4YLQT

Crystal structure of a fviia-trypsin chimera (ft) in complex with soluble tissue factor
Total Genus 47
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
47
sequence length
210
structure length
210
Chain Sequence
SGTTNTVAAYNLTWKSTNFKTILEWEPKPVNQVYTVQISTKSGDWKSKCFYTTDTECDLTDEIVKDVKQTYLARVFSYPAGNVESTGSAGEPLYENSPEFTPYLETNLGQPTIQSFEQVGTKVNVTVEDERTLVRRNNTFLSLRDVFGKDLIYTLYYWKSSSSGKKTAKTNTNEFLIDVDKGENYCFSVQAVIPSRTVNRKSTDSPVECM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Molecular Basis of Enhanced Activity in Factor VIIa-Trypsin Variants Conveys Insights into Tissue Factor-mediated Allosteric Regulation of Factor VIIa Activity.
pubmed doi rcsb
molecule keywords Coagulation factor VII
molecule tags Hydrolase
source organism Homo sapiens
total genus 47
structure length 210
sequence length 210
ec nomenclature
pdb deposition date 2015-03-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
T PF09294 Interfer-bind Interferon-alpha/beta receptor, fibronectin type III
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ylqT01
2.60.40.10 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulins 4ylqT02
3LAFA 3CFKA 1T6WA 2EDOA 1NMBH 4C56A 1OAUH 3RIFF 1X5GA 4Y4FD 4RMVA 4CN4A 4KVCL 5CJQL 2WINA 1I8KA 2IWGA 2OL3H 3ZKMD 4Y5YA 1Z5LA 5DMKA 1JCKA 1MIEL 2NY1D 3B6SB 1DLHB 3KJ4C 3MODH 4FQCL 2XICA 2J7LA 4TULL 1MWAA 1GGBL 3FRUA 5JHDD 4MD0A 3GRWL 3TBWB 1BEYH 1KIUA 5T1MB 3GSVA 4LEXH 3PGCB 5TDOB 1PYWA 2Z31A 1OQOA 1RZFH 2BNUA 1X6NA 4KRMB 1QO3B 2Q87A 2R0WL 4P3DB 1FIGL 2A0LC 2F74B 2DLEA 1AKJB 1UM4L 3QIBC 1NL0L 3V8CA 3NCMA 1ZLUK 3OXRA 5T3XD 3R8QA 1XGPA 4FTVB 3TZVA 4M1DL 4D3CH 3NIDE 4PJ5B 3FFCA 4ODHH 1DUYA 1H3WM 1P84K 1YNKH 1CCZA 4QRTB 4NKOB 1K8IB 1QFUL 4LAJH 4HZAA 5C6TH 2X70B 5D70H 4J1UB 4MJ6A 1PG7H 3HZMB 2W9EL 3RBGA 1FP5A 2BJML 1UCBL 3ARUA 3CDFA 3IETA 1FDLL 4KI5F 5E5UB 3U1SH 3O4LE 4CU6A 3VXNA 4H5SB 1RUAL 3C5SB 4MCYA 3O3BA 1ZANH 2E3VA 1EHNA 1P9MC 4ZO6A 5MEPA 1YUHA 1U92A 3L7FB 1HYRC 4NN6B 1AO7B 4NO5A 4Z95L 3IDNB 1FRGH 4EN3A 1J1XH 3PABA 2CRYA 1XF2B 43CAB 5DS8B 1X5LA 4L29B 4XPHL 3HI1B 4G8IB 4LKXA 1Q0YH 3VXSE 3QR2A 3N06B 4R7NA 4J23A 4UB0H 2C3VA 1E4WL 5HPMA 2FEDC 1OAXL 2HRPH 3SCMA 1KB9J 4F7EB 4FA8A 1I8MA 1A6ZA 3MBXL 4KH2A 3BISA 5J8OA 3FQNA 4M7KH 2J12B 3S3JA 3FTGA 4NCC1 5BS0A 1U42A 1P1ZB 3TBTA 2BY2A 2R2HB 1UJ3A 4HUVB 3IFPB 3MA9H 1ZK9A 4XNYL 5FYJE 3VD4A 2B20A 3S36X 1DQDL 1QSVA 1M05B 5ESVA 1LO2L 1DZBA 1Y18A 4XCFL 5T3ZE 1UXWB 2LV4A 5M7QA 1C16A 2ILLA 3ZYIA 3MRCB 3VXUA 1I85A 2CKBB 5T1DL 3C2AL 3MV8B 4OZIF 1S7UB 3IYLW 3TLRA 1JRHL 4XVJL 1N6VA 2BDNL 2YRPA 3CZFA 1YQ2A 2Q8BL 3LKNA 1A1NA 2YPLA 1U58A 3IFNH 1BIIA 4UILL 5LG1A 5I9QB 1R3LB 1TNNA 2N1KA 3SKNA 3FONA 3IXAA 4KJPD 2X9WA 1D6EB 5D2LA 1FPTL 3MRPA 5I16B 1OD9A 5GJTH 5DVKA 3U7YL 3AAZA 5I76B 2FRGP 2CDFA 5F7WC 1C12A 3K2UL 1MHCA 4YHML 4Y5VA 4NYLA 2HKFL 2HYMA 4HXAH 3SBWC 2F54E 3FRPA 5IWLA 3OKNB 1TCMA 1YEGH 4LRIA 1GSMA 2DL2A 3KYOB 4LCWB 5F21B 4X7EC 3PWUB 5D7IE 5LBSH 4ELMA 5IV2B 3WHE0 3GK8L 1FGVL 3FFDB 2XZCH 4HGKC 4JFXA 5E6ID 1QR1A 1XGTB 5IFHL 3K8MA 4M6NH 4F80A 4IMLA 1N64H 3VFPA 5KSBE 2IANE 2R4RH 5KJRL 2F58L 5FKAA 4IHOA 4KDTA 1MVUA 4JRXE 4HS3A 5BRZB 3RDTD 2M2DA 4X6DF 3NIFE 1U93A 3ZE2E 2DD8H 4KHTH 2BSED 4S1DD 2GI7A 1F02I 1HEZA 5DD1H 4BK5A 4YHPB 4Y16C 1X5KA 1I7RB 1EUTA 1DLHA 5K9JL 1A1OB 1VFAA 5T1LD 4LNVA 1Z3GL 1EXUA 5CGYC 2O61A 4D9RE 3FN0L 1MCPH 4ACPA 3OZ9L 1F6LL 3D3VD 1IE5A 2O5ZH 3JTSA 5E5MA 4KHXH 2QSVA 2EO9A 1RVFH 4B50A 4KVNH 1UXSA 1KJMA 1EUUA 1IGYB 1N26A 3B4NA 3HZYA 1I1YA 3C6LB 3UYPA 1TVHA 1AKJA 5GQBA 4G9FB 2NY0D 2VLJB 2EDNA 4Z7NE 5D2NB 1UFUA 3IFLH 4LVEA 4DGIH 4G6ML 1WVZA 3O0RL 2BSRA 4PYHA 3HUJF 4KGJA 4BSJA 3DOSA 2XN9D 2EE9A 4N8CL 3MRIB 1NMAH 3T0EC 2AXGA 4UIMB 2Y6SD 5ENWB 1NCTA 3ULSA 3UZVB 4I2XA 3QWOA 3T0EE 4NZRL 4BZ1H 4ZSOA 2H2SD 1P6FA 1RIVH 4NKQB 4J1UA 2ZG2A 1OCWL 2DKSA 5D96C 3B3IB 2DQGL 3O2DL 1MREH 3L95B 4MXVE 3MPCA 1EBPA 3ARGC 4U1HA 2FATL 4TRPH 1QZ1A 4W6YB 3NACL 2Y36H 3HC3H 4QXTB 5JW4N 1JJUA 1GJIA 3R1GL 4Y4HA 3KR3H 3V52L 2HP4A 4OFDA 1I7UB 3AY4C 2DOCA 5TFSL 1YNLL 3VH8G 3QUZC 3MGOA 1OL0A 3TP4A 3SPVB 1SJVA 4MD4B 3AS2A 1S7QB 5DS8A 4PJCE 4ETQA 2Y1VA 4HKBA 2VZ3A 1NFIA 4Q6IC 5FF6A 1EEZA 5DJAB 4OZHB 1A9EA 4L8SA 4GRWF 3FQXB 5EUKA 5IVNA 4ONHA 3S34H 1YEJH 5J89A 1MRDL 5EC2A 1QFPA 1Y6NR 5AAMA 4JFOB 3PXJA 1UQSB 1W8NA 1NC2B 1UEMA 1TTUA 4FQQB 7FABL 2V5MA 2YUXA 1QRND 5IHUL 1Q72L 1YEEL 5C0BE 4X6CE 4WFFE 5L2KE 3KPMB 1G7PA 5J1AA 1MRFL 3BPNB 4XBGB 5HHNB 1YDPA 2I9TB 3PDOB 4LSPH 2EH7H 2QBWA 4X8JB 3MRCA 3LQAL 1F4YL 2D7MA 1BX2A 2ZUQB 4L4VD 2VDLL 2AXFB 5HHOA 1NUDA 2X4TA 5EU5B 4Q9QH 1PQZA 1HH6B 1A6TB 5CP7B 1IT9H 4DFHA 2IALB 4OQTL 5AUMB 4OCXH 5J12B 2AABL 4F7MA 3V5KA 4HK3N 3SDYH 3N1GC 2D0FA 4JN1H 4G43B 4O00A 5HDLA 2OK0H 4JRYA 2DN7A 4DZ8A 1JZ8A 3FB8A 2VTFA 1D9KC 5ITFA 2GSGA 3PP4L 3WL9A 4OZ4B 1X5HA 1KLFA 3VXRE 4JKKA 3OKNA 4HIEA 3RU8H 1LE9A 1QYGL 3HG1E 1DLFH 1B9ZA 1H3XA 4Z8FH 5KVDL 1AXTL 1NCBL 1U8QA 4LF3A 3TT3L 5ADPH 1DE4B 5IIEB 4QRRB 3QUMA 1F8TH 3DV4B 5IMLA 2H41A 3HI6L 5ADOH 3RA7H 4XNMB 4P2OB 1QLEL 5FM5O 3J8F7 2FWOB 4WNQB 4D9QD 2HLAB 1IARB 4Y4FB 3TBYA 3GSWA 4EOWL 1G0DA 2X4PA 5GGQH 8FABB 3OJDB 1HHJA 3WFBL 