4YL8A

Crystal structure of the crumbs/moesin complex
Total Genus 93
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
93
sequence length
296
structure length
296
Chain Sequence
b'MPKTISVRVTTMDAELEFAIQPNTTGKQLFDQVVKTIGLREVWFFGLQYQDTKAFSTWLKLNKKVTAQDVRKESPLLFKFRAKFYPEDVSEELIQDITQRLFFLQVKEGILNDDIYCPPETAVLLASYAVQSKYGDFNKEVHKSGYLAGDKLLPQRVLEQHKLNKDQWEERIQVWHEEHRGMLREDAVLEYLKIAQDLEMYGVNYFSIKNKKGSELWLGVDALGLNIYEQNDRLTPKIGFPWSEIRNISFNDKKFVIKPIDKKAPDFVFYAPRLRINKRILALCMGNHELYMRRRK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Moesin
publication title Structural Basis for the Phosphorylation-regulated Interaction between the Cytoplasmic Tail of Cell Polarity Protein Crumbs and the Actin-binding Protein Moesin
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein binding
total genus 93
structure length 296
sequence length 296
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00373 FERM_M FERM central domain
A PF09379 FERM_N FERM N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.80.10 Mainly Alpha Up-down Bundle Acyl-CoA Binding Protein Acyl-CoA Binding Protein 4yl8A02
2.30.29.30 Mainly Beta Roll PH-domain like Pleckstrin-homology domain (PH domain)/Phosphotyrosine-binding domain (PTB) 4yl8A03
3.10.20.90 Alpha Beta Roll Ubiquitin-like (UB roll) Phosphatidylinositol 3-kinase Catalytic Subunit; Chain A, domain 1 4yl8A01
2FCMA 2K8HA 3VFKA 4F7ZA 2JZZA 3RD2A 3SNHA 4WQOB 3ZRFA 2GMIC 3QHTA 2BKRB 3M3JA 5CLQB 1KLVA 1IRSA 4ANXA 4KHOA 1UNPA 3WAOA 4WVFB 2ZEQA 5HE0A 4BKSA 2LVPA 2K2JA 3HM6X 3NZUA 1W1HA 4KSKC 1ZC4B 1YD8U 2PJHA 3PLVA 3KRXA 4HDOA 4KV2A 1KJTA 4BVUC 3TIXA 4BBKA 1M94A 3A1QA 2G35A 2KJRA 4IOYX 1X1GA 2COAA 2JT4B 1OQYA 4NAWB 3A33B 2OJRA 3VAWA 4KAXB 1WZ3A 1WM2A 3RCPA 3QWZB 1WGDA 1E7VA 4RM9A 1WXAA 3KVFB 4FLHA 1E8XA 3PS6A 1PMSA 4II2B 1Q67A 1FGZA 5DI9B 2EKEC 3V6EB 2KLCA 4A3OA 2PE6B 2DHKA 3ODXA 1V5OA 1ZM0A 3A4RA 2MA9B 4IWOA 2Q13A 2YF0A 1IYFA 2LRWA 4II3B 5LXIB 2D11A 4NPNA 4ZYNA 4PS3A 4GIVA 3PSEB 4JL9A 2H7DA 4I6LB 4ZDVA 1ZSQA 2P0DA 2DAFA 3D8FA 1U5GA 1ZGUB 3LJ3A 3H7SA 1JRUA 2NVUI 3H7PB 5CX3A 2Y8FA 1ST7A 4TKNA 1DDVA 2CQUA 4W9IA 2NCNA 5HE1A 4MGYE 1YQBA 4DHZE 5D3WA 4LCDE 2AL6A 4A5KA 5D3YA 4NSWA 3L54A 1WYWB 5E6PA 4N9F4 1S3SG 3VVWB 1EUVB 4JLCA 1WJ1A 2KWVB 1B55A 1PQSA 1MIZB 2MWNB 3VIAA 1V2YA 2P0FA 3QIJA 1V5PA 3PG7A 3M62B 2CHWA 1HB6A 4DHJD 1WGGA 5JH5C 1GC6A 4FHJA 1G6JA 4MM3A 2KWUB 2RPQA 1V88A 2D9VA 1H4RA 4TV3A 2LG1A 4PS8A 2MFQA 4NY0A 2L0TA 2XBBC 3JYUA 2GOWA 2ZJDA 1XKEA 4HAYB 3A9JA 1W1DA 2UZSA 2LWPA 1WMHA 3N3KB 2BF8B 1WFYA 1XCGA 1X1MA 3U30A 3ODWA 3A1QB 4WWOA 3APDA 4A20A 1UELA 1UGMA 1MK9B 3PHWB 3X0WA 3NHEB 1UPQA 3DXDA 1VCBA 4JIOU 4EJNA 1TTNA 2JZ3B 3GYOA 1L7YA 2JXXA 2GCJA 2YS3A 1XR0B 2J0MA 2N1WA 3VUWA 4FHKA 4W9CA 3VXWA 2HJ8A 4DBGA 2KGXB 2OQBA 2LXAA 4EUTA 3NS8A 4W9FA 4B6HA 5IAAC 2FJ9A 3A8PA 1OGWA 2KWCA 2LJ5A 1FOEA 5CHVC 3WAPA 3DXCA 4K7WA 3UIPB 1RRPB 3OANA 2KFKA 5C6RA 2JVCA 1X1FA 4WJQA 1NBFC 1Z2MA 2LKOA 4JQWC 2KUPA 4K81A 2MBEA 4PQ0A 3P2BA 1SE9A 3ZO5B 2FCSA 1OTRB 4NQKE 5D2MB 1WJMA 2XQNM 5J3QA 4HLEA 4E71A 1U2BA 4ANUA 1I35A 4F7HA 1NTVA 4FBJB 2Y5BB 3PV1A 2V4LA 2YSZA 4W9HA 2DHJA 2M17A 1EF1A 1V80A 2YS1A 3QC8B 2Z0PA 2NS5A 5JHBA 1RFAA 5BO4B 1WR6E 2DX5A 5LOPB 2G4DB 2IZVB 2R09A 3PZDA 4GDKA 2DZIA 2KDBA 2EMTA 2KK8A 1XX0A 2D9WA 2UWQA 3B0AA 4MGIE 2WWZA 3NSUA 3N7CA 4CHJA 4GB9A 3DQVA 2QKMA 3AI5A 3KUDB 1NVLA 3MPXA 2OOBB 3HIZA 4TUUA 3R3MA 1WMHB 3TO1A 1J8CA 2HTHA 5KCVA 4BKTA 5CHFA 2IO1B 4K17A 3JW0X 4TYZA 1I7AA 2PZ1A 1MK7B 4LJPB 1N3HA 5JZEB 2O2VA 4MDKE 2Z0QA 4KDIC 2L1CA 2KTRA 1WY8A 2I1JA 2KDEB 3RYTA 2BYFA 3IVFA 3QWMA 4IWPA 2COFA 2IO2B 4MELA 3V5WA 2COCA 4LJOB 4BOZB 4GMVA 4HB0B 4EZLA 3ENEA 3U7DA 2KC2A 1KOTA 2GJYA 2N7EA 4M0WB 2NMBA 3ZLZA 3P7ZA 1I2HA 2XEWA 3JSVA 3MJWA 5GOWB 4M8MA 1U5FA 2MCNB 4TQ0A 3H6NA 2MBBB 1MAIA 4A3PA 3L13A 2CB8A 2N1VA 2AYOB 5EFXA 3BY4B 4DXAB 1MKEA 2ASQA 4DX8A 3H7PA 2GCLA 3TCAA 2WYQA 4CYEA 2B3AA 4OVVA 1GJZA 1UD7A 4CHKA 4HK2A 4MK0A 1FXTB 1GG3A 2IFSA 3AJ4A 2FJLA 5FI0A 1WRDB 1WI0A 1YJ1A 4XWXA 1WGQA 1P98A 2M1MA 1D3ZA 4M8NA 2DX5B 1K8RB 2HD5B 3NOBA 2D3GA 4RM8A 4MT7A 4GOCA 5GMVA 1WI1A 1X05A 5HE2A 2K00A 2C7MB 4KHBB 2YS5A 2Z0EB 4ANVA 4MY6A 2KANA 1V5TA 1W1GA 2UVMA 3IG3A 2C5LC 2O6VA 1L2NA 4WAAA 2K8CA 5AZGA 1CMXB 3SUZA 4DHZB 5C23A 4XX5A 3CIKA 1ZW7A 2RNRB 1WXMA 3WAMA 4KVGB 3CF6E 2M38A 1NTIA 4KDLB 1TZ1A 4HAVB 3D32A 2MSED 5FR6A 2HTHB 3UQBA 2IYBA 1LB1A 4IM3A 2AL3A 2JRHA 4DDGD 3H9DA 2O2VB 1WJNA 4IFSA 2LULA 2L7RA 2KTRB 1V61A 4H8SA 5LONB 2KC1A 4HPLB 4Z2MB 1UNQA 1GNUA 3PGEA 4GU2A 3RULA 2JP2A 1UPRA 2O6VD 2CHZA 3M95A 2G45B 3MDBC 2CY4A 2LOZA 4A6KA 4EMOA 2K6DB 1QZEA 3JSVB 4Y94A 3G9WA 1E8ZA 2DZJA 2FCQA 3DVNU 4HDQA 1WJ4A 1WXVA 2H7EA 3QA8A 5G2NA 3F5RA 1NTYA 1V86A 2C60A 2ELAA 4HVBA 3PRPB 1UBQA 1FHOA 1WGHA 2LGYA 2M14A 4IM0A 2YT0A 3W1YA 1U27A 2C7NB 3WYFB 5DIFB 2LGDA 2KTFA 2D9XA 3R7QA 2DFKA 1YIWA 2KJHB 4ANWA 2FIFA 1ACAA 4JGHB 2NR2A 5KHOA 3X23A 4E74A 2GBRA 3DBHI 2BWFA 1KM7A 1SHCA 2K2UA 3SDLC 1U4AA 3JVZX 4C0AA 4IAPA 2EC1A 4DBBA 4YL8A 5C79A 3RUIB 3CSTA 2BWES 3KRWA 2O6VB 1H10A 2BKFA 4DWFA 5LLIA 3V60A 3RCZA 3VH4B 3ZW3A 4NQLB 3WANA 3BJIA 1BT0A 1E5WA 2KX3A 2WX1A 2QHOA 2UYZB 2I1KA 2N0YA 2MBHA 4KZCA 3AULA 2ZVOA 4GGQA 4GXBA 3FLVA 3SU8X 5L81A 2ZCCA 3K9PB 1LW3A 5L83A 2DZKA 2V1YA 2DHIA 4A6FA 3VTWA 3DVNV 1WJ6A 3ML9A 4W9DA 4KSLC 1P9DU 2JRIB 1KI1B 2KQ7A 2Z59B 2WDTB 5G55A 2Z0OA 3PRMB 4XC2A 3IHPC 3ZDMC 1AARA 4HAWB 1KZGA 1S1QB 2ZNVB 1P5TA 3EHVA 4HB2B 5AZFA 2R0DA 1SGHA 2LI5A 2LBBA 1P1AA 3DBLI 3V61A 3L10B 2MQJA 2DYNA 2K39A 4DDID 3PVLA 2MKRA 2KDFB 4DHJB 3F0WA 2REXA 5D27A 1IPGA 3PEGA 1J19A 1WH3A 3ZNID 2NBWB 3PLUA 2IY0B 2C9WB 3O96A 1E8WA 3KH0A 1V5UA 3PP2A 3PSCA 3IBEA 2K8BA 1LM8B 3MTNB 4K1RB 4G3XB 1V89A 4W9EA 2IO0B 2DYOA 2XK5A 1X11A 1Y19B 2DENB 4K2PA 2JWZA 2ROVA 1WE7A 4IC7B 5J18A 4L6EA 1BTNA 3NZSA 3ULCA 2HE7A 1YX6B 1PLSA 2D9YA 3DCGA 2UZRA 3DOWA 3FSSA 2D10A 3LDZE 4I6PA 2DYQA 1X86A 1VD2A 3KY9A 4GPTB 2KFJA 2X18A 2YVCA 3TW1A 2A4ZA 3ZKJC 2ZZPB 5DHAB 1TGZB 3L0WB 2KLGA 3GZNI 2FUHB 2DYMA 2I5CA 3A8QA 1WZ0A 4KIKA 4B95A 3A98B 4F7GA 2NBUA 2L05A 4AUQC 1EGXA 5HE3A 3V6CB 3EC8A 4MSQB 1HBKA 2FAZA 3PREA 4WJOA 3PVUA 2PEAA 4D0NB 3ML8A 5JP4A 1E90A 2NZ8B 2GBMA 1V9JA 2R2QA 2N9PC 2LOXA 3D8EA 2C7HA 3WA0A 1WX8A 1QC6A 5IA7A 1BTKA 1FGYA 1Q5WB 4A6FB 2LXCA 2RLOA 3OAWA 5CLLB 2GBKA 2KN5A 2LYDA 5D3XA 2QKLA 3D8DA 3L08A 2JF5A 2VRWB 4FULA 2LGXA 3ECIA 4I6NB 4ZRJA 1WR1A 2MRPA 1WIAA 2RGNB 3UINB 1LQBA 2MX2A 4FA6A 5TR5A 1GC7A 2P8VA 2J0KA 1WE6A 3DBSA 3ZVVA 2ZVNA 3N30A 4AJWA 4EZJA 4HHVA 2Z0DB 2DN6A 4HWIB 3Q3JA 4HPMB 4RMAA 3L16A 3ZDTA 2R2OA 5DHFB 3T9LA 2AEHA 4G50A 1WF9A 3TL5A 3OLMD 2FCNA 1P6SA 3QCAA 1U5EA 1AQCA 4FN2A 2JUOA 3T06A 4Z2NA 4BBNC 2DZMA 5C5BB 3CSFA 5EDSA 1WX7A 2XK5B 1TJ6A 4IM2A 2N23A 2CRFA 4W9KA 1UNRA 1R4NI 2IBIB 1UH6A 4J6IA 3VDZA 3P6AA 3ZNZB 2L3ZA 5JLJB 5LXHA 3KZ1A 5DPWA 1DBHA 2CKHB 2J7QB 5J2RA 2EMSA 2IO3B 3ZTCA 2D4QA 1XD3B 4CHMA 4F1SA 1F9JA 4HAUB 1DDMA 2KOXA 1RRBA 2ZNVC 1WX9A 2CAYA 4HB4B 3R66C 3PPAA 3DBRI 3FM8C 4MGKE 4PYZA 4WWPA 4KIKB 2LASA 2D2QA 2RSGA 4ZRKA 1XT9B 4X57B 3UIOB 5IJMA 2COPA 4LDTD 1FAOA 4HAXB 1ZKHA 1ZC3B 2MWSB 1EO6A 2DTCA 2KO3A 3HM3A 1V49A 3VQIA 2LVQA 2VKIA 3VTVA 1PFJA 1YX5B 1BWNA 1P3RA 3VUYA 1E7UA 4GZUA 4KZ0A 4DX90 3TMPB 4F8CB 1P0RA 4GDLA 1QQGA 1UBIA 3WIMA 3N32A 4WWNA 4NNJB 2W2XD 1NU2A 2VRRB 1NDDA 3PT2B 3HK0A 3OJ3A 2FIDA 1AWEA 1WXSA 2N4FA 2JY6A 2EJ8A 2KJ6A 4HATB 3TJPA 2RD0A 2M8SA 2KHWB 4GN1A 3IFWB 4GSWA 4FJZA 2KX0A 3PTFC 5CTRC 1WJUA 2DHZA 1XODA 4PYUA 1V81A 1J0GA 3A9KB 4WSFA 4E3CA 3B1LX 4PNKA 4BKSD 3QARA 4LDTB 4AJYB 2L76A 2ABDA 2MDXA 2A5UA 1H8CA 3AU5A 2CHXA 1OEYJ 3HW2B 2IY1B 2VSZA 2L8JA 3KUZA 4PS7A 4IW0A 4EZKA 5KQ1A 2KQSA 5D94A 3ZUNA 3KW5B 3QAQA 2RUKB 1TXDA 1Q0WB 1MPHA 3QX1A 1DYNA 4W9GA 3VUXA 2BCJA 5J17A 1FB8A 2CR5A 3DDCB 1XD4A 1Y5OA 3OJ4B 1C3TA 1UEFA 3ALBA 3EFUA 2N9XA 1TQZA 4MJSA 2K1FA 4MEMA 4NJ7A 1RJ2A 1LFDA 5D7GA 4BFRA 3VHTC 5HKHA 5JHAA 2Y8GA 5J3TA 4ICUA 2ROZB 2P0HA 3TFMA 1Y8RC 3UGBB 3GYPA 4NJ6A 3ZRCA 3BINA 4FADA 2MP2A 2MBQA 3DVGX 4A6HA 2ZPYA 3SO6A 3EECA 4HXDA 3B08A 4G11A 4IG7B 5CHWA 4GDLB 2D07B 2CU1A 1E8YA 2BYEA 4WJPA 3KSYA 1ZVRA 3K9OB 1EAZA 1HE8A 2G4SA 2NPTA 2KMAA 4EOYA 2BGFA 3VOQA 4K7UA 1FHWA 4HJKA 2V76A 3QBVB 2KNBA 3VH3B 3APFA 4GMXB 4AOFA 1DROA 3CMMB 5J3YA 2ZPNA 2RR9A 2M0XA 2CS4A 5DPSA 2G3QB 1OMWA 1M7RA 4W9JA 3ZTDA 1Z5SB 2DAJA 1FHXA 3LJUX 1SIFA 5E6OA 2LVOA 2M4NA 4G0NB 4K2OA 2GS0A 3UQAA 5C5BA 3FEHA 5E6NA 4B9KA 3PHXB 2MBOA 1T0YA 2Y7BA 4URKA 4MGZE 5AZHA 1RAXA 3M63B 4FJYA 4HB3B 4MSMB 1J0WA 2DYBA 2PPHA 2ZCBA 3CXBB 5D6JB 4OVUA 4BBNF 2YRYA 5FI1A 4F7UP 2WX0A 3KYDD 1Z87A 3S2AA 3ZVRA 1MG8A 2KDIA 3ODOA 2FDQA 2KVRA 2RVBB 3UF8A 3MHSD 4EFOA 3FP5A 3RT3B 2BPSA 2PE9A 2DA0A 2CY5A 2RQ1A 1LXDA 2E2XA 2D9ZA 1GUAB 1TBEA 5KQ4A 3SHQA 3DXEA 3AU4A 4HCNB 1P3QU 4EEWA 4MJSB 3DVGY 3R7RA 4BKGA 1BAKA 4YONA 2MW5A 1NI2A 4EKUA 2KKCA 4WJ7A 4IWQA 4ICVA 3AXCA 2W9NA 3SYXA 1A5RA 2AWTA 2KD0A 2N7DA 3RZWC 2MP2B 4MH0E 4B6WA 2FNJB 3A9JB 5AEKB 3Q3FA 2GBJA 5KHQA 2J0JA 3GOEA 3C0RB 2K6QA 1OY2A 2KZRA 3U8ZA 3PRZA 2K25A 1WG7A 1WVHA 4XZ4A 3W1SC 2KXJA 3HQCA 2RSUA 1UZXB 3A4SC 1OEYA 2WH5A 3DPDA 2NPTB 2ELBA 2W2WA 5JHHA 4NAWA 3ZNGC 3O65B 1U29A 3I3TB 2MLBA 5JHGA 2HRJA 2LD9A 5DH9B 2W2XC 4W9LA 5D3VA 5C1ZA 1ISNA 1M7EA 2DLWA 4HAZB 3ONSA 3NY5A 1R4MI 1I42A 2L0FA 2N9EB 5C16A 2L00B 4BOSC 1U5DA 5L95C 3M1IB 5DCNA 3ZNHB 1RLFA 3T8MA 1K5GB 2YT1A 4P7IA 3A9KA 3APCA 4WJNA 2KFKB 3QK0A 3VTUA 2NBVB 4TQ1A 1XQQA 2IYDB 2LUEA 1OQNA 3KYCD 2KMCA 3ZIMA 3KUCB 4AWJA 2CODA 2DKPA 2ADZA 3QJZA 2DX1A 3TBLD 2BYVE 3W1SA 4CO7A 1DDWA 2KCJA 2YLMA 3ULBA 2V3SA 3ML4A 1WGUA 3QQ8B 2J59M 4KHAA 3PVWA 4DK5A 4FJVB 1MIXA 3EPYA 5DPRA 4IUMB 3WALA 1EF5A 4HCPB 2DKQA 1WGYA 2LZ6A 1EVHA 1WGRA 1HB8A 1V6EA 1V5MA 1KZ7A 1Q1OA 1K5DB 2I5FA 4AP4C 1WM3A 2LRUA 3V62A 3SD5A 2RGFA 3HHMA 3H1UA 4K7SA 3TVVA 1C1YB 3SV1A 4GDKB 1IP9A 2JPHA 3UZTA 2L2IA 4ASWC 3L17A 3RZFA 2OTXA 2GBNA 4ZRIA 5DPTA
chains in the Genus database with same CATH superfamily
