4YL8A

Crystal structure of the crumbs/moesin complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
296
structure length
296
Chain Sequence
MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKAFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis for the Phosphorylation-regulated Interaction between the Cytoplasmic Tail of Cell Polarity Protein Crumbs and the Actin-binding Protein Moesin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
molecule keywords Moesin
total genus 93
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4yl8A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4yl8A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4yl8A01
4XWXA 4CHJA 3HW2B 4WVFB 2OTXA 1YD8U 3QC8B 2J0JA 1WR6E 4DHZE 1FOEA 4HXDA 5JHAA 1ZSQA 2G4SA 4GIVA 4HJKA 3QX1A 2BYFA 4HB0B 3GYPA 4NY0A 4B6HA 4TV3A 4B95A 2YRYA 4G50A 1UH6A 2CRFA 4HHVA 1XR0B 2DTCA 2DYOA 4G11A 3KY9A 3NHEB 2KVRA 2ZNVB 5IJMA 3N30A 1I7AA 1X1FA 2MBHA 3QIJA 2VRRB 4KDIC 2NBVB 4MJSA 5CHFA 2KDEB 3IFWB 4NAWB 2KKCA 4E3CA 4K7UA 4A3OA 2GBRA 3DXEA 3QARA 1MIZB 3ML9A 4GDLB 2KNBA 2YT0A 2PEAA 4MSQB 4WWOA 3R7RA 3HK0A 2ZPNA 3VAWA 2H7DA 3A9KB 3IVFA 2DAFA 1WGDA 2YSZA 2DYMA 3OANA 3PEGA 1WFYA 3QBVB 2K8BA 2ZVNA 2JZ3B 1PFJA 2KQ7A 2WDTB 2KJRA 4K1RB 2KDIA 4WSFA 1FB8A 3WANA 4A5KA 2CB8A 2AEHA 4RM8A 2UVMA 4W9HA 3TJPA 1P6SA 5GOWB 3DBRI 4HWIB 4AP4C 4W9EA 4ZYNA 4DK5A 2BCJA 1NTIA 4IUMB 1KOTA 1J0WA 1V88A 2IYBA 3BJIA 2MX2A 2GJYA 4EJNA 4G0NB 4HCPB 3W1SA 2N9XA 3H7PB 4TKNA 1E7UA 3NZUA 4P7IA 4FJZA 4PNKA 3QA8A 4HAWB 2HJ8A 2LGYA 2DZJA 3NZSA 3C0RB 2KC2A 3TBLD 2LG1A 4Z2NA 2IY1B 2M0XA 5CHWA 4PYUA 5HE1A 1E8WA 4EOYA 5C5BA 2DX5A 3VH4B 2FCQA 2GBJA 1WJ4A 4BOSC 2YLMA 3ZDMC 2DKPA 1H8CA 4NJ6A 1RRBA 4A6FB 4EZLA 1MKEA 1WE6A 1Q0WB 3DQVA 5DIFB 2IFSA 4ANVA 2IBIB 5DPTA 2KTRB 3P6AA 3CXBB 2WH5A 2EKEC 2KUPA 5HE3A 4HB3B 2CR5A 2YT1A 3ODOA 4W9LA 2FNJB 2RSGA 3O65B 3HHMA 3X23A 1U27A 3ODWA 5J17A 5D3XA 1UNQA 2COCA 4A6FA 2ZNVC 3B08A 2BPSA 3MPXA 4K2OA 2MFQA 3ZNHB 2CHXA 4ZDVA 3ZVRA 2D9YA 4B9KA 4IM2A 1WH3A 2KQSA 2LASA 4IWQA 4W9IA 4WWNA 5E6PA 4DBGA 1V2YA 3PRMB 2K8HA 4M8MA 2ZJDA 2Y5BB 5L83A 2G35A 3ZRCA 2NR2A 1XKEA 1WJMA 2ZZPB 3QQ8B 1WMHB 2K6QA 2M4NA 1D3ZA 2LVPA 4L6EA 4FHKA 1BTNA 1GC7A 2AWTA 3TL5A 1RAXA 3DPDA 1FHWA 1KLVA 4NSWA 2Z0PA 1UPRA 3ZO5B 1YIWA 1V81A 2RLOA 3RCZA 2MW5A 3VUYA 4HVBA 4ICVA 2P8VA 3V6CB 1J0GA 1I42A 3ZIMA 1XT9B 1MPHA 2N7DA 1WXMA 1AQCA 3AU4A 5JH5C 4LJPB 3MJWA 4E74A 4EZKA 4K2PA 1E5WA 4KZ0A 5D2MB 5C79A 3VTVA 2DFKA 3APCA 5L95C 1WM3A 2CODA 4HAVB 5BO4B 1P9DU 3UGBB 3M3JA 1V5OA 3WAPA 2BKFA 5DPRA 3I3TB 1E8ZA 1V5TA 3M62B 3EHVA 3F0WA 1Y5OA 2KOXA 4AUQC 4HAUB 3DOWA 2FAZA 4HB4B 5DHFB 3TO1A 3IHPC 3CSFA 2ELBA 4A6HA 3A8PA 3PLVA 4ASWC 4C0AA 1A5RA 4D0NB 2BKRB 2RPQA 5J3TA 2NZ8B 2CU1A 2KWUB 1SE9A 5JHBA 2I5CA 1E7VA 2K6DB 3FLVA 2JP2A 2CHWA 4PS8A 4KIKA 4MY6A 1U4AA 4WJQA 4GDLA 2UWQA 2L05A 4LJOB 5AEKB 2CAYA 2QKLA 3MHSD 4BKGA 2WYQA 3L10B 1KM7A 3F5RA 4CYEA 1R4MI 2O6VA 4FN2A 2MCNB 3VXWA 1UD7A 2IY0B 1WVHA 3H9DA 4W9KA 4A3PA 2KDFB 4YONA 2KFKB 2L7RA 2LRUA 1U5GA 3R66C 3TW1A 1W1DA 1NI2A 3PSCA 2LGXA 5EDSA 3A4SC 1UNPA 2DKQA 2JVCA 2R2QA 2LD9A 3PT2B 4J6IA 3A8QA 4FJYA 4HK2A 3PLUA 4KV2A 3W1YA 2Y8FA 3KRXA 2J0MA 5JLJB 2E2XA 2C9WB 2N4FA 4GOCA 1OQYA 2KGXB 4KHOA 1EUVB 1KJTA 4E71A 4EMOA 3P2BA 3MTNB 5D94A 3ZRFA 2K39A 3D8EA 2CS4A 3KUDB 2Q13A 3ZW3A 1M94A 4FJVB 5J2RA 2HE7A 5L81A 3DVNU 5FR6A 1IPGA 1ST7A 2UZSA 2ROVA 4KVGB 5JHGA 2Z0OA 1X1MA 3APFA 1P98A 1TXDA 3LJUX 1WXSA 2IO1B 2I1KA 3T8MA 1MK7B 1IRSA 4HB2B 2J59M 2DZKA 2V3SA 1SHCA 3H7PA 4DDID 5IA7A 1M7RA 5D27A 1V49A 1TQZA 1EGXA 3D32A 3FSSA 3B1LX 2MBOA 1TJ6A 5C23A 3SHQA 1ZM0A 5FI0A 2BYEA 2DHZA 1ISNA 2K25A 4IWOA 4WJNA 1P1AA 3ZNGC 2KHWB 2KWCA 4I6PA 2FJ9A 3K9PB 3PG7A 4BOZB 2O2VB 3DVGY 3RZFA 1LQBA 2C60A 4F8CB 1X86A 1DDVA 3L0WB 4F7HA 2Z0DB 3PRPB 5DPSA 4TQ0A 1V5MA 1L7YA 2QKMA 3WAOA 2EJ8A 2LXAA 4FULA 1RFAA 3PS6A 4KAXB 3A33B 5J18A 5CLQB 1GJZA 2ADZA 4M0WB 4DX90 2LZ6A 3ENEA 3FP5A 4AJYB 3CSTA 1EF5A 4KIKB 5DHAB 2W2WA 3KUZA 5EFXA 1K8RB 4M8NA 3VFKA 4LCDE 1BWNA 1WZ3A 2KK8A 1NBFC 4II2B 4MJSB 3TMPB 3WALA 4EEWA 5DPWA 1P5TA 3PHWB 3PZDA 5J3QA 2JRIB 3R3MA 3ULBA 2KFKA 1C3TA 3PREA 3VTUA 4CHKA 1WI1A 2DHJA 2LULA 3ULCA 1U29A 2G45B 5J3YA 3KH0A 2M38A 3PP2A 5KCVA 1FHOA 3NSUA 4MELA 2MWNB 2LWPA 1X1GA 1I2HA 3AU5A 1K5GB 3ONSA 3JVZX 4NQKE 2G4DB 2LOXA 1S1QB 5C1ZA 2GOWA 3PPAA 1WX9A 1WG7A 4DXAB 2KWVB 3DBLI 1NVLA 2JPHA 2ASQA 3AJ4A 2OOBB 4K7SA 2YVCA 2HD5B 1HB8A 3A1QB 2D2QA 2K2UA 1LM8B 3NOBA 2RD0A 2VRWB 4CO7A 3SUZA 3K9OB 2Z0EB 3RUIB 1EAZA 3HQCA 2FCNA 3V5WA 1AARA 2AYOB 2DAJA 2IO0B 2L0TA 3ML8A 2RUKB 3RCPA 3L16A 3PSEB 1GG3A 1IYFA 4ZRJA 4DBBA 2DHKA 2HRJA 1JRUA 2NPTB 3PV1A 1MG8A 4DHJB 3A4RA 1GNUA 4A20A 5TR5A 2JWZA 1ZGUB 2W2XD 2ZCCA 1DBHA 1UPQA 1NTVA 2LVOA 4MGIE 2N1WA 1UZXB 1WGHA 3EC8A 2GS0A 3KUCB 4BKSA 1V80A 2FIFA 2H7EA 3QCAA 3QWMA 5LXHA 1ACAA 2R2OA 4KSLC 3L13A 4LDTB 2NS5A 4F7ZA 1XCGA 2JT4B 3OLMD 1NTYA 1BTKA 4IFSA 2KCJA 2FCMA 2C7HA 4WJ7A 1NDDA 3MDBC 1OGWA 2VSZA 5C16A 2MBBB 4NQLB 2IO2B 1XD3B 3DVNV 4K7WA 5GMVA 3RYTA 1C1YB 3LJ3A 3WIMA 3P7ZA 1LFDA 1WGGA 2KDBA 3NS8A 3T9LA 2L1CA 1ZW7A 2I5FA 2LI5A 2COAA 2K8CA 1QC6A 2LOZA 4KHBB 5CTRC 5D3WA 3DBHI 2RNRB 1P0RA 1SIFA 4HAXB 1BAKA 3PGEA 1CMXB 1WGRA 3U30A 3PVUA 1OEYJ 3V60A 1J8CA 1Y8RC 2KMCA 3DBSA 2FJLA 2RQ1A 2ELAA 3H6NA 3ZLZA 3A1QA 2JF5A 1EVHA 1G6JA 4GDKA 2XBBC 1V61A 2LYDA 4PYZA 4XC2A 3O96A 4FLHA 5IAAC 3VHTC 1KZGA 4BVUC 2NVUI 3ZNID 2Y8GA 3N7CA 1TGZB 1V86A 4XZ4A 5AZFA 2YS5A 1OTRB 5KQ1A 2GBMA 3UINB 3KYDD 4DX8A 2LUEA 4IM3A 4BFRA 1KI1B 2LBBA 3N3KB 3ZVVA 2A5UA 2RR9A 3QK0A 2YF0A 2L8JA 4URKA 1WGYA 1Z5SB 3ZDTA 3EFUA 3JSVA 1DDWA 1NU2A 1AWEA 2ZCBA 3NY5A 2DX1A 3SNHA 5DH9B 1OQNA 2KZRA 3TFMA 3CMMB 2CQUA 3VIAA 5D3VA 1VD2A 3V61A 3KYCD 4JQWC 1V5PA 1E90A 2OJRA 2MBQA 5LXIB 4KZCA 4GU2A 4LDTD 1I35A 1QQGA 4HCNB 3G9WA 4AOFA 4WJOA 2P0DA 2MQJA 2LVQA 1W1GA 2DLWA 2P0FA 1V9JA 4GGQA 4N9F4 1WGQA 2W9NA 4IWPA 1Q67A 1V6EA 4DWFA 3ZTDA 5CX3A 5D6JB 2MBEA 2JUOA 3KRWA 2RGFA 2Z59B 4HPMB 1V5UA 2KXJA 1XX0A 3PTFC 1Z2MA 4HATB 2O6VD 2V76A 4AJWA 2KO3A 4GMXB 1H4RA 2LJ5A 2N9EB 2PPHA 4W9FA 2KANA 3PHXB 3OAWA 2EMSA 3GYOA 1WGUA 4I6LB 5E6OA 1WJNA 2R09A 3HM3A 3HIZA 4MK0A 5HKHA 2ZPYA 5HE0A 1ZKHA 2DENB 4HDOA 2RGNB 3T06A 1XQQA 3TCAA 1WJ6A 1EO6A 5C6RA 3A9JA 1WX7A 3DVGX 3L17A 1RRPB 4G3XB 5G2NA 2CHZA 5D3YA 4ANXA 4FBJB 2PE6B 3BINA 3DXCA 1WXVA 3VDZA 1V89A 2J0KA 2BWES 1WIAA 1RLFA 1PQSA 3QAQA 2ABDA 3EPYA 2EC1A 3VUXA 4NJ7A 3FM8C 1IP9A 4IW0A 3UQAA 1TZ1A 1Y19B 1F9JA 2KLCA 3ALBA 3AXCA 1VCBA 3DDCB 3JYUA 5FI1A 1QZEA 4ICUA 1WR1A 2JY6A 1OY2A 2I1JA 1UBQA 1ZVRA 4GMVA 1WMHA 5CLLB 2MA9B 2WX1A 4GZUA 1BT0A 2L76A 2Y7BA 1ZC4B 1E8XA 3KW5B 4X57B 4XX5A 1RJ2A 2BF8B 1XD4A 1WI0A 2GBNA 3M63B 4IAPA 2B3AA 4B6WA 4BKTA 5JHHA 2D9ZA 1WRDB 4JLCA 5D7GA 3A98B 3GOEA 2BWFA 4EFOA 4FA6A 2COPA 3CF6E 3OJ3A 5JZEB 2PE9A 2DZIA 1W1HA 2K2JA 1GC6A 4TYZA 2O2VA 3LDZE 4GSWA 4TQ1A 1PLSA 4WAAA 5KHOA 1WYWB 2HTHA 1WZ0A 3BY4B 1WY8A 3VTWA 4BBNF 2NBWB 3SU8X 2V1YA 1XODA 4ZRKA 4CHMA 1YJ1A 2KJ6A 2XK5A 3W1SC 1R4NI 1DYNA 2LXCA 4OVVA 3R7QA 4ANWA 3S2AA 1U5EA 2P0HA 2XQNM 1WX8A 4FADA 1GUAB 4MSMB 2KTFA 3V62A 2KJHB 2NCNA 1FHXA 4HAYB 1U2BA 4II3B 3UF8A 4AWJA 2D10A 2UZRA 2NMBA 2GCLA 2XK5B 3OJ4B 1WXAA 2WWZA 1J19A 2DYQA 1DROA 1DDMA 3B0AA 4JL9A 4BBNC 4DDGD 1WF9A 5CHVC 4MEMA 3KVFB 2DN6A 3KSYA 3SYXA 3X0WA 4GXBA 1FGYA 3ZNZB 3ECIA 2KD0A 5LONB 3UZTA 2MP2B 2ZVOA 3ODXA 2IO3B 3UQBA 3VOQA 5C5BB 1EF1A 5JP4A 3TVVA 4IM0A 3SD5A 3QJZA 2YS3A 2C7NB 2L3ZA 1HE8A 2MSED 3ZUNA 1UNRA 2KMAA 2D11A 3GZNI 2DHIA 2JXXA 3ML4A 3SO6A 2CKHB 2K1FA 2N1VA 3M95A 1B55A 2ROZB 3QWZB 1FGZA 4WJPA 2KLGA 2C7MB 5DCNA 3VVWB 3ZKJC 2DYBA 2FDQA 5DI9B 2DX5B 2G3QB 1YX5B 2LRWA 1TTNA 3L08A 4HLEA 2HTHB 1LXDA 3H7SA 2D9WA 4H8SA 3D8FA 3JSVB 4F7GA 2OQBA 4Z2MB 1U5DA 2MLBA 2KX0A 2NBUA 4MGKE 4RMAA 4RM9A 2PZ1A 3AI5A 2VKIA 2N9PC 1LW3A 3WYFB 2V4LA 4PS3A 4HDQA 3UIOB 1SGHA 2D4QA 2COFA 5G55A 4W9JA 4EZJA 4GB9A 3IG3A 1YX6B 3PRZA 3VUWA 4BBKA 2D9VA 2M17A 2FUHB 4BKSD 3WA0A 1PMSA 1M7EA 4NAWA 1HBKA 4MT7A 1OEYA 2LGDA 2QHOA 2FIDA 2WX0A 4GN1A 1WJUA 2J7QB 3L54A 4NNJB 4TUUA 4W9CA 5LLIA 3UIPB 2EMTA 3SV1A 3A9JB 5AZGA 4F7UP 2KX3A 2PJHA 3RT3B 4F1SA 5KQ4A 3JW0X 3M1IB 4HPLB 2AL3A 4A6KA 3SDLC 2GCJA 1FXTB 1P3QU 2GBKA 3N32A 4DHZB 2MRPA 1UEFA 2K00A 2KFJA 5KHQA 3CIKA 5LOPB 4K17A 2MWSB 4ZRIA 1ZC3B 2AL6A 1WJ1A 3PVLA 2CY5A 3Q3FA 2A4ZA 1MIXA 2L00B 2L0FA 2Z0QA 3WAMA 3H1UA 4EKUA 2IZVB 3U7DA 3RD2A 2REXA 1OMWA 4KSKC 2C5LC 3U8ZA 1KZ7A 2O6VB 4I6NB 5AZHA 1Z87A 1T0YA 5HE2A 1UBIA 2KC1A 4GDKB 2BYVE 3VQIA 1L2NA 2LKOA 1Q1OA 2GMIC 1X05A 1HB6A 1MK9B 2DYNA 2L2IA 3DXDA 2N23A 3KZ1A 2FCSA 2JRHA 2W2XC 4NPNA 4PS7A 3TIXA 2D9XA 4IG7B 3EECA 4JIOU 4HAZB 4KHAA 4OVUA 3V6EB 2X18A 2JZZA 4MM3A 2KN5A 1MAIA 1U5FA 4YL8A 1FAOA 3IBEA 4MGYE 3D8DA 4IOYX 1X11A 4JGHB 1YQBA 2ZEQA 4W9DA 4MH0E 2YS1A 3VH3B 2RVBB 2KTRA 2MKRA 2M8SA 5E6NA 1E8YA 3QHTA 4FHJA 2CY4A 2XEWA 2RSUA 2MP2A 2N7EA 1WE7A 3DCGA 2UYZB 4KDLB 1K5DB 3A9KA 4ANUA 2D07B 4DHJD 3APDA 4K81A 1H10A 3Q3JA 4Y94A 1S3SG 2D3GA 4MGZE 4EUTA 2BGFA 4GPTB 1TBEA 1LB1A 1N3HA 3PVWA 3RZWC 4W9GA 2N0YA 1UELA 3ZTCA 3AULA 3HM6X 4WQOB 4PQ0A 2IYDB 1P3RA 1Q5WB 3FEHA 2DA0A 2M14A 1UGMA 2NPTA 2M1MA 2MDXA 2R0DA 1WM2A 4IC7B 3RULA 4MDKE 4WWPA 2DZMA
chains in the Genus database with same CATH superfamily
