4YMIA

Crystal structure of probable nicotinate-nucleotide adenylyltransferase from mycobacterium abcessus in complex with nadp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
198
structure length
178
Chain Sequence
RRRLGVMGGTFDPIHNGHLVAASEVADRFALDEVIFVPTGQPRKVSPAEHRYLMTVIATASNPRFTVSRADIDRGGATYTVDTLTDLRTAHPDADLYFITGADALASILSWENWEQLFTLAKFIGVSRPGYGLSLVEVPALAISSTDCRIRAGQARPIWYLVPDGVVQYVAKHRLYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable nicotinate-nucleotide adenylyltransferase
publication title Crystal structure of probable nicotinate-nucleotide adenylyltransferase from Mycobacterium abcessus in complex with NADP
rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 60
structure length 178
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ymiA00
3H9BA 2HGZA 1MAUA 2QTRA 2QUHA 1Q11A 1UFVA 4U63A 4OJMX 2G36A 1VLHA 4G5FA 2CYBA 1HYBA 4ZT6A 1JHDA 1XNGA 3IOCA 4I6GA 3FY4A 2PXHA 3QTBA 4K0RA 4MW0A 1COZA 1WY5A 2Z08A 3COVA 4K03A 3IODA 4EG6A 1PFYA 1PFUA 3FHJA 1O94C 5FNZA 3DLAA 1KKUA 3CVVA 1F9AA 2HMAA 2R5WA 1MRZA 3ND6A 1F7VA 1NUUA 4QREA 2CV2A 2CFOA 4MVYA 4F4HA 2E0IA 1M8JA 1GTRA 4MUJA 3A05A 1N77A 2BTEA 1U3CA 4KR7A 3CVWA 2X1MA 1K97A 1NUSA 4MWDA 4U8HA 1IQ0A 2HZ7A 3NBAA 3FWKA 4MUFA 2WSIA 1D2RA 1IHOA 1RQGA 5DB4A 1J1UA 3A4IA 1EFVB 1KR2A 4ZT5A 5H16A 3D6VA 3TS1A 1XJQA 4ZCQA 2WB2A 3G5AA 3N2YA 4KPUA 3DO8A 1N2JA 1YULA 3AL0C 3P52A 1X8XA 1PG2A 1T6ZA 2IELA 1K92A 4EG5A 2IJGX 3P0IA 2DERA 3M5WA 3CA8A 3MLBA 3I05A 1H3EA 1VL2A 2Z09A 3ISJA 5TEWA 2GKSA 1KQOA 1OWPA 4R2MA 2AZXA 1M8GA 4HJRA 3RJZA 3ZXSA 2CYCA 2JA2A 2Z3VA 1GTSA 4CDNA 1XNHA 3AIIA 3X1JA 3CVUA 5FO0A 3KT8A 1EUQA 4PY2A 1V47A 1WQ3A 1H3NA 1YI8A 4EF6A 2O5RA 1FFYA 1T9GS 3IDFA 1KQNA 1N2HA 2CV0A 1GLNA 3N05A 4MQ6A 1N2BA 3OTWA 1S4MA 2WQ6A 5KHAA 2PG3A 3D6UA 3CLUC 4MW6A 1TEZA 1EFPA 1KQPA 3L92A 1N2EA 3DPIA 3MMXA 2YXNA 5K0SA 1PFWA 1QJCA 1VBKA 1J21A 2A1UA 4YP7A 3PXUA 1ZJWA 1VBMA 1KP3A 1ZH6A 1EJ2A 1B6TA 3IH5A 3RBAA 1WKBA 1WJGA 1YUMA 1MBZA 2A84A 3HMQA 3SEZA 3ZJTA 3QE4A 3A04A 3P0JA 2CYAA 4MLPA 1R6XA 1I6LA 4MVWA 5IJXA 4QBTA 3RK1A 1T9GR 4J76A 3JXEA 3AKZA 1N3LA 3BL5A 3N9IA 1O94D 3GLVA 3IUBA 5TS2A 4WNYA 3Q4GA 2I1LA 2QUKA 3VGJA 2JANA 4MUGA 5TGTA 1U3DA 2QUJA 4DLPA 4MWBA 3G59A 1V8FA 1N2IA 1ULHA 1IFXA 2PFSA 1TYAE 3HFJA 4DE5A 1T6YA 3NV7A 2V0GA 3SYTA 1SURA 3ZJUA 4JXZA 1JZQA 4CQNA 4NAUA 2J09A 2DXIA 3G6KA 1EE1A 1EUYA 3HL4A 3MLAA 2VTBA 1JECA 3HGMA 5DK4A 4MW4A 5J59A 2O8VA 4U7JA 1Y42X 4JFAA 1G8GA 2A1UB 3ND7A 1N75A 1JIIA 1TYDE 1O95C 1KH3A 1Q77A 5BNZA 1EXDA 3IUEA 1KAQA 4P2BA 3INNA 2RD2A 2A4MA 1IQRA 1K4MA 4PBSA 1J09A 2GOYA 4ND7A 3FG9A 1H3FA 1O97C 3AFHA 2DPLA 2A7XA 5J58A 4MVCA 4NATA 3RK0A 3SDBA 4RPIA 3SZGA 1O5TA 1PFVA 3ZXIA 1I6KA 4I6EA 2X0KA 4ZT7A 1N2OA 4JZYA 1JILA 4TS1A 3ZIUA 4PBRA 4KR9A 3P0HA 1QU3A 4RUKA 1MJHA 2VXOA 2QUIA 1R6TA 2H2AA 5H7XA 1MAWA 2JAXA 5J5AA 4ZCSA 5TEVA 2J08A 1U7DA 4E1AA 2A1TS 1JMVA 4R0NA 3SP1A 1WXIA 4MVXA 3VRHA 4Q16A 2VTBB 5KCMA 2DR2A 4XSVA 3ZUGA 3HV0A 4YP5A 4ND6A 3OP1A 5HG0A 4YMIA 1NSYA 3UK2A 1GAXA 1ILEA 2AG6A 3FOCA 5LFAA 2TS1A 1OBCA 2XRYA 1F7UA 1P7PA 3C8ZA 4MUIA 2AKEA 5HUHA 4DJAA 4WSOA 1NI5A 3IVCA 4R2LA 3KT3A 3X1KA 1WOYA 5K0TA 4ARCA 1MOPA 2V0CA 3KT6A 2D5BA 3U1VA 1M8FA 4Q93A 3FDXA 3TQIA 3CLRC 1LI5A 1QU2A 1K4KA 1CT9A 2XRZA 1QQTA 4QRDA 1A8HA 1J1ZA 1GPMA 2A1TR 3AG5A 4MW1A 4MUNA 4OUDA 4MUKA 4L2IA 1O96A 3DV2A 2EJCA 1NUPA 3IOEA 1WXEA 1OWLA 2J5BA 1J20A 4KPUB 2J07A 3SZ3A 1YIAA 4MAFA 1N2GA 3HZRA 3N8HA 4F3RA 1I2DA 2QJTA 1QRUA 3FETA 3UMVA 1KORA 3CLTC 3IMCA 1U7XA 1O0BA 3FIUA 3KFLA 3KT0A 1GZUA 2QJOA 2D54A 1JIKA 2DETA 4JXXA 3Q12A 4DDKA 5DASA 1O95D 3IOBA 1KP2A 1PG0A 1G59A 3SEQA 1N78A 2E89A 3IMGA 2NSYA 2QTNA 2OV4A 4YBRA 1MB9A 4DNXA 4MW9A 1M8PA 1ZUNA 2E18A 5LM3A 1IQUA 2E21A 4NZPA 3ZJVA 4KR6A 1T6XA 1LI7A 3CLSC 1O97D 3COZA 3LCJA 4YP6A 3FI0A 4MUEA 2WQ7A 1Q15A 1BS2A 2PZBA 3ILVA 4GU5A 4EG8A 4ZCTA 4HJXA 2QJFA 4ZT4A 1EFPB 1EFVA 1JGTA 1O0CA 1O96B 4FZJA 4DDMA 1MB2A 2B7LA 4G6ZA 2DEUA 1WQ4A 1M1ZA 2DUMA 3ND5A 3RFFA 4UZEA 1WZ2A 3GMIA 1IRXA 1XNJA 4A91A 2H29A 4MULA 2CSXA 3K9WA 3PNVA 3H97A 1G8FA 4NX2A 5HUJA 4BWVA 1JZSA 1O6BA 1QRTA 4G5YA 2X1LA 1OWNA 3F3MA 1KAMA 4AS1A 4AQ7A 2CUZA 1MC1A 2CV1A 1YIDA 4H3SA 4NDAA 4PBTA 4EFKA 2ZUFA 1J70A 1LW7A 1M8KA 4EG1A 2RE8A 2D13A 5FO1A 1M83A 3CLRD 3A2KA 3GUZA 3PRHA 3CLUD 3H99A 3H9CA 2PZAA 1NUQA 4EG7A 3IMEA 4MWCA 1NUTA 2ZUEA 2OQ2A 3RHSA 1TQ8A 2C5SA 1I6MA 4GRIA 4MWEA 2J4DA 5AHWA 3FNRA 3QTTA 4HK4A 1IH8A 1WXHA 4XFJA 4JYZA 2EL7A 4NAHA 1TYCA 3NBKA 1QNFA 5LLTA 1NYLA 3CLTD 2DLCX 1TFUA 3ELBA 3MXTA 3AG6A 5JBNA 1U0BB 3TQOA 3UC5A 1WXGA 4CDMA 5KWVA 4EGAA 1JEDA 1H1TA 1FYDA 2A88A 3TNJA 1OWMA 4XFDA 3K32A 3CR8A 4UZFA 4ZCPA 4DDHA 3TZEA 1OWOA 4J75A 3CLSD 3UY4A 2ZP1A 3IVXA 4MW5A 1ZH0A 2GM3A 3LOQA 3LE8A 1WXFA 4ZT2A 1X6VA 4MUHA 3CVXA 1OBHA 3CVYA 1YUNA 4ARIA 3H05A 2PZ8A 2CT8A 4X0EA 2X3FA 2YWCA 3L93A 2YWBA 1F4LA 2YY5A 1JIJA 4EG3A 3PNBA 4MW2A 2BYTA 1JEEA 1OD6A 1GN8A 2PIDA 4I6JA 3Q10A 2A86A 1QRSA 1NURA 3IVGA 4HPWA 4ZT3A 1KH1A 3FH0A 3UOWA 3VU8A 4MW7A 4EG4A 3ZGZA 2NZ2A 2IP1A 3E27A 3MUEA 1G8HA 1QTQA 3TZLA 5F23A 1VBNA 1NP7A 4CT0A 1NZJA 3COYA 5DEOA 3COWA 3PNYA 1TYBE 1IVSA 5IHXA 1KH2A 4ZCRA 4KKVA 4OUDB 3S3TA 4L2IB 1DNPA 1Q19A 4S1OA 5EKDA 1N1DA 1R6UA 3X1MA 2QTMA
