4YLBA

Crystal structure of a102d mutant of hsp14.1 from sulfolobus solfatataricus p2
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
128
structure length
128
Chain Sequence
GPGTMMNVIMREIGKKLDELSREFYESVIPPIDMYEEGGELVVVADLAGFNKDKISVRLSAQNELIINAEREIQYIGTKYATQRPLKIHKVIRLPVKVKRDSQVTDKYENGVLTIRIPVEGSVSIRIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Active-State Structures of a Small Heat-Shock Protein Revealed a Molecular Switch for Chaperone Function
pubmed doi rcsb
source organism Sulfolobus solfataricus (strain 98/2)
molecule tags Chaperone
molecule keywords Heat shock protein Hsp20
total genus 24
structure length 128
sequence length 128
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF17886 ArsA_HSP20 HSP20-like domain found in ArsA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.790 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 4ylbA00
3J07A 4PCKA 3IGFA 2RH0A 2CG9X 2KMWA 2MNWA 3EUDA 4ZJ9A 4MJHA 4YE0A 3QORA 3W1ZA 4PBDA 1SHSA 4I88A 4JUSA 4JUTA 3VQLA 3AACA 3QORC 3L1GA 4YLCA 3QORD 1GMEA 3QORB 2Y1ZA 1WFIA 1WH0A 1WGVA 5DS1A 4YDZA 3GT6A 2N0KA 4ELDA 2K8QA 2WJ7A 1RL1A 4M5SA 4M5TA 2WJ5A 2N3JA 5LUMA 1X5MA 2Y22A 3L1EA 4YL9A 2JKIS 5DS2A 2KLRA 2CR0A 4FEIA 3GUFA 3N3EA 2BOLA 2Y1YA 3GLAA 4RZKA 4YLBA 2O30A 3Q9PA 1EJFA 3VQMA 3AABA 3L1FA 3Q9QA 2XCMC
chains in the Genus database with same CATH superfamily
1AY1H 2R0ZH 4Y4FB 2Y9RT 3W0WE 4N0UB 1XIWB 2C7FA 2E5EA 1J88A 1G87A 3SY6A 3PYCA 4LIQH 3OKOA 4GT7A 5AG8A 5J9PB 1S9YB 5AKSA 5FM5O 3BH9A 4E9SA 3MLZL 5DRZA 5KSAB 3RJQB 1KLGB 3LD8B 3DO7A 4UZGA 5FUZH 5EZIL 1IGTA 3IJ7A 3QUYD 2JCCF 1AZRA 1Z9MA 2CKBB 4G8EB 5E1IA 3HI1A 2QGDA 2AQNA 3FO9A 3WIHA 3QDGA 3TEUA 4N5UA 4Z78B 3H4HA 3NDYE 4YHKL 1ILSA 3VH8B 1M2VA 5GS0C 2SEBA 5BO0D 4L18A 2XPGB 1Z1WA 1LK2A 2F54E 5C92A 4MB5A 4L2LA 2WLKA 5K59F 2VDQL 5FK9B 1KJMA 2XTJC 4P2OB 2NXZB 2IJ0C 3B1UA 4XPAL 3VRJA 1IRAY 3ZT7A 1QMUA 1YA5A 4JQIH 4R4ND 4LLMA 1QASA 3WHXA 4YS4A 3S5LG 3T6VA 3C9NB 3WTYA 1KBKA 5IKCB 3Q1SH 1EO8H 1GJIA 3FRPA 4Q4EA 2E76C 3CVIL 1H3UA 2DQEH 5C0CE 2P5ED 5J57B 3CFDB 5HHMD 5IBUG 4EI5C 2VDPH 5L2KE 3KH4A 3SQBA 1YUHA 3ARVA 4JKLA 3VMPA 3OB0H 3MLXL 5GGVY 5IJBC 5HGDB 3L8QA 4YSQA 1CUOA 3HIZA 2JB6B 1JXDA 3IBOA 1KDJA 5EO9B 1TJHL 5GRJL 1WD9A 1JRHI 1T03L 1E8XA 5BRZD 2ZAGA 4FQIH 4GO9A 2J6WA 3P2TA 4PJXF 2BO0A 3UAJA 2WAQA 4RMWA 2D31A 4P07A 3TFBA 5IQ7L 2VDLH 1HS6A 5BMFL 3TZVB 5KYYA 1KENL 3RRQA 3SOTA 1BYNA 4H8VA 1M2OA 1T5WA 5LWYL 1GC1H 2XPZA 2ZXBA 4I9WE 1AI1H 1HSAB 1U3HB 3CHQA 3FHQA 5B7EA 4MNQD 4HLZH 1XWVA 1SBSL 2X4QB 4PJ7B 5CWSA 4NBXB 5K59E 1EXUA 1TSRA 1MFEL 1V8HA 5JMRA 4OCRL 3VFSB 3ZTEA 5DMGD 1ZGLM 4B3VA 4BSVA 5IB3B 5CIPH 1VACA 4XCFH 4HFUL 5DCCA 1J0JA 1I85A 1MNUL 3L4TA 4LLYA 4YSRA 5EHFA 5GIRB 4HT1L 4P5MA 1FZOB 3ZJAA 1JHLL 3O3UN 4LASH 3SOBL 4ICWA 2F1EA 2XX1A 1SXZA 4FYTA 3GXDA 1A9EB 2YC1A 1FNEB 5AW4B 1SUJA 2CKBA 2HX8A 5IFJB 1FNGA 3WGVB 5H2BA 1ZLDA 2MWCA 2K78A 1WC7A 3OHXB 3GRWA 4TNGA 1RK1A 1MW0A 1FFTB 4PGBA 4PRBB 4J6IA 3QUZA 1CDHA 3KGTA 1RIHH 1R9FA 4ODXA 3O6KH 1LEGA 3L2LA 3JBG7 4Y5VA 5K9OA 1AOZA 3UPRA 1FIGH 2BVPA 2Q20A 1CYXA 3TZVA 1J8HA 1PFOA 3LIZL 3IE9A 3O45A 3LEYL 3P4OA 4UTAA 5PCYA 4QHKI 3FONA 1NC4D 1I7TB 4HIPA 4N24A 4PGEA 3MYJB 2YXVA 1XTLA 2P80D 4R96A 3SE6A 1AKJD 4NO0D 4TSAH 4NFCA 4KJPD 1NCIA 2HPOA 4P9HL 3VGEA 4O2FB 4LLWB 1OSZB 3B6SB 1V3MA 3BESR 3L4CA 1CWVA 3WS3A 5E6IB 2R2BB 3NJMA 3QDJD 1GIGH 1WZAA 4P59H 4W4NA 3V2AR 4PI2A 4EI0A 3UTQB 3N42B 3PGFL 2W38A 1YUHB 3WIAA 4J4PD 4LRIC 4W4OA 4FG0A 5IF0B 3S4SB 4A7GA 3BEWB 1G7LB 3E8VA 5DJ6A 1CD1A 1IGYB 2X3AA 5GGTL 4BCZA 2OI9C 5KBLA 2NSXA 1ID5I 3OMNB 4FFZH 4NO5A 4X4YA 5BQ7B 2R8SH 3I75B 2ZSVB 2VUOA 2ENPA 2YN3A 2PCYA 3EYQD 2E75C 4ODSH 1TZHA 3WJMB 5CBAA 2IAAC 3O8XA 3RPKA 3OMIB 3KPSA 3AROA 4YGVB 2VLKA 4QHNB 1ZCRA 3UIZA 1BW8A 4NS0A 4HQQH 4PW9A 5G55A 3QEHB 4ZJ9A 4BFKA 1DUZB 3EDFA 2M1KA 1IBGH 4HCGA 4F91B 4NKDB 5LDUA 5C0BA 2E6QA 3MREB 2CJ3A 5ALBL 4WK0B 4YSSA 4DT2A 2Z6FA 4ZMXA 3CFKB 2O5NA 3WCYA 1CFTB 2ZIDA 3SDAD 3EOTH 5A2LH 5KSBF 2OMZA 2XQBH 4OKVB 2F7RA 4QTIH 5FGBC 4A6YH 1IBBA 5IT2L 3ULUL 2JQZA 4G80A 3U9UB 4JN1L 4O4YL 1T21B 3WFCL 5J4MA 3R06B 4AE0A 4AXWB 2WGXA 1P7KA 3EBGA 3AQZA 1S9XB 2F0CA 1J1XH 1OT1A 4PJ8B 4QRAA 3L5IA 1DQLH 4GUPB 4FNLL 3GQFA 5BVJA 1X5LA 3ET9F 2DJUA 2W9EH 2PCFB 3GJFH 3KYMA 5GRJH 3WJMA 2V9TA 3MGTB 4NHUB 3AS3A 3WSQL 4BUGA 4O51A 9CGTA 1ZA3B 3MRPA 2VL5A 1S7RA 4CVZA 1MCLA 3C12A 3PWPA 4X9HA 4PJIE 3BO8A 3E2HB 1E6OH 4CSTA 3FQTA 3U9PH 1V10A 4EDXA 1UA7A 2IH8A 4BFIA 1D5BB 5A2BA 3NCYP 5D72H 3DARA 1QRNA 2OTWB 5DHMC 3BAEL 1DJHA 2ZE0A 3JWNH 1CFQA 1IVTA 3NZ8A 2NOYA 3OB8A 4ZOCA 5DUBA 3EOBB 2WVVA 2YLHA 4N1CA 5HHOB 2WXJA 3MV7A 3NG5A 3S2CA 4UANA 4ETQA 3BXNB 4MASA 3K6DA 4X9YA 3VFNB 4N2DA 2YJQA 4O51B 4XNXL 1TEFA 2YSSB 1NCTA 3D39A 4W9CC 2D3NA 4H44C 4ESKA 1DJSA 2ERJC 3MXVH 3IDJA 3OKNA 4V2CB 3W56A 1QHQA 1T2QL 2BP8B 3NGBB 4X7TB 5C6TH 2E7MA 2X2JA 3F12A 2X4TA 2WKOA 1YY9C 1DVXA 1ILUA 1JVKA 4KI5F 4OIAA 4P2QA 2VDOL 4UQ9A 1PKQB 1R3JB 4QRRE 4FABH 2NW2A 5CFHA 4G9FA 2JJWA 3GO1L 3CD4A 1X5XA 3N43F 3POCA 4AYEC 5TH2B 1OB0A 3CTTA 4PRHE 4RBPH 2ZG3A 3ARDC 3CFDA 2BS9A 4YQXL 4GG6E 4OZ4B 2Z4TA 