3B77A 3KLSX 2J52A 2WHIA 4HXDA 1WRIA 2I38A 2G4SA 2VH1A 4GIVA 2BYFA 1LO5D 5E6JA 4HHVA 1XR0B 5IJMA 3N30A 1I7AA 4MJSA 1MHXA 1SJED 1K51A 3QARA 1MIZB 2V4IB 2YT0A 2DAFA 2DYMA 1JWBD 2V0GA 2JZ3B 4QJ3B 4UDUC 2KDIA 4RM8A 3TJPA 2UVMA 3Q3NC 2RDHA 3DBRI 3HVZA 1KOTA 3ZJVA 3DWMA 1J0WA 1V88A 2IYBA 3BJIA 4G0NB 4EJNA 3MP9A 3T3NA 1E7UA 3NZUA 4P7IA 3RNEC 2HJ8A 3C0RB 4Z2NA 4EOYA 5C5BA 4EE2A 2DX5A 1I4HA 3TEXA 2DKPA 4EZLA 1Q0WB 4ANVA 3IT4B 3P6AA 1K53A 2EKEC 2YEPF 2YT1A 5EE9A 3NVZA 5J17A 1BMLC 2ZNVC 1AYFA 3ZNHB 4L1RA 4B9KA 1WH3A 4WWNA 4W9IA 4DBGA 5L83A 2K8HA 2ZJDA 2Y5BB 4OZAA 1N61A 1WMHB 2LVPA 1BTNA 2WDVB 2G9HD 3DPDA 1FHWA 1KLVA 1YIWA 4AQ7A 4HVBA 2P8VA 3V6CB 1XT9B 1WYGA 3P42A 4LJPB 3NG0A 5D2MB 5C79A 1UUPA 4HAVB 3DWGC 3URYA 2Z4DA 5DPRA 1V5TA 3M62B 4HB4B 4A6HA 5HHDG 2NZ8B 4QJ5B 2I5CA 2IDYA 2JP2A 4MY6A 2FJUB 2CAYA 4BKGA 4JKGB 5G5HA 4CYEA 4FN2A 1UD7A 2IY0B 1WVHA 5HG2A 1VZ7A 2KDFB 2LRUA 3TW1A 2DIKA 3PSCA 2LGXA 5EDSA 2DKQA 2JVCA 3PT2B 2JYTA 4KV2A 3PLUA 2DBYA 2Y8FA 3KRXA 2J0MA 2N4FA 1NYQA 1OQYA 4E71A 3RMKC 4EMOA 2K39A 3KUDB 3LXFA 1M94A 5J2RA 5IN7A 2BQQA 1IPGA 2UZSA 4OZCA 2Z0OA 1J7BA 3LJUX 1MK7B 3P4RB 2DZKA 2V3SA 3H7PA 1M7RA 5D27A 1V49A 3FSSA 3B1LX 4TSSA 2BYEA 4WJNA 3ZNGC 3NW8A 1DYQA 3PG7A 4BOZB 1E9MA 2O2VB 3DVGY 2C60A 3RFZB 2Z0DB 1V5MA 2QILA 1QOGA 1D6EC 4KAXB 1CZPA 3A33B 1ESFA 2ADZA 1EWYC 3ENEA 4JK9A 3CSTA 4WWMA 5DHAB 1F1HA 1YJJA 3KUZA 5EFXA 3VFKA 3WALA 2KK8A 3TMPB 4EEWA 4P1BC 3PHWB 5J3QA 2JRIB 2KFKA 3BVGA 3VTUA 2R61A 1MJDA 4A55A 3VR9B 3ULCA 2KIEA 3NSUA 1OQRA 1XF5L 1X1GA 1KF6B 1K5GB 4NQKE 4PS7A 2G4DB 2KWVB 1KLUD 1NVLA 2E6XA 2JPHA 3AJ4A 4M00A 2K2UA 4YT0B 3J9CA 3K9OB 1AARA 2RUKB 3L16A 1JRPA 1IYFA 4ZRJA 1AN8A 2HRJA 4P1CC 1FFVA 1GNUA 2JWZA 1ZGUB 1UPQA 2N1WA 4ZYSA 2OEDA 3QCAA 2LHEA 5LXHA 1QKZA 4J3OD 4KSLC 3HVDA 4LDTB 4ZRQA 4ARCA 3SFDB 1CJEA 1QOAA 3MDBC 5GMVA 5I2MA 4YSXB 2IO2B 1XD3B 4K7WA 3B2FA 3LJ3A 1ZW7A 2COAA 5CTRC 1QC6A 2RNRB 1P0RA 2GB1A 5LNK1 3DBSA 2RQ1A 2KYWA 1G6JA 1NEKB 1KZGA 4BVUC 2NVUI 1FNVA 4KHBA 2Y8GA 2LGSA 3KYDD 1KI1B 4YWGG 3E9PA 1WGYA 1ZE3D 1DDWA 2DX1A 3SNHA 5DH9B 3TFMA 4LNFA 3MC0B 1VD2A 4KZCA 1E6EB 1FIQA 2MQJA 1FCCC 1Q67A 1V6EA 1JDEA 5E6PA 5AZHA 3AM9A 1D4BA 1V5UA 3DHHC 5EE3A 2O6VD 1MFWA 4QAYA 2JU6X 3Q3MC 3GYOA 4XE0A 1QT9A 2BB5A 3HM3A 3HIZA 4HDOA 3TCAA 2INPE 4WAFA 3L17A 4FBJB 4XDDA 3BINA 1WXVA 3VDZA 3PZ7A 2BWES 1WIAA 3VUXA 2WXKA 1TZ1A 3DDCB 1KH0A 3O13A 2PW9A 1QZEA 1OY2A 3DHGC 2MA9B 1ZVRA 4GMVA 1TKEA 5CLLB 4GZUA 2Y7BA 1ZC4B 1E8XA 1NI3A 1WI0A 4B6WA 3ENBA 1KRHA 3VRBB 2COPA 1SE4A 2DZIA 3LDZE 4RGMA 4WAAA 3NJTA 5KHOA 1I4PA 4BBNF 1E10A 3PO0A 2KJ6A 3W1SC 1HA5A 4NZLB 4MSMB 5JVLA 2KTFA 4MM3B 3UF8A 3OHMB 2NMBA 3Q3OC 2WXGA 1EM7A 4A90A 2MEKA 4GXBA 3AEEB 3ZNZB 3ECIA 1L0YB 2MP2B 2WDQB 3ODXA 5C5BB 4IM0A 3SD5A 5H92C 1HE8A 3AE2B 2JXXA 2K1FA 2N1VA 3M95A 3AE8B 3QWZB 1FGZA 5DCNA 3I63C 2LRWA 4RF1A 3H7SA 1F77A 4F7GA 2OQBA 4Z2MB 1L4DB 3SR6A 3AI5A 2VKIA 4XWWA 5BYSA 2COFA 3Q8CA 3VUWA 1VJKA 4BKSD 4YTPB 1M7EA 2BS4B 2W82A 1HBKA 2QHOA 1OEYA 1XCQL 3EFUA 3A58A 4TUUA 5LLIA 2EMTA 1C9FA 5AZGA 4A6KA 5G5GA 1P3QU 4DHZB 2KFJA 2QIEB 1VDVA 2A4ZA 1MIXA 2Z0QA 1HTOA 5IKCM 2X0SA 4EKUA 2FBWB 1FEHA 1HQRD 2REXA 1Z87A 1T0YA 4GDKB 1N5XA 2BYVE 2JX5A 2L2IA 3DXDA 4NPNA 3RNFC 4FXCA 4B0EA 3EECA 5I4DA 2X18A 4MM3A 1MAIA 1U5FA 1FAOA 4JKCA 2MJ3A 3IBEA 1ZP0B 4LTUA 2QC8A 4W9DA 3MC8A 4GNKB 4MH0E 2YS1A 2RVBB 3U4EG 2M8SA 4FHJA 2WDRB 2CY4A 2XEWA 2N7EA 2UYZB 4HPPA 3SFEB 4DHJD 3U12A 1YN5A 1EU4A 1S3SG 3P4PB 2BGFA 4GPTB 1TBEA 2YT2A 4W9GA 4HROA 2E3TA 3RULA 2R0DA 4IC7B 4MDKE 2J0JA 1WR6E 5JHAA 1R4MB 1ZSQA 4ITKA 1GGOA 4HJKA 3QX1A 4TV3A 4B6HA 1L0XB 4G50A 1UH6A 3WCQA 1FNUA 1JWSD 3KY9A 3BK1A 1N63A 1X1FA 5CHFA 4NAWB 3IFWB 4K7UA 3W5UB 1J7CA 2QCZA 2SEBD 3DXEA 3ML9A 2KNBA 2PEAA 1WXQA 3VAWA 3A9KB 2YSZA 3FKYA 2YEPB 2ZVNA 2KQ7A 2MJDA 2WDTB 4WSFA 2AEHA 4W9HA 4HWIB 4IUMB 3P1MA 3W1SA 1TKYA 2GJYA 3ZJTA 4FJZA 4HJGE 4C7ZA 3QA8A 3AN1A 1JWMD 4S0RA 1FMAD 4WIPA 3ZDMC 4NJ6A 4KGTA 1RRBA 3EGRA 1BXTA 1MKEA 2JSVX 2Y5PA 2ZW1A 2BS3B 4ZRPA 2KTRB 2L1AA 3CXBB 4W9LA 2RSGA 1U27A 1TS4A 5D3XA 4A6FA 1TJEA 2LEKA 3B08A 4ZDVA 3MPXA 2MFQA 1XLQA 2D9YA 2KQSA 4IWQA 3BVMA 4PT5A 1MI0A 3PRMB 1HXYD 1UNSA 1SE2A 2G35A 3ZRCA 1XKEA 2ZZPB 4L6EA 1GC7A 1RAXA 4NSWA 3ZO5B 1N60A 1V81A 3FILB 1I42A 1MPHA 2K49A 1WXMA 3AU4A 3HUIA 3VTVA 4GOUA 4USAA 5BO4B 3M3JA 1I4QA 2CJNA 3WAPA 2M0AA 1E8ZA 3F0WA 4HAUB 2FAZA 5DHFB 1YJIA 3CSFA 2ELBA 1FRDA 1A5RA 2RPQA 2BKRB 1ZXHA 3FLVA 4KIKA 1C4CA 3FC4A 2L05A 3NWAA 2QKLA 1ZOYB 3MHSD 1UGJA 3F5RA 3VXWA 4A3PA 2KFKB 2L7RA 3E66A 1NI2A 2INNE 1UNPA 4J6IA 1YNTE 5JLJB 2E2XA 1YN4A 4KHOA 4XGAB 1GOZA 3ZRFA 3AEAB 2CJOA 5FR6A 2L83A 3AB5A 1Q10A 3I5JC 1ST7A 1X1MA 4ARIA 1TXDA 2Y5CA 4YSZB 4L1BA 4DDID 4TMAB 2EELA 1TQZA 1EGXA 5FI0A 2K25A 2N0SB 4I6PA 2FJ9A 3K9PB 1L5PA 1D5ZC 1DOYA 1LQBA 4F8CB 1X86A 1DDVA 3L0WB 4F7HA 3PRPB 5IOIA 2KR0A 3ZYYX 1RM6C 2QKMA 4ZOHC 2EJ8A 4FULA 1DOXA 1KFYB 1STEA 4DX90 2LZ6A 3FP5A 1EWCA 4AJYB 1EF5A 2W2WA 1SE3A 3R8BA 1WZ3A 1P5TA 2EKIA 3R3MA 3ULBA 1E7PB 3N9YC 2K8EA 1C3TA 1K50A 2DHJA 1U29A 5KCVA 3GB1A 5HI1A 2VZKD 3EFCA 2LOXA 1R7SA 1WX9A 1WG7A 3DBLI 3E9LA 4P6VF 4YTMB 2MJEA 3NOBA 3A1QB 1LM8B 3N1ZC 2MH7A 3RUIB 4JX1C 2FCNA 3ML8A 3ZXVA 2IO0B 1GG3A 2NPTB 3PV1A 1MG8A 1UWMA 2W2XD 1DBHA 3HRDD 1UZXB 4BAXA 3KUCB 1V80A 1XLPA 2H7EA 4L23A 3L13A 4F7ZA 1XCGA 2KUQA 3OLMD 1NTYA 4BZAA 4XYCA 2FCMA 4WJ7A 1OGWA 4NQLB 2VSZA 3RYTA 3WIMA 1WGGA 3NS8A 2KDBA 1VZ8A 2PVOD 1VBGA 1HZ5A 3DBHI 1SIFA 4HAXB 1BAKA 1I7HA 1CMXB 3V60A 2FJLA 4PK1A 3H6NA 2ELAA 4KGSA 1V61A 5MPOA 4PYZA 3VHTC 1TY2A 2H88B 4XZ4A 1OTRB 5KQ1A 2KAJA 2LBBA 1Z5SB 3ZDTA 2ON8A 2CQUA 4JK7A 1V5PA 1E90A 1I4XA 1JCKB 5LXIB 3AE1B 4GU2A 1GB1A 1I35A 2ICIA 3G9WA 4AOFA 3I9V1 4IDIA 2P0DA 3RPFC 4HKZE 3AE5B 4RCOA 2HDEA 5CX3A 2MBEA 2Z59B 2RGFA 4NJCA 1XX0A 1Z2MA 4HATB 2RDBC 2V76A 4AJWA 2B76B 2N9EB 1C79A 3PHXB 5EE0A 3LB8C 1C78A 1PYWD 3T06A 4JKDA 1XQQA 1WJ6A 5C6RA 4US9A 5G2NA 4ANXA 1V89A 4C56C 1RLFA 2K22A 2ABDA 2EC1A 1P7EA 3FVCA 3FM8C 3ALBA 3JYUA 1PFDA 1WR1A 2I1JA 1BT0A 1LGRA 3AEDB 1I4RA 3M63B 2BF8B 1XD4A 4K3CA 2B3AA 5JHHA 1GB4A 1WRDB 3A98B 3GOEA 3OJ3A 2M19A 1D3ZA 1GC6A 1K52A 2IGGA 1PLSA 4H2AA 1OQQA 1WYWB 1YN3A 5C2TB 3BZDB 5EE1A 1WY8A 2NBWB 2V1YA 1YJ1A 4ZRKA 1JWAD 2XK5A 2JXTA 1DYNA 4ILHA 3R7QA 1U5EA 2XQNM 1FFUA 1WX8A 4FADA 3V62A 2NCNA 2WXNA 1U2BA 3IT6B 2N7JA 2PTLA 2IPKD 2M56B 3OJ4B 1WXAA 1NVID 2DYQA 2QEJC 2JYEA 2WS3B 3HIEA 1WF9A 3N20C 2PIAA 1ET6A 1TS5A 1FGYA 1XCTL 1V97A 5LONB 3UZTA 1EF1A 2NTTA 4MH8A 4CQNA 2YS3A 2L3ZA 1BUIC 2KMAA 2D11A 4DXFA 4WJPA 2KLGA 3VVWB 2ONQA 5DI9B 1YX5B 3L08A 4LNKA 2KDMA 4HLEA 2KVZA 2D9WA 3D8FA 1T0QC 4RM9A 1L4ZB 4MGKE 3RNBC 1IUEA 2Z59A 2PZ1A 2WNMA 3V05A 4PS3A 3ZXRA 2DNFA 4GB9A 3IG3A 3PRZA 2M17A 3NVWA 2FUHB 1WSPA 1PMSA 2KN4A 4NAWA 2WX0A 2LGDA 3L54A 2J7QB 4DHZE 4F7UP 2PJHA 1FCLA 3SDLC 2GCJA 1FXTB 1DIKA 3N32A 3AEGB 1KTKA 1UEFA 2K00A 3CIKA 5LOPB 2MWSB 4L2YA 1WJ1A 4ZHPA 2X38A 3R2TA 2L00B 2L0FA 3WAMA 4DXGA 2IZVB 4K3BA 1OMWA 2O6VB 1GPXA 4N6EB 5AUKA 4JKHA 3TUOA 2JRHA 2DYNA 1FO4A 2N23A 3KZ1A 1NENB 4M02A 2QSDA 2D9XA 4JIOU 4KHAA 3N1YC 2CU3A 1YOVB 1J7AA 1N6ZA 1XLOA 4MACA 5C3JB 4JGHB 1JROA 2KTRA 2WP9B 2RSUA 5TSSA 1WE7A 4ANUA 2D07B 2WXQA 1VZ6A 4EUTA 4MGZE 5FKAC 4C4VA 2N0YA 4WQOB 5BMGA 3E56A 1Q5WB 4WWPA 3ONSA 3R7RA 4CHJA 4WVFB 2OTXA 2FE8A 1FOEA 3N1XC 1RWSA 4HB0B 3GYPA 2W3RA 2YRYA 2DTCA 2DYOA 4G11A 3AECB 1TS3A 2KVRA 2ZNVB 2MBHA 4KDIC 2VRRB 2KDEB 2KKCA 3NRZA 1TKGA 3Q2AC 1TIFA 1IGDA 4WWOA 1TYGB 2ZPNA 3V3XA 2H7DA 1QQRA 1WGDA 1WFYA 2K8BA 3NWFA 4REZA 4JKAA 1PFJA 1SB3C 4K1RB 5T8IA 1FB8A 3Q8AA 2CB8A 2AQ1B 3TSSA 2HJ1A 5GOWB 1MG4A 4ZYNA 4ACFA 2MX2A 2WU5B 2N9XA 3H7PB 4TKNA 5D3IB 1T77A 2DZJA 2KC2A 2IY1B 2M0XA 5CHWA 3VH4B 4A9AA 2FCQA 2GBJA 1WJ4A 4A6FB 4YSYB 2LHDA 2IBIB 5DPTA 1F2RC 2FNJB 3ODWA 2COCA 1J0GA 4K2OA 3ZVRA 3TEYA 4IM2A 1A70A 1MHHE 4M8MA 1OFFA 2NR2A 1WJMA 4DQOC 2K6QA 2WXJA 4FHKA 2AWTA 2TSSA 2Z0PA 2OJWA 1MVKA 3RN9C 3ZIMA 1AQCA 5JH5C 1V1OA 4E74A 4KZ0A 3APCA 1WM3A 2CODA 3DHIC 1P9DU 4JK8A 1V5OA 1VLBA 3W5VB 3EHVA 1Y5OA 5BMHA 3B9JA 3EUB2 3RNCC 1PGAA 3TO1A 3A8PA 4ASWC 4C0AA 4HKQA 5J3TA 2KWUB 2CU1A 5JHBA 1E7VA 2K6DB 2CHWA 2J53A 2D3AA 4GDLA 2UWQA 2BBCA 4LJOB 2WXLA 1SIJA 3L10B 4D2KA 1YQ4B 2MCNB 2O6VA 5FR3A 3H9DA 4W9KA 4YONA 3NWDA 3R66C 3FAHA 2LD9A 3A8QA 4FJYA 4HK2A 1KC7A 3DBLB 1N62A 2KGXB 1KJTA 3P2BA 3D8EA 2CS4A 2RMMA 2HE7A 3AE3B 4N59A 5IO9A 4KVGB 3APFA 1P98A 3FILA 2IO1B 4DIXA 1IRSA 4HB2B 5IA7A 1SHCA 3RNAC 2BB6A 3TIXA 1MPEA 2MBOA 1ZM0A 2DHZA 4IWOA 1ISNA 2KWDA 2AQ3B 2KHWB 4D6WA 3GE8C 3NUHB 1L7YA 1FXAA 3DBHB 2LXAA 1GJZA 5CLQB 4M0WB 4A8XC 4KIKB 1K8RB 4M8NA 1BWNA 4MJSB 1NBFC 3PZDA 5H8YE 3PREA 4CHKA 1WI1A 5J3YA 3PP2A 2MHJA 1FHOA 2V3NA 2MWNB 2LWPA 2QJLA 3AU5A 1B1ZA 2GI9A 3JVZX 2KACA 2KIGA 4DXAB 3GS2A 2YVCA 2HD5B 1HB8A 2VRWB 1I4GA 5BYRA 4C4VB 2Z0EB 1EAZA 1IBXA 3V5WA 2AYOB 3PSEB 3RCPA 2DHKA 4LLGM 4A20A 5TR5A 2W54A 1AWDA 2ZCCA 1NTVA 2LVOA 3IXSA 4MGIE 1WGHA 3EC8A 2GS0A 1FPYA 4BKSA 1ACCA 2FIFA 5D3DA 1ACAA 1ZDXA 2OHFA 4KGRA 2NS5A 2JT4B 2JZPA 4HRSA 3AE7B 1BTKA 2KCJA 1XEEA 1NDDA 4JKGA 4C00A 3P7ZA 1LFDA 3T9LA 2L1CA 2LI5A 3AE6B 4KHBB 1ZPSA 3U30A 4QJ4B 2H89B 3PGEA 1J8CA 2ACZB 1HZ6A 1Y8RC 3A1QA 2JF5A 4GDKA 3HSAA 2XBBC 4FLHA 5JXVA 2LFIA 1TGZB 1V86A 3SEBA 3UINB 1JQ4A 1PGBA 2GBMA 4DX8A 4IM3A 3N3KB 4YTNB 2RR9A 3QK0A 2L8JA 1NU2A 2ZCBA 2W55A 3NY5A 1T6BX 2KZRA 3CMMB 3LYYA 5D3VA 4JQWC 2BTEA 1XXGA 2K3UA 1QQGA 4HCNB 4WJOA 3TEZA 2L52A 1W1GA 2P0FA 2W9NA 3BK2A 4DWFA 4C7YA 4XDCA 2ZKMX 2KXJA 2RRFA 1H4RA 1B9RA 2PPHA 1JMLA 4HEA1 3OAWA 4I6LB 5E6OA 1WGUA 1FD6A 5HKHA 4JWSC 3A9JA 4G3XB 1WX7A 3DVGX 3ABVB 4ILGB 2PE6B 2J0KA 5L95C 2D5GA 1IP9A 3UQAA 2UU7A 2KLCA 3AXCA 4RFBA 3ZQ4A 1VCBA 5FI1A 4ICUA 1RYJA 2JY6A 3Q8FA 1UBQA 2NTSA 4XX5A 2VZKB 3AEBB 3AH7A 2WGSA 1RJ2A 1PUTA 4BKTA 4IAPA 1UF0A 3BWUD 5BYQA 4EFOA 3CF6E 5JZEB 2IJ0A 2O2VA 4GSWA 4TQ1A 3BY4B 2HTHA 3E9OA 1WZ0A 4N58A 3VTWA 3U2SC 1VBHA 4RH6A 1XODA 4CHMA 2LXCA 4ANWA 2P0HA 1PDXA 2KJHB 1FHXA 3ZGZA 1J19A 1DDMA 4DDGD 4JL9A 4BBNC 5CHVC 4WH4A 3KVFB 2DN6A 3KSYA 2LMCA 3X0WA 2ZW0A 2IO3B 3UQBA 3VOQA 3P4QB 4A6QA 2HTME 2R82A 3MJ5A 3W2DA 2C7NB 4RF0A 2R2YA 3GZNI 2D3CA 3ML4A 3SO6A 2IGDA 2L32A 3ZKJC 2FDQA 1TS2A 2DX5B 2G3QB 1TTNA 2GUMA 1LXDA 4IOIE 4H8SA 3JSVB 2MLBA 1H8CA 1U5DA 2AQ2B 3SBTA 2KX0A 4RMAA 1LW3A 3UIOB 1V1PA 5G55A 4W9JA 2WU2B 1YX6B 1T0SC 2JQRB 1FRRA 2GLSA 4MT7A 4GN1A 5LG4B 1WJUA 3P4SB 3GE3C 3W1YA 3SV1A 3A9JB 3RT3B 4F1SA 4JKBA 5KQ4A 2J42A 3M1IB 4GLSC 4M01A 1QILA 1ROEA 2GBKA 1IGCA 1T0RC 4K17A 1ZC3B 4MT5A 2AL6A 2CY5A 1ZUD2 2WQYB 4LNNA 2WXIA 3U7DA 4KSKC 4I6NB 2KC1A 2GMIC 1X05A 1HB6A 1HTQA 1DOIA 2WLBA 3V6EB 4HAZB 5M4YB 1ZDVA 1DGJA 4S17A 4MGYE 4OHJA 4RGTA 2ZEQA 2W3SA 5E6NA 4QXAB 3QHTA 3I57A 3DCGA 4KDLB 1K5DB 3A9KA 4K81A 4Y94A 2Z8LA 1VRAB 1F0ZA 1LB1A 1N3HA 1UELA 