chains in the Genus database with same CATH superfamily
3PJRA 3N2GA 3ROPA 2Q9CA 1E2BA 4FYJA 5L7YA 1AQLA 4FI3F 3WSVA 4N0EA 2H31A 2OC9A 3A9RA 3TNDA 1WEHA 3ETLA 1M2VB 3KL4A 1SZCA 3CR7A 4M9XA 1E2NA 1VLHA 3IR7A 4OJMX 3GLFA 4GXTA 1GTL1 2O8FA 2IU0A 3QU9A 4ZT6A 3U4QA 1E5QA 3MYRA 4KXYA 4K86A 2B2NA 5C5IA 2OZEA 2AD1A 3VPSA 3W9UA 3VOTA 2RCNA 4C0HA 1WAMA 2CUNA 3HVKA 3IODA 4BEWA 4KYIB 3FA2A 1GGNA 1VFNA 4JELA 1UBOS 3A4YA 1QRAA 5K8IA 3PUKA 4WCFB 1NUAA 1SZJG 1ZN9A 2ZBFA 1QV6A 1R0WA 2FG7C 3RVLA 3SPXA 1KSJA 2M2IA 3TL2A 3WTCA 4WLOA 1T5OA 4CVNA 3KKOA 4E5YA 2EIHA 3LX6A 2Z6VA 1TVKA 4E4TA 1ACMA 1XEFA 4L1KA 1PI3A 2NTNA 3RE1A 4BVEA 2CNNA 4B3SB 1XMPA 2IH2A 4H1VA 4XGRA 1T4MA 2HLDD 4U3JA 1XMOB 1OKKA 1GDTA 1YE8A 3A7EA 3ZXYA 2RBEA 3D0OA 4HH3C 1BGWA 1FUEA 4RF2A 1YZYA 3U0VA 1RNLA 3U9SA 2OBYA 3ODPA 1O5IA 2LD4A 4E03A 1KDPA 5FBRB 3VKVA 4EABA 3GAFA 5BO5A 1Q1BA 1I7QB 3TBHA 4FD3A 2WB2A 1TU3A 3DEKA 1OZ0A 1Z6XA 5EUQB 5C7YA 1N1EA 5B4UA 2P3SA 3KJQA 5HJEA 2OUIA 2RK6A 2VH2A 4KL8S 1CNMA 4JNCA 4P38A 5GJCA 4DQUA 2IELA 2GFHA 4ENSA 5BUQA 5B7GA 4PZAA 1U4SA 2XAUA 3CA8A 1YAJA 3B5EA 4NU0A 4D98A 1VKRA 1IPEA 1ZVKA 3LT0A 3QE3A 3UUWA 3NAMA 3FKSA 4HATA 5I9TA 3H13A 1NJ1A 4OXXA 2ZXUA 2WIGA 2JRLA 3KR2A 3OU6A 1PTJA 4KXLA 1ZN8A 3DBRB 2Y0CA 4JBGA 4RVHA 3RJZA 3WOHA 2Q0XA 3AF3A 1GZ6A 3L04A 1JU4A 2H1SA 4J16C 4JJZA 3AIIA 3D4BA 4QXOA 5FQOA 3X1JA 3ZCTA 4MR9A 1PLJA 4OK3A 1MU0A 3GBSA 4M83A 4E12A 1NW7A 3SQWA 5JI3E 4JX8A 4Q02A 1W30A 4B47A 3KZCA 4K9SA 1T9DA 3DC2A 3RT9A 1JH9A 2I22A 1SG6A 4TTVA 2P2CA 4HAYA 3RUEA 4GKKB 3QUAA 3OPNA 5A3SA 3CZMA 5FRDA 1X7GA 4J3FA 1KYXA 4FDVA 4GDMA 5CRIA 1XCMA 3M81A 2CKDA 5LPNA 1VIAA 5TVKA 1QQAA 4XJXA 1R1DA 3BIXA 4U5QA 3M5CA 2HQRA 3CSDA 4Q4DA 3TGLA 4EQZA 2OMEA 2IYQA 2M32A 3CPJB 4G0ZA 4MWZA 1EWKA 1OBFO 1Z47A 4KR2A 4LJ8A 4AJ1A 3ONDA 2Q6TA 1A9RA 2ZSEA 3WLHA 1DLIA 1QO7A 5BSKA 1H5QA 2VNKA 1Z0JA 4QPZA 1FS4A 2A1UA 2OA0A 5P8WA 3CZRA 4BMOB 1IB6A 5BPHA 1GSAA 3U3OA 5ELMA 4D81A 1TIKA 1B6TA 3W8RA 4DNOA 2A0WA 1MBZA 2B0JA 2RCYA 4OXKA 4BN0A 2JFQA 3O3NB 2HX1A 1G6Q1 1OYVA 2B9VA 3G2LA 4B3GA 1EINA 3P0JA 4QXQA 1QH9A 4R40A 5K3OA 2Q7DA 1KK0A 2VHYA 3C87A 2JFWA 4N5NA 3SVZA 4RZXA 3UK1A 2OHOA 4MEJA 4B80A 3WWDA 1Y8RB 3WIEA 2OHIA 3T9EA 1KO5A 4D0SA 3GA0A 3ANYB 5BRAA 3IV9A 1ZH8A 5TGTA 1JSZA 5G4KA 1FX0A 3DR5A 4TTQA 2UKDA 2AWOA 1MPXA 3I6BA 3OJLA 3VNAA 3G2IA 4BJHB 4WNAB 2QTLA 4DR7B 4IV0A 2XBLA 1KI2A 1E7WA 2WAMA 3CINA 3LQYA 3QFTA 4JY7A 2XIJA 3B1FA 3K73O 1U1EA 4KAJA 4RZUA 1K88A 4JB0A 4ZQFA 1SURA 4KWCA 3SYTA 5IMBA 1X7YA 1E3WB 2GRAA 2J5RA 5AHKA 4BLSA 1RFGE 3ELWA 5JDIC 2FR8A 2G08A 2Q1YA 4H7HA 1Y6GA 2OP0A 4YIHA 3ZXUB 4JH0A 2ZUSA 1J25A 2IV3A 2JFPA 2ZIVB 4BFXA 2NZWA 4O8CA 4C0QC 5LUBA 1XAGA 4KV7A 3T94A 1MT0A 2BCEA 3ABRB 4RKWA 1D5CA 3FYSA 5DNVA 1MW9X 1M2OB 4C7BA 4CIDA 1HMYA 3LXRA 4P5PA 3ND7A 2QHXA 3ORHA 4QT4A 1AMUA 3QPAA 4GT1A 3ZS9A 3MEQA 2H3HA 1SK8A 5JS6A 1OC4A 2JC3A 4PZYA 1XZIA 4Q1DA 5A3QA 3LT4A 2GEDA 1DDGA 4D99A 3E9ZA 1R27A 3CRRA 2F3PA 1TJNA 3VR2A 5KJFA 2XYQA 2A9FA 5F1OA 2ZM6B 5LB4A 2JAUA 5CM9C 5JJIA 3AF1A 1Z2OX 1IIRA 3CQ9A 4CM8B 3OLZA 1HDEA 2ZQ5A 5CXUA 1J9EA 3RHZA 1O97C 1XZDA 1FJXA 2BEVA 4TMVA 2JD0A 2OT3B 4NATA 5D3MA 3RK0A 2UZ0A 1ZK2A 1G6OA 3EXHA 4G84A 4IXNA 3X0DA 3F5SA 4WFIA 1B4DA 1T8UA 4G0PA 1O9HA 1ZNXA 4N8EA 2GBLA 4YO8A 4KFSA 1G18A 1KK1A 4UJ5A 4BZZA 2YS6A 3KTFA 1IEQA 2CLDX 2BKAA 4ZYUA 3I9JA 5HF5A 2ZRCA 1ISSA 4RZHA 2ZYIA 4RV4A 2NQTA 3W2FA 1USKA 5BQ3A 3BT7A 3IUSA 2Q7OE 5B2EA 3T5PA 2QVXX 1Z39A 2B8NA 4QFDA 3SNKA 4RENA 5FHRA 4MARA 5HVNA 1YE5A 5BSVA 4MCHA 5K8LA 1MAAA 3GUUA 2VSXA 2CHGA 4OAPA 1E1DA 4BLRA 4Q82A 3RSQA 3TR6A 3FDZA 4J90A 2RAVA 4C30A 5CFQA 1L4FA 2GJAA 5INTA 2KYRA 4GZMA 4BKUA 4WJZA 3A2MA 3AO0B 2QPTA 2ZJYA 2ZYRA 5T4FA 3WLRA 4JI7B 3I37X 1JIXA 2AR9A 4HGYA 1THTA 2YV4A 2ID8A 3AKYA 3HKBA 4HMQA 1B0AA 1J9ZA 2IDJA 2C5BA 3G5TA 4TLCA 4NWIA 3RJMA 1XTRA 1CJCA 1E7RA 5HUHA 3WK4A 1EX7A 2J0QA 3IVCA 2H2FA 1VI5A 1QZTA 4FW8A 1Z4OA 2EV9A 2WNIA 4P36A 4Q00A 2ZKIA 3QQ5A 4BPBA 4OI2A 1I9GA 1SHZA 1U0RA 4LHZA 2GBGA 4HB3A 1QMPA 4V0SA 1P6UA 1DIRA 4B09A 1ZVVA 3NHUA 4Q93A 1QU2A 1URPA 3EEQA 4UFNA 5COBA 3LIIA 4AW9A 2Z5FA 3CO5A 1RLTA 5BV7A 3UMJA 4A0QA 2RJOA 4ZYZA 4JUCA 3IT2A 2Q6IA 3KJXA 4GS5A 4ILEA 4YXWD 1ZO8A 5E7QA 1DQRA 5LNK1 2Y67A 2J5BA 4M7PA 4HNHA 2GGSA 1JAXA 4BTLA 3RVDA 2A0YA 3R3YA 2TSYB 3OF5A 4YV7A 3Q9SA 1L7PA 1US8B 5C0OE 4BVGA 4Q3DA 4D0NA 1RC8A 4CMEA 3MA0A 3Q88A 4BN4A 4YQZA 4D46A 3SHQA 4RV9A 1O0BA 3JWGA 3Q3VA 1XZAA 1ZIXA 5JD6A 4P81A 4E7PA 5GZ6A 5DASA 5EMLA 2VHQA 5HSGA 3IOBA 4P33A 1K89A 4D57A 3GLGB 1Y9JA 2VHXA 4EL5A 1IB0A 1QHHA 3AFOA 4OK6A 1UC9A 1W0KD 4R98A 3T15A 1F51E 4IINA 1TK2A 3E9MA 4G56A 5A9TA 5HS4A 2QD4A 4MPDA 4Z86A 1QANA 4AUEA 3V55A 5D51S 4A10A 1OI2A 1FRQA 1RYEA 4G0UA 1EUDA 3BA1A 2OD7A 1OGJA 1REQA 2W4QA 3MC1A 4D9KA 5KWIA 3E23A 4Y0NA 1TUGA 4KR6A 2DY1A 2BZ1A 2DVMA 4P31A 5FI1B 3SBXA 3ZHOA 1T5SA 4HQNA 5TNXA 5FBVB 4OOFA 1WE2A 4HB0A 5F1KA 1VL6A 5TY0A 1QE5A 4K9NA 2LIPA 4HVTA 4BRUA 1G21E 1FSPA 5KO2A 4X00A 3ISTA 3WWYA 2HRQA 3IURA 1UBTS 1U7TA 3LFHA 4P35A 3N6XA 5TDHA 1EQ2A 