4YL8A

Crystal structure of the crumbs/moesin complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
296
structure length
296
Chain Sequence
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKAFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Moesin
publication title Structural Basis for the Phosphorylation-regulated Interaction between the Cytoplasmic Tail of Cell Polarity Protein Crumbs and the Actin-binding Protein Moesin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 93
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4yl8A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4yl8A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4yl8A01
4F7ZA 1V5MA 3U7DA 3QJZA 4K81A 1WGQA 2FCQA 3ECIA 2W9NA 3V61A 2RNRB 1WZ0A 2NBWB 1KOTA 3VUWA 2N23A 3DPDA 3ZTCA 2I1JA 1KZGA 2BYEA 3EECA 5AZFA 3VFKA 1OEYJ 4GSWA 2EMTA 2MCNB 3PS6A 2DX5A 3SYXA 1EUVB 4RM8A 4TUUA 5AZGA 1QC6A 3UINB 2KANA 4A3PA 4RM9A 2M17A 5KCVA 4BBKA 4WWPA 2G3QB 2XK5B 2CHXA 2COAA 1UPQA 3QHTA 3A8QA 4XX5A 3MPXA 2ZEQA 3IVFA 3IHPC 2KMCA 2RVBB 1GG3A 4MY6A 1WR1A 1XODA 3TCAA 2DX5B 4W9KA 3VHTC 4DX90 5DPTA 2IFSA 1MIXA 2A4ZA 3H9DA 4HB3B 1NI2A 4ZRIA 4G50A 1U5EA 5FI0A 1WGDA 3EC8A 4MK0A 3H7SA 2YT0A 3VUYA 4GN1A 2M8SA 3ALBA 4HB2B 5CHWA 4XWXA 1ZC3B 4I6PA 2DYBA 3ENEA 4GU2A 2C9WB 2LG1A 2NCNA 4M0WB 1R4MI 1UBIA 4W9DA 1SHCA 2KDFB 3RUIB 1IP9A 4M8NA 4A5KA 5AZHA 2XQNM 3KH0A 2NVUI 2K8HA 1UEFA 1A5RA 1ZVRA 1SIFA 5DPSA 2KXJA 1WGHA 2Z0QA 2ZVOA 3HM3A 2KJ6A 3MHSD 3ZRCA 1TZ1A 2I1KA 2K8BA 5DIFB 4DBGA 3OAWA 4P7IA 3W1SC 2DAJA 3BJIA 2BPSA 4IOYX 1P3QU 5DHAB 3WA0A 1K5DB 4W9EA 4CHKA 3KUCB 3L10B 2RSGA 3RYTA 3RT3B 4E71A 4BOZB 5JH5C 4HPLB 1WX9A 4Z2MB 2MW5A 4EKUA 4KHBB 3UZTA 4A6FA 4GMXB 3L0WB 1PFJA 4DK5A 4HJKA 3ODOA 2J0MA 5D3WA 3H1UA 1DDMA 2W2WA 1P98A 2QKLA 4ASWC 2P0HA 1ST7A 4NPNA 2D9WA 3BINA 2LZ6A 3HQCA 3C0RB 4MT7A 3H6NA 2R0DA 2FJ9A 4A6FB 3K9PB 2MLBA 2BGFA 3ZKJC 4JQWC 3PTFC 5E6NA 1RJ2A 2PZ1A 1WXVA 4IAPA 3MDBC 3KSYA 1LQBA 1DDVA 1WH3A 4JIOU 2M1MA 3BY4B 5JLJB 3HM6X 2JWZA 3TVVA 1FXTB 3GOEA 3TBLD 5CLQB 5C23A 2D10A 1GC6A 3WAOA 1WYWB 4KSLC 4FJZA 4II2B 4WVFB 2LRWA 2ZJDA 5LLIA 1P5TA 4GZUA 4BKGA 2Y5BB 4KV2A 5KHQA 2EC1A 4HXDA 2MBOA 1Y19B 1T0YA 2KCJA 3K9OB 2V4LA 2RPQA 4CYEA 3EPYA 4IG7B 3DVNU 3IG3A 1WMHA 3WYFB 2CHWA 2NZ8B 3TMPB 1J19A 2YS1A 3DXDA 2N7DA 3ZIMA 1BTNA 5D3VA 1EF5A 3ZVVA 1E8ZA 3AU4A 1LFDA 2DZKA 2LGDA 2DAFA 1BAKA 2N9PC 2LXAA 3OJ3A 1U5FA 4CHJA 1W1GA 2G45B 4W9GA 4LJPB 4E3CA 4HB4B 4K7WA 4AWJA 2LI5A 4W9IA 3LJ3A 2N9XA 2RUKB 4HPMB 3EFUA 3WAMA 4I6LB 1V89A 5EDSA 3NY5A 3TW1A 1ZM0A 3AJ4A 2JF5A 2KLGA 4IM2A 3ZNHB 5GMVA 4W9LA 4MSMB 5L83A 1I2HA 1WG7A 2I5CA 2GMIC 1WZ3A 3ML4A 3AXCA 1XCGA 3DBHI 1VD2A 5G55A 2ADZA 2KK8A 3KUDB 2FCMA 3IFWB 1GJZA 4AP4C 5J3TA 2MWSB 2L0TA 4URKA 3D8EA 2YLMA 2GCLA 3QARA 2C7NB 3V6EB 1K5GB 4ANUA 2DTCA 2P0FA 2DKQA 2K6QA 2VSZA 5KQ1A 1TJ6A 3GYPA 4MGKE 5D3YA 1FGZA 1P0RA 2VRRB 3VTVA 4F7GA 1E7VA 1BWNA 2W2XD 1ISNA 1I35A 2WX0A 4OVVA 5IAAC 2DHIA 2D9VA 3FEHA 2COCA 1KJTA 2CRFA 2LVQA 2H7EA 2V3SA 5EFXA 1KI1B 4MGZE 3ZRFA 1FB8A 5TR5A 2KKCA 2MX2A 5LONB 2JY6A 2M14A 3L13A 2CU1A 4IM3A 1YX5B 1Z5SB 1TQZA 3PVWA 5JHAA 3DVGY 2DHJA 4DHZE 4BKSD 5LXIB 2BYVE 2PJHA 1WVHA 1KM7A 3PGEA 3CSFA 1DBHA 3HK0A 4WJNA 3ZVRA 3ZDTA 1XQQA 4BBNF 1WGUA 1G6JA 1V5OA 4G11A 3UIPB 3QA8A 1YQBA 1UH6A 2LJ5A 2OOBB 5D6JB 2AWTA 2CQUA 1KZ7A 4MEMA 3PHXB 4K2OA 1AARA 2M0XA 1CMXB 3DOWA 4X57B 4WQOB 5C16A 4HWIB 3X23A 1L2NA 2DZMA 1MAIA 4KZCA 4BBNC 3TJPA 1EVHA 2KQ7A 3VXWA 1VCBA 2LVPA 1NVLA 3W1YA 4K17A 4F8CB 5JHHA 2O6VD 3PP2A 2MQJA 3O96A 1YIWA 2FUHB 5HE0A 1NTYA 3HW2B 2UZRA 2D3GA 2K1FA 3U8ZA 2BF8B 2BKFA 1TXDA 2XK5A 5CX3A 2MRPA 2NBVB 2CR5A 4XC2A 1LXDA 4EJNA 2LGXA 1E8YA 4NAWB 2K2UA 2ZNVC 2KD0A 1E5WA 2KNBA 1YD8U 5HE2A 5D2MB 3CMMB 3RCPA 2LXCA 1J8CA 4ICVA 2NS5A 3VOQA 3KYCD 5CHFA 2V1YA 2DLWA 4NSWA 2MA9B 4ZRKA 5D7GA 4MJSA 2GBMA 4FULA 3PLUA 3PEGA 1WI0A 2L0FA 2I5FA 5L95C 4DDGD 3M3JA 2HJ8A 2COFA 3KRXA 2KN5A 4BKSA 4FADA 2HTHA 2KQSA 4WJPA 5GOWB 5C79A 2REXA 4W9HA 4BKTA 4WJOA 4MDKE 1WY8A 1P9DU 4AUQC 5CLLB 2DZJA 4RMAA 4TQ0A 1V5PA 1R4NI 4PS3A 2KX3A 1C1YB 3CXBB 1FAOA 1NTIA 4GB9A 3NZSA 1X1MA 4MJSB 3SU8X 3ODXA 1X1FA 1U27A 2ELAA 3KRWA 1WF9A 3APFA 2VRWB 3SO6A 2J7QB 5CHVC 1U5GA 5KHOA 4GPTB 1X86A 2HTHB 3JYUA 1DROA 2E2XA 2WWZA 4K2PA 2DKPA 1WJMA 2DYMA 3VIAA 2BKRB 1P6SA 4WWNA 1V5UA 2KWCA 2AL3A 2MBEA 2MP2A 1W1DA 4F1SA 2EMSA 1ACAA 1V86A 3VQIA 2YSZA 2B3AA 2O6VA 2KTRA 3V5WA 2L00B 2N1VA 2DZIA 3ONSA 2FNJB 2L05A 4D0NB 2R2OA 1WJ4A 1UNRA 3PRZA 1WE7A 1PMSA 1F9JA 3P7ZA 2RLOA 5C5BA 2MP2B 2WDTB 3M62B 1XT9B 2GBJA 2ROVA 3KUZA 2N0YA 4FHJA 1MG8A 2KWVB 5BO4B 2O6VB 3UF8A 2KTRB 3H7PA 1NBFC 4MSQB 3CIKA 2LULA 1DYNA 2N4FA 1U4AA 4MH0E 2Y8FA 4MELA 2CODA 4EZKA 1Y5OA 4B6WA 3JSVA 4WSFA 5C5BB 3N7CA 2Z0OA 5JZEB 2UZSA 1YJ1A 1V6EA 3A9JA 2L8JA 2K00A 2Y8GA 1V2YA 3T8MA 1U29A 1UD7A 3N30A 4MM3A 3RULA 3H7PB 2KC2A 2NBUA 3APCA 1HB8A 5D27A 4WAAA 3QBVB 2CY4A 1XX0A 3HHMA 3NSUA 4B6HA 3ZNZB 3JSVB 3Q3JA 1DDWA 1KLVA 2JZZA 3A9JB 3GYOA 3ZW3A 2P8VA 1W1HA 4KHAA 3B08A 4A6KA 4HDOA 4F7UP 2P0DA 4NNJB 3V62A 2LASA 4FJYA 1OEYA 2YF0A 4PS8A 4TQ1A 1ZSQA 3OLMD 1E7UA 3VDZA 2JZ3B 4NJ7A 2M38A 4AOFA 3RCZA 2KLCA 1RRBA 1FOEA 2ABDA 2ZVNA 3A1QB 3QIJA 3ML9A 2KOXA 3PREA 2J0KA 2UYZB 2QHOA 4MGIE 2LOXA 1V81A 4K1RB 4DHZB 2MDXA 4NY0A 4DWFA 3L08A 4PQ0A 3S2AA 1FHOA 1XR0B 1EGXA 5HE1A 5FR6A 2IO2B 3L54A 1XKEA 1WX8A 5C6RA 2RSUA 1MK7B 2GBNA 1X1GA 1Z2MA 2N1WA 1LW3A 2MBQA 2IBIB 1MK9B 4YONA 2D07B 2K6DB 4ANXA 2ZZPB 2RR9A 3NHEB 1UNQA 3QC8B 2G35A 2KJRA 3DBLI 2EJ8A 5JHGA 5JHBA 4GOCA 2R2QA 2XBBC 2JPHA 4ANWA 3M63B 3APDA 4B95A 5J3YA 4K7SA 3QK0A 4HAUB 4PYZA 1NU2A 3MJWA 4GIVA 4PS7A 1D3ZA 2L3ZA 3PVLA 2KDIA 3SUZA 4HAXB 2CKHB 2COPA 4WJ7A 1FGYA 2UWQA 3KW5B 1OQNA 2MKRA 4LJOB 4ZRJA 4KDLB 5LXHA 3D8DA 2JXXA 3SDLC 3VUXA 2O2VA 4G3XB 2LRUA 2X18A 2YRYA 1TBEA 2W2XC 3NZUA 2DYOA 5E6OA 1WJ6A 1K8RB 3A4SC 3DBRI 1AWEA 1M7EA 3A8PA 2NPTB 2GCJA 3M95A 4ZYNA 4KHOA 2FCNA 4KAXB 3G9WA 5HE3A 2O2VB 3CF6E 2UVMA 4DBBA 3VVWB 5DH9B 1WXSA 3QAQA 4EFOA 5IJMA 4W9CA 1RFAA 1I7AA 4GGQA 4IUMB 2DHZA 2KTFA 4JL9A 2JRHA 4EUTA 4HAWB 4FLHA 3WALA 3DDCB 1TTNA 2Y7BA 4NQKE 1Z87A 2D4QA 1M7RA 2QKMA 1I42A 2PEAA 1UBQA 1OMWA 4HHVA 2BWES 2ASQA 3ZNGC 3NS8A 3D32A 3PT2B 5CTRC 2JVCA 2DA0A 1WFYA 4JLCA 2BCJA 3VAWA 2IO3B 2MSED 4OVUA 2MWNB 2ZPYA 1UNPA 1E8XA 1Q67A 3FSSA 2VKIA 4NQLB 3WIMA 4DDID 1WIAA 1Q1OA 2G4DB 2DX1A 4NAWA 4HCNB 5AEKB 2LKOA 2FIDA 2BYFA 1HB6A 1C3TA 3RZWC 2KGXB 5L81A 5E6PA 2K2JA 3RD2A 5DCNA 5J17A 4HAZB 1HE8A 4FJVB 3QX1A 2DHKA 2PE6B 4FN2A 2YS3A 2L7RA 3ML8A 1X05A 1UPRA 1P1AA 1WXMA 4FA6A 1H8CA 4Y94A 2ROZB 2KJHB 4KIKA 4FHKA 3L16A 3PLVA 1Q5WB 2L1CA 3UQBA 4TKNA 4LDTD 4GDKA 3ZUNA 2D2QA 2CY5A 3PRMB 3NOBA 4IM0A 1WGRA 2C7HA 4KZ0A 2ZCBA 3UQAA 5D94A 2CAYA 4CHMA 4EMOA 3PV1A 4KIKB 3AU5A 2DENB 3TIXA 4L6EA 2L2IA 3SD5A 2K8CA 5DHFB 2YT1A 3DCGA 4GDKB 4IWOA 3ULBA 2YS5A 1WJNA 1S3SG 4EEWA 2MFQA 4HDQA 4GMVA 3FLVA 3ZLZA 2C7MB 1WR6E 5G2NA 4HLEA 4E74A 2XEWA 1WJUA 2DYQA 1HBKA 3B0AA 3ULCA 1BTKA 3GZNI 2IO1B 4B9KA 1IYFA 2RD0A 2KZRA 4IC7B 2IYDB 1UZXB 3DQVA 1V9JA 2K39A 2ZPNA 4BFRA 1WGGA 2FCSA 2D11A 1IPGA 1N3HA 2DYNA 3JW0X 1WM2A 3P2BA 2JT4B 1EAZA 3ZTDA 4N9F4 1OQYA 3O65B 1RRPB 2D9YA 1OY2A 4W9FA 1BT0A 2R09A 4EZJA 4ZDVA 2AL6A 5DI9B 3KYDD 3P6AA 1PQSA 4HVBA 1GUAB 2Z0PA 3AI5A 2A5UA 2ELBA 3QQ8B 3PHWB 1ZW7A 3TL5A 4J6IA 2G4SA 2GS0A 1P3RA 4G0NB 3LJUX 3Q3FA 4HAYB 3SHQA 4EOYA 2IY0B 1RLFA 4BOSC 4DHJD 4Z2NA 1MKEA 1U2BA 1ZC4B 1U5DA 2V76A 1WI1A 3DVNV 1Y8RC 2N9EB 4LDTB 1UELA 4HB0B 2Z59B 4LCDE 4HCPB 1LB1A 1J0WA 2RGNB 2AYOB 4BVUC 3A98B 1EF1A 2C60A 1X11A 1ZGUB 4TV3A 1FHWA 3OJ4B 1Q0WB 3DXCA 3A33B 3AULA 1EO6A 3VTWA 2L76A 1XD3B 1XD4A 2D9XA 2DN6A 1H10A 3A1QA 2ZNVB 3DXEA 1RAXA 1LM8B 4HK2A 3QWMA 4H8SA 2AEHA 2LBBA 3QCAA 1OTRB 3JVZX 1FHXA 2ZCCA 4AJWA 5J18A 1V5TA 4IWPA 2GBRA 2PE9A 2RGFA 4GDLA 3PPAA 1WRDB 3IBEA 2KC1A 1E8WA 1PLSA 1V80A 3EHVA 2WH5A 1AQCA 3UIOB 3VTUA 4KSKC 4HAVB 1B55A 5IA7A 4NJ6A 4CO7A 2YVCA 2HE7A 2C5LC 3ZO5B 4IFSA 2J59M 1MIZB 4YL8A 1MPHA 4GDLB 3PG7A 4II3B 4DX8A 1WJ1A 3MTNB 3FP5A 2LUEA 5J3QA 1GNUA 3V6CB 3F5RA 1YX6B 5FI1A 4WWOA 2OTXA 2PPHA 4GXBA 1QZEA 4A6HA 2MBHA 2GJYA 4W9JA 4I6NB 2FAZA 3W1SA 3V60A 1JRUA 3SNHA 3PZDA 4A20A 2EKEC 2KHWB 5HKHA 4WJQA 4KVGB 2KVRA 3L17A 3R3MA 1WMHB 2WX1A 1J0GA 4M8MA 4KDIC 4TYZA 4DHJB 2LD9A 5KQ4A 1WGYA 4K7UA 1H4RA 3FM8C 3PRPB 2KO3A 3SV1A 2JUOA 1WM3A 3PSEB 4DXAB 3R7QA 2NPTA 1IRSA 3TFMA 1S1QB 2IYBA 3ZNID 5DPWA 2Z0EB 3VH4B 2Z0DB 2LGYA 3R66C 3OANA 1V88A 2CHZA 3QWZB 3U30A 4EZLA 2J0JA 3LDZE 3F0WA 4AJYB 2OQBA 2D9ZA 1TGZB 3T06A 4A3OA 2WYQA 4PYUA 2KUPA 4IW0A 1V49A 3WANA 2MBBB 1NDDA 4IWQA 1UGMA 2CS4A 4HATB 1ZKHA 1M94A 3KZ1A 3ZDMC 3KY9A 1E90A 4ICUA 3DVGX 2OJRA 3HIZA 5J2RA 1OGWA 2DFKA 2IY1B 3I3TB 2FIFA 3PVUA 5C1ZA 1NTVA 2LVOA 5D3XA 3A9KA 1SE9A 2JRIB 3M1IB 1GC7A 3R7RA 2M4NA 3DBSA 2Q13A 2NR2A 4F7HA 3WAPA 2FDQA 4PNKA 3A4RA 2KDEB 2RQ1A 1V61A 3VH3B 2GBKA 4C0AA 4JGHB 2LOZA 4MGYE 3A9KB 3X0WA 2LYDA 2HD5B 2KFJA 2CB8A 3T9LA 3ODWA 1QQGA 2HRJA 1WE6A 4ANVA 2IO0B 3RZFA 2GOWA 3N32A 2IZVB 3D8FA 5LOPB 2H7DA 2LWPA 3B1LX 2KFKA 3KVFB 3CSTA 5JP4A 3N3KB 1WXAA 1WX7A 2N7EA 2KMAA 3TO1A 3UGBB 2BWFA 2KX0A 2K25A 3PSCA 2NMBA 5DPRA 1SGHA 2KDBA 2KFKB 2KWUB 1L7YA 4XZ4A 2JP2A 4FBJB 2FJLA
chains in the Genus database with same CATH superfamily
