4YLQT

Crystal structure of a fviia-trypsin chimera (ft) in complex with soluble tissue factor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
210
structure length
210
Chain Sequence
SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Coagulation factor VII
publication title Molecular Basis of Enhanced Activity in Factor VIIa-Trypsin Variants Conveys Insights into Tissue Factor-mediated Allosteric Regulation of Factor VIIa Activity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Hydrolase
total genus 47
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ylqT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ylqT02
1NCUA 3QHZL 5J0BA 3INUL 1KPVB 3GI9L 1IGMH 2OI9C 4OD1H 3GSUA 1C7SA 2Z35A 4Q2ZB 1Q0XH 2DWEB 3UAJC 3QDMB 3MV7D 5GRZA 3T8XB 5T3ZD 2YD5A 1JNNH 2JB5H 3M1BB 2AVGA 2FZ3A 4KMTL 1TMCB 3B2VH 4GMTH 5F1SA 4H5SA 5T3XL 3S34L 4EJ1C 1FSKB 3D18B 1A5FL 1SM3H 3ILQC 3GNML 4X7CC 5SWZB 5MEOA 1JIBA 1LDPH 4DCQA 3RAJH 1AXTH 4LLMB 4XNZC 5FHBL 4PV8A 2X09A 3FFCA 1AO7D 3ZZ1A 1TJGH 3ARZA 4FZEL 4ENEC 2OJZH 4KPHH 4WTZG 1JFQH 3X12B 2MCG1 4UTAH 4PYGA 1CL7I 1MCCA 2W9DH 4ZSOE 1B4RA 5GGQL 2X4QA 3DJ9A 4RA0C 4XH2B 4CMMA 4OKDA 5D96C 3BZEA 1IC4L 1UG9A 2W0KA 4ZUUA 5ERWA 1RZJC 1D6EA 1U3HB 2AV1A 3C6SB 3NTCL 4UQ2A 2AJSH 4HXAL 1QFWH 2NY3D 2ADIB 4KHTH 4LCCC 2P24B 3LKPB 4U1KA 2VXUL 1Z2KA 4QRSA 5KTEH 2AK1L 5D6CB 1ADQA 3CU7A 2WZPD 1UXWB 5LG1A 2HKFH 3FMGH 3VFRA 3EOTL 4MA3A 1S7WA 1LE9A 3RTQD 2IADA 3RHWK 4X6EB 4WHTB 1BOGA 1CK0H 4G9FE 4O9HH 4M8VA 4R2GB 2M1KA 2XWJA 3IDXH 4OFPA 1QSFE 3S88L 1FVDA 1HHJA 1SY6L 3ROOA 3D85A 1OT1A 2Q76B 3AB0C 4UZGA 2OQJB 1N4XL 4C54A 1WQVT 3WXWH 5K93A 2DD8L 4S2SA 1IGTB 1YNTA 3QDMD 5CHNA 4J3XA 1I1FB 4J4PC 3QUYB 4UDTA 4DGVH 4OLXH 3QG7L 1EK3A 2AXGB 5D2LF 3QUZD 4N90E 4OCSH 1GSMA 5LJYH 4X5XB 3P0YL 32C2B 2BC4A 4KKLC 1NUDA 5HDBE 4XI5C 2FD6H 4OFYD 3LD8B 3P9WB 5SWZD 2BNUA 5DJ0A 4Z7UB 5IGXL 3HUJA 4OGXH 1OAQL 2F54E 2F53B 5EZLA 1BJ1J 1MH5B 4L29B 3IDGB 2OTWA 2YKLH 1Q9OA 5HJ3B 5D7SH 5LGHL 4GKSB 4K3JL 4Y16B 1F42A 1JZ2A 1P7QA 1EMTL 5ISZA 3T04D 2ADJA 1U3HD 1J7VR 1CD1B 2X6MA 1A0QH 1NEZG 1CE6B 4GMSH 4MCYA 4HQQH 4EDWL 1KFAL 2FHFA 3DIFB 1WWCA 5DUML 2DWDB 1A2YB 2HT4C 4ORGB 3U0PB 4GRWB 3STLA 1KPUB 2D03L 1UM4L 4I4WA 1FNSH 1IT9L 3LZFL 1F4YL 1KELL 4G7VL 3JV0A 1AE6L 3O6FC 4PJIB 1RIHH 2ZUQC 4R7DB 3MLWH 4PS4H 5FA4A 1T6WA 3NABH 5D5MA 3V4PL 3BIBX 4H8WH 3O6FA 4JFZH 3KPMB 5DC0A 3VE0B 2UYLB 4PREA 1P5UA 1Z3GL 1A3QA 3QUYD 1RUQL 2F74A 5IF0A 1M7DA 2R69L 5ACZB 4JG1H 4F58H 4U05A 4YDIH 1SYSB 1U41A 4FQCL 4RFNB 4DUXA 1QFWM 5F6HJ 4PFEA 5CJOL 1KG0A 2O5YL 2HRPH 3F65A 2AJ3A 3MV7A 1NCNA 1NMAL 2X70B 5E2VL 3B2UC 1VACA 5AZ2H 3T3PF 3W0WE 2GSGA 5KVMC 2UZYB 5IB1B 1XGPB 5E2JA 2FWOB 1PG7H 3OR6A 4YE4L 1ZEAL 1SMAA 5D2NA 5HYJE 3HNVH 2IANE 3GM0A 2QQQA 1A6WH 5D2LA 4NM4L 1OGAE 1U8NA 2OCFD 4Y16D 5TQ2L 1J1OH 2A6IA 5IHUL 2MSPA 1CBVL 1MWAA 4MA8L 1NDGA 4PTUB 1JGUL 1UCBL 2VLLA 3RIFK 4RIRB 1KT2B 3GRWA 3PJSB 1UWEL 5E24E 4UINH 5F7DB 4BFIA 5E8DL 1V3MA 1K8IB 2XFXA 1E28A 2WUCH 2X4SB 4G8FB 5GRWA 4NZUL 3V5KB 3GZKA 3V6FB 2OMNA 3RTQC 1T83C 1NLDH 5ADOH 4ONFL 1JF1B 2NY2B 1XR8A 2ZUWA 2X1XR 4XNMB 3WFEH 4LLYA 3QQNA 1MQKH 4EI5C 4JREB 1NBYA 2OJEB 4TPRH 1N0LA 1T89C 1WSST 3RTQA 1T83A 2L7JA 4FQLL 3RNQA 5HY9B 2JJSC 4HKZA 3KG5A 3MLPA 5EO0B 2R1WB 4XPAL 5BJTB 3CSBA 4EI5A 4F7EA 5DMYA 4KKNA 5E7FA 3O6KL 1KPVA 4L4TB 4HLZG 1A6AB 1JPGB 3VFOB 4KKAD 3VU2A 5E99L 3QDMA 3QDGE 3PF2A 4D8PB 3NZHH 2RCSH 3C8DA 3IXTB 1KB9J 3M1BA 5I16B 1RHHB 3GSRB 1DBML 5C0AB 5GZOD 1JGVH 5D9SB 4ZXBB 3MXWH 3D18A 3JSSA 5HGBB 5JHDE 3WDJA 3REVB 2V5RA 3UTZB 4OFYA 3B8YA 5SWZA 2VLKB 4U1JB 4LLMA 3FT2B 4U6TA 5ICZA 1U3HC 2H6PB 4HFUH 2XOTA 4M5ZH 3X12A 4NKIL 2IG2L 2NYYC 1G7MB 1FIGH 4XH2A 1GGUA 2DI7A 5TE6L 1CFBA 1VSCA 1U3HA 2ADFL 1RIUL 2C26A 3C6SA 4X9HA 1OM3H 3EDKA 3LVEA 4NO2A 4D0BB 3DROB 2ADIA 3V4VL 2P24A 3LKPA 5DMKA 1ZK9A 5IWLA 4RX4D 2DL2A 3KLDA 5ESAB 3EO1B 1Z5LB 2CK2A 2NY2D 4X7SH 3LKSB 5E5MB 5D6CA 3QA3B 4R2GC 3LH2H 1UXWA 4NQDE 1K8DB 3D0VB 3DUUB 4X4XB 1IGCL 2YD4A 2ZUSA 2GIYA 5LQBL 3GO1H 5C6PB 5DR5H 4GRLC 3WLWC 3P77B 2DQDH 4JFDB 1YMME 3QUYC 1KCRH 1N8ZB 3KPOA 5E6IC 5GS1B 2OQJA 3OPZH 4L4TD 4HK0B 5IFAL 1V7ML 1BGXH 1IM3B 1BJMA 1IGTA 4YFLF 5IVXE 3RWFA 1I1FA 2DJUA 3QUYA 5IW3A 3KXFE 3WD5L 2AXGA 3I6KB 3MRCB 4LAQL 1NGQH 4X5XA 2W9EH 4YHZH 5C0AD 4ZXBD 32C2A 2YZ1A 2FECI 1AIFB 5A2JH 1A14H 2AS5M 2VLKD 2FEEI 4OZGF 3NH7L 3QUMB 4P2QE 4Z7UA 1K2DB 3KPTA 3KLSA 1W72B 2FJFB 4HS8L 5FUZH 3PWNB 2F53A 4JO3L 1EAPB 1MH5A 4L29A 3IDGA 3STZB 3SGEH 3UJTH 1GVIA 5TDNB 4AEIH 5BQ7B 4GKSA 4Y16A 3QUXB 3G6DL 4KUCD 2DICA 2Q86B 1MREH 1CD1A 4L4VB 1CE6A 3U83A 2NMSA 3MLXL 2YD6A 3DIFA 4KZDH 2IBZX 5D7IF 3BKJL 1HDMB 2DWDA 1A2YA 4WI7A 4G6AC 1XF5B 4ORGA 3U0PA 1L0QA 1P4IH 1FZMB 2YEZB 4OTXH 1KPUA 3MACH 3MRLB 4NRZB 3HI6L 5E03A 1A7PH 3ULUD 4HC1H 3HPLB 3X3GL 2A0LD 4ELKB 5IM7B 3CVHL 5JIIA 1GRWA 1FAIL 4PJIA 5DFVC 4R7DA 1U95B 5C0FB 4L1DA 4JFDD 3TF7C 4MAUH 3MODH 3WO4C 3JXAA 2WMPA 5KVDL 2VXSL 3SJVB 3WNLA 1ZLUK 2R0WL 5A1AA 3C9NB 3KPMA 4RFNC 5L9DL 1P1ZB 3VE0A 2UYLA 3K2UL 4LHQB 4WI8A 3N50A 4PG9B 4RAVB 4GG6E 3H3BC 1WFNA 3W5NA 5D7LE 4ODHH 