4YMJA

(r)-2-phenylpyrrolidine substitute imidazopyridazines: a new class of potent and selective pan-trk inhibitors
Total Genus 89
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
89
sequence length
291
structure length
270
Chain Sequence
GIHVQHIKRRDIVLKRELGEGAFGKVFLAECYNLSPTKDKMLVAVKALKDPTLAARKDFQREAELLTNLQHEHIVKFYGVCGDGDPLIMVFEYMKHGDLNKFLRAHGPGELGLSQMLHIASQIASGMVYLASQHFVHRDLATRNCLVGANLLVKIGDFGDVYTDYYRHTMLPIRWMPPESIMYRKFTTESDVWSFGVILWEIFTYGKQPWFQLSNTEVIECITQGRVLERPRVCPKEVYDVMLGCWQREPQQRLNIKEIYKILHALGKAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title (R)-2-Phenylpyrrolidine Substituted Imidazopyridazines: A New Class of Potent and Selective Pan-TRK Inhibitors.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/transferase inhibitor
molecule keywords NT-3 growth factor receptor
total genus 89
structure length 270
sequence length 291
chains with identical sequence B
ec nomenclature ec 2.7.10.1: Receptor protein-tyrosine kinase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07714 Pkinase_Tyr Protein tyrosine kinase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.510.10 Mainly Alpha Orthogonal Bundle Transferase(Phosphotransferase); domain 1 Transferase(Phosphotransferase) domain 1 4ymjA02
3.30.200.20 Alpha Beta 2-Layer Sandwich Phosphorylase Kinase; domain 1 Phosphorylase Kinase; domain 1 4ymjA01
3ZS5A 3GU7A 1W82A 4MWIA 3E88A 4U3YA 5HX6A 3EN9A 3PA5A 2WB8A 5FDXA 4J7BA 4MF1A 4F6SA 4ITJA 4BHNA 2VWZA 3R8ZA 2BFXA 4EZ3A 5J1WA 3LVPA 3PP0A 4EH6A 3LQ3A 3L8SA 2XJ1A 3W1FA 4LRMA 2JIIA 5HU3A 3AMBA 3V8SA 2R9SA 3VUGA 2ZV9A 3UOLA 4ZAUA 5AV3A 2RSVA 4DGMA 1H0WA 3FMKA 5GJGA 1A06A 3RPRA 4AZFA 4U9AA 3HMIA 4DCEA 1SNUA 4C8BA 4RC3A 4QMQA 2WO6A 5AAFA 4AX8A 