3O2NA 3B1YA 4EHLA 1IN4A 5LZ2A 3L8MA 3NHLA 5DHAA 3U44B 5CGQB 2KMLA 4MS3A 1MB2A 4LYHA 3GC6A 3AEKB 2GZSA 3L6DA 4IXTA 4L0DA 1EFAA 3H5WA 3NS7A 3DS8A 2VP5A 3WJAA 2WTMA 3CWCA 3N39C 4R05A 3A25A 4UZEA 3QEOA 1B41A 1TQ6A 3DOCA 1SIOA 4A91A 1EDBA 3K9WA 3TLXA 1ZNZA 3KPYA 5CAEB 2W2LA 1R0YA 1UJNA 1GV1A 2BL4A 4JLUA 4XJTA 2ZBQA 1E9VA 2ZYAA 2JFNA 2XHEA 3CRQA 3HH8A 1X70A 1R8QA 1VYUA 3C1TA 3OF2A 3BWXA 3PPWA 2NIPA 4L28A 2ZJ7A 3D7SA 3G88A 5A03A 4KJZA 3YASA 4GM1A 1JDBC 4MYHA 4ZEXA 1NJFA 1DZ3A 4H3SA 4CF5A 5KOJA 4RD0A 3SYKA 4UNNA 1PWYE 1KXJA 4DRYA 2PKYX 5IM4F 3K0AB 3GT0A 2BZGA 1M8KA 2WHRA 1EFRA 2YWXA 3CSSA 3GFVA 1XMSA 4RVSA 2MSKA 3S7ZA 2ALJA 5C5CA 2X1VA 4PHCA 1FZQA 3K30A 2JB9A 1NUQA 3ETCA 5JQGB 3PCTA 1WLSA 4J0JA 5KJ1A 4IG9A 3RHSA 1U6JA 3CUSA 2QM7A 4MWEA 2J4DA 1ZW6A 5AHWA 4EATA 1L5QA 1VL8A 3GZJA 4F3TA 5I51A 2O2IA 2D7CA 5EMKA 1S5PA 3KX2A 2BEWA 3JY6A 3KE9A 3WRXA 2YXPX 1EKXA 2J3HA 2QR5A 1CF2O 4QUAA 4F6LA 2R6JA 8GPBA 4O2RA 5EHZA 2OQRA 2PNFA 1NG1A 1X2BA 2GT1A 4E5UA 3M70A 4KSBA 2G1PA 4JB2A 2DWOA 1KZ9A 1NDQA 5ENVA 2V98A 3IPAA 4MPPA 4N8DA 4F46A 2AZDA 3PHCA 1ODSA 1Q1EA 4Q4AB 2CB0A 3R74A 3GPDG 1Z74A 4CKWA 2VEDA 2DFLA 4MMXB 2OOKA 3PDCA 1DXHA 5DNAA 5HTOA 5F9FA 3ACBA 3B3QA 2C96A 1XQ9A 4MA0A 4G9EA 2OGUA 3KKMA 4AO8A 3SZMA 5BQFA 3KOMA 2A0KA 2PO7A 2R47A 3L7MA 1V45E 3QVWA 2FPRA 4ILKA 4KN9S 4B33A 2QY9A 1EVYA 2VAXA 4C76A 3BVPA 4DBZA 4CEJB 4L9WA 1KJ8A 1OFHA 4IJMA 3UY4A 1UKYA 5E4TA 4CZ2A 3W4KA 4RK5A 4MZXA 4C4AA 1SU8A 1EJ0A 1GT6A 3G2MA 1WXFA 1GUFA 4XM2A 1TEXA 2QAGC 3U7EB 1T0IA 1WDLA 2H4FA 3K05A 3BIWA 5D3ZA 5BQOA 3EZ6A 1MT3A 4UVHA 1ID1A 2HPAA 3HWWA 2PLRA 5AI8A 4FFOA 4I66A 2ZUVA 2NACA 4DCJA 3U7GA 3N58A 3TW8A 4EB6A 3DNMA 1L9KA 2KI5A 4W5NA 1BH6A 2JIDA 1QAQA 3NTOA 4Q7MB 5EXTA 3RAGA 1OI7A 1OH5A 4P86A 4MQFA 1ZW1A 2PVPA 2H9YA 1D1PA 4LDQA 3LD9A 3KSBC 1WR8A 4GKJB 4FC7A 5H1YA 5D87A 1GEEA 4FNGA 3JQCA 5CGZA 1A4UA 3VPXA 5HOEA 4MYCA 1NURA 4IHJB 5JBQA 3SC2B 3N2KB 1NA5A 1LY1A 2X86A 2FHSA 2HB6A 2GJSA 1SVUA 2R84A 2RK3A 2ZR7A 3KJHA 1XRLA 1V9SA 2R6CA 3PJEA 3RC3A 1TAGA 2NN3C 2RIRA 4EA9A 3E27A 2WBLC 4M8NE 4B7UA 4CIVA 5K03A 2PKQP 4W99A 5ALQA 1NBWB 1U8FO 3FGOA 4UCWA 3RRMA 3DXYA 2IUSA 4KU4A 3M4NA 3GELA 3EXIA 4BO6A 1ZOSA 4BL5A 2ODPA 2ZTUA 3AL3A 4BX3A 1DQYA 1TF2A 2I54A 2OCYC 5F2OA 3ZK7A 1ABBA 4UFOA 4XGQA 5MGNA 2AZMA 3BRQA 3OE7A 2N1BA 4DIOA 4BQRA 4P08A 5AHXA 5FD8A 2WJ3A 4LOKA 3QSYA 1KERA 1JFTA 3O9MA 2FWRA 3ED1A 3PGMA 5AK4A 1GRNA 4Z9YA 3LOUA 4B4KA 1MX5A 2HGZA 1GLVA 2V8OA 3IV6A 4PNPA 3OIGA 3LQ2A 1MP0A 3QX3A 2FWAA 3NIGB 4A15A 3KQVA 1U0EA 5FNVF 3I2IA 4I14A 3JQFA 1DRUA 1NY5A 1PBTA 1LTKA 1CK4A 2YY7A 4KQ6A 1SQ0A 3SGLA 1E66A 1E89A 3TQHA 1ZWKA 3A10A 3GRUA 1PS8A 5JYCA 3RIEA 1UK7A 3JPWA 2M6RA 4CUZA 4O2AF 3Q1KA 4L4SA 2ODBA 4CLOA 1F0YA 4ND8B 4BB9A 3I42A 1PFUA 5J2UB 4OB8A 3SJUA 3DLAA 5IEJA 1F6WA 2VP9A 3PJGA 1F9AA 1OXBB 3ND6A 1MRZA 2CJFA 3HYSA 3QKTA 1LPAB 4PNHA 1G4HA 2ECKA 3DMRA 1IBCA 2KHZA 2UVQA 3PQ3A 1E7SA 4REOA 4ZO8A 3R5HA 4HN2A 3T7SA 2PWZA 1K4YA 5JPDA 2BH9A 4EI8A 3QVUA 3DCJA 2V7EA 5FBQB 3OZFA 1W8DA 3AVWA 1K97A 3D6HA 5KYYA 5GM2A 5TXGA 1TNDA 1ZISA 3EFOA 3X2EA 3FWKA 4HWKA 5FI5A 3IEPA 4M37A 3PNMA 1MW8X 1NBIA 1VLJA 2XUHA 4V39A 2XSZD 3CB2A 3K9HA 5H9WA 1J1UA 1KFEB 1O94A 2ZRQA 4R84A 4O4IB 1CE8A 1RPTA 3VO2A 1E2UA 3O9ZA 1WSWA 4KO8A 4ZCQA 3TS1A 3CG0A 1G98A 2FW0A 4Q9NA 5E6RB 4AJLA 1OH6A 2A7QA 3GRKA 3Q2IA 2VUHB 4TYMA 1FDIA 1SKAA 2BWJA 3P96A 4YRPA 3LY8A 3I4FA 3LQFA 1KYYA 4LYEA 2JIZA 4FPXA 4RKQA 1FEZA 3HBAA 3OQJA 3P52A 3Q1LA 4FMPA 4LYGA 1J9GA 1T6ZA 2JAWA 3HCNA 4YDHB 1EBFA 2GO7A 2I2AA 3UGKA 1KKLA 4YRJA 3ITNA 3LA8A 5KU7A 3M5WA 3H6KA 1BKSB 4WX2B 2RKWA 4E7OA 4BY9E 2G28A 1NPTO 3KJEA 1ZGCA 3Q7SA 5BVHB 2NPOA 4ZC1A 2FW9A 2O3RA 1KP9A 1TJYA 2ZBUA 1N5IA 2GYVA 4R2MA 2PUHA 3E82A 2FNAA 1GLGA 4LRWA 3VC7A 1Q3KA 3ZXSA 2JA2A 4AF6A 2HQSA 4QATA 1JG7A 1AGRA 2WNHA 3DUWA 3SBDA 4HNRA 3A6PC 3PI7A 4LSMA 3S44A 3DXFA 4D2IA 1QB8A 2QV0A 4KUEA 2IEIA 1N36B 5ICMA 3C6KA 1E77A 4UM9B 3QKRA 3UUEA 3NHAA 5ALZA 2HEIA 5IBPA 2FGKA 4LY0A 1ML4A 3RC8A 3LVQE 1JKJA 2FFQA 3GAAA 3K1YA 3ECCA 3OC6A 4EJSB 1N8KA 1WVGA 1NDUA 1GNSA 1XX6A 2QI9F 1OLUA 2H57A 4GAEA 5IK2A 2IHTA 3DF9A 3ZH9B 3L0YA 1L1RA 1XGKA 1Y34E 1FFHA 4RF3A 3SOZA 5KTPA 3HRHA 1RXVA 1WS6A 3MNFA 2PG3A 3THYA 1QAOA 4EMBA 1MX9A 3ZDQA 3WGGA 1NC1A 3K5WA 1Y37A 4L3OA 3N0WA 5CT4A 1KY3A 2PRSA 1YJBA 1A7KA 3KBBA 1AKNA 1FMLA 2Q45A 2XB9A 2HW8A 1W5BA 4PHHA 1ZK0A 2HAEA 1FTNA 1MB4A 3Q11A 1H2EA 4DIDA 4KP7A 3K8ZA 3N2ZB 5K3DA 1VDMA 3WFJA 1WKBA 3PTZA 5K3CA 4QA9A 3ORYA 2H1RA 3ABIA 4RH1A 4QBFA 1KPGA 3O8QB 4GP6A 4B3CA 4EI2A 4XD7A 3K2BA 3AR7A 4JR0A 4RAOA 2HIHA 4KG7A 1QQ7A 2J1LA 1ZQ9A 2OO7A 2VJNA 1AQNA 2VAMA 1TE2A 2BDEA 2FXIA 1KJIA 3KUUA 4DLWA 2JFXA 5HFAA 2DHDA 4ZI7B 3T7TA 4FGLA 2PS3A 4R7TA 4WHMA 4YFYA 3G7NA 3WL7A 2YCBA 3DT8A 4PFKA 1MD9A 3V1UA 3MPOA 2ZSFA 4L85A 1PU2A 4FGJA 4LPSA 3QLUA 4MYUA 1U9CA 5AJZA 4DQVA 1RCTE 3EYAA 2I34A 1DOAA 3BQNB 4LK2A 5JJCA 3LY7A 3IE2A 4G8JA 3CC8A 4DMUB 4GG1A 2PFSA 1NQVA 2PKWA 1AC5A 4MLZA 4RW0A 3LDHA 1D5WA 5GOTA 1EFHA 4JXZA 1DO0A 3E3LA 3QUCA 3TPZA 2J3LA 2Z8YA 4RCZA 2A5JA 3OZBA 1KDYA 3A4NA 3I3OA 3LY5A 3O4RA 3VSAA 2AFHA 5I4IA 2ZJBA 4L4YA 3RFTA 3OOHA 4WZZA 