3UPAA 5ACZA 3DXAE 1IAIL 1JMZA 1MJ8H 1SYSA 1QSVA 8CGTA 1CS6A 3U30C 3GSNL 3FQNB 5GZOC 4KGJA 2X70A 4M5YL 1CI5A 2R2HB 5IB1A 3QWOB 4A2LA 1XGPA 2BXYA 2FWOA 3ALXA 5E2UH 4KJWD 2YRZA 1N64H 3QNXB 4OCLC 4TYUA 2Y36H 1QUNA 4OM0L 5EU4B 2AAVA 3QUXD 1N6VA 4L9LB 4WI4A 5ILTH 3PQYB 5DEGB 5IUSA 3AU1B 3RVTC 4PTUA 3SOBL 4L4VD 2EDYA 4RIRA 1WBYB 4CN6A 4UIMB 1BVZA 2DQEH 1KT2A 4N0YL 4U4BA 4AT6B 4WHYH 3PJSA 4GS7B 3BP4B 5F7DA 2DQTL 5F3BB 4LEXH 4AIXA 1LP9B 5CUSH 5DJ6B 1K8IA 1A6PA 2EXYD 2NY2C 3V9FA 2X4SA 4G8FA 1J18A 4MNGE 5KW9H 4UQ3B 1CDJA 3V5KA 4OLVL 5GPRA 5GGSY 3EYVB 4JREC 3V6FA 5EU7C 3ULVL 4WI3A 1X5IA 3VG9B 2BRQA 1JF1A 1YEHL 4R90H 1CFVH 1R3IH 4XNMA 2BNQE 3KYMB 3SJVD 3L7EB 2AQ2A 2OJEA 3GBNH 1NL0L 4U6HB 5HY9A 4RSVA 1S7TA 3DX7B 2VXVL 4FQIL 1EFXA 1LWRA 3NIFF 3MREB 5IEKB 4P4RA 4WJ5B 2VDKH 3C87A 2R1WA 5BJTA 3FO0H 3H7LA 3SDAC 2CDEB 4L4TA 1A6AA 1JPGA 1IL1B 1VEMA 1X5FA 3QEGH 2WV3A 2G2RB 4D8PA 2B20A 4ESKA 3MOAL 2ESVE 1KN2H 3IXTA 5I16A 2BVQB 3VMPA 4L9DA 4LQ1A 2VDML 1RHHA 3GSRA 5I8OH 5IESL 5C0AA 5D9SA 4P46B 4ZXBA 4OCRL 4ZUTA 5HGBA 2PCPB 3REVA 3UTZA 4JM2B 2VLKA 4U1JA 4MZ2A 3FT2A 4IOFD 3EBAA 4DOHB 4JKPH 3C2AH 3PQYD 5C09B 2P49B 1OWWA 1S9VB 2H6PA 3CH1B 3RWDB 3QDHA 1TVDA 5DC4B 1G7MA 3G6JB 3QXDB 3T4AB 3FL7A 5I9QB 1C5DB 4BQ8A 5FDWB 4WU5B 1EA9C 5F9AC 2ZKHL 4OFIA 1ZANH 4DKFH 5E1AB 1WAAE 4WIQA 4D0BA 4WTWA 1FDLH 3DROA 3LHPL 1ADQL 3OKDB 4LRNL 4PJ5E 5DWUH 1IBGH 3EO1A 4NYLA 5FYLH 4BFBD 3TESA 1Z5LA 4JFYB 3LKSA 5E5MA 5E94B 3DARA 3QA3A 4DUVA 4K55A 2HMID 4M7KH 4N8PA 3RNKB 1K8DA 3D0VA 3DUUA 3ME0A 4X4XA 5HYFA 4YHLL 4IRJC 5MHSD 3ARPA 5H94B 4BUGA 1S7VB 1M7XA 3N1QC 5TDPB 2QL1A 4MHHI 4F15B 3P77A 1M6OB 2XZQH 4JFDA 4FHBD 4WHCA 1RUAL 5CZVL 4IRJA 5DEZA 1RZ7L 4ZPTB 3I6LE 5GS1A 4TRPH 2MHAB 4FQ1L 3BDXA 1GJIA 4JKKA 5INCB 4HK0A 5FV1L 3K4DA 1IM3A 1YECH 2EDEA 4JR9L 4XP1L 2VKWA 3MZGB 5HI5D 4LSUH 3I6KA 3MRCA 3D25B 5E8PA 4ELME 5F7KC 1VA9A 1JTOA 2KDGA 4KJWC 2XQBH 1DBJH 1HHKB 4JM2D 1AIFA 1NC4B 1V3LA 4FNLL 1DQQB 3QUMA 1EJ6A 5J3HC 1K2DA 1J9CT 1W72A 2FJFA 5C09D 3RL1B 1XCTB 3PWNA 4JFOA 4EZMA 1U8OB 4BZ2H 1EAPA 3V4UL 4OIAA 1OY3B 4JN1L 3STZA 4A6YH 1Z9OA 3B43A 5BQ7A 2ICEB 1EFQA 5GS2H 4XAKD 1YEFH 2J8HA 2VXQL 2Q86A 4IIQB 2FX9H 2EXYC 4L4VA 3HMWL 3BISA 1Q9LB 1CZ8H 4PP1D 2UUDH 4P9HL 1YPZB 1BQUA 3WMSA 1HDMA 2C3VB 3WIFB 3OG6B 1XF5A 5EOTB 1FZMA 2YEZA 3KDMB 3T0AA 1FL6A 1EXUB 3MRLA 3A6OA 1YQVH 3G6AB 3IETB 4NWTL 5EIQA 3HPLA 4OI8A 2OL3H 2DQIH 4ELKA 5IM7A 2AJVH 3PHQB 5F9DC 1DUYB 1U95A 5C0FA 4KMLB 1N0XH 3MCG1 2OTUB 2XA8L 4PBWD 4P3DB 3Q0HA 1KN4H 1DQDL 3SJVA 2IH1A 4UNVA 2J3SA 6FABL 4XBEH 2P4AB 1ZA6B 3C9NA 3HZKB 1P1ZA 4CVUA 4PG9A 4RAVA 5IP4A 2QJDA 3HA0A 3IKKA 4OF8A 1N7MH 3OAZH 1H3WM 1EDQA 1U8QB 3F6LA 5T3ZL 5L88H 4NO0B 15C8L 3IDIB 3NFSH 1NCAH 2PW1B 1B0RB 4LFHG 3FQNA 4JKLA 4QOKE 4G3YL 1UM5H 2QSQA 1I7UB 1MCRA 1NC4D 5GGVH 2R2HA 4BQCA 3QWOA 4IOFC 4EI6B 5T33H 1KIQB 4L9LC 2MMXA 4NQEE 1S8DB 1WIPA 5J8OA 3QNXA 4EEEA 4K3EL 1MWAL 4ZQKA 2ZUTA 5GJTH 2J8UB 3GMMB 4HUKB 5EU4A 5CBEB 4L9LA 3PQYA 5DEGA 3AU1A 1FAKT 3EFDL 2VL5B 1WBYA 5E9DB 1C7TA 1MJ7L 4UIMA 5IEHB 4K7PL 5JW5B 3BJLA 4PJ8C 4AT6A 2HFFB 3BP4A 5F3BA 3OJDB 1CLOH 1DSFH 4JQXC 5E95B 1LP9A 3DO3A 4JQIL 3VG9C 5DJ6A 2AJXL 4U2YA 4KAQH 4UQ3A 2D7PA 1ITBB 3EYVA 5F8QC 5BCAA 4JQXA 3QJFB 1OTUD 1JJUA 3TCXA 2C1OB 2HFGH 2VH5H 3ZE0E 1G9MC 2FLBT 3ZHLA 3PWVB 1ZV5A 4PGZA 1DBBH 3KYMA 3L7EA 4ZFGH 4L8CB 4HJGB 4YDJB 4U6HA 4M1CD 3DX7A 1KCVL 1KV3A 3DURA 3MREA 5IEKA 4WJ5A 1CYGA 2FX7H 3U7YH 1N2RB 3HUJE 5F7NC 5DTFB 4S1QH 4OIIL 4NO0D 2CDEA 3EDFA 3CFCL 3TT3H 4S1DD 4ERSH 5JW3L 1IL1A 2X4RB 4P46C 3EJZC 4C56B 1UEMA 2G2RA 4ZPVB 5A3IC 4HEME 3MLSH 4R9HA 1S7QB 3ARQA 1GHFL 4R8WH 5GRVL 1T03H 4RAHA 1GC1C 4K3HA 2BVQA 5F9OL 5GGTH 3NN8B 4IMKC 2R0LL 3S3JA 4P46A 1ZT7B 1RD6A 2PCPA 5FXCH 3GSXB 4JM2A 4JRXE 5GHWH 4NWUH 3V0VB 5I9QC 2Q3AA 1T66D 1S9VA 3CH1A 1TETL 1WK0A 3RWDA 4E5XB 4FA8A 5I30L 2L4OA 2AXFB 1NCWL 5E9DD 3G6JA 3QXDA 3EO0B 1ZA3B 3T4AA 3I9GH 4MXWH 4R4FL 1A47A 4PP1C 1C5DA 3W39B 1Q1JH 4HIJB 4URTB 4OAWB 3U1SL 3AFLA 3PV6B 4F9PC 2C4FU 4WU5A 5FDWA 1CCZA 1ZVSB 5E5RB 3FN9A 5E1AA 3K8LA 5ITBH 3OKDA 3WFBH 3H3PL 4X6CB 2YD2A 4F9PA 5I6XC 1GGBH 3BVNB 2BDNL 4JFYA 5E94A 4F15C 3GB7B 3MGOB 2A1WL 3RNKA 1P2CB 2XG5A 2Y7QB 4ZODA 5F7MC 3K2MC 5H94A 1JPTH 1S7VA 3BRFA 1DQJB 2W38A 5TDPA 1FORL 5CILH 3VXQB 3NIDE 1ZT1B 5KSAB 3CC5A 1M6OA 3Q6GL 5D6DC 5J4MA 4XP6L 1MHPH 1PYWB 4ZPTA 4I77L 4UT7L 1VB9A 3LIZL 2MHAA 4FQXC 3RWGB 3NA9L 5D2LE 1SBSL 1L4IA 5D6DA 4C56D 3FT4B 1CL7L 3ZT6A 1H5BB 2WINB 4V1DB 1ZKAA 3D25A 4NN6B 1SVCP 2R0ZL 2ILLA 3WUWB 4RBPK 3EHBC 1CIDA 1MHEB 4ZMAT 1HHKA 3B5GA 1JGLH 2E8ZA 1NC4A 3OHXB 5D7KD 1DQQA 4YNYB 4MNHB 1IAKB 2CKNA 3QCTL 4EBQH 3RL1A 1HYRC 1XCTA 1WIOA 1U8OA 4N5UA 4BKLB 4IIQC 5FO7B 1NLBH 1M05B 2HH0L 2XRAH 3AS0A 2DTSA 4WV1C 5KAQG 3BX7C 2ICEA 1MFAH 3UMTA 1G7QB 1JHKL 2LU4A 5HHXH 4ZFZB 4IIQA 1OAUL 3MYZA 4K23H 1KEML 3PUCA 4UT6L 1Q9LA 4WV1A 4PJFF 2FRGP 3G9AB 3IT8D 4UOW0 4LQFL 1YPZA 3ARGB 1BF8A 2C3VA 2R29H 5F1KC 3KR3H 4HWUA 3WIFA 2KKQA 2V7NB 4L3EE 3O3AB 5EOTA 3S3SA 1OTUC 3KDMA 3FQWB 1EXUA 1UZ6F 3BP7B 3G6AA 2HJFA 3CVIL 3IETA 3F7QA 1S5IL 3U0WL 1HKLL 4P59H 2E9JA 