2RBLA 4I5BA 2BOCB 4YBQC 1A1OA 3HE7B 1OP3H 4YNYA 4HZLB 4BH7B 5J4MA 5HYSB 2BVPA 4PJ8A 1NBZA 4PJFE 1S7WA 3MRRA 4AL8H 3BZEB 2IQAA 2P47B 4XMPH 1ETZB 4QHNB 4UV4L 1CD0A 4KXZH 1IGCH 1R5IA 5D71H 3S4SG 2V2TB 3BN3B 1G9NL 2XWJB 5CWSB 5DD0L 3C6LA 4DAGH 3QDGA 2G60H 4LEOA 1U8IA 3TGXA 3AFLA 3BFOA 3DARA 2VXTH 3KLAA 1NC4D 1QPXA 5D7KE 3WIHL 1CLCA 3BD3A 3QCVH 4QHMB 1MIEH 5GS0D 1T66D 2IPUG 3QUYA 1OP3K 4HCRL 3U48A 2AK4B 3EYFB 5F3BA 1CFQA 4TULH 1K9TA 1GGBH 1R5VB 4JVPA 5KZCD 3GRWH 4YDLC 2BSSA 3L95A 5J6HB 3WXVH 5EZLA 3P4NB 5HY9B 2H9GA 2N56A 4AENB 5CJXA 5ETUA 4QRPA 4X7TA 1EZVY 3QIUC 4QTHA 2ZNXA 2IFGA 3THML 3VI3E 1FIGH 1AXIB 2MKLC 1UM4H 4RQQB 2W60A 5CJOL 2D7PA 1NL0H 2XA3A 5JW5A 3GIZL 4FQLL 4WWID 3G5YA 2X4SB 4HPOL 2GT9B 4KKBC 4BFBD 4M1DH 1WWAX 3SPVA 4J4PD 1FFNB 5IBTL 1NGYA 2HN7A 3STLB 5IMKB 1Z0NA 1TZIB 3NIGE 4FG6D 4OZHA 3U9UB 4YC2C 3L3DB 3H9SD 3JV6B 4DUWA 1IZJA 5IF0B 3RWJB 1IAOA 1T2XA 4I3RH 5K9QG 2W9EH 4ZTOL 2QQNH 3VDAA 3ZKND 1XF5A 1UCBH 4HH9A 1LEIB 3CPLA 4TNWF 1FDLH 1NGWB 2XZQL 3CU7A 4OZGF 3I84A 4KRPB 3EKCA 5E2VL 3WKML 4AT6B 4EI5C 4JCMA 3UTPD 5FEBA 4JPWL 3WV0A 4AQOA 1I3RA 3MO1B 3KHQA 5HHNA 3I85A 2OYPA 3I9GL 1CLYL 4ODXA 4M93B 3AROA 4XPHH 5DFTA 5CJ8A 3D18B 4YK4C 5DSCA 5FGRA 3MRDB 3QFJE 1EH9A 3HR5A 3VW3L 4ZFOA 5DFVD 1E4WH 1Q9OA 1OAXH 4FQPA 5A2LH 1LK3L 2VABB 1H3PL 1Q9WB 1F4WL 3CXDL 5CINL 1G84A 4BQ9A 3H7BB 3T0VA 4PJGB 2IADB 1DDHB 3MBXH 4DGVL 4OZIA 5HGHA 4XMKH 2OS7A 4NHCH 5GSVB 1KT2B 4F33B 1ODAA 3CGTA 3S7GA 5I1IL 4U6VL 4UUJB 2V5SA 2DKUA 4XNYH 1I3VA 4AEFA 4PRID 4HPYL 5KAQG 1I1FA 3JV5A 2PF6A 5CEYA 5K9OB 1VEPA 4XCFH 5E4EB 4LNRA 1F3RB 3DRTA 4ZUUB 5AYUL 1CICA 1R3KB 3BQUC 4C83A 5ICZA 3BH9B 5CUSL 5T1DH 3C2AH 3FO2A 1VADB 3OR7A 4LK4A 4XVTL 1H0DA 2GW5A 1AGDB 1JRHH 4GKZB 3FAXA 4XVJH 2Q8AL 1U95B 5E6IB 2ED8A 2XQBL 2Q8BH 3PP3H 2PCPA 4ODVL 3IXTB 4M3JA 4UILH 1DQJA 2BRRH 1BQLL 4KY1L 2ARWA 5FOJA 3T1WA 3DJ9A 3K80A 2QKIB 5TDNB 5BV7B 4EQ2A 1QNZL 3HB3D 5HYJE 3RDTB 1MFDL 4F37F 5CCKL 1NDGB 4G42B 3V0WH 5GS1A 1U3JA 3FCTB 3I02A 5CIPA 1MI5E 3Q48A 2Z8RA 3BWUC 1JBJA 3LEXA 2YUWA 4HIIB 3K2UH 1Z9SA 2B1HL 1RK0A 2E7CA 4IOIB 4YHMH 5T1LB 1A47A 1FN4B 3SJVE 5IFJA 4X6EA 4X6FB 1MCWM 5CSZB 5JHDA 1JK8B 4O51A 3RUGF 4HWUA 4LPTA 3D3VB 4NOBA 2O5XL 2PO6A 2APVA 3PWVB 4X5XB 5FGBC 3X14B 4BA8A 1A3QA 3TFKD 1RD6A 4WI5A 3QH3A 2GITB 2ZSVA 2QADC 5JTWA 4X6DA 1DEDA 1FCCA 3GK8H 2WIMA 5EN2B 4K7FB 2Z35A 5HTSA 4PG9B 1IGMH 1N59B 4Z7VE 2D4FA 5EUOB 5C07E 5IFHH 2NY0B 1U2CA 3F5WA 4XVSL 2B1AH 5IKCA 2DB8A 3RVTC 2J4WH 4UINH 5KJRH 4X8XA 3IT8D 1LDSA 4IS6A 2F58H 5GIRA 3DGCR 2XKUA 2XG4A 5D5ME 1CT8B 4MXQD 2ICEA 3QXVA 2A9NL 4P5MB 3RVWD 3RTQC 5IB5B 1X5ZA 3LDBB 2YSSB 4RCAA 4Q0XH 3CH1A 5DZNA 3M1BB 2M26A 5K9JH 4G8GD 4ZUTB 5HSFA 3EYFA 1J0ZA 3WMSA 3HUJA 5JQHC 1OP9A 3FN0H 3RL1B 4WUUA 3OZ9H 1VESA 2VITB 2X4UB 1GHFL 4HGWB 1OTTD 3QEGL 5E00A 4RGND 1P4BL 1HXYA 5E99H 4UNVA 1ZHNB 1F2QA 3MGAA 4UDTB 2HWZL 3LQAC 5DJXA 5AD0B 2VISA 3PNWB 4Z7WB 2H32B 3MLSH 1N2RA 3QA3B 1KC5L 2C26A 4N8CH 2BP3A 1GGIH 3QQ3A 3PQYE 1M7IA 1ZHKA 5GGTA 1YEIH 2JB5L 4QGTA 5FHBL 1G9ML 5J3HD 1GYAA 4EUPB 2ERJB 2VDPL 3BEWB 5SWQA 4LP5A 4NRXA 2Y5TB 1QSFA 4IRSC 4FMFA 2RFXA 1OCWH 1WIUA 2AK1L 3ZE0F 1PAMA 2DQGH 2QSQA 1PFCA 3RJQB 3LD8B 2D0HA 1FG9C 3O2DH 4UDUA 1MJUL 3MCKB 3MLTB 2MCPL 3VXQB 3L3IA 2ADJA 2FATH 2YOCA 3NACH 5D4QA 4Y1AE 1QKZL 4ODUA 5E8NB 5J6GA 3WJJC 2XFXA 3V52H 3KPLB 4GS7C 4BK4A 1LEGA 5TFSH 1UZ8A 1YNLH 1FFOB 3QEQE 2W91A 4JKPH 1ED3A 5D7SL 1BQHA 3PWLA 2VLLB 1JWUB 3T65A 4NJAL 2J5LC 5KS9E 1D5MA 4JFEE 2APFA 5F1IB 3G08A 3GSNA 1R5WB 3H7BA 1QFOA 1MRDH 4TQEL 3ZSTA 2VSCA 4FFVC 4H0GA 5GSVA 2X5PA 4LSUH 2GCYA 3K2MC 3T0AA 1HILA 1MIML 5JLZA 4PP1C 3O45B 1J8HB 1A3RL 1IRAY 5IHUH 2F5AL 3DX8A 2ZG3A 5GRWA 4OCSL 3DSFL 5KW9L 3QG6A 5D7JA 1LQSR 2D7NA 2IQ9H 1FZOB 3PGFL 2AJUH 1MLCB 4LHUD 4RDQF 1JPGB 1QLFA 5B38G 3O4LD 2VDLH 1CLOH 2HFEB 3QDJE 4GKZA 5EPMA 3D2UB 4FQXB 5FIEA 1QVOB 3DBXA 4ZD3L 2R0ZL 4JFFB 1U8KA 2GSIA 3AM8A 3NH7L 2FNBA 1G9NC 4ONOA 3WO3B 2ZP0T 4ZTPL 4NT6A 3GMNB 5MEQB 3RY6A 3MROB 5GRZA 3DXAB 2AABH 4Y8DC 2IAMB 5ERWA 3TN0C 2R56L 2YD7A 4L9DA 2J88L 3BT2L 1SYSB 5C3TA 3DTXB 2HTKC 4G42A 4E41E 1GAFH 4KAQL 5IG7B 3ULVE 2DJSA 1PW3A 5H35A 1Q1JH 2EDRA 4RNRB 5F1KC 4HIIA 1CVRA 2CLRB 4U1IA 1HYSD 3ZHLA 1FN4A 2FEDD 5C0AD 1T1XA 4QRQB 2EDWA 1UM6L 2MPAL 3C9NA 3KYAA 1U8MA 3EJZD 5KTEL 1QYGH 1HNFA 1AHWA 3V95A 4YH6A 1NCBH 5FYJD 3EIFA 1ZHLB 2P24B 4KTDH 4U1MA 3TA3C 3GI9L 4Y19E 5T3ZD 1ONQB 5EFIA 5F7YC 4NRZA 5D9SB 1QLEH 4NHUB 2XN9A 4JHWH 2IPUK 3SGKC 4QF1A 4WWKD 5MEOB 4EOWH 4HC1A 5IB5A 4ZFGL 5IR1A 3WFBH 5DQJA 1RIHL 2W92A 3Q1SH 4PJAE 5F9WB 1A4JB 4QGYA 2UUDH 4ZUTA 4UT9L 3UC0L 1RSFA 5CJ5A 1LNUA 3TV3L 3I50H 3NCFB 1AE6L 5F7DB 3MTRA 3Q6GL 2WQ8A 1PX3A 3AMKA 5DC0A 3CFEA 3Q6FA 4N0FB 1G9NH 5INDB 5DD0H 4Q97A 2F54D 4P99A 4UDTA 5DRXB 3PL6B 3WCYA 1JYWA 4JCLA 1QHPA 4MD5A 3OGOE 1I4FA 3GMOB 2P49B 4HJ0C 4JHBA 5ACLA 1M6OB 3P9LA 3K46A 5ID1A 3WIHH 3HMXA 1LP9E 3F7YB 2ARJA 2IAND 1CE1H 3BPLB 1LO3L 2DI9A 5JORB 4HCRH 4LOUC 1IL1B 3QHTC 4MQXC 1RAMA 5HYEA 3DUSA 3CDCA 4B0MM 1PD6A 3MBEC 4L9LA 4KZEL 5D1QD 1QRNA 3SQBA 4WIQA 3X11A 2OMNA 2JCCB 2JTDA 4HUWB 1MCFA 2ZOLB 3OXSB 5B8CA 2ITDB 3LMJL 4NNPL 3THMH 1FNEB 5E7BA 5I6XB 1DTUA 5IESL 