3IOMA 3AKEA 3EDCA 2I66A 5L4SA 2VNAA 1GUYA 4OM8A 2P5UA 1UPBA 4HLNA 2VFAA 1GYQA 2BEKA 3TSYA 4EO4A 2JLRA 4NZYA 3U0BA 4ONEA 3V6MA 4FYWA 2NV0A 4BWGA 3QX9A 4F38A 1ZVQA 3L1IA 5IYZB 3R3WA 1K0UA 1AKWA 1S0UA 5AMXA 4DIFA 5DN6D 5DW0A 2D1FA 3TLJA 1PNTA 3VR6D 4U5XA 1DAMA 1Q22A 2VF2A 3UIEA 3UG6A 1EXDA 1X1QA 4PYLA 1AY0A 1N7JA 1NOIA 2OG1A 3BSWA 1JWAB 1QIKA 3DFFA 3M83A 1NM5C 1EDOA 3Q98A 4RPCA 5HCUA 3OOYA 2JHAA 1IJBA 2X9NA 3L7JA 3D6FA 5I9IA 5J40A 4JOSA 4B3BA 3P2IA 2UU9B 2Z6QA 3GLHA 3SIRA 5DI9A 2ZPTX 3LC7O 3UWSA 2ZRKA 2AKYA 3EDRA 4BNGA 1N7GA 3Q5GA 4N1AA 2W2VA 4GDFA 4GEKA 3REOA 3ZDDA 2A7XA 2V55B 3DF7A 3COJA 1RXEA 1SC3A 2ZROA 2VOJA 1RKXA 3DMNA 4CT5A 4Q48A 3TECE 1Z5NA 1WP4A 5EQDA 3AIMA 2XRFA 4EPYA 3WJ1A 2ZSBA 1ZJ5A 3DLTA 4P3YA 4Z7NB 3T7JA 2REOA 2I29A 2JPDA 3G0GA 2GYUA 2OO3A 4JBXA 4YT8A 3VR0A 3CEPB 5EMMA 3FWPA 4ME6A 2OUKA 4P7KA 4O6VA 1JXAA 3KLOA 1J22A 1RD4A 3QU7A 1XTJA 4F0JA 5J5AA 4NE7A 3AGQA 3VZBA 2NVUA 2FMTA 1VB5A 3V8VA 3VOBA 3DE7X 2C4UA 2EJUA 2WAAA 3CJQA 4M54A 2SHKA 4L8LA 4EUFA 5FV4A 1D04A 1OZGA 3C5CA 4QO8A 4E33A 3NH6A 2R1VA 3HE3A 4XSGA 4IY1A 2QRNA 1JT2A 1VYTA 1CHDA 4EKNB 2YBEA 3DBLB 1EVIA 3HJAA 2ZVPX 5DP2A 2BDTA 5KDOA 3LG2A 3MJ4A 1GPKA 4I55F 3THXA 5IKMA 2WKPA 2HU7A 1JAHA 3L18A 5HG0A 3IEVA 1KU0A 4WIAA 3NOQA 5A5EA 4UHEA 2AG6A 3FCUB 1F5SA 3ETGA 3FWHA 4DCOA 1BRMA 3NQ41 4RABA 2IYVA 3RRFA 2CXOA 4MUIA 5TX7A 3OIVA 1IHYA 1S7GA 2HREA 3WVNA 3HY3A 3F6CA 1IBRA 2GLTA 2V7WA 1FW6A 2H1LA 2RKBA 3TLKA 3RYHA 2K7FA 4MUBA 1E2EA 2PQ6A 1MOPA 2DFKB 2WHPB 1EK2A 3D4NA 3EEIA 1USWA 2DULA 3ET5A 1LDEA 3R0QA 4HAXA 4OL0A 2XUFA 5AVKA 3G85A 4AO6A 4BQQA 2FG5A 5IJ0B 3SLKA 1ODIA 1DCFA 4MQ4A 2H18A 3KDAA 4YRGA 1KMQA 2DWQA 3HKDA 4EJ6A 4WMLA 4B40A 4GP9A 3QMWA 4KDCA 3GEBA 3SF0A 1NPYA 3K0SA 5LMNB 1E0JA 1NP6A 3VISA 4G1EB 4BKQA 1LD3A 4QOHA 4RFSA 1EGAA 1OVGA 3GYBA 4WJKB 1GSHA 5IT4A 4Y6LA 1BVUA 2DFNA 2PV0A 1GUBA 4GPD1 2GPSA 1XG5A 1N2GA 5EUCA 3QVMA 3Q8KA 4MS4B 5DE3A 4ENQA 4LI0A 4IGKA 2IPLA 1OKKD 2FYTA 2QYTA 1IEVA 3ACDA 4HFJA 4YRTA 5I9BA 4AIIA 2I80A 5C5EA 1XCBA 1QCZA 4IRMA 1WPRA 4Q0MA 2XYVA 4YC7A 3W8DA 3FYUA 4UMFA 1JHXA 2IOFA 1XDSA 2GN2A 3BG5A 3T9BA 3PVZA 2V7UA 1EHIA 2H11A 3QLVC 2XCTB 1XJ5A 2UUOA 4BMVA 4IFTA 4PFQA 4BWFB 1QFXA 5C46F 4RVCA 4X66B 1OV6A 4K9MA 1KNQA 2ZBDA 2GF2A 2QMQA 3KTOA 5KB3A 1Y0BA 1RPJA 1P61B 2XMSA 4QAQA 5B1SA 5EJ2A 4WVFA 2XMZA 4J2OA 2R6DA 1RI4A 1Y5IA 3FCCA 4B6JA 2IS4A 5TJHA 3SF8B 1D6JA 3WE7A 2YN2A 3D4OA 1UMBA 3EQZA 1UDCA 3GLIE 1C3XA 1YS4A 3R0ZA 4JHLA 4POAA 2O50A 1BDIA 5B37A 1EP3B 5DGIA 4OLBA 3LRPA 3BGSA 3LBNA 3ZE9A 4U7WA 2HQOA 5C35A 3U48A 2OD2A 3DA8A 4MV4A 3KAJA 1Q1NA 4JS0A 3G9TA 3MJDA 2IY9A 1E9RA 4Q5IA 1XZBA 2C88A 3GRCA 2C97A 4OFZA 4YRFA 5EKTA 3VVLA 1BVHA 3PCXA 4WBNA 1ZINA 5H8WA 1U4OA 1RRVA 4D4HA 5I45A 2JFHA 5IT9A 1K86A 1P5ZB 4YCLA 2CB9A 4CMHA 3QEMB 5KNDH 1HG1A 3C24A 5FEUA 2H7YA 4FCCA 1GAEO 4JA2A 3EH2A 4KKXB 4ESOA 1CRPA 1IRXA 3B3JA 2Q4TA 3I32A 1LKZA 4MLCA 1HE1C 2O0JA 4E0BA 1E6LA 4YALA 4PZUA 5HCIA 4DG5A 1C50A 4CQJA 3ZVMA 4OGKA 3EOBI 2OXTA 2CZGA 1GTMA 2Z57A 2DQKA 3LDAA 1XYGA 3IRUA 3KHUA 1TKRA 4IZHA 2Y0DA 4M1YA 3BZBA 3DDOA 3IHWA 2V54A 2JGIA 3P9RA 1TTPB 3F6YA 1W5EA 2BRUC 3P94A 2UUBB 3RWOA 3EFHA 1Z06A 5EPUA 1L1FA 4JXJA 1K7YA 5DK6A 1UKZA 1MC1A 2X9LA 4MSUA 4E51A 1DJMA 1EFCA 1DELA 5KQSA 3QMMA 1SUWA 2PSHA 1ONOA 3MJVA 4EW2A 4QGAA 2JLUA 4FTWA 3CUEF 1L4LA 1M9NA 2BT4A 4BP8A 3N8NA 3MIZA 3JARB 4QUGA 4EB0A 5AM2A 4URWR 3IKJA 4DXAA 5LOVA 1NVUQ 5G0SA 3GUZA 1DXOA 2QSUA 3DAGA 3REQA 4F5DA 1A9XA 5F9HA 2GERA 3IPLA 4L5IA 4BTVA 4E4YA 3HI6A 2X3UA 1ZH2A 2JGJA 1IXYA 3GFBA 4E2XA 1UWKA 2C61A 2PU5A 2WU0A 2J67A 1AURA 2VUTA 3AEUA 5CX1B 2OHXA 1W5FA 3NPMA 4ZALA 3ZNPA 1SULA 1VHDA 4UUNA 4XFJA 2FOXA 4QGHA 2G4VA 4K9KA 3OBIA 1VSQA 1QNFA 4NFSA 3WP0A 2B4RO 1LRJA 3ND9A 1RACA 3I8XA 3TH5A 4XGNA 3MS2A 3WGLA 3H19A 3U5ZB 2V0NA 3CUUA 4ZOAA 4WD3A 4BLVA 5TQ0A 1MB0A 3GA7A 4GIBA 5AH0A 4HAIA 2R5FA 1QYIA 1YQWA 1S2MA 3P7MA 3PWSA 1R88A 5AVYA 2PKEA 3UXYA 3EPJA 4E3WA 4A0GA 1JEDA 2J32A 5AI0A 1JPVA 3LS2A 3BA6A 3ZJ4A 1N5OX 4JC0A 1BA2A 2WUEA 3LF2A 1VG0B 2DY0A 5CNKA 3ANMA 2ACKA 4KYVA 3FHTA 3WRYC 1X7ZA 4H7KA 4NZOA 2BM8A 1OX4B 4O4HF 1RAHA 4OJNA 4D7AA 2BI4A 3JYLA 5BV1A 4IQ0A 5MDHA 2N75A 3K71B 2OHGA 1EI9A 2ZREA 3D1VA 3PRKE 1V96A 1L5HB 3I9FA 3SE0A 5DMXA 4I08A 4Y2TA 3I34X 2Q4BA 2PPLA 3VR2D 3W7VA 2PBZA 3PLNA 2BJWA 2NU7B 3OOEA 4CV2A 4WBSA 2PZLA 3V3KA 1SOUA 2GH1A 2VBIA 5F9MA 3JVUA 1XJWA 3UICA 3GBPA 3K6RA 3ZWPA 3ASUA 2D8AA 2CXRA 5GY7A 4KSYA 2OXRA 3C98A 4YI3A 5EIAA 1UC5B 3N5KA 3E2IA 4MVJG 4TMTA 5AW0A 5KYNA 3D02A 5F3WB 3HA2A 1HDCA 1SRRA 1TIBA 2BGTA 2BPOA 2YY5A 4D6PA 5JANA 5ICCA 4B3DA 1MJGA 5KKAA 1J8DA 4J0CA 4Z4QA 1XF1A 1T9KA 1E6WA 3WK6A 2JKYA 4AG3A 4RKYA 2Z6AA 4PX3A 5JG7A 2O8CA 1JHMA 1BD4A 1RHUA 4XSHA 3JZIA 5EYPA 4BLUA 3BM5A 1RAIA 3FMOB 3JPYA 1CSEE 1J07A 2BFPA 2X4IA 5E1BA 4OYYA 3TLGA 1U3FA 4GH5A 1O77A 3FH0A 4MI6A 3T3NA 1YQUA 5AQEA 1LDYA 4HH0A 2ANCA 3T8YA 2ADMA 2O1WA 1UKVY 3D6TB 2JBAA 1G60A 2PY6A 2RGXA 3LMKA 4LZOA 4DYHA 1RABA 1E9DA 2M6KA 3PHBE 1EYZA 1GIAA 1NQ5A 2A1IA 2MCFA 2F1JA 2QDKA 1NP7A 3COYA 4XLTA 3ZDXB 3ZHTA 4HCJA 3TVTA 2BCGY 2FE4A 4A1FA 4PLTA 4A6EA 1FJHA 3PGKA 5K8VA 1EFTA 2C8KA 