4YL8A

Crystal structure of the crumbs/moesin complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
296
structure length
296
Chain Sequence
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKAFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Moesin
publication title Structural Basis for the Phosphorylation-regulated Interaction between the Cytoplasmic Tail of Cell Polarity Protein Crumbs and the Actin-binding Protein Moesin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 93
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4yl8A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4yl8A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4yl8A01
2ABDA 3N3KB 2J7QB 1R4MI 4EMOA 1WZ0A 5KQ4A 3V6EB 3SDLC 4IAPA 1SE9A 4CHKA 1YX5B 2RNRB 2KO3A 1TTNA 1NTVA 4ANVA 2DZMA 2CKHB 2FUHB 2PEAA 3H6NA 2KD0A 1WGDA 4IG7B 2IO0B 5CLQB 2KHWB 5JHAA 3KSYA 4KAXB 1WR1A 2LUEA 4IC7B 1X11A 4IM3A 1WF9A 5J3YA 3AJ4A 1UZXB 1M7EA 1V5MA 3NZUA 2AL3A 2R2QA 1LQBA 2M38A 3RCZA 2M17A 4TYZA 1M7RA 4GMXB 2KFKB 1ZC3B 1UEFA 2Y8FA 4FJZA 2IO1B 1Z5SB 3JSVA 4WWPA 4DDID 2LGXA 2JT4B 3NSUA 3MTNB 1DBHA 2DHJA 2ZNVB 4EJNA 3K9PB 2EJ8A 2W2XD 2MFQA 3VH3B 2DYBA 2V76A 4NJ6A 3QBVB 4GU2A 3TMPB 3TVVA 3HIZA 3A9JB 2RQ1A 1GC7A 3PVWA 1ZSQA 1WMHB 2OTXA 3VAWA 3TBLD 3F0WA 5L83A 2MBQA 5D3XA 2JP2A 2DAJA 4IM0A 2Q13A 3NY5A 3RD2A 3GYPA 1WZ3A 1HBKA 1WG7A 2MRPA 3D8EA 1KM7A 4HLEA 2RGNB 1J8CA 4GXBA 4DHZB 4K7UA 2KDFB 4TQ0A 1NU2A 2MA9B 5EDSA 4BKGA 4W9DA 3DPDA 2JZZA 2OQBA 2N9PC 1EGXA 4FBJB 3AULA 2NS5A 2PE9A 3QCAA 2KNBA 5DCNA 5FI0A 1X86A 1Z87A 1TXDA 2IBIB 2KTRB 3W1YA 4EZJA 2P0FA 3ONSA 1KOTA 4HHVA 4BVUC 4TKNA 2KQSA 4NSWA 2C5LC 5LXIB 4E71A 1U29A 2V4LA 3LDZE 2LXCA 4F7HA 4IWQA 4WJ7A 1RFAA 4N9F4 4W9EA 4DK5A 2DZKA 2MP2A 1ST7A 2QKLA 3RYTA 1U27A 2ZPNA 3U7DA 2V1YA 2L1CA 2WH5A 3RZWC 2DA0A 3ZRFA 4MT7A 2VRWB 4HXDA 4F7UP 5C79A 3Q3JA 4WJOA 1P1AA 1MK7B 3QQ8B 4KDLB 4XWXA 4GDLB 4A20A 4I6NB 3AU5A 2G3QB 1IYFA 2BKFA 3L16A 3PRZA 4HK2A 1WGHA 3A9KB 2XK5A 4W9GA 3ML8A 2RUKB 4JL9A 2EMSA 1WM2A 4F7GA 3TIXA 4IUMB 3RUIB 3ZVRA 2Z59B 2CB8A 2FCQA 2Y5BB 4IM2A 2YSZA 1W1DA 2LKOA 2ZVNA 3A4SC 2WX0A 3NZSA 2GBKA 4K17A 3T9LA 4GPTB 3PVUA 1GG3A 1XR0B 2HD5B 2XEWA 1YIWA 4L6EA 2CR5A 2LOZA 2MKRA 2VRRB 2LXAA 2DFKA 3ZLZA 2RSGA 3ZUNA 3T06A 2DN6A 2CU1A 2LVPA 2G45B 2C7NB 3KYCD 2BYEA 1HB8A 1Q5WB 4K1RB 3LJUX 1GUAB 4DDGD 2I5FA 3X23A 4A6FA 2MQJA 4I6LB 5HKHA 3ULCA 1MPHA 2E2XA 4A6KA 4AOFA 1XKEA 4LJOB 4CYEA 1P6SA 1RAXA 1K8RB 1RJ2A 4LCDE 5DPTA 1OQNA 1HB6A 3SD5A 2DKPA 2KVRA 4C0AA 1WYWB 4IWOA 2GJYA 4DHJB 3R7QA 3PZDA 4WJQA 1B55A 1BAKA 1ZW7A 2Y7BA 2NCNA 4MGYE 3QK0A 5JHBA 3ZTCA 3R7RA 2KGXB 1UBQA 4ZRKA 1TZ1A 1Y8RC 2MW5A 1G6JA 3P7ZA 3H9DA 1N3HA 3JYUA 4OVVA 2HTHA 4B6WA 1E90A 2Z0EB 5HE1A 3RZFA 4HAWB 3GOEA 1FHXA 4KZCA 1UPQA 2D9XA 5AZHA 2K2UA 4KSKC 4PNKA 1HE8A 1WGUA 3SV1A 3M3JA 4EUTA 3ML9A 3WANA 1XCGA 1C3TA 4CHMA 1U5DA 2W9NA 3QWZB 4ZRJA 3DVNU 2HE7A 1S3SG 3TL5A 2YT1A 2JVCA 3ZRCA 3ZNHB 4WWNA 5BO4B 3JW0X 2ASQA 1FAOA 1L7YA 3D8FA 4KHOA 3TFMA 1P5TA 5D3WA 2DYNA 3V60A 2JUOA 4ZRIA 2N1WA 5G55A 4AJWA 1E8XA 2O6VA 3KUZA 2C9WB 2KFJA 3PVLA 4KHAA 3VVWB 3OLMD 3Q3FA 1DDWA 2KOXA 4NNJB 4RM9A 2GBMA 1V6EA 2K8CA 2P0HA 3V5WA 3IBEA 4KDIC 3IVFA 5C5BB 4M0WB 4AJYB 4KVGB 3PSCA 2D9WA 2QKMA 3FLVA 3WA0A 2KDIA 1H10A 3HM6X 3ZNGC 5L81A 2NPTB 3H1UA 3A1QA 3KRXA 1FB8A 3FEHA 2N0YA 3KZ1A 2CHXA 1KJTA 3O65B 2CY5A 1WJUA 4MJSA 1PFJA 3ODXA 3KUDB 1V61A 2RR9A 4G50A 2KDBA 4GOCA 1K5DB 2K2JA 3KW5B 4WSFA 3K9OB 1TJ6A 4W9HA 4BBNF 3WAPA 4HCPB 4HVBA 2MLBA 2G4DB 1MK9B 4K7SA 1UGMA 1R4NI 4G3XB 2IY0B 1Z2MA 2DYOA 2CRFA 3X0WA 2ZCCA 1UD7A 2LWPA 3SNHA 4H8SA 4F1SA 3VTUA 1WXAA 3VDZA 2H7EA 2A4ZA 2IYDB 4EFOA 5IAAC 1MIXA 3IFWB 1WXVA 2IZVB 4HWIB 2UWQA 2M4NA 1P3RA 3V61A 2REXA 3G9WA 3B1LX 3TCAA 2LOXA 3QJZA 2FJ9A 2KWUB 3FM8C 2DHIA 3ECIA 4HB3B 2KDEB 2DHZA 2LI5A 3TO1A 3VUXA 2IO3B 2RD0A 2JPHA 2RGFA 2VSZA 2M1MA 2ZEQA 2GBRA 2K39A 3SU8X 3FSSA 2KMCA 1SGHA 1U2BA 2K00A 1ISNA 1X1MA 4WJPA 1WJ1A 2K8BA 2W2XC 4HB0B 2MSED 1S1QB 1WGRA 1YD8U 3M1IB 2JRHA 4A5KA 2KJ6A 4BKSD 3N32A 5DPWA 1VCBA 1DYNA 4PYZA 1TGZB 3PHXB 1KZGA 2J0KA 3ZO5B 1WVHA 3QWMA 4ICVA 2IO2B 3BINA 3JSVB 2LVQA 5GMVA 1WX8A 2FIDA 1FOEA 1LFDA 3AU4A 1W1GA 2LASA 3V6CB 3VXWA 2LVOA 1A5RA 3KY9A 2CS4A 3ML4A 1I35A 1UNQA 2GMIC 2KTRA 2KMAA 3HQCA 2D07B 1M94A 4EOYA 2L05A 3ODWA 5E6OA 1NVLA 4NAWA 2NZ8B 4G0NB 3PLVA 3MHSD 5CHFA 2KJHB 4B9KA 1KZ7A 3DXDA 2CQUA 2JRIB 3GZNI 1WRDB 4II3B 4DXAB 3GYOA 4HDOA 4ANUA 4ICUA 5AZFA 4DHJD 3A33B 2CHWA 3HK0A 5C16A 4IWPA 3VUYA 4GDKA 1ACAA 4W9CA 4W9FA 2O2VA 3PREA 3DBHI 5TR5A 4E74A 5AEKB 3WIMA 2WWZA 3PRPB 2MWNB 2D4QA 2R09A 3DOWA 4F8CB 5KHOA 1FHOA 2RVBB 4RM8A 4KIKA 3DDCB 1V86A 3PTFC 2WDTB 3DBRI 3H7SA 3DVNV 3DVGX 5C6RA 1AQCA 1KI1B 3D8DA 4Y94A 1E7VA 2ROVA 1U5EA 2J0JA 4A3OA 1V5OA 3AXCA 4XC2A 1WI0A 4HB2B 3P2BA 3F5RA 1LXDA 3H7PA 4A6HA 1E8YA 2BKRB 3PEGA 3N7CA 3CMMB 3RULA 3WYFB 1H8CA 3D32A 2D9VA 2MP2B 2MCNB 4GSWA 2B3AA 4IW0A 3EECA 2COFA 2D10A 2MBEA 3KRWA 5D94A 2ZPYA 1I7AA 5DHAB 3SYXA 1GNUA 3WAOA 3O96A 4FULA 2NVUI 3PS6A 3IG3A 4DBGA 1YQBA 4RMAA 1V88A 1PQSA 3DCGA 5CX3A 1J19A 2JY6A 2BWFA 2N1VA 3EHVA 2XK5B 3T8MA 2G4SA 2KK8A 1LW3A 2FIFA 4B95A 1ZGUB 2EC1A 1U4AA 4DX90 2Z0OA 1EVHA 5CTRC 2YLMA 3VFKA 2D9YA 4M8MA 4GN1A 3MPXA 4MK0A 1XD3B 5J3QA 1IRSA 2NBWB 1FXTB 4MSMB 1WFYA 2I1JA 4Z2MB 2R2OA 5DPRA 4W9JA 3EPYA 2L3ZA 4URKA 2KCJA 4NJ7A 2GS0A 4AP4C 1T0YA 1U5FA 1E5WA 1E8ZA 5D6JB 2MBHA 1OY2A 4LDTB 2AL6A 2YS3A 3C0RB 4LJPB 2V3SA 4EEWA 2RPQA 2LGDA 3L08A 2UVMA 1V5UA 1ZC4B 4FADA 3SHQA 4PS3A 2ZVOA 3DXEA 1ZKHA 1Q67A 2KC1A 3OAWA 3RT3B 1YX6B 3QHTA 2PE6B 1H4RA 1I42A 5HE0A 3KYDD 3R3MA 2DYMA 2R0DA 2D3GA 4GZUA 1WJ4A 3KVFB 3QA8A 3WAMA 1WJNA 2M0XA 1XX0A 4WVFB 2M8SA 4FA6A 5DHFB 2UZRA 2BCJA 3HHMA 4BOSC 2BYFA 4KV2A 2KLGA 2L7RA 1PMSA 3DVGY 3U8ZA 4GGQA 2HTHB 1P3QU 4NPNA 3QX1A 1OEYJ 3AI5A 1FGZA 1EF1A 2ZNVC 3L13A 4IOYX 4HB4B 4MH0E 3PLUA 5DPSA 4GIVA 2JZ3B 3B0AA 4MELA 5EFXA 5JZEB 2L0TA 1UBIA 2L76A 5CHVC 2IFSA 2OOBB 3TJPA 1WE7A 1J0GA 4GB9A 4WAAA 3BJIA 4PS7A 3MDBC 4D0NB 2N9XA 1QC6A 1RRBA 4JGHB 2L2IA 2KC2A 2ZCBA 3N30A 1V80A 4HPLB 5C23A 3ZIMA 3UIPB 2DX5B 2COCA 1LM8B 3ENEA 5DH9B 4FHKA 4KHBB 3ZKJC 2YRYA 1MG8A 2FCMA 2MDXA 2O6VB 3PSEB 3UGBB 3I3TB 3VTWA 4WWOA 4GMVA 1SIFA 4FHJA 3CSFA 2M14A 1NTIA 2LRUA 4FJVB 2KLCA 3L54A 2MX2A 1RRPB 2QHOA 4ANXA 2COAA 4X57B 4HAZB 3APFA 3PV1A 4PQ0A 3VOQA 2A5UA 4MY6A 5FR6A 4WQOB 3A1QB 3OANA 3NS8A 2COPA 1X1FA 1WXSA 2DLWA 1WH3A 2FNJB 4MJSB 4IFSA 2LZ6A 2Z0PA 1UPRA 3HM3A 1NTYA 5G2NA 1WGYA 2KFKA 3W1SC 4YL8A 1I2HA 2L00B 5D3YA 1EO6A 3DQVA 4P7IA 4HJKA 2GCLA 5KCVA 2KX0A 2WX1A 3LJ3A 1WX9A 1GC6A 4J6IA 2I1KA 2DYQA 2YT0A 2NBVB 4W9KA 3DBSA 3TW1A 2W2WA 2I5CA 1L2NA 2C60A 4G11A 1EAZA 1ZVRA 3APDA 1AWEA 3VTVA 1VD2A 1OEYA 2N23A 3A9JA 1XQQA 3VIAA 1V81A 3UQAA 2N7DA 1WMHA 1DDVA 3OJ3A 2L0FA 4PYUA 4DHZE 1XODA 3UF8A 2NBUA 4EZKA 2KUPA 5IA7A 1ZM0A 2XQNM 3VHTC 1Q1OA 4AWJA 3FP5A 4FJYA 2ZZPB 3QC8B 1BT0A 4MGKE 2DHKA 3UINB 3M95A 2PZ1A 1P9DU 2C7HA 5AZGA 5D3VA 5D2MB 1WGQA 3IHPC 1QQGA 2LD9A 2N7EA 4ZDVA 3P6AA 1GJZA 3UQBA 3S2AA 2KWVB 4BFRA 4XX5A 1BTNA 2RSUA 5D27A 4A3PA 3A8PA 5J17A 3WALA 1TBEA 1P0RA 3A8QA 3QIJA 2KXJA 2KX3A 1YJ1A 3A4RA 5JH5C 2G35A 1PLSA 2PPHA 1IP9A 2N9EB 4DX8A 3ALBA 2BPSA 5JHGA 3W1SA 1FGYA 5LOPB 4HAXB 2CHZA 1FHWA 3RCPA 3L10B 2ADZA 1V2YA 3R66C 1DDMA 2KANA 3BY4B 2FDQA 3ZNID 4EKUA 1OMWA 2VKIA 4OVUA 4LDTD 2C7MB 1QZEA 4ZYNA 4GDLA 1WI1A 2IY1B 4NAWB 2GBJA 4HPMB 2WYQA 2KQ7A 4JLCA 3A9KA 2DAFA 2KN5A 3B08A 3NHEB 1BWNA 3ZNZB 4ANWA 3U30A 1AARA 1V5PA 4JIOU 2EKEC 2CODA 3V62A 3UZTA 1WJ6A 4DWFA 2Y8GA 4GDKB 1U5GA 4FLHA 5IJMA 5KQ1A 2BYVE 3ZTDA 2MBBB 2O2VB 4MGIE 5DI9B 2BGFA 4BKSA 4CHJA 2OJRA 3CXBB 5CHWA 4MSQB 4XZ4A 1Y5OA 2KJRA 3KUCB 1UH6A 2J0MA 5HE3A 4AUQC 1MAIA 4KIKB 3L0WB 2KWCA 5GOWB 3DBLI 2L8JA 1Y19B 2DZIA 4BBKA 4TQ1A 2J59M 3SUZA 1WJMA 3CSTA 4HATB 1W1HA 3QARA 2KTFA 2ZJDA 1V89A 2X18A 3H7PB 2JF5A 1XT9B 2P8VA 2LYDA 4Z2NA 2IYBA 1SHCA 2DTCA 2LULA 3A98B 4MDKE 4NY0A 1LB1A 1WX7A 2D11A 2O6VD 5C1ZA 5LLIA 3SO6A 2DZJA 2P0DA 2DENB 3CF6E 1J0WA 3NOBA 4NQLB 4BOZB 1WGGA 3MJWA 1OTRB 3EFUA 2D9ZA 2UZSA 2HJ8A 3PP2A 4KSLC 3ZW3A 4HAYB 3VUWA 4YONA 3PG7A 1UELA 1RLFA 2NMBA 3L17A 1IPGA 4DBBA 1Q0WB 2KKCA 2DX1A 3PPAA 4MM3A 3ZDTA 2LJ5A 2CAYA 4W9LA 2LBBA 2GCJA 4PS8A 2H7DA 4BKTA 4A6FB 1NBFC 4B6HA 4NQKE 4K7WA 4W9IA 1X1GA 2YVCA 2KZRA 4I6PA 2PJHA 1NI2A 4BBNC 3APCA 3M62B 4F7ZA 1K5GB 1KLVA 1MIZB 2EMTA 2GBNA 2BWES 2K6QA 3ODOA 4HAUB 2YS5A 2FCSA 1NDDA 3DXCA 5LXHA 2UYZB 1V5TA 1WIAA 2RLOA 2Z0QA 2MBOA 1F9JA 5JLJB 4HDQA 4M8NA 1WR6E 2CY4A 1P98A 1JRUA 3UIOB 3EC8A 4WJNA 1V49A 1E7UA 2GOWA 1E8WA 2AEHA 3HW2B 3QAQA 2N4FA 5C5BA 4II2B 4JQWC 3VH4B 3PRMB 5JHHA 1OGWA 5E6PA 1EF5A 4TUUA 1EUVB 2XBBC 2LG1A 4FN2A 1OQYA 2NPTA 2LGYA 4ASWC 4EZLA 2AWTA 3OJ4B 2MWSB 4MGZE 2DX5A 4CO7A 5JP4A 1UNPA 1WXMA 2LRWA 3PHWB 4HAVB 1CMXB 1UNRA 5HE2A 5E6NA 2Z0DB 3PT2B 2FAZA 1WE6A 5LONB 2FJLA 5KHQA 2FCNA 3CIKA 2ELBA 4K2PA 1DROA 1WM3A 4HCNB 5J3TA 2JWZA 3M63B 3KH0A 2DKQA 4MEMA 5D7GA 3PGEA 2ROZB 2K8HA 1WY8A 4E3CA 5J18A 1D3ZA 1C1YB 4TV3A 5DIFB 1X05A 2K6DB 2D2QA 3ULBA 2K1FA 1XD4A 2K25A 2AYOB 5CLLB 3ZDMC 2YS1A 2NR2A 2YF0A 2ELAA 1V9JA 4K81A 1TQZA 1MKEA 2BF8B 2HRJA 3ZVVA 3VQIA 5FI1A 4KZ0A 5J2RA 4K2OA 1BTKA 5L95C 3JVZX 2JXXA
chains in the Genus database with same CATH superfamily
