 3TEZA 3C0RB 2YF0A 1GC7A 2IO1B 2EC1A 5EFXA 2WX0A 1TGZB 2H7EA 1NU2A 2H89B 4OVZA 5IA7A 2Z14A 3N1YC 2K5PA 1Q67A 1TTNA 3NVYA 1FIQA 2DHIA 4W9IA 4B0MA 2BYEA 1PGBA 4MM3A 1LB1A 4OVVA 1KTKA 1C1YB 2KGXB 4OW0A 1TJEA 2NVUI 4FA6A 1VBHA 3NSUA 1ACAA 3UZTA 4FHJA 2KQSA 4JKEA 1TJ6A 3WCQA 4JK7A 3QWZB 3RFZB 1D5ZC 1UNPA 2ZVOA 3U8ZA 2UZSA 3FSSA 2D2QA 2JUOA 1FCCC 1V81A 1UF0A 3LDZE 3MJ5A 1C77A 1V61A 1PGAA 1I42A 1NTIA 3PSCA 4Q2JA 1SGHA 1WX9A 4N9F4 3V60A 4TMAB 1UBQA 1V1PA 3TVVA 3DBHI 2DIKA 2AYOB 4C7ZA 1GUAB 4LNOA 4PS7A 1WYGA 3JSVB 1EWCA 2J59M 1J0GA 2AL6A 5D27A 4NNJB 3B08A 2KWCA 3GE3C 2DZMA 2LVQA 4YSYB 3PZ8A 3W1YA 2P0HA 5FR6A 4JKDA 4DBBA 3CIKA 3D8EA 2FCSA 3N20C 1MPHA 4XC2A 3SNHA 3ZTCA 1FXAA 1DYNA 4EE2A 3FAHA 4M01A 4DXGA 3EC8A 4W9GA 1Z2MA 2RR9A 1JW9D 4CQNA 5J17A 1OEYA 4LNIA 2O2VA 3GE8C 3PHXB 1WGDA 2ICIA 5BMHA 4XWWA 3S2AA 2JX5A 5EE3A 2K49A 1HEZE 5C2TB 4CO7A 4NSWA 1XEEA 3ZJVA 1B9RA 1JDEA 1PLSA 1U5FA 4KAXB 1BAKA 2BTEA 4S0RA 3AE8B 1ZXHA 4BBKA 3MFGA 2WDTB 3WALA 1WH3A 4PS8A 4H8SA 1I4PA 1SE3A 3N7CA 1B55A 4WQMA 3N3KB 1C78A 2C7NB 4NAWA 5EE1A 4M00A 3U2SC 1DROA 2LOZA 4US8A 1OQNA 2I1KA 3NS8A 2W2WA 3HUIA 1EO6A 5AUKA 5L81A 4A6KA 4I6PA 4FXCA 3W1SC 4AQ7A 5GMVA 4GIVA 1UH6A 1WGHA 2YT2A 3APDA 4HPPA 2KQ7A 3B9JA 5T8IA 2MBQA 3G9WA 1RWSA 1XLPA 2CR5A 1V97A 3KUZA 2HRJA 4D0NB 5EE0A 2VKIA 3PO0A 2CRFA 1P6SA 1X05A 2CS4A 4DXFA 2IPKD 4M8NA 2J52A 3VHTC 2RPVA 4HAVB 4GU2A 2KX0A 1OMWA 5DH9B 1WJ6A 4C4VB 3PPAA 4MT7A 1FD6A 3NZSA 2Y5CA 3V62A 1QOAA 2NTSA 2DHJA 2XN9C 4L6EA 2XEWA 4W9EA 5BMIA 2ZCCA 2DKQA 1AW7A 1N61A 5LG4B 3P4RB 1ZUD2 5FI1A 1HZ5A 1MK9B 1F2RI 5CHFA 2QSDA 2W9NA 3Q69A 1EF5A 4NY0A 4XDCA 2O2VB 4TSSA 2KMAA 3DBHB 2R2QA 2BWES 2R2YA 3EPYA 3E66A 4YWGG 2N9LA 2M0AA 3B0AA 4DXAB 3PZDA 4A6QA 2MKRA 3HM3A 2WX1A 4L1BA 3IVFA 4B9KA 4DX8A 4YT0B 1WJ4A 4FULA 3QK0A 2DLWA 1V89A 3BYYB 2K39A 3QJZA 2K25A 3EECA 2JY6A 2DHKA 3FEHA 2LRWA 3VQIA 3RNAC 3KYCD 2DX1A 5GOWB 5FI0A 1UWXA 1KLGD 1V6EA 2YEPB 3TCAA 4CYEA 1QOGA 2M8SA 3P1MA 3OG5A 5CX3A 5I4DA 1MHHE 2ZW1A 5D2MB 3IT4B 1WZ0A 4WURA 3NZUA 2KWUB 2X18A 2L05A 2MJDA 2VRRB 2ZNVC 4OHJA 3LYYA 2L76A 2XBBC 3ML8A 3IBEA 3H7PB 2N7DA 2P0FA 2EKIA 2DHZA 3D8DA 3KUDB 3D8FA 4DX90 4GNKB 2KUQA 5BYQA 3RZWC 2KKCA 4AS1A 1JMLA 2NBVA 3Q8BA 2IY1B 3VH3B 2O6VB 2LZ6A 2KHWB 3GS2A 2LI5A 1N60A 4ANWA 3ZLZA 1V5MA 2RUKB 3RUIB 2FBWB 4FBJB 1YN3A 4RGMA 3ZVVA 2NCNA 2DAJA 2BW2A 4HKQA 4NPNA 3DCGA 4CHKA 1V88A 3NWFA 1NYQA 2L3ZA 3KZ1A 4CSQA 1HQRD 4L23A 3AB5A 1ZM0A 1GB1A 3ZTDA 5DI9B 2DN6A 1J7CA 2D3BA 3OANA 3T8MA 1G6JA 2CU1A 1ZW7A 1QKZA 4JWSC 1ZYIA 4ASWC 2LGXA 2IGHA 2V3SA 4C0AA 2CHZA 4URKA 1FGYA 4HAZB 5BMGA 1EF1A 1C76A 1TKEA 2WXIA 3MC8A 3FILA 2D3CA 1Q1OA 1U2BA 1RJ2A 2V1YA 2DYBA 3N32A 3P6AA 4YSXB 3AE5B 3PTFC 3A9KA 1WXMA 3SBGA 2ZKMX 2DYOA 4L2YA 2CY5A 3T3NA 1H10A 2AQ2B 1A70A 4ZRIA 3SFDB 2G4DB 4BKSD 1JALA 4R3DA 1XXGA 1KC7A 2A5UA 1M4VA 4XE0A 2XNAC 1V80A 3P2BA 1ZE3D 4E3CA 3NJTA 4DIXA 1T0RC 1S3SG 3ZW3A 1TY0A 3NUHB 2FUG1 3EFCA 1C4PA 2WYQA 1E9MA 4F7ZA 3W9CB 2L83A 1P7EA 2DKPA 1Y56A 3R2TA 4JKAA 2PE9A 1I4QA 4GDKB 4ILGB 4IKGA 3TEXA 3L17A 2CHWA 2VH2A 1WGYA 4MT5A 3GYOA 2FE8A 2K3UA 3BYTB 4BKGA 4MH0E 4KHBA 1VRAB 1E90A 2Y8GA 1MI1A 2K22A 2KO3A 3VAWA 5HFYA 5D3DA 3QHTA 1FMAD 2R09A 1VD2A 2CJNA 2MDXA 2N7JA 1IP9A 1F2RC 2DFKA 1I4GA 4C7YA 3I63C 2A4ZA 3L0WB 5AZGA 4IDIA 2M19A 4P6VF 2H88B 4LTUA 4KX6B 2D9XA 5J2RA 1F9JA 3L16A 2DA0A 3E56A 2CQUA 3KQ4A 4ACFA 2PZ1A 1DYQA 2CU3A 2SAKA 2MHJA 2HE7A 5JLJB 4GDKA 1JCKB 1DOYA 4B95A 3DXCA 4K2OA 2EMTA 1X1GA 4PK1A 3OHMB 2D11A 1U5DA 4JKBA 1ZGUB 1WXSA 2ZPYA 3KW5B 2B76B 4XWTA 1XQQA 4KIKB 2QDFA 1PUTA 3CXBB 3MTNB 4NJCA 1QC6A 2LFIA 3RD2A 1X11A 1XO3A 1V5TA 4YONA 5E6PA 4RM9A 2D4QA 1E6EB 2LJIA 3AE9B 2KN5A 2N9KA 3F5RA 4LLGM 2LVOA 2PMVA 2RGNB 3OAWA 2NBVB 1V49A 5JHGA 4C00A 2I2YA 3AE6B 5BYRA 5IOIA 2WGSA 2L1CA 5C79A 2UYZB 1UGMA 4W9LA 4GN1A 1N6ZA 3MC0B 1YOVB 2LASA 2EKEC 3CMMB 4RMAA 1NI3A 3IHPC 4MSMB 1DOIA 2N9XA 4LDTD 3CSFA 4LNNA 2GS0A 2KWDA 3CF6E 2DNFA 3KLSX 1WRIA 2I38A 4G0NB 4QJ5B 1SIFA 1WFYA 1D5MC 1NI2A 1P0RA 4ANVA 2DZIA 3ZNID 2BVCA 3A9JA 3RULA 4ZDVA 2JZ3B 1BUIC 5HE2A 5AUIA 4KKIA 3SHQA 4JPSA 4IWPA 4WWOA 2GB1A 1V1OA 2IYDB 2N1WA 3T06A 4KSKC 2Z13A 2Z4DA 2BB5A 4OSNA 2KDFB 3VFKA 3VTUA 4F1SA 2DWQA 3DVGX 4ICUA 4P1BC 1WZ3A 1Z5SB 2BPSA 2G45B 1WRDB 3DPDA 4BFRA 2J0MA 4B6HA 2G9HD 3ULBA 5C6RA 1GB4A 1ZXIA 5HE3A 1WGQA 1LXDA 3T9LA 1JQ4A 3PEGA 3P4PB 4RFBA 3HSAA 4F7HA 3A8PA 2KVRA 2Z0DB 3N30A 4MSQB 1WE6A 2BGFA 1LW3A 2P8VA 4QJ3B 3J9CA 2NMBA 1L0YB 4TQ1A 1XF5L 5D3WA 1PDXA 4KDIC 2E2XA 4DK5A 5D3VA 4KZCA 3HRDD 2JRIB 5DPSA 3L13A 2LD9A 1MHXA 2E6XA 2L00B 1IRSA 5D3IB 4OZCA 1P3QU 4K7UA 1VZ8A 2PIAA 1J7AA 2D9ZA 2JZZA 4OZBA 3VRAB 4GSWA 2KFKB 2OHFA 3UQAA 4A6FA 2G3QB 2DENB 1MI0A 5H8YE 4KHAA 1T0QC 3A33B 5D6JB 3W2DA 3MPXA 2KAJA 2IGGA 5AZHA 2D9VA 5IN7A 2LULA 2UVMA 2QEJC 2B3AA 1MAIA 2INDC 1XCQL 2MEKA 5AZFA 2PJHA 4HLEA 1FFVA 2L0FA 2PVOD 4FJVB 1ZKHA 4NAMA 2FJUB 1L7YA 5E6JA 4D6WA 5H92C 5DPRA 2WH5A 1UPRA 4NJ7A 3RNGC 4ZRQA 4W9HA 4IWQA 4NQLB 1S1QB 2BYFA 3AE7B 3H9DA 1ZC3B 1JRUA 1FXIA 2BYTA 5LLIA 4A90A 1B1ZA 1WE7A 2C7HA 3C8YA 4HVBA 1L6VA 2MP2A 1E8WA 4F7GA 4USAA 3JSVA 2WDQB 2GOWA 1XCGA 3LXFA 2GMIC 4FLHA 1EM7A 2DYQA 1RRPB 4II3B 1DDVA 2L2IA 5JXVA 4L1RA 1BTNA 2M17A 2DBYA 1YJIA 1YQ3B 2YS3A 1I7AA 1RM6C 1F1HA 2LGIA 3O65B 4ILHA 5DCNA 5KCVA 4JLCA 1WI0A 4NAWB 3X0WA 1HZ6A 2KTFA 3RNCC 3LJ3A 2LBBA 4M02A 3WA0A 3K9PB 5KHQA 4FJZA 1WMHA 3AECB 1MG4A 4FADA 2BS3B 4IFSA 2GBRA 5C5BA 2W2XC 5KQ4A 1V8CA 1XD3B 2ZEQA 3RN9C 2VH1A 1ET9A 1OTRB 3VVWB 3Q3NC 2L52A 3AE4B 4WJ7A 3TUOA 3B77A 1WF9A 4HAYB 2GBJA 3M1IB 1E7UA 2KJHB 3VDZA 2KDBA 4N58A 3ZNGC 1E8XA 3UIOB 1GG3A 1QOBA 1W1HA 3R8BA 1SE2A 3GOEA 3VUYA 2R61A 2MRPA 4YL8A 3HVZA 3P4QB 2FUHB 3ML9A 3ODOA 3KH0A 1DDMA 3HVDA 4AJYB 2ZW0A 1HBKA 5J3YA 2TSSA 1TZOA 1T6BX 3UIPB 1HXYD 3WAOA 4BVUC 1XLOA 2DAFA 2N9EB 2NPTB 1VLBA 4DQOC 2PTLA 5IP4D 2V4LA 4HAXB 1N5WA 3NRZA 1QZEA 3UINB 1C9FA 2KLGA 2LEKA 2PKOA 4I6NB 2QC8A 1FPYA 2BBCA 2FNJB 4HEA1 4ZHPA 5E6NA 3UF8A 4KSLC 2KIEA 3A8QA 5L83A 3DBLB 3PVWA 3OWEB 1DIKA 2LHEA 3BJIA 3VTVA 3PRZA 2JYEA 3A9KB 3ZXRA 1FGZA 3VUXA 2WS3B 1LM8B 1NBFC 5FK9C 3MDBC 2RDHA 2ZZPB 4BBNC 4OZAA 4HCPB 2MCNB 5D94A 3HQCA 1P7FA 4K3BA 4ARIA 3A1QA 2IO3B 1P9DU 2MX2A 4FHKA 4XYCA 3FKYA 5J3TA 1I2HA 1AN8A 5DHAB 3APCA 2W2XD 2YT1A 2GBNA 4MJSB 4LNFA 2KIGA 4MEMA 3UGBB 5IJMA 3M62B 2K8CA 1XKEA 1FAOA 2ZNVB 1SBBB 2KLCA 1M7RA 3UQBA 2N4FA 1ZVRA 2X38A 5HG2A 4PYZA 2YRYA 4KHBB 2MWSB 3PRPB 3EHVA 1J19A 3NVWA 2K8EA 2Z59A 2HTME 4AWJA 1KLVA 3NWDA 3AEFB 4OT1A 2BS2B 3DHHC 4QJ4B 2KJRA 4A55A 1NYRA 3MP9A 4JIOU 1QF6A 3ZO5B 2XK5A 4HB3B 3ENBA 2V0GA 1L0XB 1JWSD 2GCLA 2FIDA 4K81A 2WLBA 1LQBA 2INCC 3U52E 1OY2A 1OGWA 1U29A 3UI3A 3RZFA 2YS1A 2FJ9A 4HAWB 4IOIE 2LXAA 5JVLA 2YLMA 1FFUA 2Q5WD 3AULA 1HTQA 1KI1B 5GXGB 3ECIA 3E9LA 4G11A 4S17A 1DOXA 2OOBB 3O13A 2IO2B 2KTRB 2WQYB 1YX6B 4RH6A 3DHGC 1EGXA 2JU6X 1RAXA 4W9KA 3KVFB 4EZKA 4WWMA 4II2B 2QHOA 1IYFA 3DBLI 1HB8A 1OQRA 1BXTA 3A58A 2D9WA 2RLOA 2FCMA 3DXEA 2BF8B 3RYTA 1C3TA 3ZDTA 3GZNI 4HB4B 2JRHA 3PGEA 3R2IA 1ENFA 3BINA 3ZVRA 4P1CC 3K9OB 1R4MB 4HPLB 1BWNA 1CK1A 1NEKB 4RNAA 3A4SC 1P1AA 1Y5OA 2LOXA 3A1QB 1K53A 1QT9A 1L5PA 2CHXA 2M4NA 2UZRA 3TIXA 1F52A 2M0XA 2Z59B 4W9DA 3MHSD 3NOBA 5D3YA 2C60A 4GOCA 1PFDA 3TJPA 1EU3A 3WAMA 3P7ZA 1YN5A 4MGYE 2LWPA 3RMKC 3DCXA 2MW5A 4A6FB 4W9FA 1L2NA 5JZEB 2GUMA 1YJJA 2ZVNA 5JHBA 1J0WA 4GPTB 4YTMB 4AUQC 4ITKA 3QCAA 1TY2A 3QQ8B 4IM0A 4BZAA 3FILB 1PQSA 2QCZA 4K1RB 4N59A 2K2UA 2L7RA 3Q8EA 2UWQA 2KTRA 4YTNB 3VUWA 2REXA 2QJLA 5TR5A 3RCZA 2DTCA 1HA5A 1MFWA 2CKHB 1IBXB 2BYVE 2D5GA 4WJQA 3LB8C 3CWIA 4BKSA 4X57B 4QXAB 3TEYA 2N23A 3KRWA 2PW9A 2ACZB 3ZDMC 2HDEA 3AE2B 4GDLB 1UPQA 1TS3A 1X1MA 3ZNHB 4HKZE 1GOZA 2MQJA 2CY4A 4ZYNA 3AU4A 5EDSA 1K52A 1AQCA 4A9AA 3PT2B 1TBEA 2INNE 2Y5BB 2WP9B 3RI7C 1U5EA 2O6VA 1E10A 2MBBB 4P16A 1YX5B 3Q8FA 1UGJA 4KIKA 1LFDA 2NZ8B 1FB8A 2V76A 4HROA 5C5BB 2MBOA 4GGQA 3NY5A 3KWLA 1WXVA 2VSZA 3SBTA 4JKFA 2GLSA 4NJ6A 4E74A 5CLLB 2AQ1B 2J4XA 2WXPA 3GZNB 4RGTA 4AP4C 5HHDG 2N0YA 2KN4A 1P98A 2WXOA 2KDIA 1ZP0B 3PG7A 2ONQA 3X23A 4LK0M 5IRSA 1JROA 3PSEB 2COPA 3MC9A 1SE9A 1E8YA 2CODA 2V9HA 1WXAA 2P0DA 2KUPA 1QILA 3L08A 3QAQA 1HTOA 5HKHA 1UD7A 4MH8A 1AWDA 1EWYC 1WJMA 3QX1A 1UNRA 1KLUD 1FNWA 2R0DA 3RT3B 1VBGA 4M0WA 2Z0EB 1DGJA 3N1ZC 2LYDA 1FCLA 3ZJTA 2D3GA 1KH0A 1A5RA 2N7EA 3H8HA 2BCJA 1GJZA 2K8BA 4HHVA 3SD5A 3Q2AC 1STEA 2RQ1A 3IT6B 1E5WA 1MVKA 1K50A 1TKYA 4ICVA 3V6CB 1FRDA 2QKLA 3HHMA 2VRWB 4JQWC 4PQ0A 3TW1A 1XODA 4RGNA 1WX8A 3A4RA 2JP2A 1R4MI 2W82A 5AEKB 1UELA 4XX5A 3ZYYX 4JL9A 3WYFB 4HDQA 4WWNA 3HIZA 