1OPLA 2YJRA 3CPCA 2GS7A 5LMKA 2B55A 2WQBA 4IB5A 2O0UA 3K5UA 1IRKA 1OPJA 3MW1A 2XRWA 3FMHA 3OT3A 4FV2A 3ZU7A 3RM6A 4ONAA 4KIOA 2XBAA 1R0PA 5C01A 3RAKA 4D2TA 4BBEA 1HCKA 3HA8A 5EYDA 2VO0A 1GIHA 2PZYA 2GNLA 3PLSA 1IG1A 1W8CA 4A4OA 4C59A 2QKWB 5CU4A 1ERKA 1VYWA 4YLKA 2WD1A 3O0GA 1UNLA 5IA5A 5B2MA 2C5XA 3NGAA 5JMSA 3WI6A 2WQNA 4XG8A 3FY2A 3V6RA 4IH8A 4TYEA 4V0GA 4EYMA 5FXQA 3BU5A 3HRBA 2C6EA 1XKKA 3D2KA 3ULZA 3DOGA 5A9UA 5CNNA 2Y4PA 4ZY5A 2PZPA 4ZZMA 3EFJA 3BKBA 4GS6A 3DK3A 2UW9A 2XA4A 3EQPA 2GHLA 3F3WA 2QHNA 1PXJA 3MFUA 3HP2A 4IM3A 4IZYA 2QONA 2C1BA 2C0IA 1XH6A 2GHMA 2J6MA 1R39A 3DK7A 4FV8A 3LM5A 3OY3A 4LQMA 2OU7A 3ZXZA 4X21A 3L8VA 3LCSA 2XYNA 5EM7A 3ZO3A 4DFUA 2BZIB 4FKIA 2W0JA 5CF6A 5HIDA 3C4XA 4D1SA 3H9FA 3QCSA 3KXMA 3F5PA 5LOHA 3KRWA 4BF2A 2FH9A 5TT7A 1Q97A 3LZBA 3ZO1A 4CZYB 5AV1A 2PVMA 3BEAA 4DEHA 4P2KA 3KCFA 4YTHA 5ICPA 3UVPA 3MIAA 4TWCA 4PMTA 2QOQA 4W9WA 3UC4A 2PUNA 5KNJA 4AZWA 4G31A 2E9UA 2QR8A 3H4JA 4G16A 4XG3A 5ANOA 5DR2A 5EG3A 3HYHA 5GIPE 2JBPA 4ALVA 1ZZ2A 4AGUA 4CMOA 5IMEA 2A0CX 5AX3A 2WNTA 4IAIA 1FGIA 3BHVA 4WG4A 1OUYA 3VVHA 4QYHA 2C6OA 5CEOA 4H3BA 3NNUA 4I20A 4EUTA 1H1PA 4ZOGA 1YXTA 4M14A 4CLIA 5AUXA 1UU3A 3PJ3A 4RJ8A 5HE3A 4D5KA 1B38A 3EZRA 1LP4A 4LRKA 3S95A 5D41A 4ASDA 3MPMA 5HI2A 4HGEA 3QD2B 5KMNA 3O8UA 2CLQA 2XNMA 3MVMA 5A14A 3QD3A 1GY3A 3CQUA 3MVLA 4Y46A 1R0EA 5HE1A 4CFXA 4BDJA 2QHMA 3SD0A 5CI6A 4FNWA 3VUHA 3S00A 3E62A 1J7IA 1SVEA 5FTQA 3UO6A 1O6KA 3H0YA 4Z7GA 5DPVA 2EUFB 2ITTA 1BYGA 2XK3A 3D14A 3DPKA 1UU7A 3LFCA 3QXOA 3ZBXA 4XLVA 4K1BA 4D58A 3SDJA 3B2WA 4L68A 3R02A 3GBZA 4JQ7A 4TWPA 4ZZNA 1QPCA 2CN8A 4GMYA 5EH0A 3QKLA 4UWBA 4E26A 1QMZA 3LW0A 4XHKB 3BWFA 4O0WA 3OXTA 3ZLYA 2ITPA 3IW8A 1JWHA 2CHLA 4KIKA 3TNWA 4HVDA 4NJDA 4MEDA 3ELJA 1E1XA 4R77A 