2KN4A 3DCXA 4F7ZA 3SR6A 1DOXA 1V5MA 3U7DA 2MHJA 2WXRA 2DLBA 1QOBA 4JKDA 3QJZA 3N9YC 1JRPA 4ZHPA 4K81A 1WGQA 3DBHB 2FCQA 3Q8AA 4OZAA 3ECIA 3W9CB 2I38A 2W9NA 1I4RA 3V61A 2RNRB 1WZ0A 2NBWB 5MPOA 1KOTA 4XDDA 3VUWA 2N23A 2XN9C 3DPDA 3ZTCA 2I1JA 1KZGA 2BYEA 2BB5A 3EECA 5AZFA 1C76A 3VFKA 5EE0A 1OEYJ 3T3NA 4GSWA 2EMTA 3AE1B 2MCNB 3PS6A 2DX5A 3SYXA 1EUVB 4RM8A 4TUUA 5AZGA 1QC6A 1MHXA 3W2DA 1N60A 3UINB 2CU3A 2KANA 2MJDA 4RM9A 4A3PA 2M17A 5KCVA 4BBKA 4WWPA 2G3QB 2XK5B 2CHXA 3P4SB 3U2SC 2COAA 1UPQA 3QHTA 4XWWA 3A8QA 4XX5A 3MPXA 2ZEQA 3IVFA 3IHPC 4ZYSA 4A90A 2KMCA 4JK8A 1N63A 2K9XA 2RVBB 1GG3A 4MY6A 1T0SC 1WR1A 1XODA 2INDC 3TCAA 2DX5B 4W9KA 4M0WA 3VR8B 3VHTC 4DX90 5DPTA 2IFSA 1MIXA 2A4ZA 3H9DA 2D5GA 2J4XA 4HB3B 1HEZE 1NI2A 4ZRIA 4G50A 1U5EA 5FI0A 1N61A 1WGDA 1EU3A 1CK1A 3EC8A 4MK0A 3H7SA 1GB4A 2YT0A 3VUYA 4GN1A 2M8SA 3ALBA 4HB2B 5CHWA 4XWXA 1ZC3B 4I6PA 2DYBA 3ENEA 4GU2A 3VRBB 2C9WB 2LG1A 1UWXA 2NCNA 4M0WB 2JYTA 3AE2B 4K3BA 1R4MI 2NTSA 3LB8C 5G5HA 1UBIA 2RDGA 1E10A 4W9DA 1SHCA 5TSSA 1IGDA 2KDFB 4JKBA 3RUIB 3Q8CA 1IP9A 1BMLC 4M8NA 4A5KA 5IRSA 3HRDD 5AZHA 3N1XC 2XQNM 3KH0A 2NVUI 2K8HA 2RDBC 1UEFA 1A5RA 1ZVRA 1SIFA 5DPSA 1VDVA 2KXJA 1WGHA 2Z0QA 4KGTA 3SFDB 2ZVOA 3HM3A 2KJ6A 4L1BA 3MHSD 3ZRCA 1JWBD 2I1KA 1TZ1A 3B77A 2K8BA 3ENBA 4B0EA 2QSDA 5DIFB 1JMLA 1PUTA 4DBGA 3OAWA 4KHBA 2JYEA 3FAHA 4P7IA 3W1SC 4MACA 3AB5A 2DAJA 3BJIA 2BPSA 4RGTA 3ZXVA 4IOYX 1XXGA 1P3QU 5DHAB 3WA0A 1K5DB 4W9EA 4CHKA 1L0VB 3KUCB 3BYYB 3L10B 2KIGA 4GOUA 2B76B 2RSGA 3RYTA 2AX5A 4ZRQA 1C4AA 3RT3B 4E71A 4BOZB 5JH5C 3MC9A 3P4QB 4JK7A 4HPLB 4C4VB 2E6XA 1WX9A 4Z2MB 1TT5B 4FXCA 2MW5A 4EKUA 4KHBB 3UZTA 1QOFA 4A6FA 1TS5A 2ON8A 4GMXB 3L0WB 1VLBA 2EKIA 1ZP0B 1PFJA 4DK5A 4HJKA 3ODOA 2J0MA 3NVZA 2VH1A 2K8EA 5D3WA 4QXAB 3H1UA 1D5MC 1DDMA 2W2WA 1P98A 2QKLA 4ASWC 1ZDVA 2DWQA 2P0HA 2INCC 1ST7A 4NPNA 2D9WA 3BINA 2LZ6A 3HQCA 2J42A 2SEBD 4JKAA 3C0RB 1I4QA 4MT7A 1TZOA 1KBLA 3H6NA 2Y3AA 2R0DA 2FJ9A 2WNMA 1E6EB 1SIJA 3OWEB 4A6FB 4LTUA 3K9PB 4XGAB 1SF0A 2BGFA 2MLBA 3ZKJC 4JQWC 4US8A 3PTFC 2R2YA 2N7JA 5E6NA 1RJ2A 2PZ1A 1WXVA 4IAPA 3E56A 3MDBC 5IP4D 3KSYA 4RCOA 4RFBA 1LQBA 1DDVA 1WH3A 4JIOU 1R4NB 2M1MA 3BY4B 5JLJB 3HM6X 3BZDB 1JWSD 2JWZA 3TVVA 1FXTB 2WXMA 1NENB 2ZW1A 3GOEA 3TBLD 5CLQB 5C23A 2FUG1 3HIEA 2D10A 1GC6A 1SXTA 3WAOA 1WYWB 4KSLC 4FJZA 4II2B 4A8XC 4WVFB 2LRWA 1KC7A 2ZJDA 5LLIA 1P5TA 4GZUA 3N1YC 4BKGA 2Y5BB 2PVOD 3SBTA 4KV2A 5KHQA 4YSZB 2EC1A 4HXDA 2V9HA 2MBOA 1Y19B 4MH8A 1PDXA 3AE8B 1T0YA 2KCJA 3AM9A 1SJHD 3K9OB 3BYTB 1FO4A 2V4LA 2WU2B 2RPQA 4CYEA 2W3RA 3SEBA 1HTOA 3URYA 3EPYA 4IG7B 3DHGC 4RNAA 3DVNU 3IG3A 3Q3OC 4NAMA 1WMHA 2PIAA 3WYFB 2CHWA 2NZ8B 1QLBB 3TMPB 2PTLA 4OZBA 2WGSA 1J19A 3H8HA 4GNKB 4ZOHC 1RFKA 5T8IA 2YS1A 3DXDA 2N7DA 4RF0A 3ZIMA 1NI3A 1BTNA 5D3VA 1EF5A 2DNFA 3HUIA 3ZVVA 2UU7A 1E8ZA 2JXTA 3AU4A 3AEDB 1LFDA 4YWGG 2X38A 4ILJA 2DZKA 2LGDA 2DAFA 1BAKA 2MJ3A 1L5PA 2N9PC 2LXAA 4C7YA 1U5FA 3OJ3A 4CHJA 1W1GA 2G45B 4W9GA 2KWDA 5BYRA 1EM7A 4QAYA 4LJPB 4E3CA 4HB4B 4K7WA 2LGIA 4AWJA 2LI5A 2IJ0A 3VRAB 4W9IA 3LJ3A 2N9XA 1ZOYB 2RUKB 1C9FA 4HPMB 3EFUA 3WAMA 4IOIE 4I6LB 3RPFC 1V8CA 1ZYIA 1SEBD 1V89A 5EDSA 3NY5A 1VZ6A 3TW1A 2WP9B 1ZM0A 3AJ4A 2JF5A 2KLGA 4IM2A 3ZNHB 1ZUD2 1K52A 4N58A 5GMVA 4W9LA 1A70A 4MSMB 2DIKA 5L83A 1I2HA 1VR9A 1WG7A 2I5CA 2GMIC 1WZ3A 2PVGC 4A6QA 3ML4A 3AXCA 1XCGA 3DBHI 3AE5B 1VD2A 5G55A 2ADZA 2KK8A 3KUDB 2FCMA 2WXFA 3IFWB 1GJZA 1WXQA 4AP4C 1AYFA 5J3TA 5C3JB 2MWSB 1EWYC 3Q8FA 2KT7A 2L0TA 4URKA 3D8EA 2YLMA 2GCLA 3QARA 2C7NB 1J7CA 5EE3A 3V6EB 3IAS1 1K5GB 3I63C 4ANUA 2DTCA 2P0FA 2DKQA 2K6QA 3KLSX 2VSZA 5KQ1A 1TJ6A 3GYPA 2Z13A 3AEGB 4M02A 4MGKE 5D3YA 3RNCC 1FGZA 1P0RA 1V1PA 2W55A 2VRRB 3VTVA 4F7GA 2M56B 1E7VA 1BWNA 1I4XA 1YJIA 2W2XD 1ISNA 1NEKB 2IGHA 4HPPA 4J3OD 1I35A 2QEJC 1T77A 3AN1A 1F52A 2WX0A 4OVVA 5IAAC 2DHIA 4LNFA 2D9VA 3FEHA 1FCLA 2COCA 1KJTA 2CRFA 2YEPB 2LVQA 4US9A 2WXJA 2H7EA 1SB3C 2QC8A 2V3SA 5EFXA 3B2FA 1WYGA 1KI1B 4MGZE 3NVWA 4XWTA 3GE8C 3ZRFA 1FB8A 5TR5A 1V1PB 2KKCA 3TEWA 2MX2A 5LONB 2D3AA 1L0YB 3LXFA 2JY6A 3AE9B 4N6EB 2KUQA 2M14A 2Q5WD 2CU1A 3L13A 4IM3A 3NWDA 1YMHE 5HG2A 3TUOA 1YX5B 1Z5SB 1LGRA 1F1HA 1N6ZA 3DWGC 1TQZA 1LO5D 3PVWA 5JHAA 2FE8A 3DVGY 4R3DA 2DHJA 4DHZE 2G9HD 1YJJA 4BKSD 5LXIB 2BYVE 2X0SA 2PJHA 1J7AA 1WVHA 1KM7A 3PGEA 3CSFA 5AUKA 1DBHA 3HK0A 3NW8A 2BS2B 4WJNA 3AECB 3ZVRA 4LNKA 1TY0A 3ZDTA 1XQQA 4KGSA 3BWUD 4BBNF 1WGUA 2OHFA 1G6JA 2BS4B 1V5OA 2KAJA 4G11A 3UIPB 3QA8A 1WSPA 1YQBA 1UH6A 4C7ZA 1TIFA 1C77A 2LJ5A 2OOBB 4OHJA 5D6JB 2AWTA 3MFGA 2CQUA 3V05A 1KZ7A 2QJLA 4MEMA 4NZLB 2BS3B 4K2OA 1AARA 2W3SA 3PHXB 2M0XA 1CMXB 1CZPA 3DBLB 3MJ5A 1D5XC 4H2AA 3DOWA 3AH7A 4X57B 1ACCA 4WQOB 5C16A 1M4VA 4HWIB 3X23A 1L2NA 2DZMA 2W54A 5H8YE 1MAIA 4KZCA 2NBVA 2LEKA 4BBNC 3TJPA 1EVHA 2KQ7A 3VXWA 2W82A 2WXHA 4M00A 1CJEA 1VCBA 2LVPA 3PZ8A 4YTPB 1NVLA 3W1YA 4K17A 1WRIA 5JHHA 4F8CB 5HFYA 4JE3B 2N0SB 3IT4B 2O6VD 1FFVA 2FBWB 3PP2A 2MQJA 3C19A 3O96A 1ESFA 1YIWA 2FUHB 3OG5A 5HE0A 1NTYA 3HW2B 2UZRA 5IOIA 4RGMA 2D3GA 2K1FA 2WXKA 3U8ZA 1SBBB 3NWAA 1TXDA 2BF8B 2BKFA 2XK5A 5CX3A 2MRPA 2NBVB 2CR5A 4XC2A 1LXDA 4EJNA 5FR3A 2LGXA 2INNE 1E8YA 4NAWB 4LNNA 2K2UA 4S17A 2ZNVC 3NVVA 2HTME 2KD0A 1E5WA 2KNBA 1YD8U 1VZ7A 5HE2A 5D2MB 3CMMB 3RCPA 4K3CA 1IUEA 2JQRB 2LXCA 3AV8A 3BIID 4WIPA 4ICVA 4DXGA 1STEA 5I4DA 1J8CA 2NS5A 3VOQA 3KYCD 5CHFA 2V1YA 3B9JA 2DLWA 1HA5A 3DBRB 3EGRA 1L4DB 4NSWA 2MA9B 4PT5A 3E9LA 4ZRKA 3DWMA 5D7GA 4MJSA 2GBMA 4FULA 3PLUA 3PEGA 1WI0A 3N20C 1I4PA 2L0FA 2I5FA 5L95C 4DDGD 3M3JA 2HJ8A 2COFA 3KRXA 2KN5A 4BKSA 2WHIA 3U7ZA 4FADA 2HTHA 2KQSA 4WJPA 1P7FA 5GOWB 5C79A 2REXA 4W9HA 1QKZA 4BKTA 4WJOA 4MDKE 1WY8A 1P9DU 5M4YB 2CJOA 4AUQC 5CLLB 2DZJA 4RMAA 4TQ0A 1V5PA 1R4NI 4PS3A 2KX3A 1C1YB 3CXBB 2V0GA 4D2KA 1FAOA 1NTIA 4GB9A 1IBXA 3NZSA 4DIXA 1X1MA 4MJSB 3BVMA 3SU8X 3ODXA 4WQMA 1X1FA 1U27A 2ELAA 3KRWA 4B0MA 1WF9A 3APFA 2N9LA 2VRWB 3SO6A 2J7QB 5CHVC 1U5GA 5KHOA 4GPTB 1X86A 2HTHB 5IKCM 3JYUA 1DROA 1KH0A 2E2XA 2LUMA 2WWZA 4K2PA 5EE1A 1BUIC 2DKPA 1WJMA 2DYMA 3VIAA 1FRDA 1TKGA 4JX1C 1OFFA 1ZXIA 2BKRB 1P6SA 4WWNA 1V5UA 2KWCA 2AL3A 2MBEA 2MP2A 1W1DA 4F1SA 1B1ZA 4L23A 1IBXB 2EMSA 1ACAA 2GLSA 1V86A 3Q8BA 4HJGE 3VQIA 2WXIA 1SSNA 2YSZA 2B3AA 3C8YA 4C00A 1QOGA 2R61A 2O6VA 2KTRA 3V5WA 2L00B 4WAFA 2M0AA 2N1VA 3P42A 2DZIA 3ONSA 2K3UA 1DOIA 2FNJB 2L05A 4D0NB 2R2OA 1WJ4A 2WXOA 1UNRA 2GI9A 3PRZA 4A9AA 1WE7A 1PMSA 1F9JA 3IAM1 4C4VA 1E0ZA 3P7ZA 2RLOA 5C5BA 2LHDA 1RYJA 2MP2B 2WDTB 3M62B 1XT9B 3KWVA 2GBJA 2ROVA 3KUZA 2N0YA 4FHJA 1MG8A 2KWVB 5BO4B 2O6VB 3UF8A 2KTRB 3U4EG 3H7PA 4OW0A 4P1CC 4EE2A 1NBFC 1AWDA 4MSQB 3CIKA 2LULA 1MI0A 1DYNA 1V1OA 2JZPA 1L6UA 2N4FA 1U4AA 1ZPSA 4MH0E 5FKAC 2Y8FA 4MELA 4WURA 2CODA 1DGJA 4EZKA 1Y5OA 1SE3A 4B6WA 1E7PB 3JSVA 4WSFA 3U52E 4JPSA 4XDCA 5C5BB 2BTEA 3N7CA 2Z0OA 5JZEB 2UZSA 3OHMB 1YJ1A 1V6EA 3A9JA 2L8JA 2K00A 3BVGA 2Y8GA 1V2YA 3T8MA 1U29A 1UD7A 3N30A 4MM3A 3RULA 2K49A 3H7PB 2KC2A 2NBUA 2OEDA 3APCA 1HB8A 1YNTE 5D27A 4WAAA 3QBVB 2CY4A 4HSIA 1XX0A 3HHMA 4C56C 3NSUA 4B6HA 3ZNZB 4Q2JA 1TKEA 3JSVB 2BYTA 3WCQA 4P6VF 3Q3JA 1DDWA 3U12A 1KLVA 2JZZA 3A9JB 3GYOA 3ZW3A 1VRAB 2P8VA 1W1HA 4KHAA 3B08A 4MM3B 1Q10A 4A6KA 1DYQA 1TJEA 2OJWA 4HDOA 5BMGA 4F7UP 4LNOA 2P0DA 4AQ7A 4NNJB 3V62A 2LASA 4JKFA 4FJYA 1ET6A 1OEYA 2YF0A 4PS8A 4TQ1A 1ZSQA 3OLMD 3MHZA 1E7UA 3VDZA 2JZ3B 3ZQ4A 4NJ7A 1XLNA 1UWMA 1TY2A 2M38A 1CQVA 4AOFA 3RCZA 1JWMD 2KLCA 1RRBA 1NVID 3GZNB 3L4PA 1FOEA 2RMMA 2ABDA 2ZVNA 3A1QB 3QIJA 1FXIA 3ML9A 3EFCA 2KOXA 1K51A 3PREA 1JWUD 2J0KA 2UYZB 2QHOA 3BK2A 4MGIE 2LOXA 1V81A 1BXTA 4K1RB 2MDXA 4DHZB 2VH2A 2XNAC 2KACA 1XCQL 4YTMB 4LK0M 4NY0A 4DWFA 3L08A 4PQ0A 3S2AA 1FHOA 1XR0B 1EGXA 5HE1A 2H89B 5FR6A 2BB6A 2IO2B 3L54A 1XKEA 1WX8A 4L1RA 2K0PA 5C6RA 2RSUA 1MK7B 2GBNA 5HHDG 1X1GA 1Z2MA 2N1WA 1LW3A 1HZ5A 2MBQA 2IBIB 1MK9B 3FKYA 4YONA 3GS2A 2D07B 2IDYA 2K6DB 4ANXA 3RMKC 2ZZPB 2RR9A 2JU6X 3NHEB 3P4PB 1UNQA 3T3OA 3QC8B 2G35A 4TMAB 2KJRA 4CSQA 1HXYD 5BYSA 3DBLI 2EJ8A 3VR9B 5JHGA 5JHBA 4GOCA 2R2QA 2XBBC 2JPHA 4ANWA 3M63B 4HEA1 3APDA 4B95A 5J3YA 4JKEA 4K7SA 3MC8A 3QK0A 1MPEA 4HAUB 4PYZA 1NU2A 3MJWA 4GIVA 4PS7A 2RDHA 1D3ZA 3RNAC 3ABVB 3P4RB 2L3ZA 2TSSA 1N5XA 3PVLA 2KDIA 3SUZA 1NYRA 4HAXB 2CKHB 3AE6B 2COPA 4WJ7A 1FGYA 2UWQA 3KW5B 3N1ZC 1NYQA 3FILA 1OQNA 2MKRA 4LJOB 1YN3A 4ZRJA 4P16A 2D3CA 3Q14C 4KDLB 5LXHA 3D8DA 2JXXA 3SDLC 1KLGD 2WXNA 1FIQA 3VUXA 4QJ4B 3TEXA 2O2VA 4G3XB 1V97A 2LRUA 5G5GA 2LJIA 2X18A 2VZKD 2YRYA 1TBEA 2W2XC 4JK9A 3BVZA 1KRHA 3NZUA 2DYOA 1XCTL 5E6OA 1MHHE 4M01A 1WJ6A 2WS3B 3FILB 1K8RB 3A4SC 3DBRI 1AWEA 1PFDA 5HI1A 5H92C 1M7EA 3A8PA 4USAA 2NPTB 2GCJA 3TSSA 3M95A 4ZYNA 4KHOA 2FCNA 4KAXB 1Y56A 3G9WA 5EE9A 3CIRB 5HE3A 2O2VB 3CF6E 2UVMA 3I5JC 4DBBA 3VVWB 5DH9B 1WXSA 1UF0A 3QAQA 4EFOA 5IJMA 2WXGA 4YSXB 3Q3MC 1FNVA 4W9CA 3E9PA 4YT0B 3EUB2 1RFAA 1I7AA 3W5VB 1FRRA 4GGQA 4IUMB 2NTTA 3ZJTA 2DHZA 2KTFA 4JL9A 1PGAA 1XLPA 2JRHA 4EUTA 4HAWB 4FLHA 3WALA 3DDCB 1TTNA 2WDQB 2Y7BA 5D3DA 3NJTA 2D3BA 4NQKE 3HVZA 1I4HA 1Z87A 2Z14A 3P1MA 1QILA 2QMTA 2D4QA 4O1NA 2SAKA 4BZAA 1M7RA 2PMVA 1GOZA 2KMMA 1GB1A 2QKMA 1QOAA 4ZRPA 1I42A 1KTKA 1GGOA 3B2GA 3NRZA 1WWTA 2PEAA 1UBQA 5JVLA 1OMWA 4HHVA 2BWES 2ASQA 3ZNGC 3NS8A 1HTQA 3D32A 3PT2B 2FJUB 3FC4A 5CTRC 2G1EA 2JVCA 4BAXA 2DA0A 4DXFA 3RNEC 3Q8EA 1WFYA 4JLCA 1RWSA 2BCJA 1ROEA 3VAWA 1D6EC 2IO3B 1YQ4B 2MSED 2WXQA 4OVUA 2MWNB 2ZPYA 1UNPA 1E8XA 5BYQA 1Q67A 3FSSA 2VKIA 4NQLB 3MP9A 3WIMA 4DDID 1WIAA 1Q1OA 2G4DB 2LMCA 1XF5L 2Y5CA 1F2RI 2DX1A 2MEKA 4NAWA 4HCNB 5AEKB 2LKOA 2FIDA 2X8XX 3NUHB 2BYFA 4ILGB 1HB6A 1XLQA 1C3TA 3RZWC 3SFEB 5IN7A 2KGXB 5L81A 5E6PA 2K2JA 5JXVA 1PGBA 4JWSC 1SJED 4OT1A 3RD2A 2GUMA 5DCNA 4ZHOA 5J17A 4HAZB 1HE8A 4FJVB 3QX1A 4WWMA 2M19A 2DHKA 2ONQA 2PE6B 4FN2A 2YS3A 3I57A 2L7RA 3ML8A 1X05A 1UPRA 1P1AA 1WXMA 4FA6A 1B9RA 1H8CA 4Y94A 2ROZB 2VZKB 2KJHB 4KGRA 4KIKA 4MT5A 4FHKA 1T3QA 3L16A 3PLVA 2IPKD 1Q5WB 2L1CA 3UQBA 4TKNA 5BMHA 2H88B 4LDTD 4GDKA 3ZUNA 2RPVA 2QDFA 2D2QA 2CY5A 3PRMB 3NOBA 4JKGA 4HRSA 4IM0A 1WGRA 1FXAA 2C7HA 4KZ0A 2ZCBA 5FK9C 2ZKMX 3UQAA 5D94A 2CAYA 2E3TA 1GPXA 4CHMA 4EMOA 3PV1A 2GRIA 4KIKB 1EU4A 2BW2A 3AU5A 2JWUA 2DENB 3TIXA 4L6EA 2Y5PA 2L2IA 3SD5A 2K8CA 2QCZA 5DHFB 1TS4A 2YT1A 3DCGA 4GDKB 4IWOA 4JKHA 5GXGB 4YSYB 3AMZA 3ULBA 2CJNA 2YS5A 1WJNA 1S3SG 1N62A 2INPE 4EEWA 2MFQA 4HDQA 3P63A 4JKGB 4GMVA 3FLVA 3ZLZA 3A58A 4AS1A 3IT6B 2C7MB 1WR6E 5G2NA 4HLEA 4E74A 2XEWA 1YOVB 1ENFA 2L1AA 1WJUA 2DYQA 1HBKA 3B0AA 3ULCA 1BTKA 4ACFA 3GZNI 2QILA 2IO1B 2PW9A 3J9CA 4B9KA 1IYFA 2RD0A 1L4ZB 2KZRA 1T0RC 2WXPA 2WXLA 4IC7B 2AQ1B 1UZXB 2IYDB 3ETRA 3R2IA 1K53A 3DQVA 1FMAD 1V9JA 2K39A 2IGDA 2ZPNA 3DHHC 4XE0A 3HVDA 4RGNA 4BFRA 1WGGA 3GB1A 2HJ1A 2FCSA 2D11A 2KR0A 1IPGA 1QF6A 1N3HA 2DYNA 3TEYA 3JW0X 3KQ4A 