4YMIA

Crystal structure of probable nicotinate-nucleotide adenylyltransferase from mycobacterium abcessus in complex with nadp
Total Genus 60
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
60
sequence length
198
structure length
178
Chain Sequence
RRRLGVMGGTFDPIHNGHLVAASEVADRFALDEVIFVPTGQPRKVSPAEHRYLMTVIATASNPRFTVSRADIDRGGATYTVDTLTDLRTAHPDADLYFITGADALASILSWENWEQLFTLAKFIGVSRPGYGLSLVEVPALAISSTDCRIRAGQARPIWYLVPDGVVQYVAKHRLYSG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Probable nicotinate-nucleotide adenylyltransferase
publication title Crystal structure of probable nicotinate-nucleotide adenylyltransferase from Mycobacterium abcessus in complex with NADP
rcsb
source organism Mycobacterium abscessus
molecule tags Transferase
total genus 60
structure length 178
sequence length 198
chains with identical sequence B
ec nomenclature ec 2.7.7.18: Nicotinate-nucleotide adenylyltransferase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01467 CTP_transf_like Cytidylyltransferase-like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.620 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold HUPs 4ymiA00
1J20A 3DPIA 3ND6A 2B7LA 1I6KA 3IUBA 3VRHA 3H99A 3X1MA 1SURA 1K92A 1G8GA 4MAFA 4MW5A 4DJAA 1KH3A 4MUNA 1KAMA 3G5AA 1KAQA 1M8PA 1X8XA 2E89A 1GN8A 3PNVA 1VBKA 5IJXA 3D6VA 2H29A 2CV1A 3QTBA 1VBNA 1KQPA 1YULA 5FO1A 4YBRA 2OQ2A 3VGJA 2QUKA 4DDMA 3CLTD 1JIIA 3FDXA 3K9WA 3ZJUA 4EG8A 5H7XA 1QJCA 1V8FA 4EG6A 1FFYA 4G5FA 1V47A 3ND5A 4EG5A 1YIDA 2O8VA 2PG3A 4MWDA 1JECA 1JHDA 3TQOA 4DNXA 4NAHA 2DLCX 3LOQA 3Q4GA 4ND7A 4ND6A 1OBCA 1KP2A 4MVXA 2HZ7A 4QBTA 1EJ2A 1ULHA 1ZH6A 1QNFA 1YI8A 1U3DA 1ZJWA 4R0NA 1IHOA 4L2IB 1U0BB 1JZSA 4ZCQA 1J70A 3FWKA 2DXIA 4MUIA 2YY5A 2AKEA 1IQRA 3SDBA 3CA8A 3QE4A 1T6ZA 1J1ZA 2PIDA 4HK4A 3RK1A 3SZGA 1EFVA 2PXHA 2V0CA 2VTBB 3ELBA 4EGAA 2RD2A 1H1TA 2CYAA 3CLSD 1O97C 1IQUA 1K97A 3DV2A 2BTEA 1VLHA 1WXFA 4KPUB 1JEEA 3ND7A 2GM3A 3N05A 1N2OA 3FETA 3IODA 3IVCA 5K0TA 1N2GA 2YWCA 3FY4A 2VXOA 5HUJA 3CR8A 1N2EA 3CVVA 2CSXA 1JIKA 3NBKA 5TGTA 1G8FA 1MAWA 1I6MA 2CFOA 3HFJA 4KR6A 1M8FA 4AQ7A 5BNZA 3C8ZA 1WXIA 2HMAA 1KP3A 1JZQA 1NUPA 1XNJA 3MLBA 3U1VA 4CDNA 5KWVA 2VTBA 2PZBA 5KCMA 1TYDE 2BYTA 1N77A 1EXDA 1R6XA 1WQ3A 2G36A 1S4MA 2X1MA 1T9GS 3MXTA 3E27A 4OUDB 1NSYA 3SEQA 3MUEA 1WY5A 4ZT6A 3PRHA 1F9AA 2A1TR 1TEZA 4XSVA 4S1OA 1GTSA 1GLNA 4MUEA 2QTNA 4MWBA 5LLTA 2QJTA 1DNPA 2J07A 1J1UA 1PFWA 3AIIA 2AZXA 2Z08A 4I6JA 3ZXIA 2IJGX 1R6TA 2ZUEA 3IVXA 3K32A 4K0RA 3AFHA 3TZLA 3RJZA 1QU2A 2O5RA 1N75A 4UZEA 3ZIUA 2E18A 1N2IA 4MW4A 2CT8A 3FG9A 1I2DA 5J59A 4OUDA 3KT8A 5LFAA 3GLVA 2DERA 4MUJA 1CT9A 3PNYA 3COWA 1TYCA 4MW9A 2CYCA 3DO8A 3I05A 2J4DA 4ZCTA 3NV7A 4WSOA 4MUGA 2QJFA 3P0JA 4Q93A 3CLSC 4MW0A 3CVXA 1QU3A 4ZCPA 2CV2A 3IOBA 2JAXA 1EE1A 1EFVB 1LI7A 2GOYA 1G59A 3D6UA 3COVA 1COZA 4PBRA 3P0HA 3H9BA 1QRSA 3GUZA 2WQ6A 1YUNA 3S3TA 5F23A 4F3RA 3A2KA 1JIJA 1A8HA 1JMVA 1U7DA 2X3FA 4ZT3A 1O6BA 4GRIA 1P7PA 4I6EA 2C5SA 4NDAA 4MQ6A 1MB2A 4U7JA 2OV4A 3QTTA 4ZCSA 1OWNA 4JZYA 4NX2A 3FNRA 3VU8A 3H05A 1J21A 4F4HA 1PFYA 2A1UA 1O96B 3X1JA 4JXZA 1OWOA 4KR9A 3HMQA 4MULA 3CLRD 4CT0A 1O5TA 1QTQA 4YP5A 3BL5A 3IMEA 4Q16A 1YUMA 2V0GA 1RQGA 3CVUA 4HPWA 5TS2A 1O0BA 1YIAA 1F7UA 2I1LA 1NUQA 1OWLA 1I6LA 4QRDA 4AS1A 2QTRA 4MUFA 3FOCA 4E1AA 1OWMA 1N1DA 2A1TS 1G8HA 1KQOA 2DPLA 2YWBA 3PNBA 2DUMA 1VL2A 1O96A 1WXEA 1MB9A 1GPMA 4MLPA 3HL4A 1TFUA 1UFVA 4RUKA 2CYBA 1D2RA 1IH8A 1JILA 1Q19A 3HV0A 1ILEA 4A91A 2XRZA 1T6YA 1M1ZA 1KORA 4NAUA 2HGZA 4OJMX 4DDHA 1F7VA 3TS1A 4QREA 3SZ3A 3ILVA 4PY2A 4P2BA 1FYDA 3TQIA 4J76A 1NP7A 5DASA 1H3NA 3A04A 3HGMA 4JYZA 5FO0A 1EFPB 1MC1A 3IMCA 1QRUA 4MW7A 1N2BA 4YMIA 2IP1A 3F3MA 3MLAA 1M8KA 1NUUA 1NYLA 3DLAA 2A4MA 4HJXA 5DK4A 4BWVA 1XNHA 2QTMA 4YP7A 1Q15A 3N8HA 3OP1A 5HG0A 2R5WA 2A84A 3IOEA 1IQ0A 3CLUC 4MWCA 1QRTA 1WOYA 3COZA 2JANA 3ZUGA 1JGTA 4FZJA 2D54A 4G6ZA 5AHWA 1BS2A 4MVWA 1NI5A 3INNA 1M8JA 1QQTA 2PFSA 4G5YA 1NZJA 4X0EA 3L92A 2CUZA 1EFPA 3IUEA 4EG4A 1H3FA 3AL0C 2ZP1A 4ZCRA 1GAXA 2E0IA 2A7XA 4RPIA 2J08A 1WQ4A 2QJOA 3NBAA 5LM3A 1O95C 1WXHA 3IMGA 1IFXA 2D13A 3KT0A 2QUIA 3IH5A 3M5WA 1OBHA 3GMIA 1H3EA 1LI5A 3UMVA 3UK2A 3IVGA 4EG3A 3FHJA 1PFUA 4PBTA 3P52A 3CLRC 1KH2A 1Q77A 1KR2A 1T9GR 4EF6A 4MUKA 3CVWA 4MW1A 1M8GA 4ZT4A 1KQNA 2A1UB 1GZUA 4JFAA 5DEOA 4CQNA 3UOWA 3Q12A 2E21A 3TZEA 1WKBA 2WSIA 4HJRA 1KKUA 3CLUD 2YXNA 4I6GA 3H9CA 1N2JA 2EJCA 4MW2A 1IRXA 3FI0A 3LE8A 1VBMA 4NATA 4MVYA 4DE5A 3P0IA 4GU5A 1TYAE 1F4LA 3SEZA 4R2MA 3N2YA 2GKSA 2PZ8A 3KT3A 4EG7A 3ZGZA 1K4KA 3FIUA 3UC5A 1Q11A 1O95D 1MBZA 1WJGA 2A88A 3IDFA 5DB4A 2PZAA 2DETA 2J5BA 4DDKA 1PG2A 3KFLA 3L93A 4PBSA 2Z3VA 1O94C 4TS1A 4EFKA 4XFJA 4ZT7A 5K0SA 1MRZA 4CDMA 3MMXA 4ZT2A 3KT6A 4U8HA 3JXEA 2X1LA 3OTWA 1K4MA 1ZH0A 1MOPA 3AG5A 1NUTA 3IOCA 3LCJA 4EG1A 4MWEA 2XRYA 4MVCA 2AG6A 2JA2A 2CV0A 2RE8A 5J58A 1XJQA 1O0CA 1M83A 2WQ7A 3RBAA 2D5BA 4KKVA 1U7XA 4ZT5A 3SYTA 2DR2A 1N2HA 5HUHA 4JXXA 5JBNA 3HZRA 1KH1A 4H3SA 3PXUA 3Q10A 2Z09A 1T6XA 1OD6A 3RHSA 1B6TA 2NZ2A 4L2IA 1NUSA 1MAUA 4MUHA 3COYA 4U63A 5EKDA 4ARIA 1PG0A 3X1KA 3G59A 3CVYA 1O94D 1N3LA 4UZFA 3TNJA 2DEUA 1ZUNA 1NURA 1Y42X 1LW7A 3ISJA 1MJHA 4YP6A 2ZUFA 1IVSA 1JEDA 2A86A 4ARCA 2EL7A 5H16A 3RFFA 3H97A 2IELA 4NZPA 2J09A 4XFDA 4R2LA 4KR7A 1N78A 5J5AA 3ZXSA 4KPUA 3ZJTA 1XNGA 4MW6A 4DLPA 3A4IA 2NSYA 1R6UA 1J09A 4K03A 3FH0A 5TEVA 3AG6A 2WB2A 1GTRA 1EUQA 2X0KA 1O97D 5IHXA 2QUJA 3ZJVA 1PFVA 1U3CA 3CLTC 1WZ2A 5KHAA 3RK0A 1HYBA 2QUHA 3G6KA 1EUYA 1TYBE 1TQ8A 4J75A 1X6VA 5FNZA 3A05A 2TS1A 3UY4A 2H2AA 4WNYA 5TEWA 3SP1A 3AKZA 1OWPA 3N9IA 1WXGA