2ASQA 1NVID 2AEHA 2RMMA 3DBRI 1OQQA 3PZ7A 2FJLA 2J53A 2PPHA 5CHVC 2RGFA 3NWAA 2K8HA 4EFOA 3KSYA 2D10A 2QMTA 4YTPB 3ZIMA 1P5TA 3FM8C 1ROEA 3ONSA 1CQVA 1J7BA 1N62A 1QQRA 4TUUA 1WY8A 3AN1A 2W55A 4M0WB 1PGXA 2BKRB 1WJ1A 3ZRCA 2AQ3B 3Q3JA 3Q6BA 1YMHE 4C56C 2BKFA 2HTHA 4HRSA 1TQZA 3GP7A 2N0SB 4IAPA 2KNBA 1RYJA 1JWBD 1N3HA 2KFJA 1ZDVA 4JKCA 5C23A 2PEAA 2ROZB 4K7SA 2IJ0A 4ANUA 3W5UB 3AEBB 1PMSA 1YQ4B 3Q3FA 4TYZA 2KCJA 3ALBA 4KKJA 2COAA 1FNUA 3IG3A 2INPE 2JSVX 2GCJA 3FC4A 4PT5A 4XDDA 1WIAA 4UDUC 1KZGA 4MGIE 2OJRA 5JHHA 4J3OD 2Y3AA 1QOFA 2V4IB 3CIRB 1OQYA 4EZLA 3BIID 2WXLA 4HCNB 4JX1C 4K7WA 1L6UA 3PS6A 1ZC4B 3EUB2 4G50A 3AXCA 2NR2A 2Y7BA 3TEWA 4DWFA 2COFA 2CB8A 4KZ0A 2K9XA 4N6EB 5LONB 4B6WA 2L32A 4F8CB 2NBUA 2WU5B 3QIJA 4MELA 1UZXB 3EGRA 2W3SA 1V2YA 3W5VB 4C80A 3AEDB 3OJ4B 3PVUA 2AWTA 3BY4B 4REZA 3HIEA 1SSNA 4MGKE 2D9YA 1I4XA 2ZJDA 3E9OA 2J0KA 1TS5A 3U12A 4GXBA 1K8RB 4H2AA 1V5OA 4YXDB 2KR0A 3QA8A 1UBIA 4KVGB 3BZDB 4HJGE 3V61A 2NTTA 1TXDA 2WWZA 4OVUA 4WJOA 1P3RA 2MH7A 5C3JB 4C4VA 4BKTA 4JKGB 3N1XC 1C79A 2KXJA 3T3OA 1V86A 5G5HA 4MACA 3AU5A 3NVZA 5D3XA 2QIEB 1SHCA 4HXDA 2V3PA 1YD8U 2JT4B 2LHDA 2VZKB 2C5LC 2RPQA 1SXTA 1VZ6A 1Q10A 3DDCB 3V5WA 2KQ4X 4WAFA 1F0ZA 1F77A 3BVGA 1T5XD 3B2GA 2KVZA 4DHJB 2IGDA 3AV8A 4IWOA 2COCA 5I2SA 1WXQA 2M1MA 3AEEB 2WXJA 3ENEA 2HJ8A 2KOXA 4JE3B 1NVLA 3WANA 2MFQA 4HB2B 4CHJA 1RFKA 3KYDD 1AYFA 4ZOHC 3ZRFA 3CSTA 3TSSA 4XGAB 1RLFA 2KX3A 1H8CA 1LO5D 2LUEA 4EJNA 2G1EA 2N1VA 2R2OA 3PP2A 4GZUA 4ZRJA 2YVCA 3AMZA 4EEWA 3VH4B 3ZGZA 1MG8A 3H1UA 1TIFA 2Z0OA 4WSFA 2DLBA 1U27A 4JGHB 2KDMA 2O6VD 2YS5A 1TKGA 3BK2A 5KHOA 2LGDA 4RF0A 3ZQ4A 4A5KA 3AEAB 1FO4A 3E9SA 2JVCA 1E7PB 1MIZB 3D32A 4EUTA 2H7DA 2IY0B 2L0TA 1Q0WB 1SE4A 2J7QB 5D7GA 2ABDA 2JPHA 2M38A 1XLNA 2RDGA 2IFSA 2ELAA 2I5CA 3DBSA 2IZVB 4A8XC 1WJUA 2Q13A 1SF0A 4JKGA 1ZSQA 1OEYJ 1WX7A 1E7VA 1WYWB 1YNTE 3BK1A 4ZHOA 3JYUA 3NVVA 5CTRC 2X8XX 4DHJD 2RVBB 2KK8A 1EU4A 5JP4A 4AJWA 5DHFB 2L1AA 1IPGA 1UUPA 3AJ4A 1FHWA 3PRMB 2HD5B 3FP5A 2JXXA 1R7SA 2MA9B 3L10B 1NTYA 1WVHA 2J0JA 3IAS1 1H4RA 3I9V1 2KJ6A 2BS4B 4DDGD 1V1PB 3TMPB 1C4CA 5FR3A 4P7IA 2LGSA 2K6DB 4IOYX 4BBNF 3M3JA 4PNKA 1T77A 2GJYA 1WWTA 4RM8A 1M7EA 3SFEB 4GOUA 3DWMA 3U7ZA 1ZPSA 1GGOA 3TL5A 3O96A 1FM0D 2PLPA 1VJKA 3SYXA 5EE9A 2CAYA 3P4SB 5JHAA 1ET6A 2ZCBA 5IO9A 3L54A 4ZRPA 5E6OA 3OLMD 5M4YB 1GC6A 4MK0A 2DZJA 2RSUA 2WXMA 3DOWA 2NS5A 1YQBA 1RRBA 1T0SC 1SIJA 1I4HA 2IBIB 1KJTA 3TBLD 3W1SA 3PVLA 3R3MA 5HE0A 3R7QA 1I4RA 1VZ7A 3GYPA 2X0SA 3SR6A 2DZKA 4Z2NA 1BTKA 1VDVA 2MBHA 5JH5C 3HM6X 2EJ8A 5IKCM 2BB6A 1UNQA 3U4EG 3DQVA 1UEFA 2FAZA 3PREA 1N63A 2I1JA 3N9YC 4MY6A 2KACA 4RF1A 1NENB 1VR9A 3H7PA 3ULCA 2ELBA 1WSPA 1Y8RC 4WQOB 1FHXA 4IM2A 4HDOA 4MJSA 3H6NA 1GNUA 3Q8AA 2AL3A 2LKOA 2E3TA 4TKNA 2LUMA 1V9JA 3QARA 4EOYA 1FNVA 4KGSA 3VR9B 3DVGY 3AE1B 2OEDA 1FXTB 5DIFB 2KMMA 4W9JA 4Y94A 1E0ZA 1D6EC 1PFJA 2Y5PA 2KT7A 3APFA 3M95A 3DHIC 1PYWD 1TS4A 4FN2A 4HB0B 1BT0A 1T0YA 2EELA 3R7RA 3EFUA 3SU8X 3SV1A 3I3TB 3AE3B 4JK9A 1MJDA 3AM9A 2MLBA 3A9JB 2KC1A 1YN4A 1D5XC 4WAAA 1EAZA 2RNRB 2M56B 2D3AA 4GMVA 3LJUX 1SEBD 2KC2A 4EKUA 2ADZA 4KV2A 3IAM1 4WWPA 2KYWA 4HAUB 2WU2B 2D07B 3QC8B 4JK8A 3A98B 5IAAC 1RFAA 4HSIA 2WXQA 2JWUA 5L95C 3I5JC 2G35A 4DHZB 1E8ZA 4BOZB 1AWEA 1CZPA 1EVHA 5C16A 2JYTA 4PYUA 4Z2MB 2JQRB 5LXIB 2LXCA 4AOFA 1IGDA 5HE1A 2NBWB 3R66C 3VR8B 2FIFA 3AEGB 3NHEB 3B1LX 4KGTA 1WR1A 2FDQA 1QQGA 3HW2B 2LGYA 1KFYB 1AARA 3DVNU 3OJ3A 2IO0B 4I6LB 5J18A 1WG7A 1DBHA 2WDRB 5HI1A 3TFMA 4ILJA 5CHWA
chains in the Genus database with same CATH topology
3MJWA 4A20A 1YIWA 2XK5B 1MK7B 4A3OA 1CMXB 1KBLA 3PLVA 3U7DA 4HK2A 4WJPA 2ROVA 3SO6A 4KDLB 1XX0A 3ZNZB 4JKHA 4K17A 1ST7A 1KZ7A 1NDDA 4BOSC 1WI1A 1WR6E 1HB6A 3HK0A 1TZ1A 1Q5WB 3DXDA 2LRUA 2RD0A 3VOQA 2K00A 4DDID 3QBVB 4DHZE 1X1FA 4XWXA 4KHOA 1WMHB 2R82A 3VXWA 1NTVA 2MSED 4LJPB 2OQBA 2FCQA 2NPTA 3IFWB 2XQNM 2QKMA 4A6HA 5G55A 2KANA 1J8CA 4WVFB 3RCPA 3F0WA 2KMCA 4MDKE 1WM3A 1WGUA 2C9WB 2HTHB 3KUCB 4IUMB 4CHMA 1WM2A 4LDTB 2YT0A 3VIAA 2KZRA 3TO1A 3QWMA 1XD4A 2C7MB 2MWNB 4LCDE 2L8JA 5BO4B 1XT9B 2ZPNA 3H7SA 2YSZA 2IYBA 1MKEA 2K6QA 4IM3A 3KRXA 1K5DB 1I35A 1K5GB 4TQ0A 1V5PA 3E9PA 1WGRA 3M63B 4EMOA 2DX5B 5G2NA 3DVNV 2OTXA 2MBEA 4PS3A 4K2PA 1D3ZA 4W9CA 4GDLA 3WAPA 3SUZA 2N9PC 1YJ1A 1EUVB 1HE8A 1ISNA 4M8MA 2KFKA 1FOEA 4TV3A 3PV1A 2LVPA 3JVZX 3FLVA 4HJKA 4FJYA 2Z0QA 2RSGA 3U30A 5KQ1A 1R4NI 3ODWA 2M14A 2GBKA 1U4AA 1V5UA 5LXHA 4E71A 4LJOB 4J6IA 2LG1A 4MGZE 3ZKJC 2KD0A 4IW0A 4XZ4A 3ZUNA 1Z87A 3ODXA 1KOTA 5LOPB 5C1ZA 4HATB 1W1GA 4G3XB 1WJNA 3V6EB 5CLQB 2KWVB 5DPTA 1U5GA 3PLUA 3WIMA 1MIXA 3VTWA 3ML4A 2LJ5A 3AI5A 2KDEB 1FHOA 3SDLC 4ZRKA 2K1FA 1W1DA 4A3PA 1WGGA 2DYNA 1Y19B 2BWFA 2Z0PA 4DBGA 4IG7B 1M94A 2K2JA 2G4SA 2JF5A 4WJNA 3PHWB 2DYMA 5DPWA 4HPMB 4EZJA 4ANXA 2I5FA 1DDWA 2MP2B 2FCNA 4F7UP 2EMSA 3JW0X 2Y8FA 4NQKE 5J3QA 2DX5A 4IC7B 1KM7A 4HWIB 4GB9A 2GBMA 2JWZA 1X86A 1VCBA 4GMXB 1XR0B 2PE6B 3KY9A 3C0RB 2YF0A 1GC7A 2IO1B 2EC1A 5EFXA 2WX0A 1TGZB 2H7EA 1NU2A 5IA7A 1Q67A 1TTNA 2DHIA 4W9IA 2BYEA 4MM3A 1LB1A 4OVVA 1C1YB 2KGXB 2NVUI 4FA6A 1VBHA 3NSUA 1ACAA 3UZTA 4FHJA 2KQSA 4JKEA 1TJ6A 4JK7A 3QWZB 1UNPA 2ZVOA 3U8ZA 2UZSA 3FSSA 2D2QA 2JUOA 1V81A 3LDZE 1V61A 1I42A 1NTIA 3PSCA 1SGHA 1WX9A 4N9F4 3V60A 1UBQA 3TVVA 3DBHI 2DIKA 2AYOB 1GUAB 4PS7A 3JSVB 2J59M 1J0GA 2AL6A 5D27A 4NNJB 3B08A 2KWCA 2DZMA 2LVQA 3W1YA 2P0HA 5FR6A 4JKDA 4DBBA 3CIKA 3D8EA 2FCSA 1MPHA 4XC2A 3SNHA 3ZTCA 1DYNA 3EC8A 4W9GA 1Z2MA 2RR9A 5J17A 1OEYA 2O2VA 3PHXB 1WGDA 3S2AA 4CO7A 4NSWA 1JDEA 1PLSA 1U5FA 4KAXB 1BAKA 4BBKA 2WDTB 3WALA 1WH3A 4PS8A 4H8SA 3N7CA 1B55A 3N3KB 2C7NB 4NAWA 1DROA 2LOZA 1OQNA 2I1KA 3NS8A 2W2WA 1EO6A 5L81A 4A6KA 4I6PA 3W1SC 5GMVA 4GIVA 1UH6A 1WGHA 3APDA 2KQ7A 2MBQA 3G9WA 2CR5A 3KUZA 2HRJA 4D0NB 2VKIA 2CRFA 1P6SA 1X05A 2CS4A 4M8NA 3VHTC 4HAVB 4GU2A 2KX0A 1OMWA 5DH9B 1WJ6A 3PPAA 4MT7A 3NZSA 3V62A 2DHJA 4L6EA 2XEWA 4W9EA 2ZCCA 2DKQA 5FI1A 1MK9B 5CHFA 2W9NA 1EF5A 4NY0A 2O2VB 2KMAA 2R2QA 2BWES 3EPYA 3E66A 3B0AA 4DXAB 3PZDA 2MKRA 3HM3A 2WX1A 3IVFA 4B9KA 4DX8A 1WJ4A 4FULA 3QK0A 2DLWA 1V89A 2K39A 3QJZA 2K25A 3EECA 2JY6A 2DHKA 3FEHA 2LRWA 3VQIA 3KYCD 2DX1A 5GOWB 5FI0A 1V6EA 3TCAA 4CYEA 2M8SA 5CX3A 5D2MB 1WZ0A 3NZUA 2KWUB 2X18A 2L05A 2VRRB 2ZNVC 2L76A 2XBBC 3ML8A 3IBEA 3H7PB 2N7DA 2P0FA 2DHZA 3D8DA 3KUDB 3D8FA 4DX90 3RZWC 2KKCA 2IY1B 3VH3B 2O6VB 2LZ6A 2KHWB 2LI5A 4ANWA 3ZLZA 1V5MA 2RUKB 3RUIB 4FBJB 3ZVVA 2NCNA 2DAJA 4NPNA 3DCGA 4CHKA 1V88A 2L3ZA 3KZ1A 1ZM0A 3ZTDA 5DI9B 2DN6A 3OANA 3T8MA 1G6JA 2CU1A 1ZW7A 4ASWC 2LGXA 2V3SA 4C0AA 2CHZA 4URKA 1FGYA 4HAZB 1EF1A 1Q1OA 1U2BA 1RJ2A 2V1YA 2DYBA 3N32A 3P6AA 3PTFC 3A9KA 1WXMA 3SBGA 2DYOA 2CY5A 1H10A 4ZRIA 2G4DB 4BKSD 1KC7A 2A5UA 1V80A 3P2BA 4E3CA 1S3SG 3ZW3A 2WYQA 4F7ZA 2DKPA 4JKAA 2PE9A 4GDKB 4ILGB 3L17A 2CHWA 1WGYA 3GYOA 4BKGA 4MH0E 1E90A 2Y8GA 2KO3A 3VAWA 3QHTA 2R09A 1VD2A 1IP9A 2MDXA 2DFKA 2A4ZA 3L0WB 5AZGA 2D9XA 5J2RA 1F9JA 3L16A 2DA0A 2CQUA 2PZ1A 2HE7A 5JLJB 4GDKA 4B95A 3DXCA 4K2OA 2EMTA 1X1GA 2D11A 1U5DA 4JKBA 1ZGUB 1WXSA 2ZPYA 3KW5B 1XQQA 4KIKB 3CXBB 3MTNB 1QC6A 3RD2A 1X11A 1V5TA 4YONA 5E6PA 4RM9A 2D4QA 2KN5A 3F5RA 2LVOA 2RGNB 3OAWA 2NBVB 1V49A 5JHGA 2L1CA 5C79A 2UYZB 1UGMA 4W9LA 4GN1A 2LASA 2EKEC 3CMMB 4RMAA 3IHPC 4MSMB 2N9XA 4LDTD 3CSFA 2GS0A 3CF6E 4G0NB 1SIFA 1WFYA 1NI2A 1P0RA 4ANVA 2DZIA 3ZNID 3A9JA 3RULA 4ZDVA 2JZ3B 5HE2A 3SHQA 4IWPA 4WWOA 2IYDB 2N1WA 3T06A 4KSKC 2KDFB 3VFKA 3VTUA 4F1SA 3DVGX 4ICUA 1WZ3A 1Z5SB 2BPSA 2G45B 1WRDB 3DPDA 4BFRA 2J0MA 4B6HA 3ULBA 5C6RA 5HE3A 1WGQA 1LXDA 3T9LA 3PEGA 4F7HA 3A8PA 2KVRA 2Z0DB 3N30A 4MSQB 1WE6A 2BGFA 1LW3A 2P8VA 2NMBA 4TQ1A 5D3WA 4KDIC 2E2XA 4DK5A 5D3VA 4KZCA 2JRIB 5DPSA 3L13A 2LD9A 2L00B 1IRSA 1P3QU 4K7UA 2D9ZA 2JZZA 4GSWA 2KFKB 3UQAA 4A6FA 2G3QB 2DENB 4KHAA 3A33B 5D6JB 3MPXA 5AZHA 2D9VA 2LULA 2UVMA 2B3AA 1MAIA 4HLEA 5AZFA 2PJHA 2L0FA 4FJVB 1ZKHA 1L7YA 5DPRA 2WH5A 1UPRA 4NJ7A 4W9HA 4IWQA 4NQLB 1S1QB 2BYFA 3H9DA 1ZC3B 1JRUA 5LLIA 1WE7A 2C7HA 4HVBA 2MP2A 1E8WA 4F7GA 3JSVA 2GOWA 1XCGA 2GMIC 4FLHA 2DYQA 1RRPB 4II3B 1DDVA 2L2IA 1BTNA 2M17A 2YS3A 1I7AA 3O65B 4ILHA 5DCNA 5KCVA 4JLCA 1WI0A 4NAWB 3X0WA 2KTFA 3LJ3A 2LBBA 3WA0A 3K9PB 5KHQA 4FJZA 1WMHA 4FADA 4IFSA 2GBRA 5C5BA 2W2XC 5KQ4A 1XD3B 2ZEQA 1OTRB 3VVWB 4WJ7A 1WF9A 4HAYB 2GBJA 3M1IB 1E7UA 2KJHB 3VDZA 2KDBA 3ZNGC 1E8XA 3UIOB 1GG3A 1W1HA 3GOEA 3VUYA 2MRPA 4YL8A 2FUHB 3ML9A 3ODOA 3KH0A 1DDMA 4AJYB 1HBKA 5J3YA 3UIPB 3WAOA 4BVUC 2DAFA 2N9EB 2NPTB 2V4LA 4HAXB 1QZEA 3UINB 2KLGA 4I6NB 2FNJB 5E6NA 3UF8A 4KSLC 3A8QA 5L83A 3PVWA 1DIKA 