1VBHA 1WM2A 3P2BA 2JT4B 1EAZA 2WU5B 1YN4A 3ZTDA 4N9F4 1OQYA 1T5XD 3O65B 1RRPB 2D9YA 4XYCA 1TKYA 3PZ7A 1OY2A 4W9FA 1BT0A 2R09A 4EZJA 4ZDVA 2AL6A 5DI9B 3KYDD 1F0ZA 4RF1A 1E9MA 3P6AA 4N59A 1PQSA 2MH7A 4HVBA 1GUAB 2Z0PA 3AI5A 2A5UA 2ELBA 1ZXHA 3QQ8B 3NVYA 2Z59A 3AEFB 1QT9A 3PHWB 3GE3C 1ZW7A 2K5PA 3TL5A 4J6IA 2G4SA 4ILHA 4YTNB 2GS0A 1MVKA 1P3RA 4G0NB 3CWIA 3LJUX 2KIEA 3Q3FA 4HAYB 3SHQA 4EOYA 1AN8A 2IY0B 1RLFA 4BOSC 1FPYA 3RI7C 4DHJD 4Z2NA 1TS2A 1MKEA 1U2BA 1ZC4B 1U5DA 4REZA 2V76A 1EWCA 1WI1A 3DVNV 1Y8RC 2N9EB 4LDTB 4ARIA 1FFUA 4HB0B 1UELA 2Z59B 4LCDE 4HCPB 1OQQA 1LB1A 1J0WA 2RGNB 1VBGA 2YEPF 2AYOB 3Q2AC 4BVUC 4CQNA 3A98B 1EF1A 2AQ2B 2I2YA 2C60A 1I4GA 1X11A 2BVCA 1ZGUB 4TV3A 2KQ4X 1FHWA 3OJ4B 1Q0WB 1FD6A 3DXCA 3A33B 4NJCA 3AULA 1EO6A 3VTWA 2L76A 1R7SA 1PYWD 1JWAD 3UI3A 1XD3B 1XD4A 2D9XA 2DN6A 3RN9C 1H10A 4JKCA 3A1QA 2ZNVB 3DXEA 1RAXA 1LM8B 4HK2A 3QWMA 4H8SA 1UUPA 1JCKB 1UNSA 2AEHA 2LBBA 3QCAA 2J52A 1OTRB 1C79A 3JVZX 2HDEA 1FHXA 1N5WA 2JSVX 2ZCCA 4IDIA 4ITKA 4AJWA 4OSNA 4OZCA 4DQOC 5J18A 1V5TA 1C4PA 1TYGB 4IWPA 1JALA 3SBGA 2GBRA 2PE9A 1KLUD 2RGFA 4GDLA 2GB1A 3PPAA 1JQ4A 1WRDB 4OVZA 3IBEA 2KC1A 1E8WA 1PLSA 5I2MA 1V80A 4UDUC 3EHVA 5IO9A 2WH5A 1J7BA 1AQCA 3UIOB 3VTUA 4KSKC 4HAVB 1B55A 5I2SA 5IA7A 4NJ6A 4CO7A 4LNIA 2YVCA 2HE7A 1F77A 1YN5A 2C5LC 3ZO5B 4IFSA 2LFIA 2J59M 1MIZB 1R4MB 4YL8A 1L6VA 1MPHA 4GDLB 3PG7A 2EELA 1HZ6A 1ZDXA 4II3B 4DX8A 3NWFA 1WJ1A 2BT6A 3MTNB 3FP5A 2LUEA 5J3QA 1WGKA 3E66A 1GNUA 3AEAB 2KVZA 3V6CB 3F5RA 1D5ZC 1T0QC 1YX6B 5FI1A 3AEBB 4WWOA 2OTXA 2PPHA 2N9KA 4GXBA 1QZEA 4A6HA 5D3IB 3NZ3A 2MBHA 2GJYA 1HQRD 5BMIA 4W9JA 2PLPA 1ZE3D 4I6NB 2DBYA 2FAZA 3W1SA 4C80A 3V60A 1JRUA 2WDRB 2J53A 3SNHA 4RH6A 3PZDA 3W5UB 4A20A 3ZJVA 2EKEC 2KHWB 5HKHA 4WJQA 4KVGB 1DIKA 4GLSC 2ICIA 1FEHA 2KVRA 1VZ8A 1MG4A 3L17A 3RNBC 2PKOA 3R3MA 1RM6C 1T6BX 4QJ3B 1IGCA 1WMHB 2WX1A 3Q3NC 1J0GA 4M8MA 4KDIC 4TYZA 4DHJB 2LD9A 5KQ4A 1WGYA 4YXDB 4K7UA 1H4RA 1PGXA 3FM8C 3PRPB 4RGOS 2KO3A 3SV1A 2JUOA 1WM3A 3PSEB 1JDEA 4DXAB 3R7QA 2V3NA 3PO0A 2NPTA 1IRSA 3TFMA 1S1QB 3E9OA 1XEEA 3DHIC 3IXSA 2IYBA 3ZNID 5DPWA 2Z0EB 3VH4B 2Z0DB 4TSSA 2ZW0A 4L2YA 2LGYA 3R66C 3OANA 1V88A 1C78A 3ZYYX 2CHZA 3QWZB 3U30A 2BQQA 4EZLA 1JW9D 2J0JA 3LDZE 2BBCA 2L52A 3F0WA 1OQRA 3V3XA 4AJYB 2OQBA 1FM0D 2D9ZA 4HROA 1TGZB 3T06A 1AW7A 4KX6B 4A3OA 2WYQA 4PYUA 2KUPA 2LHEA 1UGJA 3MC0B 1TS3A 5E6JA 4IW0A 1V49A 3WANA 2MBBB 1NDDA 4IWQA 1UGMA 1SE2A 2IGGA 3EA6A 1GAQB 2CS4A 4HATB 1ZKHA 4S0RA 1M94A 1XO3A 3KZ1A 1L0XB 3AE4B 3KY9A 1E90A 3ZDMC 4ICUA 3DVGX 2OJRA 3HIZA 5LNK1 5J2RA 1P7EA 1MI1A 1OGWA 2YT2A 2DFKA 3AEEB 2IY1B 3I3TB 2FIFA 2KDMA 1QQRA 1D4BA 3AE7B 3PVUA 5C1ZA 2WLBA 1NTVA 1FCCC 2LVOA 5D3XA 2QIEB 2WQYB 3A9KA 1SE9A 2JRIB 2Z8LA 3M1IB 2V4IB 1FNUA 1ET9A 3NS1A 5C2TB 3RNGC 1GC7A 4HKQA 2ACZB 3R7RA 3FVCA 2M4NA 3RNFC 3DBSA 2JX5A 1I7HA 2Q13A 4KKIA 2NR2A 2Z4DA 3TEZA 4F7HA 3WAPA 2FDQA 4KKJA 4PNKA 3A4RA 2KDEB 2RQ1A 2LGSA 2WDVB 2V3PA 1V61A 3VH3B 1FNWA 2GBKA 1YQ3B 1MFWA 3KWLA 4C0AA 1K50A 3R2TA 2LOZA 4JGHB 3Q6BA 1XLOA 4MGYE 3A9KB 1F2RC 3X0WA 3RFZB 2LYDA 2HD5B 2L32A 2KFJA 2CB8A 1DOYA 3BK1A 3T9LA 3R8BA 3ODWA 3ZJUA 1QQGA 4LLGM 3NG0A 2HRJA 4JWUC 2NMQA 1WE6A 3LYYA 1MJDA 4ANVA 2IO0B 3RZFA 2GOWA 4QJ5B 3N32A 2IZVB 4P1BC 3D8FA 5LOPB 1C4CA 1SE4A 2H7DA 3E9SA 2LWPA 3B1LX 2KFKA 4D6WA 3KVFB 2AQ3B 1KF6B 3AE3B 3CSTA 3HSAA 5JP4A 5LG4B 3N3KB 3O13A 3ZGZA 1WXAA 3GP7A 1WX7A 4WH4A 2N7EA 1KFYB 2KMAA 2KYWA 3TO1A 4PK1A 1VJKA 5AUIA 2L83A 4HKZE 2MJEA 2R82A 1JROA 3UGBB 2BWFA 2KX0A 4IKGA 2K25A 4ARCA 3PSCA 2NMBA 5DPRA 1SGHA 2K22A 2KDBA 3ZXRA 2RRFA 4A55A 2KFKB 2KWUB 3Q69A 3I9V1 1L7YA 4XZ4A 2JP2A 4FBJB 2FJLA
chains in the Genus database with same CATH topology
4F7ZA 1V5MA 3U7DA 4JKDA 3QJZA 4K81A 1WGQA 2FCQA 3ECIA 2W9NA 3V61A 2RNRB 1WZ0A 2NBWB 1KOTA 3VUWA 2N23A 3DPDA 3ZTCA 2I1JA 1KZGA 2BYEA 3EECA 5AZFA 3VFKA 1OEYJ 4GSWA 2EMTA 2MCNB 3PS6A 2DX5A 3SYXA 1EUVB 4RM8A 4TUUA 5AZGA 1QC6A 3UINB 2KANA 4A3PA 4RM9A 2M17A 5KCVA 4BBKA 4WWPA 2G3QB 2XK5B 2CHXA 2COAA 1UPQA 3QHTA 3A8QA 4XX5A 3MPXA 2ZEQA 3IVFA 3IHPC 2KMCA 4JK8A 2RVBB 1GG3A 4MY6A 1WR1A 1XODA 3TCAA 2DX5B 4W9KA 3VHTC 4DX90 5DPTA 2IFSA 1MIXA 2A4ZA 3H9DA 4HB3B 1NI2A 4ZRIA 4G50A 1U5EA 5FI0A 1WGDA 3EC8A 4MK0A 3H7SA 2YT0A 3VUYA 4GN1A 2M8SA 3ALBA 4HB2B 5CHWA 4XWXA 1ZC3B 4I6PA 2DYBA 3ENEA 4GU2A 2C9WB 2LG1A 2NCNA 4M0WB 1R4MI 1UBIA 4W9DA 1SHCA 2KDFB 4JKBA 3RUIB 1IP9A 4M8NA 4A5KA 5AZHA 2XQNM 3KH0A 2NVUI 2K8HA 1UEFA 1A5RA 1ZVRA 1SIFA 5DPSA 2KXJA 1WGHA 2Z0QA 2ZVOA 3HM3A 2KJ6A 3MHSD 3ZRCA 1TZ1A 2I1KA 2K8BA 3ENBA 5DIFB 4DBGA 3OAWA 4P7IA 3W1SC 2DAJA 3BJIA 2BPSA 4IOYX 1P3QU 5DHAB 3WA0A 1K5DB 4W9EA 4CHKA 3KUCB 3L10B 2RSGA 3RYTA 3RT3B 4E71A 4BOZB 5JH5C 4JK7A 4HPLB 1WX9A 4Z2MB 2MW5A 4EKUA 4KHBB 3UZTA 4A6FA 4GMXB 3L0WB 1PFJA 4DK5A 4HJKA 3ODOA 2J0MA 5D3WA 3H1UA 1DDMA 2W2WA 1P98A 2QKLA 4ASWC 2P0HA 1ST7A 4NPNA 2D9WA 3BINA 2LZ6A 3HQCA 4JKAA 3C0RB 4MT7A 1KBLA 3H6NA 2R0DA 2FJ9A 4A6FB 3K9PB 2MLBA 2BGFA 3ZKJC 4JQWC 3PTFC 5E6NA 1RJ2A 2PZ1A 1WXVA 4IAPA 3MDBC 3KSYA 1LQBA 1DDVA 1WH3A 4JIOU 2M1MA 3BY4B 5JLJB 3HM6X 2JWZA 3TVVA 1FXTB 3GOEA 3TBLD 5CLQB 5C23A 2D10A 1GC6A 3WAOA 1WYWB 4KSLC 4FJZA 4II2B 4WVFB 2LRWA 1KC7A 2ZJDA 5LLIA 1P5TA 4GZUA 4BKGA 2Y5BB 3SBTA 4KV2A 5KHQA 2EC1A 4HXDA 2MBOA 1Y19B 1T0YA 2KCJA 3K9OB 2V4LA 2RPQA 4CYEA 3EPYA 4IG7B 3DVNU 3IG3A 1WMHA 3WYFB 2CHWA 2NZ8B 3TMPB 1J19A 2YS1A 3DXDA 2N7DA 3ZIMA 1BTNA 5D3VA 1EF5A 3ZVVA 1E8ZA 3AU4A 1LFDA 4ILJA 2DZKA 2LGDA 2DAFA 1BAKA 2N9PC 2LXAA 3OJ3A 1U5FA 4CHJA 1W1GA 2G45B 4W9GA 4LJPB 4E3CA 4HB4B 4K7WA 4AWJA 2LI5A 4W9IA 3LJ3A 2N9XA 2RUKB 4HPMB 3EFUA 3WAMA 4I6LB 1V89A 5EDSA 3NY5A 3TW1A 1ZM0A 3AJ4A 2JF5A 2KLGA 4IM2A 3ZNHB 5GMVA 4W9LA 4MSMB 2DIKA 5L83A 1I2HA 1WG7A 2I5CA 2GMIC 1WZ3A 3ML4A 3AXCA 1XCGA 3DBHI 1VD2A 5G55A 2ADZA 2KK8A 3KUDB 2FCMA 3IFWB 1GJZA 4AP4C 5J3TA 2MWSB 2L0TA 4URKA 3D8EA 2YLMA 2GCLA 3QARA 2C7NB 3V6EB 1K5GB 4ANUA 2DTCA 2P0FA 2DKQA 2K6QA 2VSZA 5KQ1A 1TJ6A 3GYPA 4MGKE 5D3YA 1FGZA 1P0RA 2VRRB 3VTVA 4F7GA 1E7VA 1BWNA 2W2XD 1ISNA 1I35A 2WX0A 4OVVA 5IAAC 2DHIA 2D9VA 3FEHA 2COCA 1KJTA 2CRFA 2LVQA 2H7EA 2V3SA 5EFXA 1KI1B 4MGZE 3ZRFA 1FB8A 5TR5A 2KKCA 2MX2A 5LONB 2JY6A 2M14A 3L13A 2CU1A 4IM3A 1YX5B 1Z5SB 1TQZA 3PVWA 5JHAA 3DVGY 2DHJA 4DHZE 4BKSD 5LXIB 2BYVE 2X0SA 2PJHA 1WVHA 1KM7A 3PGEA 3CSFA 1DBHA 3HK0A 4WJNA 3ZVRA 3ZDTA 1XQQA 4BBNF 1WGUA 1G6JA 1V5OA 4G11A 3UIPB 3QA8A 1YQBA 1UH6A 2LJ5A 2OOBB 5D6JB 2AWTA 2CQUA 1KZ7A 4MEMA 3PHXB 4K2OA 1AARA 2M0XA 1CMXB 3DOWA 4X57B 4WQOB 5C16A 4HWIB 3X23A 1L2NA 2DZMA 1MAIA 4KZCA 4BBNC 3TJPA 1EVHA 2KQ7A 3VXWA 1VCBA 2LVPA 1NVLA 3W1YA 4K17A 4F8CB 5JHHA 2O6VD 3PP2A 2MQJA 3O96A 1YIWA 2FUHB 5HE0A 1NTYA 3HW2B 2UZRA 2D3GA 2K1FA 3U8ZA 2BF8B 2BKFA 1TXDA 2XK5A 5CX3A 2MRPA 2NBVB 2CR5A 4XC2A 1LXDA 4EJNA 2LGXA 1E8YA 4NAWB 2K2UA 2ZNVC 2KD0A 1E5WA 2KNBA 1YD8U 5HE2A 5D2MB 3CMMB 3RCPA 2LXCA 1J8CA 4ICVA 2NS5A 3VOQA 3KYCD 5CHFA 2V1YA 2DLWA 4NSWA 2MA9B 3E9LA 4ZRKA 5D7GA 4MJSA 2GBMA 4FULA 3PLUA 3PEGA 1WI0A 2L0FA 2I5FA 5L95C 4DDGD 3M3JA 2HJ8A 2COFA 3KRXA 2KN5A 4BKSA 4FADA 2HTHA 2KQSA 4WJPA 5GOWB 5C79A 2REXA 4W9HA 4BKTA 4WJOA 4MDKE 1WY8A 1P9DU 4AUQC 5CLLB 2DZJA 4RMAA 4TQ0A 1V5PA 1R4NI 4PS3A 2KX3A 1C1YB 3CXBB 1FAOA 1NTIA 4GB9A 3NZSA 1X1MA 4MJSB 3SU8X 3ODXA 1X1FA 1U27A 2ELAA 3KRWA 1WF9A 3APFA 2VRWB 3SO6A 2J7QB 5CHVC 1U5GA 5KHOA 4GPTB 1X86A 2HTHB 3JYUA 1DROA 2E2XA 2WWZA 4K2PA 2DKPA 1WJMA 2DYMA 3VIAA 2BKRB 1P6SA 4WWNA 1V5UA 2KWCA 2AL3A 2MBEA 2MP2A 1W1DA 4F1SA 2EMSA 1ACAA 1V86A 3VQIA 2YSZA 2B3AA 2O6VA 2KTRA 3V5WA 2L00B 2N1VA 2DZIA 3ONSA 2FNJB 2L05A 4D0NB 2R2OA 1WJ4A 1UNRA 3PRZA 1WE7A 1PMSA 1F9JA 3P7ZA 2RLOA 5C5BA 2MP2B 2WDTB 3M62B 1XT9B 2GBJA 2ROVA 3KUZA 2N0YA 4FHJA 1MG8A 2KWVB 5BO4B 2O6VB 3UF8A 2KTRB 3H7PA 1NBFC 4MSQB 3CIKA 2LULA 1DYNA 2N4FA 1U4AA 4MH0E 2Y8FA 4MELA 2CODA 4EZKA 1Y5OA 4B6WA 3JSVA 4WSFA 5C5BB 3N7CA 2Z0OA 5JZEB 2UZSA 1YJ1A 1V6EA 3A9JA 2L8JA 2K00A 2Y8GA 1V2YA 3T8MA 1U29A 1UD7A 3N30A 4MM3A 3RULA 3H7PB 2KC2A 2NBUA 3APCA 1HB8A 5D27A 4WAAA 3QBVB 2CY4A 1XX0A 3HHMA 3NSUA 4B6HA 3ZNZB 3JSVB 3Q3JA 1DDWA 1KLVA 2JZZA 3A9JB 3GYOA 3ZW3A 2P8VA 1W1HA 4KHAA 3B08A 4A6KA 4HDOA 4F7UP 2P0DA 4NNJB 3V62A 2LASA 4JKFA 4FJYA 1OEYA 2YF0A 4PS8A 4TQ1A 1ZSQA 3OLMD 1E7UA 3VDZA 2JZ3B 4NJ7A 2M38A 4AOFA 3RCZA 2KLCA 1RRBA 1FOEA 2ABDA 2ZVNA 3A1QB 3QIJA 3ML9A 2KOXA 3PREA 2J0KA 2UYZB 2QHOA 4MGIE 2LOXA 1V81A 4K1RB 4DHZB 2MDXA 4NY0A 4DWFA 3L08A 4PQ0A 3S2AA 1FHOA 1XR0B 1EGXA 5HE1A 5FR6A 2IO2B 3L54A 1XKEA 1WX8A 5C6RA 2RSUA 1MK7B 2GBNA 1X1GA 1Z2MA 2N1WA 1LW3A 2MBQA 2IBIB 1MK9B 4YONA 2D07B 2K6DB 4ANXA 2ZZPB 2RR9A 3NHEB 1UNQA 3QC8B 2G35A 2KJRA 3DBLI 2EJ8A 5JHGA 5JHBA 4GOCA 2R2QA 2XBBC 2JPHA 4ANWA 3M63B 3APDA 4B95A 5J3YA 4JKEA 4K7SA 3QK0A 4HAUB 4PYZA 1NU2A 3MJWA 4GIVA 4PS7A 1D3ZA 2L3ZA 3PVLA 2KDIA 3SUZA 4HAXB 2CKHB 2COPA 4WJ7A 1FGYA 2UWQA 3KW5B 1OQNA 2MKRA 4LJOB 4ZRJA 4KDLB 5LXHA 3D8DA 2JXXA 3SDLC 3VUXA 2O2VA 4G3XB 2LRUA 2X18A 2YRYA 1TBEA 2W2XC 4JK9A 3NZUA 2DYOA 5E6OA 1WJ6A 1K8RB 3A4SC 3DBRI 1AWEA 1M7EA 3A8PA 2NPTB 2GCJA 3M95A 4ZYNA 4KHOA 2FCNA 4KAXB 3G9WA 5HE3A 2O2VB 3CF6E 2UVMA 4DBBA 3VVWB 5DH9B 1WXSA 3QAQA 4EFOA 5IJMA 4W9CA 3E9PA 1RFAA 1I7AA 4GGQA 4IUMB 2DHZA 2KTFA 4JL9A 2JRHA 4EUTA 4HAWB 4FLHA 3WALA 3DDCB 1TTNA 2Y7BA 4NQKE 1Z87A 2D4QA 1M7RA 2QKMA 1I42A 1GGOA 2PEAA 1UBQA 5JVLA 1OMWA 4HHVA 2BWES 2ASQA 3ZNGC 3NS8A 3D32A 3PT2B 5CTRC 2JVCA 2DA0A 1WFYA 4JLCA 2BCJA 3VAWA 2IO3B 2MSED 4OVUA 2MWNB 2ZPYA 1UNPA 1E8XA 1Q67A 3FSSA 2VKIA 4NQLB 3WIMA 4DDID 1WIAA 1Q1OA 2G4DB 2DX1A 4NAWA 4HCNB 5AEKB 2LKOA 2FIDA 2BYFA 4ILGB 1HB6A 1C3TA 3RZWC 2KGXB 5L81A 5E6PA 2K2JA 3RD2A 5DCNA 5J17A 4HAZB 1HE8A 4FJVB 3QX1A 2DHKA 2PE6B 4FN2A 2YS3A 2L7RA 3ML8A 1X05A 1UPRA 1P1AA 1WXMA 4FA6A 1H8CA 4Y94A 2ROZB 2KJHB 4KIKA 4FHKA 3L16A 3PLVA 1Q5WB 2L1CA 3UQBA 4TKNA 4LDTD 4GDKA 3ZUNA 2D2QA 2CY5A 3PRMB 3NOBA 4JKGA 4IM0A 1WGRA 2C7HA 4KZ0A 2ZCBA 3UQAA 5D94A 2CAYA 4CHMA 4EMOA 3PV1A 4KIKB 3AU5A 2DENB 3TIXA 4L6EA 2L2IA 3SD5A 2K8CA 5DHFB 2YT1A 3DCGA 4GDKB 4IWOA 4JKHA 3ULBA 2YS5A 1WJNA 