chains in the Genus database with same CATH superfamily
4F86A 1TMKA 4S2EA 3V8PA 2YWGA 4MQMA 2FPWA 1R0YA 3X1MA 2JAUA 3H5WA 3JATB 4KFSA 1V4BA 2VNAA 3H5VA 1SIBE 1G8GA 3CJTA 4IRXA 3KPUA 4MW5A 4OAQA 4WCFB 5J2TF 1D2NA 1HV8A 1NR5A 1DXQA 2D59A 1CEYA 3ASVA 3NU1A 2DP4E 3DCNA 4X71A 1NVEA 2ISQA 5FX2A 2I9KA 2OQIA 2GZRA 3N7TA 5FLEX 3W7BA 3N6XA 1WMSA 4KO3S 3ITKA 4M21A 1UJ6A 5CW2A 4HGZA 1VIVA 1K5GA 1M6WA 4XEHA 3WL7A 5B64A 3R6WA 4YBRA 2O0LA 3RQIA 1ZM2A 4BJ3A 1USUA 1J2JA 4W5WA 5LXTF 5JW6A 3FDXA 2XGSA 1N5KA 3OUZA 4UCQA 4BVHA 1JEYA 2GN9A 3ZGNA 2GF0A 3OCWA 3LXXA 4KRXA 3T5DA 1Z88A 3KEMA 2XUAA 1AKEA 1R9JA 1EGQA 3IBCA 3KE9A 3I52A 4FS8A 3RVMA 3PGKA 5BPHA 2GS9A 3LPMA 4Q7MB 4FWTA 3OQIB 1GFZA 4OHMA 4Y2GA 4CEIA 3M3PA 2FMHA 4O4IB 4RETA 1E9EA 2H18A 3ZQ6A 3QI2A 5JARA 2H4ZA 3ERCA 1S7GA 3T3PB 1KJ8A 1YCHA 3HRIA 4OKSA 1THGA 3HSSA 2GZ3A 3CC8A 1KP2A 2AOUA 3L0BA 4PC1A 4DMMA 1NQXA 5F5NA 3GY0A 1Q6ZA 2D2VA 4MA0A 1L4UA 3A1FA 4WINA 3VR5D 3SC2B 3ZI0A 1I5EA 2N1MA 3LHKA 2IITA 4EHJA 1PR4A 4QJIA 3JQFC 1G7TA 2XUIA 4IDPA 4C7VA 4XUGB 2DSTA 1XT6A 2CK3A 2NO4A 3W5JA 4CQMD 1DBSA 1RXUA 2CD7A 2O4CA 1QKJA 2YV2A 2JAHA 5IN4A 2VTBB 1ZH2A 3RJ9A 3D6TB 3C4JA 2VWGA 4NECA 4B7AA 3TF5A 1A3CA 3C3MA 1MQAA 1LXCA 4C01A 4I1YA 3MJ4A 1YMUA 4GOJA 4N7MA 3B1JA 2Q3JA 3HKBA 5FPTA 4BPBA 1VCIA 3INTA 4CLOA 2IHZA 3H87A 1ZR4A 1W9HA 3UTDA 1GCOA 3VNSA 3ZK8A 1N8NA 4MZDA 5J47A 2Z4TA 2PUFA 3G8YA 5JYDA 3HJAA 3RI3A 3ZI4A 2VL7A 3NYWA 1R6AA 4QSMA 5DWVA 5LA6F 4BX2A 3WGVA 1QB8A 2HIHA 4X3OA 2BFCA 4DM4A 3GUUA 3O84A 4JHLA 3OQJA 4KL8S 3R0IA 4FB5A 2MSLA 4OQNA 5AOCA 1TJ5A 3TMAA 2REQB 2W6IA 2WFLA 3MGCA 2CFOA 1FEZA 4XW2A 1YDGA 3KSBC 2GT1A 2HMAA 4GSLA 2QMHA 4CDNA 4MPRA 2QUBA 1EXDA 1R6XA 1N6OA 1MJGA 2G36A 3JQ8A 3I2HA 4J0QA 3V80A 1CNMA 4K9QA 2HCFA 1GPLA 3AEUB 3A4VA 1H4VB 4YALA 2Y0PA 1LK0A 2HT6A 3MQ4A 4K9MA 2NZYA 3L0OA 2NXJA 4MPDA 1NJ8A 3ZV5A 1Q6YA 5EXDA 1C3EA 1ABBA 3CBGA 1SU7A 3H1PA 3MTJA 1WY5A 3FFBA 1U4OA 2BE7A 4R8LA 4X1IB 3AB3A 2W6NA 4QQKA 5IDVA 1BU5A 4INPA 4WCFC 1ZOSA 2AZ4A 4BVFA 1XQ1A 3H04A 4WLNA 5J1TB 5CEFA 4QATA 3OA2A 1K27A 4DLYA 2AFIB 5JMPA 3PDIA 4Y2UA 1J1UA 3T6KA 3UV7A 4MKHA 4NFLA 3R7AA 1YE3A 2ZWOA 1I7SB 2WK1A 1EE2A 1Z8HA 2AFHE 3NV9A 4N0DA 1Y81A 2VOEA 4Y6QA 5CPBA 2ZYGA 3N3BC 3S1SA 2QTVA 4XYMA 2XCTB 4NBSA 5KNLA 3WLAA 3GRFA 3MRSA 3ZYCA 1U04A 2Q99A 1DC3A 2F43A 2FSVA 2B1JA 4M1MA 5F33A 2OYCA 5IAOA 1GAQA 2NTVA 1L3BA 1B2LA 4OUDA 3AUSA 2IBTA 2P62A 2ZB3A 2AFRA 4D99A 1N1MA 2NNWB 2A8YA 1EHIA 2ZJ1A 3KZOA 5IBQA 3PUXA 3BF7A 4N3NA 4E5NA 1AHNA 4L7VA 1QGYA 4KRGA 4XIYA 1GZDA 4PWYA 1SNYA 2HOQA 1GDTA 2EBUA 4NBVA 2GILA 2UVPB 4JC8A 1U2PA 3OLYA 1I7QB 3PGVA 3QBEA 2G5TA 5GAJA 2QZZA 1Y9DA 1ZMTA 2EKLA 2IYQA 4BO9A 2AZTA 2H2IA 4FZRA 1JR3D 2H48A 4UDYX 3GGCA 5FOWA 1N7GA 1WZEA 3WRWA 2NZVG 1NPTO 4A1FA 3CEHA 4TXMA 2OO5A 1DAGA 2Z30A 2QROA 2V74B 1NSFA 2OXCA 2WIGA 3DTTA 1EIZA 3RSQA 2LUOA 1EE1A 4NNJA 1NXTA 1V7ZA 4GOKA 4XASA 1R4ZA 1P29A 1Y1LA 3IURA 4GP7A 4UJ3A 1SVIA 2IHVA 4YFVA 3SVTA 1P7CA 3FUWA 3O8QB 4O1HA 4NVRA 4BFCA 1V39A 4LXUA 4WXRA 5B3JA 4N47A 5ALMA 2CK3D 3ZH9B 2PL3A 1LQUA 1CVIA 4MYRA 3FNHA 3I30X 1QF9A 1AKWA 5HS6A 2A92A 2C5SA 3HSKA 5DLPA 1SG0A 1HG1A 2W2TA 1LBSA 4U7JA 2DHEA 2NSJA 2OV4A 2A5JA 2HWKA 5TVKA 2JBAA 4LHSA 4YFYA 1K66A 1K7CA 1J8YF 1U80A 1BVHA 1OYOA 3W6OA 2ET6A 1AKQA 4AWAA 4QOEA 5J2UF 1MFPA 1IDOA 4NZOA 4LX8A 5DOZA 2ODAA 4CLRB 3HMQA 4IOJA 3HLYA 4FNMA 2CVQA 3UW1A 5IXJA 1OVGA 2VCEA 3GCZA 4LSZA 3IHLA 2UXBB 3QKRA 2ZFUA 5IUJC 3DW3X 4V0KA 1G17A 1O95A 2XMSA 4YP5A 4ER0A 1T9AA 2XE8A 4R71A 1Q1NA 2NAPA 1JLKA 3ETEA 1ATZA 3JVIA 2XYHA 5IEBA 3EPHA 4C2UA 1S2NA 4F6CA 1MMFB 1VL1A 2HRCA 1RYBA 2W6ID 3FUVA 2X1VA 4X1KB 2JLZA 4DLRA 3BF8A 2X9VA 4JU9A 5GM2A 1J90A 4ZVSA 1UXKA 3I0ZA 5U1PA 5L4LA 3U4MA 4RACA 5AW4A 5D1HA 4W5HA 1AY0A 4UXHA 1RYNA 3GWGA 3IX7A 4HC4A 1XZJA 5KOJA 1FZQA 1HT0A 1W0JA 3DBRA 4F21A 3B12A 2BT4A 3CGWA 5ALGA 4HXEB 2N75A 2PH7A 4RTPA 1G21A 2DUMA 2LCFA 3M8KA 3WNBA 3I2GA 2IUSA 4LHVA 2Q4EA 2CKMA 5KMGB 3FIJA 3V34A 3QF7A 2B99A 2JI4A 4S0XA 2ATVA 4XTRA 2XYRA 2JAQA 5GJBA 4MYTA 3AZPA 3DAOA 3KPYA 3FUTA 1IH8A 3GEBA 5BSRA 2D5IA 3MQFA 5KOIA 4O2BF 1L4LA 1WHTA 2C5EA 2BGJA 1NONA 2ECPA 4DDHA 2ZB2A 2WABA 2VWPA 3RUFA 2FMFA 1KDVA 1U7PA 1XALA 3OKCA 4R69A 4UTXA 4DUPA 2BFDB 3INYA 5JFTA 4RO0A 1CUBA 5ELMA 2KLHA 4H0CA 1VCMA 2RHHA 3AUFA 4XFKA 5FBQB 4HDCA 3LXMA 3LVBA 5FO0A 5HQ3A 2XMGA 3AOGA 3EOAI 1BS9A 4BKOA 4G25A 2ONJA 1HNZB 2BM1A 2WV9A 2ZPAA 2OCBA 3FGZA 3BMCA 3W6UA 1I7NA 3G0DA 4ZVNA 4XCXA 1TM4E 3L0CA 3OTHA 4M0DA 3MBOA 2QU8A 4V39A 1QF7A 1A5SB 3TLBA 3F9IA 1Q5PA 4YP7A 4GRDA 1O94A 3KUUA 1L7MA 2CXNA 1C9YA 2IGBA 1E89A 1BA2A 4JSTA 2YJTD 1DMSA 4ZYZA 5SYAA 4U2FA 4HDKB 4S1NA 1MHTA 3TR6A 4MCHA 3R9IA 3LTNC 5KX5F 1WZCA 3AHCA 2JANA 3HDVA 5BVHB 1JGTA 1GSAA 3UEOA 1GARA 3C1UA 