4WVLA 4DBLE 1Y7PA 3SNHA 2FCRA 1OZFA 5I9LA 1JIUA 2EKBA 2PZGA 2CKMA 4B7ZA 4L2IB 3VZQA 3DM5A 2ACEA 2I55A 1M10A 1GL9B 3W9BA 3D8TA 4LCJA 3RYFB 5GV8A 5IG2A 4ZQBA 1AE1A 2XGGA 1ZN7A 2QUHA 4O33A 2C7OA 4GICA 2H2GA 2LGJA 3RKUA 4C4OA 2C4KA 3BMOB 4JBWA 3W6ZA 1UFVA 4U63A 4KYTA 2DUUA 3GN1A 2I6XA 5G3ZA 1TJ3A 2C20A 1I2AA 1DCKA 4Q4CA 4I6GA 3FY4A 1KWGA 2IQ5A 3VR3A 2CDRA 3DMTA 3L8CA 4K0RA 4P4LA 3WBKA 1XWFA 4W1RA 2PMWB 1FFBA 5C9ZA 2GILA 4JT9A 5KMGB 3ZE1B 1GP2A 1I3OA 2W2OA 2B25A 2YZNA 4QQRA 3SD7A 1OSNA 3Q9UA 3IAHA 2PUTA 3STXA 1NZFA 2WVAA 4A03A 3F1KA 3HCDA 3FYHA 2NUPB 3K3PA 5FR1A 3I1JA 2I4NA 4DNQA 1U7ZA 2NT3A 3BB1A 1ADJA 1XTVA 3QI7A 1D4OA 4WXHA 2DKOA 4MUJA 5JS8A 2G1UA 1NR5A 1KI3A 3A05A 2FPUA 4JJAA 5EQTA 4J4HA 3KJNA 3RK4A 2EP7A 2IS6A 1A9PA 5FULA 4YMHA 5JFTA 4ATNA 3EVCA 2HU8A 3ONFA 4RKFA 3A9UA 4WACA 2FR0A 2YYSA 3BD9A 3FTQA 3NIDB 4JLMA 3ZWNA 4TWBA 4MUFA 1PGOA 3AETA 1FX1A 1KEWA 1H22A 1N1GA 2PDAA 3CO0S 3OJOA 1R8XA 5CM8B 1Z22A 3F9CA 4CIWA 1KYVA 4WRRA 1H94A 4NJMA 1OX6A 5FWXB 1BXGB 1XKXA 1XZKA 2DYKA 1F9EA 5DWVA 4PN7A 3DO8A 1N2JA 3CVOA 4E22A 3OMWA 4WZBB 4KGDA 4DBLC 4UBMA 3NOOA 3DBVO 1X8XA 4TM7A 1UMCB 4GP7A 1P5HA 1W19A 4J7UA 3A3OA 3IO5A 4WLUA 4EG5A 3TG8A 1ZI8A 2BLLA 3X43A 3IEXA 5AUQA 3RU2A 4XEHA 3WS7A 3BWBA 2R7LA 4MV3A 5BXYA 1KY2A 1U2SA 2ZQYA 3GFSA 3QVXA 4TYNA 1E96A 4WK0B 3UB3A 3EQ2A 1J2EA 1EWQA 1LV7A 3EH1A 2AOVA 1FRVA 4GNKA 4EY7A 1M8GA 4R81A 2CYCA 3E7DA 5EN4A 4F2GA 4MDFA 4UQPA 2PAAA 2GHIA 3PD7A 1QIHA 4P4SA 4R1PA 1CUZA 1PDWA 3FSGD 1QHGA 3D2BA 4ZVTA 5J1TB 4P7FA 5A6SB 3KT8A 1EHCA 4ENVA 4UASA 1GRVA 5DWDA 4HQ6A 5GJVC 1O4VA 5E6SA 5IJ9B 1UT5A 1EUQA 4AZVA 4PZ0A 1W5TA 3ZY4A 2O5VA 2QSJA 3BIFA 3JQ6A 4HHEA 1HZZC 4N49A 3R7SA 1N2HA 2X1HA 5HGXA 5K0GA 2WB4A 2Q3HA 3ET4A 4GM0A 5AICA 4P0PB 2WU3A 2PQ0A 2C5FA 3DL4A 3BTOA 1VCNA 2XXAB 3R5TA 4OTZA 2WSYB 4RADA 4RESA 3LJKA 4XUEA 2MTBA 2EX1A 3R7WB 3HVUA 1FTWA 1LU9A 3FTPA 4C0LA 3CF4G 3WLIA 3C2QA 4L3VA 3ZNOA 3CONA 1BGVA 3E61A 2V9ZA 1C5KA 4GMDA 3VNRA 1KQPA 2Y1KA 4M9QA 2X22A 1X14A 2D2XA 3L92A 2CD9A 4I0WB 4UM5A 1RJ9A 3T1VA 2RH8A 4J16A 1EFRD 3N1UA 3SU8A 4FK8A 4BFCA 1A8PA 1AA9A 2FN7A 4TV8A 2HBZA 3WZMA 2OCDA 3ESXA 3GXBA 3L0SA 4ND2A 2J3EA 2GK7A 1CR2A 1T2CA 2RH5A 4J2TA 3ZJTA 4GX5A 1IN1A 2P4UA 2AYZA 4I4TF 4G1BA 2CYAA 4WFKA 1T9ZA 4WJLA 1K6MA 1QS0B 1LQ2A 1D9XA 1Q16A 4I8DA 3ZH2A 4MAMA 5G02A 2HXGA 2Z4SA 3PC6A 5BW4A 3M33A 4OH1A 2AC2A 1RWWA 3FF1A 2PD4A 4LVNA 2B20A 3A4MA 4ZDJA 3TTVA 4LJ7A 1YFLA 3HJUA 1FYWA 1B73A 1J2TA 1O8BA 1R0KA 2AQ8A 2YXLA 3I3SR 4MVJE 1ZAYA 4BO8A 1TD1A 4R1LA 4QVIA 1E2LA 1HE5A 1TEHA 1VPTA 1WMSA 2J9ZB 2VDLB 2YMMA 4IDEA 4JVLA 3I5MA 4IWNA 4LQ4A 4BLPA 1QGED 1N2IA 4CKCB 5AW4A 4GVLA 3P32A 1E6EA 1BYIA 2F3TA 4UUQA 4DC0A 1XF9A 4FZRA 3BK1A 3FZQA 4EVSA 5EWMA 4C88A 1NXOA 3R8XA 4ZJUA 3TLEA 4GPAA 1DMSA 3Q3EA 5EHIA 2F3QA 4LFCB 4MQ5A 1KVRA 2J09A 2P4SA 4UHBA 1TTTA 2BMJA 4GYKA 4LCEA 4A2PA 3JX9A 2DXIA 3ZR4B 2OCBA 4LF6B 3LQRA 3CUWA 3L7YA 3TE6A 3D6NB 3WO1A 3GDGA 3HL4A 6REQA 1X19A 1T8RA 2W0MA 2QUAA 2ZEJA 2G9RA 3HGMA 3V46A 5JZOA 1RIFA 1TD9A 4EP1A 2V7QA 3GJRA 1Y42X 4MRRA 4QWWA 4HLDA 3MQ4A 5CVCA 4BC0A 1HH4A 2VTEA 3GD7A 1VIVA 3F6EX 3P4YA 1N9ZA 5AVXA 1B8NA 3DNFA 4EELA 3II6X 3GEIA 3IULA 4CUKA 3A31A 3N07A 3QWFA 1CW2B 1DEOA 1A3CA 2I33A 5EJAA 4P93A 3SQDA 3FTCA 5JDIA 2UYOA 2H3EA 2W6ZA 1MGOA 3FHOA 3K09C 1MXHA 5EIFA 5GGXA 2R8EA 3H83A 3VDMA 1WUIS 1Y89A 1L6RA 2DLDA 3X2SA 4FGKA 4Y1RB 3P2OA 4ND7A 1KBQA 1T10A 2OV3A 4Q4HB 3GVXA 3HLKA 5BN4B 2XVZA 3CM0A 2DPLA 2Q3BA 1CXZA 2B36A 5SZJA 1KVQA 1OIXA 4DPKA 2J7KA 1PWZA 3U09A 3GY0A 2Z5VA 3NUGA 1KIFA 1WXQA 1OLSA 3DT6A 3HP7A 4TLLB 3FMFA 3DQZA 2IXDA 3BWVA 1YH3A 3Q3HA 4JZYA 4DSOA 3L6EA 1FQWA 4FDUA 2W83A 4WN3A 2V7XA 4PBRA 3GJTA 1L7EA 1JG2A 3SJ7A 2ZI9A 1Z0SA 3H75A 4DOMA 2NUAA 2REQA 1E94E 4QTUB 5LDGA 4K9DA 5I7UA 5JAZA 4W5TA 1G0OA 4BUCA 1KEPA 3WLQA 1QGYA 2NADA 1MABB 1W34A 4C3ZA 3V4PB 3ZV3A 5CFOA 3H0CA 3K31A 2LXNA 4EKIA 3KZXA 1JFRA 4UD6A 4NF2A 1CIVA 3IUNA 3W7BA 2JGEA 2J6IA 4G0MA 3BTUA 4MKIA 5EHNA 4CCSA 4DM7A 3ER9A 5DT9A 2PGOA 2DCUA 3IGFA 2WJ4A 1ZMRA 3R7FA 2FP4B 2J3IA 3ZCSA 1NXVA 1OBCA 2W5UA 5EXXA 1F7UA 3CF0A 3HR4A 4XQEA 2FWPA 5CCXA 1JFFB 3PXBA 2C2OA 5JH7B 1A9QA 3NONA 4QG7A 4A6DA 5FL7D 5K0TA 1WUTA 2YVLA 5JMTA 4FDTA 1IL0A 3B52X 2R7NA 3EGXB 3FR8A 3WISA 1D1TA 2EWMA 2H17A 1G5QA 1RWVA 2XMQA 2X13A 3GUVA 3CKMA 3LRTA 5DYIA 5IASA 1ULUA 3UMFA 1SOWA 3KR0A 3SE7A 4G1FA 1RADA 1IOZA 1GPMA 2OO5C 4FUQA 2B7BA 4KXUA 4W9NC 5B1DA 2FZ4A 3L8GA 3VDNB 2H4HA 4FHCA 3GJ8A 3THRA 2BKEA 5BP7A 2C0CA 1SCNE 1WTAA 4TT3A 2IY7A 1QGUB 1C9DB 3VYRB 4DANA 2FY8A 3BXOA 5L3SA 1PJQA 1M0EA 1JMYA 4JIGA 1P9WA 5I8PA 3HZZA 4Z99A 2P1DA 4X93A 4X7PA 4HN4B 2P2DA 2FH5B 2GCNA 1ZKMA 4L8VA 1NT2A 1XYYA 2VJPA 1W1WA 1Y5NA 3DZIA 2EX4A 1A9TA 1OYYA 2FN3A 3TZHA 1RYBA 4DV4B 4Y2GA 3OCWA 1W9MA 1QNLA 3RROA 2X40A 4TSFA 1N78A 1QBKC 3M8KA 4K0KB 5DX8A 3IMGA 1NX9A 3CIOA 1VMIA 2YXDA 3UTCA 2PLAA 1Q0LA 1M2NA 2J9FB 1UBHS 2Y1CA 2ZSDA 3I2JA 3NKLA 4L74A 2WRZA 1WCV1 4JLOA 4QE3A 2JIZD 4M60A 2DFVA 4U6NA 1YJ5A 1NE7A 5KNDA 2SKDA 1ZUNA 4KHZA 1W36B 1Q7CA 2J9YB 2WYIA 4AZ3B 1SGWA 2DTEA 1GCGA 3L0CA 1JG3A 3G8DA 4Z1MA 1BMQA 2CNDA 3CZAA 1E1RD 1GQSA 1G20E 4TWIA 