2FCMA 2K8HA 3VFKA 4F7ZA 2JZZA 3RD2A 3SNHA 3TEZA 4WQOB 3ZRFA 2GMIC 3MC0B 3QHTA 2BKRB 1VBHA 4JKGB 3M3JA 5CLQB 2W3SA 1KC7A 1MHHE 1KLVA 1IRSA 2MEKA 1TYGB 4ANXA 4KHOA 1UNPA 3WAOA 4C4VB 2WXNA 4WVFB 2ZEQA 5HE0A 4BKSA 2LVPA 2FJUB 1A70A 3BVZA 3AMZA 4USAA 2K2JA 3HM6X 2MJ3A 3NZUA 1W1HA 1T0SC 3GB1A 3IT6B 4KSKC 1ZC4B 4JK8A 1YD8U 2PJHA 3PLVA 3KRXA 4HDOA 4KV2A 1KJTA 3NUHB 4BVUC 3TIXA 4BBKA 1M94A 3A1QA 1J7CA 2G35A 2KJRA 4IOYX 1YOVB 1X1GA 2W55A 5BYRA 2COAA 2JT4B 1OQYA 4NAWB 3A33B 3AE3B 2OJRA 3VAWA 4KAXB 1WZ3A 1ET9A 3AECB 3RFZB 1WM2A 3RCPA 3NVVA 3QWZB 1L6UA 1SE4A 1WGDA 4JKCA 1N6ZA 2D5GA 2HTME 2NMQA 3P4SB 1E7VA 4RM9A 1WXAA 3KVFB 4FLHA 4LNNA 5EE0A 1E8XA 3PS6A 1PMSA 4II2B 4JKDA 1Q67A 4YSZB 2MH7A 1FGZA 3SFDB 4R3DA 5DI9B 2EKEC 1FMAD 3V6EB 1ZYIA 2KLCA 4A3OA 2PE6B 2KIEA 3ZJUA 2DHKA 3ODXA 1V5OA 1ZM0A 3A4RA 2MA9B 4IWOA 4A55A 2Q13A 2YF0A 1L0YB 1IYFA 3W2DA 2LRWA 4II3B 2OHFA 5LXIB 2D11A 4A90A 1JCKB 4NPNA 4ZYNA 4PS3A 4GIVA 3PSEB 4JL9A 4LNKA 3GP7A 2H7DA 4I6LB 3RNAC 4ZDVA 1ZSQA 2P0DA 2DAFA 3D8FA 1U5GA 2HDEA 1ZGUB 3LJ3A 3H7SA 1JRUA 2NVUI 2RDGA 3H7PB 3LXFA 5CX3A 3U4EG 1Q10A 2Y8FA 1ST7A 4TKNA 1DDVA 2J4XA 5BYSA 3U7ZA 2CQUA 4RH6A 3AEAB 4W9IA 2W54A 2NCNA 3CIRB 1TS5A 5LNK1 4C7YA 5HE1A 4MGYE 1YQBA 4DHZE 5D3WA 2FBWB 4ZHPA 4LCDE 1NI3A 2AL6A 4HROA 4A5KA 5D3YA 2Y3AA 1YQ4B 4JWUC 4NSWA 3L54A 1KTKA 1WYWB 1BMLC 2WXIA 5E6PA 5I2SA 4N9F4 1S3SG 3VVWB 2INPE 1EUVB 4JLCA 1CK1A 1KFYB 1L5PA 1WJ1A 2KWVB 1B55A 1PQSA 1MIZB 2MWNB 3VIAA 1V2YA 1JWUD 2P0FA 3QIJA 1V5PA 3PG7A 2PVGC 5M4YB 3M62B 1T5XD 1JROA 2CHWA 1HB6A 4DHJD 1JWSD 1WGGA 1FXIA 4ILHA 5G5GA 2GB1A 3HRDD 1XLNA 4HPPA 1GC6A 4FHJA 5JH5C 1FD6A 1AN8A 1G6JA 4MM3A 4XDCA 2KWUB 2RPQA 1V88A 2D9VA 3UI3A 1H4RA 3E9OA 1ZOYB 4TV3A 3W5UB 1OQRA 1Y56A 2LG1A 4PS8A 5GXGB 4JKFA 1VR9A 2KN4A 2MFQA 4NY0A 2E3TA 2L0TA 1VZ8A 2XBBC 2M56B 3JYUA 2J42A 1SJED 5FR3A 2GOWA 1EU3A 2ZJDA 4C80A 1XKEA 4HAYB 1HTOA 3A9JA 1C4AA 1W1DA 2UZSA 3Q14C 4P16A 2LWPA 1WMHA 2WXLA 4AQ7A 3N3KB 2BF8B 1T77A 1WFYA 5LG4B 1I4QA 1XCGA 1TKGA 1X1MA 3U30A 2IDYA 3ODWA 4DIXA 1F77A 3A1QB 2YT2A 4WWOA 2Y5CA 3APDA 4A20A 1JALA 3Q69A 1FRDA 1UELA 1MK9B 1UGMA 3PHWB 3X0WA 3NHEB 1UPQA 3DXDA 1VCBA 3TEYA 3HSAA 4JIOU 1I4XA 5IP4D 4HJGE 4EJNA 1TTNA 4ZHOA 2JZ3B 3GYOA 1L7YA 5BMGA 2JXXA 2GCJA 2YS3A 1XR0B 2J0MA 1NEKB 2N1WA 3VUWA 2QILA 2JX5A 4FHKA 4W9CA 3VXWA 2HJ8A 4DBGA 2KGXB 2OQBA 2LXAA 4EUTA 3NS8A 5BMIA 4W9FA 1XLOA 4MT5A 4B6HA 4HRSA 5IAAC 2FJ9A 4YTNB 3A8PA 3KQ4A 1OGWA 2KWCA 2AQ3B 4XWWA 2LJ5A 1J7BA 1FOEA 5CHVC 3WAPA 3DXCA 4K7WA 3AEDB 3UIPB 1TT5B 1RRPB 2ON8A 5MPOA 3OANA 2KFKA 5C6RA 2JVCA 4IDIA 4TMAB 1X1FA 2NBVA 4WJQA 1DGJA 1NBFC 1PGAA 2LKOA 1Z2MA 4JQWC 2KUPA 4OT1A 4K81A 2MBEA 2V3NA 4PQ0A 3AH7A 3P2BA 1SE9A 3BIID 4YT0B 3AEFB 3ZO5B 3OG5A 1ZPSA 4B0EA 1SIJA 2FCSA 1OTRB 4NQKE 5D2MB 1WJMA 1DOXA 2XQNM 5J3QA 4HLEA 5FK9C 4E71A 1U2BA 4ANUA 1I35A 4F7HA 1NTVA 4FBJB 2Y5BB 1UWMA 3MC9A 3PV1A 2V4LA 2YSZA 4H2AA 1HQRD 4W9HA 1JW9D 3KWLA 2DHJA 2M17A 5E6JA 2K3UA 1EF1A 1V80A 2JU6X 2YS1A 2KQ4X 3HVZA 1WXQA 3QC8B 2Z0PA 1CQVA 2NS5A 5JHBA 1RFAA 5BO4B 1WR6E 2DX5A 1C4PA 4JPSA 5LOPB 2G4DB 5BMHA 2IZVB 2R09A 3PZDA 4GDKA 3ENBA 4KHBA 2GLSA 1PYWD 3FAHA 2DZIA 3NVYA 5BYQA 2KDBA 1JRPA 3RNBC 2KK8A 2EMTA 2TSSA 1VBGA 1XX0A 2D9WA 1QOFA 2UWQA 4M02A 5HFYA 3B0AA 4MGIE 2WWZA 3NSUA 2AX5A 3N7CA 1XXGA 2M0AA 4CHJA 3I57A 1IBXB 3RNEC 2D3AA 3NW8A 4GB9A 3DQVA 4WQMA 2QKMA 3AI5A 3KUDB 1NVLA 4ILGB 3MPXA 1DOIA 2OOBB 4JE3B 4ARIA 3HIZA 1YNTE 4TUUA 4P1BC 3R3MA 1WMHB 3TO1A 1J8CA 1ZDXA 2HTHA 5KCVA 4BKTA 5CHFA 2IO1B 1B1ZA 4K17A 3JW0X 5JVLA 2IGDA 4TYZA 4HKZE 1EWYC 1ACCA 4KKJA 1QF6A 1I7AA 1SBBB 2WU2B 3IT4B 2PZ1A 2QMTA 1MK7B 4LJPB 4XYCA 1D5ZC 2WXPA 1N3HA 5JZEB 2O2VA 3R2TA 2Z0QA 4MDKE 4KDIC 2L1CA 1EWCA 4WURA 2N9LA 2KTRA 1WY8A 3V3XA 2BVCA 2I1JA 3U12A 2KDEB 3RYTA 3MHZA 2BYFA 2HJ1A 2WLBA 3IVFA 3E9SA 3QWMA 4IWPA 1F2RI 1T0RC 2BTEA 2COFA 3DCXA 1AYFA 1WSPA 2IO2B 4MELA 3V5WA 3PO0A 2BBCA 1NYQA 2COCA 2LUMA 4LJOB 4BOZB 1P7EA 3BWUD 4GMVA 4HB0B 1BUIC 1WWTA 2RRFA 4EZLA 3ENEA 3U7DA 2KC2A 1KOTA 3E9PA 2MJDA 2GJYA 2N7EA 3AE2B 4M0WB 1T6BX 2NMBA 3ZLZA 3P7ZA 1I2HA 2G9HD 2XEWA 3JSVA 3MJWA 5GOWB 4M8MA 4C7ZA 5G5HA 1U5FA 4XWTA 1YN4A 4LNIA 2WXQA 2MCNB 4TQ0A 1RFKA 4LLGM 3H6NA 2MBBB 1MAIA 4A3PA 2D3CA 3L13A 1K52A 5D3IB 2CB8A 2VH2A 5AUKA 4K3BA 2N1VA 2AYOB 2JYEA 4A6QA 5EFXA 3BY4B 1LO5D 4DXAB 3P4QB 2GI9A 3Q8CA 5JXVA 4LNOA 3FC4A 4RFBA 1MKEA 1T3QA 3RN9C 2ASQA 4DX8A 3H7PA 2GCLA 3TCAA 2WYQA 4CYEA 2B3AA 1C9FA 1UF0A 4OVVA 1GJZA 1UD7A 4CHKA 4HK2A 4RGTA 3J9CA 3AE9B 4MK0A 1FXTB 1GG3A 2IFSA 3AJ4A 2LMCA 2FJLA 1HEZE 3PZ8A 5FI0A 1WRDB 2UU7A 4JKHA 1WI0A 1YJ1A 4XWXA 1WGQA 1P98A 2M1MA 1D3ZA 4M8NA 1I4PA 1TIFA 1JQ4A 2DX5B 1K8RB 2HD5B 3NOBA 1SE2A 2D3GA 4RM8A 4MT7A 3IXSA 4GOCA 5GMVA 1WI1A 1X05A 5HE2A 2K00A 2C7MB 4KHBB 2YS5A 2Z0EB 5EE3A 4ANVA 4MY6A 2KANA 1V5TA 1W1GA 2UVMA 3IG3A 2C5LC 2O6VA 4OZCA 1L2NA 4WAAA 2K8CA 2LGSA 5AZGA 1CMXB 2LFIA 1MI0A 3SUZA 1ET6A 1IGDA 1T0QC 4DHZB 5C23A 4XX5A 3CIKA 3BK2A 1ZW7A 2RNRB 1KBLA 3AM9A 4WAFA 1PGBA 1WXMA 3WAMA 4KVGB 3CF6E 2M38A 4AS1A 1SJHD 3L4PA 1NTIA 2X0SA 4KDLB 1TZ1A 2D3BA 4HAVB 3D32A 2MSED 5FR6A 2HTHB 2VH1A 3UQBA 2IYBA 1LB1A 4DXFA 3O13A 3A58A 4IM3A 2AL3A 3R2IA 4JK7A 2JRHA 2KUQA 4ITKA 3HVDA 4QJ5B 2NTSA 4DDGD 1RWSA 3H9DA 1K50A 2LGIA 2O2VB 1WJNA 4IFSA 4US9A 2LULA 3Q3OC 2JXTA 2L7RA 2KTRB 3AB5A 3EUB2 1V61A 5HHDG 2DWQA 4H8SA 5LONB 2KC1A 4HPLB 4Z2MB 1UNQA 1GNUA 3SR6A 3DWMA 1SE3A 2WXOA 2DBYA 2Z59A 2RPVA 3Q8AA 3HIEA 1MG4A 3PGEA 2KR0A 5C3JB 1KLGD 4GU2A 3RULA 2JP2A 1UPRA 1E7PB 4ZOHC 2O6VD 2CHZA 2PMVA 1QKZA 3M95A 2G45B 3MDBC 4JX1C 2CY4A 2LOZA 2RDHA 1N62A 4A6KA 3BVGA 2OEDA 3U2SC 4EMOA 2PVOD 2K6DB 1R4MB 1QZEA 3HUIA 3JSVB 4Y94A 3G9WA 1E8ZA 2DZJA 2FCQA 3DVNU 4HDQA 1JMLA 1HXYD 1WJ4A 3VR9B 1WXVA 4OZBA 2H7EA 3QA8A 4PK1A 2K5PA 5G2NA 3F5RA 1QOBA 1HA5A 1NTYA 1V86A 2C60A 2ELAA 4HVBA 1FNVA 3PRPB 1UBQA 2V4IB 2ICIA 1FHOA 1WGHA 1FNWA 1LGRA 2LGYA 4ILJA 3C19A 2M14A 4IM0A 2YT0A 3W1YA 1U27A 2LHDA 2C7NB 3WYFB 5DIFB 2LGDA 2WXGA 2KTFA 2D9XA 3R7QA 2DFKA 1YIWA 1WRIA 2KJHB 4ANWA 2FIFA 5IRSA 2QCZA 1ACAA 4JGHB 2NR2A 5KHOA 3X23A 4E74A 2GBRA 2LJIA 1E6EB 4A8XC 3DBHI 2BWFA 1KM7A 1SHCA 2K2UA 3SDLC 1U4AA 1HTQA 3JVZX 4C0AA 4IAPA 1FEHA 4JKBA 2H88B 2EC1A 3BYTB 4DBBA 4YL8A 5C79A 3RUIB 3CSTA 2BWES 2GRIA 3Q8EA 2JZPA 3GS2A 3KRWA 2O6VB 3N1ZC 1H10A 2BKFA 4DWFA 5LLIA 3N9YC 3V60A 3RCZA 4YSXB 3VH4B 3ZW3A 4NQLB 1ENFA 3WANA 2EELA 3BJIA 2WXKA 1BT0A 1E5WA 4QJ4B 2KX3A 2WX1A 2QHOA 1IBXA 2UYZB 2EKIA 2I1KA 2N0YA 2QJLA 4RCOA 3N1YC 2Z14A 2MBHA 4KZCA 2Z4DA 3AULA 2ZVOA 4GGQA 3AEBB 4GXBA 2WHIA 3FLVA 3SU8X 3NWDA 5L81A 4US8A 1HZ5A 4B0MA 2ZCCA 3K9PB 1LW3A 1ZUD2 5IO9A 4IOIE 2CJNA 2RDBC 1CZPA 5L83A 5TSSA 2DZKA 3H8HA 2V1YA 3MJ5A 3P63A 2DHIA 4A6FA 4ZYSA 2AQ1B 3VTWA 3DVNV 1QOAA 1PFDA 2BS2B 1WJ6A 3ML9A 3BVMA 4W9DA 4NJCA 4HKQA 4KSLC 1NYRA 1P9DU 1TY2A 2JRIB 4C00A 1KI1B 2KQ7A 2BQQA 2Z59B 1QT9A 2WDTB 1XEEA 5G55A 5T8IA 4BAXA 2Z0OA 3PRMB 4XC2A 1GB4A 3IHPC 3ZDMC 3VRAB 2K8EA 1AARA 4HAWB 1KZGA 1S1QB 1TJEA 2SEBD 2ZNVB 1P5TA 3EHVA 4HB2B 1NENB 5AZFA 2R0DA 1SGHA 2LI5A 2LBBA 1P1AA 1DIKA 3DBLI 4M0WA 1MVKA 3V61A 5IOIA 3L10B 2MQJA 2Y5PA 2DYNA 3RMKC 1KF6B 4M00A 2K39A 4LK0M 3DWGC 4DDID 3PVLA 2MKRA 2KDFB 4DHJB 1N63A 2WXHA 3F0WA 2INNE 1D4BA 2REXA 3T3OA 5D27A 1IPGA 2KYWA 3PEGA 1J19A 1WH3A 3ZNID 2NBWB 2J53A 3PLUA 3NRZA 1WGKA 2IY0B 2C9WB 4CSQA 3O96A 1E8WA 3KH0A 1V5UA 3PP2A 2BB6A 3PSCA 3IBEA 2K8BA 5EE1A 1LM8B 3MTNB 4K1RB 1ZP0B 4G3XB 4K3CA 1V89A 4W9EA 2IO0B 1JWAD 3NJTA 1V1PA 2DYOA 1QOGA 2XK5A 1X11A 1SXTA 1Y19B 2DENB 1XCTL 2H89B 4K2PA 2JWZA 3AE5B 4YXDB 2ROVA 1WE7A 4DQOC 5EE9A 4GNKB 4IC7B 3DHIC 5J18A 4L6EA 1BTNA 3NZSA 4LNFA 4JWSC 3ULCA 2HE7A 2WXMA 3DHHC 2L83A 1YX6B 1PLSA 2D9YA 3DCGA 3NS1A 2UZRA 3DOWA 3AEGB 3FSSA 2D10A 3LDZE 4I6PA 4OHJA 4D6WA 2DYQA 3RNGC 1YN5A 1X86A 1VD2A 3B2FA 2JYTA 1FO4A 3NVZA 3KY9A 4GPTB 2KFJA 2WXRA 2X18A 2YVCA 3TW1A 2QEJC 2A4ZA 1E9MA 3ZKJC 2ZZPB 5DHAB 3E66A 1TGZB 3L0WB 2KLGA 1F2RC 3GZNI 4RGNA 2FUHB 1TY0A 2DYMA 2I5CA 1N60A 3A8QA 1WZ0A 2QSDA 3P42A 4KIKA 2PW9A 3P4RB 3U52E 4B95A 3A98B 4F7GA 2NBUA 2BS3B 2L05A 2PIAA 4AUQC 1EGXA 5HE3A 3V6CB 3EC8A 4MSQB 1HBKA 2FAZA 3PREA 4WJOA 3PVUA 1I7HA 5I2MA 3NWFA 2PEAA 1MPEA 3CWIA 4D0NB 5FKAC 3ML8A 5JP4A 1E90A 2NZ8B 2GBMA 1V9JA 2R2QA 2N9PC 2LOXA 1B9RA 3FVCA 3D8EA 2C7HA 3WA0A 2W3RA 1WX8A 1QC6A 5IA7A 4WWMA 1BTKA 1FGYA 1Q5WB 4WH4A 3RNFC 4A6FB 2LXCA 3EGRA 2RLOA 2YEPB 3OAWA 1N5WA 1XF5L 5CLLB 1FM0D 1SEBD 1V8CA 2GBKA 4YTMB 2KN5A 2LYDA 4IKGA 3P4PB 3IAS1 5D3XA 1GAQB 2QKLA 3D8DA 3L08A 2JF5A 3RNCC 2VRWB 4FULA 2IGGA 2LGXA 3ZXVA 3ECIA 4I6NB 4ZRJA 5I4DA 5IKCM 1WR1A 2WP9B 2MJEA 2XNAC 4OSNA 2MRPA 1WIAA 2RGNB 3UINB 1LQBA 1YN3A 4JKEA 2MX2A 4FA6A 2N0SB 5TR5A 1GC7A 2P8VA 2J0KA 1WE6A 5HI1A 3DBSA 3ZVVA 2ZVNA 3N30A 1EM7A 4AJWA 4EZJA 4HHVA 2Z0DB 3NVWA 4QJ3B 4N58A 2DN6A 4HWIB 2ZW1A 3W9CB 3Q3JA 4HPMB 1ESFA 4RMAA 1PUTA 3L16A 3ZDTA 2R2OA 1L0VB 5DHFB 1D5MC 3T9LA 2AEHA 4NZLB 4G50A 1WF9A 3TL5A 3OLMD 2FCNA 1P6SA 3QCAA 2QIEB 1FNUA 3B77A 1U5EA 1AQCA 4FN2A 3I63C 2DIKA 2JUOA 4XDDA 3T06A 4YSYB 4Z2NA 4BBNC 2DZMA 5C5BB 1TS2A 1F1HA 3CSFA 5EDSA 1WX7A 3Q3MC 1V1PB 2XK5B 1JDEA 1TJ6A 4IM2A 2N23A 2CRFA 4W9KA 1UNRA 1GB1A 1YMHE 4YWGG 1C77A 2G1EA 1R4NI 2IBIB 1QILA 1UH6A 4J6IA 3VDZA 3VR8B 3P6AA 3ZNZB 2BYTA 2L3ZA 5JLJB 2VZKD 1K53A 4C56C 2B76B 2RMMA 2W82A 5IN7A 5LXHA 3KZ1A 1DYQA 2KMMA 5DPWA 1DBHA 2CKHB 2J7QB 4OW0A 2KWDA 2WXFA 2K49A 5J2RA 2EMSA 2IO3B 3ZTCA 2D4QA 2INDC 1XD3B 4CHMA 4F1SA 1F9JA 1VZ6A 4HAUB 3ZJTA 1DDMA 2N9KA 2SAKA 2ONQA 2KOXA 1RRBA 2ZNVC 1WX9A 2YEPF 4JK9A 2CAYA 4HB4B 3R66C 3PPAA 3DBRI 1FFVA 3FM8C 4MGKE 4PYZA 4WWPA 4QAYA 4KIKB 2LASA 3LB8C 1IGCA 2D2QA 2RSGA 3LYYA 4ZRKA 1XT9B 4X57B 3UIOB 5IJMA 3GZNB 1GPXA 2COPA 4ARCA 1BXTA 4LDTD 1FAOA 1HZ6A 1OQQA 4HAXB 1ZKHA 1ZC3B 5H8YE 1K51A 4ZRPA 2MWSB 4ACFA 1EO6A 3GE8C 1DOYA 3P1MA 2DTCA 2KO3A 1FXAA 3HM3A 2Z13A 1V49A 2WDVB 3VQIA 2LVQA 2VKIA 1FRRA 3VTVA 1PFJA 3AE6B 1YX5B 1BWNA 1P3RA 3VUYA 3AN1A 1M4VA 1TZOA 1E7UA 4GZUA 2JWUA 2E6XA 4KZ0A 3N1XC 1ZXIA 4DX90 3EFCA 4RF0A 3TMPB 1FIQA 1RM6C 1P0RA 4F8CB 1IUEA 4GDLA 3AV8A 3Q6BA 1QQGA 1FFUA 1UBIA 3WIMA 2VZKB 3N32A 2L1AA 4WWNA 4NNJB 1JWBD 2W2XD 1QQRA 1UWXA 4REZA 1NU2A 1NVID 2VRRB 1NDDA 1C78A 3PT2B 3HK0A 3OJ3A 2FIDA 1AWEA 1WXSA 2N4FA 