3VFVB 3O3AB 1QBLL 5J13B 3VDBA 3GIZH 4FQLH 4Y16D 3G5VB 4HPOH 4D9RD 2DTSA 1ZV5A 4P2RA 1A7OL 4L4VA 4CJ1A 3CDGB 1JF6A 4OB5H 4OZGA 1HQRB 2DM7A 5CGYD 5IBTH 1DBKL 3CFJA 3D0VB 5JOPE 5IVZB 1A0QH 2HFGL 2R2BA 2E9IA 3T3ME 3A6CH 1FG2B 1FNGA 1YY9D 4NSKA 4ZTOH 2WBJD 3EO1B 1NCCL 3QQNA 2XZQH 2FECI 3WKMH 2DF3A 2D7TL 1EFQA 4LLYB 5EO0A 4MJIA 4J6RL 3VFOB 3L3KB 3T0ED 4HX1B 4JEGB 3GHBL 3GI8L 2ICCA 3V4UL 3ZKSD 4Z9KB 3Q0HA 3I9GH 4A6YA 4JZJC 1RHHA 4XVUC 5EBWB 3ZDZE 1CLYH 4M3KB 2AJ3A 3NCJL 1W0WB 2OZ4A 4P4KB 1C5BL 1TTGA 1Q8MA 4PP2B 1B4RA 3GEWB 3LS5H 2W0KA 4YHZH 4RAVB 3KXFB 2JK5A 2W9LA 3ARGD 4KMTL 4AYFA 3EOAB 2HVKA 3M17A 2BY0A 2NCMA 5E2WL 1H3PH 4HLJA 5TF1L 3ROOB 4F9LC 4PR5B 4Q9CA 3TBSA 1U8NB 1EMTH 5EU7E 1EJOH 4YZFE 5TPWL 3QUZD 1YECL 5C0JA 5I1IH 4U6VH 5I1AA 3ESUF 2FYYB 2XY2A 3LKSB 4HPYH 2KKQA 1F58L 4LHQB 2H3NB 4OV6F 3WUWA 2GAZA 5CBAA 5C09B 1P5VA 1HZHL 1J1PL 3TNMA 1F11B 2LE9A 1HHGA 3NA4A 4KK9C 5CUSH 4H26B 1FVEA 1W0VB 2LABA 4XVTH 4LCYA 1W72B 4JQVA 4RA0C 3REVA 2Q8AH 1MWAL 5C0BD 2XQBH 3NZ8A 3KYKL 2ICWA 1TPXB 2NZIA 1DQQA 2OL3B 4YXHL 4DTGL 5L2KD 4MS8C 4TPRL 3GMLB 5I1JH 1KULA 4DN4L 1V3JA 1BQLH 4XNZC 1ZS8A 3ME0A 4MAUL 3RUGA 1CFNA 4H1LB 1FC2D 3UTSE 1CN4A 3QUXD 3TESA 5TH2B 3RWIB 4M6AA 5EOCJ 5DQ9A 1MFDH 4Z77B 1NC4A 1YMME 2XV6B 4ZO9A 1X4YA 5A2IH 5D1ZA 5DUBB 3ULUF 1IM9B 4CN6A 1Q9KA 2BC4B 1G9MC 5IQ9A 3VFTB 4CMMA 5F7KC 1AGCA 3REWB 3DVIA 4WDIB 1ZT1A 1MCOL 3EJYD 2EDEA 4I0CC 3QXAB 2BNQB 5D7IF 4MX7A 3EDDA 2R2EA 4NC1E 4ZPTA 2XNAA 4PRHE 1QLRA 5HGDA 2EKSA 3C87A 1U8OB 1SJEA 2CIIB 43C9B 1U91A 5GGSB 4NQEE 1KPVB 1X4ZA 5KSBF 1UG9A 4JB9L 1V7ML 4OUUB 4K7PY 5IJVB 4XVSH 2CDGB 3VXRD 4YIQB 2X4RB 4HIXH 4Z7OE 5D1XC 1D6VH 3HG1D 3OBAA 2JJSA 5EIIB 1C08B 2XQYG 2VN7A 4XRCA 3TO4A 4Z7UB 3T4AB 1KB5A 4YDKL 4FQJL 1WGOA 3NIFF 1WSST 3ZE2F 3U46B 2O5YL 2A9NH 3OKEB 4MA1B 1UYWL 4XXCA 3S5LG 4W6XB 3UBXB 1MCEA 3U4BL 3H9SA 3RHWK 1TJHL 1X7QA 2AXJA 4ORGB 1FL5A 3LKPA 3MQIA 3DYOA 1VFMA 4HXBL 5EU6A 1HOCA 3FT2A 4JDZA 2ZOLA 1AGFB 1S9WB 4JZOA 5FV1L 1ZTXH 3QEGH 2F53E 1IM3B 1P4BH 2VKWA 3CX2A 4Z7NF 3O3AA 1PLGH 3DUHA 4AMKL 2HWZH 3G5VA 3S96A 3KJ4B 4XCNA 3OMZA 1EHLL 3G9AB 1KEGH 3ZYJA 4ETYA 2AJVL 1HQRA 4K2UL 4HKZA 4HJGB 2CDEB 2F5BH 4QWWC 2JB5H 1BBJB 1XR8A 5FHBH 5IVZA 1D3CA 3GIVA 3HNVL 1G9MH 2C3GA 4NPYA 4XX1G 1X9QA 3S88H 1ITBB 3I2CL 3QIBB 4KK8C 1KTDB 2DYPB 1KIRB 3C6SA 4MXVF 2ZUWA 5IFAL 2VDRH 1FVDB 1DFBL 3S35L 1MJUH 3EW3B 4AQ1B 3SGDI 4PRIA 5BOZG 1LO0L 1EVTC 4PLOB 1JNLH 3H7LA 2O93L 3BGMB 1KSRA 5DVNA 5JOFA 4YFLF 4U2ZA 3O4LB 4PJCF 1CFSA 1L0QA 5JMRA 4OCRL 3DECA 1XZ0B 5FYKU 4H25A 1SMAA 5I1HL 3SGEH 1U8JA 4MNGB 3MRNA 3QIUD 1C1EL 5EZIL 1XF4B 1M4KA 4Q9BA 2EKJA 5KG9A 4K9EL 4OCWL 1RJLB 3ARBC 5HDOA 5L88L 3QNXB 1MAJA 2FR4A 4WO4C 4KFZC 1NUNB 4X6CF 2GUOB 1A3RH 1JGEA 3DX6A 2F5AH 2J8UB 3GSOB 3ABZA 3I6GB 4LPUA 4OCSH 5C0AB 1L9NA 3B83A 1TDQA 3MJ7A 2VAAB 4WEMB 4F2MA 2NY2D 3KPNB 4V2CB 4ZD3H 1OW0A 2R0ZH 3NH7H 3QI9A 5E08L 2B8OT 1JI1A 2W65B 4WHTB 4ZTPH 2IGFL 4JM4H 4EI5D 4PD4J 4MCZB 3QISA 2R56H 3GO1L 4ZS6C 1KGCD 3BT2H 1J1OH 4RFEA 4F3FA 1UEYA 1GXEA 1JNNL 3IDUA 2CJUH 5EH1A 4KAQH 3VFMB 2P5WE 3QFJD 4KU1A 2R9HD 5C0CE 4Y2DC 4JY4A 3U0TA 3VFGL 5CGTA 1DVFD 5DJDA 3FT4A 2VDKL 3T08A 2EXWD 4G8GA 3QNYA 1D5IH 3SDCC 1I7TA 4OLWL 5HI3D 4GBXA 5BO1L 4GRLD 3HPLA 4DCQA 3BDBA 4XCYB 2MPAH 3ILQC 1N4XH 2DM4A 5F44A 3SE4A 3F7PC 1XAUA 4ODWB 4U6HA 1MCLA 3TIEA 1ZGLA 1XIWA 1NEZB 5F3HB 1TITA 3C8HA 3R8BB 3PGDB 1CFVL 1JYNA 2PXYA 2H6PB 2YBRA 1S5IL 32C2A 1GGYA 2YS4A 5BXFB 3FRPG 4PRPE 4YIQA 5IB1A 5C9JA 3H9HB 2XTJE 5H37G 3BQUD 3T4AA 3MR9A 2C9AA 3QDAA 2YPVL 5JQ6L 4KROC 3NFNA 3HZVA 4HG4K 5FCSH 5DTFA 2IANB 4ZFGH 3K7UA 1BAFL 1RIHH 4OLXH 1E4XI 3BP6B 4PJEE 4XB7A 5HYJD 4I0PC 4UT9H 3WS6A 3UC0H 4PJFF 3TBVA 3N0PB 1MI5D 3NZHL 3TV3H 5A43C 2IBGA 1KLGB 1AQDB 4U2YA 5E94A 3P3YA 5DJZB 3RZWA 3TYFB 4P9HL 3S97C 3SJVD 1O7VA 4Y16B 5C0RL 4RRPA 3NAAL 4KQ3H 1EEYA 2V7NB 1R3HA 3LEVL 3EBAA 1NJ9B 2Z8VC 5C0DB 3MNZB 4GFTB 1B6UA 2QADD 5DUML 4UIKL 5C07D 3WS3A 4YQXH 3VXME 1WBXA 1A7RL 3D39E 2NPLX 1YNTB 3JSSA 3V6FB 1KIRA 1RU9H 1NCDL 3RVTD 1RJCA 4RMTA 1EFXD 4XP4L 4KZEH 2IBZX 4D0BB 3KJ6L 3LS4H 1KXTB 5J9PB 3VI3F 1L6XA 1MPAL 3LMJH 4NNPH 4PRAA 5IW3A 5E1HB 4C56E 3RTQD 3PJSB 1QBLH 1L6ZA 1P6AB 2FX7L 1BVLB 3SE8H 4Y5YC 1A7OH 4LHUA 5F1OB 1UA6L 5FGSA 1DBKH 3W0WE 4XWGH 3D25B 4UQ2A 3ARGB 3NBNA 3NIGF 4RMRA 5BQ7B 3E2HC 3S36L 4R26H 1DBJH 4LIQH 2Z31C 1GPOL 3ZDXE 3QUML 3OX8B 2Y23A 3QPXL 3ZT7A 1JPFB 4XP6H 3C8KA 15C8L 5LQBL 4EBQL 4E42A 1ZLVH 3GNMH 3QUZB 4ORZC 1MCWW 4GRMA 3UJJL 3OKOA 3VXSA 4IRZH 2OX5A 4NKDA 1OPGH 3TZVC 2D7TH 1R3JB 2GUOA 4J6RH 5EB9A 3LN4B 3CNKA 3OAZH 1DBAH 4KTEH 2HG5A 4Q6IB 1FH5L 4MB5A 5I8OL 1JNJA 1WFUA 3GHBH 3GI8H 4PGEB 3H2WA 3I75B 1FZMB 2YWYA 1U3ZA 4IRSD 4XCCH 2VAAA 5IM7A 2ADIB 1MCKA 2P8LA 5C0BB 4DW2L 3BVNA 4GAYB 1MVFA 4Y1AD 4ELKA 5L2KB 2A6JA 3VJ6A 4D2NA 1YJDH 2WIIB 2EDYA 1C7TA 1OAZL 3WFEL 3BZ4B 4MCZA 5FUZL 5A3ID 3QEQD 1ZLVK 5DURB 3UZEA 2P7TA 5TPWH 4JN2B 4WWKA 4OGYL 5CAYB 5LGKA 3O3DA 4BFIA 3BD4A 5EDXA 1URLA 4EN3C 1X44A 1F3DH 1LILA 2WANA 2BHZA 5J0BA 4JFED 4NM4L 1VGKA 3UTTE 4Y5XA 3V6ZB 1NPUA 1F58H 2YD3A 5IW6B 4LCCA 1P69B 5SX4I 4KDWA 4NUJB 1NKOA 2DDQL 5EOQL 3SCMC 3MRFA 1OSZA 5C0IB 3RPIB 1BVKA 3BDXA 