2P9EA 4OQNA 3PF9A 3HVHA 5AT1A 3M6VA 3D1LA 4EZBA 2IYUA 5LZ7A 2O59A 4F3YA 1NULA 4BN5A 4H7JA 1T29A 1FSSA 3RU9A 2BHSA 5EZQA 1NKTA 4HQKA 5FOTA 1HLFA 1QX4A 3WWZA 2I0FA 1NRWA 5H0IA 1QM5A 2MYUA 3AKDA 3D0KA 1W2GA 3FUXA 4MV6A 3LX8A 4FFPA 4TMZA 4YIKA 4ACAA 1NF8A 4KQEA 4IDCA 5JZSA 5FCDA 4H4DA 4PYNA 4YI5A 1O96B 1N2CB 4YRZA 1LX6A 2R8RA 3G5LA 1QR2A 2XRZA 3EZGA 5IK2D 4TWAA 1LLDA 3L46A 3RFFA 1SQFA 3MCVA 3GMIA 1UOPA 3ENKA 3AZPA 1XEXA 2CSXA 2XTZA 4DJ5X 3OZDA 1E79A 3IBGA 1JHQA 1G8FA 2BMDA 5DM60 1VECA 3WQHA 8OHMA 3KSMA 5KYTA 2CLOB 3IVMA 3IKTA 3O3CA 4M9CA 2PBLA 2IT1A 3OEWA 2FA9A 4MUYA 3C3EA 4XIGS 2R62A 1N25A 4GX0A 4CQLB 4X1YA 3ZN2A 1TXGA 3L0OA 3MQ2A 5HKLA 4EHBA 1RYYA 2ZZKA 3IDAA 1E4VA 1R0XA 3KRTA 5MN4A 1Z26A 5JRDS 4CEHA 1G55A 2I6FA 4PZLA 4XD7D 1PYGA 1SA0A 2AN5A 2EG9A 1Z6QA 3CX6A 4JR1A 1CWUA 4IX9A 5DT2A 1ZN2A 2X77A 4EWLA 1CF4A 3U40A 2WVGA 4FFWA 5JU6A 5HJ2A 4FYHA 5A5GA 1F12A 2XKJE 1E2HA 3CLRD 3G17A 3K4HA 4P2GA 5FOUA 3TSOA 1BVYF 1LA2A 2IP4A 3H99A 3I6IA 3INGA 4QT0A 2Z3ZA 1JAYA 2WILA 3L1HA 3P27A 4KWIA 1PQUA 1AUPA 1Y8QA 2HEGA 1ZJ4A 4LNAA 4ABYA 1BW9A 3DDCA 2QG9A 2ZYWX 4C5CA 4YUYA 1FL9A 2PX8A 3NT5A 5J5CA 4HDRA 4BFYA 4RGBA 2VF5X 4M8SA 3UN1A 2WIJA 2ZR0A 2WM2A 3AHFA 3HYCA 4JYZA 1EZZA 2Y1GA 1IUPA 3M6FA 2ZI5A 2YUTA 4OHPA 2XMDA 3RJ5A 4EBFA 4YRIA 3SR0A 3TOXA 1EWVA 3ESAA 4M1QA 3WIBA 5LLTA 3KKPA 5CNMA 2VT3A 4JD5A 1SBTA 4LYYA 3QUQA 5DM1A 4L4RA 2QN3A 3QYAA 1NVAA 4JB8A 2ZIEA 3D8NA 1DC6A 3AG6A 4IX1A 1QVAA 1YVRA 4YAOA 1C7IA 1SXIA 3SEAA 4CG3A 1YQXA 1W7AA 1SG0A 3WNQA 4CG2A 4HKTA 4JL5A 3TX2A 4CU2A 1HKUA 3PNKA 4OIFA 1FYDA 3TW6A 2RHHA 3GF4A 2PS9A 2ORIA 1ZGGA 1XCJA 3KKKA 3VDRA 2QPOA 4JQYA 1ZS9A 521PA 4KHPB 1UBNA 3IAXA 3U7QA 4MB6A 5TGZA 4G0YA 1V0JA 1JB9A 1YR9A 4YGYA 5EGSA 5M04A 2WI8A 3HA7A 1E5VA 5EP2A 1G21A 3TD6A 2P0YA 1K5GA 3VPGA 3F4BA 3T7DA 4GOND 13PKA 1PIWA 1YKGA 1LBSA 4EW1A 3DEFA 4HADA 1TQ4A 4RVOA 3U3KA 3ADOA 3V8BA 3H4IA 1UINA 2ZOSA 2CJXA 3HA5A 1R3UA 3VX3A 3ANSA 4DY4A 3FXAA 3IIJA 4TYPA 2GAIA 3QJYA 1T2FA 1Y5RA 3NCTA 2HADA 1BE6A 4J0GA 4NBTA 2C9MA 1T2EA 2H8GA 3WLSA 3HYNA 1E2QA 1M75A 3U37A 1JIJA 4AJPA 2QIPA 1N9GB 1GFIA 1K3FA 1EUCA 3OP4A 3C3JA 1LK5A 4NBKA 4UBIA 2PS1A 4Z8YA 5A3VA 1DINA 4RLFA 5J47A 4NQRA 2P9BA 3VC3A 1WG8A 1Q1AA 2QRGA 3H9QA 2BMEA 1R7RA 2RBKA 2RFLA 1EVZA 2J85A 3L41A 4NV0A 4DQ0A 1P6XA 4F3CA 3H4VA 5EIXA 5IUKC 4ZT3A 1SWWA 2C58A 2VH1A 4CKEB 3IMFA 5BSHA 2BKUA 4CLRB 3IE1A 1Z68A 1BQEA 1M76A 1ZVMA 2XMPA 4D9FA 3KC2A 4I50A 1YDFA 4MYTA 3TDKA 3TIIA 1NONA 3JAKA 1NLUA 1T3ZA 1U2PA 4B81A 5FUVA 2GD6A 2KS6A 3OO0A 2P27A 4G01B 3LYUA 5JSUA 3WL6A 5K6AC 5LYJB 2R4UA 5JAQA 4TVSA 4ZV4A 4B3JA 3COWA 1USUA 3LXUX 4FNMA 5EJ7A 1QIGA 4EHIA 3KQLA 2P68A 4PRKA 3UJCA 1F6DA 3FPJA 3PA6A 4KK4A 5KYGA 2X2FA 3OJWA 3QXCA 5HDBB 1TYZA 2R25B 1BROA 1NHGA 2P7HA 3JSXA 3QXSA 4NONA 2EKQA 2G09A 2QM3A 1MQSA 3T5AA 3ZC3A 1QP0A 2ABWA 3WGIA 4XKJA 2R7AA 4F8JA 2E1PA 4ITRC 5AW1A 5FA6A 2O8NA 3T0IA 1X7HA 3B7PA 3M9LA 1EP2B 2IZOA 2ZSJA 5JC8A 1QC5B 3JQGB 1GGHA 4P7BA 3MBOA 2EJTA 1IHPA 2F48A 2YWHA 2CXNA 3PPXA 2Z08A 1GCUA 1OA1A 3O38A 2GA9A 1TAHA 1RSZA 3SX2A 5BSRA 3F7TA 2QTTA 3SFZA 1N5JA 3DONA 4XQ9A 2XV1A 1VKOA 3ZBUA 2O2YA 4X6YA 2W6JD 3KQKA 1D8TA 4Q4JB 3CJTA 4DMMA 2RHMA 2EEPA 5D84A 1CYEA 4ZPXA 3EPKA 2R79A 1V3TA 2D74A 2BFCB 3GQVA 4Y6PA 1UEJA 5CDTA 1THZA 4Z4CA 4FD2A 3AV3A 4OMDA 1TA4A 1ZGJA 2VK1A 1QPGA 1OXVA 2IKSA 4GYYA 4WCVA 5ILQA 2JCSA 2XADA 3H2GA 4CR8A 2V6IA 5JFGA 5B2FA 3P20A 5K6RA 5L9AA 2DTXA 2A57A 1P29A 2CBGA 4OP2A 1D4AA 2O5CA 5DJ5A 1KSHA 3IUJA 1EGMB 2JZCA 3NT2A 3UHAA 3W2GA 4LJ5A 4FSHA 2ZZNA 1CY0A 2QTZA 2ZK7A 4R8VA 4ZZ2A 5IAEA 2CVPA 4D92A 4GI3A 1KKMA 1T2AA 2PMFA 2RJ3A 4LGYA 3ETNA 3DVSX 5F5NA 1ZVJA 4KUGA 4RANA 3TEJA 1H3EA 1PQYA 1XC7A 4B2PA 2R1TB 1BCSA 3ISJA 3JS5A 3GEDA 3ESZA 1RYZA 3ODGA 4WXPA 5BRJA 2JCBA 1DC7A 1KPIA 3ILSA 3OLYA 4JI5B 2KSQA 4Q7JB 1T5DX 2CZQA 2IBMA 2PRZA 3ZW7A 2PXXA 2BEJA 3ELUA 1GNVA 4UHDA 3HJGA 2HR1A 5EIHA 2WKSA 1SELA 2ZSAA 4N5HX 2IHUA 1S2OA 2P9JA 4HWRA 4REMA 5KDLA 5G41A 3CBGA 3D81A 4EF6A 1CNFA 1F6BA 2QL9A 1UT6A 1KK2A 1TB4A 5EWLA 4CG0A 4HNUA 5DM70 4FLFA 3S1AB 4B3XA 2OR3A 4MLDA 3RWMB 1R6DA 4M1ZA 4QXPA 3OTWA 4TUYB 1AUXA 2J9GA 2OV8A 2Q2QA 1DUVG 4WINA 4B4DA 2DGDA 1UFOA 3G1UA 1EX1A 1T24A 3ZHZA 4L7VA 1X80A 3FPBA 4KB5A 1O5OA 2J48A 3R3HA 1N0WA 4YYZA 4RZIA 1A9XB 4RVUA 1VXOA 2P2SA 3KZOA 3MHTA 4UTRA 2WDPA 3E03A 4GC5A 4PF1A 3F7NA 2G8LA 2YXNA 1LSOA 4BX0A 2IY8A 3QXGA 2OFWA 3STUA 1Z18A 1QIDA 2D1RA 4LZLA 1BWPA 1X7XB 3UWPA 5DLQC 2GFIA 2ENWA 3H6HA 3W1VA 1RRCA 2ZIXA 4KIWA 5DNCA 1O3YA 5AJUA 3EIWA 4AJNA 5C7OO 3DCYA 4FQ8A 4I1VA 4Q1BA 3T1YB 4KFCA 1SUBA 1VB3A 2BFDB 3L6UA 1CR6A 1YOBA 3LX5A 1VE9A 3PQCA 5AKZA 3FSEA 3GLGE 4MI1A 1KZGB 3ZYCA 4PX2A 3NDPA 3E7WA 1E3JA 4MVWA 1QIJA 3L0BA 5DW3A 3RC1A 3ROQA 2VNSA 4LE1A 4WWHA 3HDTA 3WKEA 4AYWA 3QK7A 5JNVA 4IIVA 1QG4A 3E9YA 1IHXA 3KYCB 2POQX 3FPHA 4U7PB 4QODA 3OQOA 1PEAA 4COOA 4DQXA 3N8DA 1G16A 1X0VA 3ERCA 3WIDA 1MFPA 3BTVA 4UHFA 2GCGA 3BFKA 1QG0A 3JASB 4FWBA 4GOLD 1D4FA 4ZGWA 1DS6A 3HKCA 1ULHA 2R1UA 1IFXA 4OG2A 4HGPA 1QFSA 5L3RA 3NV7A 1V2GA 1LSUA 4LZAA 5GGYA 4C43A 1UZLA 4K6MA 4C89A 1U2GC 1XVLA 4OO3A 1GTSA 1RM3A 4K8RB 1PS9A 4EPVA 2CMFA 