3PHQA 1A3RL 4M1CC 1DUYA 1UB6B 2D0FA 3IU4L 5KSAD 1EHLH 5DYOB 2OTUA 2APWA 2YWZA 4P3DA 4WFGE 1N6QL 3BIKB 2DAVA 5I76B 8FABB 3A0OA 2HKHL 4YPJA 2ITDB 3EDJA 3QQ3A 4OF5A 4YHNB 1ZA6A 3PDOB 3HZKA 4XCCL 2YPVH 3EYSH 7CGTA 5TQ0L 1HQRB 1C08B 3GJFH 4M1DH 1IKNC 1IZKA 4V1DD 5HGAB 1U8QA 5C7XL 4XX1E 4NO0A 3IDIA 2PW1A 4JPKH 1B0RA 3T3PE 3O45B 1OSZB 2BOBB 2IGFH 4P0DA 2FDBP 3B8SA 1I7UA 3TPKA 1IKNA 1JP5A 3MRDB 1R3JA 4QGTA 4PRPB 43C9B 4KGLA 4EI6A 4CGTA 1KIQA 1S8DA 4KV5E 5EOQL 4DWHA 3VW3H 3S35X 4YQXH 2P5WE 1GGCH 4YBQD 1N5YL 1ZAGA 4WCYH 4LSPL 2J8UA 3E6FB 3GMMA 4JO2L 4KVCH 4MDJB 5CBEA 2IAMC 1VCAA 4PJDF 1A1MB 2VLJE 5HVHB 2VL5A 5E9DA 1MFCL 3CDYA 1WUNT 4M9OA 5IEHA 5JW5A 5K9OB 2Y4SA 1B2WL 4DGIL 4IOIB 2HFFA 3S96B 3B4NA 5GGUB 3ARGD 2E7CA 3OJDA 1OB1B 4JHAL 1MFBL 2GI7A 4JHWH 1KXQE 4UOW1 5F6IB 1KJ2H 3VGEA 2HG5B 3ZKND 3GUTB 1MUJB 3VI3F 3NCCB 2LQRA 3O4OB 3QJFA 5FM4A 2VISB 1JI1A 4Z9KB 2C1OA 4KROC 1FNFA 2WIMA 1AGBB 3D3VE 3O3BB 4APQB 2W60B 5GGSB 4GAJH 5LGJB 1DLFL 4L8CA 4HJGA 3ARWA 4HZLB 4RDQF 4YDJA 5C0RH 3LDBC 1UJ3B 2EKJA 3S36X 4Z7UE 1MRCL 4DFHA 1N2RA 1VPOL 5DTFA 2F53E 4PG2C 2BRRL 3DRTB 1JNJA 4GJTB 3A67H 2AP2A 2X4RA 4L5FH 1TZIA 4C56A 2YPLB 4KHXH 1XCQB 3CFDB 1DQMH 1S7QA 3HHRB 4PRPD 4J3OC 4PG2A 3NN8A 4NT6B 1HOCB 4R4ND 1FO0H 1XMWA 1YYLH 4NJAL 3OV6A 1R6VA 4PY8J 3GSXA 1UACL 3CSPA 4XMLH 3V0VA 4YDKL 3VCLB 3EOYG 1GGIL 3RVWD 2JTDA 4E5XA 1BPVA 2AXFA 4Y5YC 4LHUG 4OFVA 5I8CB 3JWDH 3EO0A 1ZA3A 4ALAL 4H0GA 1BFVH 3W39A 4HIJA 4OAWA 3PV6A 3T2PA 1ZVSA 4Z18A 1F4XL 3HRPA 2X4NB 1G7JB 2NY5C 2DQUL 1RZFL 4HMCA 1PBYA 3O81A 4N0UE 1H3TA 1J0ZA 1G7LB 2HN7B 4PJGB 3D48R 3LEYL 4X6CA 3FB8B 1ZLSL 1R0AH 2CGRH 3ULUL 4CVZB 4MCZA 3BVNA 4GXVL 5FM5M 4QTIH 1MCIA 4QRRB 3VXME 1QFHA 3GB7A 5KSAC 3MGOA 4PLJD 5TF1L 4APQD 1BECA 1P2CA 4C4KO 4GBXB 5SWSB 2Y7QA 3LS5H 4R26H 4W68A 1J0YA 2XXMB 1DQJA 1KJMB 1CT8B 2UZIH 3VXQA 4XCNB 5DF0A 1ZT1A 3O0RH 5KSAA 2YUXA 4RFOH 3QWRD 2EEDA 3H2WA 4XCFL 2B4CH 1JGEB 2X1OA 4RMTA 3GMPB 1HZHL 2EO9A 1VESA 2VZ3A 5CGMA 3RWGA 4G6JL 3VWKD 4DQOL 1QBAA 3WKMH 2X41A 2YPLD 3FT4A 1CXEA 4KVNH 1IGFH 3LKNB 4NP4L 1H5BA 2WINA 2EC9U 4V1DA 35C8L 2E7LC 3BWAB 1D5BB 3WUWA 3QUML 4OZGE 1MHEA 1O7SA 3BPCB 4BH8B 3A6CL 1EO8L 3OHXA 3DVNB 5DURD 3PWJB 4YNYA 4MNHA 1FL5B 1IAKA 1X5LA 2E7LA 3HC0B 2R1YB 1F45A 4BKLA 5FO7A 1M05A 3CXDH 1OSPH 5I1JH 1HHIB 3VD7A 3I50H 1WVZA 1YEGH 5FCSH 1G7QA 3TPUB 3ARGC 4QT5B 4ZFZA 4OF7A 4YXKL 4IDJL 3NACL 4P3WA 2APFA 4M02A 1GL4B 2DDQH 1NFDB 3ZKNC 3HNTL 3ARGA 3SE9L 1PD6A 2V7NA 4OFKA 3O3AA 2DM2A 2X1QA 3FQWA 1FGNH 4QRRD 4OUOA 1CDYA 4ODTH 4UV4L 3BP7A 1RJZB 3FKUS 5DMJB 4GBXD 5SWSD 4YO0B 5DLMH 3BH9B 1W8OA 5HYSG 5KSBB 1TENA 1F90H 1HYSD 1UB6A 4G6ML 1JYNA 1QVOB 5DYOA 5E4EB 3RDTB 3GBMH 2FECL 4YHOH 4Z95H 3BIKA 5I76A 4ZYKB 8FABA 4DKEL 5C0AE 2ITDA 5I1EH 4YHNA 3PDOA 4XP5L 2IFGA 4HPYL 1QRND 2VLKE 1E4WL 1HQRA 1C08A 4P57B 1UCTA 3P0VH 4DK3A 4RWYH 5E70A 5C71A 5HGAA 5JUEH 2VERN 1F5WA 2WQRA 3MBXL 4R4NC 3O45A 1OSZA 3BKML 2VE6B 3MSPA 3MRDA 3P40A 4XGZB 3ZT5A 5IB2B 4PRPA 3M8OH 5JW4M 1AD0B 2CKBH 4G80A 1UH2A 2CO7B 3FOMB 3K7UA 3VA6A 3RVWC 5HVHC 5CP3H 1PJ9A 4AL8L 4ZS6D 3VJ6B 4POUB 3E6FA 4ODBD 1JNLH 3RVXD 1K3ZA 4MDJA 4XNYH 4PYHA 3L5WA 4JM4L 4YHMH 4KDVA 2H41A 5C0CD 1A1MA 5HDQH 4AQOA 5FHAH 4DGYH 4GKOA 4MD4B 5F6IC 3RGVD 4LLVB 5K9OA 2CR6A 4IOIA 5ALCL 3S96A 5GGUA 4D9RD 1B0WA 3H9HB 1EEQA 5F7YC 1OB1A 3H9YA 3O4OC 4LRIC 5EZIH 2R23B 1AQKL 1YC7A 5C2BL 3V6OA 4OBRA 2BNRE 2Z92B 4YXHL 2HG5A 3L3KB 4PLJC 3ZTNH 3L6FB 4U1NB 3GUTA 4FQPA 5MP6H 1MUJA 2V2XB 1MRFL 4AIZB 4HWEH 2MCPH 4JZOB 3RWEB 4TVSa 4YUEH 1UJ3C 3O3BA 1MI5B 1G9ML 4APQA 2W60A 1I75A 5GGSA 4U31A 3FO9A 1HHHB 3NIFE 5LGJA 1WZMA 4HZLA 1WWAX 3CZFB 3OKLB 3Q3GB 5ECJE 5JR1L 4KK6D 3LQAC 1GOHA 2K7QA 5FA3B 3P4NB 5BV7H 1UJ3A 1CF8H 4LSVL 5DJAB 1NCDH 4X4ME 4XPHL 2D9CA 4PJCB 4P4KB 2XG4A 2GHWB 4U1LB 5F93C 1A6UH 1U92A 1NGXB 1NUGA 2YPLA 3NPSB 1XCQA 3CFDA 1Z6JT 2DQFB 4NC0B 3GMLA 5B3JF 1AFVH 5JW4Q 4NT6A 1HOCA 1GC1L 4JO1L 2Q7NA 1ACZA 2QQKL 5EBWB 3ZKMD 4XAWH 25C8L 2UY6A 1QFUL 4MHHG 2FB4L 4K8RH 4HKXB 5EFIB 1DR9A 4HK3N 4NFBA 4I0KA 3VD5A 4DVRH 5DHVH 1H3PH 5I8CA 3QXAB 2EDHA 2PKDA 5E7BA 1RZGB 3OF6D 1F3DH 1I9IL 3BZFB 4J3SA 1E4JA 2H32H 5J1SC 1EX0A 3T2NH 2HLAB 2D7TL 5E5UB 5GSVB 2X4NA 1G7JA 4W4OC 4PJ7F 5DVMA 5I0DA 4F7PB 2BK8A 4OGAD 4FG6C 1J05B 4X6DF 3KPRB 1G7LA 3P30L 2HN7A 4PJGA 3HZMB 3EDDA 3FB8A 3MGTB 4JPIB 4CVZA 2NQCA 4HUXB 4QRRA 1BEYL 1HYSC 3HFMH 1KBGL 2VWEC 1MI5D 1CGSH 4GBXA 2ZCHL 4OM1L 2ENSA 1CT8A 1KJMA 4JB9L 2CIIB 4XCNA 1Z0NA 5I1AB 1U8JA 3SKMB 5DUBB 1JGEA 1RV6X 3GMPA 5F1OB 2VZUA 5DD0H 1I9EA 2F58H 2W91A 3UO1H 1SEQH 4P4KD 2VITB 3UX9B 1UZ8B 3BMWA 5K33A 5CINH 2QQNH 1V05A 1U2HA 4EIGB 1I1AC 1YEKL 2BFVL 4HKBB 3BWAA 5FKAB 1D5BA 5JA8B 4KI5F 4FQJL 5JQHC 1INEH 1AI1L 3BPCA 4BH8A 2ZCKL 4ZS6C 4E0RB 3DVNA 3G08B 4QHKI 3O11B 3RVXC 3PWJA 4BSWA 1FL5A 5KAQF 1JTPA 4MAYC 3HC0A 3FB5B 2YWYA 1I7RB 4PJEF 3O9WB 2XA3A 1HHIA 2KPNA 3LS4H 1V3KA 3QHZH 1KIRB 3DSFL 3INUH 4QT5A 4PRHE 3OBAA 3GI9H 1I8IB 1NFDA 5GZND 1BLNB 2NY0B 4DZBB 4WRLA 3KPRD 3L95A 3ZKQD 4EDXB 5BOZG 1RI8A 1XF4B 4TVPD 2PYFB 3VDAA 5H2BB 4KMTH 5T3XH 3E2HB 2EDDA 3S34H 3TM6A 5E4EC 1UQSB 3RDTC 