2ABDA 3N3KB 2J7QB 1R4MI 1DIKA 4EMOA 1WZ0A 5KQ4A 3V6EB 4M00A 3SDLC 4IAPA 1SE9A 2V4IB 1GAQB 4CHKA 1YX5B 1QF6A 2RNRB 1SB3C 2L1AA 1PGAA 1TKGA 1T0RC 2KO3A 2KACA 2ZKMX 2FBWB 5D3IB 5LNK1 2WDQB 5HFYA 1TTNA 3AB5A 4C7YA 4OHJA 1NTVA 4ANVA 3BVZA 2DZMA 1QOFA 2CKHB 2FUHB 4JKCA 1MPEA 2PEAA 3H6NA 2WXKA 2INDC 5IN7A 2KD0A 4DIXA 1WGDA 3RNFC 1GGOA 4IG7B 4JK8A 2M0AA 2QILA 2IO0B 2DBYA 5CLQB 2KHWB 5JHAA 3KSYA 4KAXB 1WR1A 2LUEA 4IC7B 1X11A 4IM3A 1TKYA 1WF9A 1QQRA 2E6XA 2KAJA 5J3YA 1K50A 3AJ4A 2GRIA 1SEBD 2RPVA 1UZXB 1M7EA 2IGDA 1V5MA 3NZUA 2AL3A 2R2QA 1LQBA 2M38A 4OW0A 3RCZA 3N1XC 2M17A 4ILHA 4TYZA 1M7RA 4GMXB 1PUTA 2KFKB 4NAMA 1ZC3B 1UEFA 2HJ1A 2Y8FA 3DCXA 3SFEB 4FJZA 1VRAB 2IO1B 3Q8CA 1Z5SB 3JSVA 1M4VA 3MJ5A 1C79A 4WWPA 4DDID 3W5VB 1YN3A 2LGXA 1WXQA 2YEPF 2JT4B 3NSUA 3MTNB 1DBHA 3A58A 2ONQA 1XLQA 4JKDA 2BQQA 3LYYA 2DHJA 2ZNVB 4EJNA 2IDYA 1I4GA 1FCLA 3C8YA 3K9PB 2EJ8A 3ZQ4A 1F2RI 2G9HD 2W2XD 2MFQA 3Q3MC 3VH3B 2DYBA 2V76A 4NJ6A 1ZYIA 3QBVB 4XE0A 4GU2A 3TMPB 3TVVA 3AE6B 3HIZA 1TYGB 3DWGC 3A9JB 3KWLA 2RQ1A 1GC7A 3PVWA 2YEPB 1ZSQA 1EM7A 1WMHB 1L6UA 2PLPA 2OTXA 4RH6A 2JX5A 2PVOD 3VAWA 1SXTA 3TBLD 3F0WA 1J7BA 1J7CA 5L83A 1TY0A 2MBQA 5D3XA 2JP2A 2DAJA 2Z14A 2Q13A 4IM0A 3NY5A 2RDHA 3DHHC 3RD2A 3GYPA 1WZ3A 3N9YC 3FC4A 1HBKA 1WG7A 2MRPA 1DOXA 3D8EA 3TEZA 1KM7A 4HLEA 1ZP0B 1XCQL 1TS5A 2QMTA 2RGNB 1YN4A 1J8CA 4GXBA 4DHZB 2AQ1B 1SE4A 4HPPA 4K7UA 2KDFB 4TQ0A 1KLGD 1NU2A 1SJHD 2MA9B 3ZYYX 2JYTA 3P63A 5EDSA 4BKGA 3RNBC 4XYCA 4W9DA 3DPDA 2JZZA 2OQBA 1JROA 3KLSX 2N9PC 1EGXA 4FBJB 3AULA 2N7JA 4ACFA 1YNTE 2NS5A 2PE9A 3TEXA 3QCAA 2KNBA 2QSDA 5DCNA 5FI0A 1X86A 2WU5B 1Z87A 1NYRA 1TXDA 4OSNA 2IBIB 2KTRB 3W1YA 2OHFA 2WXHA 4EZJA 2P0FA 4R3DA 3ONSA 2J42A 1KOTA 4HHVA 4BVUC 4QXAB 3P4RB 4TKNA 2WXPA 2KQSA 4NSWA 2C5LC 3W9CB 1MHXA 1D5XC 2BVCA 3AH7A 5LXIB 1TY2A 4E71A 1U29A 2V4LA 1JDEA 3LDZE 2LXCA 2I2YA 4F7HA 4IWQA 4WJ7A 1RFAA 4N9F4 4W9EA 4DK5A 2DZKA 2MP2A 1SE3A 1ST7A 2QKLA 3RYTA 1E10A 1U27A 2ZPNA 3U7DA 2V1YA 2L1CA 2WH5A 3RZWC 2DA0A 3ZRFA 4MT7A 2VRWB 4HXDA 4F7UP 5EE1A 5C79A 3AM9A 3ZJTA 3Q3JA 4WJOA 4LK0M 3RPFC 1P1AA 1MK7B 1T6BX 3QQ8B 4KDLB 4XWXA 4REZA 4GDLB 3SR6A 4A20A 4PT5A 4I6NB 3AU5A 2G3QB 1HA5A 1IYFA 2BKFA 3L16A 3PRZA 4HK2A 1WGHA 3A9KB 1OQQA 2XK5A 4W9GA 1AW7A 5H8YE 2Y5CA 3ML8A 1MJDA 2RUKB 4JL9A 4L23A 4RNAA 2EMSA 1WM2A 2FUG1 3NW8A 4F7GA 3TIXA 1DOYA 4IUMB 3RUIB 4GOUA 3ZVRA 2Z59B 2CB8A 2FCQA 2Y5BB 2L32A 4IM2A 2YSZA 1WSPA 1W1DA 4EE2A 2LKOA 4YTNB 2KQ4X 2ZVNA 2D5GA 2SEBD 3A4SC 3E9OA 2WX0A 3NZSA 3EUB2 2GBKA 4K17A 4FXCA 2BB5A 3T9LA 4GPTB 3GE8C 3PVUA 2KT7A 1GG3A 1XR0B 2HD5B 2X38A 3TSSA 2XEWA 1I7HA 5IOIA 3BYTB 1T3QA 1YIWA 3KWVA 4L6EA 3E9LA 2MJDA 2CR5A 2LOZA 2N9LA 2MKRA 2VRRB 3I57A 1FM0D 2LXAA 2PTLA 2DFKA 3ZLZA 2RSGA 3ZUNA 3T06A 2DN6A 2CU1A 2LVPA 2G45B 2C7NB 2PVGC 3KYCD 4UDUC 2BT6A 2BYEA 3SBTA 3E9PA 4IKGA 1HB8A 4HRSA 1Q5WB 4K1RB 4M01A 3LJUX 1GUAB 4DDGD 2I5FA 3X23A 4A6FA 2MQJA 5JVLA 4IOIE 4I6LB 5HKHA 3ULCA 1MPHA 2E2XA 1K51A 4A6KA 3MC8A 4AOFA 1B9RA 1XKEA 5EE9A 2KYWA 4LJOB 4CYEA 1P6SA 1RAXA 2PKOA 1K8RB 2KR0A 1RJ2A 4LCDE 5DPTA 3NZ3A 1OQNA 3I9V1 1HB6A 3SD5A 2KDMA 5HHDG 2DKPA 4ZRQA 1T5XD 3B2FA 3AMZA 1K53A 1XF5L 1C78A 2KVRA 4P1CC 4C0AA 4JKBA 1WYWB 4IWOA 4ZYSA 2GJYA 1P7EA 1VLBA 4DHJB 3R7QA 1EU3A 3PZDA 4WJQA 1B55A 1BAKA 3TEWA 1ZW7A 5LG4B 2Y7BA 2NCNA 4MGYE 4RGMA 3QK0A 5JHBA 3BK1A 2JZPA 4J3OD 3ZTCA 3R7RA 2KGXB 2XNAC 5BYSA 5E6JA 1UBQA 1IUEA 4ZRKA 3TEYA 1TZ1A 1Y8RC 2MW5A 1G6JA 1STEA 3P7ZA 3H9DA 1YQ4B 1N3HA 4RGNA 4YTPB 4OZBA 3JYUA 4OVVA 3U12A 2HTHA 4B6WA 1E90A 4JKGA 2Z0EB 3NUHB 5HE1A 4MT5A 3RZFA 2K22A 4LNKA 4HAWB 3GOEA 1FHXA 1L0XB 4KZCA 1UPQA 2D9XA 4XDCA 5AZHA 2K2UA 3DHIC 4MM3B 4KSKC 4PNKA 1HE8A 1WGUA 3SV1A 3M3JA 1KC7A 1VZ8A 4EUTA 3ML9A 5FK9C 4Q2JA 1XCGA 3WANA 4DQOC 1C3TA 1BUIC 4CHMA 4JK7A 1U5DA 3AN1A 2W9NA 3QWZB 4LNIA 1E9MA 4ZRJA 3DVNU 2MHJA 2R2YA 2HE7A 1S3SG 3TL5A 2GLSA 2YT1A 5AUKA 3IXSA 1ZPSA 2UU7A 2JVCA 1JWMD 1OQRA 5M4YB 1ESFA 3ZRCA 3ZNHB 4WWNA 5BMHA 5BO4B 3JW0X 2ASQA 1FAOA 1FRDA 1L7YA 3D8FA 4KHOA 3TFMA 1P5TA 5D3WA 2DYNA 3V60A 2JUOA 4ZRIA 3R2TA 1IGDA 2N1WA 2V9HA 5G55A 4XWTA 2WXQA 4AJWA 1E8XA 2O6VA 3KUZA 4PK1A 2C9WB 2KFJA 3PVLA 4KHAA 3VVWB 4DXGA 4KGSA 1EU4A 3OLMD 3Q3FA 1DDWA 2KOXA 4NNJB 4RM9A 1R7SA 1VBGA 2GBMA 1V1PA 1V6EA 4B0MA 3AEDB 2K8CA 2JQRB 2P0HA 3V5WA 1N60A 2TSSA 3IBEA 4KDIC 3IVFA 5C5BB 4M0WB 5T8IA 4AJYB 4KVGB 3PSCA 3U4EG 4LNNA 2D9WA 4HEA1 2QKMA 3FLVA 3WA0A 4ILJA 2KDIA 1H10A 3HM6X 2JSVX 4HROA 3ZNGC 5L81A 1RFKA 2NPTB 3H1UA 3A1QA 3KRXA 2R61A 5I2MA 1FB8A 2LGSA 2M19A 3FEHA 2N0YA 2LEKA 3KZ1A 4HSIA 2PW9A 4LLGM 2CHXA 1KJTA 3O65B 2CY5A 2BS2B 1WJUA 4MJSA 1PFJA 3ODXA 3KUDB 4KGRA 1FD6A 1V61A 2RR9A 1L4DB 4G50A 2QC8A 2WHIA 2KDBA 4GOCA 1K5DB 4WIPA 2K2JA 2EELA 3KW5B 4LTUA 4WSFA 3K9OB 1SIJA 1TJ6A 2WLBA 3AV8A 4MACA 4W9HA 1T0QC 4BBNF 2BBCA 3WAPA 4HCPB 4HVBA 2MLBA 4AS1A 2LJIA 2G4DB 1MK9B 2KMMA 4K7SA 1UGMA 1R4NI 1QKZA 4G3XB 2NBVA 2IY0B 2QDFA 2X8XX 3E9SA 1Z2MA 2DYOA 2CRFA 3X0WA 2ICIA 2ZCCA 2PMVA 1UD7A 2LWPA 3SNHA 2WXOA 2RRFA 4H8SA 4F1SA 4D6WA 1WXAA 3VTUA 5BMGA 3VDZA 1IBXB 2DNFA 2AQ2B 2QJLA 2H7EA 4S17A 1LO5D 2A4ZA 2IYDB 4EFOA 1L0VB 5IAAC 1MIXA 3IFWB 4JX1C 2CU3A 1N5WA 1WXVA 2IZVB 4HWIB 4BAXA 2UWQA 2M4NA 1D5MC 1P3RA 3V61A 1JQ4A 2REXA 3G9WA 1ET9A 3B1LX 3TCAA 1ZOYB 4OT1A 2LOXA 3QJZA 1E6EB 5I4DA 2FJ9A 2KWUB 1VR9A 3FM8C 2DHIA 1YOVB 3ECIA 4JWSC 4HB3B 2KDEB 4K3CA 2DHZA 1TS3A 3TO1A 2LI5A 3VUXA 2ACZB 2IO3B 2RD0A 2JPHA 2RGFA 1KRHA 2VSZA 2Y3AA 2M1MA 2ZEQA 4YTMB 2RMMA 2NMQA 2GBRA 2K39A 3SU8X 3RMKC 1Q10A 3AEBB 3FSSA 1MVKA 2KMCA 3NWFA 1R4NB 2JU6X 1SGHA 1U2BA 3B9JA 2K00A 1ISNA 1X1MA 4US8A 3AEAB 1WJ1A 1XLNA 4WJPA 5D3DA 4RF1A 2MJEA 5BYQA 2K8BA 3P4PB 2EKIA 1R4MB 2W2XC 3J9CA 4HB0B 2MSED 1S1QB 1WGRA 1YD8U 3M1IB 4GNKB 3LB8C 4TMAB 4KKJA 2JRHA 4A5KA 2WNMA 1VZ7A 2KJ6A 4BKSD 3N32A 5DPWA 1VCBA 1DYNA 4PYZA 1TGZB 3PHXB 1KZGA 4O1NA 5GXGB 2J0KA 3ZO5B 1WVHA 1OFFA 3QWMA 3NWDA 4ICVA 2IO2B 3BINA 3AEFB 3JSVB 2LVQA 4XDDA 3B77A 1KTKA 5GMVA 2W3SA 1WX8A 2FIDA 1FOEA 1LFDA 3BYYB 1QOGA 2PIAA 2AX5A 3AU4A 3VR9B 1W1GA 2LASA 3V6CB 2HDEA 3VXWA 2LVOA 1A5RA 3KY9A 2CS4A 4P16A 3ML4A 1I35A 1UNQA 5MPOA 2GMIC 2KTRA 2KMAA 3HQCA 2D07B 1M94A 4EOYA 2L05A 3ZGZA 3ODWA 5E6OA 1NVLA 4NAWA 2NZ8B 2VZKB 4G0NB 4N59A 3PLVA 1MHHE 3MHSD 5CHFA 2KJHB 3Q3OC 4RFBA 4B9KA 1KZ7A 3AE1B 1QOBA 3DXDA 3BIID 2CQUA 2JRIB 3GZNI 4GLSC 4HJGE 3WCQA 2BTEA 1WRDB 4II3B 1IGCA 2WXRA 4DXAB 4ILGB 4RGOS 3GYOA 3DWMA 4RF0A 4HDOA 4JKEA 4ANUA 4ICUA 5AZFA 4DHJD 2SAKA 3MFGA 2Y5PA 1MG4A 2N0SB 1TKEA 3A33B 2CHWA 4YSZB 3HK0A 5C16A 4IWPA 3VUYA 5I2SA 4GDKA 3MP9A 1ACAA 4W9CA 4W9FA 2O2VA 3RFZB 3RNGC 3H8HA 3EGRA 3PREA 2BYTA 4WWMA 3DBHI 5TR5A 3N1ZC 4E74A 5AEKB 1XLOA 3NVYA 3WIMA 1ENFA 2WWZA 3PRPB 2MWNB 2D4QA 3OHMB 3DHGC 2R09A 3DOWA 4F8CB 5KHOA 1FHOA 2RVBB 4RM8A 2KUQA 4KIKA 2D3CA 2LFIA 3DDCB 3AE2B 1V86A 3PTFC 2M56B 1FXAA 2WDTB 3P1MA 3DBRI 3H7SA 3HRDD 3DVNV 3DVGX 5C6RA 1AQCA 1KI1B 2KIGA 3D8DA 4Y94A 1E7VA 2W82A 2ROVA 3Q8EA 1U5EA 2J0JA 3IT6B 1J7AA 4A3OA 1V5OA 3AXCA 4XC2A 1WI0A 4HB2B 3P2BA 3F5RA 2IGHA 1LXDA 2BB6A 3H7PA 2YT2A 1WYGA 1UWXA 4A6HA 2ZW0A 3MHZA 1C4PA 1E8YA 2BKRB 3ENBA 3PEGA 3N7CA 3CMMB 3GZNB 3RULA 3WYFB 3ZJVA 1H8CA 3D32A 2D9VA 3NVZA 3OG5A 4NJCA 2MP2B 2MCNB 3O13A 4GSWA 2B3AA 4IW0A 3EECA 2COFA 2D10A 2MBEA 3KRWA 5D94A 2ZPYA 2GUMA 1JW9D 1F1HA 1I7AA 5DHAB 3SYXA 1GNUA 3FKYA 4HKZE 3WAOA 3O96A 1EWCA 4FULA 2NVUI 3PS6A 4M02A 3IG3A 2WXFA 4DBGA 1YQBA 4RMAA 5G5HA 4DXFA 1V88A 1PQSA 3DCGA 1B1ZA 3VR8B 3ZXRA 3I63C 2WQYB 5CX3A 2KN4A 1J19A 2JY6A 2BWFA 2N1VA 3EHVA 2XK5B 3T8MA 2G4SA 2KK8A 1LW3A 2FIFA 4B95A 1ZGUB 2EC1A 5IO9A 3VRBB 3ETRA 3BZDB 1U4AA 4DX90 3C19A 2Z0OA 4RCOA 1EVHA 1RYJA 5CTRC 1UNSA 2YLMA 3VFKA 3R2IA 1UF0A 1FIQA 4KKIA 4L2YA 2D9YA 4M8MA 1KF6B 1HTOA 3NWAA 4GN1A 4JKFA 3MPXA 4MK0A 1XD3B 5J3QA 1IRSA 2NBWB 5AUIA 1FXTB 4MSMB 1WFYA 1Y56A 4ARIA 2I1JA 4Z2MB 2JYEA 2R2OA 5DPRA 1KBLA 4W9JA 1SF0A 2MEKA 3EPYA 1GPXA 4CSQA 1ZE3D 2L3ZA 4URKA 2KCJA 2WXNA 4YT0B 1WRIA 4NJ7A 4C4VA 2GS0A 3HIEA 3NG0A 2DLBA 1FMAD 3OWEB 4YWGG 4AP4C 3E56A 1T0YA 1U5FA 1E5WA 1E8ZA 4CQNA 2LUMA 5D6JB 4WURA 2MBHA 1OY2A 4LDTB 2FE8A 2AL6A 2YS3A 3C0RB 4LJPB 2V3SA 4QJ5B 2RPQA 2LGDA 4EEWA 3Q6BA 3GE3C 2ZW1A 3L08A 3Q69A 2UVMA 1V5UA 2FJUB 1ZC4B 4FADA 4C00A 5FR3A 3SHQA 4USAA 4PS3A 2ZVOA 3GB1A 1PGXA 3DXEA 1FFVA 1HEZE 1E7PB 1ZKHA 1Q67A 2KC1A 3OAWA 3RT3B 2X0SA 1YX6B 3QHTA 2PE6B 2WGSA 1C4CA 1CZPA 1H4RA 2G1EA 1I42A 5HE0A 3KYDD 4C56C 3R3MA 2DYMA 2R0DA 2D3GA 4GZUA 3ZXVA 1WJ4A 1ZDXA 3KVFB 1FFUA 3QA8A 4ZHPA 2IPKD 3WAMA 1WJNA 2V3PA 4C7ZA 2M0XA 3NVVA 1XX0A 4WVFB 2M8SA 1VJKA 4FA6A 1KFYB 5DHFB 2UZRA 3Q3NC 2BCJA 3AECB 3HHMA 4BOSC 3KQ4A 2BYFA 2HTME 4KV2A 2WXJA 2KLGA 2L7RA 1PMSA 3DVGY 2K0PA 4LNFA 3U8ZA 4GGQA 2HTHB 1P3QU 5EE3A 4NPNA 4JKGB 3QX1A 1OEYJ 3AI5A 4QAYA 1FGZA 1EF1A 2ZNVC 3L13A 1XEEA 2AQ3B 1YJJA 4IOYX 4HB4B 4MH0E 3PLUA 5DPSA 3FAHA 4GIVA 2JZ3B 2K5PA 3B0AA 4MELA 1SE2A 5EFXA 3GP7A 5JZEB 2W55A 3AE3B 2L0TA 1MI1A 4YXDB 1UBIA 3FILA 2L76A 3NS1A 5CHVC 2IFSA 1JALA 1HQRD 1XLPA 2OOBB 3TJPA 1WE7A 4YSYB 1L0YB 4ZRPA 1L4ZB 1J0GA 4GB9A 4WAAA 3BJIA 4PS7A 3MDBC 3NVWA 1V97A 4D0NB 2N9XA 1QC6A 2RDGA 1PGBA 3AE5B 1RRBA 4JGHB 2L2IA 2KC2A 4H2AA 4KX6B 2ZCBA 3N30A 1V80A 4HPLB 1QLBB 4A8XC 5C23A 3ZIMA 2Z8LA 2DWQA 3UIPB 2DX5B 2COCA 1LM8B 3ENEA 5DH9B 4FHKA 4KHBB 1HTQA 3ZKJC 1UWMA 2YRYA 1MG8A 2FCMA 2MDXA 2O6VB 3PSEB 3UGBB 3I3TB 3VTWA 4WWOA 3P4SB 4GMVA 1SIFA 1N62A 4FHJA 3CSFA 2M14A 1NTIA 3IT4B 2LRUA 4FJVB 2KLCA 2VZKD 4US9A 1V1PB 3L54A 2MX2A 1RRPB 5BYRA 2QHOA 4ANXA 2COAA 4XWWA 4X57B 4HAZB 5EE0A 3APFA 4K3BA 1FNVA 3PV1A 1JMLA 2H88B 1PDXA 4PQ0A 1YQ3B 3VOQA 2A5UA 2INNE 4MY6A 2D3AA 5FR6A 4RGTA 4WQOB 3A1QB 3OANA 3NS8A 2COPA 1X1FA 1GB1A 1CJEA 1WXSA 1F2RC 1ACCA 2LHEA 2DLWA 3HVZA 3U2SC 1WH3A 2INCC 3HUIA 4YSXB 1DGJA 3RNEC 2FNJB 1V8CA 2N9KA 4MJSB 4IFSA 2LZ6A 1AWDA 2Z0PA 1FEHA 1UPRA 3HM3A 4OZAA 1NTYA 2B76B 5G2NA 2VH1A 5C2TB 1WGYA 1ZDVA 2KFKA 3RN9C 3W1SC 4YL8A 3Q8BA 1I2HA 2L00B 5D3YA 1EO6A 3DQVA 4P7IA 4HJKA 2GCLA 5KCVA 2KX0A 2WX1A 1TS4A 3LJ3A 1WX9A 1D5ZC 3SFDB 1GC6A 4J6IA 3RI7C 3N20C 2I1KA 1P7FA 3HVDA 2DYQA 2YT0A 2NBVB 4W9KA 3DBSA 2JWUA 3TW1A 2W2WA 2K8EA 2I5CA 2K9XA 1L2NA 2C60A 4G11A 4TSSA 1EAZA 1ZVRA 3APDA 1D4BA 2QCZA 1AWEA 1YMHE 2R82A 1I4XA 1K52A 3VTVA 1VD2A 1OEYA 2N23A 1NEKB 3A9JA 1D6EC 1XQQA 4A9AA 3EA6A 3VIAA 1V81A 3UQAA 2N7DA 1WMHA 3B2GA 1SJED 1DDVA 3OJ3A 2VH2A 3U52E 2V0GA 2L0FA 4PYUA 4DHZE 1XODA 1AYFA 1E0ZA 3UF8A 1CQVA 2NBUA 4OVZA 4EZKA 4XGAB 2KUPA 5IA7A 1ZM0A 2XQNM 3VHTC 1QOAA 1Q1OA 4AWJA 3FP5A 4FJYA 1GOZA 2ZZPB 2NTTA 2IJ0A 3AE8B 3QC8B 1BT0A 4MGKE 2DHKA 1TZOA 3BK2A 3UINB 5BMIA 3M95A 2PZ1A 4IDIA 4A6QA 1P9DU 2C7HA 1ZXIA 1FNWA 5AZGA 5D3VA 5D2MB 2K3UA 2WXMA 3SEBA 2WDVB 4N6EB 1WGQA 3IHPC 1QQGA 1A70A 2LD9A 2N7EA 4ZDVA 3P6AA 1GJZA 4KGTA 1I4QA 3UQBA 3S2AA 