5EVJA 4M1SA 4N3BA 2YBDA 3LUGA 3QOFA 4MVWA 5K4AA 3SXJA 1ENYA 4UFNA 1M6YA 4PNZA 4CF5A 3IUMA 4X7MA 4OLJA 3O47A 9GPBA 4HQOA 4EHLA 3IPAA 1E2JA 1E5XA 1LX7A 1PRYA 2E0IA 2O06A 3C7DB 4IDFA 4BC1A 4RL4A 1ADFA 1JA9A 1VPTA 2FPIB 2LIPA 2XF2A 3UUGA 1JFSA 1XAGA 1T8WA 1D0IA 2R1UA 1AA9A 3EGXB 3D3EA 3IH5A 4WV3A 3S2IA 5BOSA 1XXHA 3Q72A 4WZAB 1H3EA 2OV6A 1R74A 2Q3DA 8ABPA 1LNQA 4DMFA 1ZK3A 1H9BA 1JRLA 3SKVA 5E4YA 4U00A 1SCDA 1UBMS 2SKCA 1FL9A 3CW2A 1B0PA 2C07A 1BROA 3AUYA 4QOFA 4JYPA 5KNCH 3OJOA 3E6AA 4BKUA 1IN7A 2GHIA 1GOTA 1YVDA 3T15A 4Q3KA 4L5CA 1X7XB 5IS2A 1KZ4A 1GNSA 1Z22A 3DLIA 4U0KA 2XCSB 2AUMA 3PKJA 1TDJA 3GFGA 3V8MA 3HABA 1GQQA 4I4TA 1UZUA 3UANA 4PV7A 2Z83A 2ZRHA 3UMGA 2D06A 3LM8A 3K0KA 3CIOA 3K92A 3IUJA 5I7UA 3UMFA 1S1MA 3D8SA 4EY5A 5A06A 3A26A 4AYWA 5AMXA 2VHWA 2ZE6A 3SN6A 4KSYA 4PS0A 1N2CE 3BIFA 3BULA 3GJ6A 4R2MA 3QFRA 3L8YA 1I9GA 2REBA 3VAYA 2PZ8A 4Q15A 3WS7A 1RAHA 5IANA 2VJMB 3GD7A 4IINA 3WJ2A 5CA0A 3B6JA 4O3FA 3N7UA 3I1JA 1O95D 4V0ME 3ZD7A 1WJGA 3MTGA 3ZV6A 2VUSA 3SR4A 2O3UA 4E15A 1RBQA 3HEAA 3KU4A 5KAPA 1AU9A 4HBZA 5AM4A 1JAYA 1CRZA 3K0HA 4NYMQ 4KXLA 2C97A 1QE0A 3D2CA 2BR5A 3EFOB 4MAMA 4BNJA 2Q6OA 2WSYB 1Y89A 2G72A 1UIRA 1Z68A 1W0JD 3NC0C 4I1UA 5CLJA 2XSZA 1XL0A 3QIAA 5I01A 2C0QA 4PZEA 4LRSB 4DCMA 1NUTA 1SVWA 4UEQA 3CJRA 4UM9B 1T1RA 3EBLA 5G0VA 5J9FA 3MS4A 2J0UB 1BCSA 2OC9A 4Z0NA 1T2VA 2JJMA 1HMYA 4U4AA 3WLMA 2D7CA 5CNKA 3PT9A 1T8SA 1Q14A 1EXVA 3EWIA 1CB7A 5AVSA 4W5TA 1R0WA 3VPAA 5SYMA 1H4QA 4B3MB 4BO2A 2VK4A 2VQEB 1Q21A 4BVEA 221PA 3ABRB 5LKRA 1U7XA 1Q44A 3O8BA 2C59A 2VZ8A 4IW3B 4NOKA 4NZ9A 1KC1A 4TS3A 1CJVC 2DF8A 2GH1A 2C9ZA 4X63A 4K8OA 5KDLA 1KDZA 1I01A 2ZJAA 5ED0A 1KI8A 4G4SP 1I3MA 1B6RA 2QN8A 2Y3IA 3FSJX 1W6UA 1N8TA 1RU3A 3GHYA 2WJIA 3BIOA 4EI7A 1XK7A 2QRZA 2AMLA 3HRKA 1WR8A 1FTYA 2DQZA 3HKCB 3N0WA 3RARA 4ARUA 3JQQA 4CTKA 4IICA 1NMXA 2C78A 2ES4A 3QE3A 1QIFA 6ADHA 1O94D 3QELA 4PX3A 5L3VA 1P4RA 5CBKA 1ZUNA 3IAAA 3EY4A 4N5DA 4JOBA 1JU3A 1NT4A 4PYNA 4KI7A 3D6NB 4LGMA 3TEJA 3WSVA 1H93A 2I54A 4DR7B 3U0VA 2R1ZA 3LBFA 1WO8A 3OT5A 2H9IA 4RL6A 4RQAA 3CEAA 1DX4A 4E7OA 1X94A 2PKRA 1RXVA 1MABA 2W98A 1DE0A 1RJ9A 2HHAA 1IIBA 1SCUB 3PHHA 4HUQA 1LPBB 3R0JA 2BGGA 1NE2A 4DNFA 3EEQA 2I2XB 3D8RA 4D0NA 1VE3A 4LI0A 4NK4A 5C81A 4IIDA 4AMZA 3QVKA 4OQEA 1VGRA 4I50F 4MGZR 4PQGA 3FJ1A 2H54A 3I0NA 3K94A 5BP7A 4J2OA 4DCPA 3DE5X 4L5IA 1K3UB 3CKYA 3L7JA 1RXEA 1CRLA 3O6VA 5FLKA 5AW2A 4UPEA 1NNSA 1QHFA 3AU8A 4FGZA 1F4VA 4KX3A 1QVRA 4HDMA 4R8MA 2NSHA 1V8ZA 3VHXA 3JAWA 4XOUA 3EC1A 2ANCA 3D4PA 3B7PA 2DYKA 2XDYA 3ABQB 2VNKA 3OLXA 3OQ6A 4TMFA 4DR2B 2VSXA 2RHTA 4IFEA 4P6VF 3R4CA 4B47A 1W1WA 3E48A 1ZVMA 3K2QA 4XB2A 4CG1A 5B57C 2AOTA 4W9NA 1DMRA 4KLZA 5JBIA 1E4OA 2PWYA 3A1NA 3TLKA 3VRHA 2I62A 4LYGA 2FGJA 3CZMA 4TUYA 4BIIA 4BHTA 2QQEA 4MI9A 2LPMA 4S1VA 4EPXA 4L4ZA 2A3NA 4C0HA 5JSFA 1MO2A 3K2EA 4REMA 4MUNA 3HVRA 3H84A 2AJLI 4FJ1A 3U4QA 4H1HA 2ZJ3A 2V7PA 1A9ZA 3K4HA 4IYRA 3HBFA 3THYA 1WCIA 1F6BA 5E4TA 3KTAA 4BPRA 1TFRA 3LBNA 4BQIA 2Y6VA 3E9YA 1I9CA 2BEKA 2KBEA 1M2FA 3RT9A 2F1KA 2IZ1A 4CMJA 5T4BA 3BFVA 1XCOA 5I7HA 4C88A 4YWHA 2YNMA 1EH5A 1OPRA 1BDBA 2IOHA 3V42A 1AGYA 3GGPA 2PRSA 5EMHA 2FZVA 4F71A 1E63A 1NI4B 4B3BA 5KO2A 2EBHX 3FDZB 2QY9A 3L7IA 1SUFA 5KREA 2VNJA 3B20A 3PEYA 1YBAA 2O8VA 5I8WA 4LMBA 2I34A 3BH6A 2XSZD 1BRMA 3BDAA 1TQ4A 4K9PA 2BKLA 1MPXA 4P4UA 4TV8B 1XCBA 4GYYA 4BNNA 2F67A 1L1QA 4BMXA 1YJCA 4I1PA 3D4NA 2Z43A 4DIEA 2L42A 4K9LA 2HZ7A 5FULA 3BT7A 4A0SA 4R3UC 5KINB 4JVLA 1KOJA 1C9NA 2HPVA 2R8OA 4U6QA 3SLRA 1T25A 5K03A 2VKQA 3V1MA 4D97A 1DUIA 1XZPA 2EJVA 4ZCQA 3ZQ4A 3M3HA 3MINA 3GRUA 1YRBA 3DOCA 3Q7EA 3WLNA 3QFHA 4CMKA 1GEEA 3BH0A 1VPWA 4HQKA 4L3VA 4BWFB 1Y3CE 2ATIA 4O0LA 1SUEA 4BJ1A 2I8AA 3DVAB 2F00A 3QW2A 5IVHA 5TSDA 1K75A 2J7PA 3WY9A 1J0AA 2GYVA 1U0LA 3QE4A 4AKTA 1WPRA 5HJ7A 3QX9A 4JEMA 1C4WA 3OEWA 5CJ2A 2J87A 5DZSA 2ZYWX 5FA5A 1EFVA 4EGAA 5AJYA 1QOPB 4YAGA 4H7HA 3QOWA 1IXYA 3BWYA 3HVHA 5IYZA 1U63A 4JLAA 2WE8A 1EGVB 4AM8A 3O03A 3QU2A 2WUGA 5IH7A 3I83A 1ZM9A 3AJAA 3A6HA 3G1UA 3IRUA 5H59A 4KVFA 1YB5A 4MYSA 4IG4A 2SKEA 1F8UA 1E60A 2A2ZA 2GAOA 2G0NA 3T9BA 1XWWA 4DRXB 1QIGA 2OHIA 2X0EA 5GV7A 1ETHA 2AEMA 2PYIA 3OUTA 2Q46A 4KVGA 3TTYA 2CL6X 1YDWA 4B7UA 4B35A 4BBJA 3CR8A 4DNQA 4FKMA 1OYYA 3GVHA 1D4FA 1NGSA 1Y9AA 1Y63A 5KJ1A 1QYRA 3LF1A 3L01A 2XMZA 3N2EA 3FOEC 4FB4A 4QGGA 3RS3A 3R7SA 3FNFA 1XNJA 5REQA 5KWVA 5FP0A 3KQHA 4LKRA 2CDCA 1QO9A 4E13A 3K0CA 4XGKA 3MMNA 3A3YA 3A9CA 1J0BA 3GBPA 1J07A 4LBYA 4PHTA 5BW5A 1RVDA 4LVCA 4FILA 1MX9A 3KKLA 2TECE 3OECA 4Z3DA 3D3WA 3WLLA 5FOXA 2QU7A 4QPJC 5AHRA 4JLJA 3VNUA 4XQ0A 4TKLA 2A9VA 4TTIA 3DCJA 5ERYA 2ZG6A 3SF0A 5CNIA 5M29A 4CETA 3D8BA 4RHFA 1HI9A 2O48X 3PRHA 2P4HX 3GEMA 3R5SA 1NLYA 1OLSB 2P4UA 3AEXA 3SBEA 4S1OA 4R31A 4RHTA 1GLNA 4P7FA 1FVFA 2RHBA 4WFIA 3FPGA 1W52X 3ZWVA 4PQRA 3FUUA 3IP9A 3L77A 3QQPA 4MUEA 5FKJA 3VV3A 3ZK7A 4YR9A 4AU1A 1DV1A 1DNPA 4LISA 3RREA 1VRWA 3ROXA 2JJ2A 2JLBA 5DGCA 3ZXIA 5KWIA 1AB5A 1X1TA 4I3FA 2HCTA 1Z26A 3ET5A 4CTOA 3IVXA 1CUAA 3C6BA 4IDOA 2INGX 2GARA 4R7TA 2B3TA 5L45A 4F4IA 1QU2A 4O02B 2GCOA 4TKUB 4U9HS 2PSFA 4H9GA 4Z7JA 2PGLA 4I1OA 1FP2A 1R50A 3NNSA 5CAEA 2G9ZA 4QGHA 3NAMA 3NVMB 