2AI0L 5FM8A 3OKDB 4EI6A 3U36B 4O2CB 1MWAH 1E4JA 1MRCL 2XQYK 1NBYA 4DTGH 4YXHH 2F54A 4PP1D 5DJ6B 1D9KB 5F71A 3VXRB 3L3JA 3TEUA 5D7IA 3DUUB 3BKML 3QDJD 2VDOL 3D5OF 3V6OE 2MHAB 2G75A 3VGEA 5LAXB 1F3JA 2YEZA 1I85C 2EYRB 5EBMB 1T20A 4N5EC 4PG2A 5IHZB 5KSBA 2XI9A 3VRJB 5HI5C 3CC5A 4XT1C 3QBTB 1MCOH 4JRXA 3HHRB 1OLLA 2GFBB 4HQQL 1GGCL 4IDJH 2V2WA 1BM3H 4MDIB 1KCUL 5D1QA 5BZDB 1JWMB 3WNLA 2AEPL 3QULA 3ULVD 4OFYD 3DURA 2DQFA 5IEKA 5KVEL 3QWRD 4Z7VF 2FEEI 5DJZA 1A6VL 3CMOH 2ESVB 4JB9H 2HVJA 1YY8B 4PJ9D 4Y16A 3SKOA 5FGCE 2DQCL 1DBML 1NSNH 4WI4A 2LU3A 1PG7W 2BSTB 4ZQKA 4OLYH 1FAKT 4UU9B 5L8KB 4LRIC 1UYWH 4G9DB 5FUOL 4TN9A 3U4BH 2FB4L 2X1WL 2ZZUT 4Z0XB 4PJXB 3TA3D 1TJHH 4K9EC 1TFHA 5GGRB 1OGTB 4ELME 2WBJA 4ZFOL 4LGRB 3DO7B 2NTFB 3HC0A 1UH3A 1WFNA 4U1LA 1ZVSA 4POYA 2YR3A 4HXBH 4RA3A 4KDTC 5J9PA 3AC0A 3V8OA 3T0EA 1J12A 2VLRD 3HS0A 1INQB 2G9HB 3WKNA 2XWTA 3WJLA 2GY5A 5ISZD 1S5HA 4XC1L 1MF2H 3T8XA 2VXQL 4AMKH 2CK0H 1N8ZB 2VLKE 1EHLH 3QQ4B 3R06A 2E27H 3TWCL 1K3ZA 2AJVH 4YDLB 4S2SA 3WEXB 35C8L 2DLHA 3WIFB 3P30H 4GXVL 4J7RA 3QIUB 3HNVH 1UKSA 2DBJA 5DC9B 1J0YA 1FZJA 3G5ZA 2D31A 4U1JB 4PJCA 2EYTA 3IS0X 4X5WA 2XZAL 1FLTX 3L3GB 2CH8A 3S35H 4DVBA 3NFPB 1T2JA 4LHJB 4ZDHA 2B5IC 1A14H 1BZ7B 2C1PB 4HJ0D 3BWAB 5ACZA 3KWWB 4APQA 2AV1A 1LO0H 3U30C 3BP4A 4R8WH 4YC2B 3S37X 1AY1L 2DKMA 4QHUA 3G04B 3QRGL 1RZGB 4JGJA 2VIRA 4LOUD 3IKKA 5JW3H 5HHQA 3MUGB 1NCNA 3MGTA 5C0BA 3TCLB 4I2XE 2YC1B 4X6CA 5JIIA 1WWWX 2XXMB 3MBED 4ZSOE 5TJWK 3JWOL 4BZ2L 5I1HH 1UJTA 3HN3A 4MGXA 5H37H 5JIHA 4ZAKD 2VC2H 1C1EH 5EZIH 4ZUSA 3QUXA 5EZJB 1JPSL 3P11L 5E1AA 4Q2ZA 4OCWH 4EKXA 4M7ZC 2VXUL 2WWMC 4Y4HC 5ALCL 5L88H 3GUTB 4XP1L 5T3XL 4I3GA 3IU3B 1HSBA 3UO1H 5JOPD 4R7DB 4GSDH 3KPPA 4YK4B 3VH8B 2V5TA 2FL5A 3FO9B 1WBYA 3STBA 3P9MA 4HW6A 1CTNA 5D7LE 4GMTL 4OF3A 4O4YL 4L8SC 1FV1A 4MA8L 4M4RA 4NO2A 2ED9A 5HHMD 2NXZD 3U36A 3L6FB 2WQRA 4LSTL 1ND0B 2EC9T 4P9HC 5E08H 1KPUB 2XKNB 4X98B 2E8YA 2ATPB 3VI4E 3VXRA 1IGTB 5MI0C 1HQ4A 4XPAL 3HG1A 5J1TC 3BQUB 4RAUA 3GO1H 2Y7QB 4HIHB 1MEXL 4NRYB 1JZ3A 1JNNH 4XVUD 3ULVF 5I1CL 2DQUH 2BNRA 5C08D 5I71C 5I75C 1PKQA 5EBMA 4PS4L 2HFFA 4JFQA 2R1YB 2KZWA 2VDKH 4P57B 5FYKE 4HS6B 4X4ME 5HYJB 1BHGA 4OLWH 5GGTL 5BO1H 3MRJB 1EO5A 1Z9OA 5E9DE 1MI5B 3PHOA 3VMPA 3PWNA 1WCBB 1KJ2A 4G8EB 2HLFC 3V7MA 4OBSA 1CL7I 2IH1B 4KJQC 1NGQH 1CFVH 4HBQA 5CILL 3SJVB 4NDMA 3QQ9C 4LLQA 1ZVYA 3B9VA 3PF2A 3QEHB 1KIPB 3CUPB 5E8EB 1YN6B 3MA7B 3BXNB 1VEOA 1P5UA 4PJFA 3Q3GB 4ZS7L 3JXAA 2A9ML 3MNVB 4WGWB 2QADB 2VXVH 5JQ6H 2BVUA 5DHVA 4G9DA 3QNZA 5I66B 4X0KA 4MNQE 3VD5A 1ZAGA 3C5ZC 3UTSD 1XR9A 1A7BA 3MV11 5D5MB 1HHKB 4PLJC 4CNIA 1WZKA 3B9DA 4OD2B 2I9LB 3UTQA 1EFXB 1YMMD 4P3CL 1N6QL 3MRKB 3GSNL 3NZHH 3MV7B 4JDVA 1D5XA 5TGBB 3KPSA 2V7HB 1JZ6A 1E0OB 3RTQB 2B4CL 3SEPA 3GSQB 4LP4A 2C7UA 5DRNA 5C0RH 2WBWB 3VG0L 4ODTL 4RBPH 3SHSA 5SX5K 3IDMA 3LEVH 4YHLH 1FNFA 4S0TD 2QR0A 3O3UN 1LP9F 5FDYA 3O11B 3WIFA 4PJ8C 2FO1A 4UIKH 3QIUA 3MFGB 4LU5H 1B0WA 2X41A 1AQKH 5IK3A 3D48R 5ESQA 1PX4A 3X3FL 1RURL 2CPCA 1AP2B 3O3EB 1ORQA 2K3TA 1JHKH 3S4SB 1BLNA 5D1XD 2R39A 5LGJA 2IG2L 4XP4H 3MJ8B 5MEND 3DIFA 4PLKD 3QXTA 1IGFH 3DSNA 4GG8A 3L5WA 1MPAH 4ZPVB 3V4VL 1E27B 4XNQB 3O41A 5C6PB 1IQWL 4QRSB 4RBPK 2FX7H 1IC1A 4IRSB 3UDWA 4XGZA 4UT7L 1RUQL 3TCXA 1UA6H 5IBLC 3QUYC 4G7YL 3TCLA 3U9PL 5IVXE 2F53D 3S36H 2QV2A 1S7VA 1DJSA 3MC0A 4EI5A 5T5NF 4LPVA 1WLHA 5CHNA 1MHEA 3OPZL 3QEQB 3QUMH 4GS7B 3QPXH 3RNKA 1O7SA 15C8H 5LQBH 1OB1A 4EBQH 4LQFH 1BQHG 1I3UA 4GKNB 1L7IL 3QFJA 3KPRE 2V5YA 3PWJB 1NUFA 3E6FB 5KS9B 4NP4L 3FQUA 5DMYA 1G6RL 4OIAA 1N3NB 1DVFA 5T5FL 4HK0B 1LE5B 5MERB 1FH5H 1VFBA 2J5LB 4RWYL 4GRLA 5I8OH 1K2DB 4OD1H 2A6IA 2EO1A 4HC1L 4UNTA 3H3KA 1F6FB 3UBXI 1BOGB 2F19H 3PV6B 2OXGA 4M7LL 3S6CA 1T5WB 3VXTB 4DW2H 4YEEA 5DMGC 4FXGB 4F7PB 4BH8A 5LKNA 1EEQA 4Z0BH 2Q76B 4HMCA 4PGCA 3DHMA 1OAZH 3WFEH 5FUZH 4G80A 4YZFF 2UY7A 3BQUA 3SOBH 1M7DB 1QBBA 1T21B 2FH8A 1YEDA 1S9KC 5F89A 4S10A 4QXGL 4LVHC 2H45A 4YO0A 2XA8L 1DN0B 3UJTL 4NM4H 5KVFH 4R90L 4LMQI 2A74B 3LV3B 5HYJA 3LKOB 3HNSH 3HMXL 1HIML 2I27N 1QG3A 5EU4A 5DK0A 5HGAB 4U1KB 2DLFH 1MI5A 1AD0B 4I77L 3TN0B 2AI0H 1MFNA 4BSVA 1E4KA 3NTCL 3G6AA 3L3OA 2BVOB 4WO4D 3QRFM 3RIFK 1Z9MA 3IJYB 2P45B 1MRCH 1XCTB 1JGUL 3V5DB 3D0LB 4NWTH 5I2IB 1K4CB 4QY8A 4OZIE 3T2NH 2VL5B 3LQZB 5GRJH 2VDOH 1KTLA 1CICC 5AWNL 3U4EA 4Z7VA 1BD2E 3F65A 4YUEL 5C07A 5FYLL 2IMMA 3TA3B 1NANH 4N8PA 3GSXA 1NFDB 3BUYB 3N1FC 1YN7B 4OAWB 4ONGH 3T1FA 3VXOB 1KCUH 2P5WD 1K6QL 2OTUA 4A2MA 3UYOD 2EE6A 4ZS6D 1FO0A 4PJAB 2VLRB 2XIDA 2YZ8A 3TJHC 5GS1C 3BW9A 4M8VA 2LFGA 5B22A 5ISZB 4FFYL 3DVGB 2ENSA 2X1PA 3ZKMC 1SVZA 4JR9L 4LDLB 2DQCH 1T0MB 4UOJA 5CEXA 2YN5A 1KYOJ 1QA9A 3SDCD 4YX2L 3WYRA 4LCIL 4U3HA 3ILQD 4EQ3A 1IKFH 2PO6C 3JWOC 5JW4M 5HD8D 3O11A 2OR8A 3AB0C 3MLXL 4NKMA 4OFVA 5ICYB 2OZ4L 2YA2A 4G6KL 2FB4H 4PRPD 4HFWA 5KBNC 3GKZA 3LKQB 1HKLH 4X6DE 3P4MB 4UI2A 3O3EA 3PQYA 2YKLL 3VDCA 4O2EA 1MY5A 4MWFA 2CR3A 1CF8L 3RWGA 3MYJB 3JUYA 1CE6B 1KTRL 1I1RA 4ZPVA 2VDQL 4KROD 5CZVH 4ZYKA 3QB7C 1S3KH 4XNQA 4D0DB 1VKXA 4GMSH 1XGRB 4OQTA 4XC1H 4I4WB 2VXQH 3WNNA 3SDXB 1A7QH 3GSUA 4YAQB 4MVBC 4GJTB 2I07B 1RUPL 4Y1AA 3MBEB 35C8H 3EOTH 4L3EE 