3BJIA 3VTVA 3PRZA 3A9KB 1FGZA 3VUXA 1LM8B 1NBFC 3MDBC 2ZZPB 4BBNC 4HCPB 2MCNB 5D94A 3HQCA 3A1QA 2IO3B 1P9DU 2MX2A 4FHKA 5J3TA 1I2HA 5DHAB 3APCA 2W2XD 2YT1A 2GBNA 4MJSB 4MEMA 3UGBB 5IJMA 3M62B 2K8CA 1XKEA 1FAOA 2ZNVB 2KLCA 1M7RA 3UQBA 2N4FA 1ZVRA 4PYZA 2YRYA 4KHBB 2MWSB 3PRPB 3EHVA 1J19A 4AWJA 1KLVA 2KJRA 4JIOU 3ZO5B 2XK5A 4HB3B 3ENBA 2GCLA 2FIDA 4K81A 1LQBA 1OY2A 1OGWA 1U29A 3RZFA 2YS1A 2FJ9A 4HAWB 2LXAA 5JVLA 2YLMA 3AULA 1KI1B 3ECIA 3E9LA 4G11A 2OOBB 2IO2B 2KTRB 1YX6B 1EGXA 1RAXA 4W9KA 3KVFB 4EZKA 4II2B 2QHOA 1IYFA 3DBLI 1HB8A 2D9WA 2RLOA 2FCMA 3DXEA 2BF8B 3RYTA 1C3TA 3ZDTA 3GZNI 4HB4B 2JRHA 3PGEA 3BINA 3ZVRA 3K9OB 4HPLB 1BWNA 3A4SC 1P1AA 1Y5OA 2LOXA 3A1QB 2CHXA 2M4NA 2UZRA 3TIXA 2M0XA 2Z59B 4W9DA 3MHSD 3NOBA 5D3YA 2C60A 4GOCA 3TJPA 3WAMA 3P7ZA 4MGYE 2LWPA 2MW5A 4A6FB 4W9FA 1L2NA 5JZEB 2ZVNA 5JHBA 1J0WA 4GPTB 4AUQC 3QCAA 3QQ8B 4IM0A 1PQSA 4K1RB 2K2UA 2L7RA 2UWQA 2KTRA 3VUWA 2REXA 5TR5A 3RCZA 2DTCA 2CKHB 2BYVE 4WJQA 4BKSA 4X57B 2N23A 3KRWA 3ZDMC 4GDLB 1UPQA 1X1MA 3ZNHB 2MQJA 2CY4A 4ZYNA 3AU4A 5EDSA 1AQCA 3PT2B 1TBEA 2Y5BB 1U5EA 2O6VA 2MBBB 1YX5B 4KIKA 1LFDA 2NZ8B 1FB8A 2V76A 5C5BB 2MBOA 4GGQA 3NY5A 1WXVA 2VSZA 3SBTA 4JKFA 4NJ6A 4E74A 5CLLB 4AP4C 2N0YA 1P98A 2KDIA 3PG7A 3X23A 3PSEB 2COPA 1SE9A 1E8YA 2CODA 1WXAA 2P0DA 2KUPA 3L08A 3QAQA 5HKHA 1UD7A 1WJMA 3QX1A 1UNRA 2R0DA 3RT3B 1VBGA 2Z0EB 2LYDA 2D3GA 1A5RA 2N7EA 1GJZA 2BCJA 2K8BA 4HHVA 3SD5A 2RQ1A 1E5WA 4ICVA 3V6CB 2QKLA 3HHMA 2VRWB 4JQWC 4PQ0A 3TW1A 1XODA 1WX8A 3A4RA 2JP2A 1R4MI 5AEKB 1UELA 4XX5A 4JL9A 3WYFB 4HDQA 4WWNA 3HIZA 2ASQA 2AEHA 3DBRI 2FJLA 2PPHA 5CHVC 2RGFA 2K8HA 4EFOA 3KSYA 2D10A 3ZIMA 1P5TA 3FM8C 3ONSA 4TUUA 1WY8A 4M0WB 2BKRB 1WJ1A 3ZRCA 3Q3JA 2BKFA 2HTHA 1TQZA 4IAPA 2KNBA 1N3HA 2KFJA 4JKCA 5C23A 2PEAA 2ROZB 4K7SA 4ANUA 1PMSA 3Q3FA 4TYZA 2KCJA 3ALBA 2COAA 3IG3A 2GCJA 1WIAA 1KZGA 4MGIE 2OJRA 5JHHA 1OQYA 4EZLA 4HCNB 4K7WA 3PS6A 1ZC4B 4G50A 3AXCA 2NR2A 2Y7BA 4DWFA 2COFA 2CB8A 4KZ0A 5LONB 4B6WA 4F8CB 2NBUA 3QIJA 4MELA 1UZXB 1V2YA 3OJ4B 3PVUA 2AWTA 3BY4B 4MGKE 2D9YA 2ZJDA 3E9OA 2J0KA 4GXBA 1K8RB 1V5OA 3QA8A 1UBIA 4KVGB 3V61A 1TXDA 2WWZA 4OVUA 4WJOA 1P3RA 4BKTA 4JKGB 2KXJA 1V86A 3AU5A 5D3XA 1SHCA 4HXDA 1YD8U 2JT4B 2C5LC 2RPQA 3DDCB 3V5WA 4DHJB 4IWOA 2COCA 2M1MA 3ENEA 2HJ8A 2KOXA 1NVLA 3WANA 2MFQA 4HB2B 4CHJA 3KYDD 3ZRFA 3CSTA 1RLFA 2KX3A 1H8CA 2LUEA 4EJNA 2N1VA 2R2OA 3PP2A 4GZUA 4ZRJA 2YVCA 4EEWA 3VH4B 1MG8A 3H1UA 2Z0OA 4WSFA 1U27A 4JGHB 2O6VD 2YS5A 5KHOA 2LGDA 4A5KA 2JVCA 1MIZB 3D32A 4EUTA 2H7DA 2IY0B 2L0TA 1Q0WB 2J7QB 5D7GA 2ABDA 2JPHA 2M38A 2IFSA 2ELAA 2I5CA 3DBSA 2IZVB 1WJUA 2Q13A 4JKGA 1ZSQA 1OEYJ 1WX7A 1E7VA 1WYWB 3JYUA 5CTRC 4DHJD 2RVBB 2KK8A 5JP4A 4AJWA 5DHFB 1IPGA 3AJ4A 1FHWA 3PRMB 2HD5B 3FP5A 2JXXA 2MA9B 3L10B 1NTYA 1WVHA 2J0JA 1H4RA 2KJ6A 4DDGD 3TMPB 4P7IA 2K6DB 4IOYX 4BBNF 3M3JA 4PNKA 2GJYA 4RM8A 1M7EA 1GGOA 3TL5A 3O96A 3SYXA 2CAYA 5JHAA 2ZCBA 3L54A 5E6OA 3OLMD 1GC6A 4MK0A 2DZJA 2RSUA 3DOWA 2NS5A 1YQBA 1RRBA 2IBIB 1KJTA 3TBLD 3W1SA 3PVLA 3R3MA 5HE0A 3R7QA 3GYPA 2X0SA 2DZKA 4Z2NA 1BTKA 2MBHA 5JH5C 3HM6X 2EJ8A 1UNQA 3DQVA 1UEFA 2FAZA 3PREA 2I1JA 4MY6A 3H7PA 3ULCA 2ELBA 1Y8RC 4WQOB 1FHXA 4IM2A 4HDOA 4MJSA 3H6NA 1GNUA 2AL3A 2LKOA 4TKNA 1V9JA 3QARA 4EOYA 3DVGY 1FXTB 5DIFB 4W9JA 4Y94A 1PFJA 3APFA 3M95A 4FN2A 4HB0B 1BT0A 1T0YA 3R7RA 3EFUA 3SU8X 3SV1A 3I3TB 4JK9A 2MLBA 3A9JB 2KC1A 4WAAA 1EAZA 2RNRB 4GMVA 3LJUX 2KC2A 4EKUA 2ADZA 4KV2A 4WWPA 4HAUB 2D07B 3QC8B 4JK8A 3A98B 5IAAC 1RFAA 5L95C 2G35A 4DHZB 1E8ZA 4BOZB 1AWEA 1EVHA 5C16A 4PYUA 4Z2MB 5LXIB 2LXCA 4AOFA 5HE1A 2NBWB 3R66C 2FIFA 3NHEB 3B1LX 1WR1A 2FDQA 1QQGA 3HW2B 2LGYA 1AARA 3DVNU 3OJ3A 2IO0B 4I6LB 5J18A 1WG7A 1DBHA 3TFMA 4ILJA 5CHWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OQN A;  2I1K A;  1WX8 A;  3A4R A;  3NS8 A;  2W2W A;  2JP2 A;  3MJW A;  1R4M I;  1EO6 A;  4A20 A;  5L81 A;  4KHA A;  1YIW A;  1UEL A;  3A33 B;  5D6J B;  5AEK B;  3MPX A;  2XK5 B;  1MK7 B;  4XX5 A;  5AZH A;  2D9V A;  4A6K A;  3WYF B;  1CMX B;  4I6P A;  3PLV A;  4JL9 A;  3W1S C;  4HDQ A;  3U7D A;  4WWN A;  4HK2 A;  3HIZ A;  2LUL A;  2ASQ A;  2UVM A;  4WJP A;  2B3A A;  1MAI A;  2ROV A;  5GMV A;  5AZF A;  4HLE A;  2PJH A;  2AEH A;  3SO6 A;  4GIV A;  1UH6 A;  1WGH A;  3DBR I;  4KDL B;  1XX0 A;  2FJL A;  3APD A;  3ZNZ B;  2L0F A;  2PPH A;  4FJV B;  1ZKH A;  2KQ7 A;  5CHV C;  4K17 A;  1L7Y A;  2RGF A;  1ST7 A;  2MBQ A;  3G9W A;  2K8H A;  5DPR A;  1KZ7 A;  2WH5 A;  4EFO A;  2CR5 A;  1NDD A;  4BOS C;  1WI1 A;  1WR6 E;  3KUZ A;  1UPR A;  2HRJ A;  4D0N B;  1HB6 A;  3HK0 A;  1TZ1 A;  4NJ7 A;  2VKI A;  1Q5W B;  3DXD A;  4W9H A;  4IWQ A;  2LRU A;  2CRF A;  4NQL B;  1S1Q B;  2RD0 A;  1P6S A;  3KSY A;  1X05 A;  2BYF A;  2CS4 A;  2D10 A;  3VOQ A;  2K00 A;  3H9D A;  1ZC3 B;  1JRU A;  1P5T A;  4M8N A;  3FM8 C;  3ZIM A;  5LLI A;  3VHT C;  3ONS A;  1WE7 A;  2C7H A;  4DDI D;  4HVB A;  4HAV B;  4GU2 A;  2KX0 A;  2MP2 A;  1OMW A;  4F7G A;  5DH9 B;  3QBV B;  1E8W A;  1WJ6 A;  1WY8 A;  3JSV A;  4TUU A;  2GOW A;  4DHZ E;  1XCG A;  4M0W B;  1X1F A;  2GMI C;  2BKR B;  3PPA A;  4FLH A;  4MT7 A;  4XWX A;  3NZS A;  1WJ1 A;  3ZRC A;  4KHO A;  1WMH B;  3V62 A;  2DYQ A;  3VXW A;  1RRP B;  4II3 B;  1NTV A;  1DDV A;  2L2I A;  2DHJ A;  2MSE D;  3Q3J A;  4L6E A;  4LJP B;  2OQB A;  2BKF A;  2HTH A;  2XEW A;  1BTN A;  1TQZ A;  2FCQ A;  2M17 A;  2NPT A;  4LDT B;  4W9E A;  3IFW B;  2XQN M;  4IAP A;  2DKQ A;  2YS3 A;  2QKM A;  2ZCC A;  1I7A A;  2KNB A;  3O65 B;  4A6H A;  5G55 A;  1N3H A;  2KFJ A;  5DCN A;  5FI1 A;  5KCV A;  2KAN A;  1MK9 B;  2PEA A;  5C23 A;  1J8C A;  2ROZ B;  4K7S A;  5CHF A;  4ANU A;  4WVF B;  2W9N A;  4JLC A;  1WI0 A;  4NAW B;  3X0W A;  3RCP A;  1PMS A;  4NY0 A;  3F0W A;  1EF5 A;  4TYZ A;  2KCJ A;  2KMC A;  2KTF A;  2COA A;  3ALB A;  3Q3F A;  3LJ3 A;  4MDK E;  1WM3 A;  2O2V B;  3IG3 A;  2LBB A;  1WGU A;  2GCJ A;  2KMA A;  2R2Q A;  2BWE S;  2C9W B;  2HTH B;  1WIA A;  3WA0 A;  1KZG A;  3EPY A;  3KUC B;  2OJR A;  4MGI E;  5JHH A;  3B0A A;  3K9P B;  5KHQ A;  4IUM B;  4FJZ A;  4DXA B;  3WAP A;  3PZD A;  4CHM A;  1WM2 A;  1WMH A;  2MKR A;  4FAD A;  1OQY A;  4EZL A;  2YT0 A;  3VIA A;  4IFS A;  2GBR A;  3HM3 A;  2WX1 A;  4HCN B;  3IVF A;  5C5B A;  4K7W A;  2W2X C;  4B9K A;  5KQ4 A;  1XD3 B;  2KZR A;  2ZEQ A;  3PS6 A;  3TO1 A;  3QWM A;  4DX8 A;  1WJ4 A;  1XD4 A;  1ZC4 B;  2C7M B;  3QK0 A;  4FUL A;  2DLW A;  1V89 A;  1OTR B;  2MWN B;  3AXC A;  4G50 A;  2NR2 A;  3VVW B;  2Y7B A;  4LCD E;  4DWF A;  4WJ7 A;  2K39 A;  2COF A;  2CB8 A;  3QJZ A;  2K25 A;  1WF9 A;  3EEC A;  4HAY B;  2GBJ A;  2L8J A;  4KZ0 A;  2JY6 A;  2DHK A;  5LON B;  5BO4 B;  4B6W A;  3FEH A;  1XT9 B;  3M1I B;  1E7U A;  2KJH B;  2LRW A;  4F8C B;  2ZPN A;  3H7S A;  2YSZ A;  2IYB A;  1MKE A;  2K6Q A;  2KDB A;  2DX1 A;  3KRX A;  2NBU A;  3KYC D;  3VDZ A;  3ZNG C;  3QIJ A;  5GOW B;  5FI0 A;  1E8X A;  1K5D B;  4MEL A;  3UIO B;  1V6E A;  1I35 A;  1GG3 A;  1K5G B;  4TQ0 A;  3TCA A;  3VQI A;  1V5P A;  1W1H A;  1WGR A;  4CYE A;  2M8S A;  3GOE A;  3VUY A;  2MRP A;  3M63 B;  1UZX B;  4YL8 A;  4EMO A;  2DX5 B;  5CX3 A;  5G2N A;  1V2Y A;  2FUH B;  3ML9 A;  3ODO A;  5D2M B;  3DVN V;  3KH0 A;  1WZ0 A;  1DDM A;  3NZU A;  4AJY B;  2OTX A;  2MBE A;  2KWU B;  4PS3 A;  2X18 A;  2L05 A;  3PVU A;  3OJ4 B;  4K2P A;  2AWT A;  1D3Z A;  3BY4 B;  1HBK A;  4GDL A;  2VRR B;  3SUZ A;  5J3Y A;  2ZNV C;  4MGK E;  2N9P C;  2D9Y A;  1YJ1 A;  1EUV B;  1HE8 A;  2L76 A;  2XBB C;  2ZJD A;  1ISN A;  2J0K A;  3ML8 A;  3UIP B;  3IBE A;  3H7P B;  4GXB A;  2KFK A;  1K8R B;  4M8M A;  3WAO A;  2N7D A;  1FOE A;  2P0F A;  3PV1 A;  1V5O A;  2DHZ A;  4TV3 A;  4BVU C;  2DAF A;  2N9E B;  3D8D A;  2NPT B;  3KUD B;  3QA8 A;  3D8F A;  4DX9 0;  1UBI A;  4KVG B;  3RZW C;  2KKC A;  2LVP A;  3V61 A;  2V4L A;  4HAX B;  2IY1 B;  3VH3 B;  2O6V B;  3FLV A;  1TXD A;  2LZ6 A;  3JVZ X;  4A3O A;  1QZE A;  2KHW B;  2WWZ A;  3UIN B;  2LI5 A;  2KLG A;  4OVU A;  4WJO A;  4ANW A;  4HJK A;  4I6N B;  1P3R A;  4FJY A;  3ZLZ A;  1V5M A;  2RUK B;  4BKT A;  2Z0Q A;  3RUI B;  2FNJ B;  2RSG A;  2KXJ A;  3U30 A;  5E6N A;  3UF8 A;  4KSL C;  1V86 A;  3A8Q A;  5KQ1 A;  4FBJ B;  3ZVV A;  5L83 A;  1R4N I;  3AU5 A;  2DAJ A;  3ODW A;  2NCN A;  3PVW A;  5D3X A;  2M14 A;  4B95 A;  2GBK A;  3BJI A;  1U4A A;  3VTV A;  1SHC A;  1V5U A;  4NPN A;  3PRZ A;  3A9K B;  4HXD A;  1L2N A;  3DCG A;  1YD8 U;  2JT4 B;  1FGZ A;  4CHK A;  3VUX A;  1V88 A;  5LXH A;  1LM8 B;  1NBF C;  2L3Z A;  3KZ1 