3AULA 3HM6X 1P3RA 2M1MA 1WM2A 1JALA 2DZMA 4XWXA 1YD8U 3HW2B 3OG5A 3QC8B 1XLNA 3Q14C 3VRAB 3BYTB 4KKJA 1GAQB 1YQ3B 3C19A 2INDC 1T3QA 4NY0A 4RGOS 4B95A 3NS1A 2BYTA 2CRFA 4WURA 3NHEB 3QIJA 2NBVB 3GZNB 4A3OA 2BT6A 2GBRA 4GDLB 4MSQB 3HK0A 3IVFA 3OANA 3PEGA 3IAS1 3QBVB 4JE3B 2KJRA 3WANA 4A5KA 1SSNA 1P6SA 4AP4C 4DK5A 2XNAC 4W9EA 3U7ZA 2BCJA 1NTIA 4HSIA 4HCPB 2RDGA 3NVVA 2V9HA 4PNKA 4HAWB 2LGYA 3TBLD 3NZSA 2LG1A 1F52A 4PYUA 5HE1A 1E8WA 4OVZA 2PVGC 4RNAA 4BOSC 2YLMA 4JKEA 1WE6A 3DQVA 5DIFB 2IFSA 2WH5A 1WWTA 2KUPA 5HE3A 4HB3B 2CR5A 3ODOA 1VR9A 1SJHD 4ILJA 3HHMA 3X23A 3O65B 1UNQA 2BPSA 2CHXA 2LASA 3P63A 1ENFA 3Q8BA 1V2YA 1KBLA 2PLPA 4Q2JA 1ZYIA 3ETRA 5IRSA 4O1NA 3QQ8B 2N9KA 1F2RI 2M4NA 2DWQA 3TL5A 1UPRA 3MFGA 2RLOA 3RCZA 2MW5A 4JPSA 3VUYA 4ICVA 3U52E 2N7DA 3MJWA 4EZKA 4K2PA 1E5WA 2DFKA 3Q8EA 1HEZE 3UGBB 2K0PA 2BKFA 3I3TB 2FUG1 2KOXA 2KMMA 4AUQC 3DOWA 4JKFA 3IHPC 2BW2A 3PLVA 4D0NB 3GP7A 1ZXIA 1SE9A 2QDFA 1QOFA 4PS8A 2NMQA 1U4AA 4WJQA 1L6UA 5AEKB 3W9CB 2WYQA 1KM7A 3KQ4A 3Q69A 1R4MI 1L6VA 1U5GA 2GRIA 2WXOA 1QOBA 1W1DA 3A4SC 2R2QA 1WGKA 1SBBB 3VR8B 4GOCA 4OT1A 1D5XC 2C9WB 1PGXA 1EUVB 3MTNB 5D94A 1AW7A 2Q13A 3ZW3A 1D5MC 3AE9B 4FJVB 5HFYA 1FNWA 5L81A 3DVNU 1FM0D 4LNOA 5KHQA 2ROVA 5JHGA 1WXSA 3T8MA 2I1KA 2J59M 3D32A 1FXIA 1TJ6A 5C23A 3SHQA 1SXTA 1P1AA 2KWCA 2G1EA 1QF6A 3RZFA 4TQ0A 3T3OA 2WXFA 5DPSA 4OW0A 3WAOA 1RFAA 3PS6A 5J18A 4YXDB 1KLGD 1EU3A 4JWUC 5BMIA 2PKOA 2NBVA 4LCDE 4II2B 4IKGA 5DPWA 3OWEB 1RFKA 5I2SA 2LULA 3KH0A 2G45B 3C8YA 2M38A 4MELA 3RNGC 1I2HA 3B2GA 2INCC 5GXGB 5C1ZA 1S1QB 2XN9C 2GOWA 3PPAA 2AX5A 2ASQA 2OOBB 4K7SA 2D2QA 4CO7A 2RD0A 3CIRB 3SUZA 3HQCA 1TT5B 2L0TA 4IG7B 4E3CA 2DAJA 4C80A 4DBBA 1JRUA 4DHJB 3EA6A 3A4RA 2I2YA 1CQVA 4OZBA 3QWMA 1R4NB 2R2OA 2J4XA 1TZOA 4IFSA 2C7HA 3PZ8A 5C16A 2MBBB 2WXMA 3DVNV 1C1YB 2N9LA 1V1PB 2I5FA 4OSNA 2K8CA 2LOZA 5D3WA 2PMVA 1WGRA 1CK1A 3PVUA 1OEYJ 2KMCA 1QLBB 3ZLZA 2Y3AA 1EVHA 2LYDA 4XC2A 5IAAC 3O96A 4B0MA 3N7CA 5AZFA 2YS5A 4BFRA 2LUEA 4RGNA 3ZVVA 5FK9C 2A5UA 2YF0A 2KQ4X 4URKA 3JSVA 5IP4D 2KT7A 1AWEA 1P7FA 2LGIA 1L0VB 1OQNA 3VIAA 3V61A 2X8XX 2WXRA 3KYCD 2OJRA 2MBQA 4LDTD 1Y56A 2LVQA 2DLWA 1V9JA 4GGQA 4N9F4 3UI3A 4ZHOA 1WGQA 2V3PA 4IWPA 3ZTDA 2QMTA 5D6JB 2LUMA 2JUOA 3KRWA 4HPMB 3PTFC 1SEBD 2KO3A 4GMXB 2WXPA 2LJ5A 3KWVA 3MC9A 4W9FA 2KANA 2EMSA 3SBGA 1ET9A 1WJNA 2SAKA 2R09A 4MK0A 1JWUD 2ZPYA 5HE0A 3CWIA 1ZKHA 2DENB 3AMZA 2RGNB 1EO6A 1RRPB 2CHZA 5D3YA 3DXCA 2K9XA 1SF0A 1PQSA 3QAQA 3EPYA 4NJ7A 4IW0A 1Y19B 1F9JA 1XO3A 2BVCA 1E0ZA 1WMHA 2WX1A 2L76A 3KW5B 4X57B 2GBNA 2D9ZA 4JLCA 5D7GA 2BWFA 4P16A 4FA6A 2PE9A 1W1HA 2K2JA 4TYZA 3SU8X 2Z13A 3Q6BA 1R4NI 4OVVA 3S2AA 4NAMA 1C76A 1GUAB 4HAYB 4II3B 5AUIA 2K5PA 4AWJA 2D10A 2UZRA 2GCLA 2XK5B 3AEFB 1YMHE 2WWZA 1DROA 3B0AA 4MEMA 3SYXA 2Z14A 1NYRA 1M4VA 1C4AA 1UWXA 2KD0A 2ZVOA 3BIID 5JP4A 3TVVA 2JWUA 3QJZA 2RPVA 2MSED 3ZUNA 1UNRA 2DHIA 1N5WA 3NZ3A 2CKHB 2IGHA 1B55A 2ROZB 1MI1A 2C7MB 3TEWA 2DYBA 2HTHB 2LJIA 2NBUA 1T5XD 3E9SA 3ZJUA 2N9PC 3WYFB 2V4LA 3DBRB 4HDQA 4LNIA 1SGHA 2D4QA 1C4PA 4EZJA 1JW9D 3L4PA 4BBKA 2D9VA 3WA0A 4NNJB 2FIDA 3ZNID 4WQMA 3UIPB 4M0WA 4W9CA 3H8HA 4US8A 2KX3A 3R2IA 3JW0X 4HPLB 2AL3A 2BS2B 2MRPA 4ZRIA 3PVLA 3Q3FA 2DLBA 4AS1A 3H1UA 3RD2A 2C5LC 3U8ZA 1KZ7A 2D3BA 1UBIA 5HE2A 3VQIA 1L2NA 2LKOA 1Q1OA 1MK9B 2FCSA 2W2XC 3BVZA 4XWTA 3RI7C 4OVUA 2JZZA 3BYYB 2KN5A 3NVYA 4YL8A 4KX6B 3D8DA 1IBXB 4KKIA 4IOYX 1X11A 3VH3B 1YQBA 2MKRA 1V8CA 3KWLA 4CSQA 1E8YA 3AV8A 2MP2A 4R3DA 3APDA 1H10A 3Q3JA 2D3GA 3MHZA 3AE4B 3IAM1 3PVWA 3RZWC 1TY0A 3ZTCA 4PQ0A 4LK0M 2IYDB 3FEHA 2DA0A 2M14A 1UGMA 3DCXA 2NPTA 1C77A 2MDXA 2WXHA 2VH2A 2Q5WD
chains in the Genus database with same CATH topology
4HXDA 2G4SA 4GIVA 2BYFA 4HHVA 1XR0B 5IJMA 3N30A 1I7AA 4MJSA 3QARA 1MIZB 2YT0A 2DAFA 2DYMA 2JZ3B 2KDIA 4RM8A 3TJPA 2UVMA 3DBRI 1KOTA 1J0WA 1V88A 2IYBA 3BJIA 4G0NB 4EJNA 1E7UA 3NZUA 4P7IA 2HJ8A 3C0RB 4Z2NA 4EOYA 5C5BA 2DX5A 2DKPA 4EZLA 1Q0WB 4ANVA 3P6AA 2EKEC 2YT1A 5J17A 2ZNVC 3ZNHB 4B9KA 1WH3A 4WWNA 4W9IA 4DBGA 5L83A 2K8HA 2ZJDA 2Y5BB 1WMHB 2LVPA 1BTNA 3DPDA 1FHWA 1KLVA 1YIWA 4HVBA 2P8VA 3V6CB 1XT9B 4LJPB 5D2MB 5C79A 4HAVB 5DPRA 1V5TA 3M62B 4HB4B 4A6HA 2NZ8B 2I5CA 2JP2A 4MY6A 2CAYA 4BKGA 4JKGB 4CYEA 4FN2A 1UD7A 2IY0B 1WVHA 2KDFB 2LRUA 3TW1A 2DIKA 3PSCA 2LGXA 5EDSA 2DKQA 2JVCA 3PT2B 4KV2A 3PLUA 2Y8FA 3KRXA 2J0MA 2N4FA 1OQYA 4E71A 4EMOA 2K39A 3KUDB 1M94A 5J2RA 1IPGA 2UZSA 2Z0OA 3LJUX 1MK7B 2DZKA 2V3SA 3H7PA 1M7RA 5D27A 1V49A 3FSSA 3B1LX 2BYEA 4WJNA 3ZNGC 3PG7A 4BOZB 2O2VB 3DVGY 2C60A 2Z0DB 1V5MA 4KAXB 3A33B 2ADZA 3ENEA 4JK9A 3CSTA 5DHAB 3KUZA 5EFXA 3VFKA 3WALA 2KK8A 3TMPB 4EEWA 3PHWB 5J3QA 2JRIB 2KFKA 3VTUA 3ULCA 3NSUA 1X1GA 4NQKE 1K5GB 4PS7A 2G4DB 2KWVB 1NVLA 2JPHA 3AJ4A 2K2UA 3K9OB 1AARA 2RUKB 3L16A 1IYFA 4ZRJA 2HRJA 1GNUA 2JWZA 1ZGUB 1UPQA 2N1WA 3QCAA 5LXHA 4KSLC 4LDTB 3MDBC 5GMVA 2IO2B 1XD3B 4K7WA 3LJ3A 1ZW7A 2COAA 5CTRC 1QC6A 2RNRB 1P0RA 3DBSA 2RQ1A 1G6JA 1KZGA 4BVUC 2NVUI 2Y8GA 3KYDD 1KI1B 3E9PA 1WGYA 1DDWA 2DX1A 3SNHA 5DH9B 3TFMA 1VD2A 4KZCA 2MQJA 1Q67A 1V6EA 1JDEA 5E6PA 5AZHA 1V5UA 2O6VD 3GYOA 3HM3A 3HIZA 4HDOA 3TCAA 3L17A 4FBJB 3BINA 1WXVA 3VDZA 2BWES 1WIAA 3VUXA 1TZ1A 3DDCB 1QZEA 1OY2A 2MA9B 1ZVRA 4GMVA 5CLLB 4GZUA 2Y7BA 1ZC4B 1E8XA 1WI0A 4B6WA 3ENBA 2COPA 2DZIA 3LDZE 4WAAA 5KHOA 4BBNF 2KJ6A 3W1SC 4MSMB 5JVLA 2KTFA 3UF8A 2NMBA 4GXBA 3ZNZB 3ECIA 2MP2B 3ODXA 5C5BB 4IM0A 3SD5A 1HE8A 2JXXA 2K1FA 2N1VA 3M95A 3QWZB 1FGZA 5DCNA 2LRWA 3H7SA 4F7GA 2OQBA 4Z2MB 3AI5A 2VKIA 2COFA 3VUWA 4BKSD 1M7EA 3EFUA 1HBKA 1OEYA 2QHOA 4TUUA 5LLIA 2EMTA 5AZGA 4A6KA 1P3QU 4DHZB 2KFJA 2A4ZA 1MIXA 2Z0QA 2X0SA 4EKUA 2REXA 1Z87A 1T0YA 4GDKB 2BYVE 2L2IA 3DXDA 4NPNA 3EECA 2X18A 4MM3A 1MAIA 1U5FA 1FAOA 4JKCA 3IBEA 4W9DA 4MH0E 2YS1A 2RVBB 2M8SA 4FHJA 2CY4A 2XEWA 2N7EA 2UYZB 4DHJD 1S3SG 2BGFA 4GPTB 1TBEA 4W9GA 3RULA 2R0DA 4IC7B 4MDKE 2J0JA 1WR6E 5JHAA 1ZSQA 1GGOA 4HJKA 3QX1A 4TV3A 4B6HA 4G50A 1UH6A 3KY9A 1X1FA 5CHFA 4NAWB 3IFWB 4K7UA 3DXEA 3ML9A 2KNBA 2PEAA 3VAWA 3A9KB 2YSZA 2ZVNA 2KQ7A 2WDTB 4WSFA 2AEHA 4W9HA 4HWIB 4IUMB 3W1SA 2GJYA 4FJZA 3QA8A 3ZDMC 4NJ6A 1RRBA 1MKEA 2KTRB 3CXBB 4W9LA 2RSGA 1U27A 5D3XA 4A6FA 3B08A 4ZDVA 3MPXA 2MFQA 2D9YA 2KQSA 4IWQA 3PRMB 2G35A 3ZRCA 1XKEA 2ZZPB 4L6EA 1GC7A 1RAXA 4NSWA 3ZO5B 1V81A 1I42A 1MPHA 1WXMA 3AU4A 3VTVA 5BO4B 3M3JA 3WAPA 1E8ZA 3F0WA 4HAUB 2FAZA 5DHFB 3CSFA 2ELBA 1A5RA 2RPQA 2BKRB 3FLVA 4KIKA 2L05A 2QKLA 3MHSD 3F5RA 3VXWA 4A3PA 2KFKB 2L7RA 3E66A 1NI2A 1UNPA 4J6IA 5JLJB 2E2XA 4KHOA 3ZRFA 5FR6A 1ST7A 1X1MA 1TXDA 4DDID 1TQZA 1EGXA 5FI0A 2K25A 4I6PA 2FJ9A 3K9PB 1LQBA 4F8CB 1X86A 1DDVA 3L0WB 4F7HA 3PRPB 2QKMA 2EJ8A 4FULA 4DX90 2LZ6A 3FP5A 4AJYB 1EF5A 2W2WA 1WZ3A 1P5TA 3R3MA 3ULBA 1C3TA 2DHJA 1U29A 5KCVA 2LOXA 1WX9A 1WG7A 3DBLI 3E9LA 3NOBA 3A1QB 1LM8B 3RUIB 2FCNA 3ML8A 2IO0B 1GG3A 2NPTB 3PV1A 1MG8A 2W2XD 1DBHA 1UZXB 3KUCB 1V80A 2H7EA 3L13A 4F7ZA 1XCGA 3OLMD 1NTYA 2FCMA 4WJ7A 1OGWA 4NQLB 2VSZA 3RYTA 3WIMA 1WGGA 3NS8A 2KDBA 1VBGA 3DBHI 1SIFA 4HAXB 1BAKA 1CMXB 3V60A 2FJLA 3H6NA 2ELAA 1V61A 4PYZA 3VHTC 4XZ4A 1OTRB 5KQ1A 2LBBA 1Z5SB 3ZDTA 2CQUA 4JK7A 1V5PA 1E90A 5LXIB 4GU2A 1I35A 3G9WA 4AOFA 2P0DA 5CX3A 2MBEA 2Z59B 2RGFA 1XX0A 1Z2MA 4HATB 4AJWA 2V76A 2N9EB 3PHXB 3T06A 4JKDA 1XQQA 1WJ6A 5C6RA 5G2NA 4ANXA 1V89A 1RLFA 2ABDA 2EC1A 3FM8C 3ALBA 3JYUA 1WR1A 2I1JA 1BT0A 3M63B 2BF8B 1XD4A 2B3AA 5JHHA 1WRDB 3A98B 3GOEA 3OJ3A 1D3ZA 1GC6A 1PLSA 1WYWB 1WY8A 2NBWB 2V1YA 1YJ1A 4ZRKA 2XK5A 1DYNA 4ILHA 3R7QA 1U5EA 2XQNM 1WX8A 4FADA 3V62A 2NCNA 1U2BA 3OJ4B 1WXAA 2DYQA 1WF9A 1FGYA 5LONB 3UZTA 1EF1A 2YS3A 2L3ZA 2KMAA 2D11A 4WJPA 2KLGA 3VVWB 5DI9B 1YX5B 3L08A 4HLEA 2D9WA 3D8FA 4RM9A 4MGKE 2PZ1A 4PS3A 4GB9A 3IG3A 3PRZA 2M17A 2FUHB 1PMSA 4NAWA 2LGDA 2WX0A 3L54A 2J7QB 4DHZE 4F7UP 2PJHA 3SDLC 2GCJA 1FXTB 1DIKA 3N32A 1UEFA 2K00A 3CIKA 5LOPB 2MWSB 1WJ1A 2L00B 2L0FA 3WAMA 2IZVB 1OMWA 2O6VB 4JKHA 2DYNA 2JRHA 2N23A 3KZ1A 2D9XA 4JIOU 4KHAA 4JGHB 2KTRA 2RSUA 1WE7A 4ANUA 2D07B 4EUTA 4MGZE 2N0YA 4WQOB 1Q5WB 3R7RA 3ONSA 4WWPA 4CHJA 4WVFB 2OTXA 1FOEA 4HB0B 3GYPA 2YRYA 2DTCA 2DYOA 4G11A 2KVRA 2ZNVB 2MBHA 4KDIC 2VRRB 2KDEB 2KKCA 4WWOA 2ZPNA 2H7DA 1WGDA 1WFYA 2K8BA 4JKAA 1PFJA 4K1RB 1FB8A 2CB8A 5GOWB 4ZYNA 2MX2A 2N9XA 3H7PB 4TKNA 2DZJA 2KC2A 2IY1B 2M0XA 5CHWA 3VH4B 2FCQA 2GBJA 1WJ4A 4A6FB 2IBIB 5DPTA 2FNJB 3ODWA 2COCA 1J0GA 4K2OA 3ZVRA 4IM2A 4M8MA 2NR2A 1WJMA 2K6QA 4FHKA 2AWTA 2Z0PA 3ZIMA 1AQCA 5JH5C 4E74A 4KZ0A 3APCA 1WM3A 2CODA 1P9DU 4JK8A 1V5OA 3EHVA 1Y5OA 3TO1A 3A8PA 4ASWC 4C0AA 5J3TA 2KWUB 2CU1A 5JHBA 1E7VA 2K6DB 2CHWA 4GDLA 2UWQA 4LJOB 3L10B 2MCNB 2O6VA 3H9DA 4W9KA 4YONA 3R66C 2LD9A 3A8QA 4FJYA 4HK2A 1KC7A 2KGXB 1KJTA 3P2BA 3D8EA 2CS4A 2HE7A 4KVGB 3APFA 1P98A 2IO1B 1IRSA 4HB2B 5IA7A 1SHCA 3TIXA 2MBOA 1ZM0A 2DHZA 4IWOA 1ISNA 2KHWB 1L7YA 2LXAA 1GJZA 5CLQB 4M0WB 4KIKB 1K8RB 4M8NA 1BWNA 4MJSB 1NBFC 3PZDA 3PREA 4CHKA 1WI1A 5J3YA 3PP2A 1FHOA 2MWNB 2LWPA 3AU5A 3JVZX 4DXAB 2YVCA 2HD5B 1HB8A 2VRWB 2Z0EB 1EAZA 3V5WA 2AYOB 3PSEB 3RCPA 2DHKA 4A20A 5TR5A 2ZCCA 1NTVA 2LVOA 4MGIE 1WGHA 3EC8A 2GS0A 4BKSA 2FIFA 1ACAA 2NS5A 2JT4B 1BTKA 2KCJA 1NDDA 4JKGA 3P7ZA 1LFDA 3T9LA 2L1CA 2LI5A 4KHBB 3U30A 3PGEA 1J8CA 1Y8RC 3A1QA 2JF5A 4GDKA 2XBBC 4FLHA 1TGZB 1V86A 3UINB 2GBMA 4DX8A 4IM3A 3N3KB 2RR9A 3QK0A 2L8JA 1NU2A 2ZCBA 3NY5A 2KZRA 3CMMB 5D3VA 4JQWC 1QQGA 4HCNB 4WJOA 1W1GA 2P0FA 2W9NA 4DWFA 2KXJA 1H4RA 2PPHA 3OAWA 4I6LB 5E6OA 1WGUA 5HKHA 3A9JA 4G3XB 1WX7A 3DVGX 4ILGB 2PE6B 5L95C 2J0KA 1IP9A 3UQAA 2KLCA 3AXCA 1VCBA 5FI1A 4ICUA 2JY6A 1UBQA 4XX5A 1RJ2A 4BKTA 4IAPA 4EFOA 3CF6E 5JZEB 2O2VA 4GSWA 4TQ1A 3BY4B 2HTHA 3E9OA 1WZ0A 3VTWA 1VBHA 1XODA 4CHMA 2LXCA 4ANWA 2P0HA 2KJHB 1FHXA 1J19A 1DDMA 4DDGD 4JL9A 4BBNC 5CHVC 3KVFB 2DN6A 3KSYA 3X0WA 2IO3B 3UQBA 3VOQA 2R82A 2C7NB 3GZNI 3ML4A 3SO6A 3ZKJC 2FDQA 2DX5B 2G3QB 1TTNA 1LXDA 4H8SA 3JSVB 1H8CA 2MLBA 1U5DA 2KX0A 3SBTA 4RMAA 1LW3A 3UIOB 5G55A 4W9JA 1YX6B 4MT7A 4GN1A 1WJUA 3W1YA 3SV1A 3A9JB 3RT3B 4F1SA 4JKBA 5KQ4A 3M1IB 2GBKA 4K17A 1ZC3B 2AL6A 