2ZF8A 1U2HA 3WMSA 1G7MA 3QXAB 4YLBA 5F0MB 3DECA 1YO4A 3QO1B 3FT2A 5DK3A 2YMOA 4LIQL 1JZ5A 3IDJB 2EVIA 1OLZA 3B2XA 2HLFC 4WTZG 2AGJL 1IO4C 2Q6WB 3QJRB 5A16A 5L7XH 1L9TA 4AV4A 3TN0A 3QJQB 3QRGL 3RIKA 1ZAGA 4BKLB 2EEBA 4JM0A 1JZHA 3I50H 3WIHL 1XAKA 2WVVB 2Y07H 2X70A 2EE2A 1IZJA 4K3EH 1NMCC 4WEEA 1KB9K 5IEKA 1AR1C 1L9PA 1QBML 2JKIS 3RURA 2Y7NA 4J8RB 4H8WH 1SYSB 2A38A 3P40A 1U8OB 5EV7A 3UGEA 2W92A 2G3NA 4EKJA 4U1MA 1QI4A 3E9UA 1AP2B 2MPAL 1OCZB 4U6TA 2E9WA 1H6EA 4GMTL 1OWWA 3THML 1L6PA 4MJHA 4PR5A 4AJVA 1UJ3A 1NMAL 3WKQA 5IROA 3P0VH 5CHNB 3QZWB 3TJEL 2WWMD 2KDGA 5FYJL 4YXLL 1ADQL 2X44D 4H8WC 1JHTB 4ELDA 5EF1A 3GLEA 4XN7A 3EG9B 2WJ5A 3PP4H 4OQ1A 3K5RA 2A4EA 3CFCL 5EBGA 1CLZL 1KGIA 5IHUH 4J23A 1BAFL 2XPGA 1FORH 2H32H 3LNFA 3LPWA 4WI8A 2IOIA 1YEIL 1KMGA 1BBDH 1W2KT 4EXKA 2E6PA 3ZE0B 1KCWA 5ABAA 3RNQA 2YD3A 5I9QC 3TP4A 5L4MA 5AVTB 1TTBA 4JM2D 4PJBF 2WZ0A 43CAA 4RGMC 5D1XD 4WI4A 4P2YA 3MHZA 5FS5A 1VFAB 2VDKB 1UXSB 3HC4H 1KCUL 5E8NB 2LLGA 2H6UA 3AG1B 4JE0A 3VDAA 1YEEH 1BOGA 1O5PA 1USZA 5KSUB 3B9KB 3DLQR 4OZHF 5DJAA 3TXAA 3ARGB 1JZ8A 2EDRA 4XN5A 1P7HL 1T6BX 1NLBL 5GSVB 2AV1A 1A2YB 2XZCL 3K2KA 1UCBH 4NQUA 5ISZD 4JCWA 2CSPA 2TSBA 5BUGA 4M7ZC 3FZUC 4U6HB 5I6PA 5HGGS 1U8KB 3PL6A 4LCCA 5C0IB 4L37B 2IQAA 1ZPUA 3T3MB 2MKLC 4AV0A 3AY4A 3MV7D 4OM1L 3VXTA 1KXHA 4HIIA 5F6HI 3FH7A 5KYUB 2H0FA 4LKXA 3TGXA 1IGYA 3TVMA 1ZDSA 1LK3H 5E8OA 1RP9A 2CUHA 2BWDA 2DYRB 3QJZA 2BM3A 1F90L 4B60A 3KLHD 1GC1C 2JWYA 4JQVA 4UAOB 3QS2A 5H35A 1B0GB 4X4XA 1FL5B 2EDTA 2ZF9A 3TN0C 3PNWA 5JQ6L 2OTUB 3EFOB 2D73A 2A2QT 4FZ8L 4UDTB 3UP6A 3CQFA 2GC7C 2KH2B 3MRGB 1ORSB 4Z7OF 1CQYA 3DK0A 2IFFH 2WVSA 2O5YH 4JFFB 4F2MB 2KQMA 1RURH 1P69B 3KHOA 3J27A 4L0YA 3B2UD 5MERA 3CFMA 4WAFA 3HB3B 5DVLA 5DRXA 4O2CA 4TTDD 5KVFL 1KACB 2P5WA 2P5EB 5CCGE 2OR7A 5ALCH 3OQRA 1FC2D 1R5VB 5HHOE 3VXUD 2JH2A 3NFNB 2DQMA 2D7TL 4NUMA 4PWKA 4E9LA 3UOAB 4H1LB 1F6AA 3UP1A 4I87A 4HBQA 4RETB 3QNXA 1TYJA 2X38A 2YQGA 3QUYC 2VN3A 1QEWA 4QY8A 3GLZA 4RAVB 4TUKL 5E1GA 1C5DA 1X6LA 4OLWH 1UUNA 1QVOB 5JYLA 4WTZA 1PKOA 4YIQB 4I2XA 5C6WH 2J4WH 3WY1A 1YMHA 4P0DA 1J86A 4IOFC 3L95B 4OCWL 1PFCA 3OGOE 3GLAA 3A4EA 4DETA 2DKSA 1UB6A 2CNYA 2FJHB 4IRJA 1XSOA 4WWNA 1DO5A 1G7PA 4HD9A 3BSHA 4IRJD 1TZGL 3MACL 4YHPA 5CR8A 3IMVA 4UILH 4U7KA 4M1CC 1FNLA 1LP9A 2D0HA 1JNHA 1M53A 3LB6C 4WWPA 1IARB 5DVOA 1SOKA 5SWQA 3RWCA 4JO2L 4E41B 4FFVC 5BW7A 5I6XB 4QJ4B 1LO2H 1RHFA 2DWTA 3RVXC 1TQSA 3X3FL 3K4DA 2EC8A 3T2LA 1S8DA 4JPVH 4LQ1A 1RUQL 3TJHD 1U8KA 3PL6B 4KTDH 2G4EA 3O4LA 1NOFA 1S7VB 1OM9A 2CGRH 4NP9A 2W94A 4LSPL 4NQCA 4ODHL 5JW4Q 4S1SH 5MEOB 1CLCA 4HIXL 3BSZH 4ONFL 1N67A 1A6TB 2OMTA 3UACA 3N1QC 4OM0L 5IQNA 3DROB 1ETA1 1DEEB 4AM0B 5GS3A 5I24A 5DS1A 5FR3A 4JRXD 4IDLA 2HKAA 5M94B 2DIEA 1G9NH 2VZOA 3CHXA 5FM4A 2Q3XA 1IFGA 3MRHB 1MFDH 2N01B 4J3TA 3ZOAA 3WUWG 2ZUWA 1V54B 2GTWA 4IRJC 2BXYA 2D4DA 2DQCL 3VGGA 1ZKAA 1VENA 5HYJE 5I0ZA 4V1DE 3Q7JA 1ZEAH 5DVNA 3RBSA 4IBTA 4OZFA 1YEJH 4WTXA 3LAFA 1IFHL 3Q01A 4OJDH 1DQLL 1LEGB 3FAWA 4JFHD 4Y5VB 5DD5L 3QH3A 3SKOB 3P54A 3BUYA 3EYOB 1DL7L 3KPQB 5IB5B 1F13A 4AGLA 1JN6A 5LLIC 3TOPA 2IPUK 4BHUI 1KXTB 1GOHA 4GW1A 5IEHB 5FYJE 4M3HA 1UZ8B 3MOBH 3KYKH 4KDWA 5FC9A 4MXWH 3GHEL 4Y1AE 5E9DB 2WWNA 1QOKA 4BSWB 4ALAH 3KVDD 5EF3A 3RX9A 4PLJC 1BFTA 2DJSA 4DCQA 3HPJB 5DO2C 1U0QA 3OWRA 2NY4B 2A77L 3P30H 2OMTB 3GI9L 2OM5A 1H0DB 2PCPA 4HKXB 3AM8A 3V6FA 1SF5A 1P53A 3PV6B 3C5SB 1CD1B 1T7XA 3Q2VA 4J4PA 2FEDD 5DQ9A 3S97C 4E36A 3G9VA 3S4SG 5BQ7A 1UASA 2FX9H 3RX8A 2QT6A 1BVNP 2HRLA 2O5XH 5CILH 4AGOA 4CSZA 4IRZH 2GJZA 5EUOB 2AKRB 5FF6B 5LBSL 3HBZA 4ABWA 1HAWA 1N64L 4NYLB 5B39G 2PW2B 3ZW3A 4HIHA 3DBXB 4IU2B 4U6XB 4ZUSB 3RHWF 4EUPG 4UBDD 1JBJA 1DJWA 3T6ZA 3WFDL 4WSKA 1ZLVK 4AKPA 1RULL 3PWVA 1FNSL 3P4OB 1B9KA 4JB9L 4K3HA 2X4UA 3PHOB 3VXNB 4NZUH 1WLHA 3U82B 1TCRB 5TF0A 3P4MA 2F54A 4ELME 4FLRA 5BRZA 1EA9C 4J4PC 3FU5A 2JKRM 4HWZA 5E7FA 3X14B 1FFOB 1FN4A 1FZKB 1L3NA 4UDTA 5CJOL 1XF1A 2A9CA 1G0XA 1IE4A 3UBXG 3TA3A 1ASOA 1A3LL 2QZ5A 5GGRB 1HH9A 1EJ8A 2F8OA 4NN5B 4TSAL 5F0PB 3ATEA 1AMXA 3KPNA 4MJ4A 3STLB 1OE2A 3NJFA 1IGMH 4G6MH 4N6RA 3RYMA 1XCQB 5MI0C 2J8UE 3KDPB 2KZBA 2B0SL 3FQ4A 3EJJX 3MMEB 3F7QA 1NEZA 3QUXA 4JHVA 2D7OA 3VFWB 5CP3H 2A74A 3PGFH 5J0BA 3B2PA 4WGVB 4LBEA 3DBSA 2OZNA 1J9QA 3VFMB 1NCAL 3ESOA 2DV6A 3WKYA 1X5HA 2C3HA 3CWGA 3L45A 1MJUL 1Q38A 4DO4A 5BJTA 4I3RL 3VD4A 1A22B 1ZD6A 5HHNB 3P77B 1QYGL 2CLRB 2PR9A 5I1KL 1XH1A 4QT5B 4LVNC 1R1CA 1A1OB 4TF4A 1EO7A 2WWMC 2X1XR 5E03A 1BBDL 1MRDL 4WO4B 1SRDA 2AQ2A 3Q13A 4WRLA 5EOTA 1ZVYA 3GPSA 1AZVA 4JRXA 1CDJA 1KJVA 1TKWA 1NCUA 1ZXQA 4M7JL 2CQVA 4M7ZB 3MUGA 1FN4B 1FZKA 3L2NA 1A9BA 2BNQB 5KS9E 1YQVL 2D31B 4G6JL 4NRXB 4DOHE 5CEZL 3GMRB 1CN4A 4AKOA 4JFPA 2DQFA 3JVFC 3OJMB 3U9WA 3HZMA 3IGAB 3WNMA 1S7QB 3EJCA 4OF0A 4JN2A 5LBGA 1IV8A 3ZDXF 5AW1B 4KQ3L 2QFPA 2F7PA 4V33A 4FG6C 5AOJA 2H6OA 4N5EC 3DUUB 1JNJA 5HI3C 1VPOH 4YSPA 2G5UA 3N9GH 4JPWL 3UZQA 2R2CA 4CNIB 1LNUA 1H15B 3NABH 4YWGL 1PLGL 3WXVH 4I18A 2Z3FA 3UAFA 3KYNB 4PS4L 5LXVA 5IREA 2QPDB 4EXPX 1KB5L 3BVTA 4F7MB 2AV7B 5T5FA 1AP2A 2YEQA 2GAZA 1VFBB 1XF2A 4O58L 4NHCH 3SPHA 5AKTA 1MFNA 3BWUC 3EZJB 3PUCA 