A;  4E71 A;  1ZM0 A;  2C5L C;  2RPQ A;  4LJO B;  4J6I A;  5DI9 B;  2LG1 A;  2DN6 A;  3ZTD A;  3MDB C;  2ZZP B;  4MGZ E;  3ZKJ C;  4BBN C;  3OAN A;  3T8M A;  3DDC B;  3V5W A;  2KD0 A;  4HCP B;  2MCN B;  5D94 A;  4IW0 A;  1G6J A;  2CU1 A;  4XZ4 A;  1ZW7 A;  3ZUN A;  4DHJ B;  3HQC A;  4ASW C;  1Z87 A;  3ODX A;  2LGX A;  1KOT A;  5LOP B;  3A1Q A;  5C1Z A;  2IO3 B;  4IWO A;  2V3S A;  4HAT B;  1W1G A;  2COC A;  4C0A A;  1P9D U;  2CHZ A;  2MX2 A;  4FHK A;  4G3X B;  4URK A;  5J3T A;  1I2H A;  2M1M A;  1FGY A;  4HAZ B;  1WJN A;  1EF1 A;  3V6E B;  4W9C A;  5CLQ B;  5DHA B;  3APC A;  1Q1O A;  2HJ8 A;  1U2B A;  2W2X D;  3ENE A;  2YT1 A;  2GBN A;  1RJ2 A;  2KOX A;  1NVL A;  3WAN A;  2V1Y A;  4MJS B;  2DYB A;  2MFQ A;  4HB2 B;  3N32 A;  2KWV B;  4MEM A;  4CHJ A;  5DPT A;  3UGB B;  5IJM A;  3P6A A;  3KYD D;  3M62 B;  2K8C A;  3PTF C;  3ZRF A;  1U5G A;  1XKE A;  3A9K A;  1WXM A;  3CST A;  2DYO A;  1FAO A;  2CY5 A;  3PLU A;  3WIM A;  1RLF A;  2KX3 A;  1H10 A;  2ZNV B;  1H8C A;  4ZRI A;  1M7R A;  1MIX A;  2KLC A;  4EJN A;  2G4D B;  2LUE A;  2N4F A;  3VTW A;  1ZVR A;  4BKS D;  3UQB A;  2N1V A;  2R2O A;  4PYZ A;  3ML4 A;  3PP2 A;  2YRY A;  4GZU A;  2LJ5 A;  3AI5 A;  4ZRJ A;  4KHB B;  2YVC A;  2A5U A;  2MWS B;  4EEW A;  3PRP B;  3EHV A;  3VH4 B;  1J19 A;  2KDE B;  1MG8 A;  3H1U A;  1V80 A;  3P2B A;  4AWJ A;  2Z0O A;  4WSF A;  4E3C A;  1KLV A;  1FHO A;  1U27 A;  4JGH B;  2KJR A;  3SDL C;  1S3S G;  2O6V D;  4ZRK A;  3ZW3 A;  2YS5 A;  4JIO U;  3ZO5 B;  2XK5 A;  5KHO A;  4HB3 B;  2K1F A;  2LGD A;  1W1D A;  2GCL A;  2WYQ A;  2FID A;  4A5K A;  4F7Z A;  4A3P A;  4K81 A;  1WGG A;  2JVC A;  1LQB A;  1MIZ B;  3D32 A;  4EUT A;  2DKP A;  1OY2 A;  2DYN A;  2H7D A;  1OGW A;  1U29 A;  2IY0 B;  2L0T A;  1Y19 B;  1Q0W B;  2BWF A;  2Z0P A;  2J7Q B;  3RZF A;  2YS1 A;  2ABD A;  5D7G A;  2JPH A;  2M38 A;  2PE9 A;  4DBG A;  2FJ9 A;  2IFS A;  4IG7 B;  4HAW B;  2ELA A;  2LXA A;  1M94 A;  2I5C A;  4GDK B;  2YLM A;  3DBS A;  2IZV B;  1WJU A;  2Q13 A;  2K2J A;  3L17 A;  3AUL A;  2G4S A;  2CHW A;  2JF5 A;  1WGY A;  1ZSQ A;  1KI1 B;  3GYO A;  4WJN A;  1OEY J;  1WX7 A;  1E7V A;  1WYW B;  3ECI A;  4G11 A;  3PHW B;  3JYU A;  4BKG A;  2DYM A;  4MH0 E;  2OOB B;  5CTR C;  1E90 A;  2Y8G A;  2IO2 B;  2KTR B;  4DHJ D;  2KO3 A;  2RVB B;  1YX6 B;  3VAW A;  2KK8 A;  4HPM B;  5DPW A;  4EZJ A;  5JP4 A;  1EGX A;  4ANX A;  4AJW A;  2I5F A;  1DDW A;  5DHF B;  1IPG A;  2MP2 B;  1RAX A;  3QHT A;  3AJ4 A;  4W9K A;  3KVF B;  4EZK A;  1FHW A;  2R09 A;  1VD2 A;  3PRM B;  4II2 B;  2MDX A;  2HD5 B;  2QHO A;  3DBL I;  1IP9 A;  1IYF A;  1HB8 A;  3FP5 A;  2FCN A;  2JXX A;  2DFK A;  2D9W A;  2RLO A;  4F7U P;  2MA9 B;  2FCM A;  3DXE A;  2BF8 B;  3L10 B;  3RYT A;  2EMS A;  1NTY A;  2A4Z A;  3L0W B;  5AZG A;  1C3T A;  1WVH A;  2J0J A;  3ZDT A;  3GZN I;  4HB4 B;  2JRH A;  1H4R A;  3PGE A;  3BIN A;  3ZVR A;  3JW0 X;  3K9O B;  4HPL B;  1BWN A;  2Y8F A;  2KJ6 A;  2D9X A;  4NQK E;  4DDG D;  5J2R A;  5J3Q A;  1F9J A;  3L16 A;  3TMP B;  3A4S C;  2DX5 A;  2DA0 A;  1P1A A;  1Y5O A;  2LOX A;  2CQU A;  3A1Q B;  4P7I A;  4IC7 B;  1KM7 A;  2K6D B;  2PZ1 A;  2CHX A;  4HWI B;  2M4N A;  4IOY X;  4BBN F;  2UZR A;  4GB9 A;  3TIX A;  2GBM A;  2JWZ A;  1X86 A;  2M0X A;  4PNK A;  2Z59 B;  3M3J A;  4MM3 A;  1VCB A;  2GJY A;  4RM8 A;  2HE7 A;  1M7E A;  5JLJ B;  3MHS D;  4GDK A;  3NOB A;  4W9D A;  4GMX B;  5D3Y A;  3TL5 A;  2C60 A;  4GOC A;  3O96 A;  3TJP A;  1XR0 B;  3DXC A;  4K2O A;  2PE6 B;  3KY9 A;  3WAM A;  2EMT A;  3SYX A;  3C0R B;  2CAY A;  1X1G A;  3P7Z A;  2YF0 A;  5JHA A;  1GC7 A;  2IO1 B;  4MGY E;  4IM3 A;  2EC1 A;  2LWP A;  2ZCB A;  2D11 A;  2G3Q B;  5EFX A;  2WX0 A;  1U5D A;  1ZGU B;  4A6F B;  1TGZ B;  2MW5 A;  3L54 A;  1WXS A;  2ZPY A;  2H7E A;  3OLM D;  4W9F A;  5E6O A;  5JZE B;  1NU2 A;  1GC6 A;  4MK0 A;  2DZJ A;  2RSU A;  3KW5 B;  2ZVN A;  3DOW A;  5JHB A;  1J0W A;  2NS5 A;  4GPT B;  1XQQ A;  1RRB A;  1YQB A;  4KIK B;  5IA7 A;  1Q67 A;  4AUQ C;  3CXB B;  2IBI B;  1KJT A;  3MTN B;  1TTN A;  3QCA A;  1QC6 A;  3QQ8 B;  4IM0 A;  2DHI A;  4W9I A;  3PVL A;  3RD2 A;  3TBL D;  1X11 A;  3R3M A;  5HE0 A;  3R7Q A;  1V5T A;  4YON A;  1PQS A;  3GYP A;  2BYE A;  4RM9 A;  5E6P A;  2D4Q A;  4K1R B;  2K2U A;  2L7R A;  2DZK A;  2KN5 A;  3F5R A;  4Z2N A;  2KTR A;  1BTK A;  1LB1 A;  2LVO A;  2RGN B;  2MBH A;  2UWQ A;  3OAW A;  2NBV B;  4OVV A;  5JH5 C;  1V49 A;  3HM6 X;  2EJ8 A;  5JHG A;  1C1Y B;  2REX A;  3VUW A;  1UNQ A;  2KGX B;  5TR5 A;  3DQV A;  1UEF A;  2FAZ A;  3RCZ A;  2NVU I;  2DTC A;  4FA6 A;  3PRE A;  2L1C A;  3NSU A;  1ACA A;  2CKH B;  2I1J A;  4MY6 A;  5C79 A;  3UZT A;  1UGM A;  2UYZ B;  4FHJ A;  2KQS A;  3H7P A;  4GN1 A;  1TJ6 A;  3ULC A;  2BYV E;  4W9L A;  4WJQ A;  2ELB A;  1Y8R C;  2LAS A;  4WQO B;  1FHX A;  2EKE C;  3CMM B;  4HDO A;  4IM2 A;  4MJS A;  3H6N A;  4BKS A;  3QWZ B;  4RMA A;  4X57 B;  1GNU A;  1UNP A;  2N23 A;  2ZVO A;  3U8Z A;  3KRW A;  3IHP C;  2UZS A;  4MSM B;  3FSS A;  2AL3 A;  2N9X A;  2D2Q A;  2LKO A;  4LDT D;  2JUO A;  3ZDM C;  1V81 A;  3CSF A;  4GDL B;  3LDZ E;  1UPQ A;  2GS0 A;  1X1M A;  4TKN A;  1V61 A;  3ZNH B;  1I42 A;  3CF6 E;  1NTI A;  1V9J A;  2MQJ A;  3QAR A;  4EOY A;  2CY4 A;  3PSC A;  4G0N B;  4ZYN A;  3AU4 A;  1SGH A;  1WX9 A;  4N9F 4;  1SIF A;  3V60 A;  1UBQ A;  5EDS A;  1WFY A;  1AQC A;  3DVG Y;  3TVV A;  1NI2 A;  1P0R A;  3PT2 B;  4ANV A;  1TBE A;  2DZI A;  2Y5B B;  3DBH I;  3ZNI D;  2AYO B;  1FXT B;  3A9J A;  1GUA B;  5DIF B;  4PS7 A;  4W9J A;  3RUL A;  4Y94 A;  3JSV B;  4ZDV A;  2JZ3 B;  1PFJ A;  5HE2 A;  1U5E A;  2O6V A;  2J59 M;  2MBB B;  1J0G A;  2AL6 A;  1YX5 B;  4KIK A;  3SHQ A;  1LFD A;  2NZ8 B;  5D27 A;  3APF A;  1FB8 A;  3M95 A;  4FN2 A;  4IWP A;  4HB0 B;  4NNJ B;  1BT0 A;  2V76 A;  1T0Y A;  5C5B B;  3B08 A;  2MBO A;  3EFU A;  4WWO A;  4GGQ A;  3R7R A;  2KWC A;  3SV1 A;  2IYD B;  3NY5 A;  3I3T B;  2DZM A;  3SU8 X;  2N1W A;  2MLB A;  3T06 A;  1WXV A;  2LVQ A;  3A9J B;  4KSK C;  2VSZ A;  2KC1 A;  4WAA A;  2KDF B;  3VFK A;  3W1Y A;  2P0H A;  3VTU A;  4F1S A;  5FR6 A;  1EAZ A;  2RNR B;  4NJ6 A;  4E74 A;  5CLL B;  3DVG X;  4GMV A;  4DBB A;  3LJU X;  3CIK A;  1WZ3 A;  2KC2 A;  4ICU A;  3D8E A;  1Z5S B;  4EKU A;  2BPS A;  1MPH A;  2FCS A;  2G45 B;  2ADZ A;  4KV2 A;  4XC2 A;  3SNH A;  3ZTC A;  1WRD B;  3DPD A;  2N0Y A;  4WWP A;  4AP4 C;  4BFR A;  2J0M A;  1DYN A;  4HAU B;  4B6H A;  1P98 A;  2KDI A;  3ULB A;  5C6R A;  3PG7 A;  2D07 B;  3EC8 A;  3QC8 B;  4W9G A;  3X23 A;  1Z2M A;  2RR9 A;  5HE3 A;  3W1S A;  1WGQ A;  1LXD A;  3T9L A;  3A98 B;  1OEY A;  3PSE B;  2COP A;  1RFA A;  1SE9 A;  2O2V A;  5IAA C;  5J17 A;  3PHX B;  3PEG A;  1E8Y A;  2COD A;  1WGD A;  5L95 C;  3S2A A;  4F7H A;  3A8P A;  2G35 A;  4DHZ B;  1WXA A;  2KVR A;  2P0D A;  2Z0D B;  3N30 A;  1E8Z A;  4MSQ B;  4BOZ B;  4CO7 A;  2KUP A;  1WE6 A;  3L08 A;  2BGF A;  1AWE A;  3QAQ A;  1EVH A;  1LW3 A;  2P8V A;  4NSW A;  5C16 A;  4PYU A;  5HKH A;  4Z2M B;  1UD7 A;  5LXI B;  2NMB A;  2LXC A;  1WJM A;  3QX1 A;  1UNR A;  4AOF A;  5HE1 A;  1PLS A;  4TQ1 A;  2NBW B;  3R66 C;  1U5F A;  4KAX B;  1BAK A;  5D3W A;  2FIF A;  2R0D A;  4KDI C;  3RT3 B;  2E2X A;  4BBK A;  3NHE B;  3B1L X;  2Z0E B;  4DK5 A;  1WR1 A;  2FDQ A;  1QQG A;  2WDT B;  2LYD A;  5D3V A;  1WH3 A;  3HW2 B;  4KZC A;  4PS8 A;  2D3G A;  2JRI B;  3WAL A;  1A5R A;  4H8S A;  5DPS A;  2N7E A;  3L13 A;  2BCJ A;  2LD9 A;  2K8B A;  4HHV A;  3SD5 A;  2LGY A;  1GJZ A;  3N7C A;  1AAR A;  1IRS A;  2L00 B;  1B55 A;  3DVN U;  3N3K B;  3OJ3 A;  2RQ1 A;  2IO0 B;  1E5W A;  1P3Q U;  4I6L B;  4K7U A;  2C7N B;  5J18 A;  4NAW A;  4ICV A;  2D9Z A;  1WG7 A;  2JZZ A;  2QKL A;  3HHM A;  3V6C B;  2VRW B;  4JQW C;  1DBH A;  4PQ0 A;  3TW1 A;  4GSW A;  1XOD A;  3TFM A;  5CHW A;  1DRO A;  2KFK B;  2LOZ A;  3UQA A;  4A6F A;  2DEN B; 
#chains in the Genus database with same CATH topology