2KWVB 4BFRA 4B0EA 4XX5A 1TS2A 1BTNA 2RSUA 4JKAA 1MFWA 4ARCA 5D27A 3FVCA 4A3PA 4QJ4B 2Z4DA 3A8PA 5J17A 3WALA 1TBEA 1P0RA 3A8QA 3IAS1 3QIJA 2KXJA 2KX3A 1YJ1A 3A4RA 1XO3A 5JH5C 3IAM1 1VBHA 2G35A 1PLSA 2PPHA 5IKCM 1IP9A 4C80A 1DOIA 2N9EB 4DX8A 3ALBA 1FXIA 2BPSA 1HXYD 1RWSA 5JHGA 3W1SA 1CK1A 2XN9C 3UI3A 1FGYA 5LOPB 4HAXB 4BZAA 2CHZA 1KLUD 2INPE 2LHDA 1FHWA 3RCPA 3L10B 2ADZA 1PFDA 2GB1A 1V2YA 3R66C 1VZ6A 4L1BA 1DDMA 2KANA 3BY4B 2FDQA 3ZNID 3L4PA 4EKUA 1OMWA 2VKIA 4OVUA 3W2DA 4LDTD 2C7MB 1QZEA 1JWBD 5HI1A 1JWSD 4ZYNA 4GDLA 4A55A 1QT9A 1WI1A 2IY1B 4NAWB 2GBJA 3ABVB 1FO4A 1TIFA 1GB4A 2JXTA 4HPMB 2WYQA 2H89B 2KQ7A 4JLCA 3A9KA 2KIEA 1NYQA 2DAFA 2KN5A 4JKHA 3B08A 3NHEB 1BWNA 3ZNZB 3N1YC 4ANWA 3U30A 3URYA 1AARA 1V5PA 4JIOU 3ZJUA 2EKEC 2CODA 3V62A 1BMLC 1YJIA 3UZTA 1WJ6A 2IGGA 1TJEA 4DWFA 2Z59A 2Y8GA 2OEDA 2LGIA 4GDKB 3EFCA 1U5GA 4FLHA 5IJMA 5KQ1A 2BYVE 3ZTDA 2J4XA 1FRRA 2MBBB 2O2VB 2MH7A 3Q8FA 4MGIE 1NENB 3BVMA 5DI9B 2BGFA 4BKSA 5TSSA 3LXFA 4CHJA 2CJOA 2OJRA 3CXBB 2KWDA 5CHWA 3AE9B 4MSQB 4XZ4A 1Y5OA 2KJRA 3KUCB 1UH6A 1L6VA 3SBGA 2J0MA 1C4AA 2QEJC 2BS3B 5HE3A 4P6VF 4WQMA 4AUQC 4ZOHC 1MAIA 4KIKB 3P42A 3L0WB 2KWCA 5GOWB 3Q2AC 1I4HA 3DBLI 2L8JA 1Y19B 2DZIA 2WXLA 4BBKA 1WWTA 4TQ1A 3RNAC 3R8BA 1AN8A 2J59M 1I4PA 1ZXHA 3SUZA 3Q8AA 3DBHB 1WJMA 1ROEA 3CSTA 4HATB 3BVGA 1W1HA 3QARA 1UGJA 2KTFA 1BXTA 2I38A 2ZJDA 1YN5A 3VRAB 2RDBC 2W3RA 1V89A 2X18A 3H7PB 2JF5A 3CIRB 1XT9B 2D3BA 2P8VA 1C77A 1SSNA 2LYDA 4Z2NA 3MC0B 1KH0A 3RNCC 2IYBA 1SHCA 2DTCA 2LULA 4P1BC 3TUOA 4D2KA 3A98B 3DBRB 4MDKE 4NY0A 1LB1A 1WX7A 2NTSA 2D11A 2O6VD 2WXGA 4WH4A 5LLIA 5C1ZA 3SO6A 1WGKA 2DZJA 2P0DA 2DENB 3CF6E 4MH8A 1J0WA 3NOBA 4NQLB 4BOZB 4JK9A 1WGGA 3MJWA 1F0ZA 1OTRB 3EFUA 1UUPA 2D9ZA 1F52A 1NI3A 5G5GA 2UZSA 2HJ8A 3PP2A 4KSLC 1T0SC 3ZW3A 4HAYB 3VUWA 4YONA 3PG7A 1UELA 1RLFA 2NMBA 3L17A 1IPGA 3I5JC 1SBBB 4DBBA 1T77A 1Q0WB 2KKCA 2DX1A 3PPAA 4MM3A 3ZDTA 2LJ5A 2CAYA 2LBBA 3DBLB 4W9LA 2GCJA 4PS8A 1XXGA 2H7DA 4JWUC 3PZ8A 2DIKA 4BKTA 4A6FB 1N6ZA 1NBFC 4B6HA 1XCTL 4NQKE 4K7WA 4W9IA 1X1GA 1VDVA 2YVCA 2W54A 1QILA 2KZRA 4L1RA 4I6PA 2PJHA 1NI2A 2K49A 4BBNC 3APCA 3M62B 4F7ZA 1K5GB 1C76A 1KLVA 1MIZB 2EMTA 2GBNA 2BWES 2K6QA 3ODOA 4HAUB 2YS5A 1JWAD 1N5XA 2FCSA 1NDDA 2BW2A 3AEEB 3DXCA 5LXHA 1F77A 2UYZB 1V5TA 3NJTA 1WIAA 2RLOA 2Z0QA 5HG2A 1EWYC 2WS3B 2MBOA 1F9JA 5JLJB 5IRSA 2L83A 2Z13A 4HDQA 1N63A 4C4VB 1JCKB 4M8NA 4QJ3B 1WR6E 2MJ3A 2CY4A 4WAFA 1FPYA 1HZ6A 1P98A 1JRUA 3UIOB 3EC8A 4WJNA 1V49A 3V05A 1C9FA 1E7UA 2GOWA 1E8WA 2AEHA 1RM6C 2QIEB 3V3XA 3HW2B 3QAQA 2N4FA 5C5BA 4II2B 4JQWC 4M0WA 3VH4B 3PRMB 5JHHA 1OGWA 5E6PA 3U7ZA 2V3NA 1TT5B 1EF5A 4TUUA 1EUVB 2XBBC 2LG1A 2E3TA 4A90A 4FN2A 1OQYA 2NPTA 2LGYA 4ASWC 4EZLA 2GI9A 1DYQA 4AQ7A 3Q14C 3T3OA 2L52A 2AWTA 3OJ4B 2MWSB 3P4QB 2J52A 4MGZE 2DX5A 1HZ5A 3CWIA 3PZ7A 4KHBA 2KVZA 3MC9A 5C3JB 4CO7A 5JP4A 1UNPA 3AE4B 3HSAA 3GS2A 2WU2B 4JE3B 1JRPA 1WXMA 2LRWA 1NVID 5IP4D 3PHWB 4HAVB 1CMXB 1UNRA 5JXVA 5HE2A 5E6NA 4ZHOA 2Z0DB 1JWUD 5H92C 1L5PA 4JPSA 1ZUD2 3PT2B 2FAZA 3AEGB 2CJNA 1WE6A 3NRZA 5LONB 2FJLA 1N61A 5KHQA 1FCCC 2FCNA 3CIKA 4S0RA 2ELBA 4LNOA 1LGRA 3BWUD 4K2PA 1DROA 1ET6A 1WM3A 4HCNB 5J3TA 2JWZA 4NZLB 3M63B 3KH0A 1MI0A 2BS4B 2DKQA 4MEMA 5D7GA 3PGEA 5FKAC 4ITKA 2ROZB 2K8HA 1WY8A 3FILB 4E3CA 5J18A 2Q5WD 2OJWA 1D3ZA 1C1YB 4TV3A 5DIFB 2ON8A 1X05A 2J53A 2WDRB 2K6DB 1IBXA 3E66A 2D2QA 3T3NA 3ULBA 1I4RA 2K1FA 1XD4A 2K25A 2WP9B 2AYOB 4OZCA 5CLLB 3ZDMC 3PO0A 3W5UB 2YS1A 2NR2A 2YF0A 2ELAA 3AE7B 1V9JA 4K81A 4N58A 1TQZA 1V1OA 1MKEA 2BF8B 2HRJA 3ZVVA 1PYWD 3VQIA 2WXIA 5FI1A 4KZ0A 2LMCA 5J2RA 4HKQA 1FNUA 4K2OA 1BTKA 5L95C 3JVZX 2JXXA
chains in the Genus database with same CATH topology
2ABDA 3N3KB 2J7QB 1R4MI 1DIKA 4EMOA 1WZ0A 5KQ4A 3V6EB 3SDLC 4IAPA 1SE9A 4CHKA 1YX5B 2RNRB 2KO3A 1TTNA 1NTVA 4ANVA 2DZMA 2CKHB 2FUHB 4JKCA 2PEAA 3H6NA 2KD0A 1WGDA 1GGOA 4IG7B 4JK8A 2IO0B 5CLQB 2KHWB 5JHAA 3KSYA 4KAXB 1WR1A 2LUEA 4IC7B 1X11A 4IM3A 1WF9A 5J3YA 3AJ4A 1UZXB 1M7EA 1V5MA 3NZUA 2AL3A 2R2QA 1LQBA 2M38A 3RCZA 2M17A 4ILHA 4TYZA 1M7RA 4GMXB 2KFKB 1ZC3B 1UEFA 2Y8FA 4FJZA 2IO1B 1Z5SB 3JSVA 4WWPA 4DDID 2LGXA 2JT4B 3NSUA 3MTNB 1DBHA 4JKDA 2DHJA 2ZNVB 4EJNA 3K9PB 2EJ8A 2W2XD 2MFQA 3VH3B 2DYBA 2V76A 4NJ6A 3QBVB 4GU2A 3TMPB 3TVVA 3HIZA 3A9JB 2RQ1A 1GC7A 3PVWA 1ZSQA 1WMHB 2OTXA 3VAWA 3TBLD 3F0WA 5L83A 2MBQA 5D3XA 2JP2A 2DAJA 4IM0A 2Q13A 3NY5A 3RD2A 3GYPA 1WZ3A 1HBKA 1WG7A 2MRPA 3D8EA 1KM7A 4HLEA 2RGNB 1J8CA 4GXBA 4DHZB 4K7UA 2KDFB 4TQ0A 1NU2A 2MA9B 5EDSA 4BKGA 4W9DA 3DPDA 2JZZA 2OQBA 2N9PC 1EGXA 4FBJB 3AULA 2NS5A 2PE9A 3QCAA 2KNBA 5DCNA 5FI0A 1X86A 1Z87A 1TXDA 2IBIB 2KTRB 3W1YA 4EZJA 2P0FA 3ONSA 1KOTA 4HHVA 4BVUC 4TKNA 2KQSA 4NSWA 2C5LC 5LXIB 4E71A 1U29A 2V4LA 1JDEA 3LDZE 2LXCA 4F7HA 4IWQA 4WJ7A 1RFAA 4N9F4 4W9EA 4DK5A 2DZKA 2MP2A 1ST7A 2QKLA 3RYTA 1U27A 2ZPNA 3U7DA 2V1YA 2L1CA 2WH5A 3RZWC 2DA0A 3ZRFA 4MT7A 2VRWB 4HXDA 4F7UP 5C79A 3Q3JA 4WJOA 1P1AA 1MK7B 3QQ8B 4KDLB 4XWXA 4GDLB 4A20A 4I6NB 3AU5A 2G3QB 1IYFA 2BKFA 3L16A 3PRZA 4HK2A 1WGHA 3A9KB 2XK5A 4W9GA 3ML8A 2RUKB 4JL9A 2EMSA 1WM2A 4F7GA 3TIXA 4IUMB 3RUIB 3ZVRA 2Z59B 2CB8A 2FCQA 2Y5BB 4IM2A 2YSZA 1W1DA 2LKOA 2ZVNA 3A4SC 3E9OA 2WX0A 3NZSA 2GBKA 4K17A 3T9LA 4GPTB 3PVUA 1GG3A 1XR0B 2HD5B 2XEWA 1YIWA 4L6EA 3E9LA 2CR5A 2LOZA 2MKRA 2VRRB 2LXAA 2DFKA 3ZLZA 2RSGA 3ZUNA 3T06A 2DN6A 2CU1A 2LVPA 2G45B 2C7NB 3KYCD 2BYEA 3SBTA 3E9PA 1HB8A 1Q5WB 4K1RB 3LJUX 1GUAB 4DDGD 2I5FA 3X23A 4A6FA 2MQJA 5JVLA 4I6LB 5HKHA 3ULCA 1MPHA 2E2XA 4A6KA 4AOFA 1XKEA 4LJOB 4CYEA 1P6SA 1RAXA 1K8RB 1RJ2A 4LCDE 5DPTA 1OQNA 1HB6A 3SD5A 2DKPA 2KVRA 4C0AA 4JKBA 1WYWB 4IWOA 2GJYA 4DHJB 3R7QA 3PZDA 4WJQA 1B55A 1BAKA 1ZW7A 2Y7BA 2NCNA 4MGYE 3QK0A 5JHBA 3ZTCA 3R7RA 2KGXB 1UBQA 4ZRKA 1TZ1A 1Y8RC 2MW5A 1G6JA 3P7ZA 3H9DA 1N3HA 3JYUA 4OVVA 2HTHA 4B6WA 1E90A 4JKGA 2Z0EB 5HE1A 3RZFA 4HAWB 3GOEA 1FHXA 4KZCA 1UPQA 2D9XA 5AZHA 2K2UA 4KSKC 4PNKA 1HE8A 1WGUA 3SV1A 3M3JA 1KC7A 4EUTA 3ML9A 3WANA 1XCGA 1C3TA 4CHMA 4JK7A 1U5DA 2W9NA 3QWZB 4ZRJA 3DVNU 2HE7A 1S3SG 3TL5A 2YT1A 2JVCA 3ZRCA 3ZNHB 4WWNA 5BO4B 3JW0X 2ASQA 1FAOA 1L7YA 3D8FA 4KHOA 3TFMA 1P5TA 5D3WA 2DYNA 3V60A 2JUOA 4ZRIA 2N1WA 5G55A 4AJWA 1E8XA 2O6VA 3KUZA 2C9WB 2KFJA 3PVLA 4KHAA 3VVWB 3OLMD 3Q3FA 1DDWA 2KOXA 4NNJB 4RM9A 1VBGA 2GBMA 1V6EA 2K8CA 2P0HA 3V5WA 3IBEA 4KDIC 3IVFA 5C5BB 4M0WB 4AJYB 4KVGB 3PSCA 2D9WA 2QKMA 3FLVA 3WA0A 4ILJA 2KDIA 1H10A 3HM6X 3ZNGC 5L81A 2NPTB 3H1UA 3A1QA 3KRXA 1FB8A 3FEHA 2N0YA 3KZ1A 2CHXA 1KJTA 3O65B 2CY5A 1WJUA 4MJSA 1PFJA 3ODXA 3KUDB 1V61A 2RR9A 4G50A 2KDBA 4GOCA 1K5DB 2K2JA 3KW5B 4WSFA 3K9OB 1TJ6A 4W9HA 4BBNF 3WAPA 4HCPB 4HVBA 2MLBA 2G4DB 1MK9B 4K7SA 1UGMA 1R4NI 4G3XB 2IY0B 1Z2MA 2DYOA 2CRFA 3X0WA 2ZCCA 1UD7A 2LWPA 3SNHA 4H8SA 4F1SA 3VTUA 1WXAA 3VDZA 2H7EA 2A4ZA 2IYDB 4EFOA 5IAAC 1MIXA 3IFWB 1WXVA 2IZVB 4HWIB 2UWQA 2M4NA 1P3RA 3V61A 2REXA 3G9WA 3B1LX 3TCAA 2LOXA 3QJZA 2FJ9A 2KWUB 3FM8C 2DHIA 3ECIA 4HB3B 2KDEB 2DHZA 2LI5A 3TO1A 3VUXA 2IO3B 2RD0A 2JPHA 2RGFA 2VSZA 2M1MA 2ZEQA 2GBRA 2K39A 3SU8X 3FSSA 2KMCA 1SGHA 1U2BA 2K00A 1ISNA 1X1MA 4WJPA 1WJ1A 2K8BA 2W2XC 4HB0B 2MSED 1S1QB 1WGRA 1YD8U 3M1IB 2JRHA 4A5KA 2KJ6A 4BKSD 3N32A 5DPWA 1VCBA 1DYNA 4PYZA 1TGZB 3PHXB 1KZGA 2J0KA 3ZO5B 1WVHA 3QWMA 4ICVA 2IO2B 3BINA 3JSVB 2LVQA 5GMVA 1WX8A 2FIDA 1FOEA 1LFDA 3AU4A 1W1GA 2LASA 3V6CB 3VXWA 2LVOA 1A5RA 3KY9A 2CS4A 3ML4A 1I35A 1UNQA 2GMIC 2KTRA 2KMAA 3HQCA 2D07B 1M94A 4EOYA 2L05A 3ODWA 5E6OA 1NVLA 4NAWA 2NZ8B 4G0NB 3PLVA 3MHSD 5CHFA 2KJHB 4B9KA 1KZ7A 3DXDA 2CQUA 2JRIB 3GZNI 1WRDB 4II3B 4DXAB 4ILGB 3GYOA 4HDOA 4JKEA 4ANUA 4ICUA 5AZFA 4DHJD 3A33B 2CHWA 3HK0A 5C16A 4IWPA 3VUYA 4GDKA 1ACAA 4W9CA 4W9FA 2O2VA 3PREA 3DBHI 5TR5A 4E74A 5AEKB 3WIMA 2WWZA 3PRPB 2MWNB 2D4QA 2R09A 3DOWA 4F8CB 5KHOA 1FHOA 2RVBB 4RM8A 4KIKA 3DDCB 1V86A 3PTFC 2WDTB 3DBRI 3H7SA 3DVNV 3DVGX 5C6RA 1AQCA 1KI1B 3D8DA 4Y94A 1E7VA 2ROVA 1U5EA 2J0JA 4A3OA 1V5OA 3AXCA 4XC2A 1WI0A 4HB2B 3P2BA 3F5RA 1LXDA 3H7PA 4A6HA 1E8YA 2BKRB 3ENBA 3PEGA 3N7CA 3CMMB 3RULA 3WYFB 1H8CA 3D32A 2D9VA 2MP2B 2MCNB 4GSWA 2B3AA 4IW0A 3EECA 2COFA 2D10A 2MBEA 3KRWA 5D94A 2ZPYA 1I7AA 5DHAB 3SYXA 1GNUA 3WAOA 3O96A 4FULA 2NVUI 3PS6A 3IG3A 4DBGA 1YQBA 4RMAA 1V88A 1PQSA 3DCGA 5CX3A 1J19A 2JY6A 2BWFA 2N1VA 3EHVA 2XK5B 3T8MA 2G4SA 2KK8A 1LW3A 2FIFA 4B95A 1ZGUB 2EC1A 1U4AA 4DX90 2Z0OA 1EVHA 5CTRC 2YLMA 3VFKA 2D9YA 4M8MA 4GN1A 4JKFA 3MPXA 4MK0A 1XD3B 5J3QA 1IRSA 2NBWB 1FXTB 4MSMB 1WFYA 2I1JA 4Z2MB 2R2OA 5DPRA 1KBLA 4W9JA 3EPYA 2L3ZA 4URKA 2KCJA 4NJ7A 2GS0A 4AP4C 1T0YA 1U5FA 1E5WA 1E8ZA 5D6JB 2MBHA 1OY2A 4LDTB 2AL6A 2YS3A 3C0RB 4LJPB 2V3SA 4EEWA 2RPQA 2LGDA 3L08A 2UVMA 1V5UA 1ZC4B 4FADA 3SHQA 4PS3A 2ZVOA 3DXEA 1ZKHA 1Q67A 2KC1A 3OAWA 3RT3B 2X0SA 1YX6B 3QHTA 2PE6B 1H4RA 1I42A 5HE0A 3KYDD 3R3MA 2DYMA 2R0DA 2D3GA 4GZUA 1WJ4A 3KVFB 3QA8A 3WAMA 1WJNA 2M0XA 1XX0A 4WVFB 2M8SA 4FA6A 5DHFB 2UZRA 2BCJA 3HHMA 4BOSC 2BYFA 4KV2A 2KLGA 2L7RA 1PMSA 3DVGY 3U8ZA 4GGQA 2HTHB 1P3QU 4NPNA 4JKGB 3QX1A 1OEYJ 3AI5A 1FGZA 1EF1A 2ZNVC 3L13A 4IOYX 4HB4B 4MH0E 3PLUA 5DPSA 4GIVA 2JZ3B 3B0AA 4MELA 5EFXA 5JZEB 2L0TA 1UBIA 2L76A 5CHVC 2IFSA 2OOBB 3TJPA 1WE7A 1J0GA 4GB9A 4WAAA 3BJIA 4PS7A 3MDBC 4D0NB 2N9XA 1QC6A 1RRBA 4JGHB 2L2IA 2KC2A 2ZCBA 3N30A 1V80A 4HPLB 5C23A 3ZIMA 3UIPB 2DX5B 2COCA 1LM8B 3ENEA 5DH9B 4FHKA 4KHBB 3ZKJC 2YRYA 1MG8A 2FCMA 2MDXA 2O6VB 3PSEB 3UGBB 3I3TB 3VTWA 4WWOA 4GMVA 1SIFA 4FHJA 3CSFA 2M14A 1NTIA 2LRUA 4FJVB 2KLCA 3L54A 2MX2A 1RRPB 2QHOA 4ANXA 2COAA 4X57B 4HAZB 3APFA 3PV1A 4PQ0A 3VOQA 2A5UA 4MY6A 5FR6A 4WQOB 3A1QB 3OANA 3NS8A 2COPA 1X1FA 1WXSA 2DLWA 1WH3A 2FNJB 4MJSB 4IFSA 2LZ6A 2Z0PA 1UPRA 3HM3A 1NTYA 5G2NA 1WGYA 2KFKA 3W1SC 4YL8A 1I2HA 2L00B 5D3YA 1EO6A 3DQVA 4P7IA 4HJKA 2GCLA 5KCVA 2KX0A 2WX1A 3LJ3A 1WX9A 1GC6A 4J6IA 2I1KA 2DYQA 2YT0A 2NBVB 4W9KA 3DBSA 3TW1A 2W2WA 2I5CA 1L2NA 2C60A 4G11A 1EAZA 1ZVRA 3APDA 1AWEA 2R82A 3VTVA 1VD2A 1OEYA 2N23A 3A9JA 1XQQA 3VIAA 1V81A 3UQAA 2N7DA 1WMHA 1DDVA 3OJ3A 2L0FA 4PYUA 4DHZE 1XODA 3UF8A 2NBUA 4EZKA 2KUPA 