1JPUA 2C7VA 1EZZA 2AT1A 3JR3A 3QVLA 4BWYA 4YCDA 5IMBA 1EZ4A 1KVRA 1PJLA 2ZT5A 2FW9A 2QM7A 1UUFA 4NYJR 5CB4A 2YNMD 4W5QA 4HWPA 2NQ8A 1CT9A 1GPBA 2PH3A 16PKA 2A7QA 4RPGA 3GBSA 3T06B 2HEGA 2Y4NA 4MV4A 1V25A 2PBZA 5E4JA 4XVHA 5CBPB 3QVSA 2WNSA 3PKIA 4RU1A 2GBPA 5CYPA 4ZOLB 4JELA 4YX9A 1L6IA 4ZCTA 5BWOA 3KC2A 4ARVA 4QIHA 2FLWA 1A2OA 1Z4MA 4MUGA 3B1FA 3C3BA 1VLQA 4ZO4A 4LXIA 2CLOB 3ZS8A 1GTZA 1UJBA 5IBRA 1XJ5A 5LSAA 4GMHA 4TYPA 1XA3A 2FB9A 4N5MA 5EHGA 2EHDA 3ZHZA 2HCJB 2J3IA 3RRZA 3T7EA 4E6PA 5L51A 1I1QB 5JYCA 4XB6B 3SXUA 4YRAA 1X1BA 1NKTA 4JZKA 4QUDA 5HIAA 5GJVC 1WTAA 4JEIA 3RVBA 4XYGA 2JK1A 4PBRA 3THWA 4JLKA 1CD5A 3WTBA 3UMYA 3DTVB 2C7PA 4F3RA 1SVOA 2JGRA 3T3EA 2RHGB 3BPSA 2J7PD 1N6PA 3NT2A 4WUVA 3RRYA 1G38A 2HR1A 4J0EA 3U7RA 3P9XA 4PFKA 1TUEA 3RRJA 5H1YA 1BZYA 4CTJA 4ER7A 1AQ6A 2AG1A 1A9XB 1PE0A 5IASA 5DP2A 1OBOA 5HMMA 2BBOA 4J49A 2XYGA 2WV7A 4EW1A 2A1UA 3GLGA 3DOEA 1PD1A 3OKPA 5I5GA 4BDSA 2FF7A 1ISGA 1F2VA 1THZA 1YR9A 2ALJA 3B6ZA 3N74A 4IDCA 3EUFA 1B41A 5C5DA 1KPIA 2CHFA 1FF9A 3NHSA 4OV6B 1A2BA 5IF3A 5KYTA 3VTKA 1GNVA 3CUUA 1DINA 3IQFA 4ZOBA 1NLFA 2R84A 1CQJA 5HFNA 2QDXA 3K31A 5LDGA 3RSFA 3ZTYA 2V0GA 3WQQA 1QRAA 1XQXA 4WK0B 3HPRA 3H6HA 3GG2A 1NVAA 1YIAA 3NT4A 1RMTA 1AC5A 1CB0A 4JJIA 1UEJA 4HNVA 3FFXA 3MAAC 1ZD1A 4AS1A 1OWLA 1WDLA 5U9CA 1A7JA 2QTRA 2RBGA 2DJ5A 3EGVA 4QJ3A 1K3TA 3W5CA 1RWXA 4ZOCA 4BO5A 4O2AB 3ZZNA 1OWMA 4DS3A 1RP7A 5DBEX 1ZOLA 1BD3A 1G8HA 3E8XA 4RF4A 5HFJA 2FRXA 2GJKA 4LSMA 3SHVA 3GFBA 5LQUA 3X2SA 1KJJA 1NTRA 4BAUA 1MB9A 2QJWA 3SZMA 4ZOQI 2Y9PB 4MPPA 1RBZA 2H06A 4HX5A 1BKYA 2PV0A 3R24A 1G20E 1L9KA 3W77A 4HQ0A 1OFTA 5L7TA 4KFRA 1Z2CA 3K5HA 1TGVA 4BN4A 5KC8A 4KXYA 5LP6A 2XBMA 2ZUVA 2AUTA 4NAUA 1NX6A 2FW0A 4KNVA 4OHOA 1QK3A 3DAGA 4OOEA 3VTZA 1W76A 4RTNA 3ID6C 1VFNA 4ALMA 3IAM1 4CIVA 2QLJA 1BWRA 3JVEA 1ODTC 2EC5A 2WM9B 3LDHA 5EEHA 3WLJA 5A5VA 5D01A 1LNSA 2JJ2D 2GDJA 3E23A 3I04A 1NFFA 5HM8A 4JUBA 4MW7A 5CA1F 5EQJB 1MJ5A 3SIPA 5A5EA 1XD8A 1CZUA 5GIPE 2PD6A 2IP1A 2XUQA 4LQ4A 5LWHA 3UXEA 1CSEE 2R1TA 2FTKE 3U7JA 3WWPA 1Y7IA 1NMSA 4QFMA 3VPHA 1NJ6A 4O4LF 2JARA 2H1HA 1IULA 2BKXA 3BB4A 1J23A 4F3YA 4KWEA 3OP1A 5I4KA 3GWZA 1GXSA 3E5NA 3O3NB 4LYJA 3SS9X 1WU8A 5L3SA 1YR3A 2PRKA 3VU0A 2HW8A 3O74A 3RKUA 3NX4A 3PZRA 3EE6A 4YRZA 2VK2A 2HO4A 1QRTA 1KI6B 2H3HA 4IDDA 5E1OA 1P0FA 3E1SA 3ZZ1A 1JFVA 2GKGA 3L6EA 3TDMA 4AP6A 1TVMA 3UXMA 3RAFC 2IW1A 3O73A 4XUDA 1DKQA 5K51A 3D4LA 4F3TA 4EY7A 5TLSA 4D9GA 1DG9A 1F9EA 2NUAB 5LNK1 5B4TA 4IJKA 4D4JA 1RTTA 4DL9A 1LA2A 1P2VA 2V03A 1G5TA 4Y6PA 4D26A 2NYRA 5CLQA 4LF5B 3QBJA 1NQ5A 2GNAA 5YASA 2KB0A 4QG7A 5LLSA 4ZRMA 1C9JA 5ILGA 2QVXX 3P26A 4UNPA 5DTEA 5MDHA 3R6TA 4HB4A 4EI8A 4EG3A 4TVKA 4YB8A 5I47A 1Q16A 2BISA 2YMPA 4QBHA 3RBXA 3EDRA 1IOZA 3BH7A 2IC5A 1UXOA 1J2EA 1FY2A 2B4YA 1M5UA 1RKBA 2XEXA 5EQFA 2FFHA 3OC0A 2M6LA 1O6CA 3P4XA 4M1KA 3DJYA 1YZHA 4OMCA 1KQNA 1OIWA 1IN1A 1HNWB 1Z7EA 4CF3A 2Q6VA 2HADA 2Q2NA 4OXKA 3W90A 4OHVA 1ZIYA 4WGFA 2JI9A 3T8YA 4EFNA 1KOGA 3Q9UA 5FLXA 1S96A 2PCJA 2FK8A 2O14A 3F6EX 2IPOA 5U4XA 1H65A 1NN3A 4AURA 4FDMA 2Z8XA 4TWAA 4EB0A 5LIRA 2XYVA 3MT7A 3H2HA 1V8BA 1XXLA 4CMIB 1XO1A 2Q0XA 4RZ2A 2PSSA 2FMIA 3MLEA 1JXAA 5I48A 5JY1A 4FQ7A 4DCUA 4FFSA 3QXSA 2X4GA 3UGKA 1DKUA 1PI3A 1DDIA 3KVYA 3VJRA 2ZSAA 1BWSA 3P2OA 3SEZA 4UXJA 2ZM5A 5UKDA 2JD0A 5JWOA 3G88A 2ON6A 3DBVO 3KOUA 3KT3A 5K3DA 2HHLA 2B98A 5HF8A 1XQ9A 3KAKA 3OCZA 2BM9A 4UVHA 3R7WB 5G4KB 4HXGA 2ICAA 1T5LA 3F46A 4J9UE 4BQNA 3W7AA 2FK7A 1GKIA 5K09A 1OJLA 3KQQA 2J85A 2PZAA 2EP8A 2C3MA 5DX8A 3LCVB 1C8BA 4HY3A 1VG0B 4CGYA 3HCBA 3ELDA 3ROKA 4TS1A 4URXR 1DPGA 3OCUA 3OIFA 2CL0X 1JTFA 1QOQB 2X1LA 1II8B 3NWOA 4RH3A 1EP3B 3CUEF 3PUHA 4UOZA 5MFPA 4G8JA 1REQA 1ISPA 1NF2A 3AERA 3DE1X 2YMMA 3S2SA 3KTDA 3U3OA 1ZC4A 2CLIB 3DXZA 3UB4A 4HKTA 4A0RA 4OX9B 1DIRA 5LQNA 3FLAA 4OXNA 3HN7A 2RE8A 4AXXA 2NTNA 3PEWA 2R9VA 2OFWA 1D0SA 3IT1A 4UDXX 2REOA 3ZE8A 2C00A 2G0AA 4JXXA 4R16A 4CL8A 3R20A 3UC9A 2ZU6A 1T9ZA 3EQ8A 4ARZA 4ZHQA 1GCGA 3TGPA 2VJCA 3GFTA 2H4WA 1HLPA 1CQIA 3E9DA 4GPZA 4XVRA 1G2QA 2VI5A 4Y3UA 1BGWA 1AN0A 1F5SA 1SA0A 2EKQA 2OXTA 5AXAA 1ZN2A 3KJZA 1U9YA 2KW5A 3QNMA 3RT7A 4V1CB 4U63A 4RGYA 2VJAA 3DVLA 2G25A 3EASA 3TE7A 4DV6B 2ILTA 1X80B 2R7MA 1JALA 3RKSA 4Z9BA 1ZX1A 3GO4A 3OM0A 2I3DA 3P4UA 1RYHA 3LOUA 5THQA 3FJOA 1W5BA 4BO8A 1KO4A 3BIXA 3K73O 3RUIA 2ZUUA 3PPWA 2VVTA 4N0PA 1IVSA 4WBNF 1E1CB 3AUXA 4Y1FA 3DWGA 4EZIA 3QKIA 4AQDA 4HV4A 1R4AA 3FE2A 2WF9A 3M9LA 1ZD3A 3COPA 3IAXA 3KQVA 2PUWA 3FMIA 3T1QA 3VOBA 1OLXA 1YVRA 1ZZEA 1ZGZA 2DH6A 2VXYA 2YJZA 3IR7A 2WWIA 4L57A 4IWYA 2Q1SA 3KG2A 5SZKB 1TI7A 1Z4QA 3IIEA 5FR1A 1R6UA 3KWLA 4L51A 2FG7C 1E59A 1J8QA 3NVDA 3Q5GA 3EXAA 3BX1A 1UZNA 2Y67A 4HEA6 2CXOA 2DUJA 3E3MA 4YDSA 2QUJA 5E9QA 3OPNA 3ZD6A 5COBA 2OSBA 2DHCA 4R05A 4RLFA 3WK5A 4CEJA 4KVAA 1DELA 5JJIA 1Y4AE 5B1EA 1TZKA 1VJ5A 5ADVA 3F6YA 3T61A 2ZVDA 3NFYA 4GLLA 3M6AA 1CVRA 5CGZA 1EUYA 4GG1A 1TQ8A 4QU5A 1QO0A 3PGMA 4QTXA 9ABPA 5IC4A 2IDJA 5J4KA 1CUDA 1ECJA 3IAS1 1GUAA 4OFWA 3PC8C 1FMTA 4PYLA 5JD5A 4QM7A 2P91A 2FOIA 4BIMA 1SQ0A 3KOWA 1PUXA 3OIUA 1KEEA 3LV8A 5EMLA 4ZI7F 3FCCA 2A0KA 4H18A 3WK8A 3L7MA 5JSHA 2I2CA 1FLVA 1IN6A 1FU8A 1PDWA 2NOAA 1T0HB 