1A5FH 43CAB 1RJZA 3GNMH 4YO0A 3BH9A 4MS8D 5KSBA 1ZLUH 5FHBH 5I73B 3I6GB 3LMJH 4JZNB 5D8JL 4E41E 4FZEH 2Z8VC 4B0MM 1QVOA 4X6DA 3RDTA 1D5ZB 1JV5B 3LEVL 4ZYKA 3IFLL 3BN3B 3IJHA 5GGQH 4CJ1A 3CPLB 4Z6AT 1DN2A 5DD3L 1IC4H 3E8UL 4MDIB 3NTCH 1S5HB 4NBYB 1T3FB 1X6LA 4P57A 4HXAH 2DLTA 5I1LB 2VYRE 2O5ZH 4FABL 4NDMB 5EOCL 4U6YA 2NXYB 1EGJA 2VXUH 3ZKMC 1LK3L 2AK1H 5IVOA 4XGZA 5DK0B 2JIXB 5IB2A 1U93B 3EOTH 1AD0A 4KI5C 3W9EB 2H45A 1AHWB 4Z78B 1CQKA 3FOMA 1FZJB 3O9WD 3VDCA 4CNIB 3A6BL 4LGRB 4S11A 5A2IH 5B8CB 1KB5B 4LVHC 3VJ6A 4WI5A 3S88H 1SY6H 5JHLL 3F7VA 2CLZB 3RUGF 1N4XH 3CMOL 4MD4A 2GAZB 4LLVA 2BJML 2DD8H 2NY0D 3OF6A 4OGAC 4WW2B 3H9HA 4JKMA 5AAMA 5F9JB 3QG7H 4IRZL 2R23A 5DRZB 2OMBA 4LPUA 2Z92A 3P0YH 3L3KA 4LF3B 3L6FA 4U1NA 3MV11 5FYJD 4HIIB 2V2XA 5IGXH 4AIZA 4OZIB 4C55A 2YA0A 5CSBA 5GJSL 3RWEA 1DVFC 1UENA 1S7UB 3IS1X 1MI5A 2IBGA 2MWCA 2VDRL 5LGHH 2VLMD 3CZFA 3OKLA 2X9XA 3Q3GA 4JY6B 4K3JH 4F9LC 4IM8A 1GOGA 1EMTH 4NUGL 1WTLA 4TULL 5FA3A 4BSVB 1W8NA 4P4KC 4Z7WF 2JE8A 5DJAA 3NPSC 5I0ZA 4EDWH 5IVZB 4ONHB 4F9LA 4H25B 4PJCA 5DUMH 2NXYD 5I1GL 4P4KA 1A9EB 2DL9A 3HAEB 3QPXL 2BOCB 2D03H 2Y1VA 1UM4H 2JIXD 2DQFA 5E8OB 1IT9H 3LZFH 2DLFL 1F4YH 1FQ9C 3NVQA 1KELH 2FHCA 3PNWB 5EBLB 5JIHA 4G7VH 5F7FA 4UUJB 1D5XB 4ISVB 1AE6H 5EBWA 4NCDA 3H7BB 1YPZE 4F3FB 2UY7A 1Q8MA 4GAYB 4BH7B 4HKXA 3LOWA 5EFIA 1HWGB 2ZUUA 3V4PH 1JZ5A 1OARL 2AEIT 2CRIA 4NC2B 3UTTB 4JVWA 1Z3GH 3QXAA 1RZGA 5GZNC 4GO6B 1YJDC 4FFVD 2YPKB 4K3GA 3BZFA 5FDYA 5C0GB 4I9WE 1RUQH 2R69H 2HLAA 5GSVA 4FQCH 5DA4A 3FHAA 4M7LL 4EVNB 5J12B 1A3LL 1MY7A 5CJOH 4F7PA 2O5YH 1N26A 1J05A 3KPRA 1NMAH 3ARXA 3HZMA 5E2VH 5F3HB 3MGTA 4JPIA 4Q97A 4LPXA 2OK0L 2D9QB 4YE4H 5EIVA 3NCJL 2X4PB 4HPOL 2HT3D 3VXUB 4NKOB 4Q9CA 5FF6B 2OZ4A 4NM4H 5TQ2H 4FQ2L 2CIIA 5IHUH 2VAJA 1CBVH 2DQHL 2EZ0D 3CDCA 4MA8H 5I1AA 1K5NB 1P4BH 1JGUH 1UCBH 2C5DC 3NCYP 4U0RC 3SKMA 4XNUL 5DUBA 2XZCL 1PW3A 1YEJL 3X17A 5F44A 1UWEH 1K3IA 2I24N 5FGBC 3BUYB 2VITA 5E8DH 1UZ8A 3TH3T 2MPAL 4CVWA 2P43B 5IQ9B 4Y8DC 5KANG 4NZUH 1X5AA 1WICA 2JB6B 1NDMB 3VFGL 4D94A 4CVXB 2VUYA 4HKBA 5FGBA 5FKAA 2LAGB 3VH8G 5BS0B 3L1OL 4JQVC 4ONFH 2VDLL 4DTGL 4E0RA 3G08A 2AJUL 4MSWB 4HD9A 3FB5A 1I7RA 4FQLH 3UTTD 3O9WA 3DV6B 5DI8B 5CMAB 3T4YA 2ARJQ 4K94C 1M4KA 3RZCB 2VQTA 3WIHL 2NY0C 4UBDC 4XPAH 2H3NA 1KIRA 2MQ3A 4PJFE 3O6KH 4MJIB 5JMRA 2Z31B 2BHYA 3E2HC 1I8IA 3ZE1F 3ZTJH 4OCXL 3HZVB 5ABDE 4LP5A 4N0FB 1BLNA 4NQXB 5E99H 4DZBA 5IJVB 5D1ZB 4EDXA 1XF4A 2PYFA 4M7ZC 5I17B 5H2BA 1FLRL 2VJXA 1DBMH 2ZG1A 4MNQA 4JHBA 1UQSA 4MXVF 43CAA 3VXUD 4YX2L 4OD2B 4OF3A 4AJ0A 3TFKD 3I6GA 4JZNA 3S4SG 4X7EC 2A9NL 2IG2H 1D5ZA 3TWCL 1JV5A 2Y6SC 5EOCJ 1KCSL 5TE6H 2FIKB 2NXYC 1GXEA 1RMFL 1OP5K 1RIUH 1XAUA 5GQBA 1QKZL 2P7TB 4MDIA 1S5HA 1T3FA 2YD1A 5I1LA 5CZKA 4PJAF 5CD5D 3DVFA 3MUHL 5F7UA 2XYCA 3QH3B 3PDDA 4NDMA 4P5KB 2R4RL 5BS0D 4G9FB 5B8CC 2F8VA 1FFOB 4LIQE 4PB9H 4GLRH 5D1XB 4OB5L 1QO3B 1QSFB 5DK0A 2JIXA 1U93A 1CU4L 4X4YB 1IGCH 4W81A 4HKJB 1AHWA 4Z78A 4NZRL 5FCUL 5LQBH 4DKDC 5CSZB 1FZJA 3UTOA 4CNIA 1T5WB 3VFNB 5B8CA 1KB5A 3LRGA 4PJDE 5IKCB 4S0SD 3RZCD 4HWBA 4R97C 1K6QL 2Z31D 4WUUE 3P9LB 2QEJA 2GAZA 1ES0B 5MEQA 5IFAH 1V7MH 2VC2L 2GKIA 2I5YL 5D1ZD 1YQ2A 5FUOL 5F9JA 3WD5H 4KMQA 3MXVL 1DLHB 2ZG3A 4LLWB 4F7TB 3VI3E 5DRZA 4LAQH 4YHPB 5JQ6L 2F54B 2H8PA 4BM7A 2V17L 2HT3C 4LF3A 4XTRD 5CS7A 3BE1L 3EYFB 4O51B 4OZ4B 3VI4E 4DAGL 2EH8L 4Z7VF 2IH3B 3NH7H 3W82A 4KZEL 2GSIB 4OZIA 1F6FB 4HS8H 4OLZL 1A6TB 1RU9L 3Q2CA 2EZ0C 4JO3H 1T1ZB 1S7UA 3DVGB 3TJEL 1CLZL 4AH2A 1E4XI 4OZHF 1KCUL 5ALBL 1IE5A 1FIEA 3QXUA 4I3GA 4JY6A 1L6XA 4TOYL 5C0ND 4WVRA 5HBBA 1T80A 3G6DH 1BVKB 4BSVA 3OX8B 4Q9RL 1XGQB 1T0PB 3D39E 3QFDB 3MLXH 5IVZA 2RAMA 4ONHA 3UJIL 4H25A 4QRQB 5ID0B 3BKJH 3HNSL 4RRPA 1A9EA 3HAEA 2XNAB 1DANU 4G9FD 2BOCA 2EIDA 3IKCB 5D1XD 5IW6A 1QSFD 3HI6H 2J88L 5E8OA 3PNWA 1SYVB 4MYWB 5EBLA 4H8WC 4G6KL 5J1AB 2IQAA 4H0IA 3X3GH 3BXNA 1FNLA 3BIAX 1D5XA 3CVHH 4ISVA 4M4RA 4WY7L 1FAIH 3OG4B 4F3FA 2AGJL 3WEXB 1MSPA 3V5DB 5KVDH 2VXSH 4GAYA 4BH7A 4NJ9L 2LFGA 4KXZH 2RFXB 4N90D 1CVSC 1NKRA 2R0WH 4MLIA 3PIQB 5L9DH 3UTTA 2BHUA 5J12C 3GKWH 4NFCA 3K2UH 3U6RB 5EC2B 2YPKA 3NCMA 5C0GA 1X5XA 3W0WB 3L5XL 1A21A 2ZG2A 4Z0BL 3TO4B 1IAIH 4WFEE 3O4LE 2F54D 1RZKC 4EVNA 5HYJB 3GSNH 2IANB 2QSTA 3CFIC 3OMZA 3QDAA 3V0WL 4M5YH 1OGAB 5F3HA 3LAFA 3V7AG 3LKRB 1F6AB 2X4PA 3TFKC 5E00B 3MFGB 1ZHLB 3VXUA 4NKOA 5DJ2B 5J13B 5FF6A 4OM0H 1V3JA 4M7JL 4PJBB 1MHCB 1K5NA 4TNWF 4D3CL 3WFDL 1IC1A 3SOBH 2CQVA 3RWIA 3V79C 4N0YH 2DQTH 1QHOA 3BUYA 3THML 4RBPH 1WBXB 3G04B 4OZHA 3SY0B 5IQ9A 1PG7X 3ARSA 4OLVH 2BHZA 2JB6A 1NDMA 4U3CA 2VR4A 4CVXA 5BS0A 4D9QE 3ULVH 4MA1B 3KLHC 1UM6L 4RGMB 1YEHH 3VXNB 1WJ3A 4OLYL 4UILL 3RZCC 1MCLA 3LSOB 3PG2A 3VXSE 3GIVB 4MSWA 5DQDL 1NL0H 2Z31C 3DV6A 5DI8A 2VXVH 4FQIH 5CMAA 3MLVL 3QDGB 3RZCA 1QG3A 1R3KB 4HFWB 3JV4B 3W0WD 3SDYL 3OXSB 4KK8D 4LU5L 4M03A 3TO4D 5I75B 4MJIA 1X5ZA 2Z31A 3BGFB 1UH4A 2WWKO 5HYJD 3HZVA 2IAND 4N0FA 5JHDB 5TH2B 2ED8A 4NQXA 3ZMRA 4C57C 4XTRC 1JCKA 1ZHBB 4R0LB 3VMOA 5IJVA 5D1ZA 1OGAD 3MOAH 3GIZL 1IQWL 5I17A 2YXMA 2VDMH 5HTSA 5IESH 1CGWA 3UXFA 4OCRH 5DRWB 3TH4T 