5IA7A 1ZM0A 2XQNM 3VHTC 1Q1OA 4AWJA 3FP5A 4FJYA 2ZZPB 3QC8B 1BT0A 4MGKE 2DHKA 3UINB 3M95A 2PZ1A 1P9DU 2C7HA 5AZGA 5D3VA 5D2MB 1WGQA 3IHPC 1QQGA 2LD9A 2N7EA 4ZDVA 3P6AA 1GJZA 3UQBA 3S2AA 2KWVB 4BFRA 4XX5A 1BTNA 2RSUA 4JKAA 5D27A 4A3PA 3A8PA 5J17A 3WALA 1TBEA 1P0RA 3A8QA 3QIJA 2KXJA 2KX3A 1YJ1A 3A4RA 5JH5C 1VBHA 2G35A 1PLSA 2PPHA 1IP9A 2N9EB 4DX8A 3ALBA 2BPSA 5JHGA 3W1SA 1FGYA 5LOPB 4HAXB 2CHZA 1FHWA 3RCPA 3L10B 2ADZA 1V2YA 3R66C 1DDMA 2KANA 3BY4B 2FDQA 3ZNID 4EKUA 1OMWA 2VKIA 4OVUA 4LDTD 2C7MB 1QZEA 4ZYNA 4GDLA 1WI1A 2IY1B 4NAWB 2GBJA 4HPMB 2WYQA 2KQ7A 4JLCA 3A9KA 2DAFA 2KN5A 4JKHA 3B08A 3NHEB 1BWNA 3ZNZB 4ANWA 3U30A 1AARA 1V5PA 4JIOU 2EKEC 2CODA 3V62A 3UZTA 1WJ6A 4DWFA 2Y8GA 4GDKB 1U5GA 4FLHA 5IJMA 5KQ1A 2BYVE 3ZTDA 2MBBB 2O2VB 4MGIE 5DI9B 2BGFA 4BKSA 4CHJA 2OJRA 3CXBB 5CHWA 4MSQB 4XZ4A 1Y5OA 2KJRA 3KUCB 1UH6A 3SBGA 2J0MA 5HE3A 4AUQC 1MAIA 4KIKB 3L0WB 2KWCA 5GOWB 3DBLI 2L8JA 1Y19B 2DZIA 4BBKA 4TQ1A 2J59M 3SUZA 1WJMA 3CSTA 4HATB 1W1HA 3QARA 2KTFA 2ZJDA 1V89A 2X18A 3H7PB 2JF5A 1XT9B 2P8VA 2LYDA 4Z2NA 2IYBA 1SHCA 2DTCA 2LULA 3A98B 4MDKE 4NY0A 1LB1A 1WX7A 2D11A 2O6VD 5C1ZA 5LLIA 3SO6A 2DZJA 2P0DA 2DENB 3CF6E 1J0WA 3NOBA 4NQLB 4BOZB 4JK9A 1WGGA 3MJWA 1OTRB 3EFUA 2D9ZA 2UZSA 2HJ8A 3PP2A 4KSLC 3ZW3A 4HAYB 3VUWA 4YONA 3PG7A 1UELA 1RLFA 2NMBA 3L17A 1IPGA 4DBBA 1Q0WB 2KKCA 2DX1A 3PPAA 4MM3A 3ZDTA 2LJ5A 2CAYA 4W9LA 2LBBA 2GCJA 4PS8A 2H7DA 2DIKA 4BKTA 4A6FB 1NBFC 4B6HA 4NQKE 4K7WA 4W9IA 1X1GA 2YVCA 2KZRA 4I6PA 2PJHA 1NI2A 4BBNC 3APCA 3M62B 4F7ZA 1K5GB 1KLVA 1MIZB 2EMTA 2GBNA 2BWES 2K6QA 3ODOA 4HAUB 2YS5A 2FCSA 1NDDA 3DXCA 5LXHA 2UYZB 1V5TA 1WIAA 2RLOA 2Z0QA 2MBOA 1F9JA 5JLJB 4HDQA 4M8NA 1WR6E 2CY4A 1P98A 1JRUA 3UIOB 3EC8A 4WJNA 1V49A 1E7UA 2GOWA 1E8WA 2AEHA 3HW2B 3QAQA 2N4FA 5C5BA 4II2B 4JQWC 3VH4B 3PRMB 5JHHA 1OGWA 5E6PA 1EF5A 4TUUA 1EUVB 2XBBC 2LG1A 4FN2A 1OQYA 2NPTA 2LGYA 4ASWC 4EZLA 2AWTA 3OJ4B 2MWSB 4MGZE 2DX5A 4CO7A 5JP4A 1UNPA 1WXMA 2LRWA 3PHWB 4HAVB 1CMXB 1UNRA 5HE2A 5E6NA 2Z0DB 3PT2B 2FAZA 1WE6A 5LONB 2FJLA 5KHQA 2FCNA 3CIKA 2ELBA 4K2PA 1DROA 1WM3A 4HCNB 5J3TA 2JWZA 3M63B 3KH0A 2DKQA 4MEMA 5D7GA 3PGEA 2ROZB 2K8HA 1WY8A 4E3CA 5J18A 1D3ZA 1C1YB 4TV3A 5DIFB 1X05A 2K6DB 3E66A 2D2QA 3ULBA 2K1FA 1XD4A 2K25A 2AYOB 5CLLB 3ZDMC 2YS1A 2NR2A 2YF0A 2ELAA 1V9JA 4K81A 1TQZA 1MKEA 2BF8B 2HRJA 3ZVVA 3VQIA 5FI1A 4KZ0A 5J2RA 4K2OA 1BTKA 5L95C 3JVZX 2JXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ABD A;  3N3K B;  2J7Q B;  1R4M I;  4EMO A;  1WZ0 A;  5KQ4 A;  3V6E B;  3SDL C;  4IAP A;  1SE9 A;  4CHK A;  1YX5 B;  2RNR B;  2KO3 A;  1TTN A;  1NTV A;  4ANV A;  2DZM A;  2CKH B;  2FUH B;  2PEA A;  3H6N A;  2KD0 A;  1WGD A;  4IG7 B;  2IO0 B;  5CLQ B;  2KHW B;  5JHA A;  3KSY A;  4KAX B;  1WR1 A;  2LUE A;  4IC7 B;  1X11 A;  4IM3 A;  1WF9 A;  5J3Y A;  3AJ4 A;  1UZX B;  1M7E A;  1V5M A;  3NZU A;  2AL3 A;  2R2Q A;  1LQB A;  2M38 A;  3RCZ A;  2M17 A;  4TYZ A;  1M7R A;  4GMX B;  2KFK B;  1ZC3 B;  1UEF A;  2Y8F A;  4FJZ A;  2IO1 B;  1Z5S B;  3JSV A;  4WWP A;  4DDI D;  2LGX A;  2JT4 B;  3NSU A;  3MTN B;  1DBH A;  2DHJ A;  2ZNV B;  4EJN A;  3K9P B;  2EJ8 A;  2W2X D;  2MFQ A;  3VH3 B;  2DYB A;  2V76 A;  4NJ6 A;  3QBV B;  4GU2 A;  3TMP B;  3TVV A;  3HIZ A;  3A9J B;  2RQ1 A;  1GC7 A;  3PVW A;  1ZSQ A;  1WMH B;  2OTX A;  3VAW A;  3TBL D;  3F0W A;  5L83 A;  2MBQ A;  5D3X A;  2JP2 A;  2DAJ A;  4IM0 A;  2Q13 A;  3NY5 A;  3RD2 A;  3GYP A;  1WZ3 A;  1HBK A;  1WG7 A;  2MRP A;  3D8E A;  1KM7 A;  4HLE A;  2RGN B;  1J8C A;  4GXB A;  4DHZ B;  4K7U A;  2KDF B;  4TQ0 A;  1NU2 A;  2MA9 B;  5EDS A;  4BKG A;  4W9D A;  3DPD A;  2JZZ A;  2OQB A;  2N9P C;  1EGX A;  4FBJ B;  3AUL A;  2NS5 A;  2PE9 A;  3QCA A;  2KNB A;  5DCN A;  5FI0 A;  1X86 A;  1Z87 A;  1TXD A;  2IBI B;  2KTR B;  3W1Y A;  4EZJ A;  2P0F A;  3ONS A;  1KOT A;  4HHV A;  4BVU C;  4TKN A;  2KQS A;  4NSW A;  2C5L C;  5LXI B;  4E71 A;  1U29 A;  2V4L A;  3LDZ E;  2LXC A;  4F7H A;  4IWQ A;  4WJ7 A;  1RFA A;  4N9F 4;  4W9E A;  4DK5 A;  2DZK A;  2MP2 A;  1ST7 A;  2QKL A;  3RYT A;  1U27 A;  2ZPN A;  3U7D A;  2V1Y A;  2L1C A;  2WH5 A;  3RZW C;  2DA0 A;  3ZRF A;  4MT7 A;  2VRW B;  4HXD A;  4F7U P;  5C79 A;  3Q3J A;  4WJO A;  1P1A A;  1MK7 B;  3QQ8 B;  4KDL B;  4XWX A;  4GDL B;  4A20 A;  4I6N B;  3AU5 A;  2G3Q B;  1IYF A;  2BKF A;  3L16 A;  3PRZ A;  4HK2 A;  1WGH A;  3A9K B;  2XK5 A;  4W9G A;  3ML8 A;  2RUK B;  4JL9 A;  2EMS A;  1WM2 A;  4F7G A;  3TIX A;  4IUM B;  3RUI B;  3ZVR A;  2Z59 B;  2CB8 A;  2FCQ A;  2Y5B B;  4IM2 A;  2YSZ A;  1W1D A;  2LKO A;  2ZVN A;  3A4S C;  2WX0 A;  3NZS A;  2GBK A;  4K17 A;  3T9L A;  4GPT B;  3PVU A;  1GG3 A;  1XR0 B;  2HD5 B;  2XEW A;  1YIW A;  4L6E A;  2CR5 A;  2LOZ A;  2MKR A;  2VRR B;  2LXA A;  2DFK A;  3ZLZ A;  2RSG A;  3ZUN A;  3T06 A;  2DN6 A;  2CU1 A;  2LVP A;  2G45 B;  2C7N B;  3KYC D;  2BYE A;  1HB8 A;  1Q5W B;  4K1R B;  3LJU X;  1GUA B;  4DDG D;  2I5F A;  3X23 A;  4A6F A;  2MQJ A;  4I6L B;  5HKH A;  3ULC A;  1MPH A;  2E2X A;  4A6K A;  4AOF A;  1XKE A;  4LJO B;  4CYE A;  1P6S A;  1RAX A;  1K8R B;  1RJ2 A;  4LCD E;  5DPT A;  1OQN A;  1HB6 A;  3SD5 A;  2DKP A;  2KVR A;  4C0A A;  1WYW B;  4IWO A;  2GJY A;  4DHJ B;  3R7Q A;  3PZD A;  4WJQ A;  1B55 A;  1BAK A;  1ZW7 A;  2Y7B A;  2NCN A;  4MGY E;  3QK0 A;  5JHB A;  3ZTC A;  3R7R A;  2KGX B;  1UBQ A;  4ZRK A;  1TZ1 A;  1Y8R C;  2MW5 A;  1G6J A;  3P7Z A;  3H9D A;  1N3H A;  3JYU A;  4OVV A;  2HTH A;  4B6W A;  1E90 A;  2Z0E B;  5HE1 A;  3RZF A;  4HAW B;  3GOE A;  1FHX A;  4KZC A;  1UPQ A;  2D9X A;  5AZH A;  2K2U A;  4KSK C;  4PNK A;  1HE8 A;  1WGU A;  3SV1 A;  3M3J A;  4EUT A;  3ML9 A;  3WAN A;  1XCG A;  1C3T A;  4CHM A;  1U5D A;  2W9N A;  3QWZ B;  4ZRJ A;  3DVN U;  2HE7 A;  1S3S G;  3TL5 A;  2YT1 A;  2JVC A;  3ZRC A;  3ZNH B;  4WWN A;  5BO4 B;  3JW0 X;  2ASQ A;  1FAO A;  1L7Y A;  3D8F A;  4KHO A;  3TFM A;  1P5T A;  5D3W A;  2DYN A;  3V60 A;  2JUO A;  4ZRI A;  2N1W A;  5G55 A;  4AJW A;  1E8X A;  2O6V A;  3KUZ A;  2C9W B;  2KFJ A;  3PVL A;  4KHA A;  3VVW B;  3OLM D;  3Q3F A;  1DDW A;  2KOX A;  4NNJ B;  4RM9 A;  2GBM A;  1V6E A;  2K8C A;  2P0H A;  3V5W A;  3IBE A;  4KDI C;  3IVF A;  5C5B B;  4M0W B;  4AJY B;  4KVG B;  3PSC A;  2D9W A;  2QKM A;  3FLV A;  3WA0 A;  2KDI A;  1H10 A;  3HM6 X;  3ZNG C;  5L81 A;  2NPT B;  3H1U A;  3A1Q A;  3KRX A;  1FB8 A;  3FEH A;  2N0Y A;  3KZ1 A;  2CHX A;  1KJT A;  3O65 B;  2CY5 A;  1WJU A;  4MJS A;  1PFJ A;  3ODX A;  3KUD B;  1V61 A;  2RR9 A;  4G50 A;  2KDB A;  4GOC A;  1K5D B;  2K2J A;  3KW5 B;  4WSF A;  3K9O B;  1TJ6 A;  4W9H A;  4BBN F;  3WAP A;  4HCP B;  4HVB A;  2MLB A;  2G4D B;  1MK9 B;  4K7S A;  1UGM A;  1R4N I;  4G3X B;  2IY0 B;  1Z2M A;  2DYO A;  2CRF A;  3X0W A;  2ZCC A;  1UD7 A;  2LWP A;  3SNH A;  4H8S A;  4F1S A;  3VTU A;  1WXA A;  3VDZ A;  2H7E A;  2A4Z A;  2IYD B;  4EFO A;  5IAA C;  1MIX A;  3IFW B;  1WXV A;  2IZV B;  4HWI B;  2UWQ A;  2M4N A;  1P3R A;  3V61 A;  2REX A;  3G9W A;  3B1L X;  3TCA A;  2LOX A;  3QJZ A;  2FJ9 A;  2KWU B;  3FM8 C;  2DHI A;  3ECI A;  4HB3 B;  2KDE B;  2DHZ A;  2LI5 A;  3TO1 A;  3VUX A;  2IO3 B;  2RD0 A;  2JPH A;  2RGF A;  2VSZ A;  2M1M A;  2ZEQ A;  2GBR A;  2K39 A;  3SU8 X;  3FSS A;  2KMC A;  1SGH A;  1U2B A;  2K00 A;  1ISN A;  1X1M A;  4WJP A;  1WJ1 A;  2K8B A;  2W2X C;  4HB0 B;  2MSE D;  1S1Q B;  1WGR A;  1YD8 U;  3M1I B;  2JRH A;  4A5K A;  2KJ6 A;  4BKS D;  3N32 A;  5DPW A;  1VCB A;  1DYN A;  4PYZ A;  1TGZ B;  3PHX B;  1KZG A;  2J0K A;  3ZO5 B;  1WVH A;  3QWM A;  4ICV A;  2IO2 B;  3BIN A;  3JSV B;  2LVQ A;  5GMV A;  1WX8 A;  2FID A;  1FOE A;  1LFD A;  3AU4 A;  1W1G A;  2LAS A;  3V6C B;  3VXW A;  2LVO A;  1A5R A;  3KY9 A;  2CS4 A;  3ML4 A;  1I35 A;  1UNQ A;  2GMI C;  2KTR A;  2KMA A;  3HQC A;  2D07 B;  1M94 A;  4EOY A;  2L05 A;  3ODW A;  5E6O A;  1NVL A;  4NAW A;  2NZ8 B;  4G0N B;  3PLV A;  3MHS D;  5CHF A;  2KJH B;  4B9K A;  1KZ7 A;  3DXD A;  2CQU A;  2JRI B;  3GZN I;  1WRD B;  4II3 B;  4DXA B;  3GYO A;  4HDO A;  4ANU A;  4ICU A;  5AZF A;  4DHJ D;  3A33 B;  2CHW A;  3HK0 A;  5C16 A;  4IWP A;  3VUY A;  4GDK A;  1ACA A;  4W9C A;  4W9F A;  2O2V A;  3PRE A;  3DBH I;  5TR5 A;  4E74 A;  5AEK B;  3WIM A;  2WWZ A;  3PRP B;  2MWN B;  2D4Q A;  2R09 A;  3DOW A;  4F8C B;  5KHO A;  1FHO A;  2RVB B;  4RM8 A;  4KIK A;  3DDC B;  1V86 A;  3PTF C;  2WDT B;  3DBR I;  3H7S A;  3DVN V;  3DVG X;  5C6R A;  1AQC A;  1KI1 B;  3D8D A;  4Y94 A;  1E7V A;  2ROV A;  1U5E A;  2J0J A;  4A3O A;  1V5O A;  3AXC A;  4XC2 A;  1WI0 A;  4HB2 B;  3P2B A;  3F5R A;  1LXD A;  3H7P A;  4A6H A;  1E8Y A;  2BKR B;  3PEG A;  3N7C A;  3CMM B;  3RUL A;  3WYF B;  1H8C A;  3D32 A;  2D9V A;  2MP2 B;  2MCN B;  4GSW A;  2B3A A;  4IW0 A;  3EEC A;  2COF A;  2D10 A;  2MBE A;  3KRW A;  5D94 A;  2ZPY A;  1I7A A;  5DHA B;  3SYX A;  1GNU A;  3WAO A;  3O96 A;  4FUL A;  2NVU I;  3PS6 A;  3IG3 A;  4DBG A;  1YQB A;  4RMA A;  1V88 A;  1PQS A;  3DCG A;  5CX3 A;  1J19 A;  2JY6 A;  2BWF A;  2N1V A;  3EHV A;  2XK5 B;  3T8M A;  2G4S A;  2KK8 A;  1LW3 A;  2FIF A;  4B95 A;  1ZGU B;  2EC1 A;  1U4A A;  4DX9 0;  2Z0O A;  1EVH A;  5CTR C;  2YLM A;  3VFK A;  2D9Y A;  4M8M A;  4GN1 A;  3MPX A;  4MK0 A;  1XD3 B;  5J3Q A;  1IRS A;  2NBW B;  1FXT B;  4MSM B;  1WFY A;  2I1J A;  4Z2M B;  2R2O A;  5DPR A;  4W9J A;  3EPY A;  2L3Z A;  4URK A;  2KCJ A;  4NJ7 A;  2GS0 A;  4AP4 C;  1T0Y A;  1U5F A;  1E5W A;  1E8Z A;  5D6J B;  2MBH A;  1OY2 A;  4LDT B;  2AL6 A;  2YS3 A;  3C0R B;  4LJP B;  2V3S A;  4EEW A;  2RPQ A;  2LGD A;  3L08 A;  2UVM A;  1V5U A;  1ZC4 B;  4FAD A;  3SHQ A;  4PS3 A;  2ZVO A;  3DXE A;  1ZKH A;  1Q67 A;  2KC1 A;  3OAW A;  3RT3 B;  1YX6 B;  3QHT A;  2PE6 B;  1H4R A;  1I42 A;  5HE0 A;  3KYD D;  3R3M A;  2DYM A;  2R0D A;  2D3G A;  4GZU A;  1WJ4 A;  3KVF B;  3QA8 A;  3WAM A;  1WJN A;  2M0X A;  1XX0 A;  4WVF B;  2M8S A;  4FA6 A;  5DHF B;  2UZR A;  2BCJ A;  3HHM A;  4BOS C;  2BYF A;  