1S3SG 4EEWA 2MFQA 4HDQA 4JKGB 4GMVA 3FLVA 3ZLZA 2C7MB 1WR6E 5G2NA 4HLEA 4E74A 2XEWA 1WJUA 2DYQA 1HBKA 3B0AA 3ULCA 1BTKA 3GZNI 2IO1B 4B9KA 1IYFA 2RD0A 2KZRA 4IC7B 2IYDB 1UZXB 3DQVA 1V9JA 2K39A 2ZPNA 4BFRA 1WGGA 2FCSA 2D11A 1IPGA 1N3HA 2DYNA 3JW0X 1VBHA 1WM2A 3P2BA 2JT4B 1EAZA 3ZTDA 4N9F4 1OQYA 3O65B 1RRPB 2D9YA 1OY2A 4W9FA 1BT0A 2R09A 4EZJA 4ZDVA 2AL6A 5DI9B 3KYDD 3P6AA 1PQSA 4HVBA 1GUAB 2Z0PA 3AI5A 2A5UA 2ELBA 3QQ8B 3PHWB 1ZW7A 3TL5A 4J6IA 2G4SA 4ILHA 2GS0A 1P3RA 4G0NB 3LJUX 3Q3FA 4HAYB 3SHQA 4EOYA 2IY0B 1RLFA 4BOSC 4DHJD 4Z2NA 1MKEA 1U2BA 1ZC4B 1U5DA 2V76A 1WI1A 3DVNV 1Y8RC 2N9EB 4LDTB 1UELA 4HB0B 2Z59B 4LCDE 4HCPB 1LB1A 1J0WA 2RGNB 1VBGA 2AYOB 4BVUC 3A98B 1EF1A 2C60A 1X11A 1ZGUB 4TV3A 1FHWA 3OJ4B 1Q0WB 3DXCA 3A33B 3AULA 1EO6A 3VTWA 2L76A 1XD3B 1XD4A 2D9XA 2DN6A 1H10A 4JKCA 3A1QA 2ZNVB 3DXEA 1RAXA 1LM8B 4HK2A 3QWMA 4H8SA 2AEHA 2LBBA 3QCAA 1OTRB 3JVZX 1FHXA 2ZCCA 4AJWA 5J18A 1V5TA 4IWPA 3SBGA 2GBRA 2PE9A 2RGFA 4GDLA 3PPAA 1WRDB 3IBEA 2KC1A 1E8WA 1PLSA 1V80A 3EHVA 2WH5A 1AQCA 3UIOB 3VTUA 4KSKC 4HAVB 1B55A 5IA7A 4NJ6A 4CO7A 2YVCA 2HE7A 2C5LC 3ZO5B 4IFSA 2J59M 1MIZB 4YL8A 1MPHA 4GDLB 3PG7A 4II3B 4DX8A 1WJ1A 3MTNB 3FP5A 2LUEA 5J3QA 3E66A 1GNUA 3V6CB 3F5RA 1YX6B 5FI1A 4WWOA 2OTXA 2PPHA 4GXBA 1QZEA 4A6HA 2MBHA 2GJYA 4W9JA 4I6NB 2FAZA 3W1SA 3V60A 1JRUA 3SNHA 3PZDA 4A20A 2EKEC 2KHWB 5HKHA 4WJQA 4KVGB 1DIKA 2KVRA 3L17A 3R3MA 1WMHB 2WX1A 1J0GA 4M8MA 4KDIC 4TYZA 4DHJB 2LD9A 5KQ4A 1WGYA 4K7UA 1H4RA 3FM8C 3PRPB 2KO3A 3SV1A 2JUOA 1WM3A 3PSEB 1JDEA 4DXAB 3R7QA 2NPTA 1IRSA 3TFMA 1S1QB 3E9OA 2IYBA 3ZNID 5DPWA 2Z0EB 3VH4B 2Z0DB 2LGYA 3R66C 3OANA 1V88A 2CHZA 3QWZB 3U30A 4EZLA 2J0JA 3LDZE 3F0WA 4AJYB 2OQBA 2D9ZA 1TGZB 3T06A 4A3OA 2WYQA 4PYUA 2KUPA 4IW0A 1V49A 3WANA 2MBBB 1NDDA 4IWQA 1UGMA 2CS4A 4HATB 1ZKHA 1M94A 3KZ1A 3ZDMC 3KY9A 1E90A 4ICUA 3DVGX 2OJRA 3HIZA 5J2RA 1OGWA 2DFKA 2IY1B 3I3TB 2FIFA 3PVUA 5C1ZA 1NTVA 2LVOA 5D3XA 3A9KA 1SE9A 2JRIB 3M1IB 1GC7A 3R7RA 2M4NA 3DBSA 2Q13A 2NR2A 4F7HA 3WAPA 2FDQA 4PNKA 3A4RA 2KDEB 2RQ1A 1V61A 3VH3B 2GBKA 4C0AA 4JGHB 2LOZA 4MGYE 3A9KB 3X0WA 2LYDA 2HD5B 2KFJA 2CB8A 3T9LA 3ODWA 1QQGA 2HRJA 1WE6A 4ANVA 2IO0B 3RZFA 2GOWA 3N32A 2IZVB 3D8FA 5LOPB 2H7DA 2LWPA 3B1LX 2KFKA 3KVFB 3CSTA 5JP4A 3N3KB 1WXAA 1WX7A 2N7EA 2KMAA 3TO1A 2R82A 3UGBB 2BWFA 2KX0A 2K25A 3PSCA 2NMBA 5DPRA 1SGHA 2KDBA 2KFKB 2KWUB 1L7YA 4XZ4A 2JP2A 4FBJB 2FJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4F7Z A;  1V5M A;  3U7D A;  3QJZ A;  4K81 A;  1WGQ A;  2FCQ A;  3ECI A;  2W9N A;  3V61 A;  2RNR B;  1WZ0 A;  2NBW B;  1KOT A;  3VUW A;  2N23 A;  3DPD A;  3ZTC A;  2I1J A;  1KZG A;  2BYE A;  3EEC A;  5AZF A;  3VFK A;  1OEY J;  4GSW A;  2EMT A;  2MCN B;  3PS6 A;  2DX5 A;  3SYX A;  1EUV B;  4RM8 A;  4TUU A;  5AZG A;  1QC6 A;  3UIN B;  2KAN A;  4A3P A;  4RM9 A;  2M17 A;  5KCV A;  4BBK A;  4WWP A;  2G3Q B;  2XK5 B;  2CHX A;  2COA A;  1UPQ A;  3QHT A;  3A8Q A;  4XX5 A;  3MPX A;  2ZEQ A;  3IVF A;  3IHP C;  2KMC A;  2RVB B;  1GG3 A;  4MY6 A;  1WR1 A;  1XOD A;  3TCA A;  2DX5 B;  4W9K A;  3VHT C;  4DX9 0;  5DPT A;  2IFS A;  1MIX A;  2A4Z A;  3H9D A;  4HB3 B;  1NI2 A;  4ZRI A;  4G50 A;  1U5E A;  5FI0 A;  1WGD A;  3EC8 A;  4MK0 A;  3H7S A;  2YT0 A;  3VUY A;  4GN1 A;  2M8S A;  3ALB A;  4HB2 B;  5CHW A;  4XWX A;  1ZC3 B;  4I6P A;  2DYB A;  3ENE A;  4GU2 A;  2C9W B;  2LG1 A;  2NCN A;  4M0W B;  1R4M I;  1UBI A;  4W9D A;  1SHC A;  2KDF B;  3RUI B;  1IP9 A;  4M8N A;  4A5K A;  5AZH A;  2XQN M;  3KH0 A;  2NVU I;  2K8H A;  1UEF A;  1A5R A;  1ZVR A;  1SIF A;  5DPS A;  2KXJ A;  1WGH A;  2Z0Q A;  2ZVO A;  3HM3 A;  2KJ6 A;  3MHS D;  3ZRC A;  1TZ1 A;  2I1K A;  2K8B A;  5DIF B;  4DBG A;  3OAW A;  4P7I A;  3W1S C;  2DAJ A;  3BJI A;  2BPS A;  4IOY X;  1P3Q U;  5DHA B;  3WA0 A;  1K5D B;  4W9E A;  4CHK A;  3KUC B;  3L10 B;  2RSG A;  3RYT A;  3RT3 B;  4E71 A;  4BOZ B;  5JH5 C;  4HPL B;  1WX9 A;  4Z2M B;  2MW5 A;  4EKU A;  4KHB B;  3UZT A;  4A6F A;  4GMX B;  3L0W B;  1PFJ A;  4DK5 A;  4HJK A;  3ODO A;  2J0M A;  5D3W A;  3H1U A;  1DDM A;  2W2W A;  1P98 A;  2QKL A;  4ASW C;  2P0H A;  1ST7 A;  4NPN A;  2D9W A;  3BIN A;  2LZ6 A;  3HQC A;  3C0R B;  4MT7 A;  3H6N A;  2R0D A;  2FJ9 A;  4A6F B;  3K9P B;  2MLB A;  2BGF A;  3ZKJ C;  4JQW C;  3PTF C;  5E6N A;  1RJ2 A;  2PZ1 A;  1WXV A;  4IAP A;  3MDB C;  3KSY A;  1LQB A;  1DDV A;  1WH3 A;  4JIO U;  2M1M A;  3BY4 B;  5JLJ B;  3HM6 X;  2JWZ A;  3TVV A;  1FXT B;  3GOE A;  3TBL D;  5CLQ B;  5C23 A;  2D10 A;  1GC6 A;  3WAO A;  1WYW B;  4KSL C;  4FJZ A;  4II2 B;  4WVF B;  2LRW A;  2ZJD A;  5LLI A;  1P5T A;  4GZU A;  4BKG A;  2Y5B B;  4KV2 A;  5KHQ A;  2EC1 A;  4HXD A;  2MBO A;  1Y19 B;  1T0Y A;  2KCJ A;  3K9O B;  2V4L A;  2RPQ A;  4CYE A;  3EPY A;  4IG7 B;  3DVN U;  3IG3 A;  1WMH A;  3WYF B;  2CHW A;  2NZ8 B;  3TMP B;  1J19 A;  2YS1 A;  3DXD A;  2N7D A;  3ZIM A;  1BTN A;  5D3V A;  1EF5 A;  3ZVV A;  1E8Z A;  3AU4 A;  1LFD A;  2DZK A;  2LGD A;  2DAF A;  1BAK A;  2N9P C;  2LXA A;  3OJ3 A;  1U5F A;  4CHJ A;  1W1G A;  2G45 B;  4W9G A;  4LJP B;  4E3C A;  4HB4 B;  4K7W A;  4AWJ A;  2LI5 A;  4W9I A;  3LJ3 A;  2N9X A;  2RUK B;  4HPM B;  3EFU A;  3WAM A;  4I6L B;  1V89 A;  5EDS A;  3NY5 A;  3TW1 A;  1ZM0 A;  3AJ4 A;  2JF5 A;  2KLG A;  4IM2 A;  3ZNH B;  5GMV A;  4W9L A;  4MSM B;  5L83 A;  1I2H A;  1WG7 A;  2I5C A;  2GMI C;  1WZ3 A;  3ML4 A;  3AXC A;  1XCG A;  3DBH I;  1VD2 A;  5G55 A;  2ADZ A;  2KK8 A;  3KUD B;  2FCM A;  3IFW B;  1GJZ A;  4AP4 C;  5J3T A;  2MWS B;  2L0T A;  4URK A;  3D8E A;  2YLM A;  2GCL A;  3QAR A;  2C7N B;  3V6E B;  1K5G B;  4ANU A;  2DTC A;  2P0F A;  2DKQ A;  2K6Q A;  2VSZ A;  5KQ1 A;  1TJ6 A;  3GYP A;  4MGK E;  5D3Y A;  1FGZ A;  1P0R A;  2VRR B;  3VTV A;  4F7G A;  1E7V A;  1BWN A;  2W2X D;  1ISN A;  1I35 A;  2WX0 A;  4OVV A;  5IAA C;  2DHI A;  2D9V A;  3FEH A;  2COC A;  1KJT A;  2CRF A;  2LVQ A;  2H7E A;  2V3S A;  5EFX A;  1KI1 B;  4MGZ E;  3ZRF A;  1FB8 A;  5TR5 A;  2KKC A;  2MX2 A;  5LON B;  2JY6 A;  2M14 A;  3L13 A;  2CU1 A;  4IM3 A;  1YX5 B;  1Z5S B;  1TQZ A;  3PVW A;  5JHA A;  3DVG Y;  2DHJ A;  4DHZ E;  4BKS D;  5LXI B;  2BYV E;  2PJH A;  1WVH A;  1KM7 A;  3PGE A;  3CSF A;  1DBH A;  3HK0 A;  4WJN A;  3ZVR A;  3ZDT A;  1XQQ A;  4BBN F;  1WGU A;  1G6J A;  1V5O A;  4G11 A;  3UIP B;  3QA8 A;  1YQB A;  1UH6 A;  2LJ5 A;  2OOB B;  5D6J B;  2AWT A;  2CQU A;  1KZ7 A;  4MEM A;  3PHX B;  4K2O A;  1AAR A;  2M0X A;  1CMX B;  3DOW A;  4X57 B;  4WQO B;  5C16 A;  4HWI B;  3X23 A;  1L2N A;  2DZM A;  1MAI A;  4KZC A;  4BBN C;  3TJP A;  1EVH A;  2KQ7 A;  3VXW A;  1VCB A;  2LVP A;  1NVL A;  3W1Y A;  4K17 A;  4F8C B;  5JHH A;  2O6V D;  3PP2 A;  2MQJ A;  3O96 A;  1YIW A;  2FUH B;  5HE0 A;  1NTY A;  3HW2 B;  2UZR A;  2D3G A;  2K1F A;  3U8Z A;  2BF8 B;  2BKF A;  1TXD A;  2XK5 A;  5CX3 A;  2MRP A;  2NBV B;  2CR5 A;  4XC2 A;  1LXD A;  4EJN A;  2LGX A;  1E8Y A;  4NAW B;  2K2U A;  2ZNV C;  2KD0 A;  1E5W A;  2KNB A;  1YD8 U;  5HE2 A;  5D2M B;  3CMM B;  3RCP A;  2LXC A;  1J8C A;  4ICV A;  2NS5 A;  3VOQ A;  3KYC D;  5CHF A;  2V1Y A;  2DLW A;  4NSW A;  2MA9 B;  4ZRK A;  5D7G A;  4MJS A;  2GBM A;  4FUL A;  3PLU A;  3PEG A;  1WI0 A;  2L0F A;  2I5F A;  5L95 C;  4DDG D;  3M3J A;  2HJ8 A;  2COF A;  3KRX A;  2KN5 A;  4BKS A;  4FAD A;  2HTH A;  2KQS A;  4WJP A;  5GOW B;  5C79 A;  2REX A;  4W9H A;  4BKT A;  4WJO A;  4MDK E;  1WY8 A;  1P9D U;  4AUQ C;  5CLL B;  2DZJ A;  4RMA A;  4TQ0 A;  1V5P A;  1R4N I;  4PS3 A;  2KX3 A;  1C1Y B;  3CXB B;  1FAO A;  1NTI A;  4GB9 A;  3NZS A;  1X1M A;  4MJS B;  3SU8 X;  3ODX A;  1X1F A;  1U27 A;  2ELA A;  3KRW A;  1WF9 A;  3APF A;  2VRW B;  3SO6 A;  2J7Q B;  5CHV C;  1U5G A;  5KHO A;  4GPT B;  1X86 A;  2HTH B;  3JYU A;  1DRO A;  2E2X A;  2WWZ A;  4K2P A;  2DKP A;  1WJM A;  2DYM A;  3VIA A;  2BKR B;  1P6S A;  4WWN A;  1V5U A;  2KWC A;  2AL3 A;  2MBE A;  2MP2 A;  1W1D A;  4F1S A;  2EMS A;  1ACA A;  1V86 A;  3VQI A;  2YSZ A;  2B3A A;  2O6V A;  2KTR A;  3V5W A;  2L00 B;  2N1V A;  2DZI A;  3ONS A;  2FNJ B;  2L05 A;  4D0N B;  2R2O A;  1WJ4 A;  1UNR A;  3PRZ A;  1WE7 A;  1PMS A;  1F9J A;  3P7Z A;  2RLO A;  5C5B A;  2MP2 B;  2WDT B;  3M62 B;  1XT9 B;  2GBJ A;  2ROV A;  3KUZ A;  2N0Y A;  4FHJ A;  1MG8 A;  2KWV B;  5BO4 B;  2O6V B;  3UF8 A;  2KTR B;  3H7P A;  1NBF C;  4MSQ B;  3CIK A;  2LUL A;  1DYN A;  2N4F A;  1U4A A;  4MH0 E;  2Y8F A;  4MEL A;  2COD A;  4EZK A;  1Y5O A;  4B6W A;  3JSV A;  4WSF A;  5C5B B;  3N7C A;  2Z0O A;  5JZE B;  2UZS A;  1YJ1 A;  1V6E A;  3A9J A;  2L8J A;  2K00 A;  2Y8G A;  1V2Y A;  3T8M A;  1U29 A;  1UD7 A;  3N30 A;  4MM3 A;  3RUL A;  3H7P B;  2KC2 A;  2NBU A;  3APC A;  1HB8 A;  5D27 A;  4WAA A;  3QBV B;  2CY4 A;  1XX0 A;  3HHM A;  3NSU A;  4B6H A;  3ZNZ B;  3JSV B;  3Q3J A;  1DDW A;  1KLV A;  2JZZ A;  3A9J B;  3GYO A;  3ZW3 A;  2P8V A;  1W1H A;  4KHA A;  3B08 A;  4A6K A;  4HDO A;  4F7U P;  2P0D A;  4NNJ B;  3V62 A;  2LAS A;  4FJY A;  1OEY A;  2YF0 A;  4PS8 A;  4TQ1 A;  1ZSQ A;  3OLM D;  1E7U A;  3VDZ A;  2JZ3 B;  4NJ7 A;  2M38 A;  4AOF A;  3RCZ A;  2KLC A;  1RRB A;  1FOE A;  2ABD A;  2ZVN A;  3A1Q B;  3QIJ A;  3ML9 A;  2KOX A;  3PRE A;  2J0K A;  2UYZ B;  2QHO A;  4MGI E;  2LOX A;  1V81 A;  4K1R B;  4DHZ B;  2MDX A;  4NY0 A;  4DWF A;  3L08 A;  4PQ0 A;  3S2A A;  1FHO A;  1XR0 B;  1EGX A;  5HE1 A;  5FR6 A;  2IO2 B;  3L54 A;  1XKE A;  1WX8 A;  5C6R A;  2RSU A;  1MK7 B;  2GBN A;  1X1G A;  1Z2M A;  2N1W A;  1LW3 A;  2MBQ A;  2IBI B;  1MK9 B;  4YON A;  2D07 B;  2K6D B;  4ANX A;  2ZZP B;  2RR9 A;  3NHE B;  1UNQ A;  3QC8 B;  2G35 A;  2KJR A;  3DBL I;  2EJ8 A;  5JHG A;  5JHB A;  4GOC A;  2R2Q A;  2XBB C;  2JPH A;  4ANW A;  3M63 B;  3APD A;  4B95 A;  5J3Y A;  4K7S A;  3QK0 A;  4HAU B;  4PYZ A;  1NU2 A;  3MJW A;  4GIV A;  4PS7 A;  1D3Z A;  2L3Z A;  3PVL A;  2KDI A;  3SUZ A;  4HAX B;  2CKH B;  2COP A;  4WJ7 A;  1FGY A;  2UWQ A;  3KW5 B;  1OQN A;  2MKR A;  4LJO B;  