1WDTA 2OVFA 4FN5A 4NU5A 3LIPA 4IQFA 1M8PA 3MGGA 1E4VA 1X8XA 2VP2A 1QBGA 3AFNA 1SC1A 1XTVA 1LPOA 4QSHA 5DI9A 3D7RA 1VBKA 1UJCA 3NHPA 3CNQS 3OX4A 2QY6A 1MG5A 2C9BA 5EKUA 5CB6A 2XDQB 5EKTA 2X8JA 4JJFA 3W2IA 1L8AA 4O29A 5FUQA 5JCPA 4F8EA 1VPDA 4PGMA 3I1IA 4Q7EA 1YWGO 5FBHA 3B2QA 4MMYB 3ZR4B 4K1XA 3ICOA 1K0UA 5CVTA 1GZ3A 1GNPA 4E03A 1V7QA 1HRDA 1I51A 1RR6A 4XARA 3GJ7A 3RHFA 3ZZUA 5LQSA 4ZALA 1NKVA 4EG6A 1P60A 2NQTA 2YHAA 1XU9A 4E11A 1M7BA 1OE0A 2EJUA 2JFFA 4NAHA 2O20A 1DO2A 1UAGA 1JSZA 1MO4A 2VDLB 2ZRBA 3FHLA 2GA8A 4CQMB 2O8FA 5I51A 2PVPA 3G0BA 1GDHA 3WSTA 5HW0A 2F1OA 2VHZA 3CRVA 4EK9A 3VTAA 3NAZA 3NTLA 5LLDA 3CY6A 4KXUA 5AJWA 3EXFA 3G85A 5B7PA 4W5OA 4RSMA 3ROPA 2W5UA 1ZJWA 4PLFA 4E5YA 1CUYA 1KI3A 2XQVA 4WXMA 1JHZA 2OCKA 3LQRA 4BP1A 4YCMA 2EQAA 4JX9A 3C7TA 3GLIB 4K2HA 2NU9B 3VR3A 1Q0RA 1Z6AA 5AHOA 1FFSA 2AKEA 1ONOA 4HL6A 4N9QA 1BVYF 2OUKA 1I1NA 1ATIA 1PEKE 3PFIA 3UF0A 3ENQA 1T6ZA 1B15A 1TGYA 3I01M 5DK6A 5DN9A 4AZVA 7REQB 2O59A 3OD1A 4IUCS 8MHTA 3BGOS 4A92A 1S8AA 2R6HA 2W2LA 1I94B 3TIGA 1HQDA 2PHZA 2W8BB 4XWKA 1RHJA 2VQDA 2WNIA 5H3HA 2PJRA 4YR7A 5EKSA 3I2YX 4LJKA 1E6WA 4QDJA 4UNIA 4DCJA 4KPUB 3HCAA 3LG2A 5BXYA 1CFZA 4GX5A 3D4BA 4IO0A 4UCXA 4KLAA 1TLTA 3H3XA 3ZWXA 1XC7A 4YO7A 3X1WA 4CFZA 5MFZA 4P22A 1L2TA 3H42B 1H2XA 5JJBA 2Q1WA 821PA 3ROGA 4S3MA 4MCIA 2CMKA 1ZSNA 2VXOA 3EX7C 4Z99A 4BC0A 1UEIA 3OTGA 3VA7A 1U0RA 4CL3A 3OE4A 4LECA 1VSQA 4DABA 3LQ4A 5DW3A 1KY2A 1Y9ZA 3K70B 2ODWA 1QUFA 2NSLA 3B13B 2GD6A 1USKA 1H8HA 3GCGA 4FBMA 4RH1A 1ID8A 3KQLA 4Y2JA 1UXIA 2BUBA 4MV7A 4X6UA 3K0FA 2EFHB 5GONB 1XDZA 3MLBA 5E7JA 2JLXA 1N77A 3NM6B 2BYTA 2VQ6A 3TI7A 1C14A 1ZRSA 3TAXA 3AY7A 2ONKA 2R8ZA 1EZ1A 3L79A 5DYWA 5KHLB 3ADCA 1KMIY 1PFGA 3BJIC 4QYWA 4GYKA 2Q4OA 4WASA 5IXSA 3T7RA 5DT2A 1WPXA 3GN2A 1EFLA 1UP6A 2BF7A 2IPNA 4F2HA 3RGWS 1OXMA 4RC9A 1Y4DE 4NV1A 4KOEC 4LF8B 4D98A 1QO0D 3DMTA 4AN4A 2H65A 2XQKA 3C1TA 3OBBA 4LJLA 5FWXB 2CEKA 4I5EA 3ZDAA 1KXZA 1VJDA 4F38A 1RYFA 3PG5A 4ZQIA 2G9VA 1YA6A 3PWKA 3CO0S 3HB5X 2VRNA 2XXBA 4Y1GA 3T5GA 2VTKA 3ZN2A 3ZWOA 2CLSA 1XKTA 1L5OA 3OLWA 2R96A 3T35A 4Q4JA 2AI1A 2RGDA 1C5KA 2P2YA 2Z4SA 2XE6A 4GHWA 2IS4A 3JZMA 2QR2A 3P9QA 1G5FA 1WG8A 2Z04A 3KQOA 1W59A 2HL6A 4HB0A 4RVHA 1LVUA 3FYHA 3VZBA 5HX7A 4UZEA 1JEYB 4QGSA 3GH3A 3JQAA 2VTEA 4I36A 1UP7A 3NBZC 3AY3A 4MW4A 1RZRA 2O7RA 1NL3A 3SNKA 3SFVA 3TBKA 3LRTA 3R7NA 4CEIB 1LF0A 3PDCA 4FW8A 1CJKC 3E9ZA 2ZTUA 5CLHA 5LFAA 2E85A 1OI4A 4TQGA 4I1SA 5FPSA 1Z34A 2AOUB 3THRA 4DSTA 1PS0A 4OKNA 2DE0X 4QWMA 1YS7A 2ZATA 2ZIZA 3P20A 4CM4A 2GXAA 3O4VA 3ZDYB 1MDFA 1SBIA 5DTIA 4KAAA 2HMWA 3VNVA 4D57A 1Y8QA 3CH7A 3CW8X 1WUHS 2J32A 1YRWA 1WF6A 3E5HA 3O1IC 1OIVA 4M0LA 3THOA 3U9TA 1N33B 1FP4A 4WNAB 1UADA 4ZI2A 4LV6A 3WGNA 2F17A 3QE0A 1RZVA 4NE2A 3WL4A 4J2TA 1YU6A 2I6QA 2GPBA 3CURA 4BATA 1XZMA 4J07A 3ITEA 3O4HA 5CFOA 2W6PA 4UW9A 4UCFA 4WECA 1ZBQA 4Q4DA 3LPCA 1COZA 2ZIGA 1OHHA 4PINA 1YKGA 1XDUA 1YUNA 3KRTA 3HXKA 1V1MA 3VR3D 3H17A 1R4NA 1ULUA 3L06A 4I1IA 1CG6A 1IC6A 3EMVA 3FR8A 3CXUA 4UE6A 4Y2VA 4BTEA 1B1CA 1C9DB 1IN4A 4HFMA 4TMWA 4F45A 4Q3NA 2QRGA 4RABA 2FKNA 3HDJA 1Z8NA 4LZPA 4MKFA 2FJPA 4DV4B 2D1TA 1TUIA 1UPFA 3JTEA 5KQLA 3PCXA 2W2LD 3D0OA 3BRQA 1GPWB 1P5FA 4F6RA 5HM6A 4HFRA 5KYNA 3ROTA 1FDWA 4XTCS 1HT2E 2WFLB 1G8KA 4OP2A 1Q92A 3OHMA 4RY0A 2XNSA 3VR0A 2YZMA 3GQBA 3COJA 1XRNA 2HA6A 3K70C 4CUJA 2CKDA 3IUPA 2ODEA 1ZU4A 4P38A 4HZUA 1JAXA 5KJCA 3JQ8B 3T5CA 5AJTA 1J7JA 4MVJI 1CFJA 2VT3A 4QE3A 4ZDKA 5BSGA 1M1UA 1WPGA 2IEZA 2GAIA 3HS3A 1DSSG 3OU7A 4B44A 4XQEA 2V3CC 2DTEA 5AVZA 3ZE9A 1H8HD 1IK6A 2C4WA 5TR9A 3T7TA 1JN0A 2OFOA 2I1LA 1UM8A 4AVYA 3HKDB 3ZHRA 2ORIA 2CFCA 4XQCA 3DDZX 3SDZA 4MWTA 2VRBA 1MUUA 4LSWA 3FOCA 1FX1A 2L82A 3ELYA 4IIJA 4X62B 1ISMA 4YRRA 3VX3A 4F9TA 1HGXA 3KD2A 1A77A 2YIJA 5H70A 5KVQA 2B6HA 2PT9A 1UFOA 4OMFG 3Q3IA 4DEYA 5GTDA 3QVOA 4G4IA 4FCCA 2P5TB 1IY2A 2AE2A 5JPCA 3FOFC 2JIZA 3AF2A 2PJDA 3FPKA 5EZYF 3OCXA 1JQBA 5F73A 1ESCA 1A9SA 3GUHA 2NXCA 4NE9A 2Q8NA 2DBVO 2H63A 4O33A 3PQEA 1KORA 5G3ZA 5LOVF 2R87A 2X5OA 1W6RA 5KTKA 1ZVQA 1BU8A 2BDEA 2IQ5A 2QTVB 4P92A 4US2R 2QW1A 2ZUBA 3I5UA 3KHUA 4AYXA 1DCFA 1E7MA 2HK9A 2O6LA 3R40A 4HLDA 4J76A 2F43B 5E7IA 4EJMA 4HWKA 1NDUA 4KDEA 3WA7A 1ZGHA 2NIPA 3GFSA 4JP3A 1WCXA 3CNHA 2PPLA 2OMKA 2VPWA 3P9YA 1NU8A 5CDSA 3H3FA 2R66A 3E0XA 4FOLA 1KTVA 2JHPA 4PIPA 4B32A 1PDVA 4IRUB 1Z3CA 4MQEA 3K71B 2BFOA 2VDWA 2GCEA 3OZXA 5F1OA 2PWBA 4Z8XA 3AJ8A 4DLVA 5DK4A 1V5IA 3JQAD 4V02A 5EHNA 4BRZA 1SCKA 2QTMA 3AUKA 3DSRA 2GBLC 3RS2A 4AKSA 3JX9A 4MINA 5J4VA 1RZRD 4QPZA 4ID3A 2B20A 4ES6A 4F3KA 3OWOA 4BX0A 4EB8A 3S5UA 1EBBA 1KEZA 2WMOB 4RZ3A 1UQTA 4AUMA 3PWZA 3FZEA 3UFXA 1KFEB 2NP6A 4N0QA 1V26A 3PV0A 4QASA 1ISSA 1NI5A 1LZKA 1KFKB 3O4IA 4NZZA 4R51A 4W1SA 3WGGA 3WMXA 4DF3A 3Q3EA 3UHOA 3EWAA 3FNEA 1X13A 4IS3A 4X0EA 6YASA 1AA6A 2DB3A 2H7XA 3S2EA 4J0JA 4DEVA 4PIMA 3P2KA 4Q4CA 5KQGA 3IDOA 4RPIA 5E6RA 1W85B 1X77A 1WQ4A 3W5HA 4C5BA 4O59O 5EHQA 1IVYA 3L1IA 4CLDA 3TTSA 4AULA 1JDSA 4KGXA 4PLTA 3WQSB 5L95A 1OVMA 3FYDA 3RTDA 5JOQA 4KO2S 3NOQA 4DLAA 1IZYA 2O2HA 3ENZA 3SZOA 4JVSB 1IBCA 1UMBA 1ZG3A 2QPOA 1FZTA 5BQPA 3GPCA 1UDBA 2JBAB 4DIFA 1Y1PA 4LIPD 2DCUA 2R7NA 1OHHD 1NOKA 