 2OJW A;  3MJW A;  2RRF A;  1YIW A;  4A20 A;  2XK5 B;  3NZ3 A;  1MK7 B;  4A3O A;  1CMX B;  1KBL A;  3PLV A;  3U7D A;  1TYG B;  2WXK A;  4HK2 A;  4WJP A;  2ROV A;  3SO6 A;  3RNB C;  4KDL B;  3ETR A;  1XX0 A;  4RCO A;  3ZNZ B;  4JKH A;  2WXR A;  1OFF A;  1TS2 A;  4K17 A;  1ST7 A;  1KZ7 A;  4BAX A;  1NDD A;  4BOS C;  1T3Q A;  1WI1 A;  1WR6 E;  5BYS A;  1HB6 A;  3HK0 A;  1TZ1 A;  2JZP A;  1Q5W B;  1SJE D;  5LNK 1;  3DXD A;  1IBX A;  2LRU A;  2RD0 A;  4WH4 A;  1GAQ B;  3VOQ A;  2K00 A;  4DDI D;  3RNF C;  3QBV B;  4DHZ E;  1X1F A;  4XWX A;  4ARC A;  4KHO A;  1WMH B;  2R82 A;  3VXW A;  4GLS C;  5FKA C;  1NTV A;  2MSE D;  4LJP B;  2OQB A;  1IUE A;  5I2M A;  2FCQ A;  3AH7 A;  2NPT A;  3IFW B;  2XQN M;  2QKM A;  1JWA D;  1K51 A;  4A6H A;  3KWV A;  1UNS A;  5G55 A;  4US9 A;  2VZK D;  2Z8L A;  2KAN A;  1J8C A;  3MHZ A;  4WVF B;  2LMC A;  3V05 A;  3RCP A;  3F0W A;  2KMC A;  3DWG C;  4ZYS A;  4MDK E;  2CJO A;  1N5X A;  1WM3 A;  4WIP A;  1WGU A;  2C9W B;  2HTH B;  1I7H A;  2BT6 A;  3KUC B;  5G5G A;  4IUM B;  4CHM A;  1WM2 A;  1C4A A;  3Q3O C;  2YT0 A;  3VIA A;  4LDT B;  1BML C;  2WXH A;  2V3N A;  1D4B A;  2KZR A;  3BVM A;  1XCT L;  3TO1 A;  3QWM A;  1XD4 A;  2C7M B;  2MWN B;  4NZL B;  4LCD E;  2L8J A;  1SJH D;  1ACC A;  5BO4 B;  1XT9 B;  2ZPN A;  3H7S A;  2YSZ A;  2IYB A;  1MKE A;  2K6Q A;  3P42 A;  3KRX A;  4IM3 A;  1K5D B;  1I35 A;  1K5G B;  4TQ0 A;  3ZXV A;  1V5P A;  3E9P A;  1WGR A;  2GRI A;  3M63 B;  4EMO A;  2DX5 B;  3VRB B;  5G2N A;  2ON8 A;  3DVN V;  2OTX A;  2MBE A;  4PS3 A;  1CJE A;  4K2P A;  1D3Z A;  4B0E A;  1ZDX A;  4W9C A;  4GDL A;  3SUZ A;  3WAP A;  3Q14 C;  2N9P C;  1YJ1 A;  1EUV B;  1HE8 A;  1ISN A;  4M8M A;  2KFK A;  1FOE A;  4TV3 A;  3PV1 A;  2WXN A;  2SEB D;  3NS1 A;  2LVP A;  1KRH A;  3JVZ X;  3FLV A;  3RNE C;  2MJ3 A;  3NG0 A;  1XLQ A;  4HJK A;  1ZOY B;  3DBR B;  4FJY A;  3B2F A;  2Z0Q A;  3BWU D;  2RSG A;  3U30 A;  5KQ1 A;  1TT5 B;  1R4N I;  3ODW A;  2M14 A;  3C19 A;  2GBK A;  1U4A A;  2UU7 A;  1V5U A;  3ABV B;  4LNK A;  1LGR A;  5LXH A;  4E71 A;  4JWU C;  4LJO B;  1QLB B;  4J6I A;  2LG1 A;  4MGZ E;  3ZKJ C;  2KD0 A;  4IW0 A;  4XZ4 A;  3ZUN A;  3I57 A;  1L0V B;  4O1N A;  1Z87 A;  3ODX A;  2QIL A;  1KOT A;  5LOP B;  5C1Z A;  2GI9 A;  1JWM D;  4HAT B;  1W1G A;  4G3X B;  2W3R A;  1WJN A;  5MPO A;  3V6E B;  3L4P A;  5CLQ B;  1WGK A;  2W54 A;  2KWV B;  1ESF A;  5DPT A;  1U5G A;  2YEP F;  2JXT A;  3PLU A;  3WIM A;  1MPE A;  3FVC A;  1MIX A;  3VTW A;  3ML4 A;  2IDY A;  2LJ5 A;  3AI5 A;  3BVZ A;  2WXG A;  3Q8C A;  3RPF C;  2KDE B;  3URY A;  1GPX A;  2AX5 A;  1FRR A;  1FHO A;  3EA6 A;  3SDL C;  2J42 A;  4ZRK A;  3NW8 A;  2BQQ A;  3IXS A;  2K1F A;  2WXF A;  1W1D A;  4YSZ B;  4A3P A;  1WGG A;  1JRP A;  2DYN A;  1JWU D;  1Y19 B;  2BWF A;  2Z0P A;  2HJ1 A;  4DBG A;  3V3X A;  4IG7 B;  1M94 A;  2NMQ A;  2WHI A;  2K2J A;  2G4S A;  2JF5 A;  4WJN A;  4QAY A;  3PHW B;  2DYM A;  4MM3 B;  1IGC A;  5DPW A;  4HPM B;  2MJE A;  3ZJU A;  4EZJ A;  1L4Z B;  4ANX A;  2I5F A;  1DDW A;  1SB3 C;  2MP2 B;  5TSS A;  1L4D B;  1R4N B;  3SEB A;  2FCN A;  4D2K A;  1FEH A;  4F7U P;  3P63 A;  2EMS A;  1UWM A;  2K0P A;  3JW0 X;  3Q3M C;  2Y8F A;  4NQK E;  5J3Q A;  2DX5 A;  2WDV B;  4IC7 B;  2RDB C;  1KM7 A;  2PVG C;  4HWI B;  4GB9 A;  2WNM A;  2GBM A;  2JWZ A;  1X86 A;  1KF6 B;  1VCB A;  3GB1 A;  4KGR A;  4GMX B;  4K3C A;  1XR0 B;  2PE6 B;  4RGO S;  3KY9 A;  3TEZ A;  3C0R B;  2YF0 A;  1GC7 A;  2IO1 B;  2EC1 A;  5EFX A;  2WX0 A;  1TGZ B;  2H7E A;  1NU2 A;  2H89 B;  4OVZ A;  5IA7 A;  2Z14 A;  3N1Y C;  2K5P A;  1Q67 A;  1TTN A;  3NVY A;  1FIQ A;  2DHI A;  4W9I A;  4B0M A;  2BYE A;  1PGB A;  4MM3 A;  1LB1 A;  4OVV A;  1KTK A;  1C1Y B;  2KGX B;  4OW0 A;  1TJE A;  2NVU I;  4FA6 A;  1VBH A;  3NSU A;  1ACA A;  3UZT A;  4FHJ A;  2KQS A;  4JKE A;  1TJ6 A;  3WCQ A;  4JK7 A;  3QWZ B;  3RFZ B;  1D5Z C;  1UNP A;  2ZVO A;  3U8Z A;  2UZS A;  3FSS A;  2D2Q A;  2JUO A;  1FCC C;  1V81 A;  1UF0 A;  3LDZ E;  3MJ5 A;  1C77 A;  1V61 A;  1PGA A;  1I42 A;  1NTI A;  3PSC A;  4Q2J A;  1SGH A;  1WX9 A;  4N9F 4;  3V60 A;  4TMA B;  1UBQ A;  1V1P A;  3TVV A;  3DBH I;  2DIK A;  2AYO B;  4C7Z A;  1GUA B;  4LNO A;  4PS7 A;  1WYG A;  3JSV B;  1EWC A;  2J59 M;  1J0G A;  2AL6 A;  5D27 A;  4NNJ B;  3B08 A;  2KWC A;  3GE3 C;  2DZM A;  2LVQ A;  4YSY B;  3PZ8 A;  3W1Y A;  2P0H A;  5FR6 A;  4JKD A;  4DBB A;  3CIK A;  3D8E A;  2FCS A;  3N20 C;  1MPH A;  4XC2 A;  3SNH A;  3ZTC A;  1FXA A;  1DYN A;  4EE2 A;  3FAH A;  4M01 A;  4DXG A;  3EC8 A;  4W9G A;  1Z2M A;  2RR9 A;  1JW9 D;  4CQN A;  5J17 A;  1OEY A;  4LNI A;  2O2V A;  3GE8 C;  3PHX B;  1WGD A;  2ICI A;  5BMH A;  4XWW A;  3S2A A;  2JX5 A;  5EE3 A;  2K49 A;  1HEZ E;  5C2T B;  4CO7 A;  4NSW A;  1XEE A;  3ZJV A;  1B9R A;  1JDE A;  1PLS A;  1U5F A;  4KAX B;  1BAK A;  2BTE A;  4S0R A;  3AE8 B;  1ZXH A;  4BBK A;  3MFG A;  2WDT B;  3WAL A;  1WH3 A;  4PS8 A;  4H8S A;  1I4P A;  1SE3 A;  3N7C A;  1B55 A;  4WQM A;  3N3K B;  1C78 A;  2C7N B;  4NAW A;  5EE1 A;  4M00 A;  3U2S C;  1DRO A;  2LOZ A;  4US8 A;  1OQN A;  2I1K A;  3NS8 A;  2W2W A;  3HUI A;  1EO6 A;  5AUK A;  5L81 A;  4A6K A;  4I6P A;  4FXC A;  3W1S C;  4AQ7 A;  5GMV A;  4GIV A;  1UH6 A;  1WGH A;  2YT2 A;  3APD A;  4HPP A;  2KQ7 A;  3B9J A;  5T8I A;  2MBQ A;  3G9W A;  1RWS A;  1XLP A;  2CR5 A;  1V97 A;  3KUZ A;  2HRJ A;  4D0N B;  5EE0 A;  2VKI A;  3PO0 A;  2CRF A;  1P6S A;  1X05 A;  2CS4 A;  4DXF A;  2IPK D;  4M8N A;  2J52 A;  3VHT C;  2RPV A;  4HAV B;  4GU2 A;  2KX0 A;  1OMW A;  5DH9 B;  1WJ6 A;  4C4V B;  3PPA A;  4MT7 A;  1FD6 A;  3NZS A;  2Y5C A;  3V62 A;  1QOA A;  2NTS A;  2DHJ A;  2XN9 C;  4L6E A;  2XEW A;  4W9E A;  5BMI A;  2ZCC A;  2DKQ A;  1AW7 A;  1N61 A;  5LG4 B;  3P4R B;  1ZUD 2;  5FI1 A;  1HZ5 A;  1MK9 B;  1F2R I;  5CHF A;  2QSD A;  2W9N A;  3Q69 A;  1EF5 A;  4NY0 A;  4XDC A;  2O2V B;  4TSS A;  2KMA A;  3DBH B;  2R2Q A;  2BWE S;  2R2Y A;  3EPY A;  3E66 A;  4YWG G;  2N9L A;  2M0A A;  3B0A A;  4DXA B;  3PZD A;  4A6Q A;  2MKR A;  3HM3 A;  2WX1 A;  4L1B A;  3IVF A;  4B9K A;  4DX8 A;  4YT0 B;  1WJ4 A;  4FUL A;  3QK0 A;  2DLW A;  1V89 A;  3BYY B;  2K39 A;  3QJZ A;  2K25 A;  3EEC A;  2JY6 A;  2DHK A;  3FEH A;  2LRW A;  3VQI A;  3RNA C;  3KYC D;  2DX1 A;  5GOW B;  5FI0 A;  1UWX A;  1KLG D;  1V6E A;  2YEP B;  3TCA A;  4CYE A;  1QOG A;  2M8S A;  3P1M A;  3OG5 A;  5CX3 A;  5I4D A;  1MHH E;  2ZW1 A;  5D2M B;  3IT4 B;  1WZ0 A;  4WUR A;  3NZU A;  2KWU B;  2X18 A;  2L05 A;  2MJD A;  2VRR B;  2ZNV C;  4OHJ A;  3LYY A;  2L76 A;  2XBB C;  3ML8 A;  3IBE A;  3H7P B;  2N7D A;  2P0F A;  2EKI A;  2DHZ A;  3D8D A;  3KUD B;  3D8F A;  4DX9 0;  4GNK B;  2KUQ A;  5BYQ A;  3RZW C;  2KKC A;  4AS1 A;  1JML A;  2NBV A;  3Q8B A;  2IY1 B;  3VH3 B;  2O6V B;  2LZ6 A;  2KHW B;  3GS2 A;  2LI5 A;  1N60 A;  4ANW A;  3ZLZ A;  1V5M A;  2RUK B;  3RUI B;  2FBW B;  4FBJ B;  1YN3 A;  4RGM A;  3ZVV A;  2NCN A;  2DAJ A;  2BW2 A;  4HKQ A;  4NPN A;  3DCG A;  4CHK A;  1V88 A;  3NWF A;  1NYQ A;  2L3Z A;  3KZ1 A;  4CSQ A;  1HQR D;  4L23 A;  3AB5 A;  1ZM0 A;  1GB1 A;  3ZTD A;  5DI9 B;  2DN6 A;  1J7C A;  2D3B A;  3OAN A;  3T8M A;  1G6J A;  2CU1 A;  1ZW7 A;  1QKZ A;  4JWS C;  1ZYI A;  4ASW C;  2LGX A;  2IGH A;  2V3S A;  4C0A A;  2CHZ A;  4URK A;  1FGY A;  4HAZ B;  5BMG A;  1EF1 A;  1C76 A;  1TKE A;  2WXI A;  3MC8 A;  3FIL A;  2D3C A;  1Q1O A;  1U2B A;  1RJ2 A;  2V1Y A;  2DYB A;  3N32 A;  3P6A A;  4YSX B;  3AE5 B;  3PTF C;  3A9K A;  1WXM A;  3SBG A;  2ZKM X;  2DYO A;  4L2Y A;  2CY5 A;  3T3N A;  1H10 A;  2AQ2 B;  1A70 A;  4ZRI A;  3SFD B;  2G4D B;  4BKS D;  1JAL A;  4R3D A;  1XXG A;  1KC7 A;  2A5U A;  1M4V A;  4XE0 A;  2XNA C;  1V80 A;  3P2B A;  1ZE3 D;  4E3C A;  3NJT A;  4DIX A;  1T0R C;  1S3S G;  3ZW3 A;  1TY0 A;  3NUH B;  2FUG 1;  3EFC A;  1C4P A;  2WYQ A;  1E9M A;  4F7Z A;  3W9C B;  2L83 A;  1P7E A;  2DKP A;  1Y56 A;  3R2T A;  4JKA A;  2PE9 A;  1I4Q A;  4GDK B;  4ILG B;  4IKG A;  3TEX A;  3L17 A;  2CHW A;  2VH2 A;  1WGY A;  4MT5 A;  3GYO A;  2FE8 A;  2K3U A;  3BYT B;  4BKG A;  4MH0 E;  4KHB A;  1VRA B;  1E90 A;  2Y8G A;  1MI1 A;  2K22 A;  2KO3 A;  3VAW A;  5HFY A;  5D3D A;  3QHT A;  1FMA D;  2R09 A;  1VD2 A;  2CJN A;  2MDX A;  2N7J A;  1IP9 A;  1F2R C;  2DFK A;  1I4G A;  4C7Y A;  3I63 C;  2A4Z A;  3L0W B;  5AZG A;  4IDI A;  2M19 A;  4P6V F;  2H88 B;  4LTU A;  4KX6 B;  2D9X A;  5J2R A;  1F9J A;  3L16 A;  2DA0 A;  3E56 A;  2CQU A;  3KQ4 A;  4ACF A;  2PZ1 A;  1DYQ A;  2CU3 A;  2SAK A;  2MHJ A;  2HE7 A;  5JLJ B;  4GDK A;  1JCK B;  1DOY A;  4B95 A;  3DXC A;  4K2O A;  2EMT A;  1X1G A;  4PK1 A;  3OHM B;  2D11 A;  1U5D A;  4JKB A;  1ZGU B;  1WXS A;  2ZPY A;  3KW5 B;  2B76 B;  4XWT A;  1XQQ A;  4KIK B;  2QDF A;  1PUT A;  3CXB B;  3MTN B;  4NJC A;  1QC6 A;  2LFI A;  3RD2 A;  1X11 A;  1XO3 A;  1V5T A;  4YON A;  5E6P A;  4RM9 A;  2D4Q A;  1E6E B;  2LJI A;  3AE9 B;  2KN5 A;  2N9K A;  3F5R A;  4LLG M;  2LVO A;  2PMV A;  2RGN B;  3OAW A;  2NBV