3NWAA 2IPKD 2JY6A 3FKYA 2XN9C 3RI7C 2EJ8A 4JKAA 2KJ6A 4HATB 3SBTA 2OJWA 3TJPA 4L1BA 2RD0A 1VLBA 2M8SA 4A9AA 2KHWB 4GN1A 3IFWB 4GSWA 4LTUA 4DXGA 4FJZA 2PKOA 2KX0A 1AW7A 3PTFC 5CTRC 2DHZA 1WJUA 1XODA 1VZ7A 4PYUA 3C8YA 2N7JA 3NZ3A 4KKIA 2WDRB 1V81A 5H92C 4L23A 3V05A 4KGSA 2V0GA 1J0GA 2L52A 3A9KB 4WSFA 4E3CA 3B1LX 3BYYB 4PNKA 4WIPA 4GOUA 4BKSD 3QARA 4LDTB 4AJYB 2L76A 1WYGA 2ABDA 2MDXA 2A5UA 1H8CA 4RF1A 3AU5A 2CHXA 1EU4A 1OEYJ 3HW2B 2IY1B 2VSZA 2L8JA 3KUZA 4PS7A 1TS3A 4IW0A 4RNAA 2KAJA 1GGOA 4EZKA 5KQ1A 2KQSA 5D94A 3ZUNA 1FCCC 3KW5B 1R4NB 3QAQA 2RUKB 4D2KA 1TXDA 4EE2A 3AE4B 1Q0WB 1F0ZA 2BW2A 2KACA 3W5VB 1MPHA 3QX1A 1DYNA 4W9GA 3VUXA 1I4HA 2BCJA 5J17A 1XO3A 1XCQL 4KX6B 1FB8A 2BB5A 2CR5A 1V1OA 2WS3B 2AQ2B 3DDCB 1XD4A 1Y5OA 3OJ4B 1C3TA 1UEFA 3ALBA 3EFUA 2N9XA 1TQZA 4MACA 3MC8A 4MH8A 4MJSA 2K1FA 2JQRB 4MEMA 2WNMA 4YTPB 3TUOA 4NJ7A 2BT6A 3MFGA 1RJ2A 2ZKMX 2IGHA 1LFDA 5D7GA 3DBRB 3GE3C 1KLUD 4BFRA 3VHTC 5HKHA 5JHAA 2Y8GA 5J3TA 4NAMA 4ICUA 2ROZB 4S17A 2P0HA 1C79A 3TFMA 1Y8RC 1MJDA 3UGBB 3GYPA 3TEWA 4NJ6A 3ZQ4A 3ZRCA 3BINA 4FADA 1XLPA 2MP2A 2MBQA 3ABVB 3DVGX 1ROEA 5D3DA 2NTTA 3NG0A 4A6HA 2ZPYA 3SO6A 3EECA 4HXDA 1E10A 3B08A 2PLPA 3N20C 3ETRA 3PZ7A 4G11A 4IG7B 2FE8A 5CHWA 4GDLB 2D07B 3AE7B 1V97A 2Q5WD 2CU1A 1E8YA 3E56A 2KIGA 2BYEA 2IJ0A 2KDMA 4WJPA 2PTLA 3KSYA 3ZXRA 1ZVRA 3K9OB 1EAZA 1HE8A 3AEEB 2G4SA 2NPTA 2ZW0A 2KMAA 4EOYA 2BGFA 1VRAB 3VOQA 4J3OD 2FUG1 3I5JC 4K7UA 1FHWA 4HJKA 2V76A 3QBVB 2KNBA 2QC8A 1MHXA 3VH3B 3APFA 4GMXB 4AOFA 3B9JA 1DROA 4PT5A 3CMMB 5J3YA 4RGMA 2ZPNA 2RR9A 3ZYYX 2M0XA 3BK1A 2LEKA 2CS4A 5DPSA 2G3QB 1XLQA 1OMWA 2X38A 5C2TB 3Q8BA 1M7RA 4W9JA 3ZTDA 1Z5SB 3WCQA 2DAJA 1FHXA 3IAM1 3LJUX 1SIFA 5E6OA 1QLBB 3URYA 2LVOA 2M4NA 4G0NB 4K2OA 2K9XA 1TKEA 2GS0A 3AE1B 3UQAA 5C5BA 3FEHA 2QDFA 1JWMD 5E6NA 4B9KA 3PHXB 2MBOA 1T0YA 2Y7BA 4URKA 3OWEB 4MGZE 4Q2JA 5AZHA 1RAXA 3M63B 4FJYA 4HB3B 1C4CA 4MSMB 1STEA 4P6VF 1J0WA 2DYBA 1L4DB 2PPHA 2ZCBA 3CXBB 5D6JB 4OVUA 4FXCA 1I4RA 3E9LA 1TKYA 2V3PA 3FILA 1ZE3D 3SEBA 2Z8LA 4BBNF 2YRYA 3SFEB 4XGAB 5FI1A 4F7UP 4KGRA 2WX0A 3KYDD 1Z87A 4UDUC 3S2AA 1L6VA 3ZVRA 1C76A 1MG8A 2KDIA 3ODOA 1PGXA 4CQNA 2FDQA 2WU5B 4S0RA 4HEA1 2KVRA 3Q2AC 2RVBB 1UUPA 3UF8A 3MHSD 4EFOA 3FP5A 2R2YA 2WQYB 1D6EC 2BPSA 3RT3B 2PE9A 2LHEA 3B2GA 2DA0A 2JSVX 2V9HA 2CY5A 2RQ1A 1LXDA 3AE8B 2E2XA 3DBHB 2ACZB 2D9ZA 2L32A 1GUAB 2R61A 1F52A 1TBEA 5KQ4A 3SHQA 3DXEA 3AU4A 1SF0A 4HCNB 1P3QU 4EEWA 4MJSB 3DHGC 3DVGY 1L0XB 3OHMB 3R7RA 4BKGA 1BAKA 2INCC 4YONA 2MW5A 1NI2A 1MFWA 4EKUA 1KRHA 2KKCA 4WJ7A 4IWQA 1MI1A 4P1CC 2I2YA 1ZXHA 4ICVA 3AXCA 3RPFC 4MM3B 4XE0A 2W9NA 3SYXA 1A5RA 2AWTA 2KD0A 2M19A 3TEXA 2K0PA 1R7SA 2N7DA 4JKGA 3RZWC 2MP2B 4MH0E 1N5XA 4C4VA 4B6WA 2FNJB 3A9JB 5AEKB 3Q3FA 2WXJA 2GBJA 2DLBA 4ZRQA 5KHQA 2J0JA 3GOEA 3C0RB 1N61A 2K6QA 4OVZA 1OY2A 2KZRA 2K22A 3U8ZA 3PRZA 2K25A 1WG7A 1WVHA 4XZ4A 3W1SC 3Q8FA 2KXJA 2WDQB 3HQCA 2RSUA 1UZXB 3A4SC 2KVZA 1OEYA 1CJEA 2WH5A 1OFFA 3BZDB 3DPDA 2NPTB 2ELBA 2W2WA 5JHHA 4NAWA 3ZNGC 3O65B 4N59A 1U29A 3I9V1 3Q3NC 3I3TB 4HSIA 2CJOA 2MLBA 5JHGA 2HRJA 2LD9A 5DH9B 2W2XC 4W9LA 1AWDA 5D3VA 5C1ZA 2WGSA 1ISNA 1M7EA 2DLWA 4HAZB 3ONSA 3MP9A 3NY5A 1R4MI 4QXAB 1I42A 1PDXA 2L0FA 2R82A 2N9EB 5C16A 3R8BA 2L00B 4BOSC 3ZGZA 1U5DA 5L95C 3M1IB 4M01A 4L1RA 3DBLB 3EA6A 1I4GA 1L4ZB 2DNFA 1YJIA 5DCNA 3ZNHB 1RLFA 3T8MA 1K5GB 2YT1A 4P7IA 3A9KA 3APCA 4WJNA 2KFKB 4RGOS 3QK0A 3VTUA 3SBGA 2NBVB 4TQ1A 1XQQA 2IYDB 1GOZA 2LUEA 1OQNA 3KYCD 2MHJA 2KMCA 2KT7A 3ZIMA 2J52A 4O1NA 3KUCB 4AWJA 1TS4A 5HG2A 2CODA 2I38A 2DKPA 2ADZA 3QJZA 2DX1A 3T3NA 4OZAA 3VRBB 3TBLD 2BYVE 1ZDVA 3W1SA 3FILB 4L2YA 2BS4B 4N6EB 4CO7A 1DDWA 2KCJA 2YLMA 3ULBA 2V3SA 3ML4A 1WGUA 2GUMA 2J59M 1VJKA 3QQ8B 1SSNA 4KHAA 3PVWA 4DK5A 4FJVB 1YJJA 1FPYA 1MIXA 3EPYA 5DPRA 4IUMB 3WALA 1EF5A 4HCPB 2CU3A 2DKQA 1SB3C 5AUIA 1WGYA 2LZ6A 3KLSX 4KGTA 1EVHA 1WGRA 1VDVA 1HB8A 1V6EA 1FCLA 1V5MA 4GLSC 1RYJA 1KZ7A 1Q1OA 1K5DB 3ZJVA 2I5FA 4AP4C 1KH0A 1WM3A 2LRUA 3V62A 3SD5A 1E0ZA 2RGFA 3HHMA 1J7AA 1UNSA 3H1UA 1P7FA 4K7SA 3KWVA 3TVVA 4BZAA 1C1YB 3SV1A 4GDKB 1IP9A 2JPHA 2X8XX 1UGJA 3UZTA 1D5XC 1YQ3B 2L2IA 4TSSA 3L17A 4ASWC 3RZFA 2OTXA 2GBNA 3TSSA 4ZRIA 5DPTA
chains in the Genus database with same CATH topology
2FCMA 2K8HA 3VFKA 4F7ZA 2JZZA 3RD2A 3SNHA 4WQOB 3ZRFA 2GMIC 3QHTA 2BKRB 1VBHA 4JKGB 3M3JA 5CLQB 1KC7A 1KLVA 1IRSA 4ANXA 4KHOA 1UNPA 3WAOA 4WVFB 2ZEQA 5HE0A 4BKSA 2LVPA 2K2JA 3HM6X 3NZUA 1W1HA 4KSKC 1ZC4B 4JK8A 1YD8U 2PJHA 3PLVA 3KRXA 4HDOA 4KV2A 1KJTA 4BVUC 3TIXA 4BBKA 1M94A 3A1QA 2G35A 2KJRA 4IOYX 1X1GA 2COAA 2JT4B 1OQYA 4NAWB 3A33B 2OJRA 3VAWA 4KAXB 1WZ3A 1WM2A 3RCPA 3QWZB 1WGDA 4JKCA 1E7VA 4RM9A 1WXAA 3KVFB 4FLHA 1E8XA 3PS6A 1PMSA 4II2B 4JKDA 1Q67A 1FGZA 5DI9B 2EKEC 3V6EB 2KLCA 4A3OA 2PE6B 2DHKA 3ODXA 1V5OA 1ZM0A 3A4RA 2MA9B 4IWOA 2Q13A 2YF0A 1IYFA 2LRWA 4II3B 5LXIB 2D11A 4NPNA 4ZYNA 4PS3A 4GIVA 3PSEB 4JL9A 2H7DA 4I6LB 4ZDVA 1ZSQA 2P0DA 2DAFA 3D8FA 1U5GA 1ZGUB 3LJ3A 3H7SA 1JRUA 2NVUI 3H7PB 5CX3A 2Y8FA 1ST7A 4TKNA 1DDVA 2CQUA 4W9IA 2NCNA 5HE1A 4MGYE 1YQBA 4DHZE 5D3WA 4LCDE 2AL6A 4A5KA 5D3YA 4NSWA 3L54A 1WYWB 5E6PA 4N9F4 1S3SG 3VVWB 1EUVB 4JLCA 1WJ1A 2KWVB 1B55A 1PQSA 1MIZB 2MWNB 3VIAA 1V2YA 2P0FA 3QIJA 1V5PA 3PG7A 3M62B 2CHWA 1HB6A 4DHJD 1WGGA 4ILHA 5JH5C 1GC6A 4FHJA 1G6JA 4MM3A 2KWUB 2RPQA 1V88A 2D9VA 1H4RA 3E9OA 4TV3A 2LG1A 4PS8A 4JKFA 2MFQA 4NY0A 2L0TA 2XBBC 3JYUA 2GOWA 2ZJDA 1XKEA 4HAYB 3A9JA 1W1DA 2UZSA 2LWPA 1WMHA 3N3KB 2BF8B 1WFYA 1XCGA 1X1MA 3U30A 3ODWA 3A1QB 4WWOA 3APDA 4A20A 1UELA 1UGMA 1MK9B 3PHWB 3X0WA 3NHEB 1UPQA 3DXDA 1VCBA 4JIOU 4EJNA 1TTNA 2JZ3B 3GYOA 1L7YA 2JXXA 2GCJA 2YS3A 1XR0B 2J0MA 2N1WA 3VUWA 4FHKA 4W9CA 3VXWA 2HJ8A 4DBGA 2KGXB 2OQBA 2LXAA 4EUTA 3NS8A 4W9FA 4B6HA 5IAAC 2FJ9A 3A8PA 1OGWA 2KWCA 2LJ5A 1FOEA 5CHVC 3WAPA 3DXCA 4K7WA 3UIPB 1RRPB 3OANA 2KFKA 5C6RA 2JVCA 1X1FA 4WJQA 1NBFC 1Z2MA 2LKOA 4JQWC 2KUPA 4K81A 2MBEA 4PQ0A 3P2BA 1SE9A 3ZO5B 2FCSA 1OTRB 4NQKE 5D2MB 1WJMA 2XQNM 5J3QA 4HLEA 4E71A 1U2BA 4ANUA 1I35A 4F7HA 1NTVA 4FBJB 2Y5BB 3PV1A 2V4LA 2YSZA 4W9HA 2DHJA 2M17A 1EF1A 1V80A 2YS1A 3QC8B 2Z0PA 2NS5A 5JHBA 1RFAA 5BO4B 1WR6E 2DX5A 5LOPB 2G4DB 2IZVB 2R09A 3PZDA 4GDKA 3ENBA 2DZIA 2KDBA 2EMTA 2KK8A 1VBGA 1XX0A 2D9WA 2UWQA 3B0AA 4MGIE 2WWZA 3NSUA 3N7CA 4CHJA 4GB9A 3DQVA 2QKMA 3AI5A 3KUDB 1NVLA 4ILGB 3MPXA 2OOBB 3HIZA 4TUUA 3R3MA 1WMHB 3TO1A 1J8CA 2HTHA 5KCVA 4BKTA 5CHFA 2IO1B 4K17A 3JW0X 5JVLA 4TYZA 1I7AA 2PZ1A 1MK7B 4LJPB 1N3HA 5JZEB 2O2VA 4MDKE 2Z0QA 4KDIC 2L1CA 2KTRA 1WY8A 2I1JA 2KDEB 3RYTA 2BYFA 3IVFA 3QWMA 4IWPA 2COFA 2IO2B 4MELA 3V5WA 2COCA 4LJOB 4BOZB 4GMVA 4HB0B 4EZLA 3ENEA 3U7DA 2KC2A 1KOTA 3E9PA 2GJYA 2N7EA 4M0WB 2NMBA 3ZLZA 3P7ZA 1I2HA 2XEWA 3JSVA 3MJWA 5GOWB 4M8MA 1U5FA 2MCNB 4TQ0A 3H6NA 2MBBB 1MAIA 4A3PA 3L13A 2CB8A 2N1VA 2AYOB 5EFXA 3BY4B 4DXAB 1MKEA 2ASQA 4DX8A 3H7PA 2GCLA 3TCAA 2WYQA 4CYEA 2B3AA 4OVVA 1GJZA 1UD7A 4CHKA 4HK2A 4MK0A 1FXTB 1GG3A 2IFSA 3AJ4A 2FJLA 5FI0A 1WRDB 4JKHA 1WI0A 1YJ1A 4XWXA 1WGQA 1P98A 2M1MA 1D3ZA 4M8NA 2DX5B 1K8RB 2HD5B 3NOBA 2D3GA 4RM8A 4MT7A 4GOCA 5GMVA 1WI1A 1X05A 5HE2A 2K00A 2C7MB 4KHBB 2YS5A 2Z0EB 4ANVA 4MY6A 2KANA 1V5TA 1W1GA 2UVMA 3IG3A 2C5LC 2O6VA 1L2NA 4WAAA 2K8CA 5AZGA 1CMXB 3SUZA 4DHZB 5C23A 4XX5A 3CIKA 1ZW7A 2RNRB 1KBLA 1WXMA 3WAMA 4KVGB 3CF6E 2M38A 1NTIA 2X0SA 4KDLB 1TZ1A 4HAVB 3D32A 2MSED 5FR6A 2HTHB 3UQBA 2IYBA 1LB1A 4IM3A 2AL3A 4JK7A 2JRHA 4DDGD 3H9DA 2O2VB 1WJNA 4IFSA 2LULA 2L7RA 2KTRB 1V61A 4H8SA 5LONB 2KC1A 4HPLB 4Z2MB 1UNQA 1GNUA 3PGEA 4GU2A 3RULA 2JP2A 1UPRA 2O6VD 2CHZA 3M95A 2G45B 3MDBC 2CY4A 2LOZA 4A6KA 4EMOA 2K6DB 1QZEA 3JSVB 4Y94A 3G9WA 1E8ZA 2DZJA 2FCQA 3DVNU 4HDQA 1WJ4A 1WXVA 2H7EA 3QA8A 5G2NA 3F5RA 1NTYA 1V86A 2C60A 2ELAA 4HVBA 3PRPB 1UBQA 1FHOA 1WGHA 2LGYA 4ILJA 2M14A 4IM0A 2YT0A 3W1YA 1U27A 2C7NB 3WYFB 5DIFB 2LGDA 2KTFA 2D9XA 3R7QA 2DFKA 1YIWA 2KJHB 4ANWA 2FIFA 1ACAA 4JGHB 2NR2A 5KHOA 3X23A 4E74A 2GBRA 3DBHI 2BWFA 1KM7A 1SHCA 2K2UA 3SDLC 1U4AA 3JVZX 4C0AA 4IAPA 4JKBA 2EC1A 4DBBA 4YL8A 5C79A 3RUIB 3CSTA 2BWES 3KRWA 2O6VB 1H10A 2BKFA 4DWFA 5LLIA 3V60A 3RCZA 3VH4B 3ZW3A 4NQLB 3WANA 3BJIA 1BT0A 1E5WA 2KX3A 2WX1A 2QHOA 2UYZB 2I1KA 2N0YA 2MBHA 4KZCA 3AULA 2ZVOA 4GGQA 4GXBA 3FLVA 3SU8X 5L81A 2ZCCA 3K9PB 1LW3A 5L83A 2DZKA 2V1YA 2DHIA 4A6FA 3VTWA 3DVNV 1WJ6A 3ML9A 4W9DA 4KSLC 1P9DU 2JRIB 1KI1B 2KQ7A 2Z59B 2WDTB 5G55A 2Z0OA 3PRMB 4XC2A 3IHPC 3ZDMC 1AARA 4HAWB 1KZGA 1S1QB 2ZNVB 1P5TA 3EHVA 4HB2B 5AZFA 2R0DA 1SGHA 2LI5A 2LBBA 1P1AA 1DIKA 3DBLI 3V61A 3L10B 2MQJA 2DYNA 2K39A 4DDID 3PVLA 2MKRA 2KDFB 4DHJB 3F0WA 2REXA 5D27A 1IPGA 3PEGA 1J19A 1WH3A 3ZNID 2NBWB 3PLUA 2IY0B 2C9WB 3O96A 1E8WA 3KH0A 1V5UA 3PP2A 3PSCA 3IBEA 2K8BA 1LM8B 3MTNB 4K1RB 4G3XB 1V89A 4W9EA 2IO0B 2DYOA 2XK5A 1X11A 1Y19B 2DENB 4K2PA 2JWZA 2ROVA 1WE7A 4IC7B 5J18A 4L6EA 1BTNA 3NZSA 3ULCA 2HE7A 1YX6B 1PLSA 2D9YA 3DCGA 2UZRA 3DOWA 3FSSA 2D10A 3LDZE 4I6PA 2DYQA 1X86A 1VD2A 3KY9A 4GPTB 2KFJA 2X18A 2YVCA 3TW1A 2A4ZA 3ZKJC 2ZZPB 5DHAB 3E66A 1TGZB 3L0WB 2KLGA 3GZNI 2FUHB 2DYMA 2I5CA 3A8QA 1WZ0A 4KIKA 4B95A 3A98B 4F7GA 2NBUA 2L05A 4AUQC 1EGXA 5HE3A 3V6CB 3EC8A 4MSQB 1HBKA 2FAZA 3PREA 4WJOA 3PVUA 2PEAA 4D0NB 3ML8A 5JP4A 1E90A 2NZ8B 2GBMA 1V9JA 2R2QA 2N9PC 2LOXA 3D8EA 2C7HA 3WA0A 1WX8A 1QC6A 5IA7A 1BTKA 1FGYA 1Q5WB 4A6FB 2LXCA 2RLOA 3OAWA 5CLLB 2GBKA 2KN5A 2LYDA 5D3XA 2QKLA 3D8DA 3L08A 2JF5A 2VRWB 4FULA 2LGXA 3ECIA 4I6NB 4ZRJA 1WR1A 2MRPA 1WIAA 2RGNB 3UINB 1LQBA 4JKEA 2MX2A 4FA6A 5TR5A 1GC7A 2P8VA 2J0KA 1WE6A 3DBSA 3ZVVA 2ZVNA 3N30A 4AJWA 4EZJA 4HHVA 2Z0DB 2DN6A 4HWIB 3Q3JA 4HPMB 4RMAA 3L16A 3ZDTA 2R2OA 5DHFB 3T9LA 2AEHA 4G50A 1WF9A 3TL5A 3OLMD 2FCNA 1P6SA 3QCAA 1U5EA 1AQCA 4FN2A 2DIKA 2JUOA 3T06A 4Z2NA 4BBNC 2DZMA 5C5BB 3CSFA 5EDSA 1WX7A 2XK5B 1JDEA 1TJ6A 4IM2A 2N23A 2CRFA 4W9KA 1UNRA 1R4NI 2IBIB 1UH6A 4J6IA 3VDZA 3P6AA 3ZNZB 2L3ZA 5JLJB 5LXHA 3KZ1A 5DPWA 1DBHA 2CKHB 2J7QB 5J2RA 2EMSA 2IO3B 3ZTCA 2D4QA 1XD3B 4CHMA 4F1SA 1F9JA 4HAUB 1DDMA 2KOXA 1RRBA 2ZNVC 1WX9A 4JK9A 2CAYA 4HB4B 3R66C 3PPAA 3DBRI 3FM8C 4MGKE 4PYZA 4WWPA 4KIKB 2LASA 2D2QA 2RSGA 4ZRKA 1XT9B 4X57B 3UIOB 5IJMA 