4WSGA 4BZ1H 1F3RB 4ZFFA 1WH0A 3REVA 1QZ1A 4M3KB 3NZSA 4ZG1A 2CK0L 4UQIM 1XHHA 4AC2A 1XXDC 4GRLD 1PAMA 3US1A 3MC0A 3SE8H 4XMKH 2OK0L 3C2AH 4PQXA 4E5XG 1XGRA 2XKNB 5ADOL 5HHXH 1J5CA 2OW6A 2W95A 1RZGA 1A25A 4GSRA 5L4FA 4PSPA 3QJOA 2F5AH 5TD4A 1YZZA 3NACL 5I1CL 1OZUA 1UFGA 2YD2A 1KWGA 4OLUL 1BFVL 3VXUA 2AV7A 3ZBMA 2CO2A 3N1FC 4G6FB 3FQRB 3ULUF 3PJNA 4Q6IA 2QFRA 3QZBA 4M8RA 3ARGC 1CTNA 2C8NA 2ICEB 4JFDB 4OSUH 4PTTA 1SEQH 4L8DB 1YUKB 2UZPA 2ZQKA 3E6FB 3QUZB 3HN8A 1JCKA 3WUWB 3L3OB 4XCCL 4Z6AT 1Q94B 3QPQC 1QFWL 2JJSA 3RDTC 1P4UA 4CVUA 4H26B 2E9GA 1SDDA 5D7EA 3T5WA 3U79A 1OGPA 2D8KA 1OARH 2B1HH 2CIIB 3T0BA 1A65A 1MRFH 2JQMA 4HXAL 2PPAA 1XL6A 3N85H 5EOTB 4QYAA 3FQUA 3ZO9A 4BXVA 4ZO8A 1HJBC 1F18A 1OPOA 2AAVA 4LSTH 1HESA 5CGMA 3NSFA 4U1LA 3MUGB 5FF6A 3GXNA 3DHPA 5B38B 3WHE0 5TQ2H 5C09B 1RUAL 4HKZA 2AJUH 3VQ2C 3NIGE 5K33A 5HYJD 4M6MH 2DMGA 3AT9A 2WLMA 2IGFL 3VB9A 4S1RH 4PJEF 5FK9A 5T3XL 4OD3L 4QGTA 3FF7A 4MYPA 5EU7E 3MV8A 4F3FB 4W9KC 7PAZA 3DPBB 3BGMB 2FWLB 2FJHA 3V7AG 2EDBA 5FV1L 4QRPB 4AIZB 3X17A 4PJAF 3W2DH 2VJXA 3QIWA 2GY7B 3P3YA 4OZHB 3HPLB 4DCQB 5KBNC 3HHRB 2NNAA 4WIQA 5HHPB 3LV3B 2VR5A 3QWQB 2ITCB 5JLZA 1BMWA 1MRCH 2VDMB 2I7SA 4FP8H 2LFEA 1OV8A 4CU8A 2I69A 4QXUH 2V4LA 3UGUA 2X10A 2VN5A 3S48A 3M1CA 1TFPA 2IALA 4PUBH 4P2OC 2H6PA 4XPGL 1U8CA 1WAPA 1CTOA 2IMNA 3FQWB 2WV3A 3L6FA 5D2NB 1LEKA 3VX1A 4AENB 4M7LL 1XV8A 4Y19A 4W9HC 1NBZB 3D51A 3FT1A 1HCYA 2CDEA 4KWUA 4QMEA 3BVNA 2ED6A 5D96C 1BVKB 2L3BA 5CD3B 4NHUA 5JNYB 3MFGB 1KDIA 4M5SA 3D2UB 4OFIA 3MZGB 4GAYB 1MRCL 5SX5K 1E40A 5IP4A 3FSAA 2X4UB 3PHOA 1CLOL 4L4VE 4NKIH 3D39E 3O2WL 4C4KT 1B2WL 1R47A 2M83A 4GAFB 3TBTA 1G1YA 3D85A 4GI6A 3RGHA 2RA1A 3NVQA 4QWWC 1SFDA 2KPWA 4ATTA 2Z4QA 4NPKA 2J21A 4QDGA 5EUKB 3KBEA 4PTTB 4TOYL 2Q3AA 3FS9A 5EZJB 5AALA 1H6TA 1OAZH 3QDHA 4GAGH 4Y16D 2EE9A 4RNRB 4J3XA 5CGYC 2D3LA 4EAEA 2JFCA 4G2AA 4G9FE 4WUUB 4Y5VC 4TL5A 1UACL 4OCYH 1JV5A 4Z95H 4FADA 3VE0B 2VXQH 5IJVA 1G4RA 3L5JA 4DZBB 3KWWA 4ZXBC 2GVYA 1TZAA 3MREA 4QTIL 3DRTA 5IQLA 2JI1A 4JFDD 1BMGA 5IHUL 4NNYA 2NQ3A 3IJ9A 3LZOA 1CLOH 4MA3A 3SPVB 5D7JB 4R8WL 3EO1B 2N7BA 3H2QA 5DO8A 4YHPB 1P7QB 4NQQA 3MXVL 3BKCH 4P46C 4D2NA 5DWUH 1S9WA 2VXQA 2GK0A 3KXFA 1RJZB 1XCTA 1DVSA 4HIEA 1K6QH 1OTSD 2W9DH 3U0TA 1LO3L 2QBWA 2AQQA 2V2XB 3CHPA 5HHXL 3QA3A 1E7UA 3BP4A 1RSFA 4TLTA 1T1XA 1WAEA 3B8SA 2WVTA 3O4OB 3GMQB 1YMMA 3LVTA 4KBPA 3DYPA 4NUGL 3UTPD 4N9OB 3I6LE 5CJQL 1Q0YL 3UTOA 2P52A 1ZA6B 3VA6A 5EDSA 3WTWA 2XQ0A 1IBYA 3RZCD 3F84A 4CN4A 2YUWA 3DVIA 1JNLH 3LOWA 2IG2L 1GGTA 3LZRA 4PLJD 3BN3B 3IXTB 5EN2A 5B8CC 4Y9FA 1GRWA 2OJEA 4ZW3A 5E8NA 3PGCA 4XP1L 5B39B 4Q9RL 4FXKC 4YDIL 1T1ZB 5JOPD 5DUPL 1OTSC 3G08B 5C0NC 1N0XL 5DVPA 4ANVA 5HGHA 4UT9L 3I3DA 4ZUTA 3GMLA 2JB5L 3HZMB 2WJ7A 1TVHB 4NZTH 3ULVC 4P06A 4MCZB 2FT8A 4QNPE 1NAMH 1UATA 1JPFA 3E80A 5CINH 4IIZA 3L4XA 1CICC 1NBVH 1ZE3C 5GJTL 4X5WB 1HQRB 1KIRB 2BHFA 4AZ8A 4N68A 2ZSVA 1CFSB 3DSFL 4XRCB 3AGVA 4M6NL 4R4BB 1W9XA 2VMCA 4AQ1C 1XF3A 3D6GA 1MCOL 5IESL 2HG5A 1KYFA 2UXGA 4KRNA 1SN0A 3IS0X 4U3HA 1DQDH 1LP9B 4Q97A 5BO1H 2R4SL 1DQJB 4E42A 2V0AA 5FOJA 4JPWH 1EDHA 5IVZA 3SGJA 4GS7B 4U1MB 4XMLH 3SE9L 2OI9B 5FB8A 3D85B 4KJQC 1UOKA 4KKLD 3AU1B 5T1KB 2G2RB 1HHHB 1XGUB 3GIVB 3MRDB 5I17A 4AQ8A 5FW6A 2WQUA 3F7VA 4J6RH 2XETA 1E4WL 4DKFH 5LGJA 5KVFH 4ZOEA 3H3BC 3VD0A 2ICWA 3ZUNC 1IM9D 3SO3B 2VOTA 3TBWA 1USQA 1U30A 1I3GL 1JPSL 3EJZC 3ZRFC 5C07D 3GPEA 1P1ZB 4HUNB 2LVEA 3QSKB 1F3DH 2ED7A 3GMOA 4UINH 1MJ7H 4PJGB 1OB1A 1OAXH 1ICTA 1E9OA 1JERA 4AV5A 4BYHA 2JJTA 2FYVA 1BIIB 4QXUL 1JNNH 1S7UB 1DQKA 4KKBC 1MCWW 1OAKH 4D9QE 3C6LB 4DP2X 3LQAH 4HH8A 1UT1A 2FBOJ 3HHSB 4K3DL 4XC1L 1BZOA 3WELA 3BQUC 3EJYD 3MODL 3SYQA 2YQ3A 3CDYA 3JV4A 1OF2A 1YQ2A 2HLEB 3IFLH 1FRGH 2YR3A 3VXMB 1QLEH 4GMTH 4Z3EA 1FL6A 3EJZD 1NC4B 3N2JA 2V7NB 4P48A 4J3OH 5ITFA 2VITB 5GIRA 5EBWA 4YHYC 2HUEA 1NBCA 4K5MA 2IDUA 2MPVA 1X6NA 4OLYH 1MFUA 2JB6A 5E4AA 2V17L 3ZDYE 2Y07L 4G8GA 2CD0A 4PG9A 3X1EA 3NZHL 5CEZH 4NNPH 4GSDL 4P04A 4EIGB 1B2WH 2OPCA 1X5FA 1C5BH 4W4OC 4PIBA 4BZ2A 3HZ3A 4L1DA 3EYSH 3MDJA 2ADYA 4I0PA 3G5WA 4C83B 3PJLA 4WFHE 2EEAA 1B0IA 3Q5OA 1CC3A 4U1HA 4GRWB 3DXAD 3SPIA 4HUXB 1TJGH 4I48B 1DFBH 3OC8A 4MHHI 4XP9L 4OZIE 3ALPA 4MS8C 2BVOA 4N2NA 5I30L 2EYTA 3M17A 4PM1A 2ADGA 2IANB 5B7FA 4R4BA 3OKMA 5KSVA 1I1YA 4ZMQA 3RWFA 3RZWA 2BIOA 4YSTA 5AB1A 3F04A 4U3CA 4M1CD 3U1SL 2NY5C 1HHIA 1MG2C 2VZSA 3B9KA 4H1LG 4LCUB 2QVIA 5DEGA 1HKFA 2Z93A 3VB8A 2X6VA 4IRSB 2OYLA 2DTML 2X4RA 3CN2A 4M1GH 3WNPA 3SPJA 2NCEA 4P05A 3QCTH 5DHEA 4A1RA 5IFAH 3ZL2A 3BGFB 2RMNA 1NIBA 4PJEA 5I1AA 1WCBA 5LN8A 3L3JA 1IGML 4G6ML 3HG4A 3HZKB 3FQRA 1ZSDA 1G7HA 4L4JA 4Y1SA 4Z3TA 4GG6F 5I1LB 3DX1A 3QUKA 4PJDE 1RD6A 4RQQA 4XCEA 2RTTA 2DQHL 4Z0BH 3WTXA 4KTEH 5EU6B 3W5MA 2J20A 3QDMB 2B8OT 1KIQA 3C5ZD 2AJXL 4M5ZL 4EMZA 1UVQA 4HZLA 1PNCA 4S1DD 5F7YC 3QA3B 3HE7C 1A9EA 4X7TA 4MBOA 3RX7A 2LW3A 1WK0A 4IK6A 4M8QB 2BX5A 2JJTC 4X0KA 1Q9LB 2A77H 2AEWA 2NY2B 4UT9H 4QRUB 1DBBL 1S7WA 1BX2A 3V4UH 4CL7A 4B7LA 2P43B 1M56B 5DJXA 5F7FA 4TQEH 4ODVH 3CPLA 4MRCA 3BUIA 5DFAA 1U36A 3QRBA 2DQIL 1S7VA 2VTFA 3UTSA 3W0WD 3C60A 4V1DA 3UZVB 1TYRA 1MCSA 4B9KC 