4KV2 A;  2KLG A;  2L7R A;  1PMS A;  3DVG Y;  3U8Z A;  4GGQ A;  2HTH B;  1P3Q U;  4NPN A;  3QX1 A;  1OEY J;  3AI5 A;  1FGZ A;  1EF1 A;  2ZNV C;  3L13 A;  4IOY X;  4HB4 B;  4MH0 E;  3PLU A;  5DPS A;  4GIV A;  2JZ3 B;  3B0A A;  4MEL A;  5EFX A;  5JZE B;  2L0T A;  1UBI A;  2L76 A;  5CHV C;  2IFS A;  2OOB B;  3TJP A;  1WE7 A;  1J0G A;  4GB9 A;  4WAA A;  3BJI A;  4PS7 A;  3MDB C;  4D0N B;  2N9X A;  1QC6 A;  1RRB A;  4JGH B;  2L2I A;  2KC2 A;  2ZCB A;  3N30 A;  1V80 A;  4HPL B;  5C23 A;  3ZIM A;  3UIP B;  2DX5 B;  2COC A;  1LM8 B;  3ENE A;  5DH9 B;  4FHK A;  4KHB B;  3ZKJ C;  2YRY A;  1MG8 A;  2FCM A;  2MDX A;  2O6V B;  3PSE B;  3UGB B;  3I3T B;  3VTW A;  4WWO A;  4GMV A;  1SIF A;  4FHJ A;  3CSF A;  2M14 A;  1NTI A;  2LRU A;  4FJV B;  2KLC A;  3L54 A;  2MX2 A;  1RRP B;  2QHO A;  4ANX A;  2COA A;  4X57 B;  4HAZ B;  3APF A;  3PV1 A;  4PQ0 A;  3VOQ A;  2A5U A;  4MY6 A;  5FR6 A;  4WQO B;  3A1Q B;  3OAN A;  3NS8 A;  2COP A;  1X1F A;  1WXS A;  2DLW A;  1WH3 A;  2FNJ B;  4MJS B;  4IFS A;  2LZ6 A;  2Z0P A;  1UPR A;  3HM3 A;  1NTY A;  5G2N A;  1WGY A;  2KFK A;  3W1S C;  4YL8 A;  1I2H A;  2L00 B;  5D3Y A;  1EO6 A;  3DQV A;  4P7I A;  4HJK A;  2GCL A;  5KCV A;  2KX0 A;  2WX1 A;  3LJ3 A;  1WX9 A;  1GC6 A;  4J6I A;  2I1K A;  2DYQ A;  2YT0 A;  2NBV B;  4W9K A;  3DBS A;  3TW1 A;  2W2W A;  2I5C A;  1L2N A;  2C60 A;  4G11 A;  1EAZ A;  1ZVR A;  3APD A;  1AWE A;  3VTV A;  1VD2 A;  1OEY A;  2N23 A;  3A9J A;  1XQQ A;  3VIA A;  1V81 A;  3UQA A;  2N7D A;  1WMH A;  1DDV A;  3OJ3 A;  2L0F A;  4PYU A;  4DHZ E;  1XOD A;  3UF8 A;  2NBU A;  4EZK A;  2KUP A;  5IA7 A;  1ZM0 A;  2XQN M;  3VHT C;  1Q1O A;  4AWJ A;  3FP5 A;  4FJY A;  2ZZP B;  3QC8 B;  1BT0 A;  4MGK E;  2DHK A;  3UIN B;  3M95 A;  2PZ1 A;  1P9D U;  2C7H A;  5AZG A;  5D3V A;  5D2M B;  1WGQ A;  3IHP C;  1QQG A;  2LD9 A;  2N7E A;  4ZDV A;  3P6A A;  1GJZ A;  3UQB A;  3S2A A;  2KWV B;  4BFR A;  4XX5 A;  1BTN A;  2RSU A;  5D27 A;  4A3P A;  3A8P A;  5J17 A;  3WAL A;  1TBE A;  1P0R A;  3A8Q A;  3QIJ A;  2KXJ A;  2KX3 A;  1YJ1 A;  3A4R A;  5JH5 C;  2G35 A;  1PLS A;  2PPH A;  1IP9 A;  2N9E B;  4DX8 A;  3ALB A;  2BPS A;  5JHG A;  3W1S A;  1FGY A;  5LOP B;  4HAX B;  2CHZ A;  1FHW A;  3RCP A;  3L10 B;  2ADZ A;  1V2Y A;  3R66 C;  1DDM A;  2KAN A;  3BY4 B;  2FDQ A;  3ZNI D;  4EKU A;  1OMW A;  2VKI A;  4OVU A;  4LDT D;  2C7M B;  1QZE A;  4ZYN A;  4GDL A;  1WI1 A;  2IY1 B;  4NAW B;  2GBJ A;  4HPM B;  2WYQ A;  2KQ7 A;  4JLC A;  3A9K A;  2DAF A;  2KN5 A;  3B08 A;  3NHE B;  1BWN A;  3ZNZ B;  4ANW A;  3U30 A;  1AAR A;  1V5P A;  4JIO U;  2EKE C;  2COD A;  3V62 A;  3UZT A;  1WJ6 A;  4DWF A;  2Y8G A;  4GDK B;  1U5G A;  4FLH A;  5IJM A;  5KQ1 A;  2BYV E;  3ZTD A;  2MBB B;  2O2V B;  4MGI E;  5DI9 B;  2BGF A;  4BKS A;  4CHJ A;  2OJR A;  3CXB B;  5CHW A;  4MSQ B;  4XZ4 A;  1Y5O A;  2KJR A;  3KUC B;  1UH6 A;  2J0M A;  5HE3 A;  4AUQ C;  1MAI A;  4KIK B;  3L0W B;  2KWC A;  5GOW B;  3DBL I;  2L8J A;  1Y19 B;  2DZI A;  4BBK A;  4TQ1 A;  2J59 M;  3SUZ A;  1WJM A;  3CST A;  4HAT B;  1W1H A;  3QAR A;  2KTF A;  2ZJD A;  1V89 A;  2X18 A;  3H7P B;  2JF5 A;  1XT9 B;  2P8V A;  2LYD A;  4Z2N A;  2IYB A;  1SHC A;  2DTC A;  2LUL A;  3A98 B;  4MDK E;  4NY0 A;  1LB1 A;  1WX7 A;  2D11 A;  2O6V D;  5C1Z A;  5LLI A;  3SO6 A;  2DZJ A;  2P0D A;  2DEN B;  3CF6 E;  1J0W A;  3NOB A;  4NQL B;  4BOZ B;  1WGG A;  3MJW A;  1OTR B;  3EFU A;  2D9Z A;  2UZS A;  2HJ8 A;  3PP2 A;  4KSL C;  3ZW3 A;  4HAY B;  3VUW A;  4YON A;  3PG7 A;  1UEL A;  1RLF A;  2NMB A;  3L17 A;  1IPG A;  4DBB A;  1Q0W B;  2KKC A;  2DX1 A;  3PPA A;  4MM3 A;  3ZDT A;  2LJ5 A;  2CAY A;  4W9L A;  2LBB A;  2GCJ A;  4PS8 A;  2H7D A;  4BKT A;  4A6F B;  1NBF C;  4B6H A;  4NQK E;  4K7W A;  4W9I A;  1X1G A;  2YVC A;  2KZR A;  4I6P A;  2PJH A;  1NI2 A;  4BBN C;  3APC A;  3M62 B;  4F7Z A;  1K5G B;  1KLV A;  1MIZ B;  2EMT A;  2GBN A;  2BWE S;  2K6Q A;  3ODO A;  4HAU B;  2YS5 A;  2FCS A;  1NDD A;  3DXC A;  5LXH A;  2UYZ B;  1V5T A;  1WIA A;  2RLO A;  2Z0Q A;  2MBO A;  1F9J A;  5JLJ B;  4HDQ A;  4M8N A;  1WR6 E;  2CY4 A;  1P98 A;  1JRU A;  3UIO B;  3EC8 A;  4WJN A;  1V49 A;  1E7U A;  2GOW A;  1E8W A;  2AEH A;  3HW2 B;  3QAQ A;  2N4F A;  5C5B A;  4II2 B;  4JQW C;  3VH4 B;  3PRM B;  5JHH A;  1OGW A;  5E6P A;  1EF5 A;  4TUU A;  1EUV B;  2XBB C;  2LG1 A;  4FN2 A;  1OQY A;  2NPT A;  2LGY A;  4ASW C;  4EZL A;  2AWT A;  3OJ4 B;  2MWS B;  4MGZ E;  2DX5 A;  4CO7 A;  5JP4 A;  1UNP A;  1WXM A;  2LRW A;  3PHW B;  4HAV B;  1CMX B;  1UNR A;  5HE2 A;  5E6N A;  2Z0D B;  3PT2 B;  2FAZ A;  1WE6 A;  5LON B;  2FJL A;  5KHQ A;  2FCN A;  3CIK A;  2ELB A;  4K2P A;  1DRO A;  1WM3 A;  4HCN B;  5J3T A;  2JWZ A;  3M63 B;  3KH0 A;  2DKQ A;  4MEM A;  5D7G A;  3PGE A;  2ROZ B;  2K8H A;  1WY8 A;  4E3C A;  5J18 A;  1D3Z A;  1C1Y B;  4TV3 A;  5DIF B;  1X05 A;  2K6D B;  2D2Q A;  3ULB A;  2K1F A;  1XD4 A;  2K25 A;  2AYO B;  5CLL B;  3ZDM C;  2YS1 A;  2NR2 A;  2YF0 A;  2ELA A;  1V9J A;  4K81 A;  1TQZ A;  1MKE A;  2BF8 B;  2HRJ A;  3ZVV A;  3VQI A;  5FI1 A;  4KZ0 A;  5J2R A;  4K2O A;  1BTK A;  5L95 C;  3JVZ X;  2JXX A; 
#chains in the Genus database with same CATH topology
 2ABD A;  3N3K B;  2J7Q B;  1R4M I;  1DIK A;  4EMO A;  1WZ0 A;  5KQ4 A;  3V6E B;  4M00 A;  3SDL C;  4IAP A;  1SE9 A;  2V4I B;  1GAQ B;  4CHK A;  1YX5 B;  1QF6 A;  2RNR B;  1SB3 C;  2L1A A;  1PGA A;  1TKG A;  1T0R C;  2KO3 A;  2KAC A;  2ZKM X;  2FBW B;  5D3I B;  5LNK 1;  2WDQ B;  5HFY A;  1TTN A;  3AB5 A;  4C7Y A;  4OHJ A;  1NTV A;  4ANV A;  3BVZ A;  2DZM A;  1QOF A;  2CKH B;  2FUH B;  4JKC A;  1MPE A;  2PEA A;  3H6N A;  2WXK A;  2IND C;  5IN7 A;  2KD0 A;  4DIX A;  1WGD A;  3RNF C;  1GGO A;  4IG7 B;  4JK8 A;  2M0A A;  2QIL A;  2IO0 B;  2DBY A;  5CLQ B;  2KHW B;  5JHA A;  3KSY A;  4KAX B;  1WR1 A;  2LUE A;  4IC7 B;  1X11 A;  4IM3 A;  1TKY A;  1WF9 A;  1QQR A;  2E6X A;  2KAJ A;  5J3Y A;  1K50 A;  3AJ4 A;  2GRI A;  1SEB D;  2RPV A;  1UZX B;  1M7E A;  2IGD A;  1V5M A;  3NZU A;  2AL3 A;  2R2Q A;  1LQB A;  2M38 A;  4OW0 A;  3RCZ A;  3N1X C;  2M17 A;  4ILH A;  4TYZ A;  1M7R A;  4GMX B;  1PUT A;  2KFK B;  4NAM A;  1ZC3 B;  1UEF A;  2HJ1 A;  2Y8F A;  3DCX A;  3SFE B;  4FJZ A;  1VRA B;  2IO1 B;  3Q8C A;  1Z5S B;  3JSV A;  1M4V A;  3MJ5 A;  1C79 A;  4WWP A;  4DDI D;  3W5V B;  1YN3 A;  2LGX A;  1WXQ A;  2YEP F;  2JT4 B;  3NSU A;  3MTN B;  1DBH A;  3A58 A;  2ONQ A;  1XLQ A;  4JKD A;  2BQQ A;  3LYY A;  2DHJ A;  2ZNV B;  4EJN A;  2IDY A;  1I4G A;  1FCL A;  3C8Y A;  3K9P B;  2EJ8 A;  3ZQ4 A;  1F2R I;  2G9H D;  2W2X D;  2MFQ A;  3Q3M C;  3VH3 B;  2DYB A;  2V76 A;  4NJ6 A;  1ZYI A;  3QBV B;  4XE0 A;  4GU2 A;  3TMP B;  3TVV A;  3AE6 B;  3HIZ A;  1TYG B;  3DWG C;  3A9J B;  3KWL A;  2RQ1 A;  1GC7 A;  3PVW A;  2YEP B;  1ZSQ A;  1EM7 A;  1WMH B;  1L6U A;  2PLP A;  2OTX A;  4RH6 A;  2JX5 A;  2PVO D;  3VAW A;  1SXT A;  3TBL D;  3F0W A;  1J7B A;  1J7C A;  5L83 A;  1TY0 A;  2MBQ A;  5D3X A;  2JP2 A;  2DAJ A;  2Z14 A;  2Q13 A;  4IM0 A;  3NY5 A;  2RDH A;  3DHH C;  3RD2 A;  3GYP A;  1WZ3 A;  3N9Y C;  3FC4 A;  1HBK A;  1WG7 A;  2MRP A;  1DOX A;  3D8E A;  3TEZ A;  1KM7 A;  4HLE A;  1ZP0 B;  1XCQ L;  1TS5 A;  2QMT A;  2RGN B;  1YN4 A;  1J8C A;  4GXB A;  4DHZ B;  2AQ1 B;  1SE4 A;  4HPP A;  4K7U A;  2KDF B;  4TQ0 A;  1KLG D;  1NU2 A;  1SJH D;  2MA9 B;  3ZYY X;  2JYT A;  3P63 A;  5EDS A;  4BKG A;  3RNB C;  4XYC A;  4W9D A;  3DPD A;  2JZZ A;  2OQB A;  1JRO A;  3KLS X;  2N9P C;  1EGX A;  4FBJ B;  3AUL A;  2N7J A;  4ACF A;  1YNT E;  2NS5 A;  2PE9 A;  3TEX A;  3QCA A;  2KNB A;  2QSD A;  5DCN A;  5FI0 A;  1X86 A;  2WU5 B;  1Z87 A;  1NYR A;  1TXD A;  4OSN A;  2IBI B;  2KTR B;  3W1Y A;  2OHF A;  2WXH A;  4EZJ A;  2P0F A;  4R3D A;  3ONS A;  2J42 A;  1KOT A;  4HHV A;  4BVU C;  4QXA B;  3P4R B;  4TKN A;  2WXP A;  2KQS A;  4NSW A;  2C5L C;  3W9C B;  1MHX A;  1D5X C;  2BVC A;  3AH7 A;  5LXI B;  1TY2 A;  4E71 A;  1U29 A;  2V4L A;  1JDE A;  3LDZ E;  2LXC A;  2I2Y A;  4F7H A;  4IWQ A;  4WJ7 A;  1RFA A;  4N9F 4;  4W9E A;  4DK5 A;  2DZK A;  2MP2 A;  1SE3 A;  1ST7 A;  2QKL A;  3RYT A;  1E10 A;  1U27 A;  2ZPN A;  3U7D A;  2V1Y A;  2L1C A;  2WH5 A;  3RZW C;  2DA0 A;  3ZRF A;  4MT7 A;  2VRW B;  4HXD A;  4F7U P;  5EE1 A;  5C79 A;  3AM9 A;  3ZJT A;  3Q3J A;  4WJO A;  4LK0 M;  3RPF C;  1P1A A;  1MK7 B;  1T6B X;  3QQ8 B;  4KDL B;  4XWX A;  4REZ A;  4GDL B;  3SR6 A;  4A20 A;  4PT5 A;  4I6N B;  3AU5 A;  2G3Q B;  1HA5 A;  1IYF A;  2BKF A;  3L16 A;  3PRZ A;  4HK2 A;  1WGH A;  3A9K B;  1OQQ A;  2XK5 A;  4W9G A;  1AW7 A;  5H8Y E;  2Y5C A;  3ML8 A;  1MJD A;  2RUK B;  4JL9 A;  4L23 A;  4RNA A;  2EMS A;  1WM2 A;  2FUG 1;  3NW8 A;  4F7G A;  3TIX A;  1DOY A;  4IUM B;  3RUI B;  4GOU A;  3ZVR A;  2Z59 B;  2CB8 A;  2FCQ A;  2Y5B B;  2L32 A;  4IM2 A;  2YSZ A;  1WSP A;  1W1D A;  4EE2 A;  2LKO A;  4YTN B;  2KQ4 X;  2ZVN A;  2D5G A;  2SEB D;  3A4S C;  3E9O A;  2WX0 A;  3NZS A;  3EUB 2;  2GBK A;  4K17 A;  4FXC A;  2BB5 A;  3T9L A;  4GPT B;  3GE8 C;  3PVU A;  2KT7 A;  1GG3 A;  1XR0 B;  2HD5 B;  2X38 A;  3TSS A;  2XEW A;  1I7H A;  5IOI A;  3BYT B;  1T3Q A;  1YIW A;  3KWV A;  4L6E A;  3E9L A;  2MJD A;  2CR5 A;  2LOZ A;  2N9L A;  2MKR A;  2VRR B;  3I57 A;  1FM0 D;  2LXA A;  2PTL A;  2DFK A;  3ZLZ A;  2RSG A;  3ZUN A;  3T06 A;  2DN6 A;  2CU1 A;  2LVP A;  2G45 B;  2C7N B;  2PVG C;  3KYC D;  4UDU C;  2BT6 A;  2BYE A;  3SBT A;  3E9P A;  4IKG A;  1HB8 A;  4HRS A;  1Q5W B;  4K1R B;  4M01 A;  3LJU X;  1GUA B;  4DDG D;  2I5F A;  3X23 A;  4A6F A;  2MQJ A;  5JVL A;  4IOI E;  4I6L B;  5HKH A;  3ULC A;  1MPH A;  2E2X A;  1K51 A;  4A6K A;  3MC8 A;  4AOF A;  1B9R A;  1XKE A;  5EE9 A;  2KYW A;  4LJO B;  4CYE A;  1P6S A;  1RAX A;  2PKO A;  1K8R B;  2KR0 A;  1RJ2 A;  4LCD E;  5DPT A;  3NZ3 A;  1OQN A;  3I9V 1;  1HB6 A;  3SD5 A;  2KDM A;  5HHD G;  2DKP A;  4ZRQ A;  1T5X D;  3B2F A;  3AMZ A;  1K53 