2COPA 4LDTD 1FAOA 4HAXB 1ZKHA 1ZC3B 2MWSB 1EO6A 2DTCA 2KO3A 3HM3A 1V49A 3VQIA 2LVQA 2VKIA 3VTVA 1PFJA 1YX5B 1BWNA 1P3RA 3VUYA 1E7UA 4GZUA 4KZ0A 4DX90 3TMPB 4F8CB 1P0RA 4GDLA 1QQGA 1UBIA 3WIMA 3N32A 4WWNA 4NNJB 2W2XD 1NU2A 2VRRB 1NDDA 3PT2B 3HK0A 3OJ3A 2FIDA 1AWEA 1WXSA 2N4FA 2JY6A 2EJ8A 4JKAA 2KJ6A 4HATB 3SBTA 3TJPA 2RD0A 2M8SA 2KHWB 4GN1A 3IFWB 4GSWA 4FJZA 2KX0A 3PTFC 5CTRC 1WJUA 2DHZA 1XODA 4PYUA 1V81A 1J0GA 3A9KB 4WSFA 4E3CA 3B1LX 4PNKA 4BKSD 3QARA 4LDTB 4AJYB 2L76A 2ABDA 2MDXA 2A5UA 1H8CA 3AU5A 2CHXA 1OEYJ 3HW2B 2IY1B 2VSZA 2L8JA 3KUZA 4PS7A 4IW0A 1GGOA 4EZKA 5KQ1A 2KQSA 5D94A 3ZUNA 3KW5B 3QAQA 2RUKB 1TXDA 1Q0WB 1MPHA 3QX1A 1DYNA 4W9GA 3VUXA 2BCJA 5J17A 1FB8A 2CR5A 3DDCB 1XD4A 1Y5OA 3OJ4B 1C3TA 1UEFA 3ALBA 3EFUA 2N9XA 1TQZA 4MJSA 2K1FA 4MEMA 4NJ7A 1RJ2A 1LFDA 5D7GA 4BFRA 3VHTC 5HKHA 5JHAA 2Y8GA 5J3TA 4ICUA 2ROZB 2P0HA 3TFMA 1Y8RC 3UGBB 3GYPA 4NJ6A 3ZRCA 3BINA 4FADA 2MP2A 2MBQA 3DVGX 4A6HA 2ZPYA 3SO6A 3EECA 4HXDA 3B08A 4G11A 4IG7B 5CHWA 4GDLB 2D07B 2CU1A 1E8YA 2BYEA 4WJPA 3KSYA 1ZVRA 3K9OB 1EAZA 1HE8A 2G4SA 2NPTA 2KMAA 4EOYA 2BGFA 3VOQA 4K7UA 1FHWA 4HJKA 2V76A 3QBVB 2KNBA 3VH3B 3APFA 4GMXB 4AOFA 1DROA 3CMMB 5J3YA 2ZPNA 2RR9A 2M0XA 2CS4A 5DPSA 2G3QB 1OMWA 1M7RA 4W9JA 3ZTDA 1Z5SB 2DAJA 1FHXA 3LJUX 1SIFA 5E6OA 2LVOA 2M4NA 4G0NB 4K2OA 2GS0A 3UQAA 5C5BA 3FEHA 5E6NA 4B9KA 3PHXB 2MBOA 1T0YA 2Y7BA 4URKA 4MGZE 5AZHA 1RAXA 3M63B 4FJYA 4HB3B 4MSMB 1J0WA 2DYBA 2PPHA 2ZCBA 3CXBB 5D6JB 4OVUA 3E9LA 4BBNF 2YRYA 5FI1A 4F7UP 2WX0A 3KYDD 1Z87A 3S2AA 3ZVRA 1MG8A 2KDIA 3ODOA 2FDQA 2KVRA 2RVBB 3UF8A 3MHSD 4EFOA 3FP5A 3RT3B 2BPSA 2PE9A 2DA0A 2CY5A 2RQ1A 1LXDA 2E2XA 2D9ZA 1GUAB 1TBEA 5KQ4A 3SHQA 3DXEA 3AU4A 4HCNB 1P3QU 4EEWA 4MJSB 3DVGY 3R7RA 4BKGA 1BAKA 4YONA 2MW5A 1NI2A 4EKUA 2KKCA 4WJ7A 4IWQA 4ICVA 3AXCA 2W9NA 3SYXA 1A5RA 2AWTA 2KD0A 2N7DA 4JKGA 3RZWC 2MP2B 4MH0E 4B6WA 2FNJB 3A9JB 5AEKB 3Q3FA 2GBJA 5KHQA 2J0JA 3GOEA 3C0RB 2K6QA 1OY2A 2KZRA 3U8ZA 3PRZA 2K25A 1WG7A 1WVHA 4XZ4A 3W1SC 2KXJA 3HQCA 2RSUA 1UZXB 3A4SC 1OEYA 2WH5A 3DPDA 2NPTB 2ELBA 2W2WA 5JHHA 4NAWA 3ZNGC 3O65B 1U29A 3I3TB 2MLBA 5JHGA 2HRJA 2LD9A 5DH9B 2W2XC 4W9LA 5D3VA 5C1ZA 1ISNA 1M7EA 2DLWA 4HAZB 3ONSA 3NY5A 1R4MI 1I42A 2L0FA 2R82A 2N9EB 5C16A 2L00B 4BOSC 1U5DA 5L95C 3M1IB 5DCNA 3ZNHB 1RLFA 3T8MA 1K5GB 2YT1A 4P7IA 3A9KA 3APCA 4WJNA 2KFKB 3QK0A 3VTUA 3SBGA 2NBVB 4TQ1A 1XQQA 2IYDB 2LUEA 1OQNA 3KYCD 2KMCA 3ZIMA 3KUCB 4AWJA 2CODA 2DKPA 2ADZA 3QJZA 2DX1A 3TBLD 2BYVE 3W1SA 4CO7A 1DDWA 2KCJA 2YLMA 3ULBA 2V3SA 3ML4A 1WGUA 3QQ8B 2J59M 4KHAA 3PVWA 4DK5A 4FJVB 1MIXA 3EPYA 5DPRA 4IUMB 3WALA 1EF5A 4HCPB 2DKQA 1WGYA 2LZ6A 1EVHA 1WGRA 1HB8A 1V6EA 1V5MA 1KZ7A 1Q1OA 1K5DB 2I5FA 4AP4C 1WM3A 2LRUA 3V62A 3SD5A 2RGFA 3HHMA 3H1UA 4K7SA 3TVVA 1C1YB 3SV1A 4GDKB 1IP9A 2JPHA 3UZTA 2L2IA 4ASWC 3L17A 3RZFA 2OTXA 2GBNA 4ZRIA 5DPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FCM A;  2K8H A;  3VFK A;  4F7Z A;  2JZZ A;  3RD2 A;  3SNH A;  4WQO B;  3ZRF A;  2GMI C;  3QHT A;  2BKR B;  3M3J A;  5CLQ B;  1KLV A;  1IRS A;  4ANX A;  4KHO A;  1UNP A;  3WAO A;  4WVF B;  2ZEQ A;  5HE0 A;  4BKS A;  2LVP A;  2K2J A;  3HM6 X;  3NZU A;  1W1H A;  4KSK C;  1ZC4 B;  1YD8 U;  2PJH A;  3PLV A;  3KRX A;  4HDO A;  4KV2 A;  1KJT A;  4BVU C;  3TIX A;  4BBK A;  1M94 A;  3A1Q A;  2G35 A;  2KJR A;  4IOY X;  1X1G A;  2COA A;  2JT4 B;  1OQY A;  4NAW B;  3A33 B;  2OJR A;  3VAW A;  4KAX B;  1WZ3 A;  1WM2 A;  3RCP A;  3QWZ B;  1WGD A;  1E7V A;  4RM9 A;  1WXA A;  3KVF B;  4FLH A;  1E8X A;  3PS6 A;  1PMS A;  4II2 B;  1Q67 A;  1FGZ A;  5DI9 B;  2EKE C;  3V6E B;  2KLC A;  4A3O A;  2PE6 B;  2DHK A;  3ODX A;  1V5O A;  1ZM0 A;  3A4R A;  2MA9 B;  4IWO A;  2Q13 A;  2YF0 A;  1IYF A;  2LRW A;  4II3 B;  5LXI B;  2D11 A;  4NPN A;  4ZYN A;  4PS3 A;  4GIV A;  3PSE B;  4JL9 A;  2H7D A;  4I6L B;  4ZDV A;  1ZSQ A;  2P0D A;  2DAF A;  3D8F A;  1U5G A;  1ZGU B;  3LJ3 A;  3H7S A;  1JRU A;  2NVU I;  3H7P B;  5CX3 A;  2Y8F A;  1ST7 A;  4TKN A;  1DDV A;  2CQU A;  4W9I A;  2NCN A;  5HE1 A;  4MGY E;  1YQB A;  4DHZ E;  5D3W A;  4LCD E;  2AL6 A;  4A5K A;  5D3Y A;  4NSW A;  3L54 A;  1WYW B;  5E6P A;  4N9F 4;  1S3S G;  3VVW B;  1EUV B;  4JLC A;  1WJ1 A;  2KWV B;  1B55 A;  1PQS A;  1MIZ B;  2MWN B;  3VIA A;  1V2Y A;  2P0F A;  3QIJ A;  1V5P A;  3PG7 A;  3M62 B;  2CHW A;  1HB6 A;  4DHJ D;  1WGG A;  5JH5 C;  1GC6 A;  4FHJ A;  1G6J A;  4MM3 A;  2KWU B;  2RPQ A;  1V88 A;  2D9V A;  1H4R A;  4TV3 A;  2LG1 A;  4PS8 A;  2MFQ A;  4NY0 A;  2L0T A;  2XBB C;  3JYU A;  2GOW A;  2ZJD A;  1XKE A;  4HAY B;  3A9J A;  1W1D A;  2UZS A;  2LWP A;  1WMH A;  3N3K B;  2BF8 B;  1WFY A;  1XCG A;  1X1M A;  3U30 A;  3ODW A;  3A1Q B;  4WWO A;  3APD A;  4A20 A;  1UEL A;  1UGM A;  1MK9 B;  3PHW B;  3X0W A;  3NHE B;  1UPQ A;  3DXD A;  1VCB A;  4JIO U;  4EJN A;  1TTN A;  2JZ3 B;  3GYO A;  1L7Y A;  2JXX A;  2GCJ A;  2YS3 A;  1XR0 B;  2J0M A;  2N1W A;  3VUW A;  4FHK A;  4W9C A;  3VXW A;  2HJ8 A;  4DBG A;  2KGX B;  2OQB A;  2LXA A;  4EUT A;  3NS8 A;  4W9F A;  4B6H A;  5IAA C;  2FJ9 A;  3A8P A;  1OGW A;  2KWC A;  2LJ5 A;  1FOE A;  5CHV C;  3WAP A;  3DXC A;  4K7W A;  3UIP B;  1RRP B;  3OAN A;  2KFK A;  5C6R A;  2JVC A;  1X1F A;  4WJQ A;  1NBF C;  1Z2M A;  2LKO A;  4JQW C;  2KUP A;  4K81 A;  2MBE A;  4PQ0 A;  3P2B A;  1SE9 A;  3ZO5 B;  2FCS A;  1OTR B;  4NQK E;  5D2M B;  1WJM A;  2XQN M;  5J3Q A;  4HLE A;  4E71 A;  1U2B A;  4ANU A;  1I35 A;  4F7H A;  1NTV A;  4FBJ B;  2Y5B B;  3PV1 A;  2V4L A;  2YSZ A;  4W9H A;  2DHJ A;  2M17 A;  1EF1 A;  1V80 A;  2YS1 A;  3QC8 B;  2Z0P A;  2NS5 A;  5JHB A;  1RFA A;  5BO4 B;  1WR6 E;  2DX5 A;  5LOP B;  2G4D B;  2IZV B;  2R09 A;  3PZD A;  4GDK A;  2DZI A;  2KDB A;  2EMT A;  2KK8 A;  1XX0 A;  2D9W A;  2UWQ A;  3B0A A;  4MGI E;  2WWZ A;  3NSU A;  3N7C A;  4CHJ A;  4GB9 A;  3DQV A;  2QKM A;  3AI5 A;  3KUD B;  1NVL A;  3MPX A;  2OOB B;  3HIZ A;  4TUU A;  3R3M A;  1WMH B;  3TO1 A;  1J8C A;  2HTH A;  5KCV A;  4BKT A;  5CHF A;  2IO1 B;  4K17 A;  3JW0 X;  4TYZ A;  1I7A A;  2PZ1 A;  1MK7 B;  4LJP B;  1N3H A;  5JZE B;  2O2V A;  4MDK E;  2Z0Q A;  4KDI C;  2L1C A;  2KTR A;  1WY8 A;  2I1J A;  2KDE B;  3RYT A;  2BYF A;  3IVF A;  3QWM A;  4IWP A;  2COF A;  2IO2 B;  4MEL A;  3V5W A;  2COC A;  4LJO B;  4BOZ B;  4GMV A;  4HB0 B;  4EZL A;  3ENE A;  3U7D A;  2KC2 A;  1KOT A;  2GJY A;  2N7E A;  4M0W B;  2NMB A;  3ZLZ A;  3P7Z A;  1I2H A;  2XEW A;  3JSV A;  3MJW A;  5GOW B;  4M8M A;  1U5F A;  2MCN B;  4TQ0 A;  3H6N A;  2MBB B;  1MAI A;  4A3P A;  3L13 A;  2CB8 A;  2N1V A;  2AYO B;  5EFX A;  3BY4 B;  4DXA B;  1MKE A;  2ASQ A;  4DX8 A;  3H7P A;  2GCL A;  3TCA A;  2WYQ A;  4CYE A;  2B3A A;  4OVV A;  1GJZ A;  1UD7 A;  4CHK A;  4HK2 A;  4MK0 A;  1FXT B;  1GG3 A;  2IFS A;  3AJ4 A;  2FJL A;  5FI0 A;  1WRD B;  1WI0 A;  1YJ1 A;  4XWX A;  1WGQ A;  1P98 A;  2M1M A;  1D3Z A;  4M8N A;  2DX5 B;  1K8R B;  2HD5 B;  3NOB A;  2D3G A;  4RM8 A;  4MT7 A;  4GOC A;  5GMV A;  1WI1 A;  1X05 A;  5HE2 A;  2K00 A;  2C7M B;  4KHB B;  2YS5 A;  2Z0E B;  4ANV A;  4MY6 A;  2KAN A;  1V5T A;  1W1G A;  2UVM A;  3IG3 A;  2C5L C;  2O6V A;  1L2N A;  4WAA A;  2K8C A;  5AZG A;  1CMX B;  3SUZ A;  4DHZ B;  5C23 A;  4XX5 A;  3CIK A;  1ZW7 A;  2RNR B;  1WXM A;  3WAM A;  4KVG B;  3CF6 E;  2M38 A;  1NTI A;  4KDL B;  1TZ1 A;  4HAV B;  3D32 A;  2MSE D;  5FR6 A;  2HTH B;  3UQB A;  2IYB A;  1LB1 A;  4IM3 A;  2AL3 A;  2JRH A;  4DDG D;  3H9D A;  2O2V B;  1WJN A;  4IFS A;  2LUL A;  2L7R A;  2KTR B;  1V61 A;  4H8S A;  5LON B;  2KC1 A;  4HPL B;  4Z2M B;  1UNQ A;  1GNU A;  3PGE A;  4GU2 A;  3RUL A;  2JP2 A;  1UPR A;  2O6V D;  2CHZ A;  3M95 A;  2G45 B;  3MDB C;  2CY4 A;  2LOZ A;  4A6K A;  4EMO A;  2K6D B;  1QZE A;  3JSV B;  4Y94 A;  3G9W A;  1E8Z A;  2DZJ A;  2FCQ A;  3DVN U;  4HDQ A;  1WJ4 A;  1WXV A;  2H7E A;  3QA8 A;  5G2N A;  3F5R A;  1NTY A;  1V86 A;  2C60 A;  2ELA A;  4HVB A;  3PRP B;  1UBQ A;  1FHO A;  1WGH A;  2LGY A;  2M14 A;  4IM0 A;  2YT0 A;  3W1Y A;  1U27 A;  2C7N B;  3WYF B;  5DIF B;  2LGD A;  2KTF A;  2D9X A;  3R7Q A;  2DFK A;  1YIW A;  2KJH B;  4ANW A;  2FIF A;  1ACA A;  4JGH B;  2NR2 A;  5KHO A;  3X23 A;  4E74 A;  2GBR A;  3DBH I;  2BWF A;  1KM7 A;  1SHC A;  2K2U A;  3SDL C;  1U4A A;  3JVZ X;  4C0A A;  4IAP A;  2EC1 A;  4DBB A;  4YL8 A;  5C79 A;  3RUI B;  3CST A;  2BWE S;  3KRW A;  2O6V B;  1H10 A;  2BKF A;  4DWF A;  5LLI A;  3V60 A;  3RCZ A;  3VH4 B;  3ZW3 A;  4NQL B;  3WAN A;  3BJI A;  1BT0 A;  1E5W A;  2KX3 A;  2WX1 A;  2QHO A;  2UYZ B;  2I1K A;  2N0Y A;  2MBH A;  4KZC A;  3AUL A;  2ZVO A;  4GGQ A;  4GXB A;  3FLV A;  3SU8 X;  5L81 A;  2ZCC A;  3K9P B;  1LW3 A;  5L83 A;  2DZK A;  2V1Y A;  2DHI A;  4A6F A;  3VTW A;  3DVN V;  1WJ6 A;  3ML9 A;  4W9D A;  4KSL C;  1P9D U;  2JRI B;  1KI1 B;  2KQ7 A;  2Z59 B;  2WDT B;  5G55 A;  2Z0O A;  3PRM B;  4XC2 A;  3IHP C;  3ZDM C;  1AAR A;  4HAW B;  1KZG A;  1S1Q B;  2ZNV B;  1P5T A;  3EHV A;  4HB2 B;  5AZF A;  2R0D A;  1SGH A;  2LI5 A;  2LBB A;  1P1A A;  3DBL I;  3V61 A;  3L10 B;  2MQJ A;  2DYN A;  2K39 A;  4DDI D;  3PVL A;  2MKR A;  2KDF B;  4DHJ B;  3F0W A;  2REX A;  5D27 A;  1IPG A;  3PEG A;  1J19 A;  1WH3 A;  3ZNI D;  2NBW B;  3PLU A;  2IY0 B;  2C9W B;  3O96 A;  1E8W A;  3KH0 A;  1V5U A;  3PP2 A;  3PSC A;  3IBE A;  2K8B A;  1LM8 B;  3MTN B;  4K1R B;  4G3X B;  1V89 A;  4W9E A;  2IO0 B;  2DYO A;  2XK5 A;  1X11 A;  1Y19 B;  2DEN B;  4K2P A;  2JWZ A;  2ROV A;  1WE7 A;  4IC7 B;  5J18 A;  4L6E A;  1BTN A;  3NZS A;  3ULC A;  2HE7 A;  1YX6 B;  1PLS A;  2D9Y A;  3DCG A;  2UZR A;  3DOW A;  3FSS A;  2D10 A;  3LDZ E;  4I6P A;  2DYQ A;  1X86 A;  1VD2 A;  3KY9 A;  4GPT B;  2KFJ A;  2X18 A;  2YVC A;  3TW1 A;  2A4Z A;  3ZKJ C;  2ZZP B;  5DHA B;  1TGZ B;  3L0W B;  2KLG A;  3GZN I;  2FUH B;  2DYM A;  2I5C A;  3A8Q A;  1WZ0 A;  4KIK A;  4B95 A;  3A98 B;  4F7G A;  2NBU A;  2L05 A;  4AUQ C;  1EGX A;  5HE3 A;  3V6C B;  3EC8 A;  4MSQ B;  1HBK A;  2FAZ A;  3PRE A;  4WJO A;  3PVU A;  2PEA A;  4D0N B;  3ML8 A;  5JP4 A;  1E90 A;  2NZ8 