2CY5A 3U7DA 4KSKC 4I6NB 2KC1A 2GMIC 1X05A 1HB6A 3V6EB 4HAZB 4MGYE 2ZEQA 5E6NA 3QHTA 3DCGA 4KDLB 1K5DB 3A9KA 4K81A 4Y94A 1LB1A 1N3HA 1UELA 3AULA 3HM6X 1P3RA 2M1MA 1WM2A 2DZMA 4XWXA 1YD8U 3HW2B 3QC8B 4NY0A 4B95A 2CRFA 3NHEB 3QIJA 2NBVB 4A3OA 2GBRA 4GDLB 4MSQB 3HK0A 3IVFA 3OANA 3PEGA 3QBVB 2KJRA 3WANA 4A5KA 1P6SA 4AP4C 4DK5A 4W9EA 2BCJA 1NTIA 4HCPB 4PNKA 4HAWB 2LGYA 3TBLD 3NZSA 2LG1A 4PYUA 5HE1A 1E8WA 4BOSC 2YLMA 4JKEA 1WE6A 3DQVA 5DIFB 2IFSA 2WH5A 2KUPA 5HE3A 4HB3B 2CR5A 3ODOA 4ILJA 3HHMA 3X23A 3O65B 1UNQA 2BPSA 2CHXA 2LASA 1V2YA 1KBLA 3QQ8B 2M4NA 3TL5A 1UPRA 2RLOA 3RCZA 2MW5A 3VUYA 4ICVA 2N7DA 3MJWA 4EZKA 4K2PA 1E5WA 2DFKA 3UGBB 2BKFA 3I3TB 2KOXA 4AUQC 3DOWA 4JKFA 3IHPC 3PLVA 4D0NB 1SE9A 4PS8A 1U4AA 4WJQA 5AEKB 2WYQA 1KM7A 1R4MI 1U5GA 1W1DA 3A4SC 2R2QA 4GOCA 2C9WB 1EUVB 3MTNB 5D94A 2Q13A 3ZW3A 4FJVB 3DVNU 5L81A 5KHQA 2ROVA 5JHGA 1WXSA 3T8MA 2I1KA 2J59M 3D32A 1TJ6A 5C23A 3SHQA 1P1AA 2KWCA 3RZFA 4TQ0A 5DPSA 3WAOA 1RFAA 3PS6A 5J18A 4LCDE 4II2B 5DPWA 2LULA 3KH0A 2G45B 2M38A 4MELA 1I2HA 5C1ZA 1S1QB 2GOWA 3PPAA 2ASQA 2OOBB 4K7SA 2D2QA 4CO7A 2RD0A 3SUZA 4E3CA 3HQCA 2L0TA 4IG7B 2DAJA 4DBBA 1JRUA 4DHJB 3A4RA 3QWMA 2R2OA 4IFSA 2C7HA 5C16A 2MBBB 3DVNV 1C1YB 2I5FA 2K8CA 2LOZA 5D3WA 1WGRA 3PVUA 1OEYJ 2KMCA 3ZLZA 1EVHA 2LYDA 4XC2A 5IAAC 3O96A 3N7CA 5AZFA 2YS5A 4BFRA 2LUEA 3ZVVA 2A5UA 2YF0A 4URKA 3JSVA 1AWEA 1OQNA 3VIAA 3V61A 3KYCD 2OJRA 2MBQA 4LDTD 2LVQA 2DLWA 1V9JA 4GGQA 4N9F4 1WGQA 4IWPA 3ZTDA 5D6JB 2JUOA 3KRWA 4HPMB 3PTFC 2KO3A 4GMXB 2LJ5A 4W9FA 2KANA 2EMSA 3SBGA 1WJNA 2R09A 4MK0A 2ZPYA 5HE0A 1ZKHA 2DENB 2RGNB 1EO6A 1RRPB 2CHZA 5D3YA 3DXCA 1PQSA 3QAQA 3EPYA 4NJ7A 4IW0A 1Y19B 1F9JA 1WMHA 2WX1A 2L76A 3KW5B 4X57B 2GBNA 2D9ZA 4JLCA 5D7GA 2BWFA 4FA6A 2PE9A 1W1HA 2K2JA 4TYZA 3SU8X 1R4NI 4OVVA 3S2AA 1GUAB 4HAYB 4II3B 4AWJA 2D10A 2UZRA 2GCLA 2XK5B 2WWZA 1DROA 3B0AA 4MEMA 3SYXA 2KD0A 2ZVOA 5JP4A 3TVVA 3QJZA 2MSED 3ZUNA 1UNRA 2DHIA 2CKHB 1B55A 2ROZB 2C7MB 2DYBA 2HTHB 2NBUA 2N9PC 3WYFB 2V4LA 4HDQA 1SGHA 2D4QA 4EZJA 4BBKA 2D9VA 3WA0A 3ZNID 2FIDA 4NNJB 3UIPB 4W9CA 2KX3A 3JW0X 4HPLB 2AL3A 2MRPA 4ZRIA 3PVLA 3Q3FA 3H1UA 3RD2A 2C5LC 3U8ZA 1KZ7A 1UBIA 5HE2A 3VQIA 1L2NA 2LKOA 1Q1OA 1MK9B 2FCSA 2W2XC 4OVUA 2JZZA 2KN5A 4YL8A 3D8DA 4IOYX 1X11A 3VH3B 1YQBA 2MKRA 1E8YA 2MP2A 3APDA 1H10A 3Q3JA 2D3GA 3PVWA 3RZWC 3ZTCA 4PQ0A 2IYDB 3FEHA 2DA0A 2M14A 1UGMA 2NPTA 2MDXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4XWX A;  4CHJ A;  3HW2 B;  4WVF B;  2OTX A;  1YD8 U;  3QC8 B;  2J0J A;  1WR6 E;  4DHZ E;  1FOE A;  4HXD A;  5JHA A;  1ZSQ A;  2G4S A;  4GIV A;  4HJK A;  3QX1 A;  2BYF A;  4HB0 B;  3GYP A;  4NY0 A;  4B6H A;  4TV3 A;  4B95 A;  2YRY A;  4G50 A;  1UH6 A;  2CRF A;  4HHV A;  1XR0 B;  2DTC A;  2DYO A;  4G11 A;  3KY9 A;  3NHE B;  2KVR A;  2ZNV B;  5IJM A;  3N30 A;  1I7A A;  1X1F A;  2MBH A;  3QIJ A;  2VRR B;  4KDI C;  2NBV B;  4MJS A;  5CHF A;  2KDE B;  3IFW B;  4NAW B;  2KKC A;  4E3C A;  4K7U A;  4A3O A;  2GBR A;  3DXE A;  3QAR A;  1MIZ B;  3ML9 A;  4GDL B;  2KNB A;  2YT0 A;  2PEA A;  4MSQ B;  4WWO A;  3R7R A;  3HK0 A;  2ZPN A;  3VAW A;  2H7D A;  3A9K B;  3IVF A;  2DAF A;  1WGD A;  2YSZ A;  2DYM A;  3OAN A;  3PEG A;  1WFY A;  3QBV B;  2K8B A;  2ZVN A;  2JZ3 B;  1PFJ A;  2KQ7 A;  2WDT B;  2KJR A;  4K1R B;  2KDI A;  4WSF A;  1FB8 A;  3WAN A;  4A5K A;  2CB8 A;  2AEH A;  4RM8 A;  2UVM A;  4W9H A;  3TJP A;  1P6S A;  5GOW B;  3DBR I;  4HWI B;  4AP4 C;  4W9E A;  4ZYN A;  4DK5 A;  2BCJ A;  1NTI A;  4IUM B;  1KOT A;  1J0W A;  1V88 A;  2IYB A;  3BJI A;  2MX2 A;  2GJY A;  4EJN A;  4G0N B;  4HCP B;  3W1S A;  2N9X A;  3H7P B;  4TKN A;  1E7U A;  3NZU A;  4P7I A;  4FJZ A;  4PNK A;  3QA8 A;  4HAW B;  2HJ8 A;  2LGY A;  2DZJ A;  3NZS A;  3C0R B;  2KC2 A;  3TBL D;  2LG1 A;  4Z2N A;  2IY1 B;  2M0X A;  5CHW A;  4PYU A;  5HE1 A;  1E8W A;  4EOY A;  5C5B A;  2DX5 A;  3VH4 B;  2FCQ A;  2GBJ A;  1WJ4 A;  4BOS C;  2YLM A;  3ZDM C;  2DKP A;  1H8C A;  4NJ6 A;  1RRB A;  4A6F B;  4EZL A;  1MKE A;  1WE6 A;  1Q0W B;  3DQV A;  5DIF B;  2IFS A;  4ANV A;  2IBI B;  5DPT A;  2KTR B;  3P6A A;  3CXB B;  2WH5 A;  2EKE C;  2KUP A;  5HE3 A;  4HB3 B;  2CR5 A;  2YT1 A;  3ODO A;  4W9L A;  2FNJ B;  2RSG A;  3O65 B;  3HHM A;  3X23 A;  1U27 A;  3ODW A;  5J17 A;  5D3X A;  1UNQ A;  2COC A;  4A6F A;  2ZNV C;  3B08 A;  2BPS A;  3MPX A;  4K2O A;  2MFQ A;  3ZNH B;  2CHX A;  4ZDV A;  3ZVR A;  2D9Y A;  4B9K A;  4IM2 A;  1WH3 A;  2KQS A;  2LAS A;  4IWQ A;  4W9I A;  4WWN A;  5E6P A;  4DBG A;  1V2Y A;  3PRM B;  2K8H A;  4M8M A;  2ZJD A;  2Y5B B;  5L83 A;  2G35 A;  3ZRC A;  2NR2 A;  1XKE A;  1WJM A;  2ZZP B;  3QQ8 B;  1WMH B;  2K6Q A;  2M4N A;  1D3Z A;  2LVP A;  4L6E A;  4FHK A;  1BTN A;  1GC7 A;  2AWT A;  3TL5 A;  1RAX A;  3DPD A;  1FHW A;  1KLV A;  4NSW A;  2Z0P A;  1UPR A;  3ZO5 B;  1YIW A;  1V81 A;  2RLO A;  3RCZ A;  2MW5 A;  3VUY A;  4HVB A;  4ICV A;  2P8V A;  3V6C B;  1J0G A;  1I42 A;  3ZIM A;  1XT9 B;  1MPH A;  2N7D A;  1WXM A;  1AQC A;  3AU4 A;  5JH5 C;  4LJP B;  3MJW A;  4E74 A;  4EZK A;  4K2P A;  1E5W A;  4KZ0 A;  5D2M B;  5C79 A;  3VTV A;  2DFK A;  3APC A;  5L95 C;  1WM3 A;  2COD A;  4HAV B;  5BO4 B;  1P9D U;  3UGB B;  3M3J A;  1V5O A;  3WAP A;  2BKF A;  5DPR A;  3I3T B;  1E8Z A;  1V5T A;  3M62 B;  3EHV A;  3F0W A;  1Y5O A;  2KOX A;  4AUQ C;  4HAU B;  3DOW A;  2FAZ A;  4HB4 B;  5DHF B;  3TO1 A;  3IHP C;  3CSF A;  2ELB A;  4A6H A;  3A8P A;  3PLV A;  4ASW C;  4C0A A;  1A5R A;  4D0N B;  2BKR B;  2RPQ A;  5J3T A;  2NZ8 B;  2CU1 A;  2KWU B;  1SE9 A;  5JHB A;  2I5C A;  1E7V A;  2K6D B;  3FLV A;  2JP2 A;  2CHW A;  4PS8 A;  4KIK A;  4MY6 A;  1U4A A;  4WJQ A;  4GDL A;  2UWQ A;  2L05 A;  4LJO B;  5AEK B;  2CAY A;  2QKL A;  3MHS D;  4BKG A;  2WYQ A;  3L10 B;  1KM7 A;  3F5R A;  4CYE A;  1R4M I;  2O6V A;  4FN2 A;  2MCN B;  3VXW A;  1UD7 A;  2IY0 B;  1WVH A;  3H9D A;  4W9K A;  4A3P A;  2KDF B;  4YON A;  2KFK B;  2L7R A;  2LRU A;  1U5G A;  3R66 C;  3TW1 A;  1W1D A;  1NI2 A;  3PSC A;  2LGX A;  5EDS A;  3A4S C;  1UNP A;  2DKQ A;  2JVC A;  2R2Q A;  2LD9 A;  3PT2 B;  4J6I A;  3A8Q A;  4FJY A;  4HK2 A;  3PLU A;  4KV2 A;  3W1Y A;  2Y8F A;  3KRX A;  2J0M A;  5JLJ B;  2E2X A;  2C9W B;  2N4F A;  4GOC A;  1OQY A;  2KGX B;  4KHO A;  1EUV B;  1KJT A;  4E71 A;  4EMO A;  3P2B A;  3MTN B;  5D94 A;  3ZRF A;  2K39 A;  3D8E A;  2CS4 A;  3KUD B;  2Q13 A;  3ZW3 A;  1M94 A;  4FJV B;  5J2R A;  2HE7 A;  5L81 A;  3DVN U;  5FR6 A;  1IPG A;  1ST7 A;  2UZS A;  2ROV A;  4KVG B;  5JHG A;  2Z0O A;  1X1M A;  3APF A;  1P98 A;  1TXD A;  3LJU X;  1WXS A;  2IO1 B;  2I1K A;  3T8M A;  1MK7 B;  1IRS A;  4HB2 B;  2J59 M;  2DZK A;  2V3S A;  1SHC A;  3H7P A;  4DDI D;  5IA7 A;  1M7R A;  5D27 A;  1V49 A;  1TQZ A;  1EGX A;  3D32 A;  3FSS A;  3B1L X;  2MBO A;  1TJ6 A;  5C23 A;  3SHQ A;  1ZM0 A;  5FI0 A;  2BYE A;  2DHZ A;  1ISN A;  2K25 A;  4IWO A;  4WJN A;  1P1A A;  3ZNG C;  2KHW B;  2KWC A;  4I6P A;  2FJ9 A;  3K9P B;  3PG7 A;  4BOZ B;  2O2V B;  3DVG Y;  3RZF A;  1LQB A;  2C60 A;  4F8C B;  1X86 A;  1DDV A;  3L0W B;  4F7H A;  2Z0D B;  3PRP B;  5DPS A;  4TQ0 A;  1V5M A;  1L7Y A;  2QKM A;  3WAO A;  2EJ8 A;  2LXA A;  4FUL A;  1RFA A;  3PS6 A;  4KAX B;  3A33 B;  5J18 A;  5CLQ B;  1GJZ A;  2ADZ A;  4M0W B;  4DX9 0;  2LZ6 A;  3ENE A;  3FP5 A;  4AJY B;  3CST A;  1EF5 A;  4KIK B;  5DHA B;  2W2W A;  3KUZ A;  5EFX A;  1K8R B;  4M8N A;  3VFK A;  4LCD E;  1BWN A;  1WZ3 A;  2KK8 A;  1NBF C;  4II2 B;  4MJS B;  3TMP B;  3WAL A;  4EEW A;  5DPW A;  1P5T A;  3PHW B;  3PZD A;  5J3Q A;  2JRI B;  3R3M A;  3ULB A;  2KFK A;  1C3T A;  3PRE A;  3VTU A;  4CHK A;  1WI1 A;  2DHJ A;  2LUL A;  3ULC A;  1U29 A;  2G45 B;  5J3Y A;  3KH0 A;  2M38 A;  3PP2 A;  5KCV A;  1FHO A;  3NSU A;  4MEL A;  2MWN B;  2LWP A;  1X1G A;  1I2H A;  3AU5 A;  1K5G B;  3ONS A;  3JVZ X;  4NQK E;  2G4D B;  2LOX A;  1S1Q B;  5C1Z A;  2GOW A;  3PPA A;  1WX9 A;  1WG7 A;  4DXA B;  2KWV B;  3DBL I;  1NVL A;  2JPH A;  2ASQ A;  3AJ4 A;  2OOB B;  4K7S A;  2YVC A;  2HD5 B;  1HB8 A;  3A1Q B;  2D2Q A;  2K2U A;  1LM8 B;  3NOB A;  2RD0 A;  2VRW B;  4CO7 A;  3SUZ A;  3K9O B;  2Z0E B;  3RUI B;  1EAZ A;  3HQC A;  2FCN A;  3V5W A;  1AAR A;  2AYO B;  2DAJ A;  2IO0 B;  2L0T A;  3ML8 A;  2RUK B;  3RCP A;  3L16 A;  3PSE B;  1GG3 A;  1IYF A;  4ZRJ A;  4DBB A;  2DHK A;  2HRJ A;  1JRU A;  2NPT B;  3PV1 A;  1MG8 A;  4DHJ B;  3A4R A;  1GNU A;  4A20 A;  5TR5 A;  2JWZ A;  1ZGU B;  2W2X D;  2ZCC A;  1DBH A;  1UPQ A;  1NTV A;  2LVO A;  4MGI E;  2N1W A;  1UZX B;  1WGH A;  3EC8 A;  2GS0 A;  3KUC B;  4BKS A;  1V80 A;  2FIF A;  2H7E A;  3QCA A;  3QWM A;  5LXH A;  1ACA A;  2R2O A;  4KSL C;  3L13 A;  4LDT B;  2NS5 A;  4F7Z A;  1XCG A;  2JT4 B;  3OLM D;  1NTY A;  1BTK A;  4IFS A;  2KCJ A;  2FCM A;  2C7H A;  4WJ7 A;  1NDD A;  3MDB C;  1OGW A;  2VSZ A;  5C16 A;  2MBB B;  4NQL B;  2IO2 B;  1XD3 B;  3DVN V;  4K7W A;  5GMV A;  3RYT A;  1C1Y B;  3LJ3 A;  3WIM A;  3P7Z A;  1LFD A;  1WGG A;  2KDB A;  3NS8 A;  3T9L A;  2L1C A;  1ZW7 A;  2I5F A;  2LI5 A;  2COA A;  2K8C A;  1QC6 A;  2LOZ A;  4KHB B;  5CTR C;  5D3W A;  3DBH I;  2RNR B;  1P0R A;  1SIF A;  4HAX B;  1BAK A;  3PGE A;  1CMX B;  1WGR A;  3U30 A;  3PVU A;  1OEY J;  3V60 A;  1J8C A;  1Y8R C;  2KMC A;  3DBS A;  2FJL A;  2RQ1 A;  2ELA A;  3H6N A;  3ZLZ A;  3A1Q A;  2JF5 A;  1EVH A;  1G6J A;  4GDK A;  2XBB C;  1V61 A;  2LYD A;  4PYZ A;  4XC2 A;  3O96 A;  4FLH A;  5IAA C;  3VHT C;  1KZG A;  4BVU C;  2NVU I;  3ZNI D;  2Y8G A;  3N7C A;  1TGZ B;  1V86 A;  4XZ4 A;  5AZF A;  2YS5 A;  1OTR B;  5KQ1 A;  2GBM A;  3UIN B;  3KYD D;  4DX8 A;  2LUE A;  4IM3 A;  4BFR A;  1KI1 B;  2LBB A;  3N3K B;  3ZVV A;  2A5U A;  2RR9 A;  3QK0 A;  2YF0 A;  2L8J A;  4URK A;  1WGY A;  1Z5S B;  3ZDT A;  3EFU A;  3JSV A;  1DDW A;  1NU2 A;  1AWE A;  2ZCB A;  3NY5 A;  2DX1 A;  3SNH A;  5DH9 B;  1OQN A;  2KZR A;  3TFM A;  3CMM B;  2CQU A;  3VIA A;  5D3V A;  1VD2 A;  3V61 A;  