A;  1XF5 L;  1C78 A;  2KVR A;  4P1C C;  4C0A A;  4JKB A;  1WYW B;  4IWO A;  4ZYS A;  2GJY A;  1P7E A;  1VLB A;  4DHJ B;  3R7Q A;  1EU3 A;  3PZD A;  4WJQ A;  1B55 A;  1BAK A;  3TEW A;  1ZW7 A;  5LG4 B;  2Y7B A;  2NCN A;  4MGY E;  4RGM A;  3QK0 A;  5JHB A;  3BK1 A;  2JZP A;  4J3O D;  3ZTC A;  3R7R A;  2KGX B;  2XNA C;  5BYS A;  5E6J A;  1UBQ A;  1IUE A;  4ZRK A;  3TEY A;  1TZ1 A;  1Y8R C;  2MW5 A;  1G6J A;  1STE A;  3P7Z A;  3H9D A;  1YQ4 B;  1N3H A;  4RGN A;  4YTP B;  4OZB A;  3JYU A;  4OVV A;  3U12 A;  2HTH A;  4B6W A;  1E90 A;  4JKG A;  2Z0E B;  3NUH B;  5HE1 A;  4MT5 A;  3RZF A;  2K22 A;  4LNK A;  4HAW B;  3GOE A;  1FHX A;  1L0X B;  4KZC A;  1UPQ A;  2D9X A;  4XDC A;  5AZH A;  2K2U A;  3DHI C;  4MM3 B;  4KSK C;  4PNK A;  1HE8 A;  1WGU A;  3SV1 A;  3M3J A;  1KC7 A;  1VZ8 A;  4EUT A;  3ML9 A;  5FK9 C;  4Q2J A;  1XCG A;  3WAN A;  4DQO C;  1C3T A;  1BUI C;  4CHM A;  4JK7 A;  1U5D A;  3AN1 A;  2W9N A;  3QWZ B;  4LNI A;  1E9M A;  4ZRJ A;  3DVN U;  2MHJ A;  2R2Y A;  2HE7 A;  1S3S G;  3TL5 A;  2GLS A;  2YT1 A;  5AUK A;  3IXS A;  1ZPS A;  2UU7 A;  2JVC A;  1JWM D;  1OQR A;  5M4Y B;  1ESF A;  3ZRC A;  3ZNH B;  4WWN A;  5BMH A;  5BO4 B;  3JW0 X;  2ASQ A;  1FAO A;  1FRD A;  1L7Y A;  3D8F A;  4KHO A;  3TFM A;  1P5T A;  5D3W A;  2DYN A;  3V60 A;  2JUO A;  4ZRI A;  3R2T A;  1IGD A;  2N1W A;  2V9H A;  5G55 A;  4XWT A;  2WXQ A;  4AJW A;  1E8X A;  2O6V A;  3KUZ A;  4PK1 A;  2C9W B;  2KFJ A;  3PVL A;  4KHA A;  3VVW B;  4DXG A;  4KGS A;  1EU4 A;  3OLM D;  3Q3F A;  1DDW A;  2KOX A;  4NNJ B;  4RM9 A;  1R7S A;  1VBG A;  2GBM A;  1V1P A;  1V6E A;  4B0M A;  3AED B;  2K8C A;  2JQR B;  2P0H A;  3V5W A;  1N60 A;  2TSS A;  3IBE A;  4KDI C;  3IVF A;  5C5B B;  4M0W B;  5T8I A;  4AJY B;  4KVG B;  3PSC A;  3U4E G;  4LNN A;  2D9W A;  4HEA 1;  2QKM A;  3FLV A;  3WA0 A;  4ILJ A;  2KDI A;  1H10 A;  3HM6 X;  2JSV X;  4HRO A;  3ZNG C;  5L81 A;  1RFK A;  2NPT B;  3H1U A;  3A1Q A;  3KRX A;  2R61 A;  5I2M A;  1FB8 A;  2LGS A;  2M19 A;  3FEH A;  2N0Y A;  2LEK A;  3KZ1 A;  4HSI A;  2PW9 A;  4LLG M;  2CHX A;  1KJT A;  3O65 B;  2CY5 A;  2BS2 B;  1WJU A;  4MJS A;  1PFJ A;  3ODX A;  3KUD B;  4KGR A;  1FD6 A;  1V61 A;  2RR9 A;  1L4D B;  4G50 A;  2QC8 A;  2WHI A;  2KDB A;  4GOC A;  1K5D B;  4WIP A;  2K2J A;  2EEL A;  3KW5 B;  4LTU A;  4WSF A;  3K9O B;  1SIJ A;  1TJ6 A;  2WLB A;  3AV8 A;  4MAC A;  4W9H A;  1T0Q C;  4BBN F;  2BBC A;  3WAP A;  4HCP B;  4HVB A;  2MLB A;  4AS1 A;  2LJI A;  2G4D B;  1MK9 B;  2KMM A;  4K7S A;  1UGM A;  1R4N I;  1QKZ A;  4G3X B;  2NBV A;  2IY0 B;  2QDF A;  2X8X X;  3E9S A;  1Z2M A;  2DYO A;  2CRF A;  3X0W A;  2ICI A;  2ZCC A;  2PMV A;  1UD7 A;  2LWP A;  3SNH A;  2WXO A;  2RRF A;  4H8S A;  4F1S A;  4D6W A;  1WXA A;  3VTU A;  5BMG A;  3VDZ A;  1IBX B;  2DNF A;  2AQ2 B;  2QJL A;  2H7E A;  4S17 A;  1LO5 D;  2A4Z A;  2IYD B;  4EFO A;  1L0V B;  5IAA C;  1MIX A;  3IFW B;  4JX1 C;  2CU3 A;  1N5W A;  1WXV A;  2IZV B;  4HWI B;  4BAX A;  2UWQ A;  2M4N A;  1D5M C;  1P3R A;  3V61 A;  1JQ4 A;  2REX A;  3G9W A;  1ET9 A;  3B1L X;  3TCA A;  1ZOY B;  4OT1 A;  2LOX A;  3QJZ A;  1E6E B;  5I4D A;  2FJ9 A;  2KWU B;  1VR9 A;  3FM8 C;  2DHI A;  1YOV B;  3ECI A;  4JWS C;  4HB3 B;  2KDE B;  4K3C A;  2DHZ A;  1TS3 A;  3TO1 A;  2LI5 A;  3VUX A;  2ACZ B;  2IO3 B;  2RD0 A;  2JPH A;  2RGF A;  1KRH A;  2VSZ A;  2Y3A A;  2M1M A;  2ZEQ A;  4YTM B;  2RMM A;  2NMQ A;  2GBR A;  2K39 A;  3SU8 X;  3RMK C;  1Q10 A;  3AEB B;  3FSS A;  1MVK A;  2KMC A;  3NWF A;  1R4N B;  2JU6 X;  1SGH A;  1U2B A;  3B9J A;  2K00 A;  1ISN A;  1X1M A;  4US8 A;  3AEA B;  1WJ1 A;  1XLN A;  4WJP A;  5D3D A;  4RF1 A;  2MJE A;  5BYQ A;  2K8B A;  3P4P B;  2EKI A;  1R4M B;  2W2X C;  3J9C A;  4HB0 B;  2MSE D;  1S1Q B;  1WGR A;  1YD8 U;  3M1I B;  4GNK B;  3LB8 C;  4TMA B;  4KKJ A;  2JRH A;  4A5K A;  2WNM A;  1VZ7 A;  2KJ6 A;  4BKS D;  3N32 A;  5DPW A;  1VCB A;  1DYN A;  4PYZ A;  1TGZ B;  3PHX B;  1KZG A;  4O1N A;  5GXG B;  2J0K A;  3ZO5 B;  1WVH A;  1OFF A;  3QWM A;  3NWD A;  4ICV A;  2IO2 B;  3BIN A;  3AEF B;  3JSV B;  2LVQ A;  4XDD A;  3B77 A;  1KTK A;  5GMV A;  2W3S A;  1WX8 A;  2FID A;  1FOE A;  1LFD A;  3BYY B;  1QOG A;  2PIA A;  2AX5 A;  3AU4 A;  3VR9 B;  1W1G A;  2LAS A;  3V6C B;  2HDE A;  3VXW A;  2LVO A;  1A5R A;  3KY9 A;  2CS4 A;  4P16 A;  3ML4 A;  1I35 A;  1UNQ A;  5MPO A;  2GMI C;  2KTR A;  2KMA A;  3HQC A;  2D07 B;  1M94 A;  4EOY A;  2L05 A;  3ZGZ A;  3ODW A;  5E6O A;  1NVL A;  4NAW A;  2NZ8 B;  2VZK B;  4G0N B;  4N59 A;  3PLV A;  1MHH E;  3MHS D;  5CHF A;  2KJH B;  3Q3O C;  4RFB A;  4B9K A;  1KZ7 A;  3AE1 B;  1QOB A;  3DXD A;  3BII D;  2CQU A;  2JRI B;  3GZN I;  4GLS C;  4HJG E;  3WCQ A;  2BTE A;  1WRD B;  4II3 B;  1IGC A;  2WXR A;  4DXA B;  4ILG B;  4RGO S;  3GYO A;  3DWM A;  4RF0 A;  4HDO A;  4JKE A;  4ANU A;  4ICU A;  5AZF A;  4DHJ D;  2SAK A;  3MFG A;  2Y5P A;  1MG4 A;  2N0S B;  1TKE A;  3A33 B;  2CHW A;  4YSZ B;  3HK0 A;  5C16 A;  4IWP A;  3VUY A;  5I2S A;  4GDK A;  3MP9 A;  1ACA A;  4W9C A;  4W9F A;  2O2V A;  3RFZ B;  3RNG C;  3H8H A;  3EGR A;  3PRE A;  2BYT A;  4WWM A;  3DBH I;  5TR5 A;  3N1Z C;  4E74 A;  5AEK B;  1XLO A;  3NVY A;  3WIM A;  1ENF A;  2WWZ A;  3PRP B;  2MWN B;  2D4Q A;  3OHM B;  3DHG C;  2R09 A;  3DOW A;  4F8C B;  5KHO A;  1FHO A;  2RVB B;  4RM8 A;  2KUQ A;  4KIK A;  2D3C A;  2LFI A;  3DDC B;  3AE2 B;  1V86 A;  3PTF C;  2M56 B;  1FXA A;  2WDT B;  3P1M A;  3DBR I;  3H7S A;  3HRD D;  3DVN V;  3DVG X;  5C6R A;  1AQC A;  1KI1 B;  2KIG A;  3D8D A;  4Y94 A;  1E7V A;  2W82 A;  2ROV A;  3Q8E A;  1U5E A;  2J0J A;  3IT6 B;  1J7A A;  4A3O A;  1V5O A;  3AXC A;  4XC2 A;  1WI0 A;  4HB2 B;  3P2B A;  3F5R A;  2IGH A;  1LXD A;  2BB6 A;  3H7P A;  2YT2 A;  1WYG A;  1UWX A;  4A6H A;  2ZW0 A;  3MHZ A;  1C4P A;  1E8Y A;  2BKR B;  3ENB A;  3PEG A;  3N7C A;  3CMM B;  3GZN B;  3RUL A;  3WYF B;  3ZJV A;  1H8C A;  3D32 A;  2D9V A;  3NVZ A;  3OG5 A;  4NJC A;  2MP2 B;  2MCN B;  3O13 A;  4GSW A;  2B3A A;  4IW0 A;  3EEC A;  2COF A;  2D10 A;  2MBE A;  3KRW A;  5D94 A;  2ZPY A;  2GUM A;  1JW9 D;  1F1H A;  1I7A A;  5DHA B;  3SYX A;  1GNU A;  3FKY A;  4HKZ E;  3WAO A;  3O96 A;  1EWC A;  4FUL A;  2NVU I;  3PS6 A;  4M02 A;  3IG3 A;  2WXF A;  4DBG A;  1YQB A;  4RMA A;  5G5H A;  4DXF A;  1V88 A;  1PQS A;  3DCG A;  1B1Z A;  3VR8 B;  3ZXR A;  3I63 C;  2WQY B;  5CX3 A;  2KN4 A;  1J19 A;  2JY6 A;  2BWF A;  2N1V A;  3EHV A;  2XK5 B;  3T8M A;  2G4S A;  2KK8 A;  1LW3 A;  2FIF A;  4B95 A;  1ZGU B;  2EC1 A;  5IO9 A;  3VRB B;  3ETR A;  3BZD B;  1U4A A;  4DX9 0;  3C19 A;  2Z0O A;  4RCO A;  1EVH A;  1RYJ A;  5CTR C;  1UNS A;  2YLM A;  3VFK A;  3R2I A;  1UF0 A;  1FIQ A;  4KKI A;  4L2Y A;  2D9Y A;  4M8M A;  1KF6 B;  1HTO A;  3NWA A;  4GN1 A;  4JKF A;  3MPX A;  4MK0 A;  1XD3 B;  5J3Q A;  1IRS A;  2NBW B;  5AUI A;  1FXT B;  4MSM B;  1WFY A;  1Y56 A;  4ARI A;  2I1J A;  4Z2M B;  2JYE A;  2R2O A;  5DPR A;  1KBL A;  4W9J A;  1SF0 A;  2MEK A;  3EPY A;  1GPX A;  4CSQ A;  1ZE3 D;  2L3Z A;  4URK A;  2KCJ A;  2WXN A;  4YT0 B;  1WRI A;  4NJ7 A;  4C4V A;  2GS0 A;  3HIE A;  3NG0 A;  2DLB A;  1FMA D;  3OWE B;  4YWG G;  4AP4 C;  3E56 A;  1T0Y A;  1U5F A;  1E5W A;  1E8Z A;  4CQN A;  2LUM A;  5D6J B;  4WUR A;  2MBH A;  1OY2 A;  4LDT B;  2FE8 A;  2AL6 A;  2YS3 A;  3C0R B;  4LJP B;  2V3S A;  4QJ5 B;  2RPQ A;  2LGD A;  4EEW A;  3Q6B A;  3GE3 C;  2ZW1 A;  3L08 A;  3Q69 A;  2UVM A;  1V5U A;  2FJU B;  1ZC4 B;  4FAD A;  4C00 A;  5FR3 A;  3SHQ A;  4USA A;  4PS3 A;  2ZVO A;  3GB1 A;  1PGX A;  3DXE A;  1FFV A;  1HEZ E;  1E7P B;  1ZKH A;  1Q67 A;  2KC1 A;  3OAW A;  3RT3 B;  2X0S A;  1YX6 B;  3QHT A;  2PE6 B;  2WGS A;  1C4C A;  1CZP A;  1H4R A;  2G1E A;  1I42 A;  5HE0 A;  3KYD D;  4C56 C;  3R3M A;  2DYM A;  2R0D A;  2D3G A;  4GZU A;  3ZXV A;  1WJ4 A;  1ZDX A;  3KVF B;  1FFU A;  3QA8 A;  4ZHP A;  2IPK D;  3WAM A;  1WJN A;  2V3P A;  4C7Z A;  2M0X A;  3NVV A;  1XX0 A;  4WVF B;  2M8S A;  1VJK A;  4FA6 A;  1KFY B;  5DHF B;  2UZR A;  3Q3N C;  2BCJ A;  3AEC B;  3HHM A;  4BOS C;  3KQ4 A;  2BYF A;  2HTM E;  4KV2 A;  2WXJ A;  2KLG A;  2L7R A;  1PMS A;  3DVG Y;  2K0P A;  4LNF A;  3U8Z A;  4GGQ A;  2HTH B;  1P3Q U;  5EE3 A;  4NPN A;  4JKG B;  3QX1 A;  1OEY J;  3AI5 A;  4QAY A;  1FGZ A;  1EF1 A;  2ZNV C;  3L13 A;  1XEE A;  2AQ3 B;  1YJJ A;  4IOY X;  4HB4 B;  4MH0 E;  3PLU A;  5DPS A;  3FAH A;  4GIV A;  2JZ3 B;  2K5P A;  3B0A A;  4MEL A;  1SE2 A;  5EFX A;  3GP7 A;  5JZE B;  2W55 A;  3AE3 B;  2L0T A;  1MI1 A;  4YXD B;  1UBI A;  3FIL A;  2L76 A;  3NS1 A;  5CHV C;  2IFS A;  1JAL A;  1HQR D;  1XLP A;  2OOB B;  3TJP A;  1WE7 A;  4YSY B;  1L0Y B;  4ZRP A;  1L4Z B;  1J0G A;  4GB9 A;  4WAA A;  3BJI A;  4PS7 A;  3MDB C;  3NVW A;  1V97 A;  4D0N B;  2N9X A;  1QC6 A;  2RDG A;  1PGB A;  3AE5 B;  1RRB A;  4JGH B;  2L2I A;  2KC2 A;  4H2A A;  4KX6 B;  2ZCB A;  3N30 A;  1V80 A;  4HPL B;  1QLB B;  4A8X C;  5C23 A;  3ZIM A;  2Z8L A;  2DWQ A;  3UIP B;  2DX5 B;  2COC A;  1LM8 B;  3ENE A;  5DH9 B;  4FHK A;  4KHB B;  1HTQ A;  3ZKJ C;  1UWM A;  2YRY A;  1MG8 A;  2FCM A;  2MDX A;  2O6V B;  3PSE B;  3UGB B;  3I3T B;  3VTW A;  4WWO A;  3P4S B;  4GMV A;  1SIF A;  1N62 A;  4FHJ A;  3CSF A;  2M14 A;  1NTI A;  3IT4 B;  2LRU A;  4FJV B;  2KLC A;  2VZK D;  4US9 A;  1V1P B;  3L54 A;  2MX2 A;  1RRP B;  5BYR A;  2QHO A;  4ANX A;  2COA A;  4XWW A;  4X57 B;  4HAZ B;  5EE0 A;  3APF A;  4K3B A;  1FNV A;  3PV1 A;  1JML A;  2H88 B;  1PDX A;  4PQ0 A;  1YQ3 B;  3VOQ A;  2A5U A;  2INN E;  4MY6 A;  2D3A A;  5FR6 A;  4RGT A;  4WQO B;  3A1Q B;  3OAN A;  3NS8 A;  2COP A;  1X1F A;  1GB1 A;  1CJE A;  1WXS A;  1F2R C;  1ACC A;  2LHE A;  2DLW A;  3HVZ A;  3U2S C;  1WH3 A;  2INC C;  3HUI A;  4YSX B;  1DGJ A;  3RNE C;  2FNJ B;  1V8C A;  2N9K A;  4MJS B;  4IFS A;  2LZ6 A;  1AWD A;  2Z0P A;  1FEH A;  1UPR A;  3HM3 A;  4OZA A;  1NTY A;  2B76 B;  5G2N A;  