3IKCA 1J0KA 3ZTJG 3GSRB 2IEPA 4URTB 1SYVB 2XTLA 1YPZF 2VQ1B 1HDMB 5I8CB 1QUNA 1FJ1A 1H3VA 1JUFB 2PW1A 4NZUL 3BPCB 5DGQA 5IGXL 1MJ8L 2MMXA 3CK0H 3BP5A 3FB6B 3VCLB 1ZVHA 2D2OA 3SGDH 3STZB 2BVQA 2YWZA 5KS9A 4JFEA 1KF9B 3VXMD 2FSEA 3VD7A 1OGAE 4N0CC 5HDQL 1C5DB 3D39D 4M6ML 2VSDA 3QO0A 2N4IA 3BO8B 2IPKA 1G7MA 1I75A 4P9MH 5HHMB 4JFDE 3PV6A 4XNUH 3P77A 1QTYT 1KCRL 3EAKA 3EYOA 4YDVB 4FXGA 2AERT 3JWOH 1ZSDA 4K7PH 4BZ2H 1QSFE 4C56D 5B3NA 1CG9B 2OJZH 3BKCL 3UZQA 5DUPL 2SEBA 3BPOB 1G7QB 1JPSH 1BZ9A 4CDGC 1PG7X 3P11H 1ORSA 1WICA 1XGYL 3I6KA 3QDJA 3DV6A 5ALCH 3FOMA 3SKJH 4JZJB 4XP1H 3W0WD 4BSWA 3A67H 5C08B 5T3XH 1KN2L 5FK9A 3KGRA 5SWZE 2QQKH 4NQCE 5E6ZA 1K3IA 3MLZL 2ZCLH 3QXUA 4MDJB 1KB5L 1VGEL 2GK0B 2L4OA 4JFHD 3GBML 3RWDB 3Q2CA 2Z31D 4E41A 1KJVB 4O4YH 4O02H 6CGTA 4GG6E 1HXMA 3KPQB 1B0GA 1A8JH 4MQ7B 4M6OL 4OFYA 4B41A 1WTLA 1CDIA 1GL4B 3QZWA 3TPUA 4KJPC 2PTTA 2DI8A 3RKDD 1MJJA 3GMQB 2B4CC 4WGVB 4PJ9A 3D0LA 3WUWG 3KLSA 4XBPA 2JLLA 4XPAH 4JPKL 3U0PA 4OKVB 1TZHA 4GAJL 5ANME 5C0EB 1RQ5A 1P7KA 1KOAA 3DROB 4GXUN 5D7JC 1MEXH 4F7TB 2VDNL 2OI9B 2DIJA 1E6JL 3CFDA 2P1YA 5C8JB 5I1CH 3MRQB 2DWEB 4Y19A 5IROA 5LJYH 4PS4H 2H26B 2Z93B 1I9IH 4BKLB 4CADB 5IMMA 3VMOA 2V9RA 4JO2L 5B38B 3IDYC 3V79C 3AM8C 5GRXG 1HH9A 2M8XA 3GMMB 4P2QB 5GGTH 4XNZB 4XPGL 4N9GB 4M7JL 3RY6C 2YZ1A 3ARFA 5TQ2H 3G6JB 5CD3A 4PJAA 3UTTD 2ZPKL 4OCYL 5CILH 3QCUH 4AEHL 1TVBA 1QBMH 4X80H 3JBG7 1Q9LA 4JY6A 4XP9L 4X7FC 4K3GA 3I3EA 5ESAA 5E7FA 1Z6JT 4GRWH 4ZS7H 2KZ1B 1F97A 2A9MH 4KRLB 3VWJB 4YHKL 4CDHA 2DQJH 2EYSA 1XT5A 4FFZL 3IS1X 4R4FL 1WZLA 1IFHH 3TH4T 1AHWC 3ARQA 4PJHF 1ZA3B 3LRSB 2X4QB 1DP0A 1A4KA 4IJ3C 5TE4L 4Y8AA 3D69B 4P4RA 5DVLA 3P4MA 5FA4A 3WFDL 5D1XB 4P3CH 1N6QH 4ZFFB 2FGWL 5MENB 4UOW1 3GSNH 1LP9A 1G7IB 3PDGA 4LGSB 1QQDB 4XB8A 4XXDA 2FGZA 1PBYA 3QHFL 5GGRY 3E3QC 5HVHC 2FJFB 1NLDH 4O58L 2B4CH 4ISVB 2Z92B 3L5HA 2P5EA 3TH2T 4N5ED 5FUCC 5DDHA 4KJYB 2DICA 4LL9A 4DN3L 5F9AC 4N0UA 3VG0H 1W2KT 3E3QE 4Y0GA 4C57C 1XGUB 3QIWA 4I4WA 5HI5D 4KXZI 1KEMH 5DRWA 2YPLD 3SDAA 4PREB 4JFYB 3AS3A 1S7XA 3NA9H 3KS0H 4XH2A 5GZND 5IMOA 4CW1B 3GGWA 2E7BA 4ZAKA 1CXHA 2OMBA 2A2QT 5I0ZA 3ZT5A 3DX9B 5M95B 3X3FH 1JTPA 3MV9E 1AGEB 1KLUB 3IDIB 2ITCB 2W0LA 3I3BA 3VCLA 2IG2H 3STZA 3VFNB 3EJJX 1I3GH 5I0DA 4JKWA 2NW2A 4PJBE 5BV7H 4ODSL 1DR9A 2YUZA 1ZT4A 2WLZA 3HCVB 2W1NA 1F6AA 4JANA 2H2PC 2OJEA 1ZXQA 4OM1L 1HCFX 5ID0A 4MHHG 4GW1B 3WE6B 1IQWH 3BD5A 2FX8L 3BEVA 1RUQH 3VG9C 4G7YH 3GJEB 1S7TA 1MH5B 4G6AC 3U9PH 1A3LL 2RHEA 1RJZA 4L9LC 1CG9A 4L3CA 1JF1B 1GOGA 2KL6A 3OPZH 3BZDA 2MKWA 1V7NL 4PJIE 3E1F1 1Z0MA 2FO4B 4K8RL 3A0OA 1K5NB 1JL8A 4JZJA 5AG9A 1WV7T 1L7IH 4CU8A 3C08L 2WNGA 3GM0A 3K81A 2P8PA 4NP4H 4H20L 5B39B 4K23L 5T5FH 2PW2A 1JWSA 2OSLB 4X4XB 5FYLE 3UX9B 2BVYA 5DEFB 5HVFB 4RDQG 2CLZB 1LO5A 3BIAX 3KPTA 2EDKA 1WWCA 2WV3A 3ARBB 2C5DC 4W70A 4FQ2L 4FXKA 4WO4B 3MLPA 4P23A 3KHOA 3LZFH 3QUKA 1EAPB 3ARED 3L3HB 2AEIT 4L8CB 1JGLL 3E6HA 4YR6B 1AJ7H 1IAIL 3RWCA 2GTZB 2B2XH 4R96B 3LQMA 3RRQA 3U7WL 1OAKL 4BQ6A 2ATKB 4XC3L 2FIRT 3ZYZA 1QRKA 5DHYB 2D9CA 3OJVC 2F15A 2R23B 2P4AB 2LU4A 1I9RH 1UC6A 4TSAH 4QXGH 2P44B 3W9DB 2XA8H 2X44D 3OKYA 3PUCA 3MRLA 2A83B 3JTTB 5IHBA 1Z2KA 1MCNA 3UTSA 3BH8A 3S3SA 4QOKB 3K3QA 1T80A 4QLRA 3GMMA 1QFHA 3QJHA 4H88L 3HMXH 1HIMH 1YMMA 4HKJB 3VGHA 4M9OA 3UXFA 1A7NL 1YEFL 2QQLL 3O6KL 2A1WL 2CD0A 3NTCH 4Y4HD 1UENA 1CXFA 3PHQB 3NOIA 4Y2DB 3VFWB 1JGUH 2K7PA 4XAKD 5D7LD 4FS0A 2BOBA 4WI6A 5JXAH 5TE6L 1JRHI 4PJ7F 2DQEH 3SDCB 3TVMA 4JY5L 4I1NB 3BKJH 3ZTJH 4PRHA 2VZVA 2YD9A 4KC3B 4GKSB 4KPHL 4JJ5B 3RVUC 1PGRB 3RKPA 4WHDA 5AWNH 2EIBA 3BUTA 4K94H 4NQEA 2JIXA 4DJMA 4WTXA 5J7CC 4YUEH 3IJHA 4LLMB 2DL9A 4PRPB 4TVPL 3O9WD 4KMQA 4JQVC 2DRUA 1T1ZB 5CMAB 2JB6B 2X4OB 5ITBL 4RWHA 5DF0A 4HMDA 5JIPA 2E7HA 3OKKB 4PJDB 1GGUA 5D1XA 2NXYC 3SDDC 3L5XL 4L4TE 4MNHB 5C7XL 1ERNA 1K6QH 1PEWA 4EVNB 5JIKA 1QQDA 3ET9F 1Q94B 3VXPA 3UBXG 4PJEB 1FFPA 5JXEA 5D1ZC 2FX9L 4FFYH 4PGZA 4NBYB 5DJ8A 3U2SA 5DJCB 5E9DD 3DVNA 4CVZA 5H8DA 5CKAA 1T66C 1ZLWK 4RGOL 4I0PB 4YX2H 4TUJA 1JHLL 5JNYB 1NBVH 1HN1A 2F53A 4A6YH 2IFFL 1TZGL 4WCYL 5GGUB 4TNWK 5BVJA 1WCQA 3L1OL 4KJQD 4H8WL 4DGYH 3BP7B 1P2CA 2R0KH 3QQ9D 1IEBB 2EIEA 5T3ZL 2X05A 4JRYD 3AMLA 5IVOA 2YA1A 2YKLH 3QJFB 3U4AA 3VFNA 4MZ3A 5KSUB 4G8FA 4PRNB 2JJSC 1CF8H 4HDIA 3JWDL 3TO4C 3IFOB 2PUQT 4LLDA 4MNQD 2VDQH 1S7SB 2LQRA 5C0FB 4UMGA 5HHPB 3RI5F 1T1YA 1U36A 4K55A 2PR4L 4XXCC 4U33A 4DVRL 2PN5A 3C5ZD 3BAEL 4QCIB 5J1SC 1NGZA 2B0SH 3ZSSA 3CFBB 3S5LB 4FQHB 1U8HB 4PLJD 1GIGH 3O8XD 3EO9L 5IP4A 3B5TA 3CFKB 1CFBA 4C56B 1KIQA 4FABL 5IB4A 4OGAC 1T4KA 1JPST 3ULUL 2Y25A 3AGVA 1H8SA 2IH3B 2WINB 1I8KB 1RJYA 3LY6A 4LHUG 4AG4L 4Z76A 3NMEA 3W0WB 5IGXH 3HPJA 1MJ8H 1Z5LB 4Y5YB 5EU6E 5DMKB 4U1SB 1J9CT 4G3YL 2UWEF 4LASL 4JO1H 2YXMA 1MWAB 5B39A 3FRUB 4MD0B 4HGMA 2CMRH 3E2HB 3O6FA 5HDQH 3GSVB 4M6MH 4P2YA 2VLME 3FMGL 1PYWB 4PJ8D 2Z31B 4YBLC 5DFVC 2BNUB 4IMKC 3U83A 3EYSL 5DEFA 2A77L 2VWEC 4X4YA 5GS0H 5EO1A 1XF3A 4QRUB 2FCBA 4A2LA 2VWEE 3OXRB 4J3VA 4MAYA 4NGHL 4JG0L 1JP5A 5C6WH 1IZKA 3TZVB 4LRNL 2C4XA 1J18A 2ZKHL 1FYTE 3FFCB 3BKCH 3IDJA 1DUYB 1ZKAA 1WC7A 4KUCF 4AK1A 1XGYH 3BESR 4Y4KA 3UJIL 2VXSH 4NZJA 1T83A 2HJLA 