3KYC D;  4JQW C;  1V5P A;  1E90 A;  2OJR A;  2MBQ A;  5LXI B;  4KZC A;  4GU2 A;  4LDT D;  1I35 A;  1QQG A;  4HCN B;  3G9W A;  4AOF A;  4WJO A;  2P0D A;  2MQJ A;  2LVQ A;  1W1G A;  2DLW A;  2P0F A;  1V9J A;  4GGQ A;  4N9F 4;  1WGQ A;  2W9N A;  4IWP A;  1Q67 A;  1V6E A;  4DWF A;  3ZTD A;  5CX3 A;  5D6J B;  2MBE A;  2JUO A;  3KRW A;  2RGF A;  2Z59 B;  4HPM B;  1V5U A;  2KXJ A;  1XX0 A;  3PTF C;  1Z2M A;  4HAT B;  2O6V D;  2V76 A;  4AJW A;  2KO3 A;  4GMX B;  1H4R A;  2LJ5 A;  2N9E B;  2PPH A;  4W9F A;  2KAN A;  3PHX B;  3OAW A;  2EMS A;  3GYO A;  1WGU A;  4I6L B;  5E6O A;  1WJN A;  2R09 A;  3HM3 A;  3HIZ A;  4MK0 A;  5HKH A;  2ZPY A;  5HE0 A;  1ZKH A;  2DEN B;  4HDO A;  2RGN B;  3T06 A;  1XQQ A;  3TCA A;  1WJ6 A;  1EO6 A;  5C6R A;  3A9J A;  1WX7 A;  3DVG X;  3L17 A;  1RRP B;  4G3X B;  5G2N A;  2CHZ A;  5D3Y A;  4ANX A;  4FBJ B;  2PE6 B;  3BIN A;  3DXC A;  1WXV A;  3VDZ A;  1V89 A;  2J0K A;  2BWE S;  1WIA A;  1RLF A;  1PQS A;  3QAQ A;  2ABD A;  3EPY A;  2EC1 A;  3VUX A;  4NJ7 A;  3FM8 C;  1IP9 A;  4IW0 A;  3UQA A;  1TZ1 A;  1Y19 B;  1F9J A;  2KLC A;  3ALB A;  3AXC A;  1VCB A;  3DDC B;  3JYU A;  5FI1 A;  1QZE A;  4ICU A;  1WR1 A;  2JY6 A;  1OY2 A;  2I1J A;  1UBQ A;  1ZVR A;  4GMV A;  1WMH A;  5CLL B;  2MA9 B;  2WX1 A;  4GZU A;  1BT0 A;  2L76 A;  2Y7B A;  1ZC4 B;  1E8X A;  3KW5 B;  4X57 B;  4XX5 A;  1RJ2 A;  2BF8 B;  1XD4 A;  1WI0 A;  2GBN A;  3M63 B;  4IAP A;  2B3A A;  4B6W A;  4BKT A;  5JHH A;  2D9Z A;  1WRD B;  4JLC A;  5D7G A;  3A98 B;  3GOE A;  2BWF A;  4EFO A;  4FA6 A;  2COP A;  3CF6 E;  3OJ3 A;  5JZE B;  2PE9 A;  2DZI A;  1W1H A;  2K2J A;  1GC6 A;  4TYZ A;  2O2V A;  3LDZ E;  4GSW A;  4TQ1 A;  1PLS A;  4WAA A;  5KHO A;  1WYW B;  2HTH A;  1WZ0 A;  3BY4 B;  1WY8 A;  3VTW A;  4BBN F;  2NBW B;  3SU8 X;  2V1Y A;  1XOD A;  4ZRK A;  4CHM A;  1YJ1 A;  2KJ6 A;  2XK5 A;  3W1S C;  1R4N I;  1DYN A;  2LXC A;  4OVV A;  3R7Q A;  4ANW A;  3S2A A;  1U5E A;  2P0H A;  2XQN M;  1WX8 A;  4FAD A;  1GUA B;  4MSM B;  2KTF A;  3V62 A;  2KJH B;  2NCN A;  1FHX A;  4HAY B;  1U2B A;  4II3 B;  3UF8 A;  4AWJ A;  2D10 A;  2UZR A;  2NMB A;  2GCL A;  2XK5 B;  3OJ4 B;  1WXA A;  2WWZ A;  1J19 A;  2DYQ A;  1DRO A;  1DDM A;  3B0A A;  4JL9 A;  4BBN C;  4DDG D;  1WF9 A;  5CHV C;  4MEM A;  3KVF B;  2DN6 A;  3KSY A;  3SYX A;  3X0W A;  4GXB A;  1FGY A;  3ZNZ B;  3ECI A;  2KD0 A;  5LON B;  3UZT A;  2MP2 B;  2ZVO A;  3ODX A;  2IO3 B;  3UQB A;  3VOQ A;  5C5B B;  1EF1 A;  5JP4 A;  3TVV A;  4IM0 A;  3SD5 A;  3QJZ A;  2YS3 A;  2C7N B;  2L3Z A;  1HE8 A;  2MSE D;  3ZUN A;  1UNR A;  2KMA A;  2D11 A;  3GZN I;  2DHI A;  2JXX A;  3ML4 A;  3SO6 A;  2CKH B;  2K1F A;  2N1V A;  3M95 A;  1B55 A;  2ROZ B;  3QWZ B;  1FGZ A;  4WJP A;  2KLG A;  2C7M B;  5DCN A;  3VVW B;  3ZKJ C;  2DYB A;  2FDQ A;  5DI9 B;  2DX5 B;  2G3Q B;  1YX5 B;  2LRW A;  1TTN A;  3L08 A;  4HLE A;  2HTH B;  1LXD A;  3H7S A;  2D9W A;  4H8S A;  3D8F A;  3JSV B;  4F7G A;  2OQB A;  4Z2M B;  1U5D A;  2MLB A;  2KX0 A;  2NBU A;  4MGK E;  4RMA A;  4RM9 A;  2PZ1 A;  3AI5 A;  2VKI A;  2N9P C;  1LW3 A;  3WYF B;  2V4L A;  4PS3 A;  4HDQ A;  3UIO B;  1SGH A;  2D4Q A;  2COF A;  5G55 A;  4W9J A;  4EZJ A;  4GB9 A;  3IG3 A;  1YX6 B;  3PRZ A;  3VUW A;  4BBK A;  2D9V A;  2M17 A;  2FUH B;  4BKS D;  3WA0 A;  1PMS A;  1M7E A;  4NAW A;  1HBK A;  4MT7 A;  1OEY A;  2LGD A;  2QHO A;  2FID A;  2WX0 A;  4GN1 A;  1WJU A;  2J7Q B;  3L54 A;  4NNJ B;  4TUU A;  4W9C A;  5LLI A;  3UIP B;  2EMT A;  3SV1 A;  3A9J B;  5AZG A;  4F7U P;  2KX3 A;  2PJH A;  3RT3 B;  4F1S A;  5KQ4 A;  3JW0 X;  3M1I B;  4HPL B;  2AL3 A;  4A6K A;  3SDL C;  2GCJ A;  1FXT B;  1P3Q U;  2GBK A;  3N32 A;  4DHZ B;  2MRP A;  1UEF A;  2K00 A;  2KFJ A;  5KHQ A;  3CIK A;  5LOP B;  4K17 A;  2MWS B;  4ZRI A;  1ZC3 B;  2AL6 A;  1WJ1 A;  3PVL A;  2CY5 A;  3Q3F A;  2A4Z A;  1MIX A;  2L00 B;  2L0F A;  2Z0Q A;  3WAM A;  3H1U A;  4EKU A;  2IZV B;  3U7D A;  3RD2 A;  2REX A;  1OMW A;  4KSK C;  2C5L C;  3U8Z A;  1KZ7 A;  2O6V B;  4I6N B;  5AZH A;  1Z87 A;  1T0Y A;  5HE2 A;  1UBI A;  2KC1 A;  4GDK B;  2BYV E;  3VQI A;  1L2N A;  2LKO A;  1Q1O A;  2GMI C;  1X05 A;  1HB6 A;  1MK9 B;  2DYN A;  2L2I A;  3DXD A;  2N23 A;  3KZ1 A;  2FCS A;  2JRH A;  2W2X C;  4NPN A;  4PS7 A;  3TIX A;  2D9X A;  4IG7 B;  3EEC A;  4JIO U;  4HAZ B;  4KHA A;  4OVU A;  3V6E B;  2X18 A;  2JZZ A;  4MM3 A;  2KN5 A;  1MAI A;  1U5F A;  4YL8 A;  1FAO A;  3IBE A;  4MGY E;  3D8D A;  4IOY X;  1X11 A;  4JGH B;  1YQB A;  2ZEQ A;  4W9D A;  4MH0 E;  2YS1 A;  3VH3 B;  2RVB B;  2KTR A;  2MKR A;  2M8S A;  5E6N A;  1E8Y A;  3QHT A;  4FHJ A;  2CY4 A;  2XEW A;  2RSU A;  2MP2 A;  2N7E A;  1WE7 A;  3DCG A;  2UYZ B;  4KDL B;  1K5D B;  3A9K A;  4ANU A;  2D07 B;  4DHJ D;  3APD A;  4K81 A;  1H10 A;  3Q3J A;  4Y94 A;  1S3S G;  2D3G A;  4MGZ E;  4EUT A;  2BGF A;  4GPT B;  1TBE A;  1LB1 A;  1N3H A;  3PVW A;  3RZW C;  4W9G A;  2N0Y A;  1UEL A;  3ZTC A;  3AUL A;  3HM6 X;  4WQO B;  4PQ0 A;  2IYD B;  1P3R A;  1Q5W B;  3FEH A;  2DA0 A;  2M14 A;  1UGM A;  2NPT A;  2M1M A;  2MDX A;  2R0D A;  1WM2 A;  4IC7 B;  3RUL A;  4MDK E;  4WWP A;  2DZM A; 
#chains in the Genus database with same CATH topology
 3B77 A;  3KLS X;  2J52 A;  2WHI A;  4HXD A;  1WRI A;  2I38 A;  2G4S A;  2VH1 A;  4GIV A;  2BYF A;  1LO5 D;  5E6J A;  4HHV A;  1XR0 B;  5IJM A;  3N30 A;  1I7A A;  4MJS A;  1MHX A;  1SJE D;  1K51 A;  3QAR A;  1MIZ B;  2V4I B;  2YT0 A;  2DAF A;  2DYM A;  1JWB D;  2V0G A;  2JZ3 B;  4QJ3 B;  4UDU C;  2KDI A;  4RM8 A;  3TJP A;  2UVM A;  3Q3N C;  2RDH A;  3DBR I;  3HVZ A;  1KOT A;  3ZJV A;  3DWM A;  1J0W A;  1V88 A;  2IYB A;  3BJI A;  4G0N B;  4EJN A;  3MP9 A;  3T3N A;  1E7U A;  3NZU A;  4P7I A;  3RNE C;  2HJ8 A;  3C0R B;  4Z2N A;  4EOY A;  5C5B A;  4EE2 A;  2DX5 A;  1I4H A;  3TEX A;  2DKP A;  4EZL A;  1Q0W B;  4ANV A;  3IT4 B;  3P6A A;  1K53 A;  2EKE C;  2YEP F;  2YT1 A;  5EE9 A;  3NVZ A;  5J17 A;  1BML C;  2ZNV C;  1AYF A;  3ZNH B;  4L1R A;  4B9K A;  1WH3 A;  4WWN A;  4W9I A;  4DBG A;  5L83 A;  2K8H A;  2ZJD A;  2Y5B B;  4OZA A;  1N61 A;  1WMH B;  2LVP A;  1BTN A;  2WDV B;  2G9H D;  3DPD A;  1FHW A;  1KLV A;  1YIW A;  4AQ7 A;  4HVB A;  2P8V A;  3V6C B;  1XT9 B;  1WYG A;  3P42 A;  4LJP B;  3NG0 A;  5D2M B;  5C79 A;  1UUP A;  4HAV B;  3DWG C;  3URY A;  2Z4D A;  5DPR A;  1V5T A;  3M62 B;  4HB4 B;  4A6H A;  5HHD G;  2NZ8 B;  4QJ5 B;  2I5C A;  2IDY A;  2JP2 A;  4MY6 A;  2FJU B;  2CAY A;  4BKG A;  4JKG B;  5G5H A;  4CYE A;  4FN2 A;  1UD7 A;  2IY0 B;  1WVH A;  5HG2 A;  1VZ7 A;  2KDF B;  2LRU A;  3TW1 A;  2DIK A;  3PSC A;  2LGX A;  5EDS A;  2DKQ A;  2JVC A;  3PT2 B;  2JYT A;  4KV2 A;  3PLU A;  2DBY A;  2Y8F A;  3KRX A;  2J0M A;  2N4F A;  1NYQ A;  1OQY A;  4E71 A;  3RMK C;  4EMO A;  2K39 A;  3KUD B;  3LXF A;  1M94 A;  5J2R A;  5IN7 A;  2BQQ A;  1IPG A;  2UZS A;  4OZC A;  2Z0O A;  1J7B A;  3LJU X;  1MK7 B;  3P4R B;  2DZK A;  2V3S A;  3H7P A;  1M7R A;  5D27 A;  1V49 A;  3FSS A;  3B1L X;  4TSS A;  2BYE A;  4WJN A;  3ZNG C;  3NW8 A;  1DYQ A;  3PG7 A;  4BOZ B;  1E9M A;  2O2V B;  3DVG Y;  2C60 A;  3RFZ B;  2Z0D B;  1V5M A;  2QIL A;  1QOG A;  1D6E C;  4KAX B;  1CZP A;  3A33 B;  1ESF A;  2ADZ A;  1EWY C;  3ENE A;  4JK9 A;  3CST A;  4WWM A;  5DHA B;  1F1H A;  1YJJ A;  3KUZ A;  5EFX A;  3VFK A;  3WAL A;  2KK8 A;  3TMP B;  4EEW A;  4P1B C;  3PHW B;  5J3Q A;  2JRI B;  2KFK A;  3BVG A;  3VTU A;  2R61 A;  1MJD A;  4A55 A;  3VR9 B;  3ULC A;  2KIE A;  3NSU A;  1OQR A;  1XF5 L;  1X1G A;  1KF6 B;  1K5G B;  4NQK E;  4PS7 A;  2G4D B;  2KWV B;  1KLU D;  1NVL A;  2E6X A;  2JPH A;  3AJ4 A;  4M00 A;  2K2U A;  4YT0 B;  3J9C A;  3K9O B;  1AAR A;  2RUK B;  3L16 A;  1JRP A;  1IYF A;  4ZRJ A;  1AN8 A;  2HRJ A;  4P1C C;  1FFV A;  1GNU A;  2JWZ A;  1ZGU B;  1UPQ A;  2N1W A;  4ZYS A;  2OED A;  3QCA A;  2LHE A;  5LXH A;  1QKZ A;  4J3O D;  4KSL C;  3HVD A;  4LDT B;  4ZRQ A;  4ARC A;  3SFD B;  1CJE A;  1QOA A;  3MDB C;  5GMV A;  5I2M A;  4YSX B;  2IO2 B;  1XD3 B;  4K7W A;  3B2F A;  3LJ3 A;  1ZW7 A;  2COA A;  5CTR C;  1QC6 A;  2RNR B;  1P0R A;  2GB1 A;  5LNK 1;  3DBS A;  2RQ1 A;  2KYW A;  1G6J A;  1NEK B;  1KZG A;  4BVU C;  2NVU I;  1FNV A;  4KHB A;  2Y8G A;  2LGS A;  3KYD D;  1KI1 B;  4YWG G;  3E9P A;  1WGY A;  1ZE3 D;  1DDW A;  2DX1 A;  3SNH A;  5DH9 B;  3TFM A;  4LNF A;  3MC0 B;  1VD2 A;  4KZC A;  1E6E B;  1FIQ A;  2MQJ A;  1FCC C;  1Q67 A;  1V6E A;  1JDE A;  5E6P A;  5AZH A;  3AM9 A;  1D4B A;  1V5U A;  3DHH C;  5EE3 A;  2O6V D;  1MFW A;  4QAY A;  2JU6 X;  3Q3M C;  3GYO A;  4XE0 A;  1QT9 A;  2BB5 A;  3HM3 A;  3HIZ A;  4HDO A;  3TCA A;  2INP E;  4WAF A;  3L17 A;  4FBJ B;  4XDD A;  3BIN A;  1WXV A;  3VDZ A;  3PZ7 A;  2BWE S;  1WIA A;  3VUX A;  2WXK A;  1TZ1 A;  3DDC B;  1KH0 A;  3O13 A;  2PW9 A;  1QZE A;  1OY2 A;  3DHG C;  2MA9 B;  1ZVR A;  4GMV A;  1TKE A;  5CLL B;  4GZU A;  2Y7B A;  1ZC4 B;  1E8X A;  1NI3 A;  1WI0 A;  4B6W A;  3ENB A;  1KRH A;  3VRB B;  2COP A;  1SE4 A;  2DZI A;  3LDZ E;  4RGM A;  4WAA A;  3NJT A;  5KHO A;  1I4P A;  4BBN F;  1E10 A;  3PO0 A;  2KJ6 A;  3W1S C;  1HA5 A;  4NZL B;  4MSM B;  5JVL A;  2KTF A;  4MM3 B;  3UF8 A;  3OHM B;  2NMB A;  3Q3O C;  2WXG A;  1EM7 A;  4A90 A;  2MEK A;  4GXB A;  3AEE B;  3ZNZ B;  3ECI A;  1L0Y B;  2MP2 B;  2WDQ B;  3ODX A;  5C5B B;  4IM0 A;  3SD5 A;  5H92 C;  1HE8 A;  3AE2 B;  2JXX A;  2K1F A;  2N1V A;  3M95 A;  3AE8 B;  3QWZ B;  1FGZ A;  5DCN A;  3I63 C;  2LRW A;  4RF1 A;  3H7S A;  1F77 A;  4F7G A;  2OQB A;  4Z2M B;  1L4D B;  3SR6 A;  3AI5 A;  2VKI A;  4XWW A;  5BYS A;  2COF A;  3Q8C A;  3VUW A;  1VJK A;  4BKS D;  4YTP B;  1M7E A;  2BS4 B;  2W82 A;  1HBK A;  2QHO A;  1OEY A;  1XCQ L;  3EFU A;  3A58 A;  4TUU A;  5LLI A;  2EMT A;  1C9F A;  5AZG A;  4A6K A;  5G5G A;  1P3Q U;  4DHZ B;  2KFJ A;  2QIE B;  1VDV A;  2A4Z A;  1MIX A;  2Z0Q A;  1HTO A;  5IKC M;  2X0S A;  4EKU A;  2FBW B;  1FEH A;  1HQR