4FF8A 5L2IA 2H6DA 4YLJA 3A7IA 4DH7A 4DINA 2ZJWA 3NDMA 3NZ0A 2R64A 3MVHA 3WBLA 2F9GA 5BUJA 5CWZA 3SC1A 4DYMA 2W1DA 4YU2A 5IA2A 5L3AA 5E9EA 2YN8A 4LFIA 2JKMA 1W84A 3TACA 2HZ4A 4KIKB 2R3QA 4PPAA 3SX9A 4BBFA 3K2LA 3BHTA 2WMUA 3DJ6A 5AAGA 2PTKA 2QU5A 2X7OA 4KKGA 4FR4A 3R1YA 3TNPC 3G9LX 5LVLA 5AP5A 2XIZA 4YZBA 4NFMA 4BKJA 5AV2A 4GW8A 5CSWA 4RJ4A 4WSYA 4QTCA 3FL4A 4GCJA 4NKSA 3RALA 1RDQE 3CS9A 3MJ1A 3MV5A 4I41A 3WYXA 3A62A 4DAWA 4JL9A 1XJDA 2ZDTA 4XP3A 4EHZA 5L6OA 2Y8OA 4EBVA 2R3JA 4CZUA 5CS6A 3PJ8A 4XX9A 2VN9A 5D9HA 2Y0AA 2YM8A 4ZS0A 2Z7RA 3HRCA 1M14A 1U5QA 2CNVA 4E4XA 3PG3A 4U8ZA 4HVHA 2QI8A 3W16A 3BV3A 4BYIA 4LL0A 3VUMA 2HOGA 4LG4A 3S3IA 2ZYBA 5CEQA 2I0EA 3KVWA 3FL5A 4QMWA 3II5A 4AN2A 3U54A 3TZ8A 3QTUA 3KULA 5A4LA 4O22A 3ZZEA 4XV9A 3WZJA 3DAEA 5HZNA 3ZDIA 3CQWA 2C5VA 5JZNA 4DTKA 2VWYA 4DLIA 2W5BA 3R8VA 4Y95A 5CEMA 2YJSA 2OZOA 4O27B 1VYZA 3CC6A 4O7VA 2YISA 4FEWA 4OTDA 5AUYA 4O7TA 2W1HA 2B0QA 5M07A 4LUDA 3FYKX 2DWBA 3BHYA 4JIKA 3KRJA 4PTGA 2W4KA 3R8UA 2BUJA 5AP7A 3Q5IA 3MB7A 5BMMA 1MP8A 3FWQA 1YHVA 1Q99A 2CGXA 3DBCA 3VC4A 5BVDA 3DKCA 3RAIA 3JUHA 1JQHA 1WVYA 3ZSGA 5CF8A 4TYGA 2VNWA 3VHKA 3CBLA 5DOSA 4C61A 4B6LA 1DM2A 2WMAA 5L8JA 5HU9A 4BZOA 1APME 1OKVA 4TTHB 4S2ZA 3FZRA 4U7ZA 4YJSA 5I5ZA 3S1HA 4DA5A 1XH9A 2HXQA 2YACA 3L9NA 4EYJA 3QX2A 4F0GA 4KIPA 4DG3E 1WZYA 4RG0A 3TKUA 3DFCB 4L3LA 4R1YA 2XK4A 3KRLA 3LMIA 4NIFB 2BROA 1NXKA 4CKRA 5BVOA 3KU2A 5DE2A 5LMKC 2XJ2A 3FPQA 2IZUA 3I0OA 3D94A 3PPZA 4G6LA 4NEUA 2PE1A 4YZNA 1OL2A 4PNIA 4ALUA 3IQ7A 3NPCA 3R6XA 4FVRA 4YBJA 4F4PA 5HBJA 1FQ1B 1Q5KA 2O5KA 3NCZA 2QOCA 3A99A 2YM6A 5ETFA 3R30A 1PXLA 2BHHA 2C0TA 3TG1A 5AR7A 4F1OA 3AD5A 4GVJA 4GYIA 3COIA 4QP2A 5DI1A 3UOKA 4UALA 5FUTA 4OTWA 4IB0A 4F0FA 5HTIA 4NW5A 4RVMA 5JFVA 4IM2A 3CEKA 