B;  2GBM A;  1V9J A;  2R2Q A;  2N9P C;  2LOX A;  3D8E A;  2C7H A;  3WA0 A;  1WX8 A;  1QC6 A;  5IA7 A;  1BTK A;  1FGY A;  1Q5W B;  4A6F B;  2LXC A;  2RLO A;  3OAW A;  5CLL B;  2GBK A;  2KN5 A;  2LYD A;  5D3X A;  2QKL A;  3D8D A;  3L08 A;  2JF5 A;  2VRW B;  4FUL A;  2LGX A;  3ECI A;  4I6N B;  4ZRJ A;  1WR1 A;  2MRP A;  1WIA A;  2RGN B;  3UIN B;  1LQB A;  2MX2 A;  4FA6 A;  5TR5 A;  1GC7 A;  2P8V A;  2J0K A;  1WE6 A;  3DBS A;  3ZVV A;  2ZVN A;  3N30 A;  4AJW A;  4EZJ A;  4HHV A;  2Z0D B;  2DN6 A;  4HWI B;  3Q3J A;  4HPM B;  4RMA A;  3L16 A;  3ZDT A;  2R2O A;  5DHF B;  3T9L A;  2AEH A;  4G50 A;  1WF9 A;  3TL5 A;  3OLM D;  2FCN A;  1P6S A;  3QCA A;  1U5E A;  1AQC A;  4FN2 A;  2JUO A;  3T06 A;  4Z2N A;  4BBN C;  2DZM A;  5C5B B;  3CSF A;  5EDS A;  1WX7 A;  2XK5 B;  1TJ6 A;  4IM2 A;  2N23 A;  2CRF A;  4W9K A;  1UNR A;  1R4N I;  2IBI B;  1UH6 A;  4J6I A;  3VDZ A;  3P6A A;  3ZNZ B;  2L3Z A;  5JLJ B;  5LXH A;  3KZ1 A;  5DPW A;  1DBH A;  2CKH B;  2J7Q B;  5J2R A;  2EMS A;  2IO3 B;  3ZTC A;  2D4Q A;  1XD3 B;  4CHM A;  4F1S A;  1F9J A;  4HAU B;  1DDM A;  2KOX A;  1RRB A;  2ZNV C;  1WX9 A;  2CAY A;  4HB4 B;  3R66 C;  3PPA A;  3DBR I;  3FM8 C;  4MGK E;  4PYZ A;  4WWP A;  4KIK B;  2LAS A;  2D2Q A;  2RSG A;  4ZRK A;  1XT9 B;  4X57 B;  3UIO B;  5IJM A;  2COP A;  4LDT D;  1FAO A;  4HAX B;  1ZKH A;  1ZC3 B;  2MWS B;  1EO6 A;  2DTC A;  2KO3 A;  3HM3 A;  1V49 A;  3VQI A;  2LVQ A;  2VKI A;  3VTV A;  1PFJ A;  1YX5 B;  1BWN A;  1P3R A;  3VUY A;  1E7U A;  4GZU A;  4KZ0 A;  4DX9 0;  3TMP B;  4F8C B;  1P0R A;  4GDL A;  1QQG A;  1UBI A;  3WIM A;  3N32 A;  4WWN A;  4NNJ B;  2W2X D;  1NU2 A;  2VRR B;  1NDD A;  3PT2 B;  3HK0 A;  3OJ3 A;  2FID A;  1AWE A;  1WXS A;  2N4F A;  2JY6 A;  2EJ8 A;  2KJ6 A;  4HAT B;  3TJP A;  2RD0 A;  2M8S A;  2KHW B;  4GN1 A;  3IFW B;  4GSW A;  4FJZ A;  2KX0 A;  3PTF C;  5CTR C;  1WJU A;  2DHZ A;  1XOD A;  4PYU A;  1V81 A;  1J0G A;  3A9K B;  4WSF A;  4E3C A;  3B1L X;  4PNK A;  4BKS D;  3QAR A;  4LDT B;  4AJY B;  2L76 A;  2ABD A;  2MDX A;  2A5U A;  1H8C A;  3AU5 A;  2CHX A;  1OEY J;  3HW2 B;  2IY1 B;  2VSZ A;  2L8J A;  3KUZ A;  4PS7 A;  4IW0 A;  4EZK A;  5KQ1 A;  2KQS A;  5D94 A;  3ZUN A;  3KW5 B;  3QAQ A;  2RUK B;  1TXD A;  1Q0W B;  1MPH A;  3QX1 A;  1DYN A;  4W9G A;  3VUX A;  2BCJ A;  5J17 A;  1FB8 A;  2CR5 A;  3DDC B;  1XD4 A;  1Y5O A;  3OJ4 B;  1C3T A;  1UEF A;  3ALB A;  3EFU A;  2N9X A;  1TQZ A;  4MJS A;  2K1F A;  4MEM A;  4NJ7 A;  1RJ2 A;  1LFD A;  5D7G A;  4BFR A;  3VHT C;  5HKH A;  5JHA A;  2Y8G A;  5J3T A;  4ICU A;  2ROZ B;  2P0H A;  3TFM A;  1Y8R C;  3UGB B;  3GYP A;  4NJ6 A;  3ZRC A;  3BIN A;  4FAD A;  2MP2 A;  2MBQ A;  3DVG X;  4A6H A;  2ZPY A;  3SO6 A;  3EEC A;  4HXD A;  3B08 A;  4G11 A;  4IG7 B;  5CHW A;  4GDL B;  2D07 B;  2CU1 A;  1E8Y A;  2BYE A;  4WJP A;  3KSY A;  1ZVR A;  3K9O B;  1EAZ A;  1HE8 A;  2G4S A;  2NPT A;  2KMA A;  4EOY A;  2BGF A;  3VOQ A;  4K7U A;  1FHW A;  4HJK A;  2V76 A;  3QBV B;  2KNB A;  3VH3 B;  3APF A;  4GMX B;  4AOF A;  1DRO A;  3CMM B;  5J3Y A;  2ZPN A;  2RR9 A;  2M0X A;  2CS4 A;  5DPS A;  2G3Q B;  1OMW A;  1M7R A;  4W9J A;  3ZTD A;  1Z5S B;  2DAJ A;  1FHX A;  3LJU X;  1SIF A;  5E6O A;  2LVO A;  2M4N A;  4G0N B;  4K2O A;  2GS0 A;  3UQA A;  5C5B A;  3FEH A;  5E6N A;  4B9K A;  3PHX B;  2MBO A;  1T0Y A;  2Y7B A;  4URK A;  4MGZ E;  5AZH A;  1RAX A;  3M63 B;  4FJY A;  4HB3 B;  4MSM B;  1J0W A;  2DYB A;  2PPH A;  2ZCB A;  3CXB B;  5D6J B;  4OVU A;  4BBN F;  2YRY A;  5FI1 A;  4F7U P;  2WX0 A;  3KYD D;  1Z87 A;  3S2A A;  3ZVR A;  1MG8 A;  2KDI A;  3ODO A;  2FDQ A;  2KVR A;  2RVB B;  3UF8 A;  3MHS D;  4EFO A;  3FP5 A;  3RT3 B;  2BPS A;  2PE9 A;  2DA0 A;  2CY5 A;  2RQ1 A;  1LXD A;  2E2X A;  2D9Z A;  1GUA B;  1TBE A;  5KQ4 A;  3SHQ A;  3DXE A;  3AU4 A;  4HCN B;  1P3Q U;  4EEW A;  4MJS B;  3DVG Y;  3R7R A;  4BKG A;  1BAK A;  4YON A;  2MW5 A;  1NI2 A;  4EKU A;  2KKC A;  4WJ7 A;  4IWQ A;  4ICV A;  3AXC A;  2W9N A;  3SYX A;  1A5R A;  2AWT A;  2KD0 A;  2N7D A;  3RZW C;  2MP2 B;  4MH0 E;  4B6W A;  2FNJ B;  3A9J B;  5AEK B;  3Q3F A;  2GBJ A;  5KHQ A;  2J0J A;  3GOE A;  3C0R B;  2K6Q A;  1OY2 A;  2KZR A;  3U8Z A;  3PRZ A;  2K25 A;  1WG7 A;  1WVH A;  4XZ4 A;  3W1S C;  2KXJ A;  3HQC A;  2RSU A;  1UZX B;  3A4S C;  1OEY A;  2WH5 A;  3DPD A;  2NPT B;  2ELB A;  2W2W A;  5JHH A;  4NAW A;  3ZNG C;  3O65 B;  1U29 A;  3I3T B;  2MLB A;  5JHG A;  2HRJ A;  2LD9 A;  5DH9 B;  2W2X C;  4W9L A;  5D3V A;  5C1Z A;  1ISN A;  1M7E A;  2DLW A;  4HAZ B;  3ONS A;  3NY5 A;  1R4M I;  1I42 A;  2L0F A;  2N9E B;  5C16 A;  2L00 B;  4BOS C;  1U5D A;  5L95 C;  3M1I B;  5DCN A;  3ZNH B;  1RLF A;  3T8M A;  1K5G B;  2YT1 A;  4P7I A;  3A9K A;  3APC A;  4WJN A;  2KFK B;  3QK0 A;  3VTU A;  2NBV B;  4TQ1 A;  1XQQ A;  2IYD B;  2LUE A;  1OQN A;  3KYC D;  2KMC A;  3ZIM A;  3KUC B;  4AWJ A;  2COD A;  2DKP A;  2ADZ A;  3QJZ A;  2DX1 A;  3TBL D;  2BYV E;  3W1S A;  4CO7 A;  1DDW A;  2KCJ A;  2YLM A;  3ULB A;  2V3S A;  3ML4 A;  1WGU A;  3QQ8 B;  2J59 M;  4KHA A;  3PVW A;  4DK5 A;  4FJV B;  1MIX A;  3EPY A;  5DPR A;  4IUM B;  3WAL A;  1EF5 A;  4HCP B;  2DKQ A;  1WGY A;  2LZ6 A;  1EVH A;  1WGR A;  1HB8 A;  1V6E A;  1V5M A;  1KZ7 A;  1Q1O A;  1K5D B;  2I5F A;  4AP4 C;  1WM3 A;  2LRU A;  3V62 A;  3SD5 A;  2RGF A;  3HHM A;  3H1U A;  4K7S A;  3TVV A;  1C1Y B;  3SV1 A;  4GDK B;  1IP9 A;  2JPH A;  3UZT A;  2L2I A;  4ASW C;  3L17 A;  3RZF A;  2OTX A;  2GBN A;  4ZRI A;  5DPT A; 
#chains in the Genus database with same CATH topology
 2FCM A;  2K8H A;  3VFK A;  4F7Z A;  2JZZ A;  3RD2 A;  3SNH A;  3TEZ A;  4WQO B;  3ZRF A;  2GMI C;  3MC0 B;  3QHT A;  2BKR B;  1VBH A;  4JKG B;  3M3J A;  5CLQ B;  2W3S A;  1KC7 A;  1MHH E;  1KLV A;  1IRS A;  2MEK A;  1TYG B;  4ANX A;  4KHO A;  1UNP A;  3WAO A;  4C4V B;  2WXN A;  4WVF B;  2ZEQ A;  5HE0 A;  4BKS A;  2LVP A;  2FJU B;  1A70 A;  3BVZ A;  3AMZ A;  4USA A;  2K2J A;  3HM6 X;  2MJ3 A;  3NZU A;  1W1H A;  1T0S C;  3GB1 A;  3IT6 B;  4KSK C;  1ZC4 B;  4JK8 A;  1YD8 U;  2PJH A;  3PLV A;  3KRX A;  4HDO A;  4KV2 A;  1KJT A;  3NUH B;  4BVU C;  3TIX A;  4BBK A;  1M94 A;  3A1Q A;  1J7C A;  2G35 A;  2KJR A;  4IOY X;  1YOV B;  1X1G A;  2W55 A;  5BYR A;  2COA A;  2JT4 B;  1OQY A;  4NAW B;  3A33 B;  3AE3 B;  2OJR A;  3VAW A;  4KAX B;  1WZ3 A;  1ET9 A;  3AEC B;  3RFZ B;  1WM2 A;  3RCP A;  3NVV A;  3QWZ B;  1L6U A;  1SE4 A;  1WGD A;  4JKC A;  1N6Z A;  2D5G A;  2HTM E;  2NMQ A;  3P4S B;  1E7V A;  4RM9 A;  1WXA A;  3KVF B;  4FLH A;  4LNN A;  5EE0 A;  1E8X A;  3PS6 A;  1PMS A;  4II2 B;  4JKD A;  1Q67 A;  4YSZ B;  2MH7 A;  1FGZ A;  3SFD B;  4R3D A;  5DI9 B;  2EKE C;  1FMA D;  3V6E B;  1ZYI A;  2KLC A;  4A3O A;  2PE6 B;  2KIE A;  3ZJU A;  2DHK A;  3ODX A;  1V5O A;  1ZM0 A;  3A4R A;  2MA9 B;  4IWO A;  4A55 A;  2Q13 A;  2YF0 A;  1L0Y B;  1IYF A;  3W2D A;  2LRW A;  4II3 B;  2OHF A;  5LXI B;  2D11 A;  4A90 A;  1JCK B;  4NPN A;  4ZYN A;  4PS3 A;  4GIV A;  3PSE B;  4JL9 A;  4LNK A;  3GP7 A;  2H7D A;  4I6L B;  3RNA C;  4ZDV A;  1ZSQ A;  2P0D A;  2DAF A;  3D8F A;  1U5G A;  2HDE A;  1ZGU B;  3LJ3 A;  3H7S A;  1JRU A;  2NVU I;  2RDG A;  3H7P B;  3LXF A;  5CX3 A;  3U4E G;  1Q10 A;  2Y8F A;  1ST7 A;  4TKN A;  1DDV A;  2J4X A;  5BYS A;  3U7Z A;  2CQU A;  4RH6 A;  3AEA B;  4W9I A;  2W54 A;  2NCN A;  3CIR B;  1TS5 A;  5LNK 1;  4C7Y A;  5HE1 A;  4MGY E;  1YQB A;  4DHZ E;  5D3W A;  2FBW B;  4ZHP A;  4LCD E;  1NI3 A;  2AL6 A;  4HRO A;  4A5K A;  5D3Y A;  2Y3A A;  1YQ4 B;  4JWU C;  4NSW A;  3L54 A;  1KTK A;  1WYW B;  1BML C;  2WXI A;  5E6P A;  5I2S A;  4N9F 4;  1S3S G;  3VVW B;  2INP E;  1EUV B;  4JLC A;  1CK1 A;  1KFY B;  1L5P A;  1WJ1 A;  2KWV B;  1B55 A;  1PQS A;  1MIZ B;  2MWN B;  3VIA A;  1V2Y A;  1JWU D;  2P0F A;  3QIJ A;  1V5P A;  3PG7 A;  2PVG C;  5M4Y B;  3M62 B;  1T5X D;  1JRO A;  2CHW A;  1HB6 A;  4DHJ D;  1JWS D;  1WGG A;  1FXI A;  4ILH A;  5G5G A;  2GB1 A;  3HRD D;  1XLN A;  4HPP A;  1GC6 A;  4FHJ A;  5JH5 C;  1FD6 A;  1AN8 A;  1G6J A;  4MM3 A;  4XDC A;  2KWU B;  2RPQ A;  1V88 A;  2D9V A;  3UI3 A;  1H4R A;  3E9O A;  1ZOY B;  4TV3 A;  3W5U B;  1OQR A;  1Y56 A;  2LG1 A;  4PS8 A;  5GXG B;  4JKF A;  1VR9 A;  2KN4 A;  2MFQ A;  4NY0 A;  2E3T A;  2L0T A;  1VZ8 A;  2XBB C;  2M56 B;  3JYU A;  2J42 A;  1SJE D;  5FR3 A;  2GOW A;  1EU3 A;  2ZJD A;  4C80 A;  1XKE A;  4HAY B;  1HTO A;  3A9J A;  1C4A A;  1W1D A;  2UZS A;  3Q14 C;  4P16 A;  2LWP A;  1WMH A;  2WXL A;  4AQ7 A;  3N3K B;  2BF8 B;  1T77 A;  1WFY A;  5LG4 B;  1I4Q A;  1XCG A;  1TKG A;  1X1M A;  3U30 A;  2IDY A;  3ODW A;  4DIX A;  1F77 A;  3A1Q B;  2YT2 A;  4WWO A;  2Y5C A;  3APD A;  4A20 A;  1JAL A;  3Q69 A;  1FRD A;  1UEL A;  1MK9 B;  1UGM A;  3PHW B;  3X0W A;  3NHE B;  1UPQ A;  3DXD A;  1VCB A;  3TEY A;  3HSA A;  4JIO U;  1I4X A;  5IP4 D;  4HJG E;  4EJN A;  1TTN A;  4ZHO A;  2JZ3 B;  3GYO A;  1L7Y A;  5BMG A;  2JXX A;  2GCJ A;  2YS3 A;  1XR0 B;  2J0M A;  1NEK B;  2N1W A;  3VUW A;  2QIL A;  2JX5 A;  4FHK A;  4W9C A;  3VXW A;  2HJ8 A;  4DBG A;  2KGX B;  2OQB A;  2LXA A;  4EUT A;  3NS8 A;  5BMI A;  4W9F A;  1XLO A;  4MT5 A;  4B6H A;  4HRS A;  5IAA C;  2FJ9 A;  4YTN B;  3A8P A;  3KQ4 A;  1OGW A;  2KWC A;  2AQ3 B;  4XWW A;  2LJ5 A;  1J7B A;  1FOE A;  5CHV C;  3WAP A;  3DXC A;  4K7W A;  3AED B;  3UIP B;  1TT5 B;  1RRP B;  2ON8 A;  5MPO A;  3OAN A;  2KFK A;  5C6R A;  2JVC A;  4IDI A;  4TMA B;  1X1F A;  2NBV A;  4WJQ A;  1DGJ A;  1NBF C;  1PGA A;  2LKO A;  1Z2M A;  4JQW C;  2KUP A;  4OT1 A;  4K81 A;  2MBE A;  2V3N A;  4PQ0 A;  3AH7 A;  3P2B A;  1SE9 A;  3BII D;  4YT0 B;  3AEF B;  3ZO5 B;  3OG5 A;  1ZPS A;  4B0E A;  1SIJ A;  2FCS A;  1OTR B;  4NQK E;  5D2M B;  1WJM A;  1DOX A;  2XQN M;  5J3Q A;  4HLE A;  5FK9 C;  4E71 A;  1U2B A;  4ANU A;  1I35 A;  4F7H A;  1NTV A;  4FBJ B;  2Y5B B;  1UWM A;  3MC9 A;  3PV1 A;  2V4L A;  2YSZ A;  4H2A A;  1HQR D;  4W9H A;  1JW9 D;  3KWL A;  2DHJ A;  2M17 A;  5E6J A;  2K3U A;  1EF1 A;  1V80 A;  2JU6 