D;  2REX A;  1Z87 A;  1T0Y A;  4GDK B;  1N5X A;  2BYV E;  2JX5 A;  2L2I A;  3DXD A;  4NPN A;  3RNF C;  4FXC A;  4B0E A;  3EEC A;  5I4D A;  2X18 A;  4MM3 A;  1MAI A;  1U5F A;  1FAO A;  4JKC A;  2MJ3 A;  3IBE A;  1ZP0 B;  4LTU A;  2QC8 A;  4W9D A;  3MC8 A;  4GNK B;  4MH0 E;  2YS1 A;  2RVB B;  3U4E G;  2M8S A;  4FHJ A;  2WDR B;  2CY4 A;  2XEW A;  2N7E A;  2UYZ B;  4HPP A;  3SFE B;  4DHJ D;  3U12 A;  1YN5 A;  1EU4 A;  1S3S G;  3P4P B;  2BGF A;  4GPT B;  1TBE A;  2YT2 A;  4W9G A;  4HRO A;  2E3T A;  3RUL A;  2R0D A;  4IC7 B;  4MDK E;  2J0J A;  1WR6 E;  5JHA A;  1R4M B;  1ZSQ A;  4ITK A;  1GGO A;  4HJK A;  3QX1 A;  4TV3 A;  4B6H A;  1L0X B;  4G50 A;  1UH6 A;  3WCQ A;  1FNU A;  1JWS D;  3KY9 A;  3BK1 A;  1N63 A;  1X1F A;  5CHF A;  4NAW B;  3IFW B;  4K7U A;  3W5U B;  1J7C A;  2QCZ A;  2SEB D;  3DXE A;  3ML9 A;  2KNB A;  2PEA A;  1WXQ A;  3VAW A;  3A9K B;  2YSZ A;  3FKY A;  2YEP B;  2ZVN A;  2KQ7 A;  2MJD A;  2WDT B;  4WSF A;  2AEH A;  4W9H A;  4HWI B;  4IUM B;  3P1M A;  3W1S A;  1TKY A;  2GJY A;  3ZJT A;  4FJZ A;  4HJG E;  4C7Z A;  3QA8 A;  3AN1 A;  1JWM D;  4S0R A;  1FMA D;  4WIP A;  3ZDM C;  4NJ6 A;  4KGT A;  1RRB A;  3EGR A;  1BXT A;  1MKE A;  2JSV X;  2Y5P A;  2ZW1 A;  2BS3 B;  4ZRP A;  2KTR B;  2L1A A;  3CXB B;  4W9L A;  2RSG A;  1U27 A;  1TS4 A;  5D3X A;  4A6F A;  1TJE A;  2LEK A;  3B08 A;  4ZDV A;  3MPX A;  2MFQ A;  1XLQ A;  2D9Y A;  2KQS A;  4IWQ A;  3BVM A;  4PT5 A;  1MI0 A;  3PRM B;  1HXY D;  1UNS A;  1SE2 A;  2G35 A;  3ZRC A;  1XKE A;  2ZZP B;  4L6E A;  1GC7 A;  1RAX A;  4NSW A;  3ZO5 B;  1N60 A;  1V81 A;  3FIL B;  1I42 A;  1MPH A;  2K49 A;  1WXM A;  3AU4 A;  3HUI A;  3VTV A;  4GOU A;  4USA A;  5BO4 B;  3M3J A;  1I4Q A;  2CJN A;  3WAP A;  2M0A A;  1E8Z A;  3F0W A;  4HAU B;  2FAZ A;  5DHF B;  1YJI A;  3CSF A;  2ELB A;  1FRD A;  1A5R A;  2RPQ A;  2BKR B;  1ZXH A;  3FLV A;  4KIK A;  1C4C A;  3FC4 A;  2L05 A;  3NWA A;  2QKL A;  1ZOY B;  3MHS D;  1UGJ A;  3F5R A;  3VXW A;  4A3P A;  2KFK B;  2L7R A;  3E66 A;  1NI2 A;  2INN E;  1UNP A;  4J6I A;  1YNT E;  5JLJ B;  2E2X A;  1YN4 A;  4KHO A;  4XGA B;  1GOZ A;  3ZRF A;  3AEA B;  2CJO A;  5FR6 A;  2L83 A;  3AB5 A;  1Q10 A;  3I5J C;  1ST7 A;  1X1M A;  4ARI A;  1TXD A;  2Y5C A;  4YSZ B;  4L1B A;  4DDI D;  4TMA B;  2EEL A;  1TQZ A;  1EGX A;  5FI0 A;  2K25 A;  2N0S B;  4I6P A;  2FJ9 A;  3K9P B;  1L5P A;  1D5Z C;  1DOY A;  1LQB A;  4F8C B;  1X86 A;  1DDV A;  3L0W B;  4F7H A;  3PRP B;  5IOI A;  2KR0 A;  3ZYY X;  1RM6 C;  2QKM A;  4ZOH C;  2EJ8 A;  4FUL A;  1DOX A;  1KFY B;  1STE A;  4DX9 0;  2LZ6 A;  3FP5 A;  1EWC A;  4AJY B;  1EF5 A;  2W2W A;  1SE3 A;  3R8B A;  1WZ3 A;  1P5T A;  2EKI A;  3R3M A;  3ULB A;  1E7P B;  3N9Y C;  2K8E A;  1C3T A;  1K50 A;  2DHJ A;  1U29 A;  5KCV A;  3GB1 A;  5HI1 A;  2VZK D;  3EFC A;  2LOX A;  1R7S A;  1WX9 A;  1WG7 A;  3DBL I;  3E9L A;  4P6V F;  4YTM B;  2MJE A;  3NOB A;  3A1Q B;  1LM8 B;  3N1Z C;  2MH7 A;  3RUI B;  4JX1 C;  2FCN A;  3ML8 A;  3ZXV A;  2IO0 B;  1GG3 A;  2NPT B;  3PV1 A;  1MG8 A;  1UWM A;  2W2X D;  1DBH A;  3HRD D;  1UZX B;  4BAX A;  3KUC B;  1V80 A;  1XLP A;  2H7E A;  4L23 A;  3L13 A;  4F7Z A;  1XCG A;  2KUQ A;  3OLM D;  1NTY A;  4BZA A;  4XYC A;  2FCM A;  4WJ7 A;  1OGW A;  4NQL B;  2VSZ A;  3RYT A;  3WIM A;  1WGG A;  3NS8 A;  2KDB A;  1VZ8 A;  2PVO D;  1VBG A;  1HZ5 A;  3DBH I;  1SIF A;  4HAX B;  1BAK A;  1I7H A;  1CMX B;  3V60 A;  2FJL A;  4PK1 A;  3H6N A;  2ELA A;  4KGS A;  1V61 A;  5MPO A;  4PYZ A;  3VHT C;  1TY2 A;  2H88 B;  4XZ4 A;  1OTR B;  5KQ1 A;  2KAJ A;  2LBB A;  1Z5S B;  3ZDT A;  2ON8 A;  2CQU A;  4JK7 A;  1V5P A;  1E90 A;  1I4X A;  1JCK B;  5LXI B;  3AE1 B;  4GU2 A;  1GB1 A;  1I35 A;  2ICI A;  3G9W A;  4AOF A;  3I9V 1;  4IDI A;  2P0D A;  3RPF C;  4HKZ E;  3AE5 B;  4RCO A;  2HDE A;  5CX3 A;  2MBE A;  2Z59 B;  2RGF A;  4NJC A;  1XX0 A;  1Z2M A;  4HAT B;  2RDB C;  2V76 A;  4AJW A;  2B76 B;  2N9E B;  1C79 A;  3PHX B;  5EE0 A;  3LB8 C;  1C78 A;  1PYW D;  3T06 A;  4JKD A;  1XQQ A;  1WJ6 A;  5C6R A;  4US9 A;  5G2N A;  4ANX A;  1V89 A;  4C56 C;  1RLF A;  2K22 A;  2ABD A;  2EC1 A;  1P7E A;  3FVC A;  3FM8 C;  3ALB A;  3JYU A;  1PFD A;  1WR1 A;  2I1J A;  1BT0 A;  1LGR A;  3AED B;  1I4R A;  3M63 B;  2BF8 B;  1XD4 A;  4K3C A;  2B3A A;  5JHH A;  1GB4 A;  1WRD B;  3A98 B;  3GOE A;  3OJ3 A;  2M19 A;  1D3Z A;  1GC6 A;  1K52 A;  2IGG A;  1PLS A;  4H2A A;  1OQQ A;  1WYW B;  1YN3 A;  5C2T B;  3BZD B;  5EE1 A;  1WY8 A;  2NBW B;  2V1Y A;  1YJ1 A;  4ZRK A;  1JWA D;  2XK5 A;  2JXT A;  1DYN A;  4ILH A;  3R7Q A;  1U5E A;  2XQN M;  1FFU A;  1WX8 A;  4FAD A;  3V62 A;  2NCN A;  2WXN A;  1U2B A;  3IT6 B;  2N7J A;  2PTL A;  2IPK D;  2M56 B;  3OJ4 B;  1WXA A;  1NVI D;  2DYQ A;  2QEJ C;  2JYE A;  2WS3 B;  3HIE A;  1WF9 A;  3N20 C;  2PIA A;  1ET6 A;  1TS5 A;  1FGY A;  1XCT L;  1V97 A;  5LON B;  3UZT A;  1EF1 A;  2NTT A;  4MH8 A;  4CQN A;  2YS3 A;  2L3Z A;  1BUI C;  2KMA A;  2D11 A;  4DXF A;  4WJP A;  2KLG A;  3VVW B;  2ONQ A;  5DI9 B;  1YX5 B;  3L08 A;  4LNK A;  2KDM A;  4HLE A;  2KVZ A;  2D9W A;  3D8F A;  1T0Q C;  4RM9 A;  1L4Z B;  4MGK E;  3RNB C;  1IUE A;  2Z59 A;  2PZ1 A;  2WNM A;  3V05 A;  4PS3 A;  3ZXR A;  2DNF A;  4GB9 A;  3IG3 A;  3PRZ A;  2M17 A;  3NVW A;  2FUH B;  1WSP A;  1PMS A;  2KN4 A;  4NAW A;  2WX0 A;  2LGD A;  3L54 A;  2J7Q B;  4DHZ E;  4F7U P;  2PJH A;  1FCL A;  3SDL C;  2GCJ A;  1FXT B;  1DIK A;  3N32 A;  3AEG B;  1KTK A;  1UEF A;  2K00 A;  3CIK A;  5LOP B;  2MWS B;  4L2Y A;  1WJ1 A;  4ZHP A;  2X38 A;  3R2T A;  2L00 B;  2L0F A;  3WAM A;  4DXG A;  2IZV B;  4K3B A;  1OMW A;  2O6V B;  1GPX A;  4N6E B;  5AUK A;  4JKH A;  3TUO A;  2JRH A;  2DYN A;  1FO4 A;  2N23 A;  3KZ1 A;  1NEN B;  4M02 A;  2QSD A;  2D9X A;  4JIO U;  4KHA A;  3N1Y C;  2CU3 A;  1YOV B;  1J7A A;  1N6Z A;  1XLO A;  4MAC A;  5C3J B;  4JGH B;  1JRO A;  2KTR A;  2WP9 B;  2RSU A;  5TSS A;  1WE7 A;  4ANU A;  2D07 B;  2WXQ A;  1VZ6 A;  4EUT A;  4MGZ E;  5FKA C;  4C4V A;  2N0Y A;  4WQO B;  5BMG A;  3E56 A;  1Q5W B;  4WWP A;  3ONS A;  3R7R A;  4CHJ A;  4WVF B;  2OTX A;  2FE8 A;  1FOE A;  3N1X C;  1RWS A;  4HB0 B;  3GYP A;  2W3R A;  2YRY A;  2DTC A;  2DYO A;  4G11 A;  3AEC B;  1TS3 A;  2KVR A;  2ZNV B;  2MBH A;  4KDI C;  2VRR B;  2KDE B;  2KKC A;  3NRZ A;  1TKG A;  3Q2A C;  1TIF A;  1IGD A;  4WWO A;  1TYG B;  2ZPN A;  3V3X A;  2H7D A;  1QQR A;  1WGD A;  1WFY A;  2K8B A;  3NWF A;  4REZ A;  4JKA A;  1PFJ A;  1SB3 C;  4K1R B;  5T8I A;  1FB8 A;  3Q8A A;  2CB8 A;  2AQ1 B;  3TSS A;  2HJ1 A;  5GOW B;  1MG4 A;  4ZYN A;  4ACF A;  2MX2 A;  2WU5 B;  2N9X A;  3H7P B;  4TKN A;  5D3I B;  1T77 A;  2DZJ A;  2KC2 A;  2IY1 B;  2M0X A;  5CHW A;  3VH4 B;  4A9A A;  2FCQ A;  2GBJ A;  1WJ4 A;  4A6F B;  4YSY B;  2LHD A;  2IBI B;  5DPT A;  1F2R C;  2FNJ B;  3ODW A;  2COC A;  1J0G A;  4K2O A;  3ZVR A;  3TEY A;  4IM2 A;  1A70 A;  1MHH E;  4M8M A;  1OFF A;  2NR2 A;  1WJM A;  4DQO C;  2K6Q A;  2WXJ A;  4FHK A;  2AWT A;  2TSS A;  2Z0P A;  2OJW A;  1MVK A;  3RN9 C;  3ZIM A;  1AQC A;  5JH5 C;  1V1O A;  4E74 A;  4KZ0 A;  3APC A;  1WM3 A;  2COD A;  3DHI C;  1P9D U;  4JK8 A;  1V5O A;  1VLB A;  3W5V B;  3EHV A;  1Y5O A;  5BMH A;  3B9J A;  3EUB 2;  3RNC C;  1PGA A;  3TO1 A;  3A8P A;  4ASW C;  4C0A A;  4HKQ A;  5J3T A;  2KWU B;  2CU1 A;  5JHB A;  1E7V A;  2K6D B;  2CHW A;  2J53 A;  2D3A A;  4GDL A;  2UWQ A;  2BBC A;  4LJO B;  2WXL A;  1SIJ A;  3L10 B;  4D2K A;  1YQ4 B;  2MCN B;  2O6V A;  5FR3 A;  3H9D A;  4W9K A;  4YON A;  3NWD A;  3R66 C;  3FAH A;  2LD9 A;  3A8Q A;  4FJY A;  4HK2 A;  1KC7 A;  3DBL B;  1N62 A;  2KGX B;  1KJT A;  3P2B A;  3D8E A;  2CS4 A;  2RMM A;  2HE7 A;  3AE3 B;  4N59 A;  5IO9 A;  4KVG B;  3APF A;  1P98 A;  3FIL A;  2IO1 B;  4DIX A;  1IRS A;  4HB2 B;  5IA7 A;  1SHC A;  3RNA C;  2BB6 A;  3TIX A;  1MPE A;  2MBO A;  1ZM0 A;  2DHZ A;  4IWO A;  1ISN A;  2KWD A;  2AQ3 B;  2KHW B;  4D6W A;  3GE8 C;  3NUH B;  1L7Y A;  1FXA A;  3DBH B;  2LXA A;  1GJZ A;  5CLQ B;  4M0W B;  4A8X C;  4KIK B;  1K8R B;  4M8N A;  1BWN A;  4MJS B;  1NBF C;  3PZD A;  5H8Y E;  3PRE A;  4CHK A;  1WI1 A;  5J3Y A;  3PP2 A;  2MHJ A;  1FHO A;  2V3N A;  2MWN B;  2LWP A;  2QJL A;  3AU5 A;  1B1Z A;  2GI9 A;  3JVZ X;  2KAC A;  2KIG A;  4DXA B;  3GS2 A;  2YVC A;  2HD5 B;  1HB8 A;  2VRW B;  1I4G A;  5BYR A;  4C4V B;  2Z0E B;  1EAZ A;  1IBX A;  3V5W A;  2AYO B;  3PSE B;  3RCP A;  2DHK A;  4LLG M;  4A20 A;  5TR5 A;  2W54 A;  1AWD A;  2ZCC A;  1NTV A;  2LVO A;  3IXS A;  4MGI E;  1WGH A;  3EC8 A;  2GS0 A;  1FPY A;  4BKS A;  1ACC A;  2FIF A;  5D3D A;  1ACA A;  1ZDX A;  2OHF A;  4KGR A;  2NS5 A;  2JT4 B;  2JZP A;  4HRS A;  3AE7 B;  1BTK A;  2KCJ A;  1XEE A;  1NDD A;  4JKG A;  4C00 A;  3P7Z A;  1LFD A;  3T9L A;  2L1C A;  2LI5 A;  3AE6 B;  4KHB B;  1ZPS A;  3U30 A;  4QJ4 B;  2H89 B;  3PGE A;  1J8C A;  2ACZ B;  1HZ6 A;  1Y8R C;  3A1Q A;  2JF5 A;  4GDK A;  3HSA A;  2XBB C;  4FLH A;  5JXV A;  2LFI A;  1TGZ B;  1V86 A;  3SEB A;  3UIN B;  1JQ4 A;  1PGB A;  2GBM A;  4DX8 A;  4IM3 A;  3N3K B;  4YTN B;  2RR9 A;  3QK0 A;  2L8J A;  1NU2 A;  2ZCB A;  2W55 A;  3NY5 A;  1T6B X;  2KZR A;  3CMM B;  3LYY A;  5D3V A;  4JQW C;  2BTE A;  1XXG A;  2K3U A;  1QQG A;  4HCN B;  4WJO A;  3TEZ A;  2L52 A;  1W1G A;  2P0F A;  2W9N A;  3BK2 A;  4DWF A;  4C7Y A;  4XDC A;  2ZKM X;  2KXJ A;  2RRF A;  1H4R A;  1B9R A;  2PPH A;  1JML A;  4HEA 1;  3OAW A;  4I6L B;  5E6O A;  1WGU A;  1FD6 A;  5HKH A;  4JWS C;  3A9J A;  4G3X B;  1WX7 A;  3DVG X;  3ABV B;  4ILG B;  2PE6 B;  2J0K A;  5L95 C;  2D5G A;  1IP9 A;  3UQA A;  2UU7 A;  2KLC A;  3AXC A;  4RFB A;  3ZQ4 A;  1VCB A;  5FI1 A;  4ICU A;  1RYJ A;  2JY6 A;  3Q8F A;  1UBQ A;  2NTS A;  4XX5 A;  2VZK B;  3AEB B;  3AH7 A;  2WGS A;  1RJ2 A;  1PUT A;  4BKT A;  4IAP A;  1UF0 A;  3BWU D;  5BYQ A;  4EFO A;  3CF6 E;  5JZE B;  2IJ0 A;  2O2V A;  4GSW A;  4TQ1 A;  3BY4 B;  2HTH A;  3E9O A;  