1KN2H 3HNTL 2Q1EA 3MXWH 4MJ6B 3S98A 3QUYD 1H8NA 2NX5E 3MXVL 3OKMA 4N1EA 2A83A 1KB5H 2R2CA 3IETB 4Z5RA 2W07A 4PB9L 4KDVA 4PIRF 3VXNB 3BGFC 1F3DJ 2K1MA 2VB5A 3D85A 4NWUL 2P5WA 3O3BB 1D5ZA 3DETD 3SKMA 3KPRD 4BFGA 5I17A 1HSAB 5C0CA 5MEPB 1YUHB 4POZC 4U7SA 1U92B 3UTTB 4OF6A 1GVIA 5K9KA 3PWPE 3SE3A 5K59E 4IRJA 4EN3B 3PABB 2E7MA 5JHLH 4MB3A 1CQYA 1ZT7A 4WJ5A 4LKXB 2PNDA 3C2SA 4JPKH 3SDCA 4GAJH 4R7NB 2AEQL 2C3VB 5HPMB 3SCMB 2IPTH 2WUBL 1IEAA 3GFUA 4JJ5A 1I8MB 1A6ZB 1JTTA 1E6JH 4QTIL 1EX0A 3E0GA 2G5BA 1WT5A 3FQNB 3FTGB 4GT7A 4HT1L 5BS0B 5DMGD 1UJ3B 1OW0C 3QI9C 3INUL 5KVGL 3MOAL 4XPGH 1N0XL 5FECA 4M7JH 5E8PB 4DOHE 5HYFA 1HWHB 5ESVB 2FLRT 1Y18B 5E03A 3KDMB 1DQML 3AXLA 1C16B 5F7EH 3ARYA 5ECJE 4PJHA 2ZPKH 4OCYH 5DQDH 3VXUB 3QEUA 1JFQH 1JGVL 4NKIL 4ZO8A 3CZFB 1BECA 3FQTA 2YPLB 3LKNB 1U58B 1BIIB 5CSBA 3EGSA 4AM0A 1B3JA 1EV2E 5ILTL 1MFEL 4GBXC 1LK2A 1T04A 4YHKH 4FP8L 4FFZH 1PVHA 4R4FH 3SKNB 3FONB 1JYXA 3SE4C 3IXAB 3WFCL 3C60C 1OTTC 3P4LA 3DYMA 5D2LB 4BQBA 3TM6A 1XIWC 4K8RC 4RGNC 1HHIB 5A16A 2HH0L 2PXYC 1DQTA 3AAZB 5K9QI 2CDFB 1C12B 1A6AA 1MHCB 2Z4QB 1Q0XL 2FGWH 4NYLB 1BD2D 2NY6C 2X89D 3LH2H 3VXMA 3B9KA 2H8PB 1TETL 3D39A 3HE6A 4O58H 4WW2F 4XPFL 4ELMB 4S1RL 1HWGB 1U41A 3QCTL 1AC0A 5J3HC 3R0NA 3DRQA 1QPPA 4JFXB 5A40E 1QR1B 3CCHA 2MFNA 2MOVA 3CX5K 4FTVE 4IMLB 3VFPB 1LWRA 1ADQH 4PJ5E 3WS6C 2ZJSL 3DMMD 5FKAB 1ZLUH 4YJZL 4LPXA 2YPKA 4IHOB 2PYEE 4U4BA 2R8SH 3QG7H 1MVUB 4HS3B 3TJHD 1W72H 5CKGA 2IH3A 1A2YA 1SVCP 1U93B 3EFDL 1HE7A 4LCUA 4X9HA 4XZUA 3FQWA 3W0WA 1HEZB 2CSPA 4GW4A 2XXCB 3LEYL 4M61A 4U1NA 1JPTL 4U1SA 3C8DA 1RPQA 1VFAB 4LDOB 4PTUA 4H1LH 1EXUB 2O61B 3O4OC 1CDGA 2EE2A 4JLRA 4U6XB 1C5CL 2PO6D 3JTSB 5DI8A 5E5MB 1FAIL 4LVNC 4UQ3A 4OM1H 3ILPA 4DWHA 5E8DH 1KCKA 1J88A 1UXSB 1KJMB 2AV7A 1FVCA 3UPRA 4M7LT 3HZYB 1I1YB 4L1DA 3EUUA 1TVHB 4LBEA 4N8VA 4QRUA 1ZA6A 5IVXF 1GGTA 3LN5A 3NN8B 5ACMA 1A3LH 2YRLA 3WFHA 1HINL 1U0QA 4S1QL 5L8LB 2B5IB 2BSRB 4WU5A 1KJ2L 1HI6A 3M45A 4X6BA 4C4KO 3U30B 3N1MC 3IVKA 2AXGB 2RCSL 3OG4B 1V7NH 2AQ1A 2YHGA 2E9JA 3NGBC 3ULSB 1BREA 1IGIL 4I2XB 3QWOB 3ETBF 4QXWA 4ZSOB 4MVBD 3H0TA 1A1MB 4ENEC 4H20H 1Q38A 5I8KL 1FGNL 4NUGH 5E2JA 2ADGB 3LN9A 4WUUD 4CRPA 3WDIA 1CDJA 4U1HB 4TVPE 5GJSL 5JMOC 3IJSA 5K93A 4M7ZB 4C4KT 4NQSA 4FQ2H 4Y4HB 1HSAA 3N1PC 1FZKA 2APTA 3UTTA 2CUHA 5I15H 4LQ1A 1OGAD 1MFBL 5DT1H 3MGOB 4YDJA 4Q9RL 1SEQL 1IC5L 5GSRA 1JGLH 4QYOA 2WZPD 5FOBA 4ETQB 1IAIH 3CFCL 4N0CD 4HKBB 1S8DA 1KB9K 1OAKH 4XC3H 1NFIB 5FF6B 1EEZB 3ISWA 1X6LA 1A9EB 4L8SB 5EUKB 2PETA 4ONHB 3O2VH 4I48A 3V4PH 1FL6A 3EJZC 4CAGA 5I1LA 4LPWA 1QSFD 3HFML 1UB5A 5EC2B 1YYML 4WV1A 6FABH 4H8WC 4PJ7A 1CU4L 4Z78A 1KPRA 4NNYA 5MI0B 3MFFA 3V6OA 5AZEH 5GHWH 1OT1A 5E8PA 1U6AH 2QQLH 3O6KH 1G7PB 5SWZD 2A1WH 5I1EH 5J1AB 4LCWE 4L4JA 1W0YT 3JWDC 3KDMA 5DEGA 1YDPB 4RMUA 5I71B 5I75B 4WWKC 1NAKL 4UTBH 1BX2B 3H3BC 4UTAL 2AVGA 4JDTL 5HHOB 4I8DA 5TE6H 3VGFA 4JY5H 2X4TB 4LSQH 1PQZB 4Y5XC 5KN5A 1S78D 5DK3A 4LCCC 5H94A 2EC8A 5MP6L 2XPGA 4HJJL 2RR3A 1NCWH 2EEDA 5BRZE 4F7MB 4NQXA 3V5KB 2VR5A 4KKCC 2FHFA 4IBLT 3ULUC 4WRLA 3SO3C 5ITBH 4JRYB 1HHIA 4DZ8B 3FB8B 3ULUE 5ITFB 2GSGB 4KKNA 2Z4QA 3L5XH 2CGRL 3WD5L 3A6BL 3TO2A 3WL9B 5D7JD 2M1KA 1IKNA 2H8PA 1IQDA 4HIEB 1LE9B 1MAMH 4JVUA 3TNNA 4JQXA 1U8QB 4LF3B 4PG2C 3QUMB 4YGVA 4G9FE 2RQ8A 3GMPB 1MUJA 5GS2D 4DKDC 4RGOH 1QD0A 5IMLB 1FL3B 2VYRE 4HH8A 5D2NE 2AS5M 5DJYB 2GTWA 2X42A 5FXCH 2I25N 3MACL 3UYRH 3KYNA 3QT2A 1PEZA 5D1QC 3RVXC 5FYJH 3S37L 3TBYB 2VLKA 3GSWB 4CJ0A 1CBVH 1WBZA 2X4PB 3EO0A 4NCC2 5DFWH 1RMFL 5T3ZH 5F7LB 3WO4C 1HHJB 4MLIA 4I5BB 3HLAA 5E8OA 2V6HA 3T4YA 3WNMA 2X09A 4YNYB 4RMWA 1BQUA 3JWDH 3ZHDA 3KLHC 1FYHB 4O5LL 3E8UL 4U6XA 2BVPB 5AAWA 4PJ8B 1NBZB 1S7WB 3MRRB 2IQAB 5EZOL 3MREA 2PR4H 2DIBA 3GB7A 4DVRH 1R5IB 5JW4Q 3BAEH 2AEWA 1FNHA 4WFHD 3SN6N 5FO7B 1YY9C 3OTTA 3QDGB 4LEOB 2V17L 2XOTA 2WBJC 3NN8A 1U8IB 3AREA 1TJGL 5EU3A 5JUEL 4G5ZL 2J8OA 4FABH 2ICES 3KLAB 1KG0A 1VCAA 2JJVA 2W0FA 1RZ7L 4JQIL 3RNQA 2FBJL 3WJLC 3X13A 4IM8A 4GW5A 5BJTA 1EO8L 4G3YH 3QUYB 4LASH 1BBDH 5C2BL 5F3BB 1A1MA 1CFQB 4J12A 4QHKJ 3WLBA 2XT1B 1OM3L 1KNOA 1KELL 2DTML 2BSSB 1YMHA 8CGTA 5EZLB 4OJFL 2ADGA 2H9GB 5D6DC 5ETUB 4PY7A 1IAKA 1OARH 3MV9D 4QRPB 4X7TB 4QTHB 3EYSH 1F4XH 1MNUL 2A77H 4L5FH 5HJ3A 2W60B 4FZEH 5JW5B 3G5YB 1U3HA 1QACA 4XTRC 4JG0H 4OF0A 1EO7A 4LRNH 5D7LA 4LLUB 1IC4H 2A6KA 4JO4L 1NGYB 4CU7A 1FO0L 2HN7B 2BMKB 4ZOCA 1SBBA 4XBEL 4APQC 5IT2L 2I5YL 2H2PD 4JFZL 3BSZL 4L8DA 3SGEI 4P59L 5KOVC 4W4OA 2D7OA 3HNTH 1IAOB 4QHLB 4XMLH 3O9WA 4G6AD 3EZJB 1XF5B 3MXVH 4HH9B 3CPLB 5AZ2L 3FQRA 4WFEE 1BWMA 2NY7H 2CLVA 5F8QC 4OI9A 4GG6F 3H42H 4NWUH 4HUMB 2EZ0C 3QUXC 5B21A 1CD9B 1EIBA 1I3RB 5ALBL 4AEIL 4DK3A 2VN4A 1MCRA 4S11A 2UYLA 4X4MA 4QRRE 4XP5L 4ODXB 5I1DA 4P2RD 2AKRA 5FYLD 4X99A 2GJJA 5E9DA 5DSCB 1YEHL 1XH3A 3HR5B 4ZFOB 2AEQH 4NQVA 1Q9OB 3EJYC 2FIKA 1H5BA 3MUHL 3V2AR 3MSPA 5JA8B 3T0XA 4QTIH 2AP2A 5DMIH 4OZIB 5HGHB 3RZCA 4JG1H 4HT1H 1N5YH 5LVEA 5IB2A 3N9GL 4P46C 3INUH 1P7QA 3MOAH 4XPTL 5J11C 1I1FB 4MJID 3VWKA 2E9BA 2DQHH 1CDCA 2GKIA 2GYSA 5CEYB 3OJMB 1MFCH 2Q6WB 1OWWA 4LNRB 4M5YL 5IW1A 2DQIH 3NFSL 2PYFA 1CICB 3DRTB 3F7VA 4C83B 4ZNCD 1DQMH 5ICZB 4MNQA 