1R5WB 2JELL 4XVSL 1BQHG 2P44B 4LHJB 5FYKE 1RK0B 2YPLE 4X7TB 3VRLF 1DL7L 1X5HA 2FIKA 2XN9A 1A7RL 3K0WA 2ZKHH 2P7TA 1NFIB 4NGHL 1EGJL 4NQDB 3LHPH 1PQZB 3QH3A 2JCCF 1ADQH 1SJHA 4LRNH 3ZT7A 4P5KA 5DVNA 4WUKL 4CKVX 4G9FA 5CJQL 2HTKC 3FAXA 4HIHB 5D1XA 3SE8L 1QSFA 1NMBH 2GUOB 3VWJB 1IMHC 1YMMB 2G9HB 4X4YA 4YHLH 1QBML 4HKJA 4Q0XL 4LSSL 1DQLL 5CSZA 5DSCB 4YC2B 5TFSL 1XF2B 1T5WA 2EYRA 3VFNA 1LO5B 4NQCE 5H37G 5IKCA 3QDGD 4J3WA 5IVXB 4ZG1A 1IARB 1RUAH 5CZVH 4QRRE 1RZ7H 3KXFB 1QTYT 3DECA 1NGYA 4WI9A 4LL9A 3DOSA 3P9LA 3MLYL 4FQ1H 1ES0A 4AMKL 5JHDD 1P4LB 1MJUL 4JR9H 5CAYB 4XP1H 1OQXA 5ELIA 4NFDA 4IEFB 4NNYB 4P2QB 1DLHA 4LLWA 1PAMA 2VWEE 2OSLB 3UZQA 2D4DA 4YHPA 3RFZC 2F54A 3B9KB 3IB4A 2XY1A 1VFBB 3EYFA 4O51A 2QR0B 2R9HC 4OZ4A 4U3XA 5CJ5A 2ADGB 2IH3A 4FNLH 4WO4B 2V2TB 2GSIA 3K3QA 4MGXA 1A6TA 3BPNC 2F8XC 1T1ZA 3DVGA 1T7YA 3V4UH 4JN1H 4BZ1L 3B5HA 4PGDB 1BVKA 2VXQH 1CXLA 2D0GA 3OX8A 4HGKC 2EKSB 3WKNA 2WM0A 1XGQA 3GMOB 4NQDD 3HMWH 3QFDA 3SDXB 4FQQB 3P4OB 4QRQA 4P9HH 3SGKC 5ID0A 5B3JE 2XNAA 3GMNB 2D7NA 3IKCA 3VWJD 3FQUB 1YMMD 2P1YA 3CFEB 4NWTH 1SYVA 5J1AA 3MRMB 1H9VA 4ODXB 5F7EL 3I2CL 4AY0A 5J89A 5DQ9B 5F21B 4GG6B 5E4IA 2XA8H 3WEXA 4RNRB 3V5DA 5D7LB 1DQDH 3DPBA 3KXFD 4Y1AE 2AJYL 3DXAB 6FABH 2RFXA 2VKXA 4KK8C 5C07A 3PIQA 2BVTA 5BOPA 3U6RA 5CKGA 5EC2A 3B9VA 4CMHB 1CDBA 4PJ7E 2VXTL 1ZE3C 5F1IB 1OHQA 3W0WA 4P2QD 4KQ4L 3B3IB 1YJDL 3DGGB 4X6DE 5T3ZH 2Y25A 15C8H 3JWOC 4TVPL 3S5LB 5HYJA 2IANA 4G3YH 3VRIB 2NXZB 1A8JH 1KTDB 3K1DA 1OGAA 4WO4D 2CPCA 5I1KL 4GW1B 4EKXA 3NAAL 5CLTA 3LKRA 1F6AA 2OZ4L 3OKNA 3BFOA 5E00A 1I7TB 1U36A 4TUJB 4K3EH 1ZHLA 1MWAH 5DJ2A 4KJPC 1OF2A 4F8TA 4H26B 2ED7A 4PJBA 1MHCA 3AC0A 3FOLB 5JXEC 3EFDH 1VENA 1MJ7H 4FN0A 4K7PH 2ZJSL 5B3NA 1S78C 3WXVL 3VFUB 4MA1C 4JQIH 1T6VN 1WBXA 3G04A 2AJXH 4KI5E 5TPWL 3WNKA 2BNQB 2CRYA 3LRSB 1F4HA 4U33A 2DKUA 2V9TA 4ODWB 4Y88A 3VXNA 4F57L 2W9LA 5BVPL 1I3VA 4PJEE 3LSOA 1OT2A 5D7LD 3GIVA 3DXAD 2NY6C 5LWYL 1OLZA 3BGFC 1KCVH 3PXJA 3MJ9A 4PLKD 5I19L 3O3EB 4OI9A 1IAII 3QDGA 1BQLL 4Y5XC 1R3KA 5CCKL 4HFWA 1RHFA 3JV4A 4GFTB 4K94L 2ESVB 3OXSA 5IV2B 3NCBB 3AS3A 4OIIH 1MI5E 3ZDYF 3CFCH 4HHAB 5JW3H 1I9JL 2KZ1B 5JHDA 5TH2A 2NXZD 1ZHBA 2I9LB 4G8GE 2V7HB 3E1F1 1ED3B 5F9OH 5FYJL 5T5NG 3AS2A 2R0LH 2XQYK 3Q5TA 5DRWA 1CN4A 1DDHB 1R5WA 3R1GL 3L3JB 3HAEG 3DNKA 1RK0A 4OJFL 1AGDB 2E7BA 4JEGB 4X7TA 2DM3A 5EZOL 1LK2B 1TETH 5I30H 3QEUB 1NCWH 4Q9QL 4PJ5B 5DRXB 4R4FH 5JMOC 1CVRA 1A7QL 4QNPF 3KS0H 2H26B 3U1SH 4JPVL 2XXCB 3IAGC 4OSUL 3QP3A 1NFIA 1UXSB 1VKXA 2BNQD 4NQDA 3FAWA 1E0OB 1PQZA 2E27L 3R0NA 1TIUA 3FMGL 3H3PH 1CDUA 1EUUA 1D6VL 5GRUL 2H2PD 2BDNH 3C8HA 3R4DA 1RUML 4HIHA 2GUOA 3VWJA 2A1WH 1YMMA 3FONB 3HMXA 1KB5L 2G5BB 2G9HA 1XR9B 4HWBL 3KJ6H 5EORL 4J8RB 5DSCA 1OD9A 1FORH 1XF2A 1LO5A 4RZCB 3RUGE 4ZO6A 3Q6GH 5IVXA 3MGAA 1XH3B 4XP6H 2ESVD 3KXFA 1WTGT 1PVHA 4I77H 1YEEL 4UT7H 1KNOB 4OV6F 3LIZH 4ELMB 3B9KC 4AIOA 3NA9H 1SBSH 4MQXD 4WHDA 4QHMB 1TJHL 1P4LA 5I18L 3QNYB 4WEMB 2OR9L 1CL7H 4NNYA 4P2QA 2Z91B 4WO4C 5SV3A 2EE9A 2OSLA 4XVUC 3MLZL 5B38A 3B9KA 2R0ZH 1CIUA 1VFBA 1YY9D 1Y6NR 2QR0A 4M3KB 3ZYIA 4FP8L 2ADGA 4WO4A 2V2TA 1WZ1L 5DEFB 4KTDL 3WS3B 4PJHF 3LN4B 2HH0H 3QCVL 3T0WA 2PW2B 1F2XK 1RJYB 3QQ9D 4LCIL 4Z7WE 4JY5L 4PJ5D 1KOAA 3QULA 1JHKH 1UADC 3U48A 1KTKE 2EKSA 3GMOA 3MJ6A 1KEMH 4UT6H 3SDXA 1X9QA 4GRWH 1FFQA 1Y6MR 4FQQA 3P4OA 4O02L 4LQFH 5JOEA 5DJYA 3U9UB 3PWLB 2QLVB 1NAKL 3GMNA 4D9LL 1Q0YL 3RKDD 4M9PA 3TN0C 3FQUA 1U8HB 2OI9B 4L8DB 3CFEA 3CVIH 4ONGL 3I6LD 2X4OB 1JN6B 3MRMA 4ODXA 4B7LA 1S5IH 3U0WH 1T2QL 1HKLH 5DQ9A 1A3RH 3TN0A 2ICCA 3IU4H 5MEOB 1MF2H 4GG6A 3QG6B 4RNRA 5D7LA 3HB3D 1N6QH 5KG9B 1IAMA 2XWBB 3DXAA 4MNQE 2HKHH 3TZVB 5EU6E 3G9VA 4XCCH 3SCMC 4QOKB 2A2QT 2YUZA 1GCFA 2YK1L 2NXZC 5TQ0H 3JZ7A 4F7CA 2FIRT 5F1IA 3B3IA 3DGGA 5C7XH 4OLEA 3SCMA 4NQEB 5HI3D 1M7IB 3S5LA 4PY7B 2YUVA 1WGOA 1J0IA 1MAML 3VRIA 1RZKL 1CLYL 4X98B 3ZHKA 2BP3A 3TLRA 5ETUB 3I85A 4GW1A 3VFVB 2W65B 4HX1A 4N8CL 1ZS8B 4LCCB 5EOQH 2FHBA 3OGOE 2Q6WB 5HI4C 1I7TA 4TUJA 2K9UA 4M62L 1N5YH 4LSPH 3TYGL 2YD8A 4JO2H 3V6ZB 3AROA 1HXYB 4H26A 2QSCL 2AJZA 5FO8B 3SDCB 4JG0L 3FOLA 4S10A 5EC1B 1FVDB 3LB6D 3OJMB 1YA5A 4NRYB 1MFCH 4ZS7L 1B2WH 4DGIH 1XZ0A 3BESR 3ZO0A 1TZGL 1MFBH 4JHAH 3VFUA 5A2KH 4U3HA 5HHNB 4XNQB 2NTFB 2ICWB 5JLZB 3LRSA 1F11B 5IQ7L 4QY8B 4WFHE 1TTFA 3UAJD 2BC4B 5BZDB 4ODWA 5E08L 3AAZB 5DJ0B 2EECA 1RVFL 4BK4A 1DLFH 3LEXB 4NOBA 4I2XE 2WNGA 4U1HB 4NKDB 1G7HB 4QOKD 3O3EA 3NFNB 3LQZB 3SHSA 5GRJL 4OZIE 3ZE1E 1MRCH 2ESVA 1VPOH 2YMXL 5IV2A 1MIML 4YIQB 2BRRH 5CJ8A 2DBLL 4NQED 4WNQB 4MA7L 4XHJD 4HHAA 3L3DB 2B5IB 1P7HL 4IOSD 4O00A 3VXTB 2I9LA 4JRXB 2V7HA 1ED3A 3NFPB 4MXVE 5DD1L 1XF1A 2XZZA 4HH8A 2AKRB 1FPTL 2XKSA 3TT1L 4NJAH 3GJEB 3SDDC 1QPXA 4M5ZL 5F88B 2PYEE 1DDHA 1UACH 1CTNA 3Q5YA 1N59A 3L3JA 4M00A 2LU3A 2ZOKB 3V95A 1AGDA 4YDKH 3SDCD 2WK2A 1GGIH 1LK2A 3QEUA 4UB0L 5KSVB 1UKSA 2E9WA 2FBJL 4PJ5A 3WL9B 4ALAH 5DRXA 2DKSA 2YN5A 4Y0GA 4PJAE 2H26A 5C08B 1QR4A 4GKZB 4MX7B 1VERA 2YS4A 5LVEA 3WE6B 2FH8A 1F4XH 4BQ9A 1DBKL 4RMQA 5CJXC 1UXSA 2DQUH 1RZFH 5EU3B 1N3NB 1X4YA 1LHZA 4DFIA 3V8OA 3UTTE 3LEYH 1ZLSH 