4L9LA 1ZLUH 5IF0A 5KJRL 1SFHA 1IJNA 4N5ED 3EF4A 1QR1A 2CGRL 1QSEE 4LCWB 4FABL 4ZMYA 1N7MH 3HUJB 3KHQA 1XR9A 2I32A 2CKNA 2FO4B 1CZ8L 4GO8A 4D7BA 1XIWC 2PN5A 2EIKB 1OSZA 3PL6D 4LPYA 1KIRA 4JREC 3OKYA 1BFVH 3EYVA 5E8DL 2X70B 3BAKA 3NN8B 3BZDA 3W57A 1MCKA 3VNYA 5C0AA 1CURA 4QIRA 1NFKA 4R8WH 3TNMB 1A9BB 5TGBB 4BUQA 4X7CC 4OF8A 1G7QA 4H26A 1VGKA 2UUDK 4O5LH 2OXHB 1HHGA 1OCCB 2GSGA 3IETB 3MACH 2K1MA 1IBZA 4HK0B 2JXMB 5AAMA 2DWXA 3HZVA 3RWGA 1OCRB 1N5YH 4N3TA 2NZ9C 1TJIH 4N0FA 9PCYA 4N2FA 4YXHL 2JKSA 1D9KB 1DBAH 1DJGA 2WBKA 4LCIL 2X42A 4JBSA 1F4AA 5IJKC 1N2RA 5GGSY 2VLRE 4ZS7L 4BGLA 3DJTA 3GSVA 1UM5H 5EA0H 4HLZG 4RRPG 3FRUB 5DZNA 1DLHB 1KFAH 4F7PA 4DH2A 1E9OB 1Z66A 3HFML 3Q8AA 3L08A 4FJ6A 3TESA 4X6CF 2PUQT 4HUUB 2YKLL 3DVFA 1B4JH 3TT3H 1RIVH 4TSBL 3VFWA 1BGXL 2WGNB 4NXKA 2FYYA 2VR8A 5E0QA 3A22A 7PCYA 1BD2B 1T6VN 1W80A 2XZZA 1J8SA 3MJGX 1ONQA 3BYTA 3HNVL 4NRZB 4F92B 5KUKA 1NFDA 2IADA 4B7IA 1WS8A 3W39B 2KBGA 3RTQD 2OTUA 2PYEE 3B83A 5KJ7E 4BELD 1I9IH 4QHUA 2JCWA 4NKMA 1Y07A 3KPTA 3OAUH 4YHMH 4DN3H 1QBLL 3ZDXB 1P6AB 1G9NC 1B3JA 5T1LB 5I2IA 1C1EL 2EKSB 2PP8A 1HKLH 3B9KD 1KEGH 1P5UC 3GHBH 3IVKA 2J1XA 2X1WL 4UQ2B 3ZE2B 1IKFL 2ILLA 1S78C 4K8RD 2J8UA 5TE4H 2A6KA 3S35H 4RA0C 5D1XB 2IO5A 2IQAB 5F96L 5H37G 3SJVD 3PHQA 1RL1A 5AQ0A 3WE6B 1CXIA 2MRYA 2XLLA 2DQFB 3D2UA 5FA4A 5DD1H 3JTBA 5FIEA 4N8VA 3IT8D 3HNSL 4IGBB 1YEDB 2IANE 3FN0H 2MEJB 3CE1A 1U21A 3GSOB 3TIEA 5B8CA 1NJ9B 2BCKB 3FTYA 3LVEA 4LLMB 1M9WA 2MIZA 4ODTL 4HJTA 4X6CE 3SB3A 2OLDA 2Z7WA 4PGBB 4PRBA 3O3DB 5CLTA 1LJMA 1FCGA 4QD2E 3LEXA 2FE0A 5HGBA 3OKEB 5GSRB 1QWUA 1H0DA 1OT4A 2P5PA 2PCPB 4U6YA 3V0IA 1Y0LA 5ELIA 3MOBL 3DGGA 2HKHL 1JNLL 5J6GB 3T4AC 4LOUD 5LQBL 2O1AA 4ZDHB 5F88A 2JI2A 4N0YH 4PJCF 4DNLA 4LKCB 1RP8A 5AWNL 1T1YA 2EIJB 2OL3A 4L5FL 3T77B 1I7ZA 1N3NA 4JHWL 3INOA 1W0YT 3MBXL 4YHYB 2O5YL 1CF8H 1M7DA 1U8IB 4AMXA 2JB5H 5LXGL 1VB9A 3O4LB 3QHFL 2CDGA 4NJAH 3OC5A 2Q8AL 2Q10A 1NLBH 3FRUA 2KDYA 3GSUA 5D2LA 3TTYA 3SN6N 3KBHE 3M88A 2P7TA 4OZGA 1JXGA 3ARBC 2WM0A 3L1EA 3QZPA 5AW0B 3PWJA 1BQUA 3Q8CA 2X1OA 4I4WB 3TO4C 4XAWL 1R46A 3WN5B 2CUMA 4NRZA 3EGDB 3EGSB 1MREH 2AITA 3R4RA 5D71H 2IPKA 4HQQL 4ELMB 2XSKA 4B9IA 1BZ7B 1W0WA 5K9KA 2VLJB 1F45A 5DVKA 4TOYH 1UTDA 1B0RA 1P1ZA 3RB7A 4DGIH 4WFHD 4OZFG 2IAMA 3V6ZA 5HGDA 1NINA 2BFGA 2P4AB 5AB0A 3EAKA 4LP8A 3WFHB 1NBYA 1GOFA 2I85A 2JJSC 2XACC 3LDBB 3FMGH 1UYWH 3RPBA 3K6OA 5AAWC 3EFDH 5HHOD 3VXUE 3O6FA 1FL5A 1D3CA 2V17H 4PJCE 1E6JL 1NCWH 4MD0A 1QO3A 2XX0A 3RFRA 4RAUA 4KO7A 1MVUA 2IBZY 2JTYA 4TULH 4QUOA 3CN1A 4MQ7A 4ZPTA 3Q8EA 1SEBB 4JFWA 2ADJB 2KZWA 3HOGA 3VFUB 4H8PA 1CPUA 3NIFE 5J6SA 4XWGL 2X9ZA 4J3OC 1GKOA 4QHMB 3GD1C 2W07B 2D7PA 1LE5A 1FE8L 3GSWB 1QA9B 2GFBB 1YDPB 5EU4A 3JV0A 3ABZA 1FO0H 1P6WA 4CKQA 2NY3D 2ZT9C 5JZ7D 4AIZA 5DUML 4EN3B 3TWCL 3QJFA 1E5BA 1LTXA 3UAJC 1HHKA 4A7UA 2EO1A 4KXZH 1NGQH 1HILA 2OL3H 2AQRA 2ZUSA 2IMMA 4MBRA 3M8OH 1AXSB 1XH3A 4MQ7B 3OVUB 5IVNA 1LE9A 3G5XA 2NY3B 4F2FA 1U92B 5KOMC 3QXUA 4NFDA 5F44A 3NK4A 4GXFA 4CW1B 4RDBA 1JXKA 3VXSB 4X98A 4FRWA 2HT2C 2NRDA 2W9DL 4FNRA 2H9GB 5D7JC 4MB3A 3ZTNH 4J1UA 5BV7L 4F24A 1KCBA 1XSKA 3CFKA 3LKSB 4MNQA 3ZE2F 1C16B 3ZRCC 1PZBA 1VSCA 1BQHA 4F2MA 1T5XA 1TQBB 2BFVL 1A7QL 4HS6B 4UTBA 2V9RA 3RUGF 3DO3A 1SQ2N 2YKKA 5F7WC 5IESH 4PB9H 4ODBD 1T21A 1YRKA 4P23D 4BJLA 5L9DH 5JORA 3GDCA 4X4KA 1TUPA 3WLBA 2XN0A 4XVUD 5LUMA 2XBDA 1UACH 1FG2B 2X89D 3TEYA 1M7XA 2QSCH 1S5IL 2VN6A 4YQXH 4QXVA 4YBQD 3CZNA 3Q05A 3FUKA 5LCVL 4NZJA 2A9MH 2BIPA 2R56L 3J07A 5D70H 1RUKL 3N06B 4XOBA 4W9LC 4WEBH 3FUEA 1NGPL 3GSRB 1N6UA 2FATH 3W37A 3FJTA 1KBWA 2OYPA 5I19H 1U91B 2X4PB 3PHAA 3SDAB 2AK1L 2Q7YA 2V3FA 3VRIA 4F8LA 2I5YL 4Z18A 5AAWA 1ETJA 3QAQA 5BXFB 3L3OC 1OCWH 2E9BA 1N5AA 3WXVL 1U41A 3X13B 4JRFA 1Q0EA 4UIMA 1AIZA 1TITA 5FHAL 3MRLA 5D96B 3QH3B 1K8DB 4MB1A 5EOQH 1QVOA 1TPXB 3HRZC 5JPMC 4Z7WA 5DVMA 2CRYA 4R7DB 1EBPA 3D4YA 1KWKA 2VIRB 2OMYB 4HALA 1J8RA 1QHOA 1EHLL 1E9QA 4JFQA 4PRIA 2QHRH 5GGSB 2H32B 3Q6GH 1AQ8A 2IC2A 4DP1X 3GT6A 3BKCL 5AYTA 4P9ML 4KK9D 2IAMD 4QAMB 2VABB 3MJ8A 3VFVA 3SGDI 3CFJB 2V7HB 3N40P 4X0NA 1KEGL 1RHHB 1RZ8B 3IB4A 4GKZB 3RE0A 1R0AH 4M8UA 2CHZA 5E94A 3APMA 4G7QB 1JWMB 1DBKH 3D4ZA 5KSBE 4XAKE 1PG7X 3N1GC 2FEEI 3SKMB 2ZX8A 3GUTA 3PDDA 1OAUH 1T0MB 4AE1A 4GAGL 5BMFH 1HEZA 5F9OH 1KC5H 4HHAB 5DR5L 2BLFA 2WWKT 1KJVB 1NLDL 1TKWB 3P1VA 2YZ1A 4TSBH 5ETUB 2EH8L 4LNRA 5IJCC 5I8OH 3QRGH 3OPUA 3HE6C 2DMKA 4FXLA 3V4UL 4K7FB 2PF6A 3WJJA 1ROWA 3BDBA 1MFMA 5DHDA 3TJPA 3VUAA 2CIKB 5C09D 3EDEA 2MQ3A 3HA0A 4DEWA 5CJOH 4FQ1L 5HYIA 2Q6WA 5KW9H 1DQIA 3K6SA 3IU3B 2J8OA 3JV6A 5CJXC 1W72H 3PGDB 3T0ED 1SJHA 2R1YB 4AM0Q 3SGKA 3OKKA 1SJMA 2YA2A 3RL2A 2GHWB 1LL1A 1NDGB 1RCYA 2CGZA 4G3YL 4Z3GA 5IQ9B 3KPRD 3GBLA 2CR6A 3MJ9A 3DV4B 2FZ3A 5EU3A 2QQKL 4FI7A 4Z3HA 2XG4B 1T1ZA 1Q94A 3HN5A 4AQOA 4L4TE 1EJFA 1B0WA 2PWEA 1ET5A 2JKWA 5SX4I 4L3CB 3PQYE 3EH1A 4B9PA 3QNFA 4YDLC 3C87A 4KMQA 5ITBH 4LSDA 1NGZB 2OR9H 3KPLB 1SVCP 4N0FB 5I1AB 3GJEA 5GHWL 3IFOA 3QZWG 4GQZA 2Y3AA 4XH2B 1NCBL 1KYUA 1FAIH 2NT0A 3LEVL 1LDSA 3N55A 4MZ3A 1D5IH 2IF7A 1CU4H 4CU7A 25C8L 1XXFC 4HAGA 5D1QE 3ESUF 1TU2A 4MA1B 4CMMA 4YBQC 5D5MA 