2Q49A 4EKYA 1XCLA 1JJAA 3KKNA 4G1FA 2J59A 3SPXA 2HQRA 3Q2KA 2YWFA 1LBTA 4GGPA 3BE4A 3KJEA 5FWYA 4FYYA 2EARA 4XR4A 3ZBTA 3L05A 3FPLA 3QKRB 3PPIA 3BTOA 4KQJA 2G9QA 4QEZA 3DLHA 2WT4A 3CLUD 1SD2A 5TPWA 3E35A 4IMRA 1T1EA 2EJCA 4B83A 2CCJA 3M7IA 3ONFA 1E0JA 3Q9LA 1PT5A 4DAOA 1TUGA 2O8CB 3WRXA 4NMLA 2I3AA 1JFTA 3IUNA 2EKBA 1JHUA 3VJKA 3L6CA 5IF9A 1KPGA 2Y1KA 4EMUA 1V11A 3LC7O 4A2CA 3QM1A 5B6PA 1XSEA 4LJYA 3ICQB 1CC1S 1NJ1A 1W36B 1YDHA 1JHPA 1U8CB 2B8JA 4MO9A 3E4CA 5I7AA 3DBRB 2Z3ZA 1IXRC 2PBRA 3BXGA 5C8ZA 2BGIA 1QRRA 1G21B 4Q4AB 3UNXA 3WMEA 1Z06A 5AUOB 2IH4A 1C81A 1BE1A 2J5BA 2J5XA 3SI7A 1WUTA 4BRSA 3FUXA 1ESEA 1YJXA 4OYLA 1DARA 4CKBA 1PT7A 3UXHA 1GVNB 3ENVA 1T26A 3UFBA 5FOQA 4IY1A 4MQBA 2E49A 1WHTB 3LQYA 3MSXA 4HTFA 4JU8A 4NKRA 4DIKA 5EJ4A 3OMWA 4QDTA 1P1IA 5ALOA 1DIGA 4CZ2A 1BDHA 1KI9A 1DC7A 3EW9A 1WA5A 1Z6YA 2OLJA 2VAXA 2YINC 4TV9A 4HF7A 4DUZB 1PJZA 4UHBA 1R7RA 1E7YA 2OD7A 2WJ3A 3EXIA 3F8WA 1THTA 2JIZD 2JA2A 4KTTE 2EDCA 1HYGA 4X24A 2JIRA 2ODPA 1S5PA 3H8VA 5KQRA 2NP7A 4CCSA 1MVOA 3OX1A 1JLLB 4YVFA 1D09A 3GDOA 1Z0FA 2EWVA 3F5MA 1U9CA 1XL1A 3NIBA 4JDUA 1DTSA 4Q3AA 4Q9IA 3T4PA 1VA5A 4Y8VA 3GEIA 4OA5A 1YE8A 4UU0A 5DM2A 1CPYA 2I8LA 1X86B 4OXRA 1UCFA 1KYXA 1TYEB 1YRQA 4U9IS 2WHEA 1YFJA 2WWYA 4FOSA 5LYJF 4X92A 3OCJA 3L6BA 2A9RA 1NW9B 4OU4A 4UMFA 1RKUA 1JQEA 4LY6A 2AKYA 4M0FA 4XPZA 3M81A 3W6NA 1E2QA 1YI0A 4R0VA 5LN1A 1KQGA 1F7UA 3AF4A 1UOEA 3D3QA 4DTIA 3J80A 4G9BA 3U13A 2OO5C 5CFLA 3WB2A 3WBBA 2ADFA 1HA3A 3CRW1 2IYNA 1GGVA 3BWXA 1D8AA 3RVJA 5HP4A 1LW7A 3IGFA 3TQRA 4RD4A 4P08A 4J6EA 3WR5A 2MIIA 3VJLA 2C8JA 2DKNA 4ARCA 1IJFA 1Z8FA 1XXHB 2E4YA 3N59A 1DQZA 3QU5A 4Q4LA 1W2GA 5E9WA 1PLLA 1CJBA 2BR4A 2NX2A 3CLKA 4IJQA 1YI1A 3WWDA 3GZTB 4MWOA 2R751 2ZR0A 4NZPA 8OHMA 1G8YA 3TXXA 1X1RA 4OQPA 3ZJTA 4KK3A 1PR0A 2FCRA 3ZE1B 2B92A 3B53X 2B1RA 1LDMA 3IE2A 4U7HA 4DW8A 4NCIA 4QO8A 4AJNA 4DLKA 1AIPA 3O38A 1C30B 3FH0A 3WYFA 3ZE6A 1NBME 3KEOA 3DM9B 2PS3A 2CMDA 4R2XA 1PFVA 3TI9A 1OXXK 4ZTUB 3MQ2A 1E92A 3NWJA 3I2KA 1Z4NA 3MEQA 4KMSA 1XVIA 4YASA 2JFNA 1SBZA 3GC6A 3RUPA 3KS9A 1TLLA 3PI7A 5D87A 2CNNA 1QPGA 5C35A 2ZAYA 1PK9A 1WDMA 1Z8DA 3DLCA 1IG3A 3M34A 3QPAA 1YQQA 2OGWA 3PUYA 1FA9A 1FYXA 5DBHX 2VSYA 2OFXA 5MHTA 5KWJA 4GXQA 4AY2A 2M2IA 4M87A 3TD9A 1VPVA 5JIBA 5EY5B 3V4RA 4C0BA 3U60B 3BE5A 3KZKA 1MF7A 1NRXA 2C61A 4DBLC 1M2OA 3KIPA 2OV2A 2VQ3A 1KXJA 2FMUA 3MELA 2DUWA 4HNRA 1W36C 2YHUA 1EDOA 1KH3A 1Z6XA 2AEFA 2EX4A 5C80A 3E3NA 1ZRNA 4MKRA 4LYYA 2ZYTX 5DHSA 2DAPA 5ELXA 1QHYA 5JS6A 3MG9A 1JR2A 1XEFA 3V48A 1IEWA 3LFTA 3WIUA 3RADC 1ZY2A 1PZGA 4WK4B 3CQ9A 4QYXA 4LOHA 4JD5A 5CP8A 5IAEA 3BFKA 1MEEA 2RGBA 5AK4A 4IV5A 2YFKA 2COKA 2ZS8A 4MI3A 3L82B 1UL1X 3NOXA 1KEKA 1R3UA 3CWCA 3NBYC 4Y18A 2CV1A 4OQZA 4LFAB 3I23A 4C3ZA 7MDHA 2G6TA 2VLIA 1LTQA 4UVEA 1VYTA 4NEQA 4Y7CA 1OFUA 1PHPA 4XQ9A 1O1YA 2IIQA 2C2WA 4UVGA 3W78A 4QHTA 1XI2A 2D00A 5BR8B 3RVNA 4EF4A 1QLJA 2OGSA 3I9V1 2XXAA 3BDVA 1A4IA 3HU3A 1S4QA 5BT9A 3ZBUA 4I3GA 1OPXA 1C7EA 2WU3A 3EIWA 3LD9A 4YJDA 2H2FA 1ZQ1A 1EB9A 4W7HA 2ZRKA 5J63A 3VR4H 1VLMA 4A6EA 2OBNA 4JJ4A 2Q7DA 2JK0A 2P11A 1JT9A 1KK2A 4M53A 3IERA 5ADHA 4JI7B 5IWCA 3IEPA 4L0QA 3C8UA 4C30A 4RKFA 5ENVA 3WDKA 3FPSA 5IPFA 2Y92A 1QNFA 1BWPA 1CP2A 1LBEA 2PLWA 3G2IA 3O7MA 4RGBA 3SQLA 4BB9A 4DSZA 2XVXA 2WJYA 3TEMA 1Q0TA 1NVVR 3KJNA 1OLOA 3GCXA 3KLPX 3KZ1E 2WA1A 2B2XA 4QX6A 1VRCA 4BFZA 3JVDA 5KU7A 3SZUA 4K9DA 1YCGA 3N8GA 4PS1A 1Y6QA 4K9KA 1ZUNB 3J81A 1JBEA 1FNSA 2A5DA 1CKEA 2JHAA 3FYUA 2PX6A 1MA0A 4YCNA 2UV8A 4FMCF 3HXTA 2EW1A 1DWOA 2X86A 3L4SO 1D4AA 2GXUA 4URHA 1YBVA 2FX5A 3CXRA 3VYUB 1MABB 3Q0EA 4HUQB 1JEAA 1OZAA 3IAFA 2R7LA 3Q1KA 3Q5DA 3KPWA 3SJUA 3QSYA 4JL8A 1BN7A 2BTEA 4C20A 5DM4A 3EZFA 4R8KA 1ISJA 4BRWA 3WJ7A 3ZWDA 2NO6A 3D8NA 4QZVA 1Z2OX 4DLLA 4JBXA 1TTHA 1VJ1A 4LHWA 4I2NA 5DISB 3CNNA 4XWOA 3PFGA 1KHHA 1YDMA 3KKEA 2EX0A 2WAXA 4FE3A 4KN6A 5EP1A 2XLCA 3HFGA 4U7TB 2Y1XA 1ZM3A 4TWJA 5BSUA 3ESAA 3F6CA 2O4UX 3GEGA 2CSXA 3VHXB 1DB3A 3ZE7A 3JAWB 2AV6A 2X3UA 3H6GA 4RWEA 3HM2A 4ZRNA 3AZOA 5BNWA 5B4VA 1E3LA 1VXRA 4BECA 4PFQA 3GNQA 3JQPA 4OGWA 5DE3A 4H08A 3KSZO 2FEKA 2XB9A 2XTJA 2FRVA 3TPZA 1LV8A 2QG9A 4LQLA 4D8YA 2W0MA 5I7WA 3NDBB 3KXIA 3UAZA 2AOTB 2JGAA 4F7DA 1FS4A 2VAPA 1HDOA 2NU6B 1DC6A 4NBKA 3ZNOA 4BVGA 2P2DA 4TUYB 3H5TA 3GCDA 3DEKA 2Q5QA 3GLGB 1Y8ZA 1WZUA 1Z4LA 5KQMA 1FS5A 2X2EA 3U4QB 1HDCA 2YJNA 3MUEA 4RKEA 3MCVA 3FCEA 2OECA 3THYB 1EP9A 1RPTA 2QV0A 2GLXA 4ETWA 3KTAB 3NNDA 1HE3A 1C3LA 2RSLA 1GM5A 2YMLA 1S2IA 5AM0A 1S8NA 2WIBA 2FNAA 1AK2A 1Z3IX 4M1YA 3U09A 3BK2A 2X0IA 1WUKS 2Y0BA 3MD0A 2Z08A 1B8NA 4RF3A 1F0KA 1B23P 2CCKA 1K8QA 3CV3A 1OYWA 1RXIA 2E55A 4OH7A 2WKSA 4LYDA 2AMJA 4OHZA 4D96A 1VXOA 3DBIA 3SQNA 3E7XA 4IXWA 3DO6A 1VSVA 1VKNA 4UUAA 1AM4D 1Z4PX 3A32A 3GEPA 1ZXBA 3PJGA 1FSPA 4G67A 1FQJA 2HU2A 2A0YA 4FFPA 1CY0A 3IV9A 5A9TA 3S29A 2X2PA 3UMCA 3CKKA 1TM3E 4MGHA 4BASA 3AW9A 3E7WA 1PD0A 4GIBA 1KHTA 3OFKA 1YJAA 4NTZA 4L75A 1U3FA 2C2YA 1K68A 4GE0A 4BCDA 5JH7F 4XWGA 1RLJA 1EDZA 4P81A 3RV4A 3SHTA 2QMUA 1JIQA 1LPNA 4OIMA 3VZDA 2ATEA 3WK7A 4EUHA 3NRJA 3VO1A 3B5IA 5EZ5A 3I05A 4AN1A 1IZZA 1SD5A 3T9CA 3ZJ4A 1YA8A 2D7DA 2PUHA 4Z4CA 2ZIVB 5GVSA 1ORVA 4AB1A 1UKAA 