1WZ0 A;  4N58 A;  3VTW A;  3U2S C;  1VBH A;  4RH6 A;  1XOD A;  4CHM A;  2LXC A;  4ANW A;  2P0H A;  1PDX A;  2KJH B;  1FHX A;  3ZGZ A;  1J19 A;  1DDM A;  4DDG D;  4JL9 A;  4BBN C;  5CHV C;  4WH4 A;  3KVF B;  2DN6 A;  3KSY A;  2LMC A;  3X0W A;  2ZW0 A;  2IO3 B;  3UQB A;  3VOQ A;  3P4Q B;  4A6Q A;  2HTM E;  2R82 A;  3MJ5 A;  3W2D A;  2C7N B;  4RF0 A;  2R2Y A;  3GZN I;  2D3C A;  3ML4 A;  3SO6 A;  2IGD A;  2L32 A;  3ZKJ C;  2FDQ A;  1TS2 A;  2DX5 B;  2G3Q B;  1TTN A;  2GUM A;  1LXD A;  4IOI E;  4H8S A;  3JSV B;  2MLB A;  1H8C A;  1U5D A;  2AQ2 B;  3SBT A;  2KX0 A;  4RMA A;  1LW3 A;  3UIO B;  1V1P A;  5G55 A;  4W9J A;  2WU2 B;  1YX6 B;  1T0S C;  2JQR B;  1FRR A;  2GLS A;  4MT7 A;  4GN1 A;  5LG4 B;  1WJU A;  3P4S B;  3GE3 C;  3W1Y A;  3SV1 A;  3A9J B;  3RT3 B;  4F1S A;  4JKB A;  5KQ4 A;  2J42 A;  3M1I B;  4GLS C;  4M01 A;  1QIL A;  1ROE A;  2GBK A;  1IGC A;  1T0R C;  4K17 A;  1ZC3 B;  4MT5 A;  2AL6 A;  2CY5 A;  1ZUD 2;  2WQY B;  4LNN A;  2WXI A;  3U7D A;  4KSK C;  4I6N B;  2KC1 A;  2GMI C;  1X05 A;  1HB6 A;  1HTQ A;  1DOI A;  2WLB A;  3V6E B;  4HAZ B;  5M4Y B;  1ZDV A;  1DGJ A;  4S17 A;  4MGY E;  4OHJ A;  4RGT A;  2ZEQ A;  2W3S A;  5E6N A;  4QXA B;  3QHT A;  3I57 A;  3DCG A;  4KDL B;  1K5D B;  3A9K A;  4K81 A;  4Y94 A;  2Z8L A;  1VRA B;  1F0Z A;  1LB1 A;  1N3H A;  1UEL A;  3AUL A;  3HM6 X;  1P3R A;  2M1M A;  1WM2 A;  1JAL A;  2DZM A;  4XWX A;  1YD8 U;  3HW2 B;  3OG5 A;  3QC8 B;  1XLN A;  3Q14 C;  3VRA B;  3BYT B;  4KKJ A;  1GAQ B;  1YQ3 B;  3C19 A;  2IND C;  1T3Q A;  4NY0 A;  4RGO S;  4B95 A;  3NS1 A;  2BYT A;  2CRF A;  4WUR A;  3NHE B;  3QIJ A;  2NBV B;  3GZN B;  4A3O A;  2BT6 A;  2GBR A;  4GDL B;  4MSQ B;  3HK0 A;  3IVF A;  3OAN A;  3PEG A;  3IAS 1;  3QBV B;  4JE3 B;  2KJR A;  3WAN A;  4A5K A;  1SSN A;  1P6S A;  4AP4 C;  4DK5 A;  2XNA C;  4W9E A;  3U7Z A;  2BCJ A;  1NTI A;  4HSI A;  4HCP B;  2RDG A;  3NVV A;  2V9H A;  4PNK A;  4HAW B;  2LGY A;  3TBL D;  3NZS A;  2LG1 A;  1F52 A;  4PYU A;  5HE1 A;  1E8W A;  4OVZ A;  2PVG C;  4RNA A;  4BOS C;  2YLM A;  4JKE A;  1WE6 A;  3DQV A;  5DIF B;  2IFS A;  2WH5 A;  1WWT A;  2KUP A;  5HE3 A;  4HB3 B;  2CR5 A;  3ODO A;  1VR9 A;  1SJH D;  4ILJ A;  3HHM A;  3X23 A;  3O65 B;  1UNQ A;  2BPS A;  2CHX A;  2LAS A;  3P63 A;  1ENF A;  3Q8B A;  1V2Y A;  1KBL A;  2PLP A;  4Q2J A;  1ZYI A;  3ETR A;  5IRS A;  4O1N A;  3QQ8 B;  2N9K A;  1F2R I;  2M4N A;  2DWQ A;  3TL5 A;  1UPR A;  3MFG A;  2RLO A;  3RCZ A;  2MW5 A;  4JPS A;  3VUY A;  4ICV A;  3U52 E;  2N7D A;  3MJW A;  4EZK A;  4K2P A;  1E5W A;  2DFK A;  3Q8E A;  1HEZ E;  3UGB B;  2K0P A;  2BKF A;  3I3T B;  2FUG 1;  2KOX A;  2KMM A;  4AUQ C;  3DOW A;  4JKF A;  3IHP C;  2BW2 A;  3PLV A;  4D0N B;  3GP7 A;  1ZXI A;  1SE9 A;  2QDF A;  1QOF A;  4PS8 A;  2NMQ A;  1U4A A;  4WJQ A;  1L6U A;  5AEK B;  3W9C B;  2WYQ A;  1KM7 A;  3KQ4 A;  3Q69 A;  1R4M I;  1L6V A;  1U5G A;  2GRI A;  2WXO A;  1QOB A;  1W1D A;  3A4S C;  2R2Q A;  1WGK A;  1SBB B;  3VR8 B;  4GOC A;  4OT1 A;  1D5X C;  2C9W B;  1PGX A;  1EUV B;  3MTN B;  5D94 A;  1AW7 A;  2Q13 A;  3ZW3 A;  1D5M C;  3AE9 B;  4FJV B;  5HFY A;  1FNW A;  5L81 A;  3DVN U;  1FM0 D;  4LNO A;  5KHQ A;  2ROV A;  5JHG A;  1WXS A;  3T8M A;  2I1K A;  2J59 M;  3D32 A;  1FXI A;  1TJ6 A;  5C23 A;  3SHQ A;  1SXT A;  1P1A A;  2KWC A;  2G1E A;  1QF6 A;  3RZF A;  4TQ0 A;  3T3O A;  2WXF A;  5DPS A;  4OW0 A;  3WAO A;  1RFA A;  3PS6 A;  5J18 A;  4YXD B;  1KLG D;  1EU3 A;  4JWU C;  5BMI A;  2PKO A;  2NBV A;  4LCD E;  4II2 B;  4IKG A;  5DPW A;  3OWE B;  1RFK A;  5I2S A;  2LUL A;  3KH0 A;  2G45 B;  3C8Y A;  2M38 A;  4MEL A;  3RNG C;  1I2H A;  3B2G A;  2INC C;  5GXG B;  5C1Z A;  1S1Q B;  2XN9 C;  2GOW A;  3PPA A;  2AX5 A;  2ASQ A;  2OOB B;  4K7S A;  2D2Q A;  4CO7 A;  2RD0 A;  3CIR B;  3SUZ A;  3HQC A;  1TT5 B;  2L0T A;  4IG7 B;  4E3C A;  2DAJ A;  4C80 A;  4DBB A;  1JRU A;  4DHJ B;  3EA6 A;  3A4R A;  2I2Y A;  1CQV A;  4OZB A;  3QWM A;  1R4N B;  2R2O A;  2J4X A;  1TZO A;  4IFS A;  2C7H A;  3PZ8 A;  5C16 A;  2MBB B;  2WXM A;  3DVN V;  1C1Y B;  2N9L A;  1V1P B;  2I5F A;  4OSN A;  2K8C A;  2LOZ A;  5D3W A;  2PMV A;  1WGR A;  1CK1 A;  3PVU A;  1OEY J;  2KMC A;  1QLB B;  3ZLZ A;  2Y3A A;  1EVH A;  2LYD A;  4XC2 A;  5IAA C;  3O96 A;  4B0M A;  3N7C A;  5AZF A;  2YS5 A;  4BFR A;  2LUE A;  4RGN A;  3ZVV A;  5FK9 C;  2A5U A;  2YF0 A;  2KQ4 X;  4URK A;  3JSV A;  5IP4 D;  2KT7 A;  1AWE A;  1P7F A;  2LGI A;  1L0V B;  1OQN A;  3VIA A;  3V61 A;  2X8X X;  2WXR A;  3KYC D;  2OJR A;  2MBQ A;  4LDT D;  1Y56 A;  2LVQ A;  2DLW A;  1V9J A;  4GGQ A;  4N9F 4;  3UI3 A;  4ZHO A;  1WGQ A;  2V3P A;  4IWP A;  3ZTD A;  2QMT A;  5D6J B;  2LUM A;  2JUO A;  3KRW A;  4HPM B;  3PTF C;  1SEB D;  2KO3 A;  4GMX B;  2WXP A;  2LJ5 A;  3KWV A;  3MC9 A;  4W9F A;  2KAN A;  2EMS A;  3SBG A;  1ET9 A;  1WJN A;  2SAK A;  2R09 A;  4MK0 A;  1JWU D;  2ZPY A;  5HE0 A;  3CWI A;  1ZKH A;  2DEN B;  3AMZ A;  2RGN B;  1EO6 A;  1RRP B;  2CHZ A;  5D3Y A;  3DXC A;  2K9X A;  1SF0 A;  1PQS A;  3QAQ A;  3EPY A;  4NJ7 A;  4IW0 A;  1Y19 B;  1F9J A;  1XO3 A;  2BVC A;  1E0Z A;  1WMH A;  2WX1 A;  2L76 A;  3KW5 B;  4X57 B;  2GBN A;  2D9Z A;  4JLC A;  5D7G A;  2BWF A;  4P16 A;  4FA6 A;  2PE9 A;  1W1H A;  2K2J A;  4TYZ A;  3SU8 X;  2Z13 A;  3Q6B A;  1R4N I;  4OVV A;  3S2A A;  4NAM A;  1C76 A;  1GUA B;  4HAY B;  4II3 B;  5AUI A;  2K5P A;  4AWJ A;  2D10 A;  2UZR A;  2GCL A;  2XK5 B;  3AEF B;  1YMH E;  2WWZ A;  1DRO A;  3B0A A;  4MEM A;  3SYX A;  2Z14 A;  1NYR A;  1M4V A;  1C4A A;  1UWX A;  2KD0 A;  2ZVO A;  3BII D;  5JP4 A;  3TVV A;  2JWU A;  3QJZ A;  2RPV A;  2MSE D;  3ZUN A;  1UNR A;  2DHI A;  1N5W A;  3NZ3 A;  2CKH B;  2IGH A;  1B55 A;  2ROZ B;  1MI1 A;  2C7M B;  3TEW A;  2DYB A;  2HTH B;  2LJI A;  2NBU A;  1T5X D;  3E9S A;  3ZJU A;  2N9P C;  3WYF B;  2V4L A;  3DBR B;  4HDQ A;  4LNI A;  1SGH A;  2D4Q A;  1C4P A;  4EZJ A;  1JW9 D;  3L4P A;  4BBK A;  2D9V A;  3WA0 A;  4NNJ B;  2FID A;  3ZNI D;  4WQM A;  3UIP B;  4M0W A;  4W9C A;  3H8H A;  4US8 A;  2KX3 A;  3R2I A;  3JW0 X;  4HPL B;  2AL3 A;  2BS2 B;  2MRP A;  4ZRI A;  3PVL A;  3Q3F A;  2DLB A;  4AS1 A;  3H1U A;  3RD2 A;  2C5L C;  3U8Z A;  1KZ7 A;  2D3B A;  1UBI A;  5HE2 A;  3VQI A;  1L2N A;  2LKO A;  1Q1O A;  1MK9 B;  2FCS A;  2W2X C;  3BVZ A;  4XWT A;  3RI7 C;  4OVU A;  2JZZ A;  3BYY B;  2KN5 A;  3NVY A;  4YL8 A;  4KX6 B;  3D8D A;  1IBX B;  4KKI A;  4IOY X;  1X11 A;  3VH3 B;  1YQB A;  2MKR A;  1V8C A;  3KWL A;  4CSQ A;  1E8Y A;  3AV8 A;  2MP2 A;  4R3D A;  3APD A;  1H10 A;  3Q3J A;  2D3G A;  3MHZ A;  3AE4 B;  3IAM 1;  3PVW A;  3RZW C;  1TY0 A;  3ZTC A;  4PQ0 A;  4LK0 M;  2IYD B;  3FEH A;  2DA0 A;  2M14 A;  1UGM A;  3DCX A;  2NPT A;  1C77 A;  2MDX A;  2WXH A;  2VH2 A;  2Q5W D; 
#chains in the Genus database with same CATH homology
 4HXD A;  2G4S A;  4GIV A;  2BYF A;  4HHV A;  1XR0 B;  5IJM A;  3N30 A;  1I7A A;  4MJS A;  3QAR A;  1MIZ B;  2YT0 A;  2DAF A;  2DYM A;  2JZ3 B;  2KDI A;  4RM8 A;  3TJP A;  2UVM A;  3DBR I;  1KOT A;  1J0W A;  1V88 A;  2IYB A;  3BJI A;  4G0N B;  4EJN A;  1E7U A;  3NZU A;  4P7I A;  2HJ8 A;  3C0R B;  4Z2N A;  4EOY A;  5C5B A;  2DX5 A;  2DKP A;  4EZL A;  1Q0W B;  4ANV A;  3P6A A;  2EKE C;  2YT1 A;  5J17 A;  2ZNV C;  3ZNH B;  4B9K A;  1WH3 A;  4WWN A;  4W9I A;  4DBG A;  5L83 A;  2K8H A;  2ZJD A;  2Y5B B;  1WMH B;  2LVP A;  1BTN A;  3DPD A;  1FHW A;  1KLV A;  1YIW A;  4HVB A;  2P8V A;  3V6C B;  1XT9 B;  4LJP B;  5D2M B;  5C79 A;  4HAV B;  5DPR A;  1V5T A;  3M62 B;  4HB4 B;  4A6H A;  2NZ8 B;  2I5C A;  2JP2 A;  4MY6 A;  2CAY A;  4BKG A;  4JKG B;  4CYE A;  4FN2 A;  1UD7 A;  2IY0 B;  1WVH A;  2KDF B;  2LRU A;  3TW1 A;  2DIK A;  3PSC A;  2LGX A;  5EDS A;  2DKQ A;  2JVC A;  3PT2 B;  4KV2 A;  3PLU A;  2Y8F A;  3KRX A;  2J0M A;  2N4F A;  1OQY A;  4E71 A;  4EMO A;  2K39 A;  3KUD B;  1M94 A;  5J2R A;  1IPG A;  2UZS A;  2Z0O A;  3LJU X;  1MK7 B;  2DZK A;  2V3S A;  3H7P A;  1M7R A;  5D27 A;  1V49 A;  3FSS A;  3B1L X;  2BYE A;  4WJN A;  3ZNG C;  3PG7 A;  4BOZ B;  2O2V B;  3DVG Y;  2C60 A;  2Z0D B;  1V5M A;  4KAX B;  3A33 B;  2ADZ A;  3ENE A;  4JK9 A;  3CST A;  5DHA B;  3KUZ A;  5EFX A;  3VFK A;  3WAL A;  2KK8 A;  3TMP B;  4EEW A;  3PHW B;  5J3Q A;  2JRI B;  2KFK A;  3VTU A;  3ULC A;  3NSU A;  1X1G A;  4NQK E;  1K5G B;  4PS7 A;  2G4D B;  2KWV B;  1NVL A;  2JPH A;  3AJ4 A;  2K2U A;  3K9O B;  1AAR A;  2RUK B;  3L16 A;  1IYF A;  4ZRJ A;  2HRJ A;  1GNU A;  2JWZ A;  1ZGU B;  1UPQ A;  2N1W A;  3QCA A;  5LXH A;  4KSL C;  4LDT B;  3MDB C;  5GMV A;  2IO2 B;  1XD3 B;  4K7W A;  3LJ3 A;  1ZW7 A;  2COA A;  5CTR C;  1QC6 A;  2RNR B;  1P0R A;  3DBS A;  2RQ1 A;  1G6J A;  1KZG A;  4BVU C;  2NVU I;  2Y8G A;  3KYD D;  1KI1 B;  3E9P A;  1WGY A;  1DDW A;  2DX1 A;  3SNH A;  5DH9 B;  3TFM A;  1VD2 A;  4KZC A;  2MQJ A;  1Q67 A;  1V6E A;  1JDE A;  5E6P A;  5AZH A;  1V5U A;  2O6V D;  3GYO A;  3HM3 A;  3HIZ A;  4HDO A;  3TCA A;  3L17 A;  4FBJ B;  3BIN A;  1WXV A;  3VDZ A;  2BWE S;  1WIA A;  3VUX A;  1TZ1 A;  3DDC B;  1QZE A;  1OY2 A;  2MA9 B;  1ZVR A;  4GMV A;  5CLL B;  4GZU A;  2Y7B A;  1ZC4 B;  1E8X A;  1WI0 A;  4B6W A;  3ENB A;  2COP A;  2DZI A;  3LDZ E;  4WAA A;  5KHO A;  4BBN F;  2KJ6 A;  3W1S C;  4MSM B;  5JVL A;  2KTF A;  3UF8 A;  2NMB A;  4GXB A;  3ZNZ B;  3ECI A;  2MP2 B;  3ODX A;  5C5B B;  4IM0 A;  3SD5 A;  1HE8 A;  2JXX A;  2K1F A;  2N1V A;  3M95 A;  3QWZ B;  1FGZ A;  5DCN A;  2LRW A;  3H7S A;  4F7G A;  2OQB A;  4Z2M B;  3AI5 A;  2VKI A;  2COF A;  3VUW A;  4BKS D;  1M7E A;  3EFU A;  1HBK A;  1OEY A;  2QHO A;  4TUU A;  5LLI A;  2EMT A;  5AZG A;  4A6K A;  1P3Q U;  4DHZ B;  2KFJ A;  2A4Z A;  1MIX A;  2Z0Q A;  2X0S A;  4EKU A;  2REX A;  1Z87 A;  1T0Y A;  4GDK B;  2BYV E;  2L2I A;  3DXD A;  4NPN A;  3EEC A;  2X18 A;  4MM3 A;  1MAI A;  1U5F A;  1FAO A;  4JKC A;  3IBE A;  4W9D A;  4MH0 E;  2YS1 A;  2RVB B;  2M8S A;  