4AK1A 3ULUH 4LPYA 4J4PD 4GXVH 2PETA 5CJXA 1WZLA 4HH9B 2VZSA 4G9DB 2F19L 5IMOA 5TF1H 3FONA 5CBAB 2G5BA 2EEAA 3JV5A 3HB3C 1XR9A 2ID5A 2A6JB 4J8RA 2ICES 5D2LB 4PGJA 4B7IA 4RZCA 4IHOB 4K9EC 2DIAA 4XCFH 4DJMA 1XH3A 3N1PC 3BRGC 2JKXA 3JUYA 1HZHH 2VLLB 1KNOA 4ELMA 2W0FB 3CX5J 5HI3C 4G6JH 4DQOH 3QNYA 4JRXD 2ZSWB 4Y5VB 2B2XL 3BAEL 4YHIA 2QTEA 2Z91A 4FZ8L 4NP4H 5IBLC 1HINL 5CZXD 4JPWL 1BIIB 35C8H 4Z7VE 3BWUC 1TLKA 3QUMH 5EWIL 3CCHB 4WEBL 3QO0B 2ERJC 3A6CH 3PP3H 2P5EB 1EO8H 3OAUL 4AEIL 3GHBL 2IQ9L 4OZHE 5DEFA 4M6NL 1QBLL 3WS3A 1JPFA 3LN4A 5HVGB 3LB6C 1IGYA 2PW2A 1BREA 1CXHA 1RJYA 3ZE2F 2CLRB 1QYGL 4L3EB 5C08D 2HVKB 4YXKH 4IDJH 3Q5OA 4EI5B 2Y72A 4F7EB 1MFEL 3JUZA 3NACH 5AYQA 5FK9B 4BFEA 1GZQB 2C3XA 1UC6A 5T1DL 3HNTH 3SE9H 3U9UA 3N06B 3PWLA 4FQHB 3WJLC 2C3GA 4FFZL 1PFCA 5LAXB 4Z0XB 4K3DL 3SKJL 4UV4H 5HD8D 1A1NA 2ZOLB 1U8HA 4HS3B 3IS0X 4MJIE 4L8DA 2X4OA 1JN6A 3WJLA 3TZVC 4P23B 3LQMA 3B2UD 4B50A 4G6MH 5DFTA 3NA4A 4OCWL 3QG6A 5ICZB 5DGQA 1NPUA 1NQBA 1AC6A 5KG9A 3BP6B 2XWBA 4DKEH 2VZOA 3TZVA 1O7VA 2CDFB 4XP5H 4XHJC 4QOKA 1K4DB 4HPYH 3DUHA 4KDTC 4M61B 1E4WH 1ZWIB 1E4XL 2P8LB 1KLGB 1T21B 1YEIL 1MPAL 4CW1A 4NO2B 1TTUA 4NQEA 1M7IA 1KJ3L 3C08L 3MBXH 4PY7A 2P5WB 4KDTA 3VXOB 3H6JA 5DMKB 3JWOL 4X98A 3SO3B 1Z9MA 1IKFL 5ETUA 2XN9E 3RA7L 4W70A 1T1WB 2QSVA 3VFVA 3OAYH 3O8XB 2W65A 2HJLB 4FOMA 3P4MB 1ZS8A 2VLJB 2VAAB 4LCCA 3SDCC 1KJVB 5F9WB 3S3PA 4HXBL 2Q6WA 4AL8H 1U3YA 5KOMC 3FQRB 1OCWL 3V6ZA 5E8EB 1HXYA 4JM4H 3JV6B 4L3ED 1PSKL 2DM4A 5ICYB 3D6GA 3RHWF 5FO8A 3SDCA 1BFOB 4R7NB 5EC1A 3PL6C 4QRUB 5DJ8B 4EI5D 5E6ZA 4NRYA 5JOPD 3KPOB 4GRLB 4TTGA 5ALCH 4GRMB 3JTTB 3G5YB 2CXGA 2J5LB 3RWFB 5E2TL 3T0XA 1KJ2A 2QHLA 2L7UA 1AQKH 5C2BH 5HHNA 4XNQA 3ARBB 2DMKA 12E8L 4X6FB 2NTFA 4YXHH 2ICWA 3D3VB 2I25N 4WFGD 5E6IB 1SJXA 5C0IB 5JLZA 3BKYL 1F11A 4QY8A 5JW4R 2VIRB 4ZUVB 4AQ1B 1MRFH 2EDLA 5BZDA 3GBNL 4J4PA 4P23D 5ESQB 4LDLB 3AAZA 3IFOB 1C5CL 2P46B 5HVFB 3CX5K 3WFCL 3MJ9L 2EYTB 1X7QB 3LEXA 1X6NA 4U1HA 1BQSA 3IDYB 5BV7B 2FGWL 3OKKB 1OAKH 4NKDA 1G7HA 3RX7A 4HJ0C 4PRAB 1FNHA 3NFNA 2B5IC 3LQZA 5IIEB 3MV8E 5CJBA 1EVUA 1NFKA 3EO9L 3KJ4B 1T4KB 4XPHH 2NYYD 4YIQA 4WNQA 5CZXC 3QAZC 3L3DA 3KAAA 1I7ZB 2P5WD 3VXTA 1OAYL 3K46A 4JRXA 4MZ3A 3NFPA 4F8QA 3EOAB 4LDOB 3O8XD 3HCVA 2AKRA 1QRKA 1GC1H 2EYSB 1MIEL 2VLJD 4JO1H 2QQKH 4QRTB 4WGWB 2GK2A 1OWRM 2EC8A 1OL0A 3GJEA 5F88A 3WNMA 2OYPA 3VRLE 1QFUH 2DS4A 2FB4H 4R2GD 2ZOKA 1B88A 1ITCA 3ZTJG 5KSVA 4N0UB 2RBLA 4EUPB 4GRLD 4ZOCA 3WL9A 3WLWD 1I9IH 1FC1A 3GM8A 1WZKA 3EW3B 3MJ8B 5KS9F 4LSTL 5F8RC 4EN3B 5C08A 4GKZA 4MX7A 3WO4B 2D7TH 2JCCE 3WE6A 3VXMB 1FFPB 3ARBD 5IROC 3M07A 1UWXH 5EU3A 3D3VD 4X6BB 1N3NA 4QWWD 4MD5B 5E6ID 5C07E 5HD8C 2KBGA 5DUPL 3KPSB 3P30H 3HMXL 1WIUA 1MFNA 3P9MA 1WCBB 1BEYH 1H0DB 5IROA 2DTML 4HH9A 1SEBB 2B4CC 4G9DA 1KBGH 4AEHL 1FGVH 3O6LL 5F71A 2E5EA 5CBAA 3U30B 2F53D 2AEQL 1FVEB 2ZCHH 4OM1H 2A6JA 1KUMA 1Y18B 4JB9H 4NQSB 1CFTB 3L5IA 4MB4A 5JZ7D 4IHOA 4QF1B 1B0GB 4JY4B 4XVJL 4Y5VC 4DN3L 4TUKL 3QRGL 5I1HL 3W81A 4OZGB 2W0FA 4BUHA 1IVLA 2W92A 2ZSWA 4RGNB 3GEWB 2D0HA 4Y5VA 3KGRA 3LCYA 1RY7B 4PJBE 1B3JA 1YEKH 1ZMYA 2BFVH 4RFEB 1BIIA 4JDVB 3JTSB 4FQJH 1Z9SA 5C3TA 1AI1H 5C0JB 3W5MA 3CCHA 4OQ1A 4Y2DC 3RBGA 2UWEF 3BPOC 3DV4B 3QO0A 2ZCKH 2P5EA 5D1QB 4G6AD 3UC0L 1O5DT 2NCMA 1Z0MA 4PRNB 1OGTB 1JBJA 3GKZA 5D7IB 2ZNXA 2FX9L 3CSGA 1D5MA 1ACYL 1KLUB 1YY8B 3K81A 1S7TB 2IPKB 5DFVD 1EFXB 3P2TA 4LAJH 1JWUB 1XGTB 3BH8B 2CLRA 3DSFH 4EN3D 3BSZL 4L3EA 4P4RB 3P3YA 2HVKA 3SN6N 1REIA 3VXMD 1F4WL 1OW0C 2FATH 1T89A 1OP9A 5FK9A 1BBDL 1GZQA 3ZL4L 1G84A 3MOBL 2JJSA 2F5AH 3D0LA 4YK4C 1JE6A 2Z9TA 3KPSD 5AYUL 1MCJA 3LPGA 4FQHA 3RVVC 2NW3B 1C5BL 2WUBL 2DN7A 1OW0A 3IRZA 4P23C 1UJTA 5LAXA 4Z0XA 2NZ9D 3SDAB 2ZOLA 4HS3A 5C0DB 1NC2B 4PUBL 4FMFA 5K9JL 4RGOL 4PV9B 4ZUTB 1F3RB 4P23A 3BW9B 5FYKU 1U58B 5D8JH 4KKBD 1E6OL 3EIFA 4J3TA 2ARJB 3BMVA 3BP6A 3LEVH 3IFLH 2XZAH 3QEQB 3QB7C 1F2QA 1WFUA 5DD3H 2CDFA 3E8UH 1K4DA 3AY4C 3CK0H 4M61A 5IJKC 1ZWIA 3SO3C 4RGND 2P8LA 1KLGA 2J6EA 3RVTD 1T21A 4X8JB 3S6CA 3GMQB 4FABH 5EOCH 3O8XC 4LSQL 2YBRB 3TBYB 5ADPL 5F9WC 2P5WA 3VXOA 3AY4A 5IJKA 4JVPA 4NYLB 5D1QD 1J86A 2WAHA 1AXSB 1GGYA 4H1LB 1T1WA 5EUOF 3DLQR 3O8XA 2HJLA 3P4MA 4P5TC 2VLJA 2VAAA 1KJVA 2W0LA 1UB5B 2AV7B 4N8VA 5FYLE 3C5ZB 3A6BH 1JYWA 1EZVX 1X5KA 5I8KL 3FQRA 4HF5L 5E8EA 5LBSH 1EFXD 5BVJA 2BY0A 5JHLH 3JV6A 4HSQA 3UDWC 1OVZA 4P5TA 2J5LC 5ICYA 1BFOA 4R7NA 1BM3L 1EHNA 4QRUA 5DJ8A 4IRJB 2BNRB 3CMOH 3ARBC 4XXCC 4Q6IC 1XT5A 2B0SL 4GRLA 2BJMH 4QWWC 3WSQL 4Z7NF 4GRMA 1QPPA 5GISL 5TDOB 3JTTA 4LPWA 5T3XD 3G5YA 3UDWA 4KUZL 2COQA 4IRZH 2Q8BL 4M1GL 3ARBA 4X6FA 4FFWD 4Q6IA 4XXCA 3SDAD 1M71B 1OPGL 3D3VA 3EGSA 5E6IA 5C0IA 5E8PB 1NC2D 1GOFA 1VEPA 1WWBX 2VIRA 3FRPA 4ZUVA 5TJWK 1H3GA 3RIAK 3IDYC 5ESQA 5BV7C 2PUQT 1MCEA 4Y19E 5JZ7C 5GJSH 1J8HA 3IFOA 4XWOC 5INDB 3KYKL 3UZVB 2EYTA 2VDRH 1X7QA 4JFOB 3KJ4C 4HG4J 4GXUN 3QEQD 3TIEB 4M8QB 1ZLVK 3OKKA 3P0GB 4NUGH 5DD5L 4TULH 4PRAA 3J7HA 3HI5L 5IIEA 2RJMA 1EERB 3W11C 5EG6C 2C3WA 3OKMB 3AXLB 3J8F7 2GQHA 4P2RE 1T4KA 5K9KB 3IDJB 1TVBB 2DOCA 4J3VA 5E6YA 2AQ1A 5I1GH 1I7ZA 3QPXH 