5DYOA 4EZMA 1CR9L 3FO2B 3OR7B 2LTQC 1JGVH 1JVKA 4NO0D 1H0DB 1U8LA 2AJXL 4NKIH 5FHAL 4P5KA 2QHRL 3C5ZA 4OFPA 1FE8H 3HRZA 2GJ6A 2PCPB 3GMPA 5KSAC 1QSEE 3O8XA 2BNRE 1SEBA 1DQJB 1FL3A 2GIYA 5ILTH 1PKQE 3OGCB 1CGSL 1MFEH 2NLJA 5DJYA 3K4ZA 5E6YA 2OTWA 3MRBA 1QOKA 5IQ7H 4FP8H 2Q86A 3EYUL 3DO3A 3I6LE 5GS1B 1JTOA 5EO9A 1I9JL 4EXPX 3I02B 5CIPB 1N5AA 1NBQA 3VE0A 3CSPA 2HH0H 3LEXB 3V5HA 2NY1B 2AK4E 1RK0B 1NGPL 1F13A 5C0NC 1F90L 1AXSA 2YRZA 3WDJA 5IFJB 4X6EB 5JHDB 4O51B 3RVUD 1LO4H 4HKXB 2CUIA 2PO6B 3RGHA 3QH3B 3AB0B 2BVTA 2ZCKH 2ZSVB 5ELIA 4S1RH 1R6VA 4X6DB 3ARWA 3MLYH 3QCTH 2Z35B 4LKCA 3WNKA 4I18A 4I3SL 1LDPL 1B90A 3W39A 4L4TD 3EFFA 4YWGL 1JZ5A 2DM3A 3BN9C 4OKDA 5FO7A 3F5WB 4V1DE 4S0SD 5IKCB 2NXYD 3SDDD 4IS6B 2ZJSH 5GIRB 4LSSL 5K33A 5BMFL 3ULVL 1UGNA 2ICEB 3EHBC 4KVCH 1JGDA 5CJQH 1P53A 5D1ZD 3EFDH 3CH1B 4KRPC 4NN5C 4OLVL 3LEYH 5IVXA 3AVEA 3KPSE 1JPTH 4PJBF 5EWIL 2D03L 5D6CA 1FLRL 4Q58C 4FQCH 1WK0A 3HUJB 4XCEA 2ZUYA 3HI5L 4ZFZA 5LXGL 4WUUB 2P48B 3FB5A 2COQA 1FAIH 1I8LA 5TDPA 3WBDA 3CJJA 4QXUL 3KPRA 4ODBD 5E00B 2R0WH 1HXYB 3FZUD 1LHZA 4WY7L 4ESKA 4BQ8A 1RUML 3M07A 1K4DA 5DJXB 5SWSA 2VISB 4C58B 4LLUA 1N2RB 1KJ2H 2EDXA 3TO4D 2QSCL 4RZCA 4PJIF 4AIZA 3QQ3B 2BMKA 1M7IB 1ZHKB 2RCSH 3AS1A 3FAWA 4PGBA 1OSPL 4PJGE 1QFUH 1IGIH 1JF5A 3QPQC 5SWQB 1G7LA 2VUYA 4OGZA 5F7MC 4NRXB 3LVEA 3ARDD 3U7AA 1QSFB 2R1WA 3UDWC 2RFXB 4QHLA 4ZXBD 1J0JA 2BJMH 4UDUB 5I8KH 2NY2C 5HYQB 1M71A 3L3IB 4R3SB 1UH4A 2ADJB 3T0BA 5DHVH 4OGAD 1RUAH 5T1KD 5GJSH 1DANT 5EU6D 4AH2A 4DZBA 5I18L 5I8EA 5EIVA 4GRWB 4ODUB 4XHJC 5J6GB 2XFXB 1ZHBA 3P0GB 1T0PB 1LEGB 4FFWD 1UACL 1UZ8B 1CFTA 1MFBH 4Z95H 4Q9RH 4B7LA 2APBA 1ED3B 4BJLA 1SEQH 1IC5H 5CLWA 2VLMD 4CVXA 2R9HC 1BQHB 3PWLB 2FDBP 4L3AA 3X12A 1XF1A 1DVFC 3CFCH 1A9BA 2EXWC 1VERA 3OSKA 3T65B 3DWTA 1D5MB 4FQIL 5HI3C 4GRLC 5JDSA 3G08B 2NY4C 2YD2A 3GSNB 3QZWG 4ZNEE 4KKLD 2A6DB 2QEJA 1SMOA 3LSOA 3HFMH 1FYTD 5EOCL 1YYMH 1OF2A 3ZLQC 4FZ8L 2GCYB 1IGJA 2YMXL 1HILB 5JLZB 1X5YA 5GRUL 3Q5OA 4DUVA 3DX8B 1BD2A 2X89A 1DQDH 1EEUA 3D3VE 1LO2H 5IB3A 2Q6WA 3QG6B 5D7JB 4TUKL 3JV4A 3BHBA 1NCAL 4LSDA 5FDWA 4OCMC 1NAKH 1QLFB 4UTAH 2NQCA 2NTSP 4JDTH 4YHIB 3CDYA 4K3EL 5EPMB 5EUOE 1F2XK 3DBXB 3IDYB 2BDNH 1U8KB 2GSIB 2Y72A 3FOLB 5DA4A 4NT6B 5MP6H 5INCA 3OGCA 4HJJH 3DMMA 4LDEB 2L7UA 3PWPD 3LKRB 5ERWB 5M94B 3OJ2C 1I1AA 4POZD 2X1OA 1E4KC 2XG5A 1FPTH 2L7JA 4PV9A 4WW1A 5KSVA 1NDMA 3RIAF 1NMBL 3U7YH 5H35B 1A21A 4JM2F 4HS8L 1OAUL 3W81A 4WFGE 2HKFH 4U1IB 3WD5H 3A6BH 1T1XB 2NZ9D 4HKXA 3C9NB 2VR4A 3B8SA 1BMGA 5ICXA 3BYYA 1U8MB 3ZKXC 3QAZB 4PY8I 1AHWB 4M43L 3MODL 1FGVH 4U1MB 3JWNC 4IJ3B 4JKLA 3QI9D 2Y06L 3MRMA 5EFIB 5FA3B 4NRZB 4Z7WE 4OV5A 5FO9B 3DX7A 4JHAL 3MACH 3I3DA 1G6RB 3IF1A 2WW8A 2XN9B 2HJFA 4BELD 5HVHB 3S37H 1G1CA 4QF1B 3RL2A 4E0RA 4L8BA 3U6RA 3KS0J 2JELL 5DGRA 1I7ZA 4JAMB 3U82B 1KXQE 5IR1B 5FYJU 5CFHA 5DQJB 4WTZA 1L9MA 2RB8A 4L3EA 3QXDB 3RWFA 3HA0A 1TCRA 2EIZA 1Z3GH 3W82A 4YFDB 4GBXD 4G6FD 4TOYL 2X4NA 4F8QA 1LNUB 3KAAA 1AFVL 3C60D 5EZOH 2C1OA 3CFEB 3Q6FB 1XIWD 3WUZA 4K8RD 2PXYD 4QT5A 2ID5A 5TQ0L 2QQQA 1OGAA 4H0IA 2V17H 4MD5B 4NBZB 1FBIL 2NY6D 5JUEH 1I4FB 4G6MH 3O0RH 4G5ZH 3F6IA 3GJFA 3P9LB 2WBKA 4JFDA 4X7SL 3T0WA 2P8MA 4JQIH 5ID1B 1ZWIA 2VH5L 3PIQA 2FBJH 4FTVD 2ARJB 4D0CA 1O0VA 3KPOA 1EO8H 4NZRH 5DD6A 3RVVC 3VG9B 1DEEA 2PYED 5C2BH 2CKNA 4X9FA 4NO3A 4UB0L 3TJEL 2CIKB 2V2XA 3DUSB 1ZGLP 1J8HE 1RZ8A 2VUOA 3MJ6A 4L9LB 5HYQA 3K1KC 1U8PA 4R3SA 1QRNB 5FM5M 4OLEA 3X11B 5A1AA 4M7KL 5FO8A 2Y4SA 5B8CB 5EC1A 5SWZA 3WNOA 4NQCA 3R1GH 2UV3A 1XCQB 5A3IC 5CEZE 1SJHA 3MA9L 1SY6A 1KCSL 1CXEA 4JKMA 4P2RB 4ZUWA 1VDGA 4L4VB 4YE4L 4JFFE 1ZGLM 4OZGB 4JO4H 1HCVA 3BGAA 5JPNA 1B6DA 4QO1A 4GG6A 1FO0H 2Q7YA 3CFJB 5IT2H 2I5YH 4JFZH 3BSZH 1EDQA 1SJXA 3RWEA 2R2BB 3DXAE 4JZNA 1WAAE 3L5JA 1VACA 5L6YL 2A6DA 4NNXA 1FNGB 4M8QA 4NSKB 5E5RB 5F7NC 4JREC 4JFPA 5ANMA 4R0LA 5AZ2H 4JO3L 3R4DA 4CKVX 7FABH 3CSYA 2N7BA 5EO0B 4MJIB 2KBGA 1Q72H 1YEEH 1B0RA 2NR6C 5ALBH 4AEIH 1MRFH 5K59F 5EOTA 4A6YB 3FO1A 1RHHB 4NO0B 4XP5H 3LQAH 5BZWA 5JO5A 1F4YH 2AJ3B 1EVUA 1IAIM 4GQ9L 5KANG 4ENED 4TVPD 4OFIA 4YHIA 1BJ1H 2VQUA 5I19L 1YEHH 3AU1B 3DVFA 2JK5B 3FOLA 3X3GL 3ZDYE 2HVKB 4OI8A 1BJ8A 3M17B 3K1DA 1Z9LA 3MZGB 1I9EA 2XZCL 3KNBA 4OQTH 3TBSB 3L7EA 3LKRA 4POUB 5JPMA 2GJZA 5F9WC 5JR1L 3ULVC 5C0JB 1ZOXA 3ECBA 5I1AB 3VXSD 4PTTA 4PJ9C 4XPTH 1S9VA 5DRZA 3C09C 5BOPA 3WUWB 4XAWL 2EDTA 4OZFA 2GAZB 3PP4H 5CBAB 3NFSH 2D3VA 3TNMB 4KHTL 4TUOB 1HHGB 4MA3A 1CR9H 3IDGA 4OLZL 1FVEB 1UZ6F 3BI9X 3PL6C 1AXTH 2X7LA 3BDYL 4LCYB 4K07A 4CGTA 5KVDH 3TT3H 2AJXH 3N1QC 5IROC 3REVB 1DN2A 2QHRH 1PSKL 3NZ8B 2ICWB 5HBBA 4DKEL 1MCPL 1DQQB 4LFHD 1R24A 2NXYB 1AI1L 4KHXL 1CGSH 4RX4D 1OD7A 5FA3A 2RIKA 1EPFA 1M1SA 1QEWA 5FO9A 1S7RA 1ZS8B 3HI6H 3RUGB 4KVNL 1CFNB 2VDML 1G6RA 3EYUH 3ELAT 3ARFC 5DQ9B 4MSWA 1C8PA 1G7HA 1NC4B 1I9JH 5D1ZB 4AEEA 4WHCA 1Q9KB 4JAMA 5IQ9B 4CMMB 1I8IB 1AGCB 4WHYG 1NGPH 1NMAL 3QXDA 1F90H 2WP3O 5BRZD 2NW3A 1ZT1B 3CSBA 4YXLL 1INEL 5KZCB 4LPYA 4MX7B 2R2EB 4ZPTB 2JCCE 2XNAB 2WWKO 3MRHA 3HAEA 2VE6B 3F12A 1GZPA 3BMWA 1QLRB 3MV9A 2EKSB 4KKCD 5HGDB 4PRDA 2BXZA 2JE8A 3CU1A 4UV4H 3ULUD 1SJEB 1U91B 1MREL 1LDPH 4I3SH 1XGQA 1CK0L 4PJBA 4WI7A 4TRPL 5DJ0A 4RGMC 5E4IA 2DMKA 2Y36L 3HC3L 4LSSH 3UTZA 3TO4B 4XRCB 2WP3T 3ULVH 1KB5B 1J5OL 5DK2A 3WN5A 1NFKA 1FNAA 2HJKA 2AJZA 2WWKT 1QFWL 3H9SB 4OLVH 3P4OA 1X7QB 3QIWC 2D03H 1FLRH 5I1GL 4N68A 2P5EE 4LGPB 2ICWJ 1AC6A 2CIKA 4JRXD 3SDAC 1FL5B 1G7JA 4N0UE 3LKPB 3HI5H 5LXGH 3S34L 1NGXB 4PJIA 1YEJL 3B9EA 1MELA 5EU6B 3RVXD 1T3FB 4MJ5A 1HOCB 4ZAKC 3FT2B 4JDZB 1X4XA 4JZOB 4HHAA 2B39A 1XCQA 4E5XB 4LARL 5CJOH 4R4BB 3S96B 5B39G 1RUMH 4XCNB 4N1CA 1UH2A 5GRVL 3KXFE 3KLHD 2QSCH 5HHXL 4HKZB 4X7CC 1JNHA 5AEAA 4YBLB 2EEAA 2X10A 3LPFA 4U49A 1XR8B 1RZJL 3GIVB 3S3PA 3CVHA 4NPYB 3S35X 5C3LD 4QHKI 3C6SB 1KTKE 2NXZC 2FZ3A 1X5JA 1S9XA 4YHOL 1H3GA 4OCXL 3WLWC 5E2VH 4PRIB 4Z6AT 5I18H 5C09E 3OR6B 2CR6A 4U0RC 4JPWH 2AW2A 1MCIA 1J87A 1NC2D 5JOFB 5E2TL 4NO0A 3FJTA 1CFSB 2XY1A 5IBUG 4H25B 3AU1A 4F58L 3BGFB 1U8JB 3VW3H 4N9OB 4LAQL 3MRNB 1LK3H 5EU7C 5ADPL 2APXA 1F4WH 3CXDH 5CINH 5KG9B 1PJ9A 4DGVH 3V7AG 3JV0A 4WUKL 2FR4B 2CO6B 4XTRD 4P23C 5ADOL 3RA7L 5L2JA 1UVQA 5GRUH 1JGEB 3DX6B 4NQUA 4DK6A 4APQD 2BNQE 3MRGA 3W9EA 3K8LA 4BQCA 3KYMA 2R1XA 5AYUH 3MMEA 3MJ7B 1NCAH 4TUOA 1PZ5A 1ACYL 1CS6A 5D72L 1F00I 2WK2A 4K3EH 3MCG1 4F2MB 4DOHB 4L4TA 3QI9B 4WFFD 3EZ8A 4ODVH 5H2BA 2EXYC 4AL8L 3MX0A 4HWBA 3SDDA 4KY1H 1NAMA 4Z7UE 1AIFA 1NMCC 2R0LL 2WM0A 1FCGA 2EZ0D 5D71L 9CGTA 2O26U 1J11A 1QNZH 1TQBC 4J8RA 4RFEB 2Z91A 4F3FB 5CCKH 3CX5J 4HEME 3C5JB 2BY3A 4JY4B 4M1GL 3U0TB 4WU7A 1RZIA 4HS8H 4P2OD 5DJDB 5HGBB 3FT4B 1I8IA 2OXHA 2B1HH 2VXTL 4G8GB 1NANI 2DWDA 3O6LL 3QNYB 3HRPA 3TVMC 1I7TB 4NC1C 3UAJC 4GBXB 3HPLB 4G6FB 2J6EA 4DCQB 3QCVL 2ZNWA 2O5XH 1H15A 2BCKA 2E6PA 3C60B 3TIEB 4M43H 2ZUVA 4U6HB 2VE6A 1ZGLB 1KV3A 1XIWB 1EK3A 3HE7D 4RGNB 4P46D 2PXYB 2YBRB 3LCYA 5CLTA 3MLRL 2Y06H 3WXVL 32C2B 1BJMA 4JHAH 5IB1B 1AR2A 2NY6B 4LMQE 5C9JB 4OQ1A 5DZOA 1GZQA 3BZFA 4K3JL 4PLKC 3ZZ1A 3MR9B 2VO5A 3NFNB 4XNXL 4NBXB 2JELH 3HZVB 1QSED 1MLBA 2BNRD 1T89A 4UBDC 5DTFB 5JXEC 4PBWD 1P4LA 3ARDA 4KZDL 4KJWD 2ENYA 2PYEB 5F88A 5KSAD 5IOPA 1JYVA 4HUUA 4ZXBA 3I6LD 1P84J 2ZCHL 1I1CA 3ARXA 4Y88A 5DO2C 3TBVB 3ALWA 3VGAC 4Q74A 4X5LA 4TOYH 4BYHA 1NGXA 2NYYD 2F8XC 1GHFH 1AFVH 4X83A 5T1KA 4I3RL 1T3FA 4HV8A 3RWHA 2QQNL 3CXHK 5E94B 4P48A 2AK4D 5FB8A 4E5XA 5TQ0H 4EJ1C 4R4BA 5DA0B 5C0ND 1H9VA 1FBIH 1EEYB 3O4OB 3ROLA 1R3HB 4P0DA 4FMKA 4NCDA 1KC5H 4OZHF 3FT3B 2KQNA 3MYZA 4LVNB 4MNGE 4X7SH 2VH5H 4IMKA 3WS3B 5B3JE 4V1DD 1WBXB 4X4ZA 4N8VG 2VDPH 4D8PA 2WLYA 1YPZE 4LLVA 1FYTA 5JOEA 3BN9D 3TJEH 2AK1H 2YUVA 4RIRA 4ZG1A 4RMSA 5I30L 5CP3A 2MCPH 2J8UE 5F97E 5D7KD 2CQVA 1KFAL 3VRIB 5C0AE 4R6UA 1DQLL 4XMKL 4GXUM 1QKZH 4NHCL 3EHBD 3KPSD 4PRAB 3OR6A 3NGBB 4X9BA 2XWBA 4GOSA 3WHE1 1LVEA 1KCSH 2NX5A 3KG5A 4KRPD 4BM7A 4LHUB 4YE4H 2EECA 3MJ9A 5D7SH 3LOWA 5I1KL 1T0NA 4UQ2B 3UCRA 3O6FC 3MNWB 5AG8A 4NJAH 3RX8A 4ZUVA 4P3WA 4AY0A 3PWPA 3WDHA 3EDFA 5L6YH 1BPVA 1V5JA 1LMKA 4N0RA 3C8KB 3OKLA 4TQEH 1TQCC 4E42B 5EA0L 4U1GC 2BRRL 4WHYH 5CBEA 1X5AA 1F5WA 4GRMB 4MAYC 3OKOB 3VXSB 5DD3L 4JO3H 1HHHB 4NKDB 5F9JA 1MIMH 2G2RA 3DGGA 5F6IC 3RGVA 1T22A 3SGJA 2HG5B 3V0WL 1X5XA 2W59A 4LLWB 4K3DL 3DSFH 5KW9H 3PG2A 3RX5A 2J3SA 1T1WA 1RUKL 3QPQD 4PBVC 1EJ6A 2VOTA 4JJHA 4G6JL 2HTLD 1VEMA 3VFUA 4Y4KC 4WI8A 3PGFH 5IM7B 3BRGC 3OB0H 1T83C 4GQ9H 2P8LB 1K8DA 3BVNB 1G1YA 4ELKB 5I19H 1JMZA 2A6JB 3VJ6B 2BK8A 2Y5EA 3X3GH 4N0YL 3L9RB 4PD4K 3ZT6A 4IIQA 3BRFA 4EDXA 4XHJD 1KUMA 1IGML 1OY3B 5JR1H 2P7TB 3JZ7A 4TTGA 2J88H 1MFAL 5GPRA 4WWKB 2B1AL 4YEFA 2J4WL 3O3DB 4UINL 4BFIB 3C5JA 3SE3C 5F70A 4IRJC 1NKRA 1HYSC 1VGKB 5HGBA 4Y5XB 4LCCB 1F45A 3GZKA 3FB7B 4XAWH 2V9QA 3TH3T 3V7AE 2NY4D 3MRFB 1UM6H 1OSZB 4Q0XL 3OB0K 1BVKB 5KTEH 4OLZH 3B6SA 3C60A 5HD8C 4EI6B 3BDYH 2A73B 2YD8A 1WT5C 3VA2C 3SO3B 1PSKH 1NBYB 4DKEH 5F7FA 3TBWA 2F54B 3GI9H 5T1MA 2XTJC 3PGCA 5TDOA 1AI1H 2LVCA 3L3JB 4TTDD 2VDMH 4OUOA 5D7IB 1QO3A 2DQTL 4OLUL 5DMJB 2ARJQ 4P3DA 5E99L 2F74A 2G75B 1FFQA 1F3JB 2WSKA 2YEZB 4PPTA 4P49A 1TLKA 1RZJC 1T20B 4FTVA 1KACB 5KSBB 3MLSL 2Q3ZA 4PJ5A 3CC5B 1GGIL 4PJHE 2PYEA 1T7XA 4JRXB 1YEIL 4YXLH 4F9PA 1INEH 4QRTA 4NKOA 1K8IA 3WIIL 2V2WB 5D1QB 4EEEA 2X70A 4OF8A 3F58L 3MV01 3QULB 3HZMA 1AE6H 3DURB 2DQFB 4EIGB 5IEKB 2XZZA 3Q6GH 4GLRI 1K85A 5F72S 2ZSWB 4WFGD 5GS3A 3WO4B 1TTFA 1CK0H 2HVJB 3JVGC 3SKOB 2OTPA 4B5EA 2DJ4A 4H5SA 3C5SA 2DM2A 1GC1L 3IGAB 3EOBB 2E9WA 4KV5E 4ZOAA 4ZQKB 5IJKA 3FT3A 3B9KC 1J5OH 3L7FA 5FYKL 4WVRA 1AO7A 1REIA 3HE6C 3IDNA 1B88A 5D8JL 4JKPL 1QFWH 1XF2A 43CAA 4U7KA 4L29A 1CD1B 3HI1A 4G8IA 3H6JA 3T2OA 4MLSA 1LO3H 1A7PL 5I1GH 2FJGB 2WBJB 4NC2B 4K71C 4F7EA 4J3UA 3HC0B 4U1LB 1ZVSB 3VRIA 3T0EB 3HS0B 1P1ZA 2XWTB 4HWEL 2R2HA 1OTUD 5IESH 4LSUL 4HD9A 4LARH 4NZTL 4HUVA 3IFPA 5HI4C 4X9GA 1S5HB 3T8XB 4XPBL 1T03L 5D96B 1FNSL 3R06B 1M05A 1JMXA 2DI7A 1CVSC 1UXWA 5HHXH 4S2SB 1RULL 1UB6B 2UZXB 1MCBA 4PJGF 2IQ9L 1RFDL 3MNWA 3U79A 1RZJH 2AJUL 2CKBA 2E8ZA 3MV8A 5SV3A 1S7UA 1J0HA 2HFGH 1CLOL 5F7HA 1FZJB 4MQSB 3G5ZB 2D31B 2Z9TA 4M62L 1JZ7A 2YN3A 4TNVF 4PJCB 2EYTB 2ZG1A 4X5WB 3MOBL 1R3LA 3EDEA 3RKDC 1NCCH 3PQYD 4DVBB 4YHOH 3ZO0A 4ZDHB 1HHHA 4E9LA 5ACZB 4APQB 3IB4A 1D6EA 2AV1B 4LLWA 1GAFL 5I16A 3BP4B 4QHUB 2HFTA 1Q1JL 3V4UH 1VHPA 5I76A 5E2TH 5GRVK 2AAVA 4MXWL 3RVVD 1J8HD