4FHJ A;  2CY4 A;  2XEW A;  2N7E A;  2UYZ B;  4DHJ D;  1S3S G;  2BGF A;  4GPT B;  1TBE A;  4W9G A;  3RUL A;  2R0D A;  4IC7 B;  4MDK E;  2J0J A;  1WR6 E;  5JHA A;  1ZSQ A;  1GGO A;  4HJK A;  3QX1 A;  4TV3 A;  4B6H A;  4G50 A;  1UH6 A;  3KY9 A;  1X1F A;  5CHF A;  4NAW B;  3IFW B;  4K7U A;  3DXE A;  3ML9 A;  2KNB A;  2PEA A;  3VAW A;  3A9K B;  2YSZ A;  2ZVN A;  2KQ7 A;  2WDT B;  4WSF A;  2AEH A;  4W9H A;  4HWI B;  4IUM B;  3W1S A;  2GJY A;  4FJZ A;  3QA8 A;  3ZDM C;  4NJ6 A;  1RRB A;  1MKE A;  2KTR B;  3CXB B;  4W9L A;  2RSG A;  1U27 A;  5D3X A;  4A6F A;  3B08 A;  4ZDV A;  3MPX A;  2MFQ A;  2D9Y A;  2KQS A;  4IWQ A;  3PRM B;  2G35 A;  3ZRC A;  1XKE A;  2ZZP B;  4L6E A;  1GC7 A;  1RAX A;  4NSW A;  3ZO5 B;  1V81 A;  1I42 A;  1MPH A;  1WXM A;  3AU4 A;  3VTV A;  5BO4 B;  3M3J A;  3WAP A;  1E8Z A;  3F0W A;  4HAU B;  2FAZ A;  5DHF B;  3CSF A;  2ELB A;  1A5R A;  2RPQ A;  2BKR B;  3FLV A;  4KIK A;  2L05 A;  2QKL A;  3MHS D;  3F5R A;  3VXW A;  4A3P A;  2KFK B;  2L7R A;  3E66 A;  1NI2 A;  1UNP A;  4J6I A;  5JLJ B;  2E2X A;  4KHO A;  3ZRF A;  5FR6 A;  1ST7 A;  1X1M A;  1TXD A;  4DDI D;  1TQZ A;  1EGX A;  5FI0 A;  2K25 A;  4I6P A;  2FJ9 A;  3K9P B;  1LQB A;  4F8C B;  1X86 A;  1DDV A;  3L0W B;  4F7H A;  3PRP B;  2QKM A;  2EJ8 A;  4FUL A;  4DX9 0;  2LZ6 A;  3FP5 A;  4AJY B;  1EF5 A;  2W2W A;  1WZ3 A;  1P5T A;  3R3M A;  3ULB A;  1C3T A;  2DHJ A;  1U29 A;  5KCV A;  2LOX A;  1WX9 A;  1WG7 A;  3DBL I;  3E9L A;  3NOB A;  3A1Q B;  1LM8 B;  3RUI B;  2FCN A;  3ML8 A;  2IO0 B;  1GG3 A;  2NPT B;  3PV1 A;  1MG8 A;  2W2X D;  1DBH A;  1UZX B;  3KUC B;  1V80 A;  2H7E A;  3L13 A;  4F7Z A;  1XCG A;  3OLM D;  1NTY A;  2FCM A;  4WJ7 A;  1OGW A;  4NQL B;  2VSZ A;  3RYT A;  3WIM A;  1WGG A;  3NS8 A;  2KDB A;  1VBG A;  3DBH I;  1SIF A;  4HAX B;  1BAK A;  1CMX B;  3V60 A;  2FJL A;  3H6N A;  2ELA A;  1V61 A;  4PYZ A;  3VHT C;  4XZ4 A;  1OTR B;  5KQ1 A;  2LBB A;  1Z5S B;  3ZDT A;  2CQU A;  4JK7 A;  1V5P A;  1E90 A;  5LXI B;  4GU2 A;  1I35 A;  3G9W A;  4AOF A;  2P0D A;  5CX3 A;  2MBE A;  2Z59 B;  2RGF A;  1XX0 A;  1Z2M A;  4HAT B;  4AJW A;  2V76 A;  2N9E B;  3PHX B;  3T06 A;  4JKD A;  1XQQ A;  1WJ6 A;  5C6R A;  5G2N A;  4ANX A;  1V89 A;  1RLF A;  2ABD A;  2EC1 A;  3FM8 C;  3ALB A;  3JYU A;  1WR1 A;  2I1J A;  1BT0 A;  3M63 B;  2BF8 B;  1XD4 A;  2B3A A;  5JHH A;  1WRD B;  3A98 B;  3GOE A;  3OJ3 A;  1D3Z A;  1GC6 A;  1PLS A;  1WYW B;  1WY8 A;  2NBW B;  2V1Y A;  1YJ1 A;  4ZRK A;  2XK5 A;  1DYN A;  4ILH A;  3R7Q A;  1U5E A;  2XQN M;  1WX8 A;  4FAD A;  3V62 A;  2NCN A;  1U2B A;  3OJ4 B;  1WXA A;  2DYQ A;  1WF9 A;  1FGY A;  5LON B;  3UZT A;  1EF1 A;  2YS3 A;  2L3Z A;  2KMA A;  2D11 A;  4WJP A;  2KLG A;  3VVW B;  5DI9 B;  1YX5 B;  3L08 A;  4HLE A;  2D9W A;  3D8F A;  4RM9 A;  4MGK E;  2PZ1 A;  4PS3 A;  4GB9 A;  3IG3 A;  3PRZ A;  2M17 A;  2FUH B;  1PMS A;  4NAW A;  2LGD A;  2WX0 A;  3L54 A;  2J7Q B;  4DHZ E;  4F7U P;  2PJH A;  3SDL C;  2GCJ A;  1FXT B;  1DIK A;  3N32 A;  1UEF A;  2K00 A;  3CIK A;  5LOP B;  2MWS B;  1WJ1 A;  2L00 B;  2L0F A;  3WAM A;  2IZV B;  1OMW A;  2O6V B;  4JKH A;  2DYN A;  2JRH A;  2N23 A;  3KZ1 A;  2D9X A;  4JIO U;  4KHA A;  4JGH B;  2KTR A;  2RSU A;  1WE7 A;  4ANU A;  2D07 B;  4EUT A;  4MGZ E;  2N0Y A;  4WQO B;  1Q5W B;  3R7R A;  3ONS A;  4WWP A;  4CHJ A;  4WVF B;  2OTX A;  1FOE A;  4HB0 B;  3GYP A;  2YRY A;  2DTC A;  2DYO A;  4G11 A;  2KVR A;  2ZNV B;  2MBH A;  4KDI C;  2VRR B;  2KDE B;  2KKC A;  4WWO A;  2ZPN A;  2H7D A;  1WGD A;  1WFY A;  2K8B A;  4JKA A;  1PFJ A;  4K1R B;  1FB8 A;  2CB8 A;  5GOW B;  4ZYN A;  2MX2 A;  2N9X A;  3H7P B;  4TKN A;  2DZJ A;  2KC2 A;  2IY1 B;  2M0X A;  5CHW A;  3VH4 B;  2FCQ A;  2GBJ A;  1WJ4 A;  4A6F B;  2IBI B;  5DPT A;  2FNJ B;  3ODW A;  2COC A;  1J0G A;  4K2O A;  3ZVR A;  4IM2 A;  4M8M A;  2NR2 A;  1WJM A;  2K6Q A;  4FHK A;  2AWT A;  2Z0P A;  3ZIM A;  1AQC A;  5JH5 C;  4E74 A;  4KZ0 A;  3APC A;  1WM3 A;  2COD A;  1P9D U;  4JK8 A;  1V5O A;  3EHV A;  1Y5O A;  3TO1 A;  3A8P A;  4ASW C;  4C0A A;  5J3T A;  2KWU B;  2CU1 A;  5JHB A;  1E7V A;  2K6D B;  2CHW A;  4GDL A;  2UWQ A;  4LJO B;  3L10 B;  2MCN B;  2O6V A;  3H9D A;  4W9K A;  4YON A;  3R66 C;  2LD9 A;  3A8Q A;  4FJY A;  4HK2 A;  1KC7 A;  2KGX B;  1KJT A;  3P2B A;  3D8E A;  2CS4 A;  2HE7 A;  4KVG B;  3APF A;  1P98 A;  2IO1 B;  1IRS A;  4HB2 B;  5IA7 A;  1SHC A;  3TIX A;  2MBO A;  1ZM0 A;  2DHZ A;  4IWO A;  1ISN A;  2KHW B;  1L7Y A;  2LXA A;  1GJZ A;  5CLQ B;  4M0W B;  4KIK B;  1K8R B;  4M8N A;  1BWN A;  4MJS B;  1NBF C;  3PZD A;  3PRE A;  4CHK A;  1WI1 A;  5J3Y A;  3PP2 A;  1FHO A;  2MWN B;  2LWP A;  3AU5 A;  3JVZ X;  4DXA B;  2YVC A;  2HD5 B;  1HB8 A;  2VRW B;  2Z0E B;  1EAZ A;  3V5W A;  2AYO B;  3PSE B;  3RCP A;  2DHK A;  4A20 A;  5TR5 A;  2ZCC A;  1NTV A;  2LVO A;  4MGI E;  1WGH A;  3EC8 A;  2GS0 A;  4BKS A;  2FIF A;  1ACA A;  2NS5 A;  2JT4 B;  1BTK A;  2KCJ A;  1NDD A;  4JKG A;  3P7Z A;  1LFD A;  3T9L A;  2L1C A;  2LI5 A;  4KHB B;  3U30 A;  3PGE A;  1J8C A;  1Y8R C;  3A1Q A;  2JF5 A;  4GDK A;  2XBB C;  4FLH A;  1TGZ B;  1V86 A;  3UIN B;  2GBM A;  4DX8 A;  4IM3 A;  3N3K B;  2RR9 A;  3QK0 A;  2L8J A;  1NU2 A;  2ZCB A;  3NY5 A;  2KZR A;  3CMM B;  5D3V A;  4JQW C;  1QQG A;  4HCN B;  4WJO A;  1W1G A;  2P0F A;  2W9N A;  4DWF A;  2KXJ A;  1H4R A;  2PPH A;  3OAW A;  4I6L B;  5E6O A;  1WGU A;  5HKH A;  3A9J A;  4G3X B;  1WX7 A;  3DVG X;  4ILG B;  2PE6 B;  5L95 C;  2J0K A;  1IP9 A;  3UQA A;  2KLC A;  3AXC A;  1VCB A;  5FI1 A;  4ICU A;  2JY6 A;  1UBQ A;  4XX5 A;  1RJ2 A;  4BKT A;  4IAP A;  4EFO A;  3CF6 E;  5JZE B;  2O2V A;  4GSW A;  4TQ1 A;  3BY4 B;  2HTH A;  3E9O A;  1WZ0 A;  3VTW A;  1VBH A;  1XOD A;  4CHM A;  2LXC A;  4ANW A;  2P0H A;  2KJH B;  1FHX A;  1J19 A;  1DDM A;  4DDG D;  4JL9 A;  4BBN C;  5CHV C;  3KVF B;  2DN6 A;  3KSY A;  3X0W A;  2IO3 B;  3UQB A;  3VOQ A;  2R82 A;  2C7N B;  3GZN I;  3ML4 A;  3SO6 A;  3ZKJ C;  2FDQ A;  2DX5 B;  2G3Q B;  1TTN A;  1LXD A;  4H8S A;  3JSV B;  1H8C A;  2MLB A;  1U5D A;  2KX0 A;  3SBT A;  4RMA A;  1LW3 A;  3UIO B;  5G55 A;  4W9J A;  1YX6 B;  4MT7 A;  4GN1 A;  1WJU A;  3W1Y A;  3SV1 A;  3A9J B;  3RT3 B;  4F1S A;  4JKB A;  5KQ4 A;  3M1I B;  2GBK A;  4K17 A;  1ZC3 B;  2AL6 A;  2CY5 A;  3U7D A;  4KSK C;  4I6N B;  2KC1 A;  2GMI C;  1X05 A;  1HB6 A;  3V6E B;  4HAZ B;  4MGY E;  2ZEQ A;  5E6N A;  3QHT A;  3DCG A;  4KDL B;  1K5D B;  3A9K A;  4K81 A;  4Y94 A;  1LB1 A;  1N3H A;  1UEL A;  3AUL A;  3HM6 X;  1P3R A;  2M1M A;  1WM2 A;  2DZM A;  4XWX A;  1YD8 U;  3HW2 B;  3QC8 B;  4NY0 A;  4B95 A;  2CRF A;  3NHE B;  3QIJ A;  2NBV B;  4A3O A;  2GBR A;  4GDL B;  4MSQ B;  3HK0 A;  3IVF A;  3OAN A;  3PEG A;  3QBV B;  2KJR A;  3WAN A;  4A5K A;  1P6S A;  4AP4 C;  4DK5 A;  4W9E A;  2BCJ A;  1NTI A;  4HCP B;  4PNK A;  4HAW B;  2LGY A;  3TBL D;  3NZS A;  2LG1 A;  4PYU A;  5HE1 A;  1E8W A;  4BOS C;  2YLM A;  4JKE A;  1WE6 A;  3DQV A;  5DIF B;  2IFS A;  2WH5 A;  2KUP A;  5HE3 A;  4HB3 B;  2CR5 A;  3ODO A;  4ILJ A;  3HHM A;  3X23 A;  3O65 B;  1UNQ A;  2BPS A;  2CHX A;  2LAS A;  1V2Y A;  1KBL A;  3QQ8 B;  2M4N A;  3TL5 A;  1UPR A;  2RLO A;  3RCZ A;  2MW5 A;  3VUY A;  4ICV A;  2N7D A;  3MJW A;  4EZK A;  4K2P A;  1E5W A;  2DFK A;  3UGB B;  2BKF A;  3I3T B;  2KOX A;  4AUQ C;  3DOW A;  4JKF A;  3IHP C;  3PLV A;  4D0N B;  1SE9 A;  4PS8 A;  1U4A A;  4WJQ A;  5AEK B;  2WYQ A;  1KM7 A;  1R4M I;  1U5G A;  1W1D A;  3A4S C;  2R2Q A;  4GOC A;  2C9W B;  1EUV B;  3MTN B;  5D94 A;  2Q13 A;  3ZW3 A;  4FJV B;  3DVN U;  5L81 A;  5KHQ A;  2ROV A;  5JHG A;  1WXS A;  3T8M A;  2I1K A;  2J59 M;  3D32 A;  1TJ6 A;  5C23 A;  3SHQ A;  1P1A A;  2KWC A;  3RZF A;  4TQ0 A;  5DPS A;  3WAO A;  1RFA A;  3PS6 A;  5J18 A;  4LCD E;  4II2 B;  5DPW A;  2LUL A;  3KH0 A;  2G45 B;  2M38 A;  4MEL A;  1I2H A;  5C1Z A;  1S1Q B;  2GOW A;  3PPA A;  2ASQ A;  2OOB B;  4K7S A;  2D2Q A;  4CO7 A;  2RD0 A;  3SUZ A;  4E3C A;  3HQC A;  2L0T A;  4IG7 B;  2DAJ A;  4DBB A;  1JRU A;  4DHJ B;  3A4R A;  3QWM A;  2R2O A;  4IFS A;  2C7H A;  5C16 A;  2MBB B;  3DVN V;  1C1Y B;  2I5F A;  2K8C A;  2LOZ A;  5D3W A;  1WGR A;  3PVU A;  1OEY J;  2KMC A;  3ZLZ A;  1EVH A;  2LYD A;  4XC2 A;  5IAA C;  3O96 A;  3N7C A;  5AZF A;  2YS5 A;  4BFR A;  2LUE A;  3ZVV A;  2A5U A;  2YF0 A;  4URK A;  3JSV A;  1AWE A;  1OQN A;  3VIA A;  3V61 A;  3KYC D;  2OJR A;  2MBQ A;  4LDT D;  2LVQ A;  2DLW A;  1V9J A;  4GGQ A;  4N9F 4;  1WGQ A;  4IWP A;  3ZTD A;  5D6J B;  2JUO A;  3KRW A;  4HPM B;  3PTF C;  2KO3 A;  4GMX B;  2LJ5 A;  4W9F A;  2KAN A;  2EMS A;  3SBG A;  1WJN A;  2R09 A;  4MK0 A;  2ZPY A;  5HE0 A;  1ZKH A;  2DEN B;  2RGN B;  1EO6 A;  1RRP B;  2CHZ A;  5D3Y A;  3DXC A;  1PQS A;  3QAQ A;  3EPY A;  4NJ7 A;  4IW0 A;  1Y19 B;  1F9J A;  1WMH A;  2WX1 A;  2L76 A;  3KW5 B;  4X57 B;  2GBN A;  2D9Z A;  4JLC A;  5D7G A;  2BWF A;  4FA6 A;  2PE9 A;  1W1H A;  2K2J A;  4TYZ A;  3SU8 X;  1R4N I;  4OVV A;  3S2A A;  1GUA B;  4HAY B;  4II3 B;  4AWJ A;  2D10 A;  2UZR A;  2GCL A;  2XK5 B;  2WWZ A;  1DRO A;  3B0A A;  4MEM A;  3SYX A;  2KD0 A;  2ZVO A;  5JP4 A;  3TVV A;  3QJZ A;  2MSE D;  3ZUN A;  1UNR A;  2DHI A;  2CKH B;  1B55 A;  2ROZ B;  2C7M B;  2DYB A;  2HTH B;  2NBU A;  2N9P C;  3WYF B;  2V4L A;  4HDQ A;  1SGH A;  2D4Q A;  4EZJ A;  4BBK A;  2D9V A;  3WA0 A;  3ZNI D;  2FID A;  4NNJ B;  3UIP B;  4W9C A;  2KX3 A;  3JW0 X;  4HPL B;  2AL3 A;  2MRP A;  4ZRI A;  3PVL A;  3Q3F A;  3H1U A;  3RD2 A;  2C5L C;  3U8Z A;  1KZ7 A;  1UBI A;  5HE2 A;  3VQI A;  1L2N A;  2LKO A;  1Q1O A;  1MK9 B;  2FCS A;  2W2X C;  4OVU A;  2JZZ A;  2KN5 A;  4YL8 A;  3D8D A;  4IOY X;  1X11 A;  3VH3 B;  1YQB A;  2MKR A;  1E8Y A;  2MP2 A;  3APD A;  1H10 A;  3Q3J A;  2D3G A;  3PVW A;  3RZW C;  3ZTC A;  4PQ0 A;  2IYD B;  3FEH A;  2DA0 A;  2M14 A;  1UGM A;  2NPT A;  2MDX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...