3M45A 3R8QA 3V0AC 4LSRL 5FUCC 3EOAA 1FL6B 2DLFH 2VTFA 4WI6A 1B9ZA 2EYSA 3SDXE 4QRTA 3C5ZD 1MEXL 2KUTA 1EIBA 4XC3L 4YPGB 5C6WH 5CWSB 1CWVA 2M2DA 1HSBB 3EFFB 1Q1JL 5E8NB 4BK5A 4EN3C 3O2DA 1AGEB 1NH6A 2IPTL 2R2EB 1E4KC 3MJ7B 4IRJD 5DRNB 1OARH 4JZJC 2BNRD 2IH1B 4N0UA 5F89A 5DJXB 4EUPA 3KPNB 1KB9K 4YHKL 3MJ8A 1JZ4A 4EN3A 2ARWA 3LPWA 4OIBA 1E4KA 3VXMA 4N0CD 4JZJA 1FFPA 4M7LH 3U2SB 1A3LH 1S9KC 2NZ9C 4ZD3L 4X6BA 4MD5A 1JWMB 4L4JA 3KPSA 2HJKB 2VOTA 2Y06L 4CJ0A 1LEIB 2OK0H 4NZDA 1AD9B 1WCBA 3CX2A 3NCJH 4OCYL 4HPOH 1H0DA 1LO0L 4XP4L 2V5SA 1SEBA 4KKBC 4DK6A 3VGBA 1FVEA 4LGSB 3SBWC 1MCSA 1Y18A 1NCCL 4FQ2H 4NQSA 1CFTA 4ZQKB 5EO9B 3BYYA 2WSKA 4D2NA 2DQHH 4QF1A 5J3HD 4P2YA 1A64A 4KRLB 4XNUH 4RGNC 1B0GA 4JY4A 4K9EL 2XZCH 3PGCB 3SBWA 1YEJH 4OLWL 3E3QC 4OZGA 5B39B 2MQCA 2MPAH 1IEBA 4JLRB 5D1QC 3VFGH 4RFEA 3QNZB 4JDVA 3JTSA 2F5BL 4PJ8B 3L1OH 5C0JA 4LVOB 2JJUA 3DV4A 2VDLH 5D1QA 3RY5A 4DTGH 4PJHE 2AJUH 1QP1A 1QLFB 3MRIB 4PRNA 1OGTA 4PRHB 5D7IA 4X99B 4X5WB 3ARDC 4FXLA 1KLUA 1BX2B 1YY8A 3WIHH 2IPKA 4KQ3L 1T0NB 1JWUA 1XGTA 1FNEB 3BH8A 3DURB 1LO2L 2DQCL 3CFJB 2KZWA 3BUTA 2QADB 2VUOA 4OCXH 4FFWC 4NO3B 5ICXB 1ORQB 2Q20A 1AY1L 3EYQD 2NW3A 1FLRH 2EO1A 2NW2B 4NM8L 3I84A 4HG4K 4E41B 4LKXB 3E6HB 1MCWW 1DZBA 1HH9B 3SDAA 1XIWC 3NCEB 4Y4KC 5C0DA 1NC2A 1KXVC 1RZIB 4PV9A 4YX2H 3WN5B 4UV7L 3BW9A 1U58A 2DLEA 1CD8A 2NY1C 4NKMB 4KK9C 2ARJA 2A9NH 3F58L 3TWCH 4M1DL 3QEQA 4M43L 1KCSH 1NCBL 2NPLX 1RMFH 1OAZL 3SQOL 1VFOA 1QKZH 2K1MA 5SX4I 4X8JA 3GMQA 1RZJL 2R4RH 2YBRA 3TBYA 4PJ8D 4LASL 3C5ZC 3GHEL 4OB5H 1AXSA 1KIPB 4H1LA 1CU4H 2XIDA 5HHVL 4HMEA 4PRHD 2EDBA 4NZRH 4XPFL 1UB5A 2AV7A 4M3JA 4IMLA 3C5ZA 3Q6FB 5I6XB 3NMEA 4O4YL 5SX5K 4UNUA 1MCDA 1MCOL 3CC5B 4XMKL 4CADB 1K6QH 4N0CC 2BNRA 2QADD 3CLEL 1AR2A 4JN2B 3QI9C 2VC2H 1PX3A 1R5VB 2I5YH 5I71B 5TDOA 4Z8FL 4LVNC 3IVKB 5FUOH 2XKUA 3MXVH 4UT9L 1B4JL 4LCWA 3K4AA 3IDMB 4E41D 5JQ6H 3ZDXF 5HYQB 4YXLL 3QI9A 1M71A 3C6LB 1MAKA 2V17H 4G8IB 2A77L 3MNWB 3BE1H 4FQXB 4DAGH 1EO5A 4RISL 2EH8H 1MVUA 4P46D 1UWGL 3EJZD 5JDSB 4ZTPL 4KZEH 5A3ID 4PJXF 1SJVA 4F37K 4OLZH 3VMNA 1RU9H 5INDA 3TJEH 4PLOB 5KOVC 3AUVA 1CLZH 1X4XA 1ZTXL 4G43B 1KCUH 5ALBH 4OZFB 5KN5B 3GFUA 4X4MA 3EAKA 4QGYA 3TIEA 4M8QA 5L6YL 4TOYH 3VXRB 5A16A 2R15A 2HFEB 3ARVA 1KTLB 4Q9RH 3OKMA 1P69B 5A2LH 1KEGL 3AXLA 4ZO9A 4WTZA 5K9KA 1NKOA 3UJIH 3IDJA 1TVBA 1X3DA 3FJTA 2A38A 1FYTE 4WV1B 1RAMA 3HNSH 1CFSB 3FZUC 4BYHA 5K9QI 1RUPL 4P5MB 2J88H 4MD0B 4G6KH 4IJ3B 3I3BA 5HHOE 1LNUB 2HJFB 4WY7H 1CICC 1TJIL 2YXFA 5CEZH 1TNNA 4HWNA 2FO1A 2AGJH 1F6LL 4YPGA 4MXQC 5CWSA 1G6RB 3C60B 3KPPB 1HSBA 4NJ9H 3EFFA 4NZJA 4PIRF 5E8NA 1AGEA 2R2EA 3T3MF 3MJ7A 5DRNA 3L3GB 5EA0L 4M6AA 2D7QA 5FYJU 5DJXA 3QQ3B 5B21A 3KPNA 2LTQB 3OAZK 1WEJL 3EYQC 3SE4C 3L5XH 3NCFB 4Z0BH 2X42A 1FP5A 3U2SA 3DO7B 2M8XA 3C6LD 1JWMA 4FQXD 2YA1A 2HJKA 4XX1G 1ZGLM 1LEIA 3V0WH 2WWKT 4KKCC 2EDFA 3MR9B 3SE4A 3V6BR 1AD9A 1R3JB 5HYEA 5C86A 2WP3O 4JDZB 3GSOB 3EHBD 2QV2A 5EO9A 2P8MB 3DVIA 4M7JH 5I1CL 4D3CH 4F7MB 3BPLB 3WFDH 4JJ5A 3GRWL 4JGUA 2C3HA 4TSAL 4YFEA 3PGCA 4X83A 1EH9A 3ARUA 1KTRL 3THMH 4A2MA 3HG1E 2VZ1A 3ARYA 1LO4L 4LVOC 5B39A 4XB8A 3KYNB 4JLRA 2FO4B 2IAMB 2ZUVA 1FG9C 1NBVL 3MA7B 2FYYB 3QNZA 3FO1B 4PJ8A 1UM6H 1PLGL 3T08A 4LCUB 1CG9A 4OLYH 4UILH 4QRPE 3EYUL 3C60D 1QLFA 3O3UN 3MRIA 4I9WD 4OT1L 1JYVA 2FX8L 4PJFB 2X7LA 2P48B 4PRHA 3IDUA 3DHJA 5DQDH 3UP1A 3DYOA 4X99A 4U49A 4X5WA 2QADC 3OWEA 3MLVH 3U0TB 4KY1L 2Q87A 1BX2A 3BYTA 5AWNL 1T0NA 4KROB 5M95B 1FNEA 2FEDD 3SDYH 4LU5H 1F58L 3CFJA 4U1SB 1FE8L 3DHMA 4NO3A 1ORQA 5ICXA 3LDBB 1BAFL 4GOSA 3GIZH 1IQWH 3KWWB 1TZIB 3WN5C 2NW2A 2JJTC 3B9EA 4E41A 4LKXA 2I27N 3E6HA 3FN0L 1HH9A 3ECBB 1ZOXA 3MCLL 3VD9A 5D72L 5J11C 1RZIA 3TYFB 2JELH 4XVSH 1FH5L 3WN5A 1D5IL 2JJTA 5TGBB 4WDIB 2LVCA 2E8YA 4NKMA 1DL7H 4IMKA 2KL6A 4ZTOL 2Q3ZA 2PNDA 2BMKB 4QEGA 3MNZB 5GRXG 2ATKB 5J9PB 2J6EL 1KF9B 4MJ4A 5DO2C 1A7RH 2JF1A 3G5ZB 2C1PB 4NGHH 1EGJH 1JUFB 2IAMD 3MNVB 2B8OT 5EZJA 3H0TB 3U36B 4Y5YB 2O5XL 5CD3B 5C2UB 4XVTL 5CGYD 3T2QA 3FTGB 1I4FB 4EUPG 5CJQH 1U8LB 3BGMB 3O6ML 4PJDB 2GY5A 3QPQD 3SE8H 4MCZB 4RMSA 5C08E 1FNAA 1KIPA 5HPMB 2WBJC 5DGRA 3EJYC 4YEEA 1QBMH 4Q0XH 4LSSH 1CGYA 4WUUB 1CDCA 3RX8A 1DQLH 2O93L 4XHQA 5TFSH 5L0QC 3Q6FA 4UIKH 1WWWX 4H20L 4HWZA 3S37L 4C59B 2ICWJ 4HUMB 5I71C 4KROD 4KTEL 1A6VL 4NNXA 3LRHA 5EBGA 4OGZA 4CADA 2V9QA 3QXWA 5ANME 3MLYH 3BDYL 4JN2A 4RMWA 4AMKH 1J8KA 3C6LC 5M7QA 1R5VA 1MJUH 4JFHD 1ERNA 4OLUL 3IVKA 3VG0L 1W0WB 4JO4L 3RKPA 3IDMA 4HWEL 2BSSB 5HYQA 3FCTA 1NSNL 4HMDA 5T5FL 4YUEL 3C6LA 4J6RL 4WEUD 1MNUL 5DHYB 4G8IA 5C0BE 4X9IA 3MNWA 4FQXA 4Q9BA 1JZ8A 5JDSA 3C8KB 2DLIA 5IMLB 3VGGA 3VGDA 3D39B 4G43A 4BZ1H 1BZ7A 4WENB 4OZFA 5KN5A 5EIIB 4LEOB 3ULVF 2P5EE 3VXRA 1FL3B 2HFEA 1J87A 2ZUYA 3L3HB 5GIRB 1KTLA 4WGVB 2EDKA 2X40A 3MA9H 1NMCB 4R6UA 2VDOL 4IJ3C 4UI2A 1CFSA 3RY6C 4L8SB 4P5MA 2AEPL 4MD0A 1S7XA 1T0MB 3C60C 3FT3B 3N1GC 1HQ4B 4HZAA 5JOPE 3DX9B 4WUUD 3ZKXB 5F7EH 1LNUA 3I2CH 3RBSA 5CKAA 5IOPB 4DVRL 1BZ9B 3RY6A 4J7RA 1DTUA 2DLHA 3O2DL 2HLFD 5JOFB 1CQYA 2LTQC 4NBXB 4XWGL 1G6RA 3C60A 2VR9A 3KPPA 3SGDI 5HSFA 2AJYH 2FEDC 4V2BA 