4ZRJ A;  4KDL B;  5LXH A;  3D8D A;  2JXX A;  3SDL C;  3VUX A;  2O2V A;  4G3X B;  2LRU A;  2X18 A;  2YRY A;  1TBE A;  2W2X C;  3NZU A;  2DYO A;  5E6O A;  1WJ6 A;  1K8R B;  3A4S C;  3DBR I;  1AWE A;  1M7E A;  3A8P A;  2NPT B;  2GCJ A;  3M95 A;  4ZYN A;  4KHO A;  2FCN A;  4KAX B;  3G9W A;  5HE3 A;  2O2V B;  3CF6 E;  2UVM A;  4DBB A;  3VVW B;  5DH9 B;  1WXS A;  3QAQ A;  4EFO A;  5IJM A;  4W9C A;  1RFA A;  1I7A A;  4GGQ A;  4IUM B;  2DHZ A;  2KTF A;  4JL9 A;  2JRH A;  4EUT A;  4HAW B;  4FLH A;  3WAL A;  3DDC B;  1TTN A;  2Y7B A;  4NQK E;  1Z87 A;  2D4Q A;  1M7R A;  2QKM A;  1I42 A;  2PEA A;  1UBQ A;  1OMW A;  4HHV A;  2BWE S;  2ASQ A;  3ZNG C;  3NS8 A;  3D32 A;  3PT2 B;  5CTR C;  2JVC A;  2DA0 A;  1WFY A;  4JLC A;  2BCJ A;  3VAW A;  2IO3 B;  2MSE D;  4OVU A;  2MWN B;  2ZPY A;  1UNP A;  1E8X A;  1Q67 A;  3FSS A;  2VKI A;  4NQL B;  3WIM A;  4DDI D;  1WIA A;  1Q1O A;  2G4D B;  2DX1 A;  4NAW A;  4HCN B;  5AEK B;  2LKO A;  2FID A;  2BYF A;  1HB6 A;  1C3T A;  3RZW C;  2KGX B;  5L81 A;  5E6P A;  2K2J A;  3RD2 A;  5DCN A;  5J17 A;  4HAZ B;  1HE8 A;  4FJV B;  3QX1 A;  2DHK A;  2PE6 B;  4FN2 A;  2YS3 A;  2L7R A;  3ML8 A;  1X05 A;  1UPR A;  1P1A A;  1WXM A;  4FA6 A;  1H8C A;  4Y94 A;  2ROZ B;  2KJH B;  4KIK A;  4FHK A;  3L16 A;  3PLV A;  1Q5W B;  2L1C A;  3UQB A;  4TKN A;  4LDT D;  4GDK A;  3ZUN A;  2D2Q A;  2CY5 A;  3PRM B;  3NOB A;  4IM0 A;  1WGR A;  2C7H A;  4KZ0 A;  2ZCB A;  3UQA A;  5D94 A;  2CAY A;  4CHM A;  4EMO A;  3PV1 A;  4KIK B;  3AU5 A;  2DEN B;  3TIX A;  4L6E A;  2L2I A;  3SD5 A;  2K8C A;  5DHF B;  2YT1 A;  3DCG A;  4GDK B;  4IWO A;  3ULB A;  2YS5 A;  1WJN A;  1S3S G;  4EEW A;  2MFQ A;  4HDQ A;  4GMV A;  3FLV A;  3ZLZ A;  2C7M B;  1WR6 E;  5G2N A;  4HLE A;  4E74 A;  2XEW A;  1WJU A;  2DYQ A;  1HBK A;  3B0A A;  3ULC A;  1BTK A;  3GZN I;  2IO1 B;  4B9K A;  1IYF A;  2RD0 A;  2KZR A;  4IC7 B;  2IYD B;  1UZX B;  3DQV A;  1V9J A;  2K39 A;  2ZPN A;  4BFR A;  1WGG A;  2FCS A;  2D11 A;  1IPG A;  1N3H A;  2DYN A;  3JW0 X;  1WM2 A;  3P2B A;  2JT4 B;  1EAZ A;  3ZTD A;  4N9F 4;  1OQY A;  3O65 B;  1RRP B;  2D9Y A;  1OY2 A;  4W9F A;  1BT0 A;  2R09 A;  4EZJ A;  4ZDV A;  2AL6 A;  5DI9 B;  3KYD D;  3P6A A;  1PQS A;  4HVB A;  1GUA B;  2Z0P A;  3AI5 A;  2A5U A;  2ELB A;  3QQ8 B;  3PHW B;  1ZW7 A;  3TL5 A;  4J6I A;  2G4S A;  2GS0 A;  1P3R A;  4G0N B;  3LJU X;  3Q3F A;  4HAY B;  3SHQ A;  4EOY A;  2IY0 B;  1RLF A;  4BOS C;  4DHJ D;  4Z2N A;  1MKE A;  1U2B A;  1ZC4 B;  1U5D A;  2V76 A;  1WI1 A;  3DVN V;  1Y8R C;  2N9E B;  4LDT B;  1UEL A;  4HB0 B;  2Z59 B;  4LCD E;  4HCP B;  1LB1 A;  1J0W A;  2RGN B;  2AYO B;  4BVU C;  3A98 B;  1EF1 A;  2C60 A;  1X11 A;  1ZGU B;  4TV3 A;  1FHW A;  3OJ4 B;  1Q0W B;  3DXC A;  3A33 B;  3AUL A;  1EO6 A;  3VTW A;  2L76 A;  1XD3 B;  1XD4 A;  2D9X A;  2DN6 A;  1H10 A;  3A1Q A;  2ZNV B;  3DXE A;  1RAX A;  1LM8 B;  4HK2 A;  3QWM A;  4H8S A;  2AEH A;  2LBB A;  3QCA A;  1OTR B;  3JVZ X;  1FHX A;  2ZCC A;  4AJW A;  5J18 A;  1V5T A;  4IWP A;  2GBR A;  2PE9 A;  2RGF A;  4GDL A;  3PPA A;  1WRD B;  3IBE A;  2KC1 A;  1E8W A;  1PLS A;  1V80 A;  3EHV A;  2WH5 A;  1AQC A;  3UIO B;  3VTU A;  4KSK C;  4HAV B;  1B55 A;  5IA7 A;  4NJ6 A;  4CO7 A;  2YVC A;  2HE7 A;  2C5L C;  3ZO5 B;  4IFS A;  2J59 M;  1MIZ B;  4YL8 A;  1MPH A;  4GDL B;  3PG7 A;  4II3 B;  4DX8 A;  1WJ1 A;  3MTN B;  3FP5 A;  2LUE A;  5J3Q A;  1GNU A;  3V6C B;  3F5R A;  1YX6 B;  5FI1 A;  4WWO A;  2OTX A;  2PPH A;  4GXB A;  1QZE A;  4A6H A;  2MBH A;  2GJY A;  4W9J A;  4I6N B;  2FAZ A;  3W1S A;  3V60 A;  1JRU A;  3SNH A;  3PZD A;  4A20 A;  2EKE C;  2KHW B;  5HKH A;  4WJQ A;  4KVG B;  2KVR A;  3L17 A;  3R3M A;  1WMH B;  2WX1 A;  1J0G A;  4M8M A;  4KDI C;  4TYZ A;  4DHJ B;  2LD9 A;  5KQ4 A;  1WGY A;  4K7U A;  1H4R A;  3FM8 C;  3PRP B;  2KO3 A;  3SV1 A;  2JUO A;  1WM3 A;  3PSE B;  4DXA B;  3R7Q A;  2NPT A;  1IRS A;  3TFM A;  1S1Q B;  2IYB A;  3ZNI D;  5DPW A;  2Z0E B;  3VH4 B;  2Z0D B;  2LGY A;  3R66 C;  3OAN A;  1V88 A;  2CHZ A;  3QWZ B;  3U30 A;  4EZL A;  2J0J A;  3LDZ E;  3F0W A;  4AJY B;  2OQB A;  2D9Z A;  1TGZ B;  3T06 A;  4A3O A;  2WYQ A;  4PYU A;  2KUP A;  4IW0 A;  1V49 A;  3WAN A;  2MBB B;  1NDD A;  4IWQ A;  1UGM A;  2CS4 A;  4HAT B;  1ZKH A;  1M94 A;  3KZ1 A;  3ZDM C;  3KY9 A;  1E90 A;  4ICU A;  3DVG X;  2OJR A;  3HIZ A;  5J2R A;  1OGW A;  2DFK A;  2IY1 B;  3I3T B;  2FIF A;  3PVU A;  5C1Z A;  1NTV A;  2LVO A;  5D3X A;  3A9K A;  1SE9 A;  2JRI B;  3M1I B;  1GC7 A;  3R7R A;  2M4N A;  3DBS A;  2Q13 A;  2NR2 A;  4F7H A;  3WAP A;  2FDQ A;  4PNK A;  3A4R A;  2KDE B;  2RQ1 A;  1V61 A;  3VH3 B;  2GBK A;  4C0A A;  4JGH B;  2LOZ A;  4MGY E;  3A9K B;  3X0W A;  2LYD A;  2HD5 B;  2KFJ A;  2CB8 A;  3T9L A;  3ODW A;  1QQG A;  2HRJ A;  1WE6 A;  4ANV A;  2IO0 B;  3RZF A;  2GOW A;  3N32 A;  2IZV B;  3D8F A;  5LOP B;  2H7D A;  2LWP A;  3B1L X;  2KFK A;  3KVF B;  3CST A;  5JP4 A;  3N3K B;  1WXA A;  1WX7 A;  2N7E A;  2KMA A;  3TO1 A;  3UGB B;  2BWF A;  2KX0 A;  2K25 A;  3PSC A;  2NMB A;  5DPR A;  1SGH A;  2KDB A;  2KFK B;  2KWU B;  1L7Y A;  4XZ4 A;  2JP2 A;  4FBJ B;  2FJL A; 
#chains in the Genus database with same CATH topology
 2KN4 A;  3DCX A;  4F7Z A;  3SR6 A;  1DOX A;  1V5M A;  3U7D A;  2MHJ A;  2WXR A;  2DLB A;  1QOB A;  4JKD A;  3QJZ A;  3N9Y C;  1JRP A;  4ZHP A;  4K81 A;  1WGQ A;  3DBH B;  2FCQ A;  3Q8A A;  4OZA A;  3ECI A;  3W9C B;  2I38 A;  2W9N A;  1I4R A;  3V61 A;  2RNR B;  1WZ0 A;  2NBW B;  5MPO A;  1KOT A;  4XDD A;  3VUW A;  2N23 A;  2XN9 C;  3DPD A;  3ZTC A;  2I1J A;  1KZG A;  2BYE A;  2BB5 A;  3EEC A;  5AZF A;  1C76 A;  3VFK A;  5EE0 A;  1OEY J;  3T3N A;  4GSW A;  2EMT A;  3AE1 B;  2MCN B;  3PS6 A;  2DX5 A;  3SYX A;  1EUV B;  4RM8 A;  4TUU A;  5AZG A;  1QC6 A;  1MHX A;  3W2D A;  1N60 A;  3UIN B;  2CU3 A;  2KAN A;  2MJD A;  4RM9 A;  4A3P A;  2M17 A;  5KCV A;  4BBK A;  4WWP A;  2G3Q B;  2XK5 B;  2CHX A;  3P4S B;  3U2S C;  2COA A;  1UPQ A;  3QHT A;  4XWW A;  3A8Q A;  4XX5 A;  3MPX A;  2ZEQ A;  3IVF A;  3IHP C;  4ZYS A;  4A90 A;  2KMC A;  4JK8 A;  1N63 A;  2K9X A;  2RVB B;  1GG3 A;  4MY6 A;  1T0S C;  1WR1 A;  1XOD A;  2IND C;  3TCA A;  2DX5 B;  4W9K A;  4M0W A;  3VR8 B;  3VHT C;  4DX9 0;  5DPT A;  2IFS A;  1MIX A;  2A4Z A;  3H9D A;  2D5G A;  2J4X A;  4HB3 B;  1HEZ E;  1NI2 A;  4ZRI A;  4G50 A;  1U5E A;  5FI0 A;  1N61 A;  1WGD A;  1EU3 A;  1CK1 A;  3EC8 A;  4MK0 A;  3H7S A;  1GB4 A;  2YT0 A;  3VUY A;  4GN1 A;  2M8S A;  3ALB A;  4HB2 B;  5CHW A;  4XWX A;  1ZC3 B;  4I6P A;  2DYB A;  3ENE A;  4GU2 A;  3VRB B;  2C9W B;  2LG1 A;  1UWX A;  2NCN A;  4M0W B;  2JYT A;  3AE2 B;  4K3B A;  1R4M I;  2NTS A;  3LB8 C;  5G5H A;  1UBI A;  2RDG A;  1E10 A;  4W9D A;  1SHC A;  5TSS A;  1IGD A;  2KDF B;  4JKB A;  3RUI B;  3Q8C A;  1IP9 A;  1BML C;  4M8N A;  4A5K A;  5IRS A;  3HRD D;  5AZH A;  3N1X C;  2XQN M;  3KH0 A;  2NVU I;  2K8H A;  2RDB C;  1UEF A;  1A5R A;  1ZVR A;  1SIF A;  5DPS A;  1VDV A;  2KXJ A;  1WGH A;  2Z0Q A;  4KGT A;  3SFD B;  2ZVO A;  3HM3 A;  2KJ6 A;  4L1B A;  3MHS D;  3ZRC A;  1JWB D;  2I1K A;  1TZ1 A;  3B77 A;  2K8B A;  3ENB A;  4B0E A;  2QSD A;  5DIF B;  1JML A;  1PUT A;  4DBG A;  3OAW A;  4KHB A;  2JYE A;  3FAH A;  4P7I A;  3W1S C;  4MAC A;  3AB5 A;  2DAJ A;  3BJI A;  2BPS A;  4RGT A;  3ZXV A;  4IOY X;  1XXG A;  1P3Q U;  5DHA B;  3WA0 A;  1K5D B;  4W9E A;  4CHK A;  1L0V B;  3KUC B;  3BYY B;  3L10 B;  2KIG A;  4GOU A;  2B76 B;  2RSG A;  3RYT A;  2AX5 A;  4ZRQ A;  1C4A A;  3RT3 B;  4E71 A;  4BOZ B;  5JH5 C;  3MC9 A;  3P4Q B;  4JK7 A;  4HPL B;  4C4V B;  2E6X A;  1WX9 A;  4Z2M B;  1TT5 B;  4FXC A;  2MW5 A;  4EKU A;  4KHB B;  3UZT A;  1QOF A;  4A6F A;  1TS5 A;  2ON8 A;  4GMX B;  3L0W B;  1VLB A;  2EKI A;  1ZP0 B;  1PFJ A;  4DK5 A;  4HJK A;  3ODO A;  2J0M A;  3NVZ A;  2VH1 A;  2K8E A;  5D3W A;  4QXA B;  3H1U A;  1D5M C;  1DDM A;  2W2W A;  1P98 A;  2QKL A;  4ASW C;  1ZDV A;  2DWQ A;  2P0H A;  2INC C;  1ST7 A;  4NPN A;  2D9W A;  3BIN A;  2LZ6 A;  3HQC A;  2J42 A;  2SEB D;  4JKA A;  3C0R B;  1I4Q A;  4MT7 A;  1TZO A;  1KBL A;  3H6N A;  2Y3A A;  2R0D A;  2FJ9 A;  2WNM A;  1E6E B;  1SIJ A;  3OWE B;  4A6F B;  4LTU A;  3K9P B;  4XGA B;  1SF0 A;  2BGF A;  2MLB A;  3ZKJ C;  4JQW C;  4US8 A;  3PTF C;  2R2Y A;  2N7J A;  5E6N A;  1RJ2 A;  2PZ1 A;  1WXV A;  4IAP A;  3E56 A;  3MDB C;  5IP4 D;  3KSY A;  4RCO A;  4RFB A;  1LQB A;  1DDV A;  1WH3 A;  4JIO U;  1R4N B;  2M1M A;  3BY4 B;  5JLJ B;  3HM6 X;  3BZD B;  1JWS D;  2JWZ A;  3TVV A;  1FXT B;  2WXM A;  1NEN B;  2ZW1 A;  3GOE A;  3TBL D;  5CLQ B;  5C23 A;  2FUG 1;  3HIE A;  2D10 A;  1GC6 A;  1SXT A;  3WAO A;  1WYW B;  4KSL C;  4FJZ A;  4II2 B;  4A8X C;  4WVF B;  2LRW A;  1KC7 A;  2ZJD A;  5LLI A;  1P5T A;  4GZU A;  3N1Y C;  4BKG A;  2Y5B B;  2PVO D;  3SBT A;  4KV2 A;  5KHQ A;  4YSZ B;  2EC1 A;  4HXD A;  2V9H A;  2MBO A;  1Y19 B;  4MH8 A;  1PDX A;  3AE8 B;  1T0Y A;  2KCJ A;  3AM9 A;  1SJH D;  3K9O B;  3BYT B;  1FO4 A;  2V4L A;  2WU2 B;  2RPQ A;  4CYE A;  2W3R A;  3SEB A;  1HTO A;  3URY A;  3EPY A;  4IG7 B;  3DHG C;  4RNA A;  3DVN U;  3IG3 A;  3Q3O C;  4NAM A;  1WMH A;  2PIA A;  3WYF B;  2CHW A;  2NZ8 B;  1QLB B;  3TMP B;  2PTL A;  4OZB A;  2WGS A;  1J19 A;  3H8H A;  4GNK B;  4ZOH C;  1RFK A;  5T8I A;  2YS1 A;  3DXD A;  2N7D A;  4RF0 A;  3ZIM A;  1NI3 A;  1BTN A;  5D3V A;  1EF5 A;  2DNF A;  3HUI A;  3ZVV A;  2UU7 A;  1E8Z A;  2JXT A;  3AU4 A;  3AED B;  1LFD A;  4YWG G;  2X38 A;  4ILJ A;  2DZK A;  2LGD A;  2DAF A;  1BAK A;  2MJ3 A;  1L5P A;  2N9P C;  2LXA A;  4C7Y A;  1U5F A;  3OJ3 A;  4CHJ A;  1W1G A;  2G45 B;  4W9G A;  2KWD A;  5BYR A;  1EM7 A;  4QAY A;  4LJP B;  4E3C A;  4HB4 B;  4K7W A;  2LGI A;  4AWJ A;  2LI5 A;  2IJ0 A;  3VRA B;  4W9I A;  3LJ3 A;  2N9X A;  1ZOY B;  2RUK B;  1C9F A;  4HPM B;  3EFU A;  3WAM A;  4IOI E;  4I6L B;  3RPF C;  1V8C A;  1ZYI A;  1SEB D;  1V89 A;  5EDS