3ALOA 4QYYA 3NUSA 5C4LA 1ZYSA 1KWPA 2VTIA 5HD7A 5HD4A 3K3IA 4J96A 2LGCA 3UJGA 2YCRA 4DE4A 1Y6BA 4G3CA 2G2FA 2SRCA 4FEXA 3CKXA 4U97A 5CALA 2DS1A 5F9EA 3D7TA 2VX0A 4I22A 3FSKA 3BIZA 5AUTA 5H8EA 1H1WA 3RHKA 4XG4A 4CKJA 3HGKA 5J87A 1CKPA 1OMWA 3FQSA 2GU8A 4LV5A 1E1VA 3T3UA 5I3RA 1G8SA 2ERKA 3FZOA 5A4TA 4FT3A 3D0EA 5FGKA 4LYNA 5AUUA 2WMXA 3R1QA 1WBSA 4IM0A 3UP7A 5EQYA 4XG7A 5HBHA 4ZEGA 4A9SA 4S31A 5DIAA 3TL8A 4AOJA 1XR1A 2IO6A 1M7NA 3HMNA 3O7LD 4NZWB 4PDOA 4TKSA 4QMUA 4F1MA 3M1SA 3UQFA 2ZM4A 2QO7A 3B8RA 4ERKA 3DKFA 3RAHA 2OJIA 1YWRA 2JKOA 2YDKA 5CAPA 4YBKA 4UN0C 3Q4TA 4EOPA 3AT3A 3QTIA 4D1ZA 3LFEA 2V7OA 5IA4A 2BZJA 3E64A 2WIPA 1P4FA 2XM9A 1GZ8A 4LMUA 3EKKA 5G1XA 2XIYA 3FC1X 4DF3A 2PE2A 5L2TA 3TNIA 2BRMA 2BPMA 2YM7A 3BGZA 2XH5A 3BU3A 3DS6A 2P2HA 2ZDUA 3MDYA 3QRTA 4IVAA 3TZ7A 5GNKA 4ZJVA 3FC2A 4FSTA 4ZSAA 1H26A 4DTAA 5JRQA 4BDDA 5JH6A 5IQHA 2RKUA 4K33A 2YWPA 3CKWA 2EB2A 2F7XE 4WRSA 2RGPA 5AWMA 2R3FA 5DT4A 2W5HA 3QWJA 5CX9A 2GDOA 2EXEA 4M7IA 4PTEA 4LL5A 2ONLC 5M44A 2NRUA 2XUUA 3GP0A 2XNEA 2VZ6A 3GCSA 4ITIA 3MS9A 2O63A 3FLNC 4XOYA 3FUPA 4WG3A 4RFMA 3E7OA 3UPXA 5AADA 4II5A 1KE9A 4DEBA 4KINA 3T9TA 1J3HA 4QP1A 4BCNA 3M11A 3FMDA 4QQCA 4P7EA 4L44A 4O96A 4UZHA 5FBOA 5FTGA 3ZLSA 4C4IA 2FYSA 2HWPA 3VBTA 5BUIA 5JQ5A 1WAKA 5BX0A 3ENHA 5A6NA 3JS2A 4KA3A 5HESA 3RCDA 1YI6A 2NNWB 4OTQA 2HZIA 3Q2MA 1GIIA 5DVRA 4BI1A 3UIMA 1UVRA 4AUAA 4NSTA 3OS3A 3E5AA 3ZRKA 1V1KA 2NP8A 3VQUA 3I1AA 3KVXA 3H3CA 3ET7A 2Y4IC 4AGCA 2Z2WA 3ZXTA 2WOUA 3D9VA 4WNMA 1LEZA 1ZRZA 2R4BA 3QZGA 1F5QA 1OPKA 3KN6A 3OTUA 3P7AA 3AQVA 4IX3A 5ACBC 1SYKA 1ZXEA 2O8YA 2R2PA 3EHAA 5E8UA 2X8DA 3ZH8A 4AF3A 4DFYA 4CGAA 2XK8A 4BTFA 3VBYA 5EFQA 5IQEA 3OTVA 4AXAA 4KAOA 4NW6A 1ZOHA 3KULB 4L43A 4I1ZA 3FXXA 5GJFA 5FM2A 2VX3A 2UZBA 