3VXOB 3WTVA 4JDEA 4KDTC 2W60B 4XCFL 5JHAA 4CGTA 4LLUA 3VWKD 5EFIB 3KCPB 2YXFA 4E42B 1J8KA 1V3KA 5KG9B 3PNRB 4CDHA 5CZXD 1U8JA 1JP5A 3NPZB 3O8XD 3MRMB 2AKRA 1D5ZB 3JT0A 4OZIB 5IW6A 5CGBA 1HXYA 1D7CA 1H8SA 2WTPA 4MDJA 1I53A 5GZNA 1AY1L 4MNHA 2UWEE 5EBLB 1G6RH 3BZ4A 1ZA3A 4OQTL 3SDCB 2V2XA 2ICES 4DKEH 5LGKA 4XBEL 3M45A 1L9MA 5D6CB 3FSWA 3OZKA 2FHCA 3EZ8A 4JL2A 2X4NA 3LQZA 3BQUA 1BFOB 1GL4B 3K0YA 3QG7H 4O9HH 3RUGA 3RVTD 1D5XA 1MJJA 1NCCH 1T1YB 4HPYH 5HJGA 4PBDA 1MFAH 2ITDB 5HI4D 4DP4X 2F74B 4BWWA 1TEYA 5AW9B 2P48B 4N0UA 3H9SA 1S9KC 4Y4FD 1BLIA 4G8GE 1IKFH 4XBMA 5GS2H 1AHMA 2Y7QB 2TRHA 4RX4D 1VAHA 3IN2A 5ILTH 4Q8BA 4GXVH 4YXLH 1TQVA 2Y1VA 5D1XC 3BPOB 5C3LD 3GZOA 4J8QA 3KS0J 3H53A 3TEXA 5KG9A 1G7HB 1KELH 5B1CA 4HBCH 3FFOA 3CVBA 5DQJB 4OGXH 3SDXB 1TTRA 2VDRL 2YUXA 3WNNA 4WNSA 4WFED 1HN1A 1NDGA 2D3JA 5DFWH 2ZYIA 2XKSA 1CBVH 1JWSB 1S7SB 1DANU 3DX3A 2CJTA 3NSJA 4R5TA 3EJSA 4NZTL 2MQGA 4B41A 2B39A 4GMSL 5CBEA 3LYRA 3ZKMC 3FHAA 4MX7B 2NT1A 2YPLB 43C9A 5DJYA 3KLLA 3KPLA 2ALWA 2BFVH 3ETSA 4JM2F 4APQB 5I75B 5GS2D 3RILA 3KBFA 5A3ID 3QQNA 4ILDA 5D1QD 4DGIL 5C0CB 4WU7A 1KPUA 3MUZ1 1KT2B 1IC5H 3VM7A 4ETYA 1KLUB 1MHEA 2WLHA 1KF9B 3PFQA 2ZP9A 4OGXL 4XC3L 4NRYB 5IB1A 4G7YL 2ADFH 4JK0D 4OT1L 3L9BA 1IGFL 1JPST 4XP5H 1U8QB 1OAJA 4JQIL 4MQXC 3RPIA 5TFSH 3ECBB 4Y9BA 1HL9A 1VGEL 3QUMB 3IFLL 4LVEA 3LZPA 5F3HB 1A4JB 3JTSA 3SDDD 3ALWA 5LVEA 3O3AB 3FSVA 3CVCA 3F58H 1DSYA 1QA9A 1MCJA 2GFBA 4YDIH 4ORZC 4UQ3A 3NUKA 1RVFL 4PJAA 4RBPK 4ZMAT 4FQXD 5HYFA 1DVFC 5ID0A 3VG0H 4NT6B 3RX5A 4XVTL 2AXWA 1IQWH 1KZQA 4PGJA 3WEXA 2LT9A 4L3ED 3VXME 2WN2A 2ZYRA 3BPCA 3UTSE 3V0EA 1X5MA 4XBGB 2Z8RA 3CVHB 2C9VA 5DURB 3PPEA 5E6ZA 4R0LC 1A5FL 3ZSTA 5HDLA 4RMTA 5T1KD 4PJEB 1ND0A 5LNEA 2YD7A 5T3ZL 4GW4A 4NUPA 1GW6A 2FLRT 3IAQA 4AQAB 3IXAB 3GTNA 2R4SH 1BIHA 2VQ1B 3HPLA 4FERA 1KXVC 1TO4A 4U1JA 4ZMNA 3W0WA 4UTAH 4H8HA 4YX2L 3W5NA 2AMUA 4WFGD 2OKMA 1WT5C 1OAYL 5IV2B 5JA9A 2FX7H 2BHUA 3Q43A 4OGZA 2HJLB 1N0LB 2Y2YA 2E56A 4UNUA 3RDTB 1MIEL 1MF2H 3GBDA 5BZDB 3T04D 1I85C 2BVOB 1IUZA 1NMBL 2XRAH 3NJXA 1V27A 3HC3H 2G2RA 4IEFB 3VXRA 5KYWB 3UYOD 2LE9A 4MQSB 4Z77B 1N4XL 2JKLA 1QPKA 3R7QA 1O5DT 3US0A 3HI6L 1AD9B 5MP6H 3F00A 4E9XA 1F1GA 3C8DA 2Z0UA 2XXMB 3KVPA 2FVNA 3A4AA 2WTRB 4XCYA 3S35L 2WK2A 2YFOA 2X87A 4L3EB 3JWDL 1ZWIA 3D85D 1ZV5A 4P46A 1E8WA 5JHLA 2AP2A 3GBEA 1HQRA 3HLAA 4IU3A 2NY1C 4PRPB 2XBZA 4XNXH 2EE6A 4RGND 2DQEL 4R5VA 3KNBA 4JY6A 4PB0L 2DWSA 3LZFL 3LKQA 3MFFA 1WUNT 2VW7A 4P5KB 1QFUH 4PTUA 2AS5M 1NCCL 3T4YB 3Q9QA 4C47A 5AW5B 2IDCA 2R23A 3PP3K 4JDTL 4RIRB 5DI8B 2ZOLB 1B4LA 1T83A 2H26A 5DRWA 5EU6E 4TNWF 5DHVH 1JAEA 1JPGB 3FT3B 2I5YH 4JM4H 3ABKB 3BH4A 4FQ2L 3SGEI 5HVHC 1JPTL 3WLBB 2YD6A 3GSOA 1U8CB 4WO4A 5D2NA 4FFWC 3RL1A 2GTQA 1EJOH 5C08E 2NTSP 4AYFA 1S5HB 2WBJA 1I9EA 1O9WA 2I24N 3MUY1 1J5IA 1LDPL 5I0DA 1WZ1H 2NY0D 3L4UA 4KPHL 2B4CH 1GR7A 3QZMA 1QFWH 2J1KA 4PJHA 4RFEB 4KI5D 2IH1A 3I6KB 3TBYB 2V2TB 3L13A 1PGRB 2ARJQ 4MA8H 4AQ1A 4Y2DA 2BSTA 4PJBB 5IW3A 3EHBD 2IAMC 4NQCD 2N59A 2UY7B 4FQJL 4UV4H 1MJ8H 2RFXA 1A4KB 3BISA 1T66D 1WSST 3KM1A 3UBFA 2OMWA 1DANT 4XNZB 4KQ4H 3NIGB 2EDYA 3SHSA 1SM3H 2J1WA 2P5WD 3DMMC 4HYTB 4QJ3B 3RGBA 1HH9B 4J2XA 4F80A 3QPQD 5BJTB 4PJ5B 3U4AA 5FGBA 2K0RA 4WFGE 2OMVB 2XN1A 2OSYA 3AADB 3RVWD 4BFNA 5AD0A 4ES9A 4RMRA 4E9WA 5FCUH 1A47A 2DQTH 2DW5A 2L04A 2X6MA 3FNKA 4Y2DB 4EUPA 2QJDA 4MQXD 2A74B 5DLML 4YL9A 4AX3A 2HKFH 4S0TD 3IKCB 4H20H 4L29A 3ISWA 4QHKJ 3CFIC 2UZYB 5I15H 5DD3H 5I0WA 5EUOE 3AUWB 3B8YA 4XMLL 4XOCA 2ZPKH 5I9QB 4YEFA 1NGYA 2JIXB 2V5SA 4HP5A 1BCIA 2YPLD 1J8HE 3QUHA 5E5UB 4PY7A 4HGKC 1ACXA 3C9NA 4LK4A 3LS4L 2E7CA 3KYKL 4FTVD 1PYWB 3MLWL 4LSRH 4LLDB 3U0WL 5IHBA 4ELMF 1J0IA 2D7QA 3U1PA 3UTSB 1LD9A 4I0KA 1QW8A 1RQ5A 1UGNA 1GGIL 2BRRH 1DUZA 2E7HA 2NZIA 3L17A 4JZJB 4NC0B 1UB5A 1BGXH 2VJ8A 3SCMA 4TL4A 1QKZL 5FW8A 3VXRD 2LFGA 4M00A 3QPXL 4I3SH 4JRYA 4AUJA 4DZ8A 4RDQF 3QNYA 4PRID 4XBPB 2DQGH 5D7IB 3TA4D 1B0GA 3HZYB 1V7MH 5E2VH 4ZQKB 2Y2WA 2Y7MA 5I73C 1UD4A 4G7RB 3DTDA 5AOKA 4ONHA 2BOCB 1IBGL 1ZVHA 3K6NA 5CN3A 1LNUB 3DJ9A 4JNXA 1MH5A 2WQWA 1OY3B 3ZO0A 1YY8B 2EJ1A 2QVFB 3MNZB 5I8KL 5J9PA 4S1SL 2IH1B 1JGEB 3I6KA 4HUWB 2QR0A 3TBYA 1QRNE 4W9JC 1J10A 4M48H 1MNUH 3UBXI 3TPUB 1ETZA 3D5OF 3MV7E 1X9QA 1DZBA 5CIPB 1L5GB 3NFSH 3RI5K 1C16A 5GGUA 5LCVA 5FLVA 1JVLA 2WKLA 2CLZB 2BSBA 5SWSD 4AGNA 1E2WA 3OR7A 1RZ8A 1I75A 1QD0A 5LJYH 2YPKB 2YPVL 1FFNB 5EORL 4EI6A 3ARGA 3U4BH 3L3OA 3NAAL 1EHXA 1ZS2A 3FPXA 1MFAL 4B9GA 4FTVB 4JO4L 1RZKH 1YY8A 4L3EA 4DOHB 4Q0XL 3OJ2C 5LCVH 1U8NB 5T1DL 4UB0L 3WFEL 2C4FU 2WSDA 2XY1A 1K3ZA 5HHQB 4OVUA 1DUYA 3CSGA 4XNDA 1CGYA 4TQHA 4HJGB 4JDVB 5F9JA 1L5GA 2WYHA 4XPBH 2F5BL 1N59B 3UTZB 5IBLC 4XP6H 2YPLE 1Z9SB 1H3XA 4UM9B 5K9QG 2GPZA 1P7BA 1MWAH 2HJLA 2A99A 1U4EA 5EG6C 4F2ME 3H54A 1T83C 5AZEH 3ULVE 3UBXB 3X12A 4E9QA 4QTHA 3ARWA 2FO1A 2ICWJ 3QUXB 4XZUB 3LKPA 3FH5A 4E0RB 4FL4C 2XTJE 4P99A 4XB7A 1F41A 4XMZA 5KOVC 2IWEA 2W88A 5FHBL 4WCYL 1EZUA 4WUUA 1G7MB 2JKNA 1IL1A 3WYRA 1IQWL 3BEWA 2Q2LA 3BSGA 5GGRY 5IG7B 3UJTH 5BV7B 5L2JA 2YO3A 3PWUA 4HETA 1IJ9A 3CFBB 2F58L 4B9JA 1OTUC 2FYYB 4OLZH 3ZK0A 2EO7A 2H1XA 4Z76A 2Z35B 1SBBA 