4IJWA 4IRMA 3V8NA 4WH0A 1OX5A 4K7JA 4WPGA 3CKLA 4E5MA 4QTZA 2D2EA 4Q05A 3UW3A 2CE7A 2HIGA 4W7IA 1GU1A 2VTVA 3TE6A 1ZNYA 3COSA 1Q7TA 1EFVB 3K9CA 4MRRA 3EIOA 1EFDN 4YWJA 1ZW1A 3VBCA 5A9RA 3F7MA 4A2QA 4QGAA 3LT2A 2C8VA 4CCWA 2D3TA 4WVLA 5IYZB 1GCAA 4G81A 4TRNA 4YPOA 1X3SA 3P0HA 3H9BA 3QUQA 4ZGGA 1G9XA 2EFYA 2B4KA 1C8LA 4YYZA 1AQLA 1EFHA 3WB0A 3UK1A 1ZVKA 4W5NA 3PDJA 1EWTA 1JWAB 2VBCA 3GFVA 5BVGB 2W2XA 1BH6A 4O4JA 1RC0A 1U2TA 3FPBA 3FWHA 2OQVA 5K8VA 2VIIA 3GLHA 2VSOA 1WCV1 2VJYA 4IIUA 3SMVA 1MTZA 1Q83A 3WIOA 4YJGA 3WWEA 1DFGA 1E2UA 4RX1A 3DNMA 2A9QA 4A0QA 3IA7A 3CSDA 2YCLA 3GHHA 3X1JA 2MSCB 4JXZA 4ZO9A 4R2WA 3NHLA 5BYAA 2AXEA 4X93A 5IMSA 5REQB 3C3EA 4F1WA 3HM9A 5FWDA 1GCIA 1H6BA 3RTEA 1O5TA 3LLUA 2YDYA 3M0EA 2BW0A 4GOOD 3JV7A 1A8PA 3QV1A 2OESA 3ROFA 3ANYB 3ORHA 3FR7A 1UBUS 3DZDA 3EMKA 2PKQO 4L95C 4MLDA 5I3CA 2PZJA 3S55A 3WNCA 4YTEA 3D3WB 4UHHA 2WP8J 3MA0A 4W9NC 3DHNA 1W35A 1X9GA 2R4UA 2YVQA 4WOPA 5ITWA 1NUQA 4Z3KA 4QULA 4QFBA 3EVBA 1HQKA 1YL7A 3GEHA 1EA5A 1MTOA 1TAGA 5DTRA 4A10A 5GPBA 5M2QA 3DAHA 3OZDA 1WW2A 2FDXA 1UK9A 2G70A 1ML4A 4CM7A 3WLOA 3C98A 4MRPA 2ZBVA 2I4IA 1EK0A 1MPTA 4JWKA 4AUNA 4B3RB 3NB0A 1W93A 2WP0A 3ZU2A 3GLKA 2ZIXA 4QUJA 3QH4A 4S35A 4RUKA 3ZCSA 4C0JA 3GP8A 3FKSA 1ZC3A 4LRTB 1KETA 1YJ8A 1ZLYA 2VT2A 3S40A 2DPGA 4UBKA 2Z4RA 2GCOB 1O8BA 1P8JA 1GPH1 2YNMC 1M6VA 3GVXA 4IG9A 1VE5A 4ACBA 4KN9S 3WWZA 2QQ0A 1Z5ZA 4F4JA 4JV5B 4ARAA 2FSSA 4PRZA 5GMOA 2F1HA 4BXOB 2B8NA 2IIPA 3T1YB 1WB6A 4NPHA 3WAKA 5HQTA 2QL9A 3C5WP 1H4SA 1IMOA 2PXXA 3ICEA 5CB4B 2QN7A 4QUAA 1N2CA 5AUQA 3AI2A 3T5MA 5LL6P 4ESEA 5SV2A 3N8NA 1N36B 4MWSA 2AD1A 3W3ZB 3OCCA 3IUQA 4M0PA 2YH2A 4ZYYA 2H3EA 4V0MA 1X0VA 2XD4A 3H8SA 2QEQA 3NP7A 4ON9A 3RRMA 1Y5MA 1H2RS 2JLWA 4KN5A 4M76B 3R1IA 1YZLA 3D81A 5CLLA 1CBUA 4YECA 4AMYA 3E2PA 3ESYA 2VPPA 1YE5A 2IYYA 1ADJA 2X9LA 1CY7A 2VG8A 2AMYA 2PBLA 4FZJA 4EEZA 1Q2XA 4G6ZA 1GKUB 1WABA 1PR5A 3SXUB 4D9EA 5D3KA 1L7XA 3ZWYA 3BMOA 4GYWA 1M8JA 2C8KA 4Q66C 5JDIC 4KXMA 2P8JA 1T5TA 4KO8A 4RCZA 4YMTA 2CUZA 1XFAA 2ORED 3UJPA 5JADA 3FA2A 1EX9A 4PO1A 4I8XA 1XZBA 3LUKA 4CL2A 3GW8A 2NPFA 2J08A 2C5FA 2C96A 3P8ZA 2XJ9A 4I4IA 3RIXA 3KT0A 1MNQA 1RLUA 1OTHA 3QU7A 2FQWA 4ZZIA 4Z9YA 1OBHA 3IVGA 4XLZA 2X4DA 4INOA 1QG6A 4KUHA 2CSUA 3VZQA 4HQRA 4HR7A 2DM6A 3U16A 3BORA 2C2OA 2PKYX 1KH2A 3E05A 4TXNA 1UK7A 4B0OA 5ICFA 4CV2A 3EDYA 1Z7BA 2G82A 2TSYB 3KB6A 2OENG 2F62A 3QJYA 4LJ5A 5EE3A 3INGA 3CZRA 2A1UB 3ST7A 1LDNA 5CPFA 2BMVA 3BMNA 4FGJA 5J2TA 1AKYA 3G2HA 1XMSA 2CUNA 2X5XA 3R3ZA 1R3DA 2ZPUA 3DT6A 2PM8A 3G9XA 3P0EA 4Z0TA 3WI7A 1DC5A 1SKMA 3HCCA 1JDUA 3LKBA 1RFGE 2M9MA 5IFKA 1ZS9A 4KDCA 5AVJA 2JLRA 2PUVA 4XWTA 5DLYA 2FQXA 5LMNB 2H31A 4YRJA 3FI0A 1VQ1A 2PJZA 1VBMA 1SHTX 3IBTA 3FF1A 2AG0A 4MVYA 3RB8A 3GF4A 1VZ2A 3JWIA 2AF4C 2JPDA 3DBOB 1PX0A 3TZKA 3DMNA 1Q3KA 2G5GX 2QN9A 3N2YA 1TU4A 4HNHA 4YAWA 5LZ8A 3TL2A 5LXTA 3TW8B 4QNNA 4IUBS 1KE2A 3CTMA 1L4NA 2BTQA 1N3BA 2WWGA 4FYPA 1XBTA 2ZDQA 3C45A 2YCBA 4GH5A 4RXUA 5IAJA 3W9UA 4DPMA 4GWKA 1FJ2A 4PE5B 2JZNA 1GUYA 1OZ0A 1UOQA 4LOJA 2AN4A 2Q9UA 5GQSA 2BMWA 3JASA 1MU0A 1G0NA 4RDIA 3VPXA 1VBFA 2V45A 1OZGA 3AVWA 1PGJA 5C4MA 3UQZA 1BW9A 1CEQA 4F2WA 2XYPA 3AB8A 3LGAA 1MRZA 4UUBA 4U6NA 4FM9A 3MMXA 2E9SA 2FW6A 1P1BA 4FPXA 4O5OA 4ZT2A 2ZBQA 2ZSDA 2AYYA 1MOPA 4I2VA 3ADKA 3QGMA 3IOCA 4JI1B 1A9PA 1M2EA 3KB2A 3DVQX 3TTXA 2K7ZA 4BVAA 3N3AC 3N58A 4GLFA 3SC6A 3FKSD 3UG6A 3KL4A 4G56A 1SM4A 2L69A 3AKDA 3QLUA 2H2HA 4EUSA 1DAKA 2G8NA 3Q85A 4IZOA 1FMFA 2OV3A 3WBJA 2VPQA 3MGBA 2G77B 2CFSA 1MQ9A 5AW9A 1U6IA 2BUCA 2XZDA 4IIEA 4NY1A 4DUGA 3AVTA 1P8AA 1TC2A 2JVIA 3UTCA 5L3SB 2VUIB 4XSGA 3TLGA 1VPLA 4JR1A 2IUTA 5FD8A 1Y1RA 1F3LA 2IYSA 4BQFA 5ISMA 1H85A 2HTEA 5A0TA 4Y7DA 1XKQA 3K8YA 3GFPA 3RVKA 3CRQA 3RHSA 5LJLA 1B6TA 5FTJA 2NPIA 4IDAA 4MI1A 5FTLA 5FTKA 3NNNA 3TVTA 2E4AA 3NUGA 2PQ0A 2WVGA 1PG0A 2PCLA 1E18A 3ZCXA 3G59A 3LJKA 5TVGA 1WZNA 4BFWA 3FSEA 3NH9A 5M3BA 3OIVA 5DKFA 2M6RA 3UAXA 2BLLA 1R0LA 4JP8A 5FI1B 1U98A 3K4PA 3VC3A 4DG9A 1FW8A 3H7IA 1EINA 4UAUA 4BZQA 4CF4A 3GCWA 1RWVA 5EPEA 2N46A 4TRJA 4YRIA 2XWSA 2ZE7A 2EL7A 1B4DA 3GFQA 3GRCA 1N5RA 1PS9A 2JJYA 2ZJ4A 4HP8A 3KUDA 4N5NA 3USZA 4WZZA 3CISA 2H1SA 2P2SA 4KLRA 4ZQEA 4AS2A 1PL6A 2CUTA 1UWKA 3EVDA 4NDNE 1AUQA 3VYWA 3ZHBA 1ZMXA 5E8RA 3IKTA 3FROA 1EFCA 5FXMA 2QUZA 3DWIA 1SHZA 4DLUA 2ZTSA 2A67A 1A8QA 2V7XA 1U0TA 2R86A 2WTXA 3MWLA 3QITA 5T6MA 4AY3A 1WOMA 2X0KA 1O97D 3OZSA 1DRJA 4MVJA 1Y5LA 2CLCX 3OOYA 4OB8A 3MAGA 2OR3A 3NM4A 4QPPA 5G0WA 2ST1A 1K6EA 5J3JA 1JDJA 1UDWA 3U4IA 3RK0A 1DOZA 5FPQA 3ZW8A 2BMDA 4GXTA 5CUQA 3QVVA 3OY7A 1FUYB 4DHEA 1FFAA 3G23A 4NULA 4GECA 3TQFA 1YB6A 2A5GA 3PGLA 2GERA 2H4FA 1D0VA 1UKBA 3SVZA 2BGNA 4MKZA 1H5NA 3AKZA 1SMKA 4GBJA 4M9UA 2ILVA 3ABOB 3E53A 2F55A 2RHLA 4B76A 5CDTA 1FS6A 2PL1A 4J1SA 1GNLA 1VTKA 3LW8A 2O54A 4GPIB 1V9CA 2Z9CA 5I4IA 2Z6UA 5EJFA 5T64A 2J6HA 3PIDA 4QUKA 3ER9A 4CW7A 2EJTA 3JWJA 3MHPA 1POXA 1T5IA 2FDRA 3HA5A 4GI3A 4KE7A 3F3SA 5K0JA 5LM3A 1JVNA 3MXOA 3NTQA 1K86A 4IKPA 3TDNA 4B6QA 1CQPA 1G1AA 5FEUA 4OHCA 4JLOA 4LHYA 4JCOA 3CN9A 3OPMA 2R85A 4UM7A 3EXEA 1E7WA 2HJSA 3JSXA 5L6LB 1E99A 1I2MA 1DKNA 1J8MF 2W9XA 3A31A 5C31A 3D6VA 3H2JA 3HB4X 4WK2B 2FF5A 