A;  3NY5 A;  1VZ6 A;  3TW1 A;  2WP9 B;  1ZM0 A;  3AJ4 A;  2JF5 A;  2KLG A;  4IM2 A;  3ZNH B;  1ZUD 2;  1K52 A;  4N58 A;  5GMV A;  4W9L A;  1A70 A;  4MSM B;  2DIK A;  5L83 A;  1I2H A;  1VR9 A;  1WG7 A;  2I5C A;  2GMI C;  1WZ3 A;  2PVG C;  4A6Q A;  3ML4 A;  3AXC A;  1XCG A;  3DBH I;  3AE5 B;  1VD2 A;  5G55 A;  2ADZ A;  2KK8 A;  3KUD B;  2FCM A;  2WXF A;  3IFW B;  1GJZ A;  1WXQ A;  4AP4 C;  1AYF A;  5J3T A;  5C3J B;  2MWS B;  1EWY C;  3Q8F A;  2KT7 A;  2L0T A;  4URK A;  3D8E A;  2YLM A;  2GCL A;  3QAR A;  2C7N B;  1J7C A;  5EE3 A;  3V6E B;  3IAS 1;  1K5G B;  3I63 C;  4ANU A;  2DTC A;  2P0F A;  2DKQ A;  2K6Q A;  3KLS X;  2VSZ A;  5KQ1 A;  1TJ6 A;  3GYP A;  2Z13 A;  3AEG B;  4M02 A;  4MGK E;  5D3Y A;  3RNC C;  1FGZ A;  1P0R A;  1V1P A;  2W55 A;  2VRR B;  3VTV A;  4F7G A;  2M56 B;  1E7V A;  1BWN A;  1I4X A;  1YJI A;  2W2X D;  1ISN A;  1NEK B;  2IGH A;  4HPP A;  4J3O D;  1I35 A;  2QEJ C;  1T77 A;  3AN1 A;  1F52 A;  2WX0 A;  4OVV A;  5IAA C;  2DHI A;  4LNF A;  2D9V A;  3FEH A;  1FCL A;  2COC A;  1KJT A;  2CRF A;  2YEP B;  2LVQ A;  4US9 A;  2WXJ A;  2H7E A;  1SB3 C;  2QC8 A;  2V3S A;  5EFX A;  3B2F A;  1WYG A;  1KI1 B;  4MGZ E;  3NVW A;  4XWT A;  3GE8 C;  3ZRF A;  1FB8 A;  5TR5 A;  1V1P B;  2KKC A;  3TEW A;  2MX2 A;  5LON B;  2D3A A;  1L0Y B;  3LXF A;  2JY6 A;  3AE9 B;  4N6E B;  2KUQ A;  2M14 A;  2Q5W D;  2CU1 A;  3L13 A;  4IM3 A;  3NWD A;  1YMH E;  5HG2 A;  3TUO A;  1YX5 B;  1Z5S B;  1LGR A;  1F1H A;  1N6Z A;  3DWG C;  1TQZ A;  1LO5 D;  3PVW A;  5JHA A;  2FE8 A;  3DVG Y;  4R3D A;  2DHJ A;  4DHZ E;  2G9H D;  1YJJ A;  4BKS D;  5LXI B;  2BYV E;  2X0S A;  2PJH A;  1J7A A;  1WVH A;  1KM7 A;  3PGE A;  3CSF A;  5AUK A;  1DBH A;  3HK0 A;  3NW8 A;  2BS2 B;  4WJN A;  3AEC B;  3ZVR A;  4LNK A;  1TY0 A;  3ZDT A;  1XQQ A;  4KGS A;  3BWU D;  4BBN F;  1WGU A;  2OHF A;  1G6J A;  2BS4 B;  1V5O A;  2KAJ A;  4G11 A;  3UIP B;  3QA8 A;  1WSP A;  1YQB A;  1UH6 A;  4C7Z A;  1TIF A;  1C77 A;  2LJ5 A;  2OOB B;  4OHJ A;  5D6J B;  2AWT A;  3MFG A;  2CQU A;  3V05 A;  1KZ7 A;  2QJL A;  4MEM A;  4NZL B;  2BS3 B;  4K2O A;  1AAR A;  2W3S A;  3PHX B;  2M0X A;  1CMX B;  1CZP A;  3DBL B;  3MJ5 A;  1D5X C;  4H2A A;  3DOW A;  3AH7 A;  4X57 B;  1ACC A;  4WQO B;  5C16 A;  1M4V A;  4HWI B;  3X23 A;  1L2N A;  2DZM A;  2W54 A;  5H8Y E;  1MAI A;  4KZC A;  2NBV A;  2LEK A;  4BBN C;  3TJP A;  1EVH A;  2KQ7 A;  3VXW A;  2W82 A;  2WXH A;  4M00 A;  1CJE A;  1VCB A;  2LVP A;  3PZ8 A;  4YTP B;  1NVL A;  3W1Y A;  4K17 A;  1WRI A;  5JHH A;  4F8C B;  5HFY A;  4JE3 B;  2N0S B;  3IT4 B;  2O6V D;  1FFV A;  2FBW B;  3PP2 A;  2MQJ A;  3C19 A;  3O96 A;  1ESF A;  1YIW A;  2FUH B;  3OG5 A;  5HE0 A;  1NTY A;  3HW2 B;  2UZR A;  5IOI A;  4RGM A;  2D3G A;  2K1F A;  2WXK A;  3U8Z A;  1SBB B;  3NWA A;  1TXD A;  2BF8 B;  2BKF A;  2XK5 A;  5CX3 A;  2MRP A;  2NBV B;  2CR5 A;  4XC2 A;  1LXD A;  4EJN A;  5FR3 A;  2LGX A;  2INN E;  1E8Y A;  4NAW B;  4LNN A;  2K2U A;  4S17 A;  2ZNV C;  3NVV A;  2HTM E;  2KD0 A;  1E5W A;  2KNB A;  1YD8 U;  1VZ7 A;  5HE2 A;  5D2M B;  3CMM B;  3RCP A;  4K3C A;  1IUE A;  2JQR B;  2LXC A;  3AV8 A;  3BII D;  4WIP A;  4ICV A;  4DXG A;  1STE A;  5I4D A;  1J8C A;  2NS5 A;  3VOQ A;  3KYC D;  5CHF A;  2V1Y A;  3B9J A;  2DLW A;  1HA5 A;  3DBR B;  3EGR A;  1L4D B;  4NSW A;  2MA9 B;  4PT5 A;  3E9L A;  4ZRK A;  3DWM A;  5D7G A;  4MJS A;  2GBM A;  4FUL A;  3PLU A;  3PEG A;  1WI0 A;  3N20 C;  1I4P A;  2L0F A;  2I5F A;  5L95 C;  4DDG D;  3M3J A;  2HJ8 A;  2COF A;  3KRX A;  2KN5 A;  4BKS A;  2WHI A;  3U7Z A;  4FAD A;  2HTH A;  2KQS A;  4WJP A;  1P7F A;  5GOW B;  5C79 A;  2REX A;  4W9H A;  1QKZ A;  4BKT A;  4WJO A;  4MDK E;  1WY8 A;  1P9D U;  5M4Y B;  2CJO A;  4AUQ C;  5CLL B;  2DZJ A;  4RMA A;  4TQ0 A;  1V5P A;  1R4N I;  4PS3 A;  2KX3 A;  1C1Y B;  3CXB B;  2V0G A;  4D2K A;  1FAO A;  1NTI A;  4GB9 A;  1IBX A;  3NZS A;  4DIX A;  1X1M A;  4MJS B;  3BVM A;  3SU8 X;  3ODX A;  4WQM A;  1X1F A;  1U27 A;  2ELA A;  3KRW A;  4B0M A;  1WF9 A;  3APF A;  2N9L A;  2VRW B;  3SO6 A;  2J7Q B;  5CHV C;  1U5G A;  5KHO A;  4GPT B;  1X86 A;  2HTH B;  5IKC M;  3JYU A;  1DRO A;  1KH0 A;  2E2X A;  2LUM A;  2WWZ A;  4K2P A;  5EE1 A;  1BUI C;  2DKP A;  1WJM A;  2DYM A;  3VIA A;  1FRD A;  1TKG A;  4JX1 C;  1OFF A;  1ZXI A;  2BKR B;  1P6S A;  4WWN A;  1V5U A;  2KWC A;  2AL3 A;  2MBE A;  2MP2 A;  1W1D A;  4F1S A;  1B1Z A;  4L23 A;  1IBX B;  2EMS A;  1ACA A;  2GLS A;  1V86 A;  3Q8B A;  4HJG E;  3VQI A;  2WXI A;  1SSN A;  2YSZ A;  2B3A A;  3C8Y A;  4C00 A;  1QOG A;  2R61 A;  2O6V A;  2KTR A;  3V5W A;  2L00 B;  4WAF A;  2M0A A;  2N1V A;  3P42 A;  2DZI A;  3ONS A;  2K3U A;  1DOI A;  2FNJ B;  2L05 A;  4D0N B;  2R2O A;  1WJ4 A;  2WXO A;  1UNR A;  2GI9 A;  3PRZ A;  4A9A A;  1WE7 A;  1PMS A;  1F9J A;  3IAM 1;  4C4V A;  1E0Z A;  3P7Z A;  2RLO A;  5C5B A;  2LHD A;  1RYJ A;  2MP2 B;  2WDT B;  3M62 B;  1XT9 B;  3KWV A;  2GBJ A;  2ROV A;  3KUZ A;  2N0Y A;  4FHJ A;  1MG8 A;  2KWV B;  5BO4 B;  2O6V B;  3UF8 A;  2KTR B;  3U4E G;  3H7P A;  4OW0 A;  4P1C C;  4EE2 A;  1NBF C;  1AWD A;  4MSQ B;  3CIK A;  2LUL A;  1MI0 A;  1DYN A;  1V1O A;  2JZP A;  1L6U A;  2N4F A;  1U4A A;  1ZPS A;  4MH0 E;  5FKA C;  2Y8F A;  4MEL A;  4WUR A;  2COD A;  1DGJ A;  4EZK A;  1Y5O A;  1SE3 A;  4B6W A;  1E7P B;  3JSV A;  4WSF A;  3U52 E;  4JPS A;  4XDC A;  5C5B B;  2BTE A;  3N7C A;  2Z0O A;  5JZE B;  2UZS A;  3OHM B;  1YJ1 A;  1V6E A;  3A9J A;  2L8J A;  2K00 A;  3BVG A;  2Y8G A;  1V2Y A;  3T8M A;  1U29 A;  1UD7 A;  3N30 A;  4MM3 A;  3RUL A;  2K49 A;  3H7P B;  2KC2 A;  2NBU A;  2OED A;  3APC A;  1HB8 A;  1YNT E;  5D27 A;  4WAA A;  3QBV B;  2CY4 A;  4HSI A;  1XX0 A;  3HHM A;  4C56 C;  3NSU A;  4B6H A;  3ZNZ B;  4Q2J A;  1TKE A;  3JSV B;  2BYT A;  3WCQ A;  4P6V F;  3Q3J A;  1DDW A;  3U12 A;  1KLV A;  2JZZ A;  3A9J B;  3GYO A;  3ZW3 A;  1VRA B;  2P8V A;  1W1H A;  4KHA A;  3B08 A;  4MM3 B;  1Q10 A;  4A6K A;  1DYQ A;  1TJE A;  2OJW A;  4HDO A;  5BMG A;  4F7U P;  4LNO A;  2P0D A;  4AQ7 A;  4NNJ B;  3V62 A;  2LAS A;  4JKF A;  4FJY A;  1ET6 A;  1OEY A;  2YF0 A;  4PS8 A;  4TQ1 A;  1ZSQ A;  3OLM D;  3MHZ A;  1E7U A;  3VDZ A;  2JZ3 B;  3ZQ4 A;  4NJ7 A;  1XLN A;  1UWM A;  1TY2 A;  2M38 A;  1CQV A;  4AOF A;  3RCZ A;  1JWM D;  2KLC A;  1RRB A;  1NVI D;  3GZN B;  3L4P A;  1FOE A;  2RMM A;  2ABD A;  2ZVN A;  3A1Q B;  3QIJ A;  1FXI A;  3ML9 A;  3EFC A;  2KOX A;  1K51 A;  3PRE A;  1JWU D;  2J0K A;  2UYZ B;  2QHO A;  3BK2 A;  4MGI E;  2LOX A;  1V81 A;  1BXT A;  4K1R B;  2MDX A;  4DHZ B;  2VH2 A;  2XNA C;  2KAC A;  1XCQ L;  4YTM B;  4LK0 M;  4NY0 A;  4DWF A;  3L08 A;  4PQ0 A;  3S2A A;  1FHO A;  1XR0 B;  1EGX A;  5HE1 A;  2H89 B;  5FR6 A;  2BB6 A;  2IO2 B;  3L54 A;  1XKE A;  1WX8 A;  4L1R A;  2K0P A;  5C6R A;  2RSU A;  1MK7 B;  2GBN A;  5HHD G;  1X1G A;  1Z2M A;  2N1W A;  1LW3 A;  1HZ5 A;  2MBQ A;  2IBI B;  1MK9 B;  3FKY A;  4YON A;  3GS2 A;  2D07 B;  2IDY A;  2K6D B;  4ANX A;  3RMK C;  2ZZP B;  2RR9 A;  2JU6 X;  3NHE B;  3P4P B;  1UNQ A;  3T3O A;  3QC8 B;  2G35 A;  4TMA B;  2KJR A;  4CSQ A;  1HXY D;  5BYS A;  3DBL I;  2EJ8 A;  3VR9 B;  5JHG A;  5JHB A;  4GOC A;  2R2Q A;  2XBB C;  2JPH A;  4ANW A;  3M63 B;  4HEA 1;  3APD A;  4B95 A;  5J3Y A;  4JKE A;  4K7S A;  3MC8 A;  3QK0 A;  1MPE A;  4HAU B;  4PYZ A;  1NU2 A;  3MJW A;  4GIV A;  4PS7 A;  2RDH A;  1D3Z A;  3RNA C;  3ABV B;  3P4R B;  2L3Z A;  2TSS A;  1N5X A;  3PVL A;  2KDI A;  3SUZ A;  1NYR A;  4HAX B;  2CKH B;  3AE6 B;  2COP A;  4WJ7 A;  1FGY A;  2UWQ A;  3KW5 B;  3N1Z C;  1NYQ A;  3FIL A;  1OQN A;  2MKR A;  4LJO B;  1YN3 A;  4ZRJ A;  4P16 A;  2D3C A;  3Q14 C;  4KDL B;  5LXH A;  3D8D A;  2JXX A;  3SDL C;  1KLG D;  2WXN A;  1FIQ A;  3VUX A;  4QJ4 B;  3TEX A;  2O2V A;  4G3X B;  1V97 A;  2LRU A;  5G5G A;  2LJI A;  2X18 A;  2VZK D;  2YRY A;  1TBE A;  2W2X C;  4JK9 A;  3BVZ A;  1KRH A;  3NZU A;  2DYO A;  1XCT L;  5E6O A;  1MHH E;  4M01 A;  1WJ6 A;  2WS3 B;  3FIL B;  1K8R B;  3A4S C;  3DBR I;  1AWE A;  1PFD A;  5HI1 A;  5H92 C;  1M7E A;  3A8P A;  4USA A;  2NPT B;  2GCJ A;  3TSS A;  3M95 A;  4ZYN A;  4KHO A;  2FCN A;  4KAX B;  1Y56 A;  3G9W A;  5EE9 A;  3CIR B;  5HE3 A;  2O2V B;  3CF6 E;  2UVM A;  3I5J C;  4DBB A;  3VVW B;  5DH9 B;  1WXS A;  1UF0 A;  3QAQ A;  4EFO A;  5IJM A;  2WXG A;  4YSX B;  3Q3M C;  1FNV A;  4W9C A;  3E9P A;  4YT0 B;  3EUB 2;  1RFA A;  1I7A A;  3W5V B;  1FRR A;  4GGQ A;  4IUM B;  2NTT A;  3ZJT A;  2DHZ A;  2KTF A;  4JL9 A;  1PGA A;  1XLP A;  2JRH A;  4EUT A;  4HAW B;  4FLH A;  3WAL A;  3DDC B;  1TTN A;  2WDQ B;  2Y7B A;  5D3D A;  3NJT A;  2D3B A;  4NQK E;  3HVZ A;  1I4H A;  1Z87 A;  2Z14 A;  3P1M A;  1QIL A;  2QMT A;  2D4Q A;  4O1N A;  2SAK A;  4BZA A;  1M7R A;  2PMV A;  1GOZ A;  2KMM A;  1GB1 A;  2QKM A;  1QOA A;  4ZRP A;  1I42 A;  1KTK A;  1GGO A;  3B2G A;  3NRZ A;  1WWT A;  2PEA A;  1UBQ A;  5JVL A;  1OMW A;  4HHV A;  2BWE S;  2ASQ A;  3ZNG C;  3NS8 A;  1HTQ A;  3D32 A;  3PT2 B;  2FJU B;  3FC4 A;  5CTR C;  2G1E A;  2JVC A;  4BAX A;  2DA0 A;  4DXF A;  3RNE C;  3Q8E A;  1WFY A;  4JLC A;  1RWS A;  2BCJ A;  1ROE A;  3VAW A;  1D6E C;  2IO3 B;  1YQ4 B;  2MSE D;  2WXQ A;  4OVU A;  2MWN B;  2ZPY A;  1UNP A;  1E8X A;  5BYQ A;  1Q67 A;  3FSS A;  2VKI A;  4NQL B;  3MP9 A;  3WIM A;  4DDI D;  1WIA A;  1Q1O A;  2G4D B;  2LMC A;  1XF5 L;  2Y5C A;  1F2R I;  2DX1 A;  2MEK A;  4NAW A;  4HCN B;  5AEK B;  2LKO A;  2FID A;  2X8X X;  3NUH B;  2BYF A;  4ILG B;  1HB6 A;  1XLQ A;  1C3T A;  3RZW C;  3SFE B;  5IN7 A;  2KGX B;  5L81 A;  5E6P A;  2K2J A;  5JXV A;  1PGB A;  4JWS C;  1SJE D;  4OT1 A;  3RD2 A;  2GUM A;  5DCN A;  4ZHO A;  5J17 A;  4HAZ B;  1HE8 A;  4FJV B;  3QX1 A;  4WWM A;  2M19 A;  2DHK A;  2ONQ A;  2PE6 B;  4FN2 A;  2YS3 A;  3I57 A;  2L7R A;  3ML8 A;  1X05 A;  1UPR A;  1P1A A;  1WXM A;  4FA6 A;  1B9R A;  1H8C A;  4Y94 A;  2ROZ B;  2VZK B;  2KJH B;  