4I1PA 5T1JA 3G04A 3QISA 3B4NA 4FFVD 1W8NA 4A66A 4YMPA 4D94A 1XGTA 4LNVA 4XNMA 1DN0A 1I8LC 4NNXA 1L7IL 4I0PC 5CD3A 4KUCD 5G4OA 2YGNA 3GRWL 4AGMA 3RGVB 3BPLB 3GKZA 4XP4L 2WXPA 3HCVB 1FYTB 1OTTD 4I9XA 2BINA 2WD0A 1SJEB 1MY7A 4Y4HB 2VDNL 5DD5H 4YJZL 4OKDA 1KBGH 4MFHA 2XTLA 3JWNG 3V7MA 5CCKL 1F86A 3UROR 2VXVH 1DBML 4C57C 1X4ZA 3AS1A 3KM2A 5HD8C 4U1NA 4ANKA 1JYNA 1N0XH 2JK5B 4FNPA 2BJMH 1DJIA 2BP0A 3LQAL 3E1F1 5GJSL 1GOGA 1MFCL 3HC0A 5HY9A 1W91A 1XD1A 1A64A 2DWEA 3CC1A 3QXVA 4YXKL 1J0ZA 5T5FL 1P4IL 1ZVNA 3IN0A 3HB3C 1RUMH 4GKSA 3D0VA 3GRWH 4H0HB 3P02A 3JV5A 4GUPA 1CI5A 3V8OA 5D1ZB 5K1NA 2KHAA 3GS4A 4WVRA 4KNSA 1EVTC 3BEVA 5DJDB 3VU1A 3UEQA 3G5ZB 5TF1L 5BPPA 4M62L 1G7IA 3O2VH 3DOSB 1YEIH 5ITBL 5HHME 3FUDA 1L0PA 5IB5A 3T0DA 3KLAA 2NR6D 4YFEA 2J2ZA 1BV8A 3UJIH 3I6SA 2XFXA 3DI3B 1MDAA 3HCVA 2VO8A 5DRNA 3OKLA 3BPNC 3N1PC 4L4TB 3T6QC 1S9VA 1L6XA 5D70L 1RJYB 4LMQE 5LNGA 1Z7JA 4B6ZA 1HQ4B 4ZOAA 4BRVA 5EO0A 1IAOA 3QO0A 4WHTA 4HT1H 1RHHA 4GKZA 4Z3FA 4YC2C 2CAKA 1DCEA 3OM3B 1ERNA 3JVGA 4YDLB 5ICUA 2GI0A 2P5WE 3ZKXC 2OX5B 2WXMA 4XPHH 3QQDB 2B9BA 1YPZB 3O9WD 4PMEA 2DH3A 4R97C 3TIDA 4I4WA 1HEHC 4K7PY 1VZHA 4G8IA 4L4TA 6PAZA 4H0LC 5FDYA 4KV5E 1YEFH 3RWHA 3PQYA 2EH7H 2J1YA 1OKEA 2ZUQB 1TZIB 3APCA 1HYSD 3S8GB 4JM4L 2WXNA 3KPOA 4RGNB 4DVRH 2RQ8A 4GBXC 4E41E 1X44A 3DSFH 4Q7DA 3ILQC 5A2CA 4KTEL 3IMSA 2DKUA 4LSUL 4M4RA 4BCYA 1F1DA 3SYPA 4PWIA 3P9LA 1YNLL 1YNTA 4Q52A 3ZXAC 3NK3A 2RHEA 4DVBB 2EYRA 4IIQA 4WK2B 4FHBD 5TQ0L 5D5ME 1UD5A 1FH5H 3O11B 4WO0A 3H2PA 3C08L 4LBAA 2E0PA 2D4FA 5GGQH 3T1WA 5AVRB 2NY4D 4PLKD 1MHPH 3LEXB 4NP4H 4HEPG 4RAVA 3EOAB 2W81C 1M42A 5JHLL 3P0VL 3KPQA 3FTGA 3QCUL 3ABGA 2H3NB 4TVSa 4WCYH 2UWEA 2OX5A 2Q76A 4CA4A 4PWFA 1RU9L 4FF9A 2F54B 2VLMD 2YAQA 2JSFA 2VGLM 2J43A 4APQD 5CJ5A 1CYGA 3H4FA 3O4LE 3WY4A 3HUJF 6PCYA 3NSXA 3GBNL 4A67A 1CG9B 3G6DL 2ATKA 4GRLC 2C9SA 1R6VA 3RUGE 2YRBA 5SWZD 1U8LA 5ESQB 1XT5A 4KO5A 4YE0A 5KN5B 2H1PL 5BOJA 4MCYB 5KZCD 2FK9A 1M9SA 3WUZA 2OZ4L 4LDLB 2XFXB 5DRNB 4YVNA 3F2LA 1FO0L 2OCCB 2PLTA 5F7EL 1F0LA 2W0LA 1X7QA 1ZS8A 1M57B 3FB8B 2A0LD 2VERA 4ODUB 1C7SA 3HI5L 1CS6A 1BREA 5FEBA 3PU7A 3T08A 3TZVC 1GH7A 5CINL 3R8QA 1HCZA 5KVGL 3L9RA 3FXIC 4PV1C 2G30A 4RA3A 5EC2A 4KX7A 3N44B 1ITCA 1L7TH 3IKKA 4X5QA 4J5VA 3SODB 4RWHA 4LSVH 4JY4B 4XNQA 5HD8D 4WFEE 1X5ZA 1ZHLB 3P4LA 4G1MB 4PGZA 3SJVB 3AU1A 5B3JF 3HG0A 3U0PA 2VDQB 2KL6A 5DZJA 1KLFB 2COVD 2F18A 3BPNB 2ORBL 1KCUH 3OZLA 2BVQA 3L5XL 4PAZA 4A7TA 4X6DE 4ZW5A 4ZFQA 3CFJA 4UCFA 2XZAL 5FWQA 1SXBA 3QEQE 5TFSL 3TVMC 3KMDA 4L8DA 1R3KB 2DQTL 2E7BA 4LASL 3SOBH 1OANA 1YN6A 5GGRA 1QEWB 3QUGA 1VKXA 5EZOL 2IXQA 4NQCE 5I66A 5EZLA 4WWID 1XGYL 3BW9A 4NGHL 3VRLE 3VVVA 3GI9H 1NGQL 1ZV9A 1J7VR 2CJUL 3QFJE 5E4EC 3SPCA 5CJXA 5CLYA 1M7UA 5CKAA 1W72A 4OAWA 3ATBA 3RWFB 5IVXB 3DTUB 4Z7UF 3K6IA 5C0DB 1Q72H 2Q8BH 3RVVC 2QTVA 5B39A 5BNXD 2G3MA 3BQVA 2TRYA 1SOXA 5C8JB 4FNQA 2UWEB 3FB7A 1Q0XL 1IC0A 3SYAA 2VDLL 4GG6B 1PZ5A 2AXHA 5F3BB 1B3IA 5EZOH 2A3TA 3LRKA 3UMNA 5DJCB 3GZQA 5BRZE 5MEQA 4L1LA 2NNFA 1RUAH 4JO3L 3NAAH 2PO6C 2AZUA 2OP4H 5FYLH 2PCXA 1BZ9B 3DGCR 2WCSA 1DQQB 1X9UA 4MCMA 3LH2L 4UT7L 3PAYA 4HIEB 5DLLA 4DUXA 1KGUA 3JYBA 1GS6X 4MMZB 5B1BB 1HOCB 5JOFA 4ENED 5C8JA 4AL8C 2APWA 2XICA 5MEPA 4NDMB 4KX8A 4AOFA 2WZPD 1D2OA 1OT2A 2W65B 4WFFE 4F2EA 1CGXA 3IPBA 4DZ8B 1OAXL 4W1TA 4CILA 3UJTL 3I84A 1QWHA 2CALA 2EE3A 1KXVA 4WGKA 1Q1JH 3MRKA 1AHKA 4XI5C 2EDHA 4KI1A 3QNZA 1OAQL 4R90L 4U4BA 3D69B 2GBAA 3PQYD 4KRPC 1HIMH 3I6GB 5E2WL 5FYKU 2Y5TA 3IJYB 3KCWA 3VXRE 3HKFA 3IGLA 2F7QA 4GYBA 5BRPA 4DGWC 4ODXB 2NX5A 3AB0B 4FTVA 3V0JA 2WNXA 5C0BB 4BE6A 4JDEB 5GS0L 1MIMH 2GSGB 2VR9A 4C59B 3NSYA 3L1GA 1P4LB 4PJFA 5DMIH 5ABDE 5IFJA 3F5WB 4WJ5B 4EN3C 1NFAA 3OKKB 4L48A 3FW6A 5D4QA 1NIDA 4D0CA 2BXZA 4KRLB 5KS9A 1AFVL 3BKYL 3GBNH 1QSFE 1BM7A 1DBAL 3IE4A 4LCIH 2DIBA 5CN1A 2HTLD 4F5CA 4FG6D 2X40A 3OLGA 4WW1A 5CZKA 3NCEB 3V5DB 4FC3E 1HH6B 3LRMA 1PLBA 4Y88A 3LKRB 2P49B 5KVEE 1Z9PA 1V05A 1RZJC 1YQVH 4PG2A 4PJ7A 5F1NB 4MZRA 5SWZB 3FCTB 3TO4D 1KCSH 1XTMA 4JCMA 4ZSOA 3WFDH 3OHXC 3IGUA 4JQIA 3RA7L 1IGCH 3ULVL 4Z7OE 2R2BA 4KITB 5C0RL 4OD2B 1RZJL 5BZXA 1CDCA 2ZX9A 1N9PA 2YXMA 2XG5B 3C60C 1TCMA 1FZOA 4MCYA 2SODB 4U3SB 3ENEA 3CDZA 1S7TA 3OAUL 4OB5L 5FHBH 3FQXA 4YSUA 4K23L 5GXBB 4G7VL 2QKIC 1PY4A 4K71C 1I7ZB 4N3UA 2WKGA 2ZYSA 3D25B 2EDQA 4JFDE 5D93C 2Z35A 1QSFB 4KKNA 5I5MA 5T5FH 4I1NB 4K5OA 4ZK8A 3X2QB 4KI5E 3LH9A 1AQDA 5L2KB 2ZWKA 2OJEB 1QHPA 3FUMA 3RNKB 4PCTA 1PSKH 2XA3A 4GINA 1ZPLA 4ZFZA 1I4FA 3TWCH 5AVSB 3L1OH 3NTCL 3U6XA 1IU1A 1EGJL 4AJ0A 2ARJA 2AJVH 4BK8A 2K7QA 5D2LF 3O81A 1EK3A 3C2AL 5C0EA 1GGBH 1JV2B 3K0WA 4NUJA 2XN2A 4HIQA 2ADFL 1MCPH 1MJUH 2K70A 1X5AA 4HXBH 1F58L 4ZS6C 5ANMB 1OAYH 2VLKD 1NAML 2DRUA 4RMVA 2WYZA 4TQEL 3D0LA 1W6WA 4NAMA 5A7EA 1JWUA 4EBQH 4A2GA 2HFEA 4DQOL 2I9LA 2ZJSL 4J27A 3ZY7A 3A21A 1XMWA 1M6OB 3OZ9H 1S78D 4NO5B 4KVPA 4M5YL 1OM3H 2H2PD 3JTTB 1CIUA 5M7QA 3WHXB 1T20A 3G6JF 4R7NB 1N68A 4I88A 2EDMA 2V2WA 1PZDA 3NCFB 1YEHL 4JFEA 1MQKH 1FFQA 4YDZA 1BM3L 3BJ91 1I8AA 4DK5A 1JK9A 2WOYA 4FHJA 4BKSC 1IEHA 1VADA 2GQHA 3H9YA 3QDJA 5CSZB 1JYXA 1S7RB 4CVZB 1X4XA 1NDMB 3IDNB 