1P7KA 5I2IB 3O2VH 1OTTC 3O4LB 4WW1B 3L3GA 5KS9E 2J1KA 4X9BA 1S3KL 3HZYB 3HR6A 1RIVL 2VXTH 4NO5A 3PHOB 4KQ4H 1YJDH 3VFWA 3MQIA 1U8IB 1LEKB 5H37H 3T0EE 4TVPH 2F9BT 3DO7A 1F00I 2XTJE 2OBGA 1EJOL 2IBBA 3MR9A 3NAAH 4KDWA 4KU1A 2OZ4H 1AO7B 3T09A 3BPLC 2EDOA 3D39D 4WWKC 4JDZA 2GCYB 3GSOA 4G80B 2EXWD 2CD0A 2DQJL 4LOUD 2P8MA 2F58L 3OTTA 1FG2B 4GKNA 1AKJB 1PEWA 2V5TA 1G7PB 1CGVA 4F7MA 3L5WB 4EIZC 4H1LG 1CR9H 1FNGB 2NLJB 4U1IB 2NY3B 2ZJSH 4Q6YA 4PD4J 4S1SL 3N85L 3RP1A 4XBGB 2EDJA 3UCRA 1F3JB 3RI5F 1IGJB 5CGYC 1KPRB 2OS7A 3K4ZA 2G75B 3KYNA 2FO4A 4I1NB 3QWQB 1DBAL 5TPWH 2IAMA 1K4CB 4HGMA 3QPQC 3VXSB 4UU9B 3FQTB 3MA7A 2FYYA 4UNTA 1M1SA 1JPSL 1EBPA 3FO1A 1XGUB 2J2ZA 3UTQB 2ZPKL 3MUGB 2H2SD 4LCUA 4F57H 5BVPH 5IR1B 1Q9KB 3GSQB 4GAGL 3LS4L 4OCMC 3B5TA 4PJFA 3ARFC 4ZFOB 1MLBB 3AS1A 3PXHA 2H1PL 3O4LD 4WFED 5LWYH 1QEWA 3FO9B 1HCFX 2FSEB 5I19H 1QACA 3U0TA 4MJ5B 3HUJF 1BQLH 1RURH 3DI3B 3X13B 5C9JB 3DETD 5CCKH 1IILE 2DMCA 4K94H 2FGZA 3ARFA 1J8HE 2NY7L 5B4MD 5IMKB 4HUWA 4KJYB 3WJJC 3QUZB 4G6FB 4U1SA 5ESVB 3U9PL 1L7TL 2XPGB 1I9JH 1J10A 3WYRA 4HBCL 1U92B 3KWWA 1QLRB 1RUKL 4N5EC 3WJJA 5FYJH 1I1YB 2R1XA 3LMJL 1IJ9A 3GMLB 5F70A 3ECBA 3CDGB 4ZNCD 4XC1L 2IPUK 4EOWL 2VMFA 3TYFA 3RVUC 3R1GH 2BVUA 4Z76B 2MJWA 5TGBA 5DZLA 4WDIA 4KC3B 4OJFH 1AKJD 4X0KB 1U9KA 2BVPB 2GJJA 4XRCB 5EZOH 2DRUA 1YYML 3IDNB 4Q9QH 1EHXA 2RR3A 4YHYC 2BMKA 2O5ZL 3MNZA 3WCYA 2ATKA 5DJCA 5J9PA 1A7QH 1NBQA 4D9QD 4JFEE 3TV3L 4DW2L 1T2JA 4JPVH 4ODSL 3G5ZA 4LPVA 4OSUH 5FUCE 2C1PA 3L5JA 5D5MF 4MJ2A 4CN1A 1JUFA 5JNYB 3MNVA 4IDLA 3VXSD 3H0TA 3WBDA 3U36A 2E27H 2GITB 4Y5YA 3F62A 5TF0A 5DT1L 2NY4C 5CD3A 1D6VH 2Z8SA 5EUOE 5GRUH 1KYOJ 1I4FA 3FTGA 3RU8L 1AH1A 1U8LA 3BGMA 3GSVB 4NQCB 1RUMH 4PJDA 4NQVB 2HLFC 4GW5B 2BY2A 5HPMA 1IRAY 1KB5H 2FBOJ 2AK4E 4HWBH 3NIDF 5BRZB 2IFFL 2PR4H 4WUUA 3BQUB 5EORH 1F97A 4XPGL 1UA6L 3KPSE 5DDHB 1YEDB 1TQCB 4IRSB 3V7MA 1NGZB 5JXAL 4GW4B 3MRRB 3IFNL 5IT2L 1U8JB 4Z7NE 1H8SA 1YEEH 1U2CA 3R0MA 4G6FD 4G7YL 4LKCB 5AG9A 2XTLA 1CGUA 1TJHH 3IJSB 5I18H 2EH7L 2OR9H 1W0WA 4NUJB 3QHFL 2LAAA 5FYKD 1NANI 3MLZH 2BSSA 5IHZB 4OD3L 5DHYA 4LFHD 4FP8H 4NHUB 1PEZA 2EXWC 5BMFL 1W72L 1WZ1H 4HS6B 4PD4K 3C8KA 4LOUC 5B39G 4RGNE 3HC3L 1I1AB 3RL2B 4KTDH 5IMLA 1CE1L 1RJLB 4BSWB 5FKPB 3D39A 3QCVH 3E3QE 5GS0D 2CLVB 4LCIH 3VFMB 4P9HC 4JY5H 4NCC2 1NMCC 2PO6B 5EIIA 3TIDB 4LEOA 2JJVA 2CJUL 1FL3A 1C8PA 5EU5B 5F96L 3L3HA 5GIRA 4P2OB 4MAYB 2HVJA 4L8SC 3HAEH 1HNFA 5CGTA 3TNNB 2J7LA 5D7IE 1KULA 4NHCL 2DB8A 4O02H 2D4FA 4Q58C 3V2AR 1GGTA 3ZKXC 1NAKH 3L95B 4D9LH 1L7IL 1Q0YH 2CK0L 4CUCA 1CDGA 5LKNA 4TNVF 4NQCD 2H2SC 4L8SA 2VDQH 1FC2D 1F3DJ 1J12A 2Y07L 1Y0LA 1T0MA 1ZT4B 4ONGH 4PJ9B 3FT3A 4Y1AB 2BXZA 1HQ4A 5MI0B 5BRZD 3DX9A 3BQUD 1T2QH 4FG6D 2VN7A 1R3HB 5IOPA 1BZ9A 5T3XE 4IRSD 3AMKA 5JOFA 4PJ7B 3DETC 4KRNA 3P4LA 5AZEL 1MRDL 4X6DB 5B4MC 5I2IA 1IFHL 3O4LA 3DTXB 4WW1A 1OTSD 5TE4L 3IJHB 3QEHB 3HZYA 1L0XA 2YK1H 5D2NC 5CEXB 5DZOA 5J6HB 3PHOA 5I74C 1U8IA 1LEKA 2VN4A 1YUHB 4RCAA 4AEEA 1MAMH 1RZKH 2HT2D 3QEQE 1CLYH 2NNAB 2XACC 4U6YB 4X4ZA 3ZLQC 2CIKB 4MQ7B 5FOBA 4KV5F 1EBAA 4HJJL 4U6VL 1I1AD 1A7NL 4N8CH 1AO7A 3LN5B 4CU8A 1QSEE 1P4BL 1BP3B 4MWFB 4M62H 2GCYA 4MB5A 4XB7A 2NY3C 3TYGH 5KVEL 3MLRL 2PO6D 4HCRA 1FG2A 3X14B 2QSCH 1AKJA 4JG0H 1G7PA 4P2OD 4MAYD 2YZ8A 3F7VB 1KYOK 1FNGA 2NLJA 4ZS7H 4U1IA 4WWID 4XBGA 2YUWA 4ZFFB 4LVHB 4NOFA 1JHLL 1F3JA 3IJYB 1IGJA 1DFBL 1TZGH 1KPRA 3IU3B 4WI2A 3TC9A 5FEBA 2G75A 3UPCA 1K4CA 4PJEB 4R3SB 3VXSA 4UU9A 3FQTA 5IQ7H 1YN7B 4PJ9D 4Y1AD 1Q72L 1XGUA 2NTSP 3UTQA 1CXIA 4AYFA 1QLEL 3MUGA 3TGXA 4PB0L 5E08H 4LRIA 5IR1A 1Q9KA 1YDPB 3B9DA 3GSQA 3NPZB 4LCWE 1RVFH 1UKQA 3KPQB 4ZFOA 1MLBA 3C2SA 3RDTD 2VSCA 4K7PX 5LXGL 3I02B 2DQGH 3QUZC 4PRIE 4Z7UF 2FSEA 4W6YB 2APXA 4U2ZA 4MJ5A 4Q2ZA 3X13A 5C9JA 5GRJH 2DWEA 1FSKC 1TXKA 4G8GB 1DVFB 3T8XA 1Y6KR 2YMXH 5IMKA 4KJYA 2D7MA 1MIMH 3H9SE 5CEYB 3QUZA 1BJ1H 2DBLH 1JK8B 4MA7H 5ESVA 2XPGA 3D87B 4OZFG 5E2WL 1T1YB 1JTTA 4KJQD 1DEDA 3OR7B 4JFPB 1QLRA 5D4QA 5DD1H 3OZ9L 1P5VA 1I1YA 2Z8RA 4W6WB 2G60L 1FPTH 1ZVHA 3OJVC 3TT1H 3CDGA 3MFFB 4OGYL 2B1HH 2VZVA 4GRWF 5GS0C 4Z76A 4G8EB 5IWLC 4X0KA 5SWQB 2BVPA 1JRHL 5FO9B 3KLAB 2W0PA 4XRCA 4KI5D 4MB3A 4HULB 3IDNA 4UB0H 2P42B 4UAOB 2V6HA 4PJIF 3D9AL 2FBJH 3CXHJ 1OOAA 1FCCA 1S7RB 4QXGL 3TJHD 1DBKH 1PKQE 1W0VB 1C1EL 5JNYA 1SJEB 4ODVL 4PB9L 2R8SL 1WFTA 4PTTB 2GITA 2Y9RT 4GQ9L 5MENE 1IQDB 1AC0A 4L8BB 3PHSA 3BQUC 4X6EA 3V52L 4OF6A 3MV01 4WHTA 1DP0A 2CXKA 3GSVA 4NQCA 3RUGB 4NQVA 1TQCC 4IRSC 1NAMB 3PGDB 3IYLW 3RGHA 4GW5A 2F19H 4EXPX 4TSBL 4W4OA 2E7HA 3PABB 1QA9B 2BY1A 5BRZA 5DMIL 3BQUA 4XPBL 2Q76A 5DDHA 1OTSC 1YEDA 4IRSA 2V2WB 7FABL 1G1CA 4G8GD 1NGZA 5F97E 4K2UL 1DVFD 3MMEB 2V9RA 2KQMA 4GW4A 4MVBD 3MRRA 3LD8C 2R0KL 4LKCA 5I15L 1G0YR 2IJ0C 3IJSA 1C16B 2HT2C 4JRWA 3ZDXE 1FBIL 2B2XH 4NUJA 4JFFE 3BAEH 3IRPX 4FZ8H 1HHGB 1NUNB 1HINH 4U0RB 4Y16C 1IEAB 5K9QG 5B22A 4E42B 4CAGA 4JPWH 5IHZA 1FFNB 5EWIH 4PJXE 4WEBH 3S37X 5HHQB 4Z7WB 5HJ3A 4NHUA 5HHME 4UTBL 2Q7YB 3OAUH 3GHBH 2PO6C 4G5ZL 2IQ9H 4HS6A 1ZLVH 1QFWI 1I1AA 4M6NH 1QBLH 2EE3A 3RL2A 3OXRB 4M7LT 1RJLA 4P2OC 5FKPA 4JJHA