1R4MA 4RQUA 2XEDA 3QBTA 1AF4A 1Y48E 2VYVA 1XLWA 3KQNA 2GNOA 1GUAA 5J2TF 3KO8A 4Q05A 3C7CB 2D5IA 4K6OA 3UXMA 4AAYA 1WDTA 4MW4A 1QOZA 2O8VA 3UJBA 1HQKA 5B6JA 1G8GA 1BYUA 3BYZA 4HUJA 3RVSA 4N5MA 4PPNA 1ACJA 5KNLA 3LBHA 3AM4A 2MSDB 2BSAA 3WMRA 3PIIA 5IT0A 3W78A 3EPRA 1Q77A 4AVYA 1W1UA 5BNZA 3DAHA 3I1FA 4UEKA 2QT9A 1QIIA 4XVRA 3UWDA 4NFHA 2JHGA 2PZEA 1PUJA 3QYPA 4ITUA 4R1MA 2RD2A 2C4MA 4OMUA 1P8JA 3UPTA 2ZJ5A 3SC4A 4D9GA 2J4FA 5DCLA 1Q0TA 4TZ6A 1OFGA 2J46A 1XD2B 4KRXA 1G2PA 4HVCA 4DBVO 1YJ8A 1AKEA 1GFWA 1RIIA 5KPDA 1SPBS 3IFSA 5B3JC 4AWXA 3CZPA 4JYPA 4CMIA 2NU9B 4URUR 4YAWA 5IZ4A 2QWXA 4JKOA 3FG9A 4PZZA 3ETDA 1MX1A 3I2KA 3OZWA 5HF6A 5AJYA 1XPRA 2YMQA 1L5ZA 1AQ6A 1P2UA 2D4AA 2OL4A 3ZXIA 3KWMA 5DBHX 3FJYA 3QI2A 4IMPA 2IOQA 3TB6A 3EIEA 3ZLTA 3NEPX 4GKVA 1ZZGA 3KPVA 1YZVA 3OQBA 2J31A 4I81A 2V4ZA 4H0CA 4TS1A 3TX6A 2WWHA 1C1DB 3LCRA 1NM5A 2HJGA 3T9FA 4PQYA 4G5RA 1IU9A 4OUKX 3TE7A 5JS7A 5MF6A 5E3JA 3R09A 2I2FA 2FKNA 3F46A 2O0HA 2PX2A 1DGQA 2J08A 4HTAA 4Z0PA 3A14A 4BBPA 1A9OA 1JJIA 1DQPA 2A5YB 3KDSE 3EPPA 3VH2A 1UBCA 1M33A 2O2EA 2FRDC 3KUCA 1C4KA 3BWCA 4RO0A 3M3DA 4E09A 4PG6A 2GN4A 1PR0A 5E0KB 2D0OB 2O2JA 3L8YA 4JGBA 2Y68A 1TRKA 1CZOA 4X97A 5F35A 1LVUA 2WIBA 3OIFA 3PTAA 1UZAA 1DVRA 1R9JA 1V5EA 4N3BA 3RCBA 3UZUA 1CUEA 2PYZA 4NV3A 4LJKA 2I1VB 2QN9A 2JCXA 2G70A 1C30B 4WXYB 4Z3DA 1JQBA 5FUWA 5ITWA 5JXHA 1RMTA 1KEVA 2NO5A 2OZLB 3TTYA 4AS2A 3S5JA 5LSAA 2CJWA 3VR3D 1EVKA 4HRAA 1UPFA 1IYZA 1FFXB 1ST2A 4AZ0B 3MBKA 1WOYA 5HYVA 5LJIA 2IYZA 2B98A 3R3UA 3SKVA 1HMPA 5CB4A 1Z7BA 4XM1A 1JI3A 1P2DA 2R96A 4B2LA 3EFBA 4YR9A 5BOSB 1K4KA 5CA1B 3GJSA 4FWTA 4HRXA 5K3FB 2B3DA 1A69A 5D8DA 9ABPA 1X13A 2A3NA 4UVIA 2WF9A 4C6TB 4CEIA 2YBDA 3O95A 1AS2A 1NT4A 1V7QA 1ZJZA 2ZIZA 4OUDA 5AXCA 5EHXA 5IWAB 3WJ2A 2Y6VA 4GI5A 2EJCA 3KKZA 1A4IA 1DTSA 1CV2A 1JEQB 1SIUA 2EX0A 3KZMA 1J20A 3ZWOA 4YCSA 5HIJA 3RS8A 3TPCA 3W5SA 5ECYA 1S2LA 3SZ3A 5EKUA 4GMHA 5I7VA 5FF9A 3AR6A 3HZRA 4RA9A 4F3RA 2QMUA 4ZVUA 2PFKA 4S2UA 4NSNA 4XWYA 5G1PA 3HABA 4BJ3A 2CCKA 3CLTC 4KR0A 5E7JA 1ZIOA 2A33A 1VZ2A 5EFOA 1BCRB 3KT0A 3JYOA 1X7DA 2QJOA 2Y0PA 3H4MA 1V4VA 4G9GA 4NE9A 3C4JA 5CDUA 5BOVA 3Q12A 4ZV9A 3H5AA 1E8NA 5MFPA 1O95D 2JVKA 3V4RA 1A7AA 3IUMA 3WV4A 2H4YA 4ZFNA 2E89A 4RZSA 1Z12A 3SSNA 1WBJB 4QFCA 3C14C 4US0R 3TXAA 3AINA 1XMJA 1I0IA 3AHJA 4GSYA 5E4YA 1QRDA 5YASA 2HNBA 1X42A 3WADA 4X1KB 4FYIA 1JF8A 2J0UA 1F2UB 4JP8A 4P83A 3T5BA 2E18A 2PE5A 2WYOA 2AN9A 4CKBB 5LM3A 3ZHYA 1LGYA 1QH8B 3UFXB 1E0KA 3ESQA 2GR9A 2ZT7A 2GPJA 4HR7A 5B7QA 2EOAA 1ORIA 3V5NA 3EVTA 1Q7BA 1AQIA 3QWHA 1UP6A 2B4AA 1CRZA 3PFFA 4Y1EA 4YAEA 5G53C 3TDNA 4ZOEA 5IABA 4YROA 2H63A 4NNJA 2YFQA 3MWDA 1N0IA 1YC5A 5FOXA 2XF2A 3PQ4A 4HX9A 4KMMA 2QJFA 3K8QA 3QLVA 1AF7A 1UADA 1GGMA 2Z8ZA 4FOLA 4C0XA 4DWWA 2JKZA 4ALMA 5IAJA 1GCAA 1U0NA 3OIWA 2R87A 3K9NA 1WQ4A 4OI1A 4LF4B 2DUMA 4J0DA 1LFDB 5U4QA 3FPEA 2D8MA 2QN7A 5D7NA 1J0DA 1M6HA 3RV3A 2FF7A 3FHLA 4D8TA 1W0JA 4EPTA 1SUCA 2IUYA 3O4FA 5C1OA 2XGMA 1YU6A 3JATB 5IAOA 3IIEA 1SCDA 1QQ5A 1XPJA 5LQAA 4A73A 4O3FA 4YAUA 4Z2YA 3BE6A 4OQLA 1LRKA 2F7SA 5M2QA 3DZ8A 3RVOA 3HEAA 3DOIA 3W5AA 1R6BX 4K28A 4PCLA 1JB1A 1S3SA 5LQKA 2GYYA 4EHFA 2Z98A 1QJ4A 3QW4B 1PVOA 2CMDA 2Z5GA 5CFNA 2OHJA 1RZ3A 3CY6A 3M6UA 2Z3WA 5LNK6 3DOOA 3QJGA 4JZKA 1EEXB 4FEEA 4R71A 3IVRA 3FTDA 1A82A 4MI9A 1OBOA 1T1IA 1ZICA 1ZK4A 2V65A 3PDIB 5TPWB 3S2YA 2F43B 1QUFA 3RU7A 1JP7A 3W5IA 3WAKA 4M9UA 3ZLUA 4LMRA 1XEWX 2E4YA 2GD0A 4YCNA 4DUYB 4IOJA 5CTJA 2GB4A 5I7RA 1EE9A 2FRXA 4IDAA 5AKGA 4XIYA 3R75A 3F74A 1N8NA 1WMAA 3ZOKA 3KJFA 1E3SA 4X65B 3TVDA 4ZAYA 4D8WA 2C5SA 2XMBA 3AIOA 5JYEA 2Y8EA 4BB6A 4CTMA 2Q3DA 2BRUA 1E4OA 1Z0UA 3A1VA 3CXRA 3L4SO 3QITA 3S8YA 1HYQA 4YRNA 2QAIA 1FQJA 1OAAA 3FLBA 2X8JB 4Q39A 3P9XA 4NAHA 1GG8A 1F14A 5KYXA 1T9BA 2ZTVA 1OVMA 2BR3A 3EK2A 5E8JA 3CU5A 5KTRA 1JR3E 3QW2A 4ETMA 3FOBA 4AKHA 1J97A 4PFSA 2E5WA 5ADUS 2IKQA 2HWKA 1DE0A 4JP3A 3U7HB 3GU3A 4HNAA 1MTOA 3DDZX 4WAUA 4EMTA 4QDKA 1A4XA 2MIIA 1JSCA 1Z34A 2CDBA 3D31A 4G5XA 3BJIC 3TZ6A 2Q3FA 3AILA 2J59A 2RGDA 3RTAA 1H1TA 3ZU2A 1X38A 4AJOA 2BMVA 2HMSA 2V7QD 3OZXA 3HCBA 3LI2A 2ZQZA 3QXHA 4IO0A 1SUSA 3F3YA 4LV8B 2A9PA 1E92A 2PH7A 3GEGA 1J8MF 2BFFA 4DLZA 1XLTC 3WNBA 3SQOA 3VPDA 1HE4A 3VPHA 2GNAA 2H5EA 2OGZA 4CV0A 4QX6A 3TTWA 3MHPA 4YJGB 1ODCA 3JYPA 5KBYA 4CI9A 3DDNA 1FMTA 3FIJA 3WKDA 4MW5A 4UHCA 1M6WA 3OFKA 1EDZA 3IXLA 4UTZA 3ZX4A 3D3EA 3RBXA 4UDXX 4C7KA 2R8YA 4DJJA 4AQYB 3HDQA 3WI7A 2QLMA 3O83A 5JNSA 5ITVA 1T3TA 1ZSVA 3FVRA 1PFGA 2X3FA 3EEYA 3R4VA 1I36A 1H2YA 4G26A 3FFXA 1ARZA 2TECE 2YYZA 5AJHA 1XT6A 5JCOC 3WRYA 2BSQA 2GVZC 1JMKC 1U8UA 2BTOA 2NVOA 3C8UA 4N01A 1J33A 1U0LA 2VAVA 5JEDA 4AC9A 1TUBB 4AX4A 1V3VA 1IQPA 3IBFA 4D3XA 1V16A 1YI0A 2HPHA 4AXBA 4BE7B 5HQ3A 5KNCH 4GMXA 3QPDA 5AJWA 2IPAB 1HLPA 3PSHA 1CD5A 1KEKA 2PR7A 1KH1A 3UOWA 1GJRA 4DYVA 3KOWA 5I3CA 4KQFA 1WB5A 3BGIA 4JSYA 4DPLA 2IP1A 3AUYA 3R3XA 2H07A 4GR4A 4PO1A 4Q3OA 3K9GA 2IYLD 2ZYSA 4W8HA 5EINA 2C98A 1YK0A 4KYUA 1BXRA 4CT0A 2ZCJA 1XNRB 1JNXX 3ZCUA 3KAQA 3A2NA 3WYNA 1UM9B 1LWOA 3JSAA 3CB4A 4QYMA 3DV0B 2BFOA 2BZ0A 1R6VA 221PA 2XDQB 2O8DA 1SOVA 4IHQA 1M0SA 4Q3AA 4JGGA 