B;  1V49 A;  5JHG A;  4C00 A;  2I2Y A;  3AE6 B;  5BYR A;  5IOI A;  2WGS A;  2L1C A;  5C79 A;  2UYZ B;  1UGM A;  4W9L A;  4GN1 A;  1N6Z A;  3MC0 B;  1YOV B;  2LAS A;  2EKE C;  3CMM B;  4RMA A;  1NI3 A;  3IHP C;  4MSM B;  1DOI A;  2N9X A;  4LDT D;  3CSF A;  4LNN A;  2GS0 A;  2KWD A;  3CF6 E;  2DNF A;  3KLS X;  1WRI A;  2I38 A;  4G0N B;  4QJ5 B;  1SIF A;  1WFY A;  1D5M C;  1NI2 A;  1P0R A;  4ANV A;  2DZI A;  3ZNI D;  2BVC A;  3A9J A;  3RUL A;  4ZDV A;  2JZ3 B;  1BUI C;  5HE2 A;  5AUI A;  4KKI A;  3SHQ A;  4JPS A;  4IWP A;  4WWO A;  2GB1 A;  1V1O A;  2IYD B;  2N1W A;  3T06 A;  4KSK C;  2Z13 A;  2Z4D A;  2BB5 A;  4OSN A;  2KDF B;  3VFK A;  3VTU A;  4F1S A;  2DWQ A;  3DVG X;  4ICU A;  4P1B C;  1WZ3 A;  1Z5S B;  2BPS A;  2G45 B;  1WRD B;  3DPD A;  4BFR A;  2J0M A;  4B6H A;  2G9H D;  3ULB A;  5C6R A;  1GB4 A;  1ZXI A;  5HE3 A;  1WGQ A;  1LXD A;  3T9L A;  1JQ4 A;  3PEG A;  3P4P B;  4RFB A;  3HSA A;  4F7H A;  3A8P A;  2KVR A;  2Z0D B;  3N30 A;  4MSQ B;  1WE6 A;  2BGF A;  1LW3 A;  2P8V A;  4QJ3 B;  3J9C A;  2NMB A;  1L0Y B;  4TQ1 A;  1XF5 L;  5D3W A;  1PDX A;  4KDI C;  2E2X A;  4DK5 A;  5D3V A;  4KZC A;  3HRD D;  2JRI B;  5DPS A;  3L13 A;  2LD9 A;  1MHX A;  2E6X A;  2L00 B;  1IRS A;  5D3I B;  4OZC A;  1P3Q U;  4K7U A;  1VZ8 A;  2PIA A;  1J7A A;  2D9Z A;  2JZZ A;  4OZB A;  3VRA B;  4GSW A;  2KFK B;  2OHF A;  3UQA A;  4A6F A;  2G3Q B;  2DEN B;  1MI0 A;  5H8Y E;  4KHA A;  1T0Q C;  3A33 B;  5D6J B;  3W2D A;  3MPX A;  2KAJ A;  2IGG A;  5AZH A;  2D9V A;  5IN7 A;  2LUL A;  2UVM A;  2QEJ C;  2B3A A;  1MAI A;  2IND C;  1XCQ L;  2MEK A;  5AZF A;  2PJH A;  4HLE A;  1FFV A;  2L0F A;  2PVO D;  4FJV B;  1ZKH A;  4NAM A;  2FJU B;  1L7Y A;  5E6J A;  4D6W A;  5H92 C;  5DPR A;  2WH5 A;  1UPR A;  4NJ7 A;  3RNG C;  4ZRQ A;  4W9H A;  4IWQ A;  4NQL B;  1S1Q B;  2BYF A;  3AE7 B;  3H9D A;  1ZC3 B;  1JRU A;  1FXI A;  2BYT A;  5LLI A;  4A90 A;  1B1Z A;  1WE7 A;  2C7H A;  3C8Y A;  4HVB A;  1L6V A;  2MP2 A;  1E8W A;  4F7G A;  4USA A;  3JSV A;  2WDQ B;  2GOW A;  1XCG A;  3LXF A;  2GMI C;  4FLH A;  1EM7 A;  2DYQ A;  1RRP B;  4II3 B;  1DDV A;  2L2I A;  5JXV A;  4L1R A;  1BTN A;  2M17 A;  2DBY A;  1YJI A;  1YQ3 B;  2YS3 A;  1I7A A;  1RM6 C;  1F1H A;  2LGI A;  3O65 B;  4ILH A;  5DCN A;  5KCV A;  4JLC A;  1WI0 A;  4NAW B;  3X0W A;  1HZ6 A;  2KTF A;  3RNC C;  3LJ3 A;  2LBB A;  4M02 A;  3WA0 A;  3K9P B;  5KHQ A;  4FJZ A;  1WMH A;  3AEC B;  1MG4 A;  4FAD A;  2BS3 B;  4IFS A;  2GBR A;  5C5B A;  2W2X C;  5KQ4 A;  1V8C A;  1XD3 B;  2ZEQ A;  3RN9 C;  2VH1 A;  1ET9 A;  1OTR B;  3VVW B;  3Q3N C;  2L52 A;  3AE4 B;  4WJ7 A;  3TUO A;  3B77 A;  1WF9 A;  4HAY B;  2GBJ A;  3M1I B;  1E7U A;  2KJH B;  3VDZ A;  2KDB A;  4N58 A;  3ZNG C;  1E8X A;  3UIO B;  1GG3 A;  1QOB A;  1W1H A;  3R8B A;  1SE2 A;  3GOE A;  3VUY A;  2R61 A;  2MRP A;  4YL8 A;  3HVZ A;  3P4Q B;  2FUH B;  3ML9 A;  3ODO A;  3KH0 A;  1DDM A;  3HVD A;  4AJY B;  2ZW0 A;  1HBK A;  5J3Y A;  2TSS A;  1TZO A;  1T6B X;  3UIP B;  1HXY D;  3WAO A;  4BVU C;  1XLO A;  2DAF A;  2N9E B;  2NPT B;  1VLB A;  4DQO C;  2PTL A;  5IP4 D;  2V4L A;  4HAX B;  1N5W A;  3NRZ A;  1QZE A;  3UIN B;  1C9F A;  2KLG A;  2LEK A;  2PKO A;  4I6N B;  2QC8 A;  1FPY A;  2BBC A;  2FNJ B;  4HEA 1;  4ZHP A;  5E6N A;  3UF8 A;  4KSL C;  2KIE A;  3A8Q A;  5L83 A;  3DBL B;  3PVW A;  3OWE B;  1DIK A;  2LHE A;  3BJI A;  3VTV A;  3PRZ A;  2JYE A;  3A9K B;  3ZXR A;  1FGZ A;  3VUX A;  2WS3 B;  1LM8 B;  1NBF C;  5FK9 C;  3MDB C;  2RDH A;  2ZZP B;  4BBN C;  4OZA A;  4HCP B;  2MCN B;  5D94 A;  3HQC A;  1P7F A;  4K3B A;  4ARI A;  3A1Q A;  2IO3 B;  1P9D U;  2MX2 A;  4FHK A;  4XYC A;  3FKY A;  5J3T A;  1I2H A;  1AN8 A;  5DHA B;  3APC A;  2W2X D;  2YT1 A;  2GBN A;  4MJS B;  4LNF A;  2KIG A;  4MEM A;  3UGB B;  5IJM A;  3M62 B;  2K8C A;  1XKE A;  1FAO A;  2ZNV B;  1SBB B;  2KLC A;  1M7R A;  3UQB A;  2N4F A;  1ZVR A;  2X38 A;  5HG2 A;  4PYZ A;  2YRY A;  4KHB B;  2MWS B;  3PRP B;  3EHV A;  1J19 A;  3NVW A;  2K8E A;  2Z59 A;  2HTM E;  4AWJ A;  1KLV A;  3NWD A;  3AEF B;  4OT1 A;  2BS2 B;  3DHH C;  4QJ4 B;  2KJR A;  4A55 A;  1NYR A;  3MP9 A;  4JIO U;  1QF6 A;  3ZO5 B;  2XK5 A;  4HB3 B;  3ENB A;  2V0G A;  1L0X B;  1JWS D;  2GCL A;  2FID A;  4K81 A;  2WLB A;  1LQB A;  2INC C;  3U52 E;  1OY2 A;  1OGW A;  1U29 A;  3UI3 A;  3RZF A;  2YS1 A;  2FJ9 A;  4HAW B;  4IOI E;  2LXA A;  5JVL A;  2YLM A;  1FFU A;  2Q5W D;  3AUL A;  1HTQ A;  1KI1 B;  5GXG B;  3ECI A;  3E9L A;  4G11 A;  4S17 A;  1DOX A;  2OOB B;  3O13 A;  2IO2 B;  2KTR B;  2WQY B;  1YX6 B;  4RH6 A;  3DHG C;  1EGX A;  2JU6 X;  1RAX A;  4W9K A;  3KVF B;  4EZK A;  4WWM A;  4II2 B;  2QHO A;  1IYF A;  3DBL I;  1HB8 A;  1OQR A;  1BXT A;  3A58 A;  2D9W A;  2RLO A;  2FCM A;  3DXE A;  2BF8 B;  3RYT A;  1C3T A;  3ZDT A;  3GZN I;  4HB4 B;  2JRH A;  3PGE A;  3R2I A;  1ENF A;  3BIN A;  3ZVR A;  4P1C C;  3K9O B;  1R4M B;  4HPL B;  1BWN A;  1CK1 A;  1NEK B;  4RNA A;  3A4S C;  1P1A A;  1Y5O A;  2LOX A;  3A1Q B;  1K53 A;  1QT9 A;  1L5P A;  2CHX A;  2M4N A;  2UZR A;  3TIX A;  1F52 A;  2M0X A;  2Z59 B;  4W9D A;  3MHS D;  3NOB A;  5D3Y A;  2C60 A;  4GOC A;  1PFD A;  3TJP A;  1EU3 A;  3WAM A;  3P7Z A;  1YN5 A;  4MGY E;  2LWP A;  3RMK C;  3DCX A;  2MW5 A;  4A6F B;  4W9F A;  1L2N A;  5JZE B;  2GUM A;  1YJJ A;  2ZVN A;  5JHB A;  1J0W A;  4GPT B;  4YTM B;  4AUQ C;  4ITK A;  3QCA A;  1TY2 A;  3QQ8 B;  4IM0 A;  4BZA A;  3FIL B;  1PQS A;  2QCZ A;  4K1R B;  4N59 A;  2K2U A;  2L7R A;  3Q8E A;  2UWQ A;  2KTR A;  4YTN B;  3VUW A;  2REX A;  2QJL A;  5TR5 A;  3RCZ A;  2DTC A;  1HA5 A;  1MFW A;  2CKH B;  1IBX B;  2BYV E;  2D5G A;  4WJQ A;  3LB8 C;  3CWI A;  4BKS A;  4X57 B;  4QXA B;  3TEY A;  2N23 A;  3KRW A;  2PW9 A;  2ACZ B;  3ZDM C;  2HDE A;  3AE2 B;  4GDL B;  1UPQ A;  1TS3 A;  1X1M A;  3ZNH B;  4HKZ E;  1GOZ A;  2MQJ A;  2CY4 A;  4ZYN A;  3AU4 A;  5EDS A;  1K52 A;  1AQC A;  4A9A A;  3PT2 B;  1TBE A;  2INN E;  2Y5B B;  2WP9 B;  3RI7 C;  1U5E A;  2O6V A;  1E10 A;  2MBB B;  4P16 A;  1YX5 B;  3Q8F A;  1UGJ A;  4KIK A;  1LFD A;  2NZ8 B;  1FB8 A;  2V76 A;  4HRO A;  5C5B B;  2MBO A;  4GGQ A;  3NY5 A;  3KWL A;  1WXV A;  2VSZ A;  3SBT A;  4JKF A;  2GLS A;  4NJ6 A;  4E74 A;  5CLL B;  2AQ1 B;  2J4X A;  2WXP A;  3GZN B;  4RGT A;  4AP4 C;  5HHD G;  2N0Y A;  2KN4 A;  1P98 A;  2WXO A;  2KDI A;  1ZP0 B;  3PG7 A;  2ONQ A;  3X23 A;  4LK0 M;  5IRS A;  1JRO A;  3PSE B;  2COP A;  3MC9 A;  1SE9 A;  1E8Y A;  2COD A;  2V9H A;  1WXA A;  2P0D A;  2KUP A;  1QIL A;  3L08 A;  3QAQ A;  1HTO A;  5HKH A;  1UD7 A;  4MH8 A;  1AWD A;  1EWY C;  1WJM A;  3QX1 A;  1UNR A;  1KLU D;  1FNW A;  2R0D A;  3RT3 B;  1VBG A;  4M0W A;  2Z0E B;  1DGJ A;  3N1Z C;  2LYD A;  1FCL A;  3ZJT A;  2D3G A;  1KH0 A;  1A5R A;  2N7E A;  3H8H A;  2BCJ A;  1GJZ A;  2K8B A;  4HHV A;  3SD5 A;  3Q2A C;  1STE A;  2RQ1 A;  3IT6 B;  1E5W A;  1MVK A;  1K50 A;  1TKY A;  4ICV A;  3V6C B;  1FRD A;  2QKL A;  3HHM A;  2VRW B;  4JQW C;  4PQ0 A;  3TW1 A;  1XOD A;  4RGN A;  1WX8 A;  3A4R A;  2JP2 A;  1R4M I;  2W82 A;  5AEK B;  1UEL A;  4XX5 A;  3ZYY X;  4JL9 A;  3WYF B;  4HDQ A;  4WWN A;  3HIZ A;  2ASQ A;  1NVI D;  2AEH A;  2RMM A;  3DBR I;  1OQQ A;  3PZ7 A;  2FJL A;  2J53 A;  2PPH A;  5CHV C;  2RGF A;  3NWA A;  2K8H A;  4EFO A;  3KSY A;  2D10 A;  2QMT A;  4YTP B;  3ZIM A;  1P5T A;  3FM8 C;  1ROE A;  3ONS A;  1CQV A;  1J7B A;  1N62 A;  1QQR A;  4TUU A;  1WY8 A;  3AN1 A;  2W55 A;  4M0W B;  1PGX A;  2BKR B;  1WJ1 A;  3ZRC A;  2AQ3 B;  3Q3J A;  3Q6B A;  1YMH E;  4C56 C;  2BKF A;  2HTH A;  4HRS A;  1TQZ A;  3GP7 A;  2N0S B;  4IAP A;  2KNB A;  1RYJ A;  1JWB D;  1N3H A;  2KFJ A;  1ZDV A;  4JKC A;  5C23 A;  2PEA A;  2ROZ B;  4K7S A;  2IJ0 A;  4ANU A;  3W5U B;  3AEB B;  1PMS A;  1YQ4 B;  3Q3F A;  4TYZ A;  2KCJ A;  3ALB A;  4KKJ A;  2COA A;  1FNU A;  3IG3 A;  2INP E;  2JSV X;  2GCJ A;  3FC4 A;  4PT5 A;  4XDD A;  1WIA A;  4UDU C;  1KZG A;  4MGI E;  2OJR A;  5JHH A;  4J3O D;  2Y3A A;  1QOF A;  2V4I B;  3CIR B;  1OQY A;  4EZL A;  3BII D;  2WXL A;  4HCN B;  4JX1 C;  4K7W A;  1L6U A;  3PS6 A;  1ZC4 B;  3EUB 2;  4G50 A;  3AXC A;  2NR2 A;  2Y7B A;  3TEW A;  4DWF A;  2COF A;  2CB8 A;  4KZ0 A;  2K9X A;  4N6E B;  5LON B;  4B6W A;  2L32 A;  4F8C B;  2NBU A;  2WU5 B;  3QIJ A;  4MEL A;  1UZX B;  3EGR A;  2W3S A;  1V2Y A;  3W5V B;  4C80 A;  3AED B;  3OJ4 B;  3PVU A;  2AWT A;  3BY4 B;  4REZ A;  3HIE A;  1SSN A;  4MGK E;  2D9Y A;  1I4X A;  2ZJD A;  3E9O