2Z60A 4UXQA 5GZ8A 4ZSGA 5IQCA 3OW3A 5ANEA 4NTSA 2UV2A 4EJNA 1YDRE 4BHZA 2PZ5A 5E8WA 5EI2A 3LLAA 3P08A 5L2QA 4FODA 1WBVA 3EFKA 3MIYA 2BHEA 2WEIA 2PK9A 2XYUA 3FQEA 3PA4A 3LFQA 4W4XA 5T3QA 2PUPA 2VTTA 4EKKA 2YWVA 3TIYA 4PDYA 5KUPA 4FTLA 4GK4A 3O96A 1NY3A 1FPUA 3NYOA 4L6QA 4RWLA 3DKGA 4JG8A 3RHXA 2QC6A 3NIZA 4N4SA 3GCVA 4UMTA 3R01A 5HVYA 4MK0A 5AP1A 2ITXA 1P2AA 3HUCA 2JDTA 3NW7A 2YDIA 5DLSA 5EI8A 4FEVA 5ETIA 2UZEA 2C3LA 3NUPA 4ENYA 5DT3A 1YQJA 3P0MA 2I0HA 1OIYA 5ANIA 5JEBA 5H8GA 4E6CA 4PMMA 2PULA 4E5WA 3ODYX 4ZLYA 3IOKA 4O38A 4EHEA 2C6IA 5JKGA 4NKAA 3UQCA 4L7FA 4OTGA 1GOLA 1JAMA 2VTOA 4D28A 4BIEA 5D10A 3C50A 4FNYA 4GT5A 3FI8A 2RFDA 4A07A 2GTMA 2UZDA 3NNWA 3U9CA 4ENXA 1WBWA 3OWLA 4BBMA 5IUIA 4FV4A 2IW9A 1Q8YA 2BTRA 5TKDA 1U5RA 4YMJA 4MNFA 2F57A 4HNIA 2VD5A 4CYIA 3TUCA 1XWSA 1Z5MA 4FT0A 2QOOA 4AT4A 2E2BA 3JXWA 5IQIA 4K77A 4IVCA 4UBAA 4X3FB 2BIKB 3CCNA 2O64A 5DT0A 5AUVA 2UW7A 3FLWA 1TVOA 3IS5A 3JY9A 4KWPA 2CN5A 3ORLA 1TQPA 3FPMA 4X2JA 2AYPA 5CXZA 1BI7A 5GHVA 1LEWA 2XIKA 3AC8A 5TE0A 3I79A 2G2HA 3AMYA 2UVZA 4BCGA 3PXZA 3IOPA 2R0IA 4DGLC 5HORA 3ZZWA 3G6HA 4I4FA 3RPYA 4RIYA 3MY1A 1UKIA 5IQGA 5ACKA 3U87A 3OW4A 3QQHA 3D5VA 3MI9A 3RK9A 5HG9A 2ITZA 5CYIA 3BLRA 4PMPA 3U6JA 2CCHA 2JDRA 2R3MA 4FYOA 3GGFA 3RK7A 4QTEA 5B2KA 1PMEA 2LAVA 3DQXA 4C34A 5EHLA 3GC7A 2PL0A 3CD3A 4G17A 4EUUA 3QKMA 4ASEA 4QP8A 4CMUA 5A4EA 4AW2A 1DAWA 3G51A 3AG9A 2RFNA 4L52A 2C30A 4S33A 3DTCA 3REPA 3PY3A 2YM5A 5EKOA 4CFUA 3G5DA 1URWA 1SM2A 3KXXA 4PV0A 4DH3A 5CT7A 2WTKC 3HLLA 4D2PA 3UZPA 2BKKA 1JKTA 3A61A 1BI8A 3VS2A 2ZB0A 4FZ6A 2QURA 3L8XA 4G5JA 3UZRA 1H00A 2ETMA 4ZK5A 4HYSA 2X7FA 1W7HA 2QOBA 2Y9QA 3C51A 3ENMA 1FGKA 4IB3A 3C4CA 1YDTE 3PIYA 4RIWA 3KGAA 1PMNA 3HEGA 3LOKA 3QQJA 4AGWA 3C5IA 2W1ZA 2WPAA 1JKSA 