4KGR A;  4KIK A;  4MT5 A;  4FHK A;  1T3Q A;  3L16 A;  3PLV A;  2IPK D;  1Q5W B;  2L1C A;  3UQB A;  4TKN A;  5BMH A;  2H88 B;  4LDT D;  4GDK A;  3ZUN A;  2RPV A;  2QDF A;  2D2Q A;  2CY5 A;  3PRM B;  3NOB A;  4JKG A;  4HRS A;  4IM0 A;  1WGR A;  1FXA A;  2C7H A;  4KZ0 A;  2ZCB A;  5FK9 C;  2ZKM X;  3UQA A;  5D94 A;  2CAY A;  2E3T A;  1GPX A;  4CHM A;  4EMO A;  3PV1 A;  2GRI A;  4KIK B;  1EU4 A;  2BW2 A;  3AU5 A;  2JWU A;  2DEN B;  3TIX A;  4L6E A;  2Y5P A;  2L2I A;  3SD5 A;  2K8C A;  2QCZ A;  5DHF B;  1TS4 A;  2YT1 A;  3DCG A;  4GDK B;  4IWO A;  4JKH A;  5GXG B;  4YSY B;  3AMZ A;  3ULB A;  2CJN A;  2YS5 A;  1WJN A;  1S3S G;  1N62 A;  2INP E;  4EEW A;  2MFQ A;  4HDQ A;  3P63 A;  4JKG B;  4GMV A;  3FLV A;  3ZLZ A;  3A58 A;  4AS1 A;  3IT6 B;  2C7M B;  1WR6 E;  5G2N A;  4HLE A;  4E74 A;  2XEW A;  1YOV B;  1ENF A;  2L1A A;  1WJU A;  2DYQ A;  1HBK A;  3B0A A;  3ULC A;  1BTK A;  4ACF A;  3GZN I;  2QIL A;  2IO1 B;  2PW9 A;  3J9C A;  4B9K A;  1IYF A;  2RD0 A;  1L4Z B;  2KZR A;  1T0R C;  2WXP A;  2WXL A;  4IC7 B;  2AQ1 B;  1UZX B;  2IYD B;  3ETR A;  3R2I A;  1K53 A;  3DQV A;  1FMA D;  1V9J A;  2K39 A;  2IGD A;  2ZPN A;  3DHH C;  4XE0 A;  3HVD A;  4RGN A;  4BFR A;  1WGG A;  3GB1 A;  2HJ1 A;  2FCS A;  2D11 A;  2KR0 A;  1IPG A;  1QF6 A;  1N3H A;  2DYN A;  3TEY A;  3JW0 X;  3KQ4 A;  1VBH A;  1WM2 A;  3P2B A;  2JT4 B;  1EAZ A;  2WU5 B;  1YN4 A;  3ZTD A;  4N9F 4;  1OQY A;  1T5X D;  3O65 B;  1RRP B;  2D9Y A;  4XYC A;  1TKY A;  3PZ7 A;  1OY2 A;  4W9F A;  1BT0 A;  2R09 A;  4EZJ A;  4ZDV A;  2AL6 A;  5DI9 B;  3KYD D;  1F0Z A;  4RF1 A;  1E9M A;  3P6A A;  4N59 A;  1PQS A;  2MH7 A;  4HVB A;  1GUA B;  2Z0P A;  3AI5 A;  2A5U A;  2ELB A;  1ZXH A;  3QQ8 B;  3NVY A;  2Z59 A;  3AEF B;  1QT9 A;  3PHW B;  3GE3 C;  1ZW7 A;  2K5P A;  3TL5 A;  4J6I A;  2G4S A;  4ILH A;  4YTN B;  2GS0 A;  1MVK A;  1P3R A;  4G0N B;  3CWI A;  3LJU X;  2KIE A;  3Q3F A;  4HAY B;  3SHQ A;  4EOY A;  1AN8 A;  2IY0 B;  1RLF A;  4BOS C;  1FPY A;  3RI7 C;  4DHJ D;  4Z2N A;  1TS2 A;  1MKE A;  1U2B A;  1ZC4 B;  1U5D A;  4REZ A;  2V76 A;  1EWC A;  1WI1 A;  3DVN V;  1Y8R C;  2N9E B;  4LDT B;  4ARI A;  1FFU A;  4HB0 B;  1UEL A;  2Z59 B;  4LCD E;  4HCP B;  1OQQ A;  1LB1 A;  1J0W A;  2RGN B;  1VBG A;  2YEP F;  2AYO B;  3Q2A C;  4BVU C;  4CQN A;  3A98 B;  1EF1 A;  2AQ2 B;  2I2Y A;  2C60 A;  1I4G A;  1X11 A;  2BVC A;  1ZGU B;  4TV3 A;  2KQ4 X;  1FHW A;  3OJ4 B;  1Q0W B;  1FD6 A;  3DXC A;  3A33 B;  4NJC A;  3AUL A;  1EO6 A;  3VTW A;  2L76 A;  1R7S A;  1PYW D;  1JWA D;  3UI3 A;  1XD3 B;  1XD4 A;  2D9X A;  2DN6 A;  3RN9 C;  1H10 A;  4JKC A;  3A1Q A;  2ZNV B;  3DXE A;  1RAX A;  1LM8 B;  4HK2 A;  3QWM A;  4H8S A;  1UUP A;  1JCK B;  1UNS A;  2AEH A;  2LBB A;  3QCA A;  2J52 A;  1OTR B;  1C79 A;  3JVZ X;  2HDE A;  1FHX A;  1N5W A;  2JSV X;  2ZCC A;  4IDI A;  4ITK A;  4AJW A;  4OSN A;  4OZC A;  4DQO C;  5J18 A;  1V5T A;  1C4P A;  1TYG B;  4IWP A;  1JAL A;  3SBG A;  2GBR A;  2PE9 A;  1KLU D;  2RGF A;  4GDL A;  2GB1 A;  3PPA A;  1JQ4 A;  1WRD B;  4OVZ A;  3IBE A;  2KC1 A;  1E8W A;  1PLS A;  5I2M A;  1V80 A;  4UDU C;  3EHV A;  5IO9 A;  2WH5 A;  1J7B A;  1AQC A;  3UIO B;  3VTU A;  4KSK C;  4HAV B;  1B55 A;  5I2S A;  5IA7 A;  4NJ6 A;  4CO7 A;  4LNI A;  2YVC A;  2HE7 A;  1F77 A;  1YN5 A;  2C5L C;  3ZO5 B;  4IFS A;  2LFI A;  2J59 M;  1MIZ B;  1R4M B;  4YL8 A;  1L6V A;  1MPH A;  4GDL B;  3PG7 A;  2EEL A;  1HZ6 A;  1ZDX A;  4II3 B;  4DX8 A;  3NWF A;  1WJ1 A;  2BT6 A;  3MTN B;  3FP5 A;  2LUE A;  5J3Q A;  1WGK A;  3E66 A;  1GNU A;  3AEA B;  2KVZ A;  3V6C B;  3F5R A;  1D5Z C;  1T0Q C;  1YX6 B;  5FI1 A;  3AEB B;  4WWO A;  2OTX A;  2PPH A;  2N9K A;  4GXB A;  1QZE A;  4A6H A;  5D3I B;  3NZ3 A;  2MBH A;  2GJY A;  1HQR D;  5BMI A;  4W9J A;  2PLP A;  1ZE3 D;  4I6N B;  2DBY A;  2FAZ A;  3W1S A;  4C80 A;  3V60 A;  1JRU A;  2WDR B;  2J53 A;  3SNH A;  4RH6 A;  3PZD A;  3W5U B;  4A20 A;  3ZJV A;  2EKE C;  2KHW B;  5HKH A;  4WJQ A;  4KVG B;  1DIK A;  4GLS C;  2ICI A;  1FEH A;  2KVR A;  1VZ8 A;  1MG4 A;  3L17 A;  3RNB C;  2PKO A;  3R3M A;  1RM6 C;  1T6B X;  4QJ3 B;  1IGC A;  1WMH B;  2WX1 A;  3Q3N C;  1J0G A;  4M8M A;  4KDI C;  4TYZ A;  4DHJ B;  2LD9 A;  5KQ4 A;  1WGY A;  4YXD B;  4K7U A;  1H4R A;  1PGX A;  3FM8 C;  3PRP B;  4RGO S;  2KO3 A;  3SV1 A;  2JUO A;  1WM3 A;  3PSE B;  1JDE A;  4DXA B;  3R7Q A;  2V3N A;  3PO0 A;  2NPT A;  1IRS A;  3TFM A;  1S1Q B;  3E9O A;  1XEE A;  3DHI C;  3IXS A;  2IYB A;  3ZNI D;  5DPW A;  2Z0E B;  3VH4 B;  2Z0D B;  4TSS A;  2ZW0 A;  4L2Y A;  2LGY A;  3R66 C;  3OAN A;  1V88 A;  1C78 A;  3ZYY X;  2CHZ A;  3QWZ B;  3U30 A;  2BQQ A;  4EZL A;  1JW9 D;  2J0J A;  3LDZ E;  2BBC A;  2L52 A;  3F0W A;  1OQR A;  3V3X A;  4AJY B;  2OQB A;  1FM0 D;  2D9Z A;  4HRO A;  1TGZ B;  3T06 A;  1AW7 A;  4KX6 B;  4A3O A;  2WYQ A;  4PYU A;  2KUP A;  2LHE A;  1UGJ A;  3MC0 B;  1TS3 A;  5E6J A;  4IW0 A;  1V49 A;  3WAN A;  2MBB B;  1NDD A;  4IWQ A;  1UGM A;  1SE2 A;  2IGG A;  3EA6 A;  1GAQ B;  2CS4 A;  4HAT B;  1ZKH A;  4S0R A;  1M94 A;  1XO3 A;  3KZ1 A;  1L0X B;  3AE4 B;  3KY9 A;  1E90 A;  3ZDM C;  4ICU A;  3DVG X;  2OJR A;  3HIZ A;  5LNK 1;  5J2R A;  1P7E A;  1MI1 A;  1OGW A;  2YT2 A;  2DFK A;  3AEE B;  2IY1 B;  3I3T B;  2FIF A;  2KDM A;  1QQR A;  1D4B A;  3AE7 B;  3PVU A;  5C1Z A;  2WLB A;  1NTV A;  1FCC C;  2LVO A;  5D3X A;  2QIE B;  2WQY B;  3A9K A;  1SE9 A;  2JRI B;  2Z8L A;  3M1I B;  2V4I B;  1FNU A;  1ET9 A;  3NS1 A;  5C2T B;  3RNG C;  1GC7 A;  4HKQ A;  2ACZ B;  3R7R A;  3FVC A;  2M4N A;  3RNF C;  3DBS A;  2JX5 A;  1I7H A;  2Q13 A;  4KKI A;  2NR2 A;  2Z4D A;  3TEZ A;  4F7H A;  3WAP A;  2FDQ A;  4KKJ A;  4PNK A;  3A4R A;  2KDE B;  2RQ1 A;  2LGS A;  2WDV B;  2V3P A;  1V61 A;  3VH3 B;  1FNW A;  2GBK A;  1YQ3 B;  1MFW A;  3KWL A;  4C0A A;  1K50 A;  3R2T A;  2LOZ A;  4JGH B;  3Q6B A;  1XLO A;  4MGY E;  3A9K B;  1F2R C;  3X0W A;  3RFZ B;  2LYD A;  2HD5 B;  2L32 A;  2KFJ A;  2CB8 A;  1DOY A;  3BK1 A;  3T9L A;  3R8B A;  3ODW A;  3ZJU A;  1QQG A;  4LLG M;  3NG0 A;  2HRJ A;  4JWU C;  2NMQ A;  1WE6 A;  3LYY A;  1MJD A;  4ANV A;  2IO0 B;  3RZF A;  2GOW A;  4QJ5 B;  3N32 A;  2IZV B;  4P1B C;  3D8F A;  5LOP B;  1C4C A;  1SE4 A;  2H7D A;  3E9S A;  2LWP A;  3B1L X;  2KFK A;  4D6W A;  3KVF B;  2AQ3 B;  1KF6 B;  3AE3 B;  3CST A;  3HSA A;  5JP4 A;  5LG4 B;  3N3K B;  3O13 A;  3ZGZ A;  1WXA A;  3GP7 A;  1WX7 A;  4WH4 A;  2N7E A;  1KFY B;  2KMA A;  2KYW A;  3TO1 A;  4PK1 A;  1VJK A;  5AUI A;  2L83 A;  4HKZ E;  2MJE A;  2R82 A;  1JRO A;  3UGB B;  2BWF A;  2KX0 A;  4IKG A;  2K25 A;  4ARC A;  3PSC A;  2NMB A;  5DPR A;  1SGH A;  2K22 A;  2KDB A;  3ZXR A;  2RRF A;  4A55 A;  2KFK B;  2KWU B;  3Q69 A;  3I9V 1;  1L7Y A;  4XZ4 A;  2JP2 A;  4FBJ B;  2FJL A; 
#chains in the Genus database with same CATH homology
 4F7Z A;  1V5M A;  3U7D A;  4JKD A;  3QJZ A;  4K81 A;  1WGQ A;  2FCQ A;  3ECI A;  2W9N A;  3V61 A;  2RNR B;  1WZ0 A;  2NBW B;  1KOT A;  3VUW A;  2N23 A;  3DPD A;  3ZTC A;  2I1J A;  1KZG A;  2BYE A;  3EEC A;  5AZF A;  3VFK A;  1OEY J;  4GSW A;  2EMT A;  2MCN B;  3PS6 A;  2DX5 A;  3SYX A;  1EUV B;  4RM8 A;  4TUU A;  5AZG A;  1QC6 A;  3UIN B;  2KAN A;  4A3P A;  4RM9 A;  2M17 A;  5KCV A;  4BBK A;  4WWP A;  2G3Q B;  2XK5 B;  2CHX A;  2COA A;  1UPQ A;  3QHT A;  3A8Q A;  4XX5 A;  3MPX A;  2ZEQ A;  3IVF A;  3IHP C;  2KMC A;  4JK8 A;  2RVB B;  1GG3 A;  4MY6 A;  1WR1 A;  1XOD A;  3TCA A;  2DX5 B;  4W9K A;  3VHT C;  4DX9 0;  5DPT A;  2IFS A;  1MIX A;  2A4Z A;  3H9D A;  4HB3 B;  1NI2 A;  4ZRI A;  4G50 A;  1U5E A;  5FI0 A;  1WGD A;  3EC8 A;  4MK0 A;  3H7S A;  2YT0 A;  3VUY A;  4GN1 A;  2M8S A;  3ALB A;  4HB2 B;  5CHW A;  4XWX A;  1ZC3 B;  4I6P A;  2DYB A;  3ENE A;  4GU2 A;  2C9W B;  2LG1 A;  2NCN A;  4M0W B;  1R4M I;  1UBI A;  4W9D A;  1SHC A;  2KDF B;  4JKB A;  3RUI B;  1IP9 A;  4M8N A;  4A5K A;  5AZH A;  2XQN M;  3KH0 A;  2NVU I;  2K8H A;  1UEF A;  1A5R A;  1ZVR A;  1SIF A;  5DPS A;  2KXJ A;  1WGH A;  2Z0Q A;  2ZVO A;  3HM3 A;  2KJ6 A;  3MHS D;  3ZRC A;  1TZ1 A;  2I1K A;  2K8B A;  3ENB A;  5DIF B;  4DBG A;  3OAW A;  4P7I A;  3W1S C;  2DAJ A;  3BJI A;  2BPS A;  4IOY X;  1P3Q U;  5DHA B;  3WA0 A;  1K5D B;  4W9E A;  4CHK A;  3KUC B;  3L10 B;  2RSG A;  3RYT A;  3RT3 B;  4E71 A;  4BOZ B;  5JH5 C;  4JK7 A;  4HPL B;  1WX9 A;  4Z2M B;  2MW5 A;  4EKU A;  4KHB B;  3UZT A;  4A6F A;  4GMX B;  3L0W B;  1PFJ A;  4DK5 A;  4HJK A;  3ODO A;  2J0M A;  5D3W A;  3H1U A;  1DDM A;  2W2W A;  1P98 A;  2QKL A;  4ASW C;  2P0H A;  1ST7 A;  4NPN A;  2D9W A;  3BIN A;  2LZ6 A;  3HQC A;  4JKA A;  3C0R B;  4MT7 A;  1KBL A;  3H6N A;  2R0D A;  2FJ9 A;  4A6F B;  3K9P B;  2MLB A;  2BGF A;  3ZKJ C;  4JQW C;  3PTF C;  5E6N A;  1RJ2 A;  2PZ1 A;  1WXV A;  4IAP A;  3MDB C;  3KSY A;  1LQB A;  1DDV A;  1WH3 A;  4JIO U;  2M1M A;  3BY4 B;  5JLJ B;  3HM6 X;  2JWZ A;  3TVV A;  1FXT B;  3GOE A;  3TBL D;  5CLQ B;  5C23 A;  2D10 A;  1GC6 A;  3WAO A;  1WYW B;  4KSL C;  4FJZ A;  4II2 B;  4WVF B;  2LRW A;  1KC7 A;  2ZJD A;  5LLI A;  1P5T A;  4GZU A;  4BKG A;  2Y5B B;  3SBT A;  4KV2 A;  5KHQ A;  2EC1 A;  4HXD A;  2MBO A;  1Y19 B;  1T0Y A;  2KCJ A;  3K9O B;  2V4L A;  2RPQ A;  4CYE A;  3EPY A;  4IG7 B;  3DVN U;  3IG3 A;  1WMH A;  3WYF B;  2CHW A;  2NZ8 B;  3TMP B;  1J19 A;  2YS1 A;  3DXD A;  2N7D A;  3ZIM A;  1BTN A;  5D3V A;  1EF5 A;  3ZVV A;  1E8Z A;  3AU4 A;  1LFD A;  4ILJ A;  2DZK A;  2LGD A;  2DAF A;  1BAK A;  2N9P C;  2LXA A;  3OJ3 A;  1U5F A;  4CHJ A;  1W1G A;  2G45 B;  4W9G A;  4LJP B;  4E3C A;  4HB4 B;  4K7W A;  4AWJ A;  2LI5 A;  4W9I A;  3LJ3 A;  2N9X A;  2RUK B;  4HPM B;  3EFU A;  3WAM A;  4I6L B;  1V89 A;  5EDS A;  3NY5 A;  3TW1 A;  1ZM0 A;  3AJ4 A;  2JF5 A;  2KLG A;  4IM2 A;  3ZNH B;  5GMV A;  4W9L A;  4MSM B;  2DIK A;  5L83 A;  1I2H A;  1WG7 A;  2I5C A;  2GMI C;  1WZ3 A;  3ML4 A;  3AXC A;  1XCG A;  3DBH I;  1VD2 A;  5G55 A;  