X;  2YS1 A;  2KQ4 X;  3HVZ A;  1WXQ A;  3QC8 B;  2Z0P A;  1CQV A;  2NS5 A;  5JHB A;  1RFA A;  5BO4 B;  1WR6 E;  2DX5 A;  1C4P A;  4JPS A;  5LOP B;  2G4D B;  5BMH A;  2IZV B;  2R09 A;  3PZD A;  4GDK A;  3ENB A;  4KHB A;  2GLS A;  1PYW D;  3FAH A;  2DZI A;  3NVY A;  5BYQ A;  2KDB A;  1JRP A;  3RNB C;  2KK8 A;  2EMT A;  2TSS A;  1VBG A;  1XX0 A;  2D9W A;  1QOF A;  2UWQ A;  4M02 A;  5HFY A;  3B0A A;  4MGI E;  2WWZ A;  3NSU A;  2AX5 A;  3N7C A;  1XXG A;  2M0A A;  4CHJ A;  3I57 A;  1IBX B;  3RNE C;  2D3A A;  3NW8 A;  4GB9 A;  3DQV A;  4WQM A;  2QKM A;  3AI5 A;  3KUD B;  1NVL A;  4ILG B;  3MPX A;  1DOI A;  2OOB B;  4JE3 B;  4ARI A;  3HIZ A;  1YNT E;  4TUU A;  4P1B C;  3R3M A;  1WMH B;  3TO1 A;  1J8C A;  1ZDX A;  2HTH A;  5KCV A;  4BKT A;  5CHF A;  2IO1 B;  1B1Z A;  4K17 A;  3JW0 X;  5JVL A;  2IGD A;  4TYZ A;  4HKZ E;  1EWY C;  1ACC A;  4KKJ A;  1QF6 A;  1I7A A;  1SBB B;  2WU2 B;  3IT4 B;  2PZ1 A;  2QMT A;  1MK7 B;  4LJP B;  4XYC A;  1D5Z C;  2WXP A;  1N3H A;  5JZE B;  2O2V A;  3R2T A;  2Z0Q A;  4MDK E;  4KDI C;  2L1C A;  1EWC A;  4WUR A;  2N9L A;  2KTR A;  1WY8 A;  3V3X A;  2BVC A;  2I1J A;  3U12 A;  2KDE B;  3RYT A;  3MHZ A;  2BYF A;  2HJ1 A;  2WLB A;  3IVF A;  3E9S A;  3QWM A;  4IWP A;  1F2R I;  1T0R C;  2BTE A;  2COF A;  3DCX A;  1AYF A;  1WSP A;  2IO2 B;  4MEL A;  3V5W A;  3PO0 A;  2BBC A;  1NYQ A;  2COC A;  2LUM A;  4LJO B;  4BOZ B;  1P7E A;  3BWU D;  4GMV A;  4HB0 B;  1BUI C;  1WWT A;  2RRF A;  4EZL A;  3ENE A;  3U7D A;  2KC2 A;  1KOT A;  3E9P A;  2MJD A;  2GJY A;  2N7E A;  3AE2 B;  4M0W B;  1T6B X;  2NMB A;  3ZLZ A;  3P7Z A;  1I2H A;  2G9H D;  2XEW A;  3JSV A;  3MJW A;  5GOW B;  4M8M A;  4C7Z A;  5G5H A;  1U5F A;  4XWT A;  1YN4 A;  4LNI A;  2WXQ A;  2MCN B;  4TQ0 A;  1RFK A;  4LLG M;  3H6N A;  2MBB B;  1MAI A;  4A3P A;  2D3C A;  3L13 A;  1K52 A;  5D3I B;  2CB8 A;  2VH2 A;  5AUK A;  4K3B A;  2N1V A;  2AYO B;  2JYE A;  4A6Q A;  5EFX A;  3BY4 B;  1LO5 D;  4DXA B;  3P4Q B;  2GI9 A;  3Q8C A;  5JXV A;  4LNO A;  3FC4 A;  4RFB A;  1MKE A;  1T3Q A;  3RN9 C;  2ASQ A;  4DX8 A;  3H7P A;  2GCL A;  3TCA A;  2WYQ A;  4CYE A;  2B3A A;  1C9F A;  1UF0 A;  4OVV A;  1GJZ A;  1UD7 A;  4CHK A;  4HK2 A;  4RGT A;  3J9C A;  3AE9 B;  4MK0 A;  1FXT B;  1GG3 A;  2IFS A;  3AJ4 A;  2LMC A;  2FJL A;  1HEZ E;  3PZ8 A;  5FI0 A;  1WRD B;  2UU7 A;  4JKH A;  1WI0 A;  1YJ1 A;  4XWX A;  1WGQ A;  1P98 A;  2M1M A;  1D3Z A;  4M8N A;  1I4P A;  1TIF A;  1JQ4 A;  2DX5 B;  1K8R B;  2HD5 B;  3NOB A;  1SE2 A;  2D3G A;  4RM8 A;  4MT7 A;  3IXS A;  4GOC A;  5GMV A;  1WI1 A;  1X05 A;  5HE2 A;  2K00 A;  2C7M B;  4KHB B;  2YS5 A;  2Z0E B;  5EE3 A;  4ANV A;  4MY6 A;  2KAN A;  1V5T A;  1W1G A;  2UVM A;  3IG3 A;  2C5L C;  2O6V A;  4OZC A;  1L2N A;  4WAA A;  2K8C A;  2LGS A;  5AZG A;  1CMX B;  2LFI A;  1MI0 A;  3SUZ A;  1ET6 A;  1IGD A;  1T0Q C;  4DHZ B;  5C23 A;  4XX5 A;  3CIK A;  3BK2 A;  1ZW7 A;  2RNR B;  1KBL A;  3AM9 A;  4WAF A;  1PGB A;  1WXM A;  3WAM A;  4KVG B;  3CF6 E;  2M38 A;  4AS1 A;  1SJH D;  3L4P A;  1NTI A;  2X0S A;  4KDL B;  1TZ1 A;  2D3B A;  4HAV B;  3D32 A;  2MSE D;  5FR6 A;  2HTH B;  2VH1 A;  3UQB A;  2IYB A;  1LB1 A;  4DXF A;  3O13 A;  3A58 A;  4IM3 A;  2AL3 A;  3R2I A;  4JK7 A;  2JRH A;  2KUQ A;  4ITK A;  3HVD A;  4QJ5 B;  2NTS A;  4DDG D;  1RWS A;  3H9D A;  1K50 A;  2LGI A;  2O2V B;  1WJN A;  4IFS A;  4US9 A;  2LUL A;  3Q3O C;  2JXT A;  2L7R A;  2KTR B;  3AB5 A;  3EUB 2;  1V61 A;  5HHD G;  2DWQ A;  4H8S A;  5LON B;  2KC1 A;  4HPL B;  4Z2M B;  1UNQ A;  1GNU A;  3SR6 A;  3DWM A;  1SE3 A;  2WXO A;  2DBY A;  2Z59 A;  2RPV A;  3Q8A A;  3HIE A;  1MG4 A;  3PGE A;  2KR0 A;  5C3J B;  1KLG D;  4GU2 A;  3RUL A;  2JP2 A;  1UPR A;  1E7P B;  4ZOH C;  2O6V D;  2CHZ A;  2PMV A;  1QKZ A;  3M95 A;  2G45 B;  3MDB C;  4JX1 C;  2CY4 A;  2LOZ A;  2RDH A;  1N62 A;  4A6K A;  3BVG A;  2OED A;  3U2S C;  4EMO A;  2PVO D;  2K6D B;  1R4M B;  1QZE A;  3HUI A;  3JSV B;  4Y94 A;  3G9W A;  1E8Z A;  2DZJ A;  2FCQ A;  3DVN U;  4HDQ A;  1JML A;  1HXY D;  1WJ4 A;  3VR9 B;  1WXV A;  4OZB A;  2H7E A;  3QA8 A;  4PK1 A;  2K5P A;  5G2N A;  3F5R A;  1QOB A;  1HA5 A;  1NTY A;  1V86 A;  2C60 A;  2ELA A;  4HVB A;  1FNV A;  3PRP B;  1UBQ A;  2V4I B;  2ICI A;  1FHO A;  1WGH A;  1FNW A;  1LGR A;  2LGY A;  4ILJ A;  3C19 A;  2M14 A;  4IM0 A;  2YT0 A;  3W1Y A;  1U27 A;  2LHD A;  2C7N B;  3WYF B;  5DIF B;  2LGD A;  2WXG A;  2KTF A;  2D9X A;  3R7Q A;  2DFK A;  1YIW A;  1WRI A;  2KJH B;  4ANW A;  2FIF A;  5IRS A;  2QCZ A;  1ACA A;  4JGH B;  2NR2 A;  5KHO A;  3X23 A;  4E74 A;  2GBR A;  2LJI A;  1E6E B;  4A8X C;  3DBH I;  2BWF A;  1KM7 A;  1SHC A;  2K2U A;  3SDL C;  1U4A A;  1HTQ A;  3JVZ X;  4C0A A;  4IAP A;  1FEH A;  4JKB A;  2H88 B;  2EC1 A;  3BYT B;  4DBB A;  4YL8 A;  5C79 A;  3RUI B;  3CST A;  2BWE S;  2GRI A;  3Q8E A;  2JZP A;  3GS2 A;  3KRW A;  2O6V B;  3N1Z C;  1H10 A;  2BKF A;  4DWF A;  5LLI A;  3N9Y C;  3V60 A;  3RCZ A;  4YSX B;  3VH4 B;  3ZW3 A;  4NQL B;  1ENF A;  3WAN A;  2EEL A;  3BJI A;  2WXK A;  1BT0 A;  1E5W A;  4QJ4 B;  2KX3 A;  2WX1 A;  2QHO A;  1IBX A;  2UYZ B;  2EKI A;  2I1K A;  2N0Y A;  2QJL A;  4RCO A;  3N1Y C;  2Z14 A;  2MBH A;  4KZC A;  2Z4D A;  3AUL A;  2ZVO A;  4GGQ A;  3AEB B;  4GXB A;  2WHI A;  3FLV A;  3SU8 X;  3NWD A;  5L81 A;  4US8 A;  1HZ5 A;  4B0M A;  2ZCC A;  3K9P B;  1LW3 A;  1ZUD 2;  5IO9 A;  4IOI E;  2CJN A;  2RDB C;  1CZP A;  5L83 A;  5TSS A;  2DZK A;  3H8H A;  2V1Y A;  3MJ5 A;  3P63 A;  2DHI A;  4A6F A;  4ZYS A;  2AQ1 B;  3VTW A;  3DVN V;  1QOA A;  1PFD A;  2BS2 B;  1WJ6 A;  3ML9 A;  3BVM A;  4W9D A;  4NJC A;  4HKQ A;  4KSL C;  1NYR A;  1P9D U;  1TY2 A;  2JRI B;  4C00 A;  1KI1 B;  2KQ7 A;  2BQQ A;  2Z59 B;  1QT9 A;  2WDT B;  1XEE A;  5G55 A;  5T8I A;  4BAX A;  2Z0O A;  3PRM B;  4XC2 A;  1GB4 A;  3IHP C;  3ZDM C;  3VRA B;  2K8E A;  1AAR A;  4HAW B;  1KZG A;  1S1Q B;  1TJE A;  2SEB D;  2ZNV B;  1P5T A;  3EHV A;  4HB2 B;  1NEN B;  5AZF A;  2R0D A;  1SGH A;  2LI5 A;  2LBB A;  1P1A A;  1DIK A;  3DBL I;  4M0W A;  1MVK A;  3V61 A;  5IOI A;  3L10 B;  2MQJ A;  2Y5P A;  2DYN A;  3RMK C;  1KF6 B;  4M00 A;  2K39 A;  4LK0 M;  3DWG C;  4DDI D;  3PVL A;  2MKR A;  2KDF B;  4DHJ B;  1N63 A;  2WXH A;  3F0W A;  2INN E;  1D4B A;  2REX A;  3T3O A;  5D27 A;  1IPG A;  2KYW A;  3PEG A;  1J19 A;  1WH3 A;  3ZNI D;  2NBW B;  2J53 A;  3PLU A;  3NRZ A;  1WGK A;  2IY0 B;  2C9W B;  4CSQ A;  3O96 A;  1E8W A;  3KH0 A;  1V5U A;  3PP2 A;  2BB6 A;  3PSC A;  3IBE A;  2K8B A;  5EE1 A;  1LM8 B;  3MTN B;  4K1R B;  1ZP0 B;  4G3X B;  4K3C A;  1V89 A;  4W9E A;  2IO0 B;  1JWA D;  3NJT A;  1V1P A;  2DYO A;  1QOG A;  2XK5 A;  1X11 A;  1SXT A;  1Y19 B;  2DEN B;  1XCT L;  2H89 B;  4K2P A;  2JWZ A;  3AE5 B;  4YXD B;  2ROV A;  1WE7 A;  4DQO C;  5EE9 A;  4GNK B;  4IC7 B;  3DHI C;  5J18 A;  4L6E A;  1BTN A;  3NZS A;  4LNF A;  4JWS C;  3ULC A;  2HE7 A;  2WXM A;  3DHH C;  2L83 A;  1YX6 B;  1PLS A;  2D9Y A;  3DCG A;  3NS1 A;  2UZR A;  3DOW A;  3AEG B;  3FSS A;  2D10 A;  3LDZ E;  4I6P A;  4OHJ A;  4D6W A;  2DYQ A;  3RNG C;  1YN5 A;  1X86 A;  1VD2 A;  3B2F A;  2JYT A;  1FO4 A;  3NVZ A;  3KY9 A;  4GPT B;  2KFJ A;  2WXR A;  2X18 A;  2YVC A;  3TW1 A;  2QEJ C;  2A4Z A;  1E9M A;  3ZKJ C;  2ZZP B;  5DHA B;  3E66 A;  1TGZ B;  3L0W B;  2KLG A;  1F2R C;  3GZN I;  4RGN A;  2FUH B;  1TY0 A;  2DYM A;  2I5C A;  1N60 A;  3A8Q A;  1WZ0 A;  2QSD A;  3P42 A;  4KIK A;  2PW9 A;  3P4R B;  3U52 E;  4B95 A;  3A98 B;  4F7G A;  2NBU A;  2BS3 B;  2L05 A;  2PIA A;  4AUQ C;  1EGX A;  5HE3 A;  3V6C B;  3EC8 A;  4MSQ B;  1HBK A;  2FAZ A;  3PRE A;  4WJO A;  3PVU A;  1I7H A;  5I2M A;  3NWF A;  2PEA A;  1MPE A;  3CWI A;  4D0N B;  5FKA C;  3ML8 A;  5JP4 A;  1E90 A;  2NZ8 B;  2GBM A;  1V9J A;  2R2Q A;  2N9P C;  2LOX A;  1B9R A;  3FVC A;  3D8E A;  2C7H A;  3WA0 A;  2W3R A;  1WX8 A;  1QC6 A;  5IA7 A;  4WWM A;  1BTK A;  1FGY A;  1Q5W B;  4WH4 A;  3RNF C;  4A6F B;  2LXC A;  3EGR A;  2RLO A;  2YEP B;  3OAW A;  1N5W A;  1XF5 L;  5CLL B;  1FM0 D;  1SEB D;  1V8C A;  2GBK A;  4YTM B;  2KN5 A;  2LYD A;  4IKG A;  3P4P B;  3IAS 1;  5D3X A;  1GAQ B;  2QKL A;  3D8D A;  3L08 A;  2JF5 A;  3RNC C;  2VRW B;  4FUL A;  2IGG A;  2LGX A;  3ZXV A;  3ECI A;  4I6N B;  4ZRJ A;  5I4D A;  5IKC M;  1WR1 A;  2WP9 B;  2MJE A;  2XNA C;  4OSN A;  2MRP A;  1WIA A;  2RGN B;  3UIN B;  1LQB A;  1YN3 A;  4JKE A;  2MX2 A;  4FA6 A;  2N0S B;  5TR5 A;  1GC7 A;  2P8V A;  2J0K A;  1WE6 A;  5HI1 A;  3DBS A;  3ZVV A;  2ZVN A;  3N30 A;  1EM7 A;  4AJW A;  4EZJ A;  4HHV A;  2Z0D B;  3NVW A;  4QJ3 B;  4N58 A;  2DN6 A;  4HWI B;  2ZW1 A;  3W9C B;  3Q3J A;  4HPM B;  1ESF A;  4RMA A;  1PUT A;  3L16 A;  3ZDT A;  2R2O A;  1L0V B;  5DHF B;  1D5M C;  3T9L A;  2AEH A;  4NZL B;  4G50 A;  1WF9 A;  3TL5 A;  3OLM D;  2FCN A;  1P6S A;  3QCA A;  2QIE B;  1FNU A;  3B77 A;  1U5E A;  1AQC A;  4FN2 A;  3I63 C;  2DIK A;  2JUO A;  4XDD A;  3T06 A;  4YSY B;  4Z2N A;  4BBN C;  2DZM A;  5C5B B;  1TS2 A;  1F1H A;  3CSF A;  5EDS A;  1WX7 A;  3Q3M C;  1V1P B;  2XK5 B;  1JDE A;  1TJ6 A;  4IM2 A;  2N23 A;  2CRF A;  4W9K A;  1UNR A;  1GB1 A;  1YMH E;  4YWG G;  1C77 A;  2G1E A;  1R4N I;  2IBI B;  1QIL A;  1UH6 A;  4J6I A;  3VDZ A;  3VR8 B;  3P6A A;  3ZNZ B;  2BYT A;  2L3Z A;  5JLJ B;  2VZK D;  1K53 A;  4C56 C;  2B76 B;  2RMM A;  2W82 A;  5IN7 A;  5LXH A;  3KZ1 A;  1DYQ A;  2KMM A;  5DPW A;  1DBH A;  2CKH B;  2J7Q B;  4OW0 A;  2KWD A;  2WXF A;  2K49 A;  5J2R A;  2EMS A;  2IO3 B;  3ZTC A;  2D4Q A;  2IND C;  1XD3 B;  4CHM A;  4F1S A;  1F9J A;  1VZ6 A;  4HAU B;  3ZJT A;  1DDM A;  2N9K A;  2SAK A;  2ONQ A;  2KOX A;  1RRB A;  2ZNV C;  1WX9 A;  2YEP F;  4JK9 A;  2CAY A;  4HB4 B;  3R66 C;  3PPA A;  3DBR I;  1FFV A;  3FM8 C;  4MGK E;  4PYZ A;  4WWP A;  4QAY A;  4KIK B;  2LAS A;  3LB8 C;  1IGC A;  2D2Q A;  2RSG A;  3LYY A;  4ZRK A;  1XT9 B;  4X57 B;  3UIO B;  5IJM A;  3GZN B;  1GPX A;  2COP A;  4ARC A;  1BXT A;  4LDT D;  1FAO A;  1HZ6 A;  1OQQ A;  4HAX B;  1ZKH