3AUKA 3WZLA 3LUFA 4UE3S 1VJ1A 4HEQA 2IXBA 3RUCA 3AB7A 3Q3CA 2PJUA 4GR5A 2YHIB 3BXXA 3ZE7A 1Z5UA 3PNPA 4QDJA 5HNKA 2FOLA 3FPFA 1I33A 3DEYX 2QL6A 2L2QA 3R7NA 1K5DA 4O3MA 3L8HA 4B83A 4BWYA 2BFMA 4EJSC 4FVTA 5C32A 4XRRA 4F6CA 1OI3A 3E6AA 2V1XA 4AM8A 3IAM1 4RMNA 1OY1A 4OJKA 1L7DA 3LUHA 3L6OO 4F4FA 3NXKA 5KCZA 3ZKAA 1V1JA 3V8QA 4BV9A 2WMYA 4D9MA 3BMNA 1VMEA 2ZJOA 5CFMA 1QOQB 1YDGA 4B7AA 2YZMA 1DAOA 4TT3D 3T7IA 4BO9A 4ZJZA 3W4IA 4MP3A 3ZD8A 1VPWA 2OHHA 3DL2A 3HB4X 3EVBA 3HXTA 3PDWA 4UNPA 1DOZA 3MK31 3SYLA 2EF1A 4YCMA 1A5BB 1V7PC 4MGEA 5FP0A 5H82A 3CVVA 4ZYWA 2RJNA 3U4IA 1F7VA 4P84A 1L4MA 2H2IA 4BVLA 1RC1A 1GRQA 2WAOA 4LDJA 4B6GA 5A1TA 2FTKE 1CS0B 2WUFA 4J0KA 3QENA 1MF7A 5AKJA 3OQ6A 3OWOA 6AT1A 4Q6WA 9GPBA 1VSVA 3E35A 1U1IA 1DO2A 1Y1KE 1RPZA 1KI9A 2H8KA 2F1RA 3H2IA 5AI6A 1DRWA 1N2SA 2JL1A 4RZ2A 4UVEA 1XN4A 1D2RA 2OECA 1EDDA 1UBSB 1HURA 3MIIA 4C7XA 1H1LA 2IHYA 2IYYA 4NCNA 4XDZA 5TE9A 1VJ0A 4TS3A 4DJEC 4O1MA 1YFJA 1MHPA 2HKIA 5J23A 2CMKA 4BO5A 5JCPA 2FPWA 2GM5A 1JLLA 2I3AA 4RJTA 3L7BA 3C3WA 1CUCA 4PPQA 5CITA 4WK4B 1CJTC 1T91A 2PT5A 1U0JA 1NW4A 1ZM3A 2E87A 3LQ1A 4KMSA 4O4LA 4A0SA 3PUXA 1U5BA 1VG1A 3JQ8B 1U9IC 2IH4A 2QD1A 4R16A 1N32B 4G5QA 3K0HA 4KGVA 2XWSA 4QWMA 4BZXA 1KARA 3CUVA 3GEMA 4MV5A 1I1QB 5A4KA 1SC4A 3C3DA 3LNTA 3GGSA 3VTAA 3QUSA 1YE3A 3GEHA 3G89A 3QF4B 4GKAA 3RFVA 5JNUA 1RKVA 2AA3A 2AQKA 1JEYA 4TMKA 4INOA 2P6OA 1JI0A 2XB2A 3RVBA 2CBXA 2CGEA 3BJRA 3ETJA 4PS1A 4L5CA 4UOEA 2ZVDA 4NC9A 4ZTZB 2J3DA 2EARA 3I09A 4JLBA 1SVNA 5EY5B 3NATA 1GGJA 5AW7A 4FZ3A 3URKA 5CG1A 2FPGB 1UEXC 1FFGA 4YT2A 1L8XA 1FC0A 1H4TA 1YB2A 3BJMA 3MOIA 4QPDA 2GM9A 3GZNA 4P98A 3BRWA 2PWBA 3O0TA 4TKVB 4XYLA 2A5FA 5IANA 4DIUA 1AK2A 1L0BA 5K9ZA 3BMQA 1TDJA 5SZKB 4RGYA 1Y81A 5ALTA 4R1TA 4TGLA 3RT7A 4B82A 2CXPA 4R69A 1FYFA 2WWTA 3ITDA 3GLQA 5SYAA 2VF4X 3DT9A 1BA3A 1FFEA 1P62B 2P1ZA 2M1ZA 3AP2A 4YYEA 1T5LA 2HOQA 1DQNA 1MC4A 2YZ2A 2AL7A 1ORVA 1ETHA 1XV5A 1YIOA 1PDVA 3SR4A 2B4TO 2RGEA 1MVNA 5EP4A 5B53A 2ZTHA 1DAIA 2OVBA 1KJWA 1OFUA 4F2DA 3LKBA 3BMCA 2JJ1A 3JQPA 3AHEA 2O8EB 2QLLA 4V3CA 1HO3A 1SEPA 3DM9B 3DTVA 5B1IA 2FQQA 3PX7A 4FBGA 2WTBA 3BERA 3B89A 2BGIA 3PKIA 4S3MA 4RY9A 1NV9A 1BEEA 1WPQA 3N9IA 4QNRA 3STTA 4J7XA 1BN7A 4XR4A 1CS4C 1KOJA 4FJ2A 3LHDA 4TL7A 5BXQC 2W6MA 2NZ8A 5J1SB 2YJZA 4EY5A 1F0KA 5A06A 5JVDA 3AEQB 3ER8A 2APJA 2PUEA 2C8VA 1P44A 1RQLA 1F0PA 1K7FB 4MRMB 4QEKA 3GDHA 2W48A 3FB1A 1U3WA 2OM6A 1KYIA 2ZSIA 5PNTA 5FOQA 2D2EA 3HA3A 2Q1TA 2CL0X 3NBZC 3IJEB 3C5HA 1PT5A 2CMGA 2ORYA 1Y4AE 3PT5A 4FGSA 4NEGA 5KS2A 5AKLA 4CPDA 4U8GA 1CU1A 5JQWA 1JZQA 1YZUA 2PMBA 2W11A 3CNHA 2VYND 5K05A 1GGKA 1N3BA 5L53A 3DCIA 1VGVA 1YDMA 1MQ8B 2IOHA 3NWBA 3SXUA 3TLCA 4AMGA 3UAXA 1N6KA 4XJVA 2D5AA 1VRWA 3I12A 4KQXA 4B76A 2ETVA 3F3SA 5B4VA 2VJYA 1DOHA 3SI7A 1UUFA 3HGQA 1Y6FA 4TPKA 3UJDA 4FYVA 4GE3A 1Y6ZA 3RF6A 3TOZA 5ARBA 2RI6A 1I2ZA 2ZB7A 3FE2A 1KC3A 3KOOA 3N8GA 4Q37A 3AFMA 3KKEA 3QNUA 3GPLA 2CHUA 2DWCA 5LQNA 4D8UA 5LXTA 1V4NA 1M6VA 2F2TA 1QTNA 4IF4A 4NFYA 4AY5A 3OETA 3VNSA 3MFYA 4DJDC 3LWBA 3NBMA 1PLKA 4FT4A 2XMCA 4YDRA 1LJLA 1K4MA 2NYVA 3AP1A 3G2JA 1JDJA 1RVV1 4W1PA 1IY9A 4F5ZA 3DEHA 5AK3A 1SC6A 3KOYA 4FKZA 1PSWA 2ORVA 3B6IA 3MW8A 3X1WA 4RTLA 1KDZA 3B85A 3H2ZA 3NCHA 4RETA 1V5FA 4QHSA 1QF6A 4C2TA 4RHFA 3W79A 2MR6A 3OZCA 5H83A 3RU3A 2QN8A 3SDBA 4AMBA 4LFBB 1UP4A 4QGFA 3LV8A 4Y2YA 3GLFB 1Q91A 2ORWA 1DEAA 4FCWA 2JVJA 3ETHA 1KY5A 4AL4A 3N2GB 1GO2A 5B5SA 2RAPA 5DX0A 2BEUA 4BO3A 1TLFA 2VXOA 3W3AH 1C8BA 3K09A 4UM8B 5BYBA 1MAWA 1TF7A 2JAXA 3AUUA 2O1XA 4U2CA 5FFFA 1P1JA 2WF6A 2AG8A 1J2YA 4RBNA 4G5SA 4WY5A 4XJSA 4NBNA 3STHA 5L8VA 1Y8ZA 5HBGA 4NQZA 2VBCA 2VTDA 2JA1A 2R11A 2Y71A 3EWNA 3SLRA 5HKBA 3U4QB 4DM4A 4A0RA 4F4IA 3H9GA 2QRHA 2ZWVA 5GVSA 5ELXA 2ERXA 1MN6A 2XLBA 5KCMA 1WO8A 4X8LA 3L7LA 1NN3A 5T5QA 3AR8A 1JTFA 3N74A 2PEYA 3JR7A 2ZSKA 3U39A 5LLSA 3RRXA 3OP1A 4TXNA 1P9NA 4PGAA 4H60A 2G06A 4HZIA 2VHZA 1ILEA 2P6MA 5BN3B 4MVJA 5BSTA 1MQAA 3MJSA 3W2TA 3U81A 1G5IA 4YT5A 3VHQA 5F73A 3FD8A 5SV2A 1T34A 2OV1A 3DYVA 1J2RA 2XCQA 4MO9A 1Y3AA 1YZNA 3G2OA 1KL7A 1GT91 4R3NA 2ECFA 5DIFA 4YBZA 4CM4A 4NHEA 2QORA 5KX5F 4FMDF 1TVKB 2C31A 4KXXA 1JHRA 3FCAA 1E7QA 3KKLA 5KHOC 4RHXA 4FFNA 5ESXA 1QMGA 1HBJA 2O9JA 4BV2A 4U3JB 5JPCA 3T4UA 1CT9A 2D3WA 1A8HA 1A7UA 1C9EA 1GAJA 1QQ6A 1V35A 1XD9A 2F9MA 2VBFA 2ZVQX 3E15A 4H7DA 4N6NA 5FORA 1YXMA 1CNEA 4PIMA 3ZDCA 2I4OA 1W76A 1JLHA 3QHAA 2WJWA 1GU0A 1EP9A 3OD1A 3NVMB 2DMRA 2O5EA 2XE8A 2IUTA 4QSMA 4KGXA 1KDVA 2HA5A 4YFVA 2FE1A 2WM9B 3O2SB 4QD3A 1VJRA 3W1WA 4ALLA 5C52B 4MWOA 4AUNA 2BKLA 1WUHS 1U98A 5EE5B 1TT5B 3RPEA 4CIBA 3L4JA 2UYGA 1CQXA 2G6BA 3LLVA 4B9EA 3SXPA 4I1IA 5FX2A 3LXMA 3GPCA 1C9JA 3PWTA 2PUGA 1UKAA 2IS1A 3NAQA 3SEQA 3LIPA 2OO5A 1HL7A 4W9NA 1HDRA 1NLMA 1VHJA 3RVJA 3ZBTA 5JMWA 5C1DA 3BILA 1J0XO 5A7FA 3CF2A 4FZVA 4RMGA 2ZE8A 2HRDA 2OV4A 3ZGXA 4DNXA 4YK7A 3FOZA 1NUHA 3O92A 3UQYS 4MR9B 4J8PA 3SYMA 2DCMA 3CWZA 1GWNA 1CERA 4OBEA 1UIRA 3D8BA 1HE3A 1P5FA 3COZA 4YJDA 4YJ3B 3ML1A 2GRJA 3IP8A 2QENA 4MUEA 4G65A 4M1MA 4O08A 4YP6A 5FT9A 5HK8A 3U60B 1E4YA 2FUKA 3AY0A 3HXPA 4KLCA 2W6PA 1AK1A 4GFDA 1ZRSA 4AWAA 4IIJF 4HJXA