2ADZ A;  2KK8 A;  3KUD B;  2FCM A;  3IFW B;  1GJZ A;  4AP4 C;  5J3T A;  2MWS B;  2L0T A;  4URK A;  3D8E A;  2YLM A;  2GCL A;  3QAR A;  2C7N B;  3V6E B;  1K5G B;  4ANU A;  2DTC A;  2P0F A;  2DKQ A;  2K6Q A;  2VSZ A;  5KQ1 A;  1TJ6 A;  3GYP A;  4MGK E;  5D3Y A;  1FGZ A;  1P0R A;  2VRR B;  3VTV A;  4F7G A;  1E7V A;  1BWN A;  2W2X D;  1ISN A;  1I35 A;  2WX0 A;  4OVV A;  5IAA C;  2DHI A;  2D9V A;  3FEH A;  2COC A;  1KJT A;  2CRF A;  2LVQ A;  2H7E A;  2V3S A;  5EFX A;  1KI1 B;  4MGZ E;  3ZRF A;  1FB8 A;  5TR5 A;  2KKC A;  2MX2 A;  5LON B;  2JY6 A;  2M14 A;  3L13 A;  2CU1 A;  4IM3 A;  1YX5 B;  1Z5S B;  1TQZ A;  3PVW A;  5JHA A;  3DVG Y;  2DHJ A;  4DHZ E;  4BKS D;  5LXI B;  2BYV E;  2X0S A;  2PJH A;  1WVH A;  1KM7 A;  3PGE A;  3CSF A;  1DBH A;  3HK0 A;  4WJN A;  3ZVR A;  3ZDT A;  1XQQ A;  4BBN F;  1WGU A;  1G6J A;  1V5O A;  4G11 A;  3UIP B;  3QA8 A;  1YQB A;  1UH6 A;  2LJ5 A;  2OOB B;  5D6J B;  2AWT A;  2CQU A;  1KZ7 A;  4MEM A;  3PHX B;  4K2O A;  1AAR A;  2M0X A;  1CMX B;  3DOW A;  4X57 B;  4WQO B;  5C16 A;  4HWI B;  3X23 A;  1L2N A;  2DZM A;  1MAI A;  4KZC A;  4BBN C;  3TJP A;  1EVH A;  2KQ7 A;  3VXW A;  1VCB A;  2LVP A;  1NVL A;  3W1Y A;  4K17 A;  4F8C B;  5JHH A;  2O6V D;  3PP2 A;  2MQJ A;  3O96 A;  1YIW A;  2FUH B;  5HE0 A;  1NTY A;  3HW2 B;  2UZR A;  2D3G A;  2K1F A;  3U8Z A;  2BF8 B;  2BKF A;  1TXD A;  2XK5 A;  5CX3 A;  2MRP A;  2NBV B;  2CR5 A;  4XC2 A;  1LXD A;  4EJN A;  2LGX A;  1E8Y A;  4NAW B;  2K2U A;  2ZNV C;  2KD0 A;  1E5W A;  2KNB A;  1YD8 U;  5HE2 A;  5D2M B;  3CMM B;  3RCP A;  2LXC A;  1J8C A;  4ICV A;  2NS5 A;  3VOQ A;  3KYC D;  5CHF A;  2V1Y A;  2DLW A;  4NSW A;  2MA9 B;  3E9L A;  4ZRK A;  5D7G A;  4MJS A;  2GBM A;  4FUL A;  3PLU A;  3PEG A;  1WI0 A;  2L0F A;  2I5F A;  5L95 C;  4DDG D;  3M3J A;  2HJ8 A;  2COF A;  3KRX A;  2KN5 A;  4BKS A;  4FAD A;  2HTH A;  2KQS A;  4WJP A;  5GOW B;  5C79 A;  2REX A;  4W9H A;  4BKT A;  4WJO A;  4MDK E;  1WY8 A;  1P9D U;  4AUQ C;  5CLL B;  2DZJ A;  4RMA A;  4TQ0 A;  1V5P A;  1R4N I;  4PS3 A;  2KX3 A;  1C1Y B;  3CXB B;  1FAO A;  1NTI A;  4GB9 A;  3NZS A;  1X1M A;  4MJS B;  3SU8 X;  3ODX A;  1X1F A;  1U27 A;  2ELA A;  3KRW A;  1WF9 A;  3APF A;  2VRW B;  3SO6 A;  2J7Q B;  5CHV C;  1U5G A;  5KHO A;  4GPT B;  1X86 A;  2HTH B;  3JYU A;  1DRO A;  2E2X A;  2WWZ A;  4K2P A;  2DKP A;  1WJM A;  2DYM A;  3VIA A;  2BKR B;  1P6S A;  4WWN A;  1V5U A;  2KWC A;  2AL3 A;  2MBE A;  2MP2 A;  1W1D A;  4F1S A;  2EMS A;  1ACA A;  1V86 A;  3VQI A;  2YSZ A;  2B3A A;  2O6V A;  2KTR A;  3V5W A;  2L00 B;  2N1V A;  2DZI A;  3ONS A;  2FNJ B;  2L05 A;  4D0N B;  2R2O A;  1WJ4 A;  1UNR A;  3PRZ A;  1WE7 A;  1PMS A;  1F9J A;  3P7Z A;  2RLO A;  5C5B A;  2MP2 B;  2WDT B;  3M62 B;  1XT9 B;  2GBJ A;  2ROV A;  3KUZ A;  2N0Y A;  4FHJ A;  1MG8 A;  2KWV B;  5BO4 B;  2O6V B;  3UF8 A;  2KTR B;  3H7P A;  1NBF C;  4MSQ B;  3CIK A;  2LUL A;  1DYN A;  2N4F A;  1U4A A;  4MH0 E;  2Y8F A;  4MEL A;  2COD A;  4EZK A;  1Y5O A;  4B6W A;  3JSV A;  4WSF A;  5C5B B;  3N7C A;  2Z0O A;  5JZE B;  2UZS A;  1YJ1 A;  1V6E A;  3A9J A;  2L8J A;  2K00 A;  2Y8G A;  1V2Y A;  3T8M A;  1U29 A;  1UD7 A;  3N30 A;  4MM3 A;  3RUL A;  3H7P B;  2KC2 A;  2NBU A;  3APC A;  1HB8 A;  5D27 A;  4WAA A;  3QBV B;  2CY4 A;  1XX0 A;  3HHM A;  3NSU A;  4B6H A;  3ZNZ B;  3JSV B;  3Q3J A;  1DDW A;  1KLV A;  2JZZ A;  3A9J B;  3GYO A;  3ZW3 A;  2P8V A;  1W1H A;  4KHA A;  3B08 A;  4A6K A;  4HDO A;  4F7U P;  2P0D A;  4NNJ B;  3V62 A;  2LAS A;  4JKF A;  4FJY A;  1OEY A;  2YF0 A;  4PS8 A;  4TQ1 A;  1ZSQ A;  3OLM D;  1E7U A;  3VDZ A;  2JZ3 B;  4NJ7 A;  2M38 A;  4AOF A;  3RCZ A;  2KLC A;  1RRB A;  1FOE A;  2ABD A;  2ZVN A;  3A1Q B;  3QIJ A;  3ML9 A;  2KOX A;  3PRE A;  2J0K A;  2UYZ B;  2QHO A;  4MGI E;  2LOX A;  1V81 A;  4K1R B;  4DHZ B;  2MDX A;  4NY0 A;  4DWF A;  3L08 A;  4PQ0 A;  3S2A A;  1FHO A;  1XR0 B;  1EGX A;  5HE1 A;  5FR6 A;  2IO2 B;  3L54 A;  1XKE A;  1WX8 A;  5C6R A;  2RSU A;  1MK7 B;  2GBN A;  1X1G A;  1Z2M A;  2N1W A;  1LW3 A;  2MBQ A;  2IBI B;  1MK9 B;  4YON A;  2D07 B;  2K6D B;  4ANX A;  2ZZP B;  2RR9 A;  3NHE B;  1UNQ A;  3QC8 B;  2G35 A;  2KJR A;  3DBL I;  2EJ8 A;  5JHG A;  5JHB A;  4GOC A;  2R2Q A;  2XBB C;  2JPH A;  4ANW A;  3M63 B;  3APD A;  4B95 A;  5J3Y A;  4JKE A;  4K7S A;  3QK0 A;  4HAU B;  4PYZ A;  1NU2 A;  3MJW A;  4GIV A;  4PS7 A;  1D3Z A;  2L3Z A;  3PVL A;  2KDI A;  3SUZ A;  4HAX B;  2CKH B;  2COP A;  4WJ7 A;  1FGY A;  2UWQ A;  3KW5 B;  1OQN A;  2MKR A;  4LJO B;  4ZRJ A;  4KDL B;  5LXH A;  3D8D A;  2JXX A;  3SDL C;  3VUX A;  2O2V A;  4G3X B;  2LRU A;  2X18 A;  2YRY A;  1TBE A;  2W2X C;  4JK9 A;  3NZU A;  2DYO A;  5E6O A;  1WJ6 A;  1K8R B;  3A4S C;  3DBR I;  1AWE A;  1M7E A;  3A8P A;  2NPT B;  2GCJ A;  3M95 A;  4ZYN A;  4KHO A;  2FCN A;  4KAX B;  3G9W A;  5HE3 A;  2O2V B;  3CF6 E;  2UVM A;  4DBB A;  3VVW B;  5DH9 B;  1WXS A;  3QAQ A;  4EFO A;  5IJM A;  4W9C A;  3E9P A;  1RFA A;  1I7A A;  4GGQ A;  4IUM B;  2DHZ A;  2KTF A;  4JL9 A;  2JRH A;  4EUT A;  4HAW B;  4FLH A;  3WAL A;  3DDC B;  1TTN A;  2Y7B A;  4NQK E;  1Z87 A;  2D4Q A;  1M7R A;  2QKM A;  1I42 A;  1GGO A;  2PEA A;  1UBQ A;  5JVL A;  1OMW A;  4HHV A;  2BWE S;  2ASQ A;  3ZNG C;  3NS8 A;  3D32 A;  3PT2 B;  5CTR C;  2JVC A;  2DA0 A;  1WFY A;  4JLC A;  2BCJ A;  3VAW A;  2IO3 B;  2MSE D;  4OVU A;  2MWN B;  2ZPY A;  1UNP A;  1E8X A;  1Q67 A;  3FSS A;  2VKI A;  4NQL B;  3WIM A;  4DDI D;  1WIA A;  1Q1O A;  2G4D B;  2DX1 A;  4NAW A;  4HCN B;  5AEK B;  2LKO A;  2FID A;  2BYF A;  4ILG B;  1HB6 A;  1C3T A;  3RZW C;  2KGX B;  5L81 A;  5E6P A;  2K2J A;  3RD2 A;  5DCN A;  5J17 A;  4HAZ B;  1HE8 A;  4FJV B;  3QX1 A;  2DHK A;  2PE6 B;  4FN2 A;  2YS3 A;  2L7R A;  3ML8 A;  1X05 A;  1UPR A;  1P1A A;  1WXM A;  4FA6 A;  1H8C A;  4Y94 A;  2ROZ B;  2KJH B;  4KIK A;  4FHK A;  3L16 A;  3PLV A;  1Q5W B;  2L1C A;  3UQB A;  4TKN A;  4LDT D;  4GDK A;  3ZUN A;  2D2Q A;  2CY5 A;  3PRM B;  3NOB A;  4JKG A;  4IM0 A;  1WGR A;  2C7H A;  4KZ0 A;  2ZCB A;  3UQA A;  5D94 A;  2CAY A;  4CHM A;  4EMO A;  3PV1 A;  4KIK B;  3AU5 A;  2DEN B;  3TIX A;  4L6E A;  2L2I A;  3SD5 A;  2K8C A;  5DHF B;  2YT1 A;  3DCG A;  4GDK B;  4IWO A;  4JKH A;  3ULB A;  2YS5 A;  1WJN A;  1S3S G;  4EEW A;  2MFQ A;  4HDQ A;  4JKG B;  4GMV A;  3FLV A;  3ZLZ A;  2C7M B;  1WR6 E;  5G2N A;  4HLE A;  4E74 A;  2XEW A;  1WJU A;  2DYQ A;  1HBK A;  3B0A A;  3ULC A;  1BTK A;  3GZN I;  2IO1 B;  4B9K A;  1IYF A;  2RD0 A;  2KZR A;  4IC7 B;  2IYD B;  1UZX B;  3DQV A;  1V9J A;  2K39 A;  2ZPN A;  4BFR A;  1WGG A;  2FCS A;  2D11 A;  1IPG A;  1N3H A;  2DYN A;  3JW0 X;  1VBH A;  1WM2 A;  3P2B A;  2JT4 B;  1EAZ A;  3ZTD A;  4N9F 4;  1OQY A;  3O65 B;  1RRP B;  2D9Y A;  1OY2 A;  4W9F A;  1BT0 A;  2R09 A;  4EZJ A;  4ZDV A;  2AL6 A;  5DI9 B;  3KYD D;  3P6A A;  1PQS A;  4HVB A;  1GUA B;  2Z0P A;  3AI5 A;  2A5U A;  2ELB A;  3QQ8 B;  3PHW B;  1ZW7 A;  3TL5 A;  4J6I A;  2G4S A;  4ILH A;  2GS0 A;  1P3R A;  4G0N B;  3LJU X;  3Q3F A;  4HAY B;  3SHQ A;  4EOY A;  2IY0 B;  1RLF A;  4BOS C;  4DHJ D;  4Z2N A;  1MKE A;  1U2B A;  1ZC4 B;  1U5D A;  2V76 A;  1WI1 A;  3DVN V;  1Y8R C;  2N9E B;  4LDT B;  1UEL A;  4HB0 B;  2Z59 B;  4LCD E;  4HCP B;  1LB1 A;  1J0W A;  2RGN B;  1VBG A;  2AYO B;  4BVU C;  3A98 B;  1EF1 A;  2C60 A;  1X11 A;  1ZGU B;  4TV3 A;  1FHW A;  3OJ4 B;  1Q0W B;  3DXC A;  3A33 B;  3AUL A;  1EO6 A;  3VTW A;  2L76 A;  1XD3 B;  1XD4 A;  2D9X A;  2DN6 A;  1H10 A;  4JKC A;  3A1Q A;  2ZNV B;  3DXE A;  1RAX A;  1LM8 B;  4HK2 A;  3QWM A;  4H8S A;  2AEH A;  2LBB A;  3QCA A;  1OTR B;  3JVZ X;  1FHX A;  2ZCC A;  4AJW A;  5J18 A;  1V5T A;  4IWP A;  3SBG A;  2GBR A;  2PE9 A;  2RGF A;  4GDL A;  3PPA A;  1WRD B;  3IBE A;  2KC1 A;  1E8W A;  1PLS A;  1V80 A;  3EHV A;  2WH5 A;  1AQC A;  3UIO B;  3VTU A;  4KSK C;  4HAV B;  1B55 A;  5IA7 A;  4NJ6 A;  4CO7 A;  2YVC A;  2HE7 A;  2C5L C;  3ZO5 B;  4IFS A;  2J59 M;  1MIZ B;  4YL8 A;  1MPH A;  4GDL B;  3PG7 A;  4II3 B;  4DX8 A;  1WJ1 A;  3MTN B;  3FP5 A;  2LUE A;  5J3Q A;  3E66 A;  1GNU A;  3V6C B;  3F5R A;  1YX6 B;  5FI1 A;  4WWO A;  2OTX A;  2PPH A;  4GXB A;  1QZE A;  4A6H A;  2MBH A;  2GJY A;  4W9J A;  4I6N B;  2FAZ A;  3W1S A;  3V60 A;  1JRU A;  3SNH A;  3PZD A;  4A20 A;  2EKE C;  2KHW B;  5HKH A;  4WJQ A;  4KVG B;  1DIK A;  2KVR A;  3L17 A;  3R3M A;  1WMH B;  2WX1 A;  1J0G A;  4M8M A;  4KDI C;  4TYZ A;  4DHJ B;  2LD9 A;  5KQ4 A;  1WGY A;  4K7U A;  1H4R A;  3FM8 C;  3PRP B;  2KO3 A;  3SV1 A;  2JUO A;  1WM3 A;  3PSE B;  1JDE A;  4DXA B;  3R7Q A;  2NPT A;  1IRS A;  3TFM A;  1S1Q B;  3E9O A;  2IYB A;  3ZNI D;  5DPW A;  2Z0E B;  3VH4 B;  2Z0D B;  2LGY A;  3R66 C;  3OAN A;  1V88 A;  2CHZ A;  3QWZ B;  3U30 A;  4EZL A;  2J0J A;  3LDZ E;  3F0W A;  4AJY B;  2OQB A;  2D9Z A;  1TGZ B;  3T06 A;  4A3O A;  2WYQ A;  4PYU A;  2KUP A;  4IW0 A;  1V49 A;  3WAN A;  2MBB B;  1NDD A;  4IWQ A;  1UGM A;  2CS4 A;  4HAT B;  1ZKH A;  1M94 A;  3KZ1 A;  3ZDM C;  3KY9 A;  1E90 A;  4ICU A;  3DVG X;  2OJR A;  3HIZ A;  5J2R A;  1OGW A;  2DFK A;  2IY1 B;  3I3T B;  2FIF A;  3PVU A;  5C1Z A;  1NTV A;  2LVO A;  5D3X A;  3A9K A;  1SE9 A;  2JRI B;  3M1I B;  1GC7 A;  3R7R A;  2M4N A;  3DBS A;  2Q13 A;  2NR2 A;  4F7H A;  3WAP A;  2FDQ A;  4PNK A;  3A4R A;  2KDE B;  2RQ1 A;  1V61 A;  3VH3 B;  2GBK A;  4C0A A;  4JGH B;  2LOZ A;  4MGY E;  3A9K B;  3X0W A;  2LYD A;  2HD5 B;  2KFJ A;  2CB8 A;  3T9L A;  3ODW A;  1QQG A;  2HRJ A;  1WE6 A;  4ANV A;  2IO0 B;  3RZF A;  2GOW A;  3N32 A;  2IZV B;  3D8F A;  5LOP B;  2H7D A;  2LWP A;  3B1L X;  2KFK A;  3KVF B;  3CST A;  5JP4 A;  3N3K B;  1WXA A;  1WX7 A;  2N7E A;  2KMA A;  3TO1 A;  2R82 A;  3UGB B;  2BWF A;  2KX0 A;  2K25 A;  3PSC A;  2NMB A;  5DPR A;  1SGH A;  2KDB A;  2KFK B;  2KWU B;  1L7Y A;  4XZ4 A;  2JP2 A;  4FBJ B;  2FJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...