2VH1 A;  5C2T B;  1WGY A;  1ZDV A;  2KFK A;  3RN9 C;  3W1S C;  4YL8 A;  3Q8B A;  1I2H A;  2L00 B;  5D3Y A;  1EO6 A;  3DQV A;  4P7I A;  4HJK A;  2GCL A;  5KCV A;  2KX0 A;  2WX1 A;  1TS4 A;  3LJ3 A;  1WX9 A;  1D5Z C;  3SFD B;  1GC6 A;  4J6I A;  3RI7 C;  3N20 C;  2I1K A;  1P7F A;  3HVD A;  2DYQ A;  2YT0 A;  2NBV B;  4W9K A;  3DBS A;  2JWU A;  3TW1 A;  2W2W A;  2K8E A;  2I5C A;  2K9X A;  1L2N A;  2C60 A;  4G11 A;  4TSS A;  1EAZ A;  1ZVR A;  3APD A;  1D4B A;  2QCZ A;  1AWE A;  1YMH E;  2R82 A;  1I4X A;  1K52 A;  3VTV A;  1VD2 A;  1OEY A;  2N23 A;  1NEK B;  3A9J A;  1D6E C;  1XQQ A;  4A9A A;  3EA6 A;  3VIA A;  1V81 A;  3UQA A;  2N7D A;  1WMH A;  3B2G A;  1SJE D;  1DDV A;  3OJ3 A;  2VH2 A;  3U52 E;  2V0G A;  2L0F A;  4PYU A;  4DHZ E;  1XOD A;  1AYF A;  1E0Z A;  3UF8 A;  1CQV A;  2NBU A;  4OVZ A;  4EZK A;  4XGA B;  2KUP A;  5IA7 A;  1ZM0 A;  2XQN M;  3VHT C;  1QOA A;  1Q1O A;  4AWJ A;  3FP5 A;  4FJY A;  1GOZ A;  2ZZP B;  2NTT A;  2IJ0 A;  3AE8 B;  3QC8 B;  1BT0 A;  4MGK E;  2DHK A;  1TZO A;  3BK2 A;  3UIN B;  5BMI A;  3M95 A;  2PZ1 A;  4IDI A;  4A6Q A;  1P9D U;  2C7H A;  1ZXI A;  1FNW A;  5AZG A;  5D3V A;  5D2M B;  2K3U A;  2WXM A;  3SEB A;  2WDV B;  4N6E B;  1WGQ A;  3IHP C;  1QQG A;  1A70 A;  2LD9 A;  2N7E A;  4ZDV A;  3P6A A;  1GJZ A;  4KGT A;  1I4Q A;  3UQB A;  3S2A A;  2KWV B;  4BFR A;  4B0E A;  4XX5 A;  1TS2 A;  1BTN A;  2RSU A;  4JKA A;  1MFW A;  4ARC A;  5D27 A;  3FVC A;  4A3P A;  4QJ4 B;  2Z4D A;  3A8P A;  5J17 A;  3WAL A;  1TBE A;  1P0R A;  3A8Q A;  3IAS 1;  3QIJ A;  2KXJ A;  2KX3 A;  1YJ1 A;  3A4R A;  1XO3 A;  5JH5 C;  3IAM 1;  1VBH A;  2G35 A;  1PLS A;  2PPH A;  5IKC M;  1IP9 A;  4C80 A;  1DOI A;  2N9E B;  4DX8 A;  3ALB A;  1FXI A;  2BPS A;  1HXY D;  1RWS A;  5JHG A;  3W1S A;  1CK1 A;  2XN9 C;  3UI3 A;  1FGY A;  5LOP B;  4HAX B;  4BZA A;  2CHZ A;  1KLU D;  2INP E;  2LHD A;  1FHW A;  3RCP A;  3L10 B;  2ADZ A;  1PFD A;  2GB1 A;  1V2Y A;  3R66 C;  1VZ6 A;  4L1B A;  1DDM A;  2KAN A;  3BY4 B;  2FDQ A;  3ZNI D;  3L4P A;  4EKU A;  1OMW A;  2VKI A;  4OVU A;  3W2D A;  4LDT D;  2C7M B;  1QZE A;  1JWB D;  5HI1 A;  1JWS D;  4ZYN A;  4GDL A;  4A55 A;  1QT9 A;  1WI1 A;  2IY1 B;  4NAW B;  2GBJ A;  3ABV B;  1FO4 A;  1TIF A;  1GB4 A;  2JXT A;  4HPM B;  2WYQ A;  2H89 B;  2KQ7 A;  4JLC A;  3A9K A;  2KIE A;  1NYQ A;  2DAF A;  2KN5 A;  4JKH A;  3B08 A;  3NHE B;  1BWN A;  3ZNZ B;  3N1Y C;  4ANW A;  3U30 A;  3URY A;  1AAR A;  1V5P A;  4JIO U;  3ZJU A;  2EKE C;  2COD A;  3V62 A;  1BML C;  1YJI A;  3UZT A;  1WJ6 A;  2IGG A;  1TJE A;  4DWF A;  2Z59 A;  2Y8G A;  2OED A;  2LGI A;  4GDK B;  3EFC A;  1U5G A;  4FLH A;  5IJM A;  5KQ1 A;  2BYV E;  3ZTD A;  2J4X A;  1FRR A;  2MBB B;  2O2V B;  2MH7 A;  3Q8F A;  4MGI E;  1NEN B;  3BVM A;  5DI9 B;  2BGF A;  4BKS A;  5TSS A;  3LXF A;  4CHJ A;  2CJO A;  2OJR A;  3CXB B;  2KWD A;  5CHW A;  3AE9 B;  4MSQ B;  4XZ4 A;  1Y5O A;  2KJR A;  3KUC B;  1UH6 A;  1L6V A;  3SBG A;  2J0M A;  1C4A A;  2QEJ C;  2BS3 B;  5HE3 A;  4P6V F;  4WQM A;  4AUQ C;  4ZOH C;  1MAI A;  4KIK B;  3P42 A;  3L0W B;  2KWC A;  5GOW B;  3Q2A C;  1I4H A;  3DBL I;  2L8J A;  1Y19 B;  2DZI A;  2WXL A;  4BBK A;  1WWT A;  4TQ1 A;  3RNA C;  3R8B A;  1AN8 A;  2J59 M;  1I4P A;  1ZXH A;  3SUZ A;  3Q8A A;  3DBH B;  1WJM A;  1ROE A;  3CST A;  4HAT B;  3BVG A;  1W1H A;  3QAR A;  1UGJ A;  2KTF A;  1BXT A;  2I38 A;  2ZJD A;  1YN5 A;  3VRA B;  2RDB C;  2W3R A;  1V89 A;  2X18 A;  3H7P B;  2JF5 A;  3CIR B;  1XT9 B;  2D3B A;  2P8V A;  1C77 A;  1SSN A;  2LYD A;  4Z2N A;  3MC0 B;  1KH0 A;  3RNC C;  2IYB A;  1SHC A;  2DTC A;  2LUL A;  4P1B C;  3TUO A;  4D2K A;  3A98 B;  3DBR B;  4MDK E;  4NY0 A;  1LB1 A;  1WX7 A;  2NTS A;  2D11 A;  2O6V D;  2WXG A;  4WH4 A;  5LLI A;  5C1Z A;  3SO6 A;  1WGK A;  2DZJ A;  2P0D A;  2DEN B;  3CF6 E;  4MH8 A;  1J0W A;  3NOB A;  4NQL B;  4BOZ B;  4JK9 A;  1WGG A;  3MJW A;  1F0Z A;  1OTR B;  3EFU A;  1UUP A;  2D9Z A;  1F52 A;  1NI3 A;  5G5G A;  2UZS A;  2HJ8 A;  3PP2 A;  4KSL C;  1T0S C;  3ZW3 A;  4HAY B;  3VUW A;  4YON A;  3PG7 A;  1UEL A;  1RLF A;  2NMB A;  3L17 A;  1IPG A;  3I5J C;  1SBB B;  4DBB A;  1T77 A;  1Q0W B;  2KKC A;  2DX1 A;  3PPA A;  4MM3 A;  3ZDT A;  2LJ5 A;  2CAY A;  2LBB A;  3DBL B;  4W9L A;  2GCJ A;  4PS8 A;  1XXG A;  2H7D A;  4JWU C;  3PZ8 A;  2DIK A;  4BKT A;  4A6F B;  1N6Z A;  1NBF C;  4B6H A;  1XCT L;  4NQK E;  4K7W A;  4W9I A;  1X1G A;  1VDV A;  2YVC A;  2W54 A;  1QIL A;  2KZR A;  4L1R A;  4I6P A;  2PJH A;  1NI2 A;  2K49 A;  4BBN C;  3APC A;  3M62 B;  4F7Z A;  1K5G B;  1C76 A;  1KLV A;  1MIZ B;  2EMT A;  2GBN A;  2BWE S;  2K6Q A;  3ODO A;  4HAU B;  2YS5 A;  1JWA D;  1N5X A;  2FCS A;  1NDD A;  2BW2 A;  3AEE B;  3DXC A;  5LXH A;  1F77 A;  2UYZ B;  1V5T A;  3NJT A;  1WIA A;  2RLO A;  2Z0Q A;  5HG2 A;  1EWY C;  2WS3 B;  2MBO A;  1F9J A;  5JLJ B;  5IRS A;  2L83 A;  2Z13 A;  4HDQ A;  1N63 A;  4C4V B;  1JCK B;  4M8N A;  4QJ3 B;  1WR6 E;  2MJ3 A;  2CY4 A;  4WAF A;  1FPY A;  1HZ6 A;  1P98 A;  1JRU A;  3UIO B;  3EC8 A;  4WJN A;  1V49 A;  3V05 A;  1C9F A;  1E7U A;  2GOW A;  1E8W A;  2AEH A;  1RM6 C;  2QIE B;  3V3X A;  3HW2 B;  3QAQ A;  2N4F A;  5C5B A;  4II2 B;  4JQW C;  4M0W A;  3VH4 B;  3PRM B;  5JHH A;  1OGW A;  5E6P A;  3U7Z A;  2V3N A;  1TT5 B;  1EF5 A;  4TUU A;  1EUV B;  2XBB C;  2LG1 A;  2E3T A;  4A90 A;  4FN2 A;  1OQY A;  2NPT A;  2LGY A;  4ASW C;  4EZL A;  2GI9 A;  1DYQ A;  4AQ7 A;  3Q14 C;  3T3O A;  2L52 A;  2AWT A;  3OJ4 B;  2MWS B;  3P4Q B;  2J52 A;  4MGZ E;  2DX5 A;  1HZ5 A;  3CWI A;  3PZ7 A;  4KHB A;  2KVZ A;  3MC9 A;  5C3J B;  4CO7 A;  5JP4 A;  1UNP A;  3AE4 B;  3HSA A;  3GS2 A;  2WU2 B;  4JE3 B;  1JRP A;  1WXM A;  2LRW A;  1NVI D;  5IP4 D;  3PHW B;  4HAV B;  1CMX B;  1UNR A;  5JXV A;  5HE2 A;  5E6N A;  4ZHO A;  2Z0D B;  1JWU D;  5H92 C;  1L5P A;  4JPS A;  1ZUD 2;  3PT2 B;  2FAZ A;  3AEG B;  2CJN A;  1WE6 A;  3NRZ A;  5LON B;  2FJL A;  1N61 A;  5KHQ A;  1FCC C;  2FCN A;  3CIK A;  4S0R A;  2ELB A;  4LNO A;  1LGR A;  3BWU D;  4K2P A;  1DRO A;  1ET6 A;  1WM3 A;  4HCN B;  5J3T A;  2JWZ A;  4NZL B;  3M63 B;  3KH0 A;  1MI0 A;  2BS4 B;  2DKQ A;  4MEM A;  5D7G A;  3PGE A;  5FKA C;  4ITK A;  2ROZ B;  2K8H A;  1WY8 A;  3FIL B;  4E3C A;  5J18 A;  2Q5W D;  2OJW A;  1D3Z A;  1C1Y B;  4TV3 A;  5DIF B;  2ON8 A;  1X05 A;  2J53 A;  2WDR B;  2K6D B;  1IBX A;  3E66 A;  2D2Q A;  3T3N A;  3ULB A;  1I4R A;  2K1F A;  1XD4 A;  2K25 A;  2WP9 B;  2AYO B;  4OZC A;  5CLL B;  3ZDM C;  3PO0 A;  3W5U B;  2YS1 A;  2NR2 A;  2YF0 A;  2ELA A;  3AE7 B;  1V9J A;  4K81 A;  4N58 A;  1TQZ A;  1V1O A;  1MKE A;  2BF8 B;  2HRJ A;  3ZVV A;  1PYW D;  3VQI A;  2WXI A;  5FI1 A;  4KZ0 A;  2LMC A;  5J2R A;  4HKQ A;  1FNU A;  4K2O A;  1BTK A;  5L95 C;  3JVZ X;  2JXX A; 
#chains in the Genus database with same CATH homology
 2ABD A;  3N3K B;  2J7Q B;  1R4M I;  1DIK A;  4EMO A;  1WZ0 A;  5KQ4 A;  3V6E B;  3SDL C;  4IAP A;  1SE9 A;  4CHK A;  1YX5 B;  2RNR B;  2KO3 A;  1TTN A;  1NTV A;  4ANV A;  2DZM A;  2CKH B;  2FUH B;  4JKC A;  2PEA A;  3H6N A;  2KD0 A;  1WGD A;  1GGO A;  4IG7 B;  4JK8 A;  2IO0 B;  5CLQ B;  2KHW B;  5JHA A;  3KSY A;  4KAX B;  1WR1 A;  2LUE A;  4IC7 B;  1X11 A;  4IM3 A;  1WF9 A;  5J3Y A;  3AJ4 A;  1UZX B;  1M7E A;  1V5M A;  3NZU A;  2AL3 A;  2R2Q A;  1LQB A;  2M38 A;  3RCZ A;  2M17 A;  4ILH A;  4TYZ A;  1M7R A;  4GMX B;  2KFK B;  1ZC3 B;  1UEF A;  2Y8F A;  4FJZ A;  2IO1 B;  1Z5S B;  3JSV A;  4WWP A;  4DDI D;  2LGX A;  2JT4 B;  3NSU A;  3MTN B;  1DBH A;  4JKD A;  2DHJ A;  2ZNV B;  4EJN A;  3K9P B;  2EJ8 A;  2W2X D;  2MFQ A;  3VH3 B;  2DYB A;  2V76 A;  4NJ6 A;  3QBV B;  4GU2 A;  3TMP B;  3TVV A;  3HIZ A;  3A9J B;  2RQ1 A;  1GC7 A;  3PVW A;  1ZSQ A;  1WMH B;  2OTX A;  3VAW A;  3TBL D;  3F0W A;  5L83 A;  2MBQ A;  5D3X A;  2JP2 A;  2DAJ A;  4IM0 A;  2Q13 A;  3NY5 A;  3RD2 A;  3GYP A;  1WZ3 A;  1HBK A;  1WG7 A;  2MRP A;  3D8E A;  1KM7 A;  4HLE A;  2RGN B;  1J8C A;  4GXB A;  4DHZ B;  4K7U A;  2KDF B;  4TQ0 A;  1NU2 A;  2MA9 B;  5EDS A;  4BKG A;  4W9D A;  3DPD A;  2JZZ A;  2OQB A;  2N9P C;  1EGX A;  4FBJ B;  3AUL A;  2NS5 A;  2PE9 A;  3QCA A;  2KNB A;  5DCN A;  5FI0 A;  1X86 A;  1Z87 A;  1TXD A;  2IBI B;  2KTR B;  3W1Y A;  4EZJ A;  2P0F A;  3ONS A;  1KOT A;  4HHV A;  4BVU C;  4TKN A;  2KQS A;  4NSW A;  2C5L C;  5LXI B;  4E71 A;  1U29 A;  2V4L A;  1JDE A;  3LDZ E;  2LXC A;  4F7H A;  4IWQ A;  4WJ7 A;  1RFA A;  4N9F 4;  4W9E A;  4DK5 A;  2DZK A;  2MP2 A;  1ST7 A;  2QKL A;  3RYT A;  1U27 A;  2ZPN A;  3U7D A;  2V1Y A;  2L1C A;  2WH5 A;  3RZW C;  2DA0 A;  3ZRF A;  4MT7 A;  2VRW B;  4HXD A;  4F7U P;  5C79 A;  3Q3J A;  4WJO A;  1P1A A;  1MK7 B;  3QQ8 B;  4KDL B;  4XWX A;  4GDL B;  4A20 A;  4I6N B;  3AU5 A;  2G3Q B;  1IYF A;  2BKF A;  3L16 A;  3PRZ A;  4HK2 A;  1WGH A;  3A9K B;  2XK5 A;  4W9G A;  3ML8 A;  2RUK B;  4JL9 A;  2EMS A;  1WM2 A;  4F7G A;  3TIX A;  4IUM B;  3RUI B;  3ZVR A;  2Z59 B;  2CB8 A;  2FCQ A;  2Y5B B;  4IM2 A;  2YSZ A;  1W1D A;  2LKO A;  2ZVN A;  3A4S C;  3E9O A;  2WX0 A;  3NZS A;  2GBK A;  4K17 A;  3T9L A;  4GPT B;  3PVU A;  1GG3 A;  1XR0 B;  2HD5 B;  2XEW A;  1YIW A;  4L6E A;  3E9L A;  2CR5 A;  2LOZ A;  2MKR A;  2VRR B;  2LXA A;  2DFK A;  3ZLZ A;  2RSG A;  3ZUN A;  3T06 A;  2DN6 A;  2CU1 A;  2LVP A;  2G45 B;  2C7N B;  3KYC D;  2BYE A;  3SBT A;  3E9P A;  1HB8 A;  1Q5W B;  4K1R B;  3LJU X;  1GUA B;  4DDG D;  2I5F A;  3X23 A;  4A6F A;  2MQJ A;  5JVL A;  4I6L B;  5HKH A;  3ULC A;  1MPH A;  2E2X A;  4A6K A;  4AOF A;  1XKE A;  4LJO B;  4CYE A;  1P6S A;  1RAX A;  1K8R B;  1RJ2 A;  4LCD E;  5DPT A;  1OQN A;  1HB6 A;  3SD5 A;  2DKP A;  2KVR A;  4C0A A;  4JKB A;  1WYW B;  4IWO A;  2GJY A;  4DHJ B;  3R7Q A;  3PZD A;  4WJQ A;  1B55 A;  1BAK A;  1ZW7 A;  2Y7B A;  2NCN A;  4MGY E;  3QK0 A;  5JHB A;  3ZTC A;  3R7R A;  2KGX B;  1UBQ A;  4ZRK A;  1TZ1 A;  1Y8R C;  2MW5 A;  1G6J A;  3P7Z A;  