2PX3A 1W5TA 1REQB 2HSGA 1S1CA 3AERB 4IH9A 1J25A 2EU8A 2AMFA 3BCHA 3CX4A 4NBLA 4NJEA 3V2IA 2MSKA 2QF7A 4ND5A 4P54A 5CB8A 3HVIA 1I80A 1FUIA 2ZGVA 3L84A 2BSQA 1L7VC 4N8EA 1IAQA 1LZLA 2GBGA 3I9MA 2B9VA 4PYMA 4XJVA 3JZAA 4B6EA 4B2YA 4CQLA 5E9AA 1M6HA 2GWRA 3GPIA 4MMZB 3TD6A 4GR5A 5FUWA 1JHDA 3TNDA 5SZIA 1JFFA 3PYLA 2I7VA 4JLBA 1LY1A 2QQ5A 4DG8A 3TR0A 4ARZB 4ZHQB 2EV9A 1NVBA 1SQ6A 1CQIB 1JJBA 3EMBA 2PD3A 5TT1A 3FZQA 3LUBA 4M6WA 2PT6A 5IKPA 2G5PA 1SA0B 2HHCA 4PHGA 3REOA 2ODQA 3ZXYA 1P7WA 2AR7A 3IPLA 3MCWA 2FG6C 2H7VA 3K2IA 4KQKA 2CLDX 1WP4A 2O2YA 4M46A 4V0NA 2IZ0A 3T54A 3TUIC 3EUWA 4DUGD 2R60A 4PZCA 3TAHA 1ZOIA 2Q9AA 3ZHYA 4RANA 4D9KA 2HTFA 2K7FA 2V7QA 4HO1X 3M1YA 1ZJ4A 3UPUA 3GFOA 4QTTB 2J0VA 4OSPA 3B5EA 5JFOA 1Z4KA 1B8PA 4REQB 1J9EA 5EWJB 1IJKA 1DLJA 2FPRA 2DECA 2QW8A 3I4FA 3RNLA 2RD2A 1OXVA 4A3SA 4B4UA 4J0GA 2GZ2A 2I87A 4GX1A 3RSOA 4MQFA 4BUJA 1IQUA 1Z35A 1K97A 1ADGA 2ZQZA 2B6NA 2LBPA 3QE2A 4LG1A 2GZMA 2QV7A 3GT4A 4QICA 1G4UR 3EDMA 3LC2O 5FI0B 1NBWB 3JZDA 4HDAA 4S12A 4WJLA 4MB0A 4J3FA 5L6MB 3JS5A 5IC6A 3NQ41 4FYXA 4ISBA 3F9CA 3RFVA 1Q3TA 1S7CA 4HEHA 3WL3A 4ANFA 2JD1A 4C7MA 4DDWA 2YJGA 3KZMA 2FZKA 2RFLA 1F3OA 3IEIA 1E3DA 3QY9A 4RLSA 2C8LA 3K16A 2ONZA 1T3TA 3CVVA 3ZY4A 1OA1A 2G08A 1T4CA 4CEJB 1U8YA 4OCZA 1ULTA 2F9FA 5DNVA 1G8FA 5SZJA 1YASA 4UHCA 5CJPA 4PZLA 5DXFA 4DY6A 2Y6UA 3AYZB 4M8NE 4ND8A 4DWJA 4E09A 2P65A 4RORA 5BNZA 3A6JA 4M22A 2ZR8A 3KQKA 2RCYA 2OYRA 4NENA 5KCMA 3U3ZA 1BQ3A 2WLTA 1NAHA 4O2BA 3K5IA 1PZNA 3VDNB 1XF1A 2YY6A 4K9SA 3EVFA 4MVJD 5JPDA 4C14A 5LNK6 3ZYZA 1KEEB 3STYA 1U8UA 1CR2A 4JIGA 4URZR 2CXHA 3DPSA 3OZCA 4FNOA 4KHPB 3VR6H 5KYUB 1V5EA 3A6ZA 2OL4A 1ULSA 1P44A 1C0LA 5HK8A 1T15A 1NSYA 5J5VA 5GJCA 1F9AA 1SC9A 3EQ9A 2ZDGA 3MUOA 4OYRA 5TQ0A 3T3HA 4H7FA 2YN0A 3AP1A 3JD4A 4BDTA 2ZCUA 5JU6A 1ZR2A 3C7KA 2EP5A 1KO5A 2IH5A 2OZPA 3V1LA 3QEAZ 1F0PA 5LLTA 1L5FA 4NRDA 5P21A 2R5NA 1FLNA 621PA 1RXYA 1TXGA 2ZKLA 3H16A 1Z7WA 4E5UA 2AZXA 1AD2A 2XB6A 4KH1A 4XIGS 2I91A 3PIIA 5KPJA 3DLBA 3L7CA 4ZYLA 1SVLA 3W1VA 3AFHA 4GO1A 5KX5A 2RJOA 2IX3A 3LY5A 1EUDA 3A6DA 5CDYA 3WMGA 1GTJ1 2XITA 4UQOA 1WVIA 1T0UA 3SF8A 3NVKI 1W75A 3FG9A 3S44A 3A8TA 3L1JA 1I2DA 2X76A 4HRYA 2NACA 4L8VA 5J59A 5KJEA 2Q9BA 4FZ5A 1W29A 4C7XA 4NNPA 4LGVA 1DKPA 2O8FB 4OQXA 1ZMBA 4IIHA 3LSTA 3UK7A 4J0FA 4FOOA 3RC2A 4ER3A 1AGRA 3AH8A 3IILA 4LYEA 3EXFB 5A7GA 4B80A 4C0SA 2C4KA 3IAHA 1HMPA 2CYCA 1KO7A 1R8YA 1F1BA 3DKKA 3E58A 4IL5A 4JLVA 5G3YA 6LDHA 4P98A 4LXQA 3NV7A 3SEFA 2FE4A 4E5VA 1EQUA 3QFFA 3QPUA 3FPHA 1Z2PX 3G2KA 3O2NA 1DRVA 4BLWA 2GEJA 4E1BA 2WJZB 4GX0A 2C9DA 5F2NA 1ORDA 1Z5VA 2I4RA 3DKIA 3LUCA 1L1EA 4EQ6A 1QFXA 1G20A 3GLRA 2QXUA 1EBUA 2JLQA 4RTSA 1T8UA 2Q1YA 3IA2A 2HT1A 2I29A 2YN4A 3D6UA 3CZPA 1Z0JA 1SFRA 5DM70 3T3NA 5SY6A 4XH9B 4ZAVA 5KOYA 1UM9A 1QRSA 4RZXA 2QOEA 4UU8A 3P9NA 4KPEC 1ORWA 2ZWPA 4KMMA 4A6XA 2A5FA 3G5MA 1RQPA 1CUGA 2NZ8A 3PJRA 3A2KA 1PWYE 2V7QD 2PAFA 2XE7A 2PE5A 4GRIA 5MN6A 5M7EA 1XHEA 5TE9A 3PTAA 2JH8A 4NBUA 1G5PA 1Z5PA 3D0RA 1UBCA 5LQAA 1B0UA 1U7UA 5FA6A 2P2LA 3TX2A 3WGIA 4ZV4A 3QTTA 1VLVA 1F8XA 3DEJA 3P2MA 4KEAA 3EJ6A 4F4CA 4FGUA 3OLCX 2ZJ8A 3EAGA 5LZ7A 1PFYA 1XZLA 1ZSVA 1XUOA 3K0AB 3HU1A 4PYQA 4DA7A 3I8OA 4EA6A 4KR9A 4EITA 1JU9A 1XP5A 3H2IA 3K0FB 3B3JA 5CIQA 2HPZA 2UDPA 3ENNA 4QU8A 4RS4A 1JQDA 3BICA 4G0PA 3ZWWA 2RGEA 4D2IA 3BBPA 2E4WA 5DM60 5BUSA 1G63A 4AJEA 2HD4A 4ZHSA 1UKZA 4JS0A 5I9SA 2HFKA 5EI5A 3OOEA 2LKDA 4WLFA 3JYPA 5HCUA 4BBPA 4BEBA 2QTBA 1M67A 1O4VA 2JB9A 1Y7PA 3U48A 1KEVA 2ABWA 2FETA 2HDNB 2FXVA 1Z36A 2P6PA 2KHZA 4NFYA 1DLIA 5CHYA 5D84A 4KXXA 2GFQA 2G5CA 3HWRA 1ZN7A 3U3JA 3TM4A 4BGIA 121PA 5HHTA 1FUEA 3GA5A 3W9SA 5G0TA 5DYIA 4G0UA 2ZRLA 3TOVA 4UTNA 4ENPA 3DZBA 3DCIA 1N6KA 2Y2VA 3OKAA 4TZKA 1KQOA 4Q9AA 3U7IA 4L6IA 5E9JA 4AROA 1JE0A 2OAQ1 3MUNA 1O96A 4UU1A 4LRQA 1YRAA 4C0LA 4U3JA 1QS0A 3BD9A 3D0KA 1TFUA 1CWUA 5C37A 2CGEA 3MMSA 2HRZA 2YWEA 1Z13A 3Q7RA 3QUBA 3PFNA 1GNQA 2IYXA 1NNUA 1RRFA 2JJ1A 2XQJA 1SVKA 4KU4A 1R00A 1YQGA 1Z17A 3JQAB 4RK0A 5TXGA 1LLQA 3RF6A 4WNCA 4DCVA 5EGSA 3TQIA 1LRJA 4WKGA 4XUEA 3TTWA 3TVYA 3KAJA 2BFNA 1JJFA 2J41A 3FYSA 3PT5A 5F7ZA 4CG2A 1KMHA 5KDOA 4H6XA 4WACA 1OT3A 1A98A 5MN4A 1ID1A 1C9MA 1E3IA 2YUIA 1RKXA 3INRA 4GNRA 1M2NA 5JNWA 4Z4QA 3IAS6 1HE4A 4JC4A 4C2TA 3RS9A 2X8LA 2CNOA 4L0CA 4QYMA 4LXXA 2Z9DA 4ASUA 3ZQUA 1NN0A 2W2KB 3CVOA 1Q7EA 4CM4B 2WSLA 1JBQA 4F4FA 1ADYA 1NW7A 2QL6A 2R5WA 1T8YA 4DEXA 5CK4A 4IUYA 2ZI4A 4CN8A 2P90A 3QFSA 3LRXA 4WL0A 2WA2A 4MWCA 4QAQA 2XWQA 1FP4B 2O1XA 3D5TA 5B5SA 4I50A 4YPFA 1JEQA 3M9XA 3FLEA 4DMCA 5EA2A 3V9AA 3RYTC 2RI0A 1RMQA 4UBOA 4ZYXA 4EGQA 3LGSA 1AUXA 1BS2A 5ILQA 4AZ3A 1MENA 4BB0A 4HPJB 2ZB4A 4BKRA 4MV1A 2CXQA 1ZI8A 3E3AA 5BV0A 4EG4A 1E4EA 1YR1A 1V43A 4TLDA 4C9BA 5DDIP 1Z0SA 1V1MB 3NBAA 4CQJA 4BY9E 1R4NB 2A6PA 4B3GA 1VGQA 2E37A 4KNYA 2QS9A 3WGMA 1V6AA 4PAMA 4PSDA 4U02A 5EIEA 4H7PA 3CF4G 3PEUA 3OETA 1KSGA 5HS4A 5BUQA 1JAZA 1P72A 2PO5A 4H1VA 4H0FA 4DC0A 5JTUA 1Q77A 2JS7A 2Y1WA 4HDNA 2OHHA 3R5HA 2C2MA 1O08A 2JFUA 2RC5A 2P3QA 3VSAA 4F6RB 3B1VA 1SQFA 2CDNA 1VE6A 4ZV7A 2XCRB 1OXUA 1SUBA 2BF4A 1CUXA 3P27A 4HRVA 2HK8A 3I6BA 4L9RA 4Z1MA 1YACA 4D92A 1N8SA 1YL6A 4L07A 3ROQA 5KWEA