3M1BA 5T3XE 3CLEH 3C5ZC 1CICA 1BZQK 1U3YA 1JPFB 2C26A 2AJYH 2J73A 2PYFA 3IGAA 2BERA 3FTWA 3A0OA 1J9SA 4NUJB 5DWUL 1I8IB 2DTMH 1A6VL 3O41A 5AYUH 3IFNL 5E6SB 5IMMA 4QRQB 5ACMA 3CVDA 3S6CA 4WJKB 2YBRA 35C8H 3ERXA 3H7BB 4HCFA 4KKQA 4KKPA 4NNPL 4PJDB 3LSOA 4QR7A 1A0QH 5DA0B 5FO2A 4CNIA 2BDNH 5SWSA 3TT1H 1E50A 2CPUA 3BAIA 4P59L 3VI4B 4YDNA 1U92A 2XBTA 4PP2A 3BHBB 1VERA 1YEDA 2Q5BA 4NUQA 3H42L 2EIMB 3CMOL 4RZKA 5GQBA 4TNVK 1KTBA 4NKQB 1TO5A 3QI9B 1IC7H 4Y19E 4E9RA 4PJHF 1B4JL 4XNUH 3HNTL 4C56B 5LKNA 4ZO9A 4MMXC 4S0HA 2NNAB 4OI7A 4GW5A 3W9DB 1RULH 4D9RD 4ONOA 4YAQA 2KI6A 1S9WB 2N0MA 3GC3A 2VDLB 2NUTB 3ZYOA 2QSTA 5JHDE 1ADWA 1PTZA 3BIAX 3O6FC 3QDJB 5CCKH 3KW8A 6FABL 3L3IA 5LAPA 3QG6B 2JLPA 5IWLA 1H5BC 1TEGA 4IRZA 1YHPA 1X5IA 2F7OA 2OMVA 4M1DL 4G5ZL 3C60D 2ZD0A 4AKQA 3V4VB 1AKJB 3D12B 4NO0B 4WW2B 3SDDA 5KYXA 1QRKA 3ULUC 5B4MD 1PDKA 1D5IL 2Y2TA 2FSEA 1P2CB 2G75A 2R69A 3O6FB 2AF2A 3RKDC 3LD8C 3RLSA 1FFOA 2ZOWA 4N9GB 3P11H 3ZHNA 5EIIG 1E2VA 3BD4A 2GYSA 1G0DA 4JR9L 4HMCA 3CFCH 3GS7A 4DPBX 2GW5A 4HUMB 1K72A 2I26N 3ARFA 1OSPH 2JELH 4GKOA 5T8IA 4LEXL 1J5OH 3BGFC 1BJ8A 1I9RH 3O2VL 3PIQB 2YPLA 5AKRA 1KYAA 2X4SA 3V4PB 43C9B 3MKKA 2HYMA 3CHOA 3BQUD 3EJYC 2BY1A 3TYFA 1H5BA 1S3KL 4QOKE 2VXQL 3UYRH 2G5BA 2WNWA 1BXAA 1GZPB 5EOQL 2QPUA 4ACTA 5BUPA 1W72L 1XGQA 5L88H 4HULB 2VKXA 4OD3H 3VD9A 4OKVA 2VXSH 1NBVL 4YDJA 4GQ9H 2UY6B 2GSIB 3NT0A 5F89A 4FGMA 1ZT1A 3DX2A 2X3BA 4RDQG 1WGOA 2AQ1A 2GCYA 2K4AA 4TKWA 1AHWA 1CFBA 1E2ZA 1EEZA 3UTPE 1EPFA 2O5ZH 4Q6KA 2F19L 3CQQA 5I6NA 1PD6A 1QFWM 4GKNA 1PJ9A 2V33A 1R4XA 4TUOB 4UIKL 4DGYL 2BHYA 4ZZKA 2LU4A 2M26A 5IMMB 1EZVX 3QB7C 4BK4A 1WIUA 2DEXX 2K7PA 4XCNB 1BD2E 1J9TA 2IPUG 2R23B 4RIRA 4YO0B 1O7SA 4IOFD 3CXDH 3VFOA 3GXPA 5FWRA 2YLKA 5C0FB 4JFYB 2B7DT 3IDMB 4ZX3A 1IL1B 1MY5A 4M03A 5A2JH 3HN3A 4M6OH 1PX3A 3EH2A 4LVOB 1AVAA 1M3IA 4NQEE 1A2YA 1E65A 1BVOA 3OTTA 4WHYH 1YJDC 3LPPA 1FUNA 3U4BL 1NICA 3B34A 4YSOA 2HFFA 1DLFH 3O4LD 2FL5B 4Z9KB 4NWUL 2WYTA 4WU7B 4H88L 4XX5A 2AQSA 3DHJA 1ZHBA 4W81A 4KKRA 3DTXA 5BZWA 1R24A 5AOIA 1WCQA 4MWFB 5ALBH 3RVXD 1NPNA 2F58H 1AS7A 5KS9F 1KCSL 1UWEH 4XNBA 3VW3H 3BAJA 3OF6A 1A6AA 1P7QD 4G8FB 3ZTDC 2D7NA 2E7LA 2VDRB 4JO8A 1FH5L 1GCYA 1OK8A 2VR4A 1WG3A 4QRSB 2QGBA 2NR6A 1KJ3H 3K80A 1FF5A 1OTUD 4JG1H 2VDML 4Y2OA 4YHIA 1WZLA 1ACYL 4OGAD 4X6FB 4F7CA 3SE8L 3HTLX 4ODHH 4XXWC 1K2DA 4HSQA 5J13B 5E08L 2MCPH 1A7RL 4NZDA 4B9FA 5JTWA 3U6RA 3SYOA 5EO0B 2C1PA 2VABA 2HSIA 3MJ8B 1H9VA 4XHJD 5T33L 5C07A 2OV0A 1K85A 2WHVA 1YC8A 4DHLA 3QQ3B 1AR1D 4A6YB 3ZYZA 3F64A 3CMGA 4EEEA 2PP9A 5AVXB 1O6SB 3BVXA 4CADA 3K71A 2GTZA 1WBZA 5EDXA 2EDDA 1T89A 2NSMA 4A39A 1MLCA 2YA1A 4ODWB 1UM5L 2VAAB 2WINB 4X6FA 1NGXB 1N19A 3APNA 3DHMA 5DZ9A 5EU5A 4Y7MA 3VRJB 5T5NF 2HFFB 3K2UL 5F1IB 1ED3A 3HG1B 4LSQL 2XIBA 1OEZW 1XR8A 3TO4B 2HMIC 5GRZA 4YFLF 2VISB 4ZZFA 2WSPA 3COOA 1MLBA 1KZYA 4M4RB 3HC0B 5HY9B 3M1OA 4GRLA 1ES0A 3AREA 3DA0A 1S4IA 1G6RB 5JW4R 4CC4A 3KS0H 2P8MA 4MGXA 3CFTA 3O3BA 3O6KL 1CFVL 3IK2A 1XGPB 2Z91A 3BOVA 4Q74A 1DDTA 1WEJL 4K3JL 1KJ2L 1L0YA 3OL2A 2FJGB 4N2CA 4ZSOB 1P5VB 2BNRA 1FGVL 4FFTA 4Z3IA 5D9SB 5DTFA 1JZ2A 2E9IA 1HK6A 1AO7A 4KH2A 2E9JA 1T3FB 3LRSB 4X7DC 3RKPA 1M1XA 1BQ5A 3GXUB 1OAQH 5A3IC 3I02A 3SCMB 3IETA 3QG7L 2P8LB 4KY1H 1MQKL 2BK8A 2XJKA 4O9HL 5I82A 1QQDA 4R3SA 4HUUA 2WO3B 1NMBH 3VFTA 3RZCA 4KJWD 1C5CH 1JCVA 3D3VD 4P2RD 1F2XK 3VFVB 2F1AA 2IDQA 4CGUB 3CCHA 4MXVE 3BJLA 3WNJA 4PRNB 4HHGA 3QBTB 4YHNA 3E3QC 3MR9A 3LKOA 4RFNC 1Z32X 1I4FB 3U4EB 1U33A 1SVBA 1RMFH 5DFVD 1NAKH 4P3WA 1NUDA 1KBGL 2YGOA 3ZIYA 4CVXB 3GEFA 4PJEE 1LLAA 4YPGB 4GQ9L 1NUNB 3CFQA 3FU0A 1U3NA 2X4SB 4XODA 4Q9BA 4IIQB 3OGCA 4FXKA 3CUPA 4ACPA 4OFQA 1N5YL 3X1BA 4U1GB 5D5MF 3G5VB 3QW9A 3BWAB 4EI5A 2DI8A 3Q48A 3SCMC 5TDNB 4M7KL 2JJUA 1M71A 3X1NA 2CR3A 4MXQD 3RZCC 2ZONA 3L3GA 5E6YA 2R0ZL 1XCWA 2IPTL 4R7VA 2Q86B 3NSCA 1IZKA 1I7RA 1DN2A 4P5TD 2G60H 2PPCA 3FCTA 5LGHL 1NSNH 5TF1H 3CLEL 1G7JA 2GK2A 4AMWA 2FT6A 3DXAB 1L9QA 4XCEB 3S8FB 5IFHL 4BKTC 3DRQB 4MJIB 4H8UA 1KSRA 4NM4H 3TWYA 1HL5A 2QLYA 3OKDB 1NGWA 3JSSA 5EEUA 4XVJH 4P3CL 3V9EA 3BKJL 1CGUA 2CPCA 1ZHNB 2B5IC 4K3EL 1H8OA 1YPZA 1EHKB 4ZXBA 1E5ZA 1Q9LA 4F20A 3RVWC 4QYOB 3KPMB 2GIXA 4AQEA 5JORB 3MX0A 1NEUA 3BP5A 3P3SA 5CFAA 1RLBA 1Z9LA 2AZAA 2VW6A 5DC2A 5D4JA 4HG4J 1CGSH 3THMH 4ZNCD 4JKWA 3CSPA 1IB5A 5DS8B 1RK7A 3ZDXE 3DC0A 3KL0A 1E5AA 2J8HA 4PJDA 1RZIB 5E8PB 4QPEA 25C8H 5DC4B 1K3IA 1KOAA 2AK4A 5ESVA 5HXMA 3TONA 5MEQB 3CFEB 5DFTA 2W0FA 1AD0B 3MBEA 1ZIAA 2FECL 3WY3A 2VLRA 5CMAA 1BG9A 3NABL 1BJ1H 1U93B 2HCZX 3GIZL 1X9RA 4JAMB 4JFXA 2F19H 4JY5L 4UZUA 4EVNA 3S37H 1ZJAA 1VADB 2W9EL 3MI6A 1J05B 3EG9A 5CSZA 2ZKHL 3APFA 5GISH 4XX1E 4Z8FL 4XN2A 1EMTL 4P4KC 4Q58C 3KYOB 5E2WH 4G9DA 1MG3C 3ECVA 1HSBB 1IGFH 5TDOA 2XNAB 3JTTA 5H8DA 5ESVB 4E2OA 5KZCB 2RH0A 4DK6A 4LVOC 5FUCE 3ULUH 3UDWC 5I76B 4PBWD 3U7YH 4N1EA 5JQHC 4LAQH 2CXGA 3MRRA 1A7PL 3EJTA 4LL1A 2Q7NA 3II1A 3EDDA 1AQDB 5L2KA 4X4ZA 4GH7B 4APXB 3JWDH 4PWJA 3SE9H 1F2QA 1NBQA 3S37L 1WFNA 4P4KD 3RBGA 2ZCKL 4N8CL 4X8XA 5KVFE 1T1WA 2YSTA 4FQQA 5I0XA 4HWBL 3F01A 3AWEA 4QNPF 3NJIA 2J5WA 4WEBL 2ARWA 1T0NA 2HRHA 4QOKB 2DF3A 3ULUD 