A;  1ZC3 B;  5H8Y E;  1K51 A;  4ZRP A;  2MWS B;  4ACF A;  1EO6 A;  3GE8 C;  1DOY A;  3P1M A;  2DTC A;  2KO3 A;  1FXA A;  3HM3 A;  2Z13 A;  1V49 A;  2WDV B;  3VQI A;  2LVQ A;  2VKI A;  1FRR A;  3VTV A;  1PFJ A;  3AE6 B;  1YX5 B;  1BWN A;  1P3R A;  3VUY A;  3AN1 A;  1M4V A;  1TZO A;  1E7U A;  4GZU A;  2JWU A;  2E6X A;  4KZ0 A;  3N1X C;  1ZXI A;  4DX9 0;  3EFC A;  4RF0 A;  3TMP B;  1FIQ A;  1RM6 C;  1P0R A;  4F8C B;  1IUE A;  4GDL A;  3AV8 A;  3Q6B A;  1QQG A;  1FFU A;  1UBI A;  3WIM A;  2VZK B;  3N32 A;  2L1A A;  4WWN A;  4NNJ B;  1JWB D;  2W2X D;  1QQR A;  1UWX A;  4REZ A;  1NU2 A;  1NVI D;  2VRR B;  1NDD A;  1C78 A;  3PT2 B;  3HK0 A;  3OJ3 A;  2FID A;  1AWE A;  1WXS A;  2N4F A;  3NWA A;  2IPK D;  2JY6 A;  3FKY A;  2XN9 C;  3RI7 C;  2EJ8 A;  4JKA A;  2KJ6 A;  4HAT B;  3SBT A;  2OJW A;  3TJP A;  4L1B A;  2RD0 A;  1VLB A;  2M8S A;  4A9A A;  2KHW B;  4GN1 A;  3IFW B;  4GSW A;  4LTU A;  4DXG A;  4FJZ A;  2PKO A;  2KX0 A;  1AW7 A;  3PTF C;  5CTR C;  2DHZ A;  1WJU A;  1XOD A;  1VZ7 A;  4PYU A;  3C8Y A;  2N7J A;  3NZ3 A;  4KKI A;  2WDR B;  1V81 A;  5H92 C;  4L23 A;  3V05 A;  4KGS A;  2V0G A;  1J0G A;  2L52 A;  3A9K B;  4WSF A;  4E3C A;  3B1L X;  3BYY B;  4PNK A;  4WIP A;  4GOU A;  4BKS D;  3QAR A;  4LDT B;  4AJY B;  2L76 A;  1WYG A;  2ABD A;  2MDX A;  2A5U A;  1H8C A;  4RF1 A;  3AU5 A;  2CHX A;  1EU4 A;  1OEY J;  3HW2 B;  2IY1 B;  2VSZ A;  2L8J A;  3KUZ A;  4PS7 A;  1TS3 A;  4IW0 A;  4RNA A;  2KAJ A;  1GGO A;  4EZK A;  5KQ1 A;  2KQS A;  5D94 A;  3ZUN A;  1FCC C;  3KW5 B;  1R4N B;  3QAQ A;  2RUK B;  4D2K A;  1TXD A;  4EE2 A;  3AE4 B;  1Q0W B;  1F0Z A;  2BW2 A;  2KAC A;  3W5V B;  1MPH A;  3QX1 A;  1DYN A;  4W9G A;  3VUX A;  1I4H A;  2BCJ A;  5J17 A;  1XO3 A;  1XCQ L;  4KX6 B;  1FB8 A;  2BB5 A;  2CR5 A;  1V1O A;  2WS3 B;  2AQ2 B;  3DDC B;  1XD4 A;  1Y5O A;  3OJ4 B;  1C3T A;  1UEF A;  3ALB A;  3EFU A;  2N9X A;  1TQZ A;  4MAC A;  3MC8 A;  4MH8 A;  4MJS A;  2K1F A;  2JQR B;  4MEM A;  2WNM A;  4YTP B;  3TUO A;  4NJ7 A;  2BT6 A;  3MFG A;  1RJ2 A;  2ZKM X;  2IGH A;  1LFD A;  5D7G A;  3DBR B;  3GE3 C;  1KLU D;  4BFR A;  3VHT C;  5HKH A;  5JHA A;  2Y8G A;  5J3T A;  4NAM A;  4ICU A;  2ROZ B;  4S17 A;  2P0H A;  1C79 A;  3TFM A;  1Y8R C;  1MJD A;  3UGB B;  3GYP A;  3TEW A;  4NJ6 A;  3ZQ4 A;  3ZRC A;  3BIN A;  4FAD A;  1XLP A;  2MP2 A;  2MBQ A;  3ABV B;  3DVG X;  1ROE A;  5D3D A;  2NTT A;  3NG0 A;  4A6H A;  2ZPY A;  3SO6 A;  3EEC A;  4HXD A;  1E10 A;  3B08 A;  2PLP A;  3N20 C;  3ETR A;  3PZ7 A;  4G11 A;  4IG7 B;  2FE8 A;  5CHW A;  4GDL B;  2D07 B;  3AE7 B;  1V97 A;  2Q5W D;  2CU1 A;  1E8Y A;  3E56 A;  2KIG A;  2BYE A;  2IJ0 A;  2KDM A;  4WJP A;  2PTL A;  3KSY A;  3ZXR A;  1ZVR A;  3K9O B;  1EAZ A;  1HE8 A;  3AEE B;  2G4S A;  2NPT A;  2ZW0 A;  2KMA A;  4EOY A;  2BGF A;  1VRA B;  3VOQ A;  4J3O D;  2FUG 1;  3I5J C;  4K7U A;  1FHW A;  4HJK A;  2V76 A;  3QBV B;  2KNB A;  2QC8 A;  1MHX A;  3VH3 B;  3APF A;  4GMX B;  4AOF A;  3B9J A;  1DRO A;  4PT5 A;  3CMM B;  5J3Y A;  4RGM A;  2ZPN A;  2RR9 A;  3ZYY X;  2M0X A;  3BK1 A;  2LEK A;  2CS4 A;  5DPS A;  2G3Q B;  1XLQ A;  1OMW A;  2X38 A;  5C2T B;  3Q8B A;  1M7R A;  4W9J A;  3ZTD A;  1Z5S B;  3WCQ A;  2DAJ A;  1FHX A;  3IAM 1;  3LJU X;  1SIF A;  5E6O A;  1QLB B;  3URY A;  2LVO A;  2M4N A;  4G0N B;  4K2O A;  2K9X A;  1TKE A;  2GS0 A;  3AE1 B;  3UQA A;  5C5B A;  3FEH A;  2QDF A;  1JWM D;  5E6N A;  4B9K A;  3PHX B;  2MBO A;  1T0Y A;  2Y7B A;  4URK A;  3OWE B;  4MGZ E;  4Q2J A;  5AZH A;  1RAX A;  3M63 B;  4FJY A;  4HB3 B;  1C4C A;  4MSM B;  1STE A;  4P6V F;  1J0W A;  2DYB A;  1L4D B;  2PPH A;  2ZCB A;  3CXB B;  5D6J B;  4OVU A;  4FXC A;  1I4R A;  3E9L A;  1TKY A;  2V3P A;  3FIL A;  1ZE3 D;  3SEB A;  2Z8L A;  4BBN F;  2YRY A;  3SFE B;  4XGA B;  5FI1 A;  4F7U P;  4KGR A;  2WX0 A;  3KYD D;  1Z87 A;  4UDU C;  3S2A A;  1L6V A;  3ZVR A;  1C76 A;  1MG8 A;  2KDI A;  3ODO A;  1PGX A;  4CQN A;  2FDQ A;  2WU5 B;  4S0R A;  4HEA 1;  2KVR A;  3Q2A C;  2RVB B;  1UUP A;  3UF8 A;  3MHS D;  4EFO A;  3FP5 A;  2R2Y A;  2WQY B;  1D6E C;  2BPS A;  3RT3 B;  2PE9 A;  2LHE A;  3B2G A;  2DA0 A;  2JSV X;  2V9H A;  2CY5 A;  2RQ1 A;  1LXD A;  3AE8 B;  2E2X A;  3DBH B;  2ACZ B;  2D9Z A;  2L32 A;  1GUA B;  2R61 A;  1F52 A;  1TBE A;  5KQ4 A;  3SHQ A;  3DXE A;  3AU4 A;  1SF0 A;  4HCN B;  1P3Q U;  4EEW A;  4MJS B;  3DHG C;  3DVG Y;  1L0X B;  3OHM B;  3R7R A;  4BKG A;  1BAK A;  2INC C;  4YON A;  2MW5 A;  1NI2 A;  1MFW A;  4EKU A;  1KRH A;  2KKC A;  4WJ7 A;  4IWQ A;  1MI1 A;  4P1C C;  2I2Y A;  1ZXH A;  4ICV A;  3AXC A;  3RPF C;  4MM3 B;  4XE0 A;  2W9N A;  3SYX A;  1A5R A;  2AWT A;  2KD0 A;  2M19 A;  3TEX A;  2K0P A;  1R7S A;  2N7D A;  4JKG A;  3RZW C;  2MP2 B;  4MH0 E;  1N5X A;  4C4V A;  4B6W A;  2FNJ B;  3A9J B;  5AEK B;  3Q3F A;  2WXJ A;  2GBJ A;  2DLB A;  4ZRQ A;  5KHQ A;  2J0J A;  3GOE A;  3C0R B;  1N61 A;  2K6Q A;  4OVZ A;  1OY2 A;  2KZR A;  2K22 A;  3U8Z A;  3PRZ A;  2K25 A;  1WG7 A;  1WVH A;  4XZ4 A;  3W1S C;  3Q8F A;  2KXJ A;  2WDQ B;  3HQC A;  2RSU A;  1UZX B;  3A4S C;  2KVZ A;  1OEY A;  1CJE A;  2WH5 A;  1OFF A;  3BZD B;  3DPD A;  2NPT B;  2ELB A;  2W2W A;  5JHH A;  4NAW A;  3ZNG C;  3O65 B;  4N59 A;  1U29 A;  3I9V 1;  3Q3N C;  3I3T B;  4HSI A;  2CJO A;  2MLB A;  5JHG A;  2HRJ A;  2LD9 A;  5DH9 B;  2W2X C;  4W9L A;  1AWD A;  5D3V A;  5C1Z A;  2WGS A;  1ISN A;  1M7E A;  2DLW A;  4HAZ B;  3ONS A;  3MP9 A;  3NY5 A;  1R4M I;  4QXA B;  1I42 A;  1PDX A;  2L0F A;  2R82 A;  2N9E B;  5C16 A;  3R8B A;  2L00 B;  4BOS C;  3ZGZ A;  1U5D A;  5L95 C;  3M1I B;  4M01 A;  4L1R A;  3DBL B;  3EA6 A;  1I4G A;  1L4Z B;  2DNF A;  1YJI A;  5DCN A;  3ZNH B;  1RLF A;  3T8M A;  1K5G B;  2YT1 A;  4P7I A;  3A9K A;  3APC A;  4WJN A;  2KFK B;  4RGO S;  3QK0 A;  3VTU A;  3SBG A;  2NBV B;  4TQ1 A;  1XQQ A;  2IYD B;  1GOZ A;  2LUE A;  1OQN A;  3KYC D;  2MHJ A;  2KMC A;  2KT7 A;  3ZIM A;  2J52 A;  4O1N A;  3KUC B;  4AWJ A;  1TS4 A;  5HG2 A;  2COD A;  2I38 A;  2DKP A;  2ADZ A;  3QJZ A;  2DX1 A;  3T3N A;  4OZA A;  3VRB B;  3TBL D;  2BYV E;  1ZDV A;  3W1S A;  3FIL B;  4L2Y A;  2BS4 B;  4N6E B;  4CO7 A;  1DDW A;  2KCJ A;  2YLM A;  3ULB A;  2V3S A;  3ML4 A;  1WGU A;  2GUM A;  2J59 M;  1VJK A;  3QQ8 B;  1SSN A;  4KHA A;  3PVW A;  4DK5 A;  4FJV B;  1YJJ A;  1FPY A;  1MIX A;  3EPY A;  5DPR A;  4IUM B;  3WAL A;  1EF5 A;  4HCP B;  2CU3 A;  2DKQ A;  1SB3 C;  5AUI A;  1WGY A;  2LZ6 A;  3KLS X;  4KGT A;  1EVH A;  1WGR A;  1VDV A;  1HB8 A;  1V6E A;  1FCL A;  1V5M A;  4GLS C;  1RYJ A;  1KZ7 A;  1Q1O A;  1K5D B;  3ZJV A;  2I5F A;  4AP4 C;  1KH0 A;  1WM3 A;  2LRU A;  3V62 A;  3SD5 A;  1E0Z A;  2RGF A;  3HHM A;  1J7A A;  1UNS A;  3H1U A;  1P7F A;  4K7S A;  3KWV A;  3TVV A;  4BZA A;  1C1Y B;  3SV1 A;  4GDK B;  1IP9 A;  2JPH A;  2X8X X;  1UGJ A;  3UZT A;  1D5X C;  1YQ3 B;  2L2I A;  4TSS A;  3L17 A;  4ASW C;  3RZF A;  2OTX A;  2GBN A;  3TSS A;  4ZRI A;  5DPT A; 
#chains in the Genus database with same CATH homology
 2FCM A;  2K8H A;  3VFK A;  4F7Z A;  2JZZ A;  3RD2 A;  3SNH A;  4WQO B;  3ZRF A;  2GMI C;  3QHT A;  2BKR B;  1VBH A;  4JKG B;  3M3J A;  5CLQ B;  1KC7 A;  1KLV A;  1IRS A;  4ANX A;  4KHO A;  1UNP A;  3WAO A;  4WVF B;  2ZEQ A;  5HE0 A;  4BKS A;  2LVP A;  2K2J A;  3HM6 X;  3NZU A;  1W1H A;  4KSK C;  1ZC4 B;  4JK8 A;  1YD8 U;  2PJH A;  3PLV A;  3KRX A;  4HDO A;  4KV2 A;  1KJT A;  4BVU C;  3TIX A;  4BBK A;  1M94 A;  3A1Q A;  2G35 A;  2KJR A;  4IOY X;  1X1G A;  2COA A;  2JT4 B;  1OQY A;  4NAW B;  3A33 B;  2OJR A;  3VAW A;  4KAX B;  1WZ3 A;  1WM2 A;  3RCP A;  3QWZ B;  1WGD A;  4JKC A;  1E7V A;  4RM9 A;  1WXA A;  3KVF B;  4FLH A;  1E8X A;  3PS6 A;  1PMS A;  4II2 B;  4JKD A;  1Q67 A;  1FGZ A;  5DI9 B;  2EKE C;  3V6E B;  2KLC A;  4A3O A;  2PE6 B;  2DHK A;  3ODX A;  1V5O A;  1ZM0 A;  3A4R A;  2MA9 B;  4IWO A;  2Q13 A;  2YF0 A;  1IYF A;  2LRW A;  4II3 B;  5LXI B;  2D11 A;  4NPN A;  4ZYN A;  4PS3 A;  4GIV A;  3PSE B;  4JL9 A;  2H7D A;  4I6L B;  4ZDV A;  1ZSQ A;  2P0D A;  2DAF A;  3D8F A;  1U5G A;  1ZGU B;  3LJ3 A;  3H7S A;  1JRU A;  2NVU I;  3H7P B;  5CX3 A;  2Y8F A;  1ST7 A;  4TKN A;  1DDV A;  2CQU A;  4W9I A;  2NCN A;  5HE1 A;  4MGY E;  1YQB A;  4DHZ E;  5D3W A;  4LCD E;  2AL6 A;  4A5K A;  5D3Y A;  4NSW A;  3L54 A;  1WYW B;  5E6P A;  4N9F 4;  1S3S G;  3VVW B;  1EUV B;  4JLC A;  1WJ1 A;  2KWV B;  1B55 A;  1PQS A;  1MIZ B;  2MWN B;  3VIA A;  1V2Y A;  2P0F A;  3QIJ A;  1V5P A;  3PG7 A;  3M62 B;  2CHW A;  1HB6 A;  4DHJ D;  1WGG A;  4ILH A;  5JH5 C;  1GC6 A;  4FHJ A;  1G6J A;  4MM3 A;  2KWU B;  2RPQ A;  1V88 A;  2D9V A;  1H4R A;  3E9O A;  4TV3 A;  2LG1 A;  4PS8 A;  4JKF A;  2MFQ A;  4NY0 A;  2L0T A;  2XBB C;  3JYU A;  2GOW A;  2ZJD A;  1XKE A;  4HAY B;  3A9J A;  1W1D A;  2UZS A;  2LWP A;  1WMH A;  3N3K B;  2BF8 B;  1WFY A;  1XCG A;  1X1M A;  3U30 A;  3ODW A;  3A1Q B;  4WWO A;  3APD A;  4A20 A;  1UEL A;  1UGM A;  1MK9 B;  3PHW B;  3X0W A;  3NHE B;  1UPQ A;  3DXD A;  1VCB A;  4JIO U;  4EJN A;  1TTN A;  2JZ3 B;  3GYO A;  1L7Y A;  2JXX A;  2GCJ A;  2YS3 A;  1XR0 B;  2J0M A;  2N1W A;  3VUW A;  4FHK A;  4W9C A;  3VXW A;  2HJ8 A;  4DBG A;  2KGX B;  2OQB A;  2LXA A;  4EUT A;  3NS8 A;  4W9F A;  4B6H A;  5IAA C;  2FJ9 A;  3A8P A;  1OGW A;  2KWC A;  2LJ5 A;  1FOE A;  5CHV C;  3WAP A;  3DXC A;  4K7W A;  3UIP B;  1RRP B;  3OAN A;  2KFK A;  5C6R A;  2JVC A;  1X1F A;  4WJQ A;  1NBF C;  1Z2M A;  2LKO A;  4JQW C;  2KUP A;  4K81 A;  2MBE A;  4PQ0 A;  3P2B A;  1SE9 A;  3ZO5 B;  2FCS A;  1OTR B;  4NQK E;  5D2M B;  1WJM A;  2XQN M;  5J3Q A;  4HLE A;  4E71 A;  1U2B A;  4ANU A;  1I35 A;  4F7H A;  1NTV A;  4FBJ B;  2Y5B B;  3PV1 A;  2V4L A;  2YSZ A;  4W9H A;  2DHJ A;  2M17 A;  1EF1 A;  1V80 A;  2YS1 A;  3QC8 B;  2Z0P A;  2NS5 A;  5JHB A;  1RFA A;  5BO4 B;  1WR6 E;  2DX5 A;  5LOP B;  2G4D B;  2IZV B;  2R09 A;  3PZD A;  4GDK A;  3ENB A;  2DZI A;  2KDB A;  2EMT A;  2KK8 A;  1VBG A;  1XX0 A;  2D9W A;  2UWQ A;  3B0A A;  4MGI E;  2WWZ A;  3NSU A;  3N7C A;  4CHJ A;  4GB9 A;  3DQV A;  2QKM A;  3AI5 A;  3KUD B;  1NVL A;  4ILG B;  3MPX A;  2OOB B;  3HIZ A;  4TUU A;  3R3M A;  1WMH B;  3TO1 A;  1J8C A;  2HTH A;  5KCV A;  4BKT A;  5CHF A;  2IO1 B;  4K17 A;  3JW0 X;  5JVL A;  4TYZ A;  1I7A A;  2PZ1 A;  1MK7 B;  4LJP B;  1N3H A;  5JZE B;  2O2V A;  4MDK E;  2Z0Q A;  4KDI C;  2L1C A;  2KTR A;  1WY8 A;  2I1J A;  2KDE B;  3RYT A;  2BYF A;  3IVF A;  3QWM A;  4IWP A;  2COF A;  2IO2 B;  4MEL A;  3V5W A;  2COC A;  4LJO B;  4BOZ B;  4GMV A;  4HB0 B;  4EZL A;  3ENE A;  3U7D A;  2KC2 A;  1KOT A;  3E9P A;  2GJY A;  2N7E A;  4M0W B;  2NMB A;  3ZLZ A;  3P7Z A;  1I2H A;  2XEW A;  3JSV A;  3MJW A;  5GOW B;  4M8M A;  1U5F A;  2MCN B;  4TQ0 A;  3H6N A;  2MBB B;  1MAI A;  4A3P A;  3L13 A;  2CB8 A;  2N1V A;  2AYO B;  5EFX A;  3BY4 B;  4DXA B;  1MKE A;  2ASQ A;  4DX8 A;  3H7P A;  2GCL A;  3TCA A;  2WYQ A;  4CYE A;  2B3A A;  4OVV A;  1GJZ A;  1UD7 A;  4CHK A;  4HK2 A;  4MK0 A;  1FXT B;  1GG3 A;  2IFS A;  3AJ4 A;  2FJL A;  5FI0 A;  1WRD B;  4JKH A;  1WI0 A;  1YJ1 A;  4XWX A;  1WGQ A;  1P98 A;  2M1M A;  1D3Z A;  4M8N A;  2DX5 B;  1K8R B;  2HD5 B;  3NOB A;  2D3G A;  4RM8 A;  4MT7 A;  4GOC A;  5GMV A;  1WI1 A;  1X05 A;  5HE2 A;  2K00 A;  2C7M B;  4KHB B;  2YS5 A;  2Z0E B;  4ANV A;  4MY6 A;  2KAN A;  1V5T A;  1W1G A;  2UVM A;  3IG3 A;  2C5L C;  2O6V A;  1L2N A;  4WAA A;  2K8C A;  5AZG A;  1CMX B;  3SUZ A;  4DHZ B;  5C23 A;  4XX5 A;  3CIK A;  1ZW7 A;  2RNR B;  1KBL A;  1WXM A;  3WAM A;  4KVG B;  3CF6 E;  2M38 A;  1NTI A;  2X0S A;  4KDL B;  1TZ1 A;  4HAV B;  3D32 A;  2MSE D;  5FR6 A;  2HTH B;  3UQB A;  2IYB A;  1LB1 A;  4IM3 A;  2AL3 A;  4JK7 A;  2JRH A;  4DDG D;  3H9D A;  2O2V B;  1WJN A;  4IFS A;  2LUL A;  2L7R A;  2KTR B;  1V61 A;  4H8S A;  5LON B;  2KC1 A;  4HPL B;  4Z2M B;  1UNQ A;  1GNU A;  3PGE A;  4GU2 A;  3RUL A;  2JP2 A;  1UPR A;  2O6V D;  2CHZ A;  3M95 A;  2G45 B;  3MDB C;  2CY4 A;  2LOZ A;  4A6K A;  4EMO A;  2K6D B;  1QZE A;  3JSV B;  4Y94 A;  3G9W A;  1E8Z A;  2DZJ A;  2FCQ A;  3DVN U;  4HDQ A;  1WJ4 A;  1WXV A;  2H7E A;  3QA8 A;  5G2N A;  3F5R A;  1NTY A;  1V86 A;  2C60 A;  2ELA A;  4HVB A;  3PRP B;  1UBQ A;  1FHO A;  1WGH A;  2LGY A;  4ILJ A;  2M14 A;  4IM0 A;  2YT0 A;  3W1Y A;  1U27 A;  2C7N B;  3WYF B;  5DIF B;  2LGD A;  2KTF A;  2D9X A;  3R7Q A;  2DFK A;  1YIW A;  2KJH B;  4ANW A;  2FIF A;  1ACA A;  4JGH B;  2NR2 A;  5KHO A;  3X23 A;  4E74 A;  2GBR A;  3DBH I;  2BWF A;  1KM7 A;  1SHC A;  2K2U A;  3SDL C;  1U4A A;  3JVZ X;  4C0A A;  4IAP A;  4JKB A;  2EC1 A;  4DBB A;  4YL8 A;  5C79 A;  3RUI B;  3CST A;  2BWE S;  3KRW A;  2O6V B;  1H10 A;  2BKF A;  4DWF A;  5LLI A;  3V60 A;  3RCZ A;  3VH4 B;  3ZW3 A;  4NQL B;  3WAN A;  3BJI A;  1BT0 A;  1E5W A;  2KX3 A;  2WX1 A;  2QHO A;  2UYZ B;  2I1K A;  2N0Y A;  2MBH A;  4KZC A;  3AUL A;  2ZVO A;  4GGQ A;  4GXB A;  3FLV A;  3SU8 X;  5L81 A;  2ZCC A;  3K9P B;  1LW3 A;  5L83 A;  2DZK A;  2V1Y A;  2DHI A;  4A6F A;  3VTW A;  3DVN V;  1WJ6 A;  3ML9 A;  4W9D A;  4KSL C;  1P9D U;  2JRI B;  1KI1 B;  2KQ7 A;  2Z59 B;  2WDT B;  5G55 A;  2Z0O A;  3PRM B;  4XC2 A;  3IHP C;  3ZDM C;  1AAR A;  4HAW B;  1KZG A;  1S1Q B;  2ZNV B;  1P5T A;  3EHV A;  4HB2 B;  5AZF A;  2R0D A;  1SGH A;  2LI5 A;  2LBB A;  1P1A A;  1DIK A;  3DBL I;  3V61 A;  3L10 B;  2MQJ A;  2DYN A;  2K39 A;  4DDI D;  3PVL A;  2MKR A;  2KDF B;  4DHJ B;  3F0W A;  2REX A;  5D27 A;  1IPG A;  3PEG A;  1J19 A;  1WH3 A;  3ZNI D;  2NBW B;  3PLU A;  2IY0 B;  2C9W B;  3O96 A;  1E8W A;  3KH0 A;  1V5U A;  3PP2 A;  3PSC A;  3IBE A;  2K8B A;  1LM8 B;  3MTN B;  4K1R B;  4G3X B;  1V89 A;  4W9E A;  2IO0 B;  2DYO A;  2XK5 A;  1X11 A;  1Y19 B;  2DEN B;  4K2P A;  2JWZ A;  2ROV A;  1WE7 A;  4IC7 B;  5J18 A;  4L6E A;  1BTN A;  3NZS A;  3ULC A;  2HE7 A;  1YX6 B;  1PLS A;  2D9Y A;  3DCG A;  2UZR A;  3DOW A;  3FSS A;  2D10 A;  3LDZ E;  4I6P A;  2DYQ A;  1X86 A;  1VD2 A;  3KY9 A;  4GPT B;  2KFJ A;  2X18 A;  2YVC A;  3TW1 A;  2A4Z A;  3ZKJ C;  2ZZP B;  5DHA B;  3E66 A;  1TGZ B;  3L0W B;  2KLG A;  3GZN I;  2FUH B;  2DYM A;  2I5C A;  3A8Q A;  1WZ0 A;  4KIK A;  4B95 A;  3A98 B;  4F7G A;  2NBU A;  2L05 A;  4AUQ C;  1EGX A;  5HE3 A;  3V6C B;  3EC8 A;  4MSQ B;  1HBK A;  2FAZ A;  3PRE A;  4WJO A;  3PVU A;  2PEA A;  4D0N B;  3ML8 A;  5JP4 A;  1E90 A;  2NZ8 B;  2GBM A;  1V9J A;  2R2Q A;  2N9P C;  2LOX A;  3D8E A;  2C7H A;  3WA0 A;  1WX8 A;  1QC6 A;  5IA7 A;  1BTK A;  1FGY A;  1Q5W B;  4A6F B;  2LXC A;  2RLO A;  3OAW A;  5CLL B;  2GBK A;  2KN5 A;  2LYD A;  5D3X A;  2QKL A;  3D8D A;  3L08 A;  2JF5 A;  2VRW B;  4FUL A;  2LGX A;  3ECI A;  4I6N B;  4ZRJ A;  1WR1 A;  2MRP A;  1WIA A;  2RGN B;  3UIN B;  1LQB A;  4JKE A;  2MX2 A;  4FA6 A;  5TR5 A;  1GC7 A;  2P8V A;  2J0K A;  1WE6 A;  3DBS A;  3ZVV A;  2ZVN A;  3N30 A;  4AJW A;  4EZJ A;  4HHV A;  2Z0D B;  2DN6 A;  4HWI B;  3Q3J A;  4HPM B;  4RMA A;  3L16 A;  3ZDT A;  2R2O A;  5DHF B;  3T9L A;  2AEH A;  4G50 A;  1WF9 A;  3TL5 A;  3OLM D;  2FCN A;  1P6S A;  3QCA A;  1U5E A;  1AQC A;  4FN2 A;  2DIK A;  2JUO A;  3T06 A;  4Z2N A;  4BBN C;  2DZM A;  5C5B B;  3CSF A;  5EDS A;  1WX7 A;  2XK5 B;  1JDE A;  1TJ6 A;  4IM2 A;  2N23 A;  2CRF A;  4W9K A;  1UNR A;  1R4N I;  2IBI B;  1UH6 A;  4J6I A;  3VDZ A;  3P6A A;  3ZNZ B;  2L3Z A;  5JLJ B;  5LXH A;  3KZ1 A;  5DPW A;  1DBH A;  2CKH B;  2J7Q B;  5J2R A;  2EMS A;  2IO3 B;  3ZTC A;  2D4Q A;  1XD3 B;  4CHM A;  4F1S A;  1F9J A;  4HAU B;  1DDM A;  2KOX A;  1RRB A;  2ZNV C;  1WX9 A;  4JK9 A;  2CAY A;  4HB4 B;  3R66 C;  3PPA A;  3DBR I;  3FM8 C;  4MGK E;  4PYZ A;  4WWP A;  4KIK B;  2LAS A;  2D2Q A;  2RSG A;  4ZRK A;  1XT9 B;  4X57 B;  3UIO B;  5IJM A;  2COP A;  4LDT D;  1FAO A;  4HAX B;  1ZKH A;  1ZC3 B;  2MWS B;  1EO6 A;  2DTC A;  2KO3 A;  3HM3 A;  1V49 A;  3VQI A;  2LVQ A;  2VKI A;  3VTV A;  1PFJ A;  1YX5 B;  1BWN A;  1P3R A;  3VUY A;  1E7U A;  4GZU A;  4KZ0 A;  4DX9 0;  3TMP B;  4F8C B;  1P0R A;  4GDL A;  1QQG A;  1UBI A;  3WIM A;  3N32 A;  4WWN A;  4NNJ B;  2W2X D;  1NU2 A;  2VRR B;  1NDD A;  3PT2 B;  3HK0 A;  3OJ3 A;  2FID A;  1AWE A;  1WXS A;  2N4F A;  2JY6 A;  2EJ8 A;  4JKA A;  2KJ6 A;  4HAT B;  3SBT A;  3TJP A;  2RD0 A;  2M8S A;  2KHW B;  4GN1 A;  3IFW B;  4GSW A;  4FJZ A;  2KX0 A;  3PTF C;  5CTR C;  1WJU A;  2DHZ A;  1XOD A;  4PYU A;  1V81 A;  1J0G A;  3A9K B;  4WSF A;  4E3C A;  3B1L X;  4PNK A;  4BKS D;  3QAR A;  4LDT B;  4AJY B;  2L76 A;  2ABD A;  2MDX A;  2A5U A;  1H8C A;  3AU5 A;  2CHX A;  1OEY J;  3HW2 B;  2IY1 B;  2VSZ A;  2L8J A;  3KUZ A;  4PS7 A;  4IW0 A;  1GGO A;  4EZK A;  5KQ1 A;  2KQS A;  5D94 A;  3ZUN A;  3KW5 B;  3QAQ A;  2RUK B;  1TXD A;  1Q0W B;  1MPH A;  3QX1 A;  1DYN A;  4W9G A;  3VUX A;  2BCJ A;  5J17 A;  1FB8 A;  2CR5 A;  3DDC B;  1XD4 A;  1Y5O A;  3OJ4 B;  1C3T A;  1UEF A;  3ALB A;  3EFU A;  2N9X A;  1TQZ A;  4MJS A;  2K1F A;  4MEM A;  4NJ7 A;  1RJ2 A;  1LFD A;  5D7G A;  4BFR A;  3VHT C;  5HKH A;  5JHA A;  2Y8G A;  5J3T A;  4ICU A;  2ROZ B;  2P0H A;  3TFM A;  1Y8R C;  3UGB B;  3GYP A;  4NJ6 A;  3ZRC A;  3BIN A;  4FAD A;  2MP2 A;  2MBQ A;  3DVG X;  4A6H A;  2ZPY A;  3SO6 A;  3EEC A;  4HXD A;  3B08 A;  4G11 A;  4IG7 B;  5CHW A;  4GDL B;  2D07 B;  2CU1 A;  1E8Y A;  2BYE A;  4WJP A;  3KSY A;  1ZVR A;  3K9O B;  1EAZ A;  1HE8 A;  2G4S A;  2NPT A;  2KMA A;  4EOY A;  2BGF A;  3VOQ A;  4K7U A;  1FHW A;  4HJK A;  2V76 A;  3QBV B;  2KNB A;  3VH3 B;  3APF A;  4GMX B;  4AOF A;  1DRO A;  3CMM B;  5J3Y A;  2ZPN A;  2RR9 A;  2M0X A;  2CS4 A;  5DPS A;  2G3Q B;  1OMW A;  1M7R A;  4W9J A;  3ZTD A;  1Z5S B;  2DAJ A;  1FHX A;  3LJU X;  1SIF A;  5E6O A;  2LVO A;  2M4N A;  4G0N B;  4K2O A;  2GS0 A;  3UQA A;  5C5B A;  3FEH A;  5E6N A;  4B9K A;  3PHX B;  2MBO A;  1T0Y A;  2Y7B A;  4URK A;  4MGZ E;  5AZH A;  1RAX A;  3M63 B;  4FJY A;  4HB3 B;  4MSM B;  1J0W A;  2DYB A;  2PPH A;  2ZCB A;  3CXB B;  5D6J B;  4OVU A;  3E9L A;  4BBN F;  2YRY A;  5FI1 A;  4F7U P;  2WX0 A;  3KYD D;  1Z87 A;  3S2A A;  3ZVR A;  1MG8 A;  2KDI A;  3ODO A;  2FDQ A;  2KVR A;  2RVB B;  3UF8 A;  3MHS D;  4EFO A;  3FP5 A;  3RT3 B;  2BPS A;  2PE9 A;  2DA0 A;  2CY5 A;  2RQ1 A;  1LXD A;  2E2X A;  2D9Z A;  1GUA B;  1TBE A;  5KQ4 A;  3SHQ A;  3DXE A;  3AU4 A;  4HCN B;  1P3Q U;  4EEW A;  4MJS B;  3DVG Y;  3R7R A;  4BKG A;  1BAK A;  4YON A;  2MW5 A;  1NI2 A;  4EKU A;  2KKC A;  4WJ7 A;  4IWQ A;  4ICV A;  3AXC A;  2W9N A;  3SYX A;  1A5R A;  2AWT A;  2KD0 A;  2N7D A;  4JKG A;  3RZW C;  2MP2 B;  4MH0 E;  4B6W A;  2FNJ B;  3A9J B;  5AEK B;  3Q3F A;  2GBJ A;  5KHQ A;  2J0J A;  3GOE A;  3C0R B;  2K6Q A;  1OY2 A;  2KZR A;  3U8Z A;  3PRZ A;  2K25 A;  1WG7 A;  1WVH A;  4XZ4 A;  3W1S C;  2KXJ A;  3HQC A;  2RSU A;  1UZX B;  3A4S C;  1OEY A;  2WH5 A;  3DPD A;  2NPT B;  2ELB A;  2W2W A;  5JHH A;  4NAW A;  3ZNG C;  3O65 B;  1U29 A;  3I3T B;  2MLB A;  5JHG A;  2HRJ A;  2LD9 A;  5DH9 B;  2W2X C;  4W9L A;  5D3V A;  5C1Z A;  1ISN A;  1M7E A;  2DLW A;  4HAZ B;  3ONS A;  3NY5 A;  1R4M I;  1I42 A;  2L0F A;  2R82 A;  2N9E B;  5C16 A;  2L00 B;  4BOS C;  1U5D A;  5L95 C;  3M1I B;  5DCN A;  3ZNH B;  1RLF A;  3T8M A;  1K5G B;  2YT1 A;  4P7I A;  3A9K A;  3APC A;  4WJN A;  2KFK B;  3QK0 A;  3VTU A;  3SBG A;  2NBV B;  4TQ1 A;  1XQQ A;  2IYD B;  2LUE A;  1OQN A;  3KYC D;  2KMC A;  3ZIM A;  3KUC B;  4AWJ A;  2COD A;  2DKP A;  2ADZ A;  3QJZ A;  2DX1 A;  3TBL D;  2BYV E;  3W1S A;  4CO7 A;  1DDW A;  2KCJ A;  2YLM A;  3ULB A;  2V3S A;  3ML4 A;  1WGU A;  3QQ8 B;  2J59 M;  4KHA A;  3PVW A;  4DK5 A;  4FJV B;  1MIX A;  3EPY A;  5DPR A;  4IUM B;  3WAL A;  1EF5 A;  4HCP B;  2DKQ A;  1WGY A;  2LZ6 A;  1EVH A;  1WGR A;  1HB8 A;  1V6E A;  1V5M A;  1KZ7 A;  1Q1O A;  1K5D B;  2I5F A;  4AP4 C;  1WM3 A;  2LRU A;  3V62 A;  3SD5 A;  2RGF A;  3HHM A;  3H1U A;  4K7S A;  3TVV A;  1C1Y B;  3SV1 A;  4GDK B;  1IP9 A;  2JPH A;  3UZT A;  2L2I A;  4ASW C;  3L17 A;  3RZF A;  2OTX A;  2GBN A;  4ZRI A;  5DPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...