3ORPA 3VF8A 3EKNA 3P1AA 2XEZA 3PA3A 4F63A 2HW7A 5E1SA 3AGLA 3G2FA 4I24A 4IAKA 3LCKA 2UZVA 1I09A 3CQEA 1SVGA 4RIOA 1JBPE 4NWMA 2FSOX 3NSZA 1OL5A 1UKHA 2OBJA 3NUYA 1NW1A 3TJDA 1H24A 4EWHA 1WBNA 4HYHA 1BUHA 3O71A 2PVKA 5E7RA 3F3VA 5EM8A 3QZHA 4JBPA 3SRVB 1UA2A 3A2CA 1FINA 3ORMA 2YIYA 3SG8A 3RPVA 4BCKA 5I4NA 3BZ3A 5I9YA 2BVAA 2JIUA 4GG7A 4BN1A 1KSWA 5CU0A 4C7TA 2XZSA 2YDJA 2A27A 3K3JA 1QPEA 4BDGA 4YURA 5EDPA 3FV8A 2WIHA 4M84A 1OECA 4BIBA 5BYYA 2VTPA 2BFYA 4HGLA 3W2QA 4B0GA 4O84A 3SG9A 2VU3A 1YW2A 4UMQA 2RF9A 2Y6OA 4O6EA 2YM4A 3R04A 4FZ7A 2YABA 2WTDA 4MD8E 1WVWA 3EOCA 5E91A 3RJCA 3ID6C 5CAVA 2XRUA 3ORNA 5KO1A 2C6MA 2B1PA 4JLCA 2JFMA 3Q04A 4HJOA 4I0RA 2X9EA 4XMOA 4BGGA 5KMIA 3R7GA 4R3PA 4W4WA 4CV8A 2WTIA 4AT3A 5ANGA 4AFEA 5J7BA 2VWIA 3C7QA 1PRYA 1V0OA 4DGNA 3UZTA 3BRBA 5FWKK 3VBWA 2R3NA 3FMLA 3NNVA 3ATSA 4PL5A 4H39A 5E92A 3MY0A 3ZFMA 4EH7A 4YTCA 5JZJA 2JKQA 4BCQA 1ND4A 5E8ZA 4AE6A 4O7LA 3QTXA 3I4BA 3ZONA 5HQ0A 4A4XA 4QNAA 5CVGA 3EQIA 3UPZA 4ZTLA 3IW7A 1MRVA 4YZCA 3F5UA 4EQUA 4FIHA 1PKDA 4WNKA 4FKQA 3PXKA 4CT1A 5HO8A 2UW8A 3PVUA 4M69B 2QOKA 4QT1A 4FGBA 3TUBA 4RQKA 4ZIMA 4BDCA 4BDIA 2J0KA 4MTAA 4TWOA 4IVDA 3BBTB 3U8WA 1R1WA 3HV7A 3QTWA 3ZOSA 1XQZA 4L42A 4YNEA 1Q8WA 3FHIA 4UWYA 4E93A 1OL6A 3QTZA 3PWDA 3TN8A 1ZZLA 3SQQA 3WOWA 4ANNA 3TKHA 3LIJA 4BCPA 1YXSA 5FQDC 1K2PA 2V55A 4XV2A 4F99A 2QOFA 4JBOA 4FGRA 3V5WA 2OICA 2RFSA 4JQ8A 3SHEA 3P7BA 4HPUE 2PVNA 4YC6A 4FTAA 4O6LA 4BDFA 1PY5A 5IMXA 3C5UA 3VJOA 2C6KA 3UIXA 4D4SA 2B54A 4FK6A 2IZRA 4JJRA 4M3QA 4ZLOA 2QO9A 2VTMA 2V7AA 2RL5A 3IG7A 1U46A 3HMMA 3FBVA 3Q9WA 2IVSA 4ZTSA 4I0TA 1IAJA 2BAKA 4F6UA 3TNQB 5E1EA 3VQHA 5AAEA 2C5YA 4BCOA 4D2WA 3SOCA 4KUJA 1OI9A 4EOIA 3SW7A 2HENA 5M09A 3A8XA 4PP7A 3VRZA 3P23A 3VF9A 4EH2A 3OMVA 4IFGA 