1PZAA 4WEUD 4MMXB 1TVBB 1Y7VA 2ATPB 4G6KH 3KWUA 4E68A 4N0CC 1IILE 4CBPA 4EZMA 1OP5K 1Q0XH 4P4KB 1MCIA 4U2YA 2FD6L 4OJEH 4OVVA 4XTRD 2ATAA 3L9RB 1PW3A 4M43L 4DQAA 1QSEB 3NEOA 3TT3L 4APXA 4FEMA 3O2DL 3U36B 4PS4H 5DHXB 3AY2A 3PF2A 4QRRB 4WI7A 4N8CH 2FBJL 1KLFA 2XPYA 3V0FA 1SXCA 5EU7C 2ZKXA 1YN7A 5IBUB 4HH9B 1AQMA 3CDFA 1JF5A 4JFOB 2IH9A 4MVBC 5IW1B 3TO4A 1J1XL 3QZOA 4ZTEA 1BHGA 4GBXB 4GIAA 4IRZL 4L9LC 3RWIB 2IQ9H 1D6VH 1MHHB 3C75A 2Q3ZA 1NCDL 2X1QA 1UWFA 2O61B 1SF3A 2PYEA 3B5TA 4PJHB 3K1DA 4RFEA 1A0QL 4TQIA 4F5CE 3L5XH 2XOTA 4OCMC 5IHHA 4O02L 4GXVL 3WDHA 3D4GA 3EOTL 4MMYA 3LJ3A 4XI5D 2V9QA 1PJWA 3UH8A 1MCCA 5C0RH 4JDZB 1CGTA 2BSSA 5F9JB 4KVNH 3QI9C 3TH4T 4LMQI 4PJ7E 3F6JA 4LARL 3VFGH 1FGNL 3HAEG 4MQTB 4WUUD 1MRDH 4XP6L 4IKJA 1F6AB 1EDYA 1U58B 3V0AC 4KMTH 5CUSH 4JVWA 5E8EA 4WI9A 3FCBA 1HSBA 2GJ6D 1F58H 4AVKA 5BS0A 1NCDH 4FQHB 3RFZC 2FH8A 2MNUA 4NQDB 5C9JA 4NKDA 3T9WA 4MJ6A 2VERN 4PJFB 1HHJA 1CGWA 4RMSA 1S7XB 1JUFB 3EYVB 2DS4A 2IANA 3SD5A 3OZ9L 4JFDA 3FT9A 4EN2A 3BGAA 3O8XB 5TTRA 3EO0A 4LSTL 2A0LC 2AJSL 3V4LA 4YLCA 1JPEA 4NQVA 1L9SA 3DWTA 1TMCB 2HFTA 4R7DA 3PDGA 3HNTH 1OAKL 1LQBC 2EC9T 1IQDA 2RJMA 3CVHH 3OAYH 4RFNB 5B1JC 2OMXA 2EEFA 4FKEA 4DUWA 1IGTB 3QIUB 1WZKA 4QRTA 2APBA 1IEBA 1SZNA 5E5MA 2J72A 1ECYA 2WY3B 1VZIA 1RZ7H 4PJCA 1RJLA 5EZJA 4UB0H 1YEWA 2ZXCA 3KPSE 2BY2A 2K6ZA 2G5RA 2YOCA 3KZ8A 1LQSR 4OLVL 2ZOTA 4OJFL 1WPCA 4AVIA 1URIA 5I1IH 3EO0B 3E38A 3VG0L 1WQVT 3UTZA 3ZDZE 5I1GL 2DWDB 5F7KC 1OM3L 2AK1H 4I2XB 3GMNA 1WVZA 1KG0B 4OCRH 2BWIA 2VR6A 2AK4B 3UYPA 4F7EB 5D2LE 2AV1B 3KWTA 1XL4A 1P1VA 1SXNA 2XWBB 3AY4C 1WAAA 4MJ6B 4RGNE 2VB5A 5IWLC 3CDGA 2XY2A 4Z5RA 1ZK9A 2FX8L 2AQPA 2GC4C 3S0PA 1TETL 4LVNB 4RVBA 3WIFB 3EYQC 4P9HC 3WEXB 1A7NL 2P44B 4AG4L 4N8PA 4JFEE 2VM9A 3IWVA 1Z0MA 4ZMWA 5ADPH 5IROC 2AFNA 2G2PA 3MX0B 4JS7A 1RZJH 3QDJE 4WU5B 5DO2D 2BP8A 2JJVA 1AR1B 1RMFL 4ANUA 2QKSA 1FFPB 5E00A 3MUUA 4X7EC 3KPRE 2DQDL 2R69L 5DK2B 4ZUWB 3RIFF 2BW4A 4HUCA 2VZ3A 3GKWL 4G42A 5FM5M 1B4TA 1V3JA 2O30A 3DDGA 4R26L 1E90A 3ZHLA 4BZ1A 2CDEB 3CZSA 3MV7B 1L3WA 3AXHA 4ETQB 4ENZA 1IMHC 1UCTA 5K69A 2G9KA 3TX4A 2A73B 2PTTA 1SOSA 2BZ7A 4NN5C 2WXRA 2Y36H 1WS7A 4JKNA 3B2MA 3BX7C 4FQIL 2XZQH 1IGJA 4UUJA 1FQ9C 4WTQA 1FG9C 3QNYB 4XBPA 5DJXB 4NPJA 1DBJL 3VXRB 1C08B 4F9PA 4XVSH 2GSMB 4QRPD 5LGHH 3INUH 4EE2A 3G6AB 2HH0H 5DHVA 4YNYB 1FORL 3D08A 4HD5A 3FQ1A 5GS0H 1JD7A 4RGOH 1ES0B 3AREB 4I13B 3P3TA 3F7LA 3IDIB 2AEQH 1MDTA 2BNRD 1INEL 2YGVA 3AU0A 3HS9A 3KYAA 3MGAA 4FFZA 1FV1B 3WIIH 1BPLB 3G3LA 1GMEA 4P3CH 4V11A 4P2QE 4ZUUB 5KANG 4BM7A 4ONGH 3V10A 1JS4A 3T8MA 4OM1H 1ZS8B 4LCYA 5KVGH 4GW4B 4QO1B 3QI9A 4A7QA 1PPIA 1T80A 5D9SA 3US9A 4PRHA 1KNOA 2OR8A 2Z31C 1ZLSH 4Y5XC 3ZHKA 1AGEA 3MRQB 4F7KA 3OKDA 4Z7WE 5LQBH 3U48A 2ZOLA 2BSRB 1K4DB 5L9DL 4WV1C 2F61A 2QPSA 5I1DA 4LHUA 2DEWX 4PJGE 3MROA 5F1OB 1L9RA 3NYKA 3Q3GB 1FVDA 5FO8A 4KK5D 1MJJB 1R3IH 2E27L 4XMPH 3ZT6A 1HI6A 1JG9A 1FO0A 1FA4A 5ACLA 2CLVB 3BVUA 5JOPE 1Y18B 2DY2A 3IJ8A 1UA6L 5CXPA 4FEIA 1XGYH 4KHXH 3VJ6A 2EE0A 2J6EH 2NY1D 4OD2A 2AEPH 5T3ZD 4G6KL 1G43A 4GB9A 2AERT 1CQKA 1YECH 4WV1B 4P5RA 2P42B 2AI0H 3HJ0A 1COBA 4X9IA 4AI7A 2APFA 4ZFOB 3A6BL 3VQLA 3K2IA 4F27A 4KGJA 2P8MB 2RAMA 2GJRA 3TIDB 1U8NA 1MCRA 1J9CT 2F68X 4HS3A 4N2OA 3TF7C 4JKMA 4HKJA 1ROCA 4AL8L 2H7WA 3O6FD 4CU6A 3T3PE 4OZIF 4XRCA 4NBYB 4I0PB 3X3GL 4JFXB 1T22B 4L37A 4UM8B 5C71A 5EIIA 3VJ6B 3CV5A 5G5DB 4B3EA 1Z3RA 3T0EC 5CBEB 2GBVA 4HKBA 4Y9EA 1I3GH 1I7UB 1JPSH 3DGGB 3OLDA 5D6DA 2PO6B 3ZE0F 1WAAF 1H3TA 2NX5D 1R33A 2Y4SA 5D5MB 3VXOA 2YPVA 1OQOA 1LO3H 1GSKA 3MU3A 1WWCA 4P5SA 1E6JH 2NLJB 2EDOA 3ZE1F 2YD4A 4PRIE 1LO2L 4ZNEE 4C56D 1YNKH 3NQIA 5CLWA 1BP3B 4UQDA 5HYSG 4KY2A 2PR4H 5F8QC 1AACA 4ALAL 4OY9A 2DBJA 3QEQD 5EEYA 1IM3A 3F7PC 2IBZX 2XT1B 1NUFA 4JHAL 3BUDA 3SSGA 5HVGB 5J1SC 1D7FA 1GGIH 4KK8C 4GQRA 4OCYL 3LX9A 1UWGH 1FL3B 1AZUA 4I77H 2VQTA 4FLQA 3AFLA 1OOWA 4XN1A 3QORD 4J1UB 1OZTG 3KL3A 4QRPA 2AVGA 1NOLA 2BY0A 3N50A 1XQ4A 1DQML 1KELL 1KYDA 2X7LA 2XXCB 3P9MA 3FBQA 4HOXA 3DTXB 5BZWB 2ZUTA 4Y9CA 2BP0B 4HWEL 4QEGA 1JTTA 5D6DC 1M71B 3PRZA 3FO0L 5TK2A 2GIYA 4PWHA 2EUVA 4PJ5A 5F3HA 2OMXB 2H1PH 1MVFA 3WAJA 1IFRA 4ZW7A 3ILPB 4Z7AA 3OX8A 1BF8A 1AD0A 2NPLX 3MBEB 1Q9WB 2HAZA 2XDHA 4Q89A 4LCVA 3RWHB 3ZT5A 3VSQA 1GAFH 2DJ4A 4RZCB 4GY4A 4W9IC 2DM4A 4OZFH 5CJQH 4G42B 2XWTA 1U4FA 1JGLH 1PY9A 4V1DB 5CKGA 4JFSA 2VXTH 2NUPA 2P24A 1ACYH 2HP4A 1NCOA 1ETB1 1WBYB 4IJ3C 4DKFL 2X0VA 4XMWA 3Q0HA 4FQQB 3VE0A 4JKPH 4HMEA 3FQNB 5HGAA 1JZ3A 5H4YA 1IGCL 2CK2A 3AS2A 1MOEA 5INCA 1BQKA 3ZSSA 2B15A 1O9ZA 3VI3E 3SZ6A 4AVJA 3CIAA 2WB7A 3EJQA 3ZL4H 5L0QB 3LMJL 4HGMA 4RGMB 3VGHA 1O7VA 4EBQL 3TO2B 2WLLA 4UYQA 2YWYA 2YAPA 4M6NH 4FI6A 3DSNA 2XN9B 4GP4B 4ICXA 3BIKA 4FYSA 2FD6H 5IROD 1TJIL 3QCVL 4TSCL 1Q1PA 4PYGA 4AQZA 3ATFA 1CK0H 3OAYK 1D5XB 1TIUA 4KJQD 4H7VA 2V2TA 5TK4A 1WBXA 4ZAKD 1IVLA 3ELAT 3IU3A 4HEPA 1BX2B 1SHMA 5IW1A 3WEAA 2SEBB 3GSNA 3NCCB 5TJWK 3SIKA 4PS7A 1LP9E 1KFAL 3HS0C 1J5OL 2VC2L 3WJJC 3T8XA 2QQLH 4JZOB 3UTTE 1KPVA 3BZFB 3T0AA 5C0CD 3B1TA 4YHLH 4XB8A 1FVEA 3TH2T 3I3EA 5I1DB 3FB8A 4YZWA 3FQTB 4FKKA 1YG9A 4I5BB 1UJ3B 3ARRA 5L88L 4QTHB 3AWGA