3H9D A;  1N3H A;  3JYU A;  4OVV A;  2HTH A;  4B6W A;  1E90 A;  4JKG A;  2Z0E B;  5HE1 A;  3RZF A;  4HAW B;  3GOE A;  1FHX A;  4KZC A;  1UPQ A;  2D9X A;  5AZH A;  2K2U A;  4KSK C;  4PNK A;  1HE8 A;  1WGU A;  3SV1 A;  3M3J A;  1KC7 A;  4EUT A;  3ML9 A;  3WAN A;  1XCG A;  1C3T A;  4CHM A;  4JK7 A;  1U5D A;  2W9N A;  3QWZ B;  4ZRJ A;  3DVN U;  2HE7 A;  1S3S G;  3TL5 A;  2YT1 A;  2JVC A;  3ZRC A;  3ZNH B;  4WWN A;  5BO4 B;  3JW0 X;  2ASQ A;  1FAO A;  1L7Y A;  3D8F A;  4KHO A;  3TFM A;  1P5T A;  5D3W A;  2DYN A;  3V60 A;  2JUO A;  4ZRI A;  2N1W A;  5G55 A;  4AJW A;  1E8X A;  2O6V A;  3KUZ A;  2C9W B;  2KFJ A;  3PVL A;  4KHA A;  3VVW B;  3OLM D;  3Q3F A;  1DDW A;  2KOX A;  4NNJ B;  4RM9 A;  1VBG A;  2GBM A;  1V6E A;  2K8C A;  2P0H A;  3V5W A;  3IBE A;  4KDI C;  3IVF A;  5C5B B;  4M0W B;  4AJY B;  4KVG B;  3PSC A;  2D9W A;  2QKM A;  3FLV A;  3WA0 A;  4ILJ A;  2KDI A;  1H10 A;  3HM6 X;  3ZNG C;  5L81 A;  2NPT B;  3H1U A;  3A1Q A;  3KRX A;  1FB8 A;  3FEH A;  2N0Y A;  3KZ1 A;  2CHX A;  1KJT A;  3O65 B;  2CY5 A;  1WJU A;  4MJS A;  1PFJ A;  3ODX A;  3KUD B;  1V61 A;  2RR9 A;  4G50 A;  2KDB A;  4GOC A;  1K5D B;  2K2J A;  3KW5 B;  4WSF A;  3K9O B;  1TJ6 A;  4W9H A;  4BBN F;  3WAP A;  4HCP B;  4HVB A;  2MLB A;  2G4D B;  1MK9 B;  4K7S A;  1UGM A;  1R4N I;  4G3X B;  2IY0 B;  1Z2M A;  2DYO A;  2CRF A;  3X0W A;  2ZCC A;  1UD7 A;  2LWP A;  3SNH A;  4H8S A;  4F1S A;  3VTU A;  1WXA A;  3VDZ A;  2H7E A;  2A4Z A;  2IYD B;  4EFO A;  5IAA C;  1MIX A;  3IFW B;  1WXV A;  2IZV B;  4HWI B;  2UWQ A;  2M4N A;  1P3R A;  3V61 A;  2REX A;  3G9W A;  3B1L X;  3TCA A;  2LOX A;  3QJZ A;  2FJ9 A;  2KWU B;  3FM8 C;  2DHI A;  3ECI A;  4HB3 B;  2KDE B;  2DHZ A;  2LI5 A;  3TO1 A;  3VUX A;  2IO3 B;  2RD0 A;  2JPH A;  2RGF A;  2VSZ A;  2M1M A;  2ZEQ A;  2GBR A;  2K39 A;  3SU8 X;  3FSS A;  2KMC A;  1SGH A;  1U2B A;  2K00 A;  1ISN A;  1X1M A;  4WJP A;  1WJ1 A;  2K8B A;  2W2X C;  4HB0 B;  2MSE D;  1S1Q B;  1WGR A;  1YD8 U;  3M1I B;  2JRH A;  4A5K A;  2KJ6 A;  4BKS D;  3N32 A;  5DPW A;  1VCB A;  1DYN A;  4PYZ A;  1TGZ B;  3PHX B;  1KZG A;  2J0K A;  3ZO5 B;  1WVH A;  3QWM A;  4ICV A;  2IO2 B;  3BIN A;  3JSV B;  2LVQ A;  5GMV A;  1WX8 A;  2FID A;  1FOE A;  1LFD A;  3AU4 A;  1W1G A;  2LAS A;  3V6C B;  3VXW A;  2LVO A;  1A5R A;  3KY9 A;  2CS4 A;  3ML4 A;  1I35 A;  1UNQ A;  2GMI C;  2KTR A;  2KMA A;  3HQC A;  2D07 B;  1M94 A;  4EOY A;  2L05 A;  3ODW A;  5E6O A;  1NVL A;  4NAW A;  2NZ8 B;  4G0N B;  3PLV A;  3MHS D;  5CHF A;  2KJH B;  4B9K A;  1KZ7 A;  3DXD A;  2CQU A;  2JRI B;  3GZN I;  1WRD B;  4II3 B;  4DXA B;  4ILG B;  3GYO A;  4HDO A;  4JKE A;  4ANU A;  4ICU A;  5AZF A;  4DHJ D;  3A33 B;  2CHW A;  3HK0 A;  5C16 A;  4IWP A;  3VUY A;  4GDK A;  1ACA A;  4W9C A;  4W9F A;  2O2V A;  3PRE A;  3DBH I;  5TR5 A;  4E74 A;  5AEK B;  3WIM A;  2WWZ A;  3PRP B;  2MWN B;  2D4Q A;  2R09 A;  3DOW A;  4F8C B;  5KHO A;  1FHO A;  2RVB B;  4RM8 A;  4KIK A;  3DDC B;  1V86 A;  3PTF C;  2WDT B;  3DBR I;  3H7S A;  3DVN V;  3DVG X;  5C6R A;  1AQC A;  1KI1 B;  3D8D A;  4Y94 A;  1E7V A;  2ROV A;  1U5E A;  2J0J A;  4A3O A;  1V5O A;  3AXC A;  4XC2 A;  1WI0 A;  4HB2 B;  3P2B A;  3F5R A;  1LXD A;  3H7P A;  4A6H A;  1E8Y A;  2BKR B;  3ENB A;  3PEG A;  3N7C A;  3CMM B;  3RUL A;  3WYF B;  1H8C A;  3D32 A;  2D9V A;  2MP2 B;  2MCN B;  4GSW A;  2B3A A;  4IW0 A;  3EEC A;  2COF A;  2D10 A;  2MBE A;  3KRW A;  5D94 A;  2ZPY A;  1I7A A;  5DHA B;  3SYX A;  1GNU A;  3WAO A;  3O96 A;  4FUL A;  2NVU I;  3PS6 A;  3IG3 A;  4DBG A;  1YQB A;  4RMA A;  1V88 A;  1PQS A;  3DCG A;  5CX3 A;  1J19 A;  2JY6 A;  2BWF A;  2N1V A;  3EHV A;  2XK5 B;  3T8M A;  2G4S A;  2KK8 A;  1LW3 A;  2FIF A;  4B95 A;  1ZGU B;  2EC1 A;  1U4A A;  4DX9 0;  2Z0O A;  1EVH A;  5CTR C;  2YLM A;  3VFK A;  2D9Y A;  4M8M A;  4GN1 A;  4JKF A;  3MPX A;  4MK0 A;  1XD3 B;  5J3Q A;  1IRS A;  2NBW B;  1FXT B;  4MSM B;  1WFY A;  2I1J A;  4Z2M B;  2R2O A;  5DPR A;  1KBL A;  4W9J A;  3EPY A;  2L3Z A;  4URK A;  2KCJ A;  4NJ7 A;  2GS0 A;  4AP4 C;  1T0Y A;  1U5F A;  1E5W A;  1E8Z A;  5D6J B;  2MBH A;  1OY2 A;  4LDT B;  2AL6 A;  2YS3 A;  3C0R B;  4LJP B;  2V3S A;  4EEW A;  2RPQ A;  2LGD A;  3L08 A;  2UVM A;  1V5U A;  1ZC4 B;  4FAD A;  3SHQ A;  4PS3 A;  2ZVO A;  3DXE A;  1ZKH A;  1Q67 A;  2KC1 A;  3OAW A;  3RT3 B;  2X0S A;  1YX6 B;  3QHT A;  2PE6 B;  1H4R A;  1I42 A;  5HE0 A;  3KYD D;  3R3M A;  2DYM A;  2R0D A;  2D3G A;  4GZU A;  1WJ4 A;  3KVF B;  3QA8 A;  3WAM A;  1WJN A;  2M0X A;  1XX0 A;  4WVF B;  2M8S A;  4FA6 A;  5DHF B;  2UZR A;  2BCJ A;  3HHM A;  4BOS C;  2BYF A;  4KV2 A;  2KLG A;  2L7R A;  1PMS A;  3DVG Y;  3U8Z A;  4GGQ A;  2HTH B;  1P3Q U;  4NPN A;  4JKG B;  3QX1 A;  1OEY J;  3AI5 A;  1FGZ A;  1EF1 A;  2ZNV C;  3L13 A;  4IOY X;  4HB4 B;  4MH0 E;  3PLU A;  5DPS A;  4GIV A;  2JZ3 B;  3B0A A;  4MEL A;  5EFX A;  5JZE B;  2L0T A;  1UBI A;  2L76 A;  5CHV C;  2IFS A;  2OOB B;  3TJP A;  1WE7 A;  1J0G A;  4GB9 A;  4WAA A;  3BJI A;  4PS7 A;  3MDB C;  4D0N B;  2N9X A;  1QC6 A;  1RRB A;  4JGH B;  2L2I A;  2KC2 A;  2ZCB A;  3N30 A;  1V80 A;  4HPL B;  5C23 A;  3ZIM A;  3UIP B;  2DX5 B;  2COC A;  1LM8 B;  3ENE A;  5DH9 B;  4FHK A;  4KHB B;  3ZKJ C;  2YRY A;  1MG8 A;  2FCM A;  2MDX A;  2O6V B;  3PSE B;  3UGB B;  3I3T B;  3VTW A;  4WWO A;  4GMV A;  1SIF A;  4FHJ A;  3CSF A;  2M14 A;  1NTI A;  2LRU A;  4FJV B;  2KLC A;  3L54 A;  2MX2 A;  1RRP B;  2QHO A;  4ANX A;  2COA A;  4X57 B;  4HAZ B;  3APF A;  3PV1 A;  4PQ0 A;  3VOQ A;  2A5U A;  4MY6 A;  5FR6 A;  4WQO B;  3A1Q B;  3OAN A;  3NS8 A;  2COP A;  1X1F A;  1WXS A;  2DLW A;  1WH3 A;  2FNJ B;  4MJS B;  4IFS A;  2LZ6 A;  2Z0P A;  1UPR A;  3HM3 A;  1NTY A;  5G2N A;  1WGY A;  2KFK A;  3W1S C;  4YL8 A;  1I2H A;  2L00 B;  5D3Y A;  1EO6 A;  3DQV A;  4P7I A;  4HJK A;  2GCL A;  5KCV A;  2KX0 A;  2WX1 A;  3LJ3 A;  1WX9 A;  1GC6 A;  4J6I A;  2I1K A;  2DYQ A;  2YT0 A;  2NBV B;  4W9K A;  3DBS A;  3TW1 A;  2W2W A;  2I5C A;  1L2N A;  2C60 A;  4G11 A;  1EAZ A;  1ZVR A;  3APD A;  1AWE A;  2R82 A;  3VTV A;  1VD2 A;  1OEY A;  2N23 A;  3A9J A;  1XQQ A;  3VIA A;  1V81 A;  3UQA A;  2N7D A;  1WMH A;  1DDV A;  3OJ3 A;  2L0F A;  4PYU A;  4DHZ E;  1XOD A;  3UF8 A;  2NBU A;  4EZK A;  2KUP A;  5IA7 A;  1ZM0 A;  2XQN M;  3VHT C;  1Q1O A;  4AWJ A;  3FP5 A;  4FJY A;  2ZZP B;  3QC8 B;  1BT0 A;  4MGK E;  2DHK A;  3UIN B;  3M95 A;  2PZ1 A;  1P9D U;  2C7H A;  5AZG A;  5D3V A;  5D2M B;  1WGQ A;  3IHP C;  1QQG A;  2LD9 A;  2N7E A;  4ZDV A;  3P6A A;  1GJZ A;  3UQB A;  3S2A A;  2KWV B;  4BFR A;  4XX5 A;  1BTN A;  2RSU A;  4JKA A;  5D27 A;  4A3P A;  3A8P A;  5J17 A;  3WAL A;  1TBE A;  1P0R A;  3A8Q A;  3QIJ A;  2KXJ A;  2KX3 A;  1YJ1 A;  3A4R A;  5JH5 C;  1VBH A;  2G35 A;  1PLS A;  2PPH A;  1IP9 A;  2N9E B;  4DX8 A;  3ALB A;  2BPS A;  5JHG A;  3W1S A;  1FGY A;  5LOP B;  4HAX B;  2CHZ A;  1FHW A;  3RCP A;  3L10 B;  2ADZ A;  1V2Y A;  3R66 C;  1DDM A;  2KAN A;  3BY4 B;  2FDQ A;  3ZNI D;  4EKU A;  1OMW A;  2VKI A;  4OVU A;  4LDT D;  2C7M B;  1QZE A;  4ZYN A;  4GDL A;  1WI1 A;  2IY1 B;  4NAW B;  2GBJ A;  4HPM B;  2WYQ A;  2KQ7 A;  4JLC A;  3A9K A;  2DAF A;  2KN5 A;  4JKH A;  3B08 A;  3NHE B;  1BWN A;  3ZNZ B;  4ANW A;  3U30 A;  1AAR A;  1V5P A;  4JIO U;  2EKE C;  2COD A;  3V62 A;  3UZT A;  1WJ6 A;  4DWF A;  2Y8G A;  4GDK B;  1U5G A;  4FLH A;  5IJM A;  5KQ1 A;  2BYV E;  3ZTD A;  2MBB B;  2O2V B;  4MGI E;  5DI9 B;  2BGF A;  4BKS A;  4CHJ A;  2OJR A;  3CXB B;  5CHW A;  4MSQ B;  4XZ4 A;  1Y5O A;  2KJR A;  3KUC B;  1UH6 A;  3SBG A;  2J0M A;  5HE3 A;  4AUQ C;  1MAI A;  4KIK B;  3L0W B;  2KWC A;  5GOW B;  3DBL I;  2L8J A;  1Y19 B;  2DZI A;  4BBK A;  4TQ1 A;  2J59 M;  3SUZ A;  1WJM A;  3CST A;  4HAT B;  1W1H A;  3QAR A;  2KTF A;  2ZJD A;  1V89 A;  2X18 A;  3H7P B;  2JF5 A;  1XT9 B;  2P8V A;  2LYD A;  4Z2N A;  2IYB A;  1SHC A;  2DTC A;  2LUL A;  3A98 B;  4MDK E;  4NY0 A;  1LB1 A;  1WX7 A;  2D11 A;  2O6V D;  5C1Z A;  5LLI A;  3SO6 A;  2DZJ A;  2P0D A;  2DEN B;  3CF6 E;  1J0W A;  3NOB A;  4NQL B;  4BOZ B;  4JK9 A;  1WGG A;  3MJW A;  1OTR B;  3EFU A;  2D9Z A;  2UZS A;  2HJ8 A;  3PP2 A;  4KSL C;  3ZW3 A;  4HAY B;  3VUW A;  4YON A;  3PG7 A;  1UEL A;  1RLF A;  2NMB A;  3L17 A;  1IPG A;  4DBB A;  1Q0W B;  2KKC A;  2DX1 A;  3PPA A;  4MM3 A;  3ZDT A;  2LJ5 A;  2CAY A;  4W9L A;  2LBB A;  2GCJ A;  4PS8 A;  2H7D A;  2DIK A;  4BKT A;  4A6F B;  1NBF C;  4B6H A;  4NQK E;  4K7W A;  4W9I A;  1X1G A;  2YVC A;  2KZR A;  4I6P A;  2PJH A;  1NI2 A;  4BBN C;  3APC A;  3M62 B;  4F7Z A;  1K5G B;  1KLV A;  1MIZ B;  2EMT A;  2GBN A;  2BWE S;  2K6Q A;  3ODO A;  4HAU B;  2YS5 A;  2FCS A;  1NDD A;  3DXC A;  5LXH A;  2UYZ B;  1V5T A;  1WIA A;  2RLO A;  2Z0Q A;  2MBO A;  1F9J A;  5JLJ B;  4HDQ A;  4M8N A;  1WR6 E;  2CY4 A;  1P98 A;  1JRU A;  3UIO B;  3EC8 A;  4WJN A;  1V49 A;  1E7U A;  2GOW A;  1E8W A;  2AEH A;  3HW2 B;  3QAQ A;  2N4F A;  5C5B A;  4II2 B;  4JQW C;  3VH4 B;  3PRM B;  5JHH A;  1OGW A;  5E6P A;  1EF5 A;  4TUU A;  1EUV B;  2XBB C;  2LG1 A;  4FN2 A;  1OQY A;  2NPT A;  2LGY A;  4ASW C;  4EZL A;  2AWT A;  3OJ4 B;  2MWS B;  4MGZ E;  2DX5 A;  4CO7 A;  5JP4 A;  1UNP A;  1WXM A;  2LRW A;  3PHW B;  4HAV B;  1CMX B;  1UNR A;  5HE2 A;  5E6N A;  2Z0D B;  3PT2 B;  2FAZ A;  1WE6 A;  5LON B;  2FJL A;  5KHQ A;  2FCN A;  3CIK A;  2ELB A;  4K2P A;  1DRO A;  1WM3 A;  4HCN B;  5J3T A;  2JWZ A;  3M63 B;  3KH0 A;  2DKQ A;  4MEM A;  5D7G A;  3PGE A;  2ROZ B;  2K8H A;  1WY8 A;  4E3C A;  5J18 A;  1D3Z A;  1C1Y B;  4TV3 A;  5DIF B;  1X05 A;  2K6D B;  3E66 A;  2D2Q A;  3ULB A;  2K1F A;  1XD4 A;  2K25 A;  2AYO B;  5CLL B;  3ZDM C;  2YS1 A;  2NR2 A;  2YF0 A;  2ELA A;  1V9J A;  4K81 A;  1TQZ A;  1MKE A;  2BF8 B;  2HRJ A;  3ZVV A;  3VQI A;  5FI1 A;  4KZ0 A;  5J2R A;  4K2O A;  1BTK A;  5L95 C;  3JVZ X;  2JXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...