A;  2J0K A;  1TS5 A;  3U12 A;  4GXB A;  1K8R B;  4H2A A;  1V5O A;  4YXD B;  2KR0 A;  3QA8 A;  1UBI A;  4KVG B;  3BZD B;  4HJG E;  3V61 A;  2NTT A;  1TXD A;  2WWZ A;  4OVU A;  4WJO A;  1P3R A;  2MH7 A;  5C3J B;  4C4V A;  4BKT A;  4JKG B;  3N1X C;  1C79 A;  2KXJ A;  3T3O A;  1V86 A;  5G5H A;  4MAC A;  3AU5 A;  3NVZ A;  5D3X A;  2QIE B;  1SHC A;  4HXD A;  2V3P A;  1YD8 U;  2JT4 B;  2LHD A;  2VZK B;  2C5L C;  2RPQ A;  1SXT A;  1VZ6 A;  1Q10 A;  3DDC B;  3V5W A;  2KQ4 X;  4WAF A;  1F0Z A;  1F77 A;  3BVG A;  1T5X D;  3B2G A;  2KVZ A;  4DHJ B;  2IGD A;  3AV8 A;  4IWO A;  2COC A;  5I2S A;  1WXQ A;  2M1M A;  3AEE B;  2WXJ A;  3ENE A;  2HJ8 A;  2KOX A;  4JE3 B;  1NVL A;  3WAN A;  2MFQ A;  4HB2 B;  4CHJ A;  1RFK A;  3KYD D;  1AYF A;  4ZOH C;  3ZRF A;  3CST A;  3TSS A;  4XGA B;  1RLF A;  2KX3 A;  1H8C A;  1LO5 D;  2LUE A;  4EJN A;  2G1E A;  2N1V A;  2R2O A;  3PP2 A;  4GZU A;  4ZRJ A;  2YVC A;  3AMZ A;  4EEW A;  3VH4 B;  3ZGZ A;  1MG8 A;  3H1U A;  1TIF A;  2Z0O A;  4WSF A;  2DLB A;  1U27 A;  4JGH B;  2KDM A;  2O6V D;  2YS5 A;  1TKG A;  3BK2 A;  5KHO A;  2LGD A;  4RF0 A;  3ZQ4 A;  4A5K A;  3AEA B;  1FO4 A;  3E9S A;  2JVC A;  1E7P B;  1MIZ B;  3D32 A;  4EUT A;  2H7D A;  2IY0 B;  2L0T A;  1Q0W B;  1SE4 A;  2J7Q B;  5D7G A;  2ABD A;  2JPH A;  2M38 A;  1XLN A;  2RDG A;  2IFS A;  2ELA A;  2I5C A;  3DBS A;  2IZV B;  4A8X C;  1WJU A;  2Q13 A;  1SF0 A;  4JKG A;  1ZSQ A;  1OEY J;  1WX7 A;  1E7V A;  1WYW B;  1YNT E;  3BK1 A;  4ZHO A;  3JYU A;  3NVV A;  5CTR C;  2X8X X;  4DHJ D;  2RVB B;  2KK8 A;  1EU4 A;  5JP4 A;  4AJW A;  5DHF B;  2L1A A;  1IPG A;  1UUP A;  3AJ4 A;  1FHW A;  3PRM B;  2HD5 B;  3FP5 A;  2JXX A;  1R7S A;  2MA9 B;  3L10 B;  1NTY A;  1WVH A;  2J0J A;  3IAS 1;  1H4R A;  3I9V 1;  2KJ6 A;  2BS4 B;  4DDG D;  1V1P B;  3TMP B;  1C4C A;  5FR3 A;  4P7I A;  2LGS A;  2K6D B;  4IOY X;  4BBN F;  3M3J A;  4PNK A;  1T77 A;  2GJY A;  1WWT A;  4RM8 A;  1M7E A;  3SFE B;  4GOU A;  3DWM A;  3U7Z A;  1ZPS A;  1GGO A;  3TL5 A;  3O96 A;  1FM0 D;  2PLP A;  1VJK A;  3SYX A;  5EE9 A;  2CAY A;  3P4S B;  5JHA A;  1ET6 A;  2ZCB A;  5IO9 A;  3L54 A;  4ZRP A;  5E6O A;  3OLM D;  5M4Y B;  1GC6 A;  4MK0 A;  2DZJ A;  2RSU A;  2WXM A;  3DOW A;  2NS5 A;  1YQB A;  1RRB A;  1T0S C;  1SIJ A;  1I4H A;  2IBI B;  1KJT A;  3TBL D;  3W1S A;  3PVL A;  3R3M A;  5HE0 A;  3R7Q A;  1I4R A;  1VZ7 A;  3GYP A;  2X0S A;  3SR6 A;  2DZK A;  4Z2N A;  1BTK A;  1VDV A;  2MBH A;  5JH5 C;  3HM6 X;  2EJ8 A;  5IKC M;  2BB6 A;  1UNQ A;  3U4E G;  3DQV A;  1UEF A;  2FAZ A;  3PRE A;  1N63 A;  2I1J A;  3N9Y C;  4MY6 A;  2KAC A;  4RF1 A;  1NEN B;  1VR9 A;  3H7P A;  3ULC A;  2ELB A;  1WSP A;  1Y8R C;  4WQO B;  1FHX A;  4IM2 A;  4HDO A;  4MJS A;  3H6N A;  1GNU A;  3Q8A A;  2AL3 A;  2LKO A;  2E3T A;  4TKN A;  2LUM A;  1V9J A;  3QAR A;  4EOY A;  1FNV A;  4KGS A;  3VR9 B;  3DVG Y;  3AE1 B;  2OED A;  1FXT B;  5DIF B;  2KMM A;  4W9J A;  4Y94 A;  1E0Z A;  1D6E C;  1PFJ A;  2Y5P A;  2KT7 A;  3APF A;  3M95 A;  3DHI C;  1PYW D;  1TS4 A;  4FN2 A;  4HB0 B;  1BT0 A;  1T0Y A;  2EEL A;  3R7R A;  3EFU A;  3SU8 X;  3SV1 A;  3I3T B;  3AE3 B;  4JK9 A;  1MJD A;  3AM9 A;  2MLB A;  3A9J B;  2KC1 A;  1YN4 A;  1D5X C;  4WAA A;  1EAZ A;  2RNR B;  2M56 B;  2D3A A;  4GMV A;  3LJU X;  1SEB D;  2KC2 A;  4EKU A;  2ADZ A;  4KV2 A;  3IAM 1;  4WWP A;  2KYW A;  4HAU B;  2WU2 B;  2D07 B;  3QC8 B;  4JK8 A;  3A98 B;  5IAA C;  1RFA A;  4HSI A;  2WXQ A;  2JWU A;  5L95 C;  3I5J C;  2G35 A;  4DHZ B;  1E8Z A;  4BOZ B;  1AWE A;  1CZP A;  1EVH A;  5C16 A;  2JYT A;  4PYU A;  4Z2M B;  2JQR B;  5LXI B;  2LXC A;  4AOF A;  1IGD A;  5HE1 A;  2NBW B;  3R66 C;  3VR8 B;  2FIF A;  3AEG B;  3NHE B;  3B1L X;  4KGT A;  1WR1 A;  2FDQ A;  1QQG A;  3HW2 B;  2LGY A;  1KFY B;  1AAR A;  3DVN U;  3OJ3 A;  2IO0 B;  4I6L B;  5J18 A;  1WG7 A;  1DBH A;  2WDR B;  5HI1 A;  3TFM A;  4ILJ A;  5CHW A; 
#chains in the Genus database with same CATH homology
 3MJW A;  4A20 A;  1YIW A;  2XK5 B;  1MK7 B;  4A3O A;  1CMX B;  1KBL A;  3PLV A;  3U7D A;  4HK2 A;  4WJP A;  2ROV A;  3SO6 A;  4KDL B;  1XX0 A;  3ZNZ B;  4JKH A;  4K17 A;  1ST7 A;  1KZ7 A;  1NDD A;  4BOS C;  1WI1 A;  1WR6 E;  1HB6 A;  3HK0 A;  1TZ1 A;  1Q5W B;  3DXD A;  2LRU A;  2RD0 A;  3VOQ A;  2K00 A;  4DDI D;  3QBV B;  4DHZ E;  1X1F A;  4XWX A;  4KHO A;  1WMH B;  2R82 A;  3VXW A;  1NTV A;  2MSE D;  4LJP B;  2OQB A;  2FCQ A;  2NPT A;  3IFW B;  2XQN M;  2QKM A;  4A6H A;  5G55 A;  2KAN A;  1J8C A;  4WVF B;  3RCP A;  3F0W A;  2KMC A;  4MDK E;  1WM3 A;  1WGU A;  2C9W B;  2HTH B;  3KUC B;  4IUM B;  4CHM A;  1WM2 A;  4LDT B;  2YT0 A;  3VIA A;  2KZR A;  3TO1 A;  3QWM A;  1XD4 A;  2C7M B;  2MWN B;  4LCD E;  2L8J A;  5BO4 B;  1XT9 B;  2ZPN A;  3H7S A;  2YSZ A;  2IYB A;  1MKE A;  2K6Q A;  4IM3 A;  3KRX A;  1K5D B;  1I35 A;  1K5G B;  4TQ0 A;  1V5P A;  3E9P A;  1WGR A;  3M63 B;  4EMO A;  2DX5 B;  5G2N A;  3DVN V;  2OTX A;  2MBE A;  4PS3 A;  4K2P A;  1D3Z A;  4W9C A;  4GDL A;  3WAP A;  3SUZ A;  2N9P C;  1YJ1 A;  1EUV B;  1HE8 A;  1ISN A;  4M8M A;  2KFK A;  1FOE A;  4TV3 A;  3PV1 A;  2LVP A;  3JVZ X;  3FLV A;  4HJK A;  4FJY A;  2Z0Q A;  2RSG A;  3U30 A;  5KQ1 A;  1R4N I;  3ODW A;  2M14 A;  2GBK A;  1U4A A;  1V5U A;  5LXH A;  4E71 A;  4LJO B;  4J6I A;  2LG1 A;  4MGZ E;  3ZKJ C;  2KD0 A;  4IW0 A;  4XZ4 A;  3ZUN A;  1Z87 A;  3ODX A;  1KOT A;  5LOP B;  5C1Z A;  4HAT B;  1W1G A;  4G3X B;  1WJN A;  3V6E B;  5CLQ B;  2KWV B;  5DPT A;  1U5G A;  3PLU A;  3WIM A;  1MIX A;  3VTW A;  3ML4 A;  2LJ5 A;  3AI5 A;  2KDE B;  1FHO A;  3SDL C;  4ZRK A;  2K1F A;  1W1D A;  4A3P A;  1WGG A;  2DYN A;  1Y19 B;  2BWF A;  2Z0P A;  4DBG A;  4IG7 B;  1M94 A;  2K2J A;  2G4S A;  2JF5 A;  4WJN A;  3PHW B;  2DYM A;  5DPW A;  4HPM B;  4EZJ A;  4ANX A;  2I5F A;  1DDW A;  2MP2 B;  2FCN A;  4F7U P;  2EMS A;  3JW0 X;  2Y8F A;  4NQK E;  5J3Q A;  2DX5 A;  4IC7 B;  1KM7 A;  4HWI B;  4GB9 A;  2GBM A;  2JWZ A;  1X86 A;  1VCB A;  4GMX B;  1XR0 B;  2PE6 B;  3KY9 A;  3C0R B;  2YF0 A;  1GC7 A;  2IO1 B;  2EC1 A;  5EFX A;  2WX0 A;  1TGZ B;  2H7E A;  1NU2 A;  5IA7 A;  1Q67 A;  1TTN A;  2DHI A;  4W9I A;  2BYE A;  4MM3 A;  1LB1 A;  4OVV A;  1C1Y B;  2KGX B;  2NVU I;  4FA6 A;  1VBH A;  3NSU A;  1ACA A;  3UZT A;  4FHJ A;  2KQS A;  4JKE A;  1TJ6 A;  4JK7 A;  3QWZ B;  1UNP A;  2ZVO A;  3U8Z A;  2UZS A;  3FSS A;  2D2Q A;  2JUO A;  1V81 A;  3LDZ E;  1V61 A;  1I42 A;  1NTI A;  3PSC A;  1SGH A;  1WX9 A;  4N9F 4;  3V60 A;  1UBQ A;  3TVV A;  3DBH I;  2DIK A;  2AYO B;  1GUA B;  4PS7 A;  3JSV B;  2J59 M;  1J0G A;  2AL6 A;  5D27 A;  4NNJ B;  3B08 A;  2KWC A;  2DZM A;  2LVQ A;  3W1Y A;  2P0H A;  5FR6 A;  4JKD A;  4DBB A;  3CIK A;  3D8E A;  2FCS A;  1MPH A;  4XC2 A;  3SNH A;  3ZTC A;  1DYN A;  3EC8 A;  4W9G A;  1Z2M A;  2RR9 A;  5J17 A;  1OEY A;  2O2V A;  3PHX B;  1WGD A;  3S2A A;  4CO7 A;  4NSW A;  1JDE A;  1PLS A;  1U5F A;  4KAX B;  1BAK A;  4BBK A;  2WDT B;  3WAL A;  1WH3 A;  4PS8 A;  4H8S A;  3N7C A;  1B55 A;  3N3K B;  2C7N B;  4NAW A;  1DRO A;  2LOZ A;  1OQN A;  2I1K A;  3NS8 A;  2W2W A;  1EO6 A;  5L81 A;  4A6K A;  4I6P A;  3W1S C;  5GMV A;  4GIV A;  1UH6 A;  1WGH A;  3APD A;  2KQ7 A;  2MBQ A;  3G9W A;  2CR5 A;  3KUZ A;  2HRJ A;  4D0N B;  2VKI A;  2CRF A;  1P6S A;  1X05 A;  2CS4 A;  4M8N A;  3VHT C;  4HAV B;  4GU2 A;  2KX0 A;  1OMW A;  5DH9 B;  1WJ6 A;  3PPA A;  4MT7 A;  3NZS A;  3V62 A;  2DHJ A;  4L6E A;  2XEW A;  4W9E A;  2ZCC A;  2DKQ A;  5FI1 A;  1MK9 B;  5CHF A;  2W9N A;  1EF5 A;  4NY0 A;  2O2V B;  2KMA A;  2R2Q A;  2BWE S;  3EPY A;  3E66 A;  3B0A A;  4DXA B;  3PZD A;  2MKR A;  3HM3 A;  2WX1 A;  3IVF A;  4B9K A;  4DX8 A;  1WJ4 A;  4FUL A;  3QK0 A;  2DLW A;  1V89 A;  2K39 A;  3QJZ A;  2K25 A;  3EEC A;  2JY6 A;  2DHK A;  3FEH A;  2LRW A;  3VQI A;  3KYC D;  2DX1 A;  5GOW B;  5FI0 A;  1V6E A;  3TCA A;  4CYE A;  2M8S A;  5CX3 A;  5D2M B;  1WZ0 A;  3NZU A;  2KWU B;  2X18 A;  2L05 A;  2VRR B;  2ZNV C;  2L76 A;  2XBB C;  3ML8 A;  3IBE A;  3H7P B;  2N7D A;  2P0F A;  2DHZ A;  3D8D A;  3KUD B;  3D8F A;  4DX9 0;  3RZW C;  2KKC A;  2IY1 B;  3VH3 B;  2O6V B;  2LZ6 A;  2KHW B;  2LI5 A;  4ANW A;  3ZLZ A;  1V5M A;  2RUK B;  3RUI B;  4FBJ B;  3ZVV A;  2NCN A;  2DAJ A;  4NPN A;  3DCG A;  4CHK A;  1V88 A;  2L3Z A;  3KZ1 A;  1ZM0 A;  3ZTD A;  5DI9 B;  2DN6 A;  3OAN A;  3T8M A;  1G6J A;  2CU1 A;  1ZW7 A;  4ASW C;  2LGX A;  2V3S A;  4C0A A;  2CHZ A;  4URK A;  1FGY A;  4HAZ B;  1EF1 A;  1Q1O A;  1U2B A;  1RJ2 A;  2V1Y A;  2DYB A;  3N32 A;  3P6A A;  3PTF C;  3A9K A;  1WXM A;  3SBG A;  2DYO A;  2CY5 A;  1H10 A;  4ZRI A;  2G4D B;  4BKS D;  1KC7 A;  2A5U A;  1V80 A;  3P2B A;  4E3C A;  1S3S G;  3ZW3 A;  2WYQ A;  4F7Z A;  2DKP A;  4JKA A;  2PE9 A;  4GDK B;  4ILG B;  3L17 A;  2CHW A;  1WGY A;  3GYO A;  4BKG A;  4MH0 E;  1E90 A;  2Y8G A;  2KO3 A;  3VAW A;  3QHT A;  2R09 A;  1VD2 A;  1IP9 A;  2MDX A;  2DFK A;  2A4Z A;  3L0W B;  5AZG A;  2D9X A;  5J2R A;  1F9J A;  3L16 A;  2DA0 A;  2CQU A;  2PZ1 A;  2HE7 A;  5JLJ B;  4GDK A;  4B95 A;  3DXC A;  4K2O A;  2EMT A;  1X1G A;  2D11 A;  1U5D A;  4JKB A;  1ZGU B;  1WXS A;  2ZPY A;  3KW5 B;  1XQQ A;  4KIK B;  3CXB B;  3MTN B;  1QC6 A;  3RD2 A;  1X11 A;  1V5T A;  4YON A;  5E6P A;  4RM9 A;  2D4Q A;  2KN5 A;  3F5R A;  2LVO A;  2RGN B;  3OAW A;  2NBV B;  1V49 A;  5JHG A;  2L1C A;  5C79 A;  2UYZ B;  1UGM A;  4W9L A;  4GN1 A;  2LAS A;  2EKE C;  3CMM B;  4RMA A;  3IHP C;  4MSM B;  2N9X A;  4LDT D;  3CSF A;  2GS0 A;  3CF6 E;  4G0N B;  1SIF A;  1WFY A;  1NI2 A;  1P0R A;  4ANV A;  2DZI A;  3ZNI D;  3A9J A;  3RUL A;  4ZDV A;  2JZ3 B;  5HE2 A;  3SHQ A;  4IWP A;  4WWO A;  2IYD B;  2N1W A;  3T06 A;  4KSK C;  2KDF B;  3VFK A;  3VTU A;  4F1S A;  3DVG X;  4ICU A;  1WZ3 A;  1Z5S B;  2BPS A;  2G45 B;  1WRD B;  3DPD A;  4BFR A;  2J0M A;  4B6H A;  3ULB A;  5C6R A;  5HE3 A;  1WGQ A;  1LXD A;  3T9L A;  3PEG A;  4F7H A;  3A8P A;  2KVR A;  2Z0D B;  3N30 A;  4MSQ B;  1WE6 A;  2BGF A;  1LW3 A;  2P8V A;  2NMB A;  4TQ1 A;  5D3W A;  4KDI C;  2E2X A;  4DK5 A;  5D3V A;  4KZC A;  2JRI B;  5DPS A;  3L13 A;  2LD9 A;  2L00 B;  1IRS A;  1P3Q U;  4K7U A;  2D9Z A;  2JZZ A;  4GSW A;  2KFK B;  3UQA A;  4A6F A;  2G3Q B;  2DEN B;  4KHA A;  3A33 B;  5D6J B;  3MPX A;  5AZH A;  2D9V A;  2LUL A;  2UVM A;  2B3A A;  1MAI A;  4HLE A;  5AZF A;  2PJH A;  2L0F A;  4FJV B;  1ZKH A;  1L7Y A;  5DPR A;  2WH5 A;  1UPR A;  4NJ7 A;  4W9H A;  4IWQ A;  4NQL B;  1S1Q B;  2BYF A;  3H9D A;  1ZC3 B;  1JRU A;  5LLI A;  1WE7 A;  2C7H A;  4HVB A;  2MP2 A;  1E8W A;  4F7G A;  3JSV A;  2GOW A;  1XCG A;  2GMI C;  4FLH A;  2DYQ A;  1RRP B;  4II3 B;  1DDV A;  2L2I A;  1BTN A;  2M17 A;  2YS3 A;  1I7A A;  3O65 B;  4ILH A;  5DCN A;  5KCV A;  4JLC A;  1WI0 A;  4NAW B;  3X0W A;  2KTF A;  3LJ3 A;  2LBB A;  3WA0 A;  3K9P B;  5KHQ A;  4FJZ A;  1WMH A;  4FAD A;  4IFS A;  2GBR A;  5C5B A;  2W2X C;  5KQ4 A;  1XD3 B;  2ZEQ A;  1OTR B;  3VVW B;  4WJ7 A;  1WF9 A;  4HAY B;  2GBJ A;  3M1I B;  1E7U A;  2KJH B;  3VDZ A;  2KDB A;  3ZNG C;  1E8X A;  3UIO B;  1GG3 A;  1W1H A;  3GOE A;  3VUY A;  2MRP A;  4YL8 A;  2FUH B;  3ML9 A;  3ODO A;  3KH0 A;  1DDM A;  4AJY B;  1HBK A;  5J3Y A;  3UIP B;  3WAO A;  4BVU C;  2DAF A;  2N9E B;  2NPT B;  2V4L A;  4HAX B;  1QZE A;  3UIN B;  2KLG A;  4I6N B;  2FNJ B;  5E6N A;  3UF8 A;  4KSL C;  3A8Q A;  5L83 A;  3PVW A;  1DIK A;  3BJI A;  3VTV A;  3PRZ A;  3A9K B;  1FGZ A;  3VUX A;  1LM8 B;  1NBF C;  3MDB C;  2ZZP B;  4BBN C;  4HCP B;  2MCN B;  5D94 A;  3HQC A;  3A1Q A;  2IO3 B;  1P9D U;  2MX2 A;  4FHK A;  5J3T A;  1I2H A;  5DHA B;  3APC A;  2W2X D;  2YT1 A;  2GBN A;  4MJS B;  4MEM A;  3UGB B;  5IJM A;  3M62 B;  2K8C A;  1XKE A;  1FAO A;  2ZNV B;  2KLC A;  1M7R A;  3UQB A;  2N4F A;  1ZVR A;  4PYZ A;  2YRY A;  4KHB B;  2MWS B;  3PRP B;  3EHV A;  1J19 A;  4AWJ A;  1KLV A;  2KJR A;  4JIO U;  3ZO5 B;  2XK5 A;  4HB3 B;  3ENB A;  2GCL A;  2FID A;  4K81 A;  1LQB A;  1OY2 A;  1OGW A;  1U29 A;  3RZF A;  2YS1 A;  2FJ9 A;  4HAW B;  2LXA A;  5JVL A;  2YLM A;  3AUL A;  1KI1 B;  3ECI A;  3E9L A;  4G11 A;  2OOB B;  2IO2 B;  2KTR B;  1YX6 B;  1EGX A;  1RAX A;  4W9K A;  3KVF B;  4EZK A;  4II2 B;  2QHO A;  1IYF A;  3DBL I;  1HB8 A;  2D9W A;  2RLO A;  2FCM A;  3DXE A;  2BF8 B;  3RYT A;  1C3T A;  3ZDT A;  3GZN I;  4HB4 B;  2JRH A;  3PGE A;  3BIN A;  3ZVR A;  3K9O B;  4HPL B;  1BWN A;  3A4S C;  1P1A A;  1Y5O A;  2LOX A;  3A1Q B;  2CHX A;  2M4N A;  2UZR A;  3TIX A;  2M0X A;  2Z59 B;  4W9D A;  3MHS D;  3NOB A;  5D3Y A;  2C60 A;  4GOC A;  3TJP A;  3WAM A;  3P7Z A;  4MGY E;  2LWP A;  2MW5 A;  4A6F B;  4W9F A;  1L2N A;  5JZE B;  2ZVN A;  5JHB A;  1J0W A;  4GPT B;  4AUQ C;  3QCA A;  3QQ8 B;  4IM0 A;  1PQS A;  4K1R B;  2K2U A;  2L7R A;  2UWQ A;  2KTR A;  3VUW A;  2REX A;  5TR5 A;  3RCZ A;  2DTC A;  2CKH B;  2BYV E;  4WJQ A;  4BKS A;  4X57 B;  2N23 A;  3KRW A;  3ZDM C;  4GDL B;  1UPQ A;  1X1M A;  3ZNH B;  2MQJ A;  2CY4 A;  4ZYN A;  3AU4 A;  5EDS A;  1AQC A;  3PT2 B;  1TBE A;  2Y5B B;  1U5E A;  2O6V A;  2MBB B;  1YX5 B;  4KIK A;  1LFD A;  2NZ8 B;  1FB8 A;  2V76 A;  5C5B B;  2MBO A;  4GGQ A;  3NY5 A;  1WXV A;  2VSZ A;  3SBT A;  4JKF A;  4NJ6 A;  4E74 A;  5CLL B;  4AP4 C;  2N0Y A;  1P98 A;  2KDI A;  3PG7 A;  3X23 A;  3PSE B;  2COP A;  1SE9 A;  1E8Y A;  2COD A;  1WXA A;  2P0D A;  2KUP A;  3L08 A;  3QAQ A;  5HKH A;  1UD7 A;  1WJM A;  3QX1 A;  1UNR A;  2R0D A;  3RT3 B;  1VBG A;  2Z0E B;  2LYD A;  2D3G A;  1A5R A;  2N7E A;  1GJZ A;  2BCJ A;  2K8B A;  4HHV A;  3SD5 A;  2RQ1 A;  1E5W A;  4ICV A;  3V6C B;  2QKL A;  3HHM A;  2VRW B;  4JQW C;  4PQ0 A;  3TW1 A;  1XOD A;  1WX8 A;  3A4R A;  2JP2 A;  1R4M I;  5AEK B;  1UEL A;  4XX5 A;  4JL9 A;  3WYF B;  4HDQ A;  4WWN A;  3HIZ A;  2ASQ A;  2AEH A;  3DBR I;  2FJL A;  2PPH A;  5CHV C;  2RGF A;  2K8H A;  4EFO A;  3KSY A;  2D10 A;  3ZIM A;  1P5T A;  3FM8 C;  3ONS A;  4TUU A;  1WY8 A;  4M0W B;  2BKR B;  1WJ1 A;  3ZRC A;  3Q3J A;  2BKF A;  2HTH A;  1TQZ A;  4IAP A;  2KNB A;  1N3H A;  2KFJ A;  4JKC A;  5C23 A;  2PEA A;  2ROZ B;  4K7S A;  4ANU A;  1PMS A;  3Q3F A;  4TYZ A;  2KCJ A;  3ALB A;  2COA A;  3IG3 A;  2GCJ A;  1WIA A;  1KZG A;  4MGI E;  2OJR A;  5JHH A;  1OQY A;  4EZL A;  4HCN B;  4K7W A;  3PS6 A;  1ZC4 B;  4G50 A;  3AXC A;  2NR2 A;  2Y7B A;  4DWF A;  2COF A;  2CB8 A;  4KZ0 A;  5LON B;  4B6W A;  4F8C B;  2NBU A;  3QIJ A;  4MEL A;  1UZX B;  1V2Y A;  3OJ4 B;  3PVU A;  2AWT A;  3BY4 B;  4MGK E;  2D9Y A;  2ZJD A;  3E9O A;  2J0K A;  4GXB A;  1K8R B;  1V5O A;  3QA8 A;  1UBI A;  4KVG B;  3V61 A;  1TXD A;  2WWZ A;  4OVU A;  4WJO A;  1P3R A;  4BKT A;  4JKG B;  2KXJ A;  1V86 A;  3AU5 A;  5D3X A;  1SHC A;  4HXD A;  1YD8 U;  2JT4 B;  2C5L C;  2RPQ A;  3DDC B;  3V5W A;  4DHJ B;  4IWO A;  2COC A;  2M1M A;  3ENE A;  2HJ8 A;  2KOX A;  1NVL A;  3WAN A;  2MFQ A;  4HB2 B;  4CHJ A;  3KYD D;  3ZRF A;  3CST A;  1RLF A;  2KX3 A;  1H8C A;  2LUE A;  4EJN A;  2N1V A;  2R2O A;  3PP2 A;  4GZU A;  4ZRJ A;  2YVC A;  4EEW A;  3VH4 B;  1MG8 A;  3H1U A;  2Z0O A;  4WSF A;  1U27 A;  4JGH B;  2O6V D;  2YS5 A;  5KHO A;  2LGD A;  4A5K A;  2JVC A;  1MIZ B;  3D32 A;  4EUT A;  2H7D A;  2IY0 B;  2L0T A;  1Q0W B;  2J7Q B;  5D7G A;  2ABD A;  2JPH A;  2M38 A;  2IFS A;  2ELA A;  2I5C A;  3DBS A;  2IZV B;  1WJU A;  2Q13 A;  4JKG A;  1ZSQ A;  1OEY J;  1WX7 A;  1E7V A;  1WYW B;  3JYU A;  5CTR C;  4DHJ D;  2RVB B;  2KK8 A;  5JP4 A;  4AJW A;  5DHF B;  1IPG A;  3AJ4 A;  1FHW A;  3PRM B;  2HD5 B;  3FP5 A;  2JXX A;  2MA9 B;  3L10 B;  1NTY A;  1WVH A;  2J0J A;  1H4R A;  2KJ6 A;  4DDG D;  3TMP B;  4P7I A;  2K6D B;  4IOY X;  4BBN F;  3M3J A;  4PNK A;  2GJY A;  4RM8 A;  1M7E A;  1GGO A;  3TL5 A;  3O96 A;  3SYX A;  2CAY A;  5JHA A;  2ZCB A;  3L54 A;  5E6O A;  3OLM D;  1GC6 A;  4MK0 A;  2DZJ A;  2RSU A;  3DOW A;  2NS5 A;  1YQB A;  1RRB A;  2IBI B;  1KJT A;  3TBL D;  3W1S A;  3PVL A;  3R3M A;  5HE0 A;  3R7Q A;  3GYP A;  2X0S A;  2DZK A;  4Z2N A;  1BTK A;  2MBH A;  5JH5 C;  3HM6 X;  2EJ8 A;  1UNQ A;  3DQV A;  1UEF A;  2FAZ A;  3PRE A;  2I1J A;  4MY6 A;  3H7P A;  3ULC A;  2ELB A;  1Y8R C;  4WQO B;  1FHX A;  4IM2 A;  4HDO A;  4MJS A;  3H6N A;  1GNU A;  2AL3 A;  2LKO A;  4TKN A;  1V9J A;  3QAR A;  4EOY A;  3DVG Y;  1FXT B;  5DIF B;  4W9J A;  4Y94 A;  1PFJ A;  3APF A;  3M95 A;  4FN2 A;  4HB0 B;  1BT0 A;  1T0Y A;  3R7R A;  3EFU A;  3SU8 X;  3SV1 A;  3I3T B;  4JK9 A;  2MLB A;  3A9J B;  2KC1 A;  4WAA A;  1EAZ A;  2RNR B;  4GMV A;  3LJU X;  2KC2 A;  4EKU A;  2ADZ A;  4KV2 A;  4WWP A;  4HAU B;  2D07 B;  3QC8 B;  4JK8 A;  3A98 B;  5IAA C;  1RFA A;  5L95 C;  2G35 A;  4DHZ B;  1E8Z A;  4BOZ B;  1AWE A;  1EVH A;  5C16 A;  4PYU A;  4Z2M B;  5LXI B;  2LXC A;  4AOF A;  5HE1 A;  2NBW B;  3R66 C;  2FIF A;  3NHE B;  3B1L X;  1WR1 A;  2FDQ A;  1QQG A;  3HW2 B;  2LGY A;  1AAR A;  3DVN U;  3OJ3 A;  2IO0 B;  4I6L B;  5J18 A;  1WG7 A;  1DBH A;  3TFM A;  4ILJ A;  5CHW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...