1WCCA 2CKOA 4K11A 4EH4A 4HGSA 3R9NA 2VTHA 4IZ7A 4AZTA 2J4ZA 1PJKA 3PJCA 2GNJA 3SV0A 3ZEWA 4XP0A 3Q4CA 1WMKA 3PP1A 4OBOA 4RQVA 5F20A 5M56A 4OT6A 3ULIA 4I6HA 2IW8A 2I40A 4KKEA 4QMLA 5AP6A 2IZTA 3ZFYA 5CF4A 1PXIA 2HXLA 2A1AB 5JGBA 2BRNA 4AU8A 2OJFE 2H9VA 2J0IA 4NTTA 4CG8A 2P0CA 4BDAA 3KQ7A 5T68A 3Q4UA 4WUAA 3FLSA 3R1NA 2OIBA 4ASZA 2OLCA 3OXZA 3PZHA 2J51A 1XH7A 4JG6A 3Q52A 2WQMA 4O86A 2H8HA 3MPAA 2JEDA 3QQGA 3WZDA 3BBWA 3PYYA 3QUEA 5FBNC 4Z9LA 4FIJA 4TW9A 4JR7A 1XH8A 3DK6A 4BWPA 1JSTA 2BMCA 2XNOA 3AC1A 3COMA 4IWPA 4O0SA 2UZOA 2Y6MA 5EW9A 4F6WA 3D2IA 4HCUA 4RVTA 2EU9A 4DEEA 2JLDA 1G5SA 3AC2A 2VRXA 2Z7LA 3IW6A 2A4LA 2XIRA 3M2WA 4G34A 4EK8A 3UNZA 4AG8A 5FLFA 5DWRA 4YUQA 4R3RA 4O0YA 3NYNA 2C69A 3QCQA 4GJ3A 5KMKA 4XS2A 1J7LA 1Q8UA 3DY7A 4G9RA 3AGMA 5JRSA 5D7VA 5HCZA 4ZLZA 5IH4A 3NUAA 3MTFA 2HW6A 2JDVA 4E8AA 2C47A 3MESA 3HX4A 4RMZA 1FVRA 3PVGA 3V5QA 4B7TA 3OFMA 2GFCA 1Y8GA 4J53A 3G0EA 4FEQA 4YJUA 4B9DA 1W0XC 4FSMA 4U81A 5KHWA 3F6XA 3MA3A 1ZWSA 2QO2A 3HUBA 1W83A 3QCXA 4FKUA 4RWKA 4AGDA 4BCJA 4OW8A 3ITZA 4FC0A 5GZ9A 3EQBA 3R8MA 4O7NA 3CY2A 5DRBA 4FK3A 4ERWA 3HNGA 4E20A 1H0VA 2RFEA 3UG1A 5CANA 1ZOGA 5BNJA 3IKAA 1TQIA 3EB0A 4YJQA 5CENA 4QMYA 4A9RA 2C6DA 4E6QA 2BILB 5AUZA 3UE4A 4CFFA 2ITVA 1RJBA 2VTNA 3QLFA 4FKGA 4JG7A 4PL4A 4WHZA 4TYHA 1Q3WA 4AT5A 5KX8A 4GUBA 5LMAA 3RPOA 3W10A 2UZTA 3ZTXA 2HZNA 1YWNA 3UIUA 3ZSIA 3GB2A 2ITNA 4FL1A 4GV1A 4Q9ZA 4LUEA 4DCAA 4WT6A 5HX8A 2H96A 5C8KA 3UQGA 2X81A 1MQBA 3I81A 4JX3A 4MAOA 3NWWA 4G3FA 5CU2A 5AV4A 4FNZA 2QVSE 2QLQA 3EQCA 5LCJA 3R7EA 5CT0A 2VV9A 3FJQE 3TV7A 3S2PA 4A9YA 4FKRA 4N6YA 5C1QB 5CU6A 1O9UA 3HDNA 3EN6A 4X2FA 2J9MA 5AP3A 4ZSJA 4U42A 4HW7A 2R5TA 4FNXA 2RG5A 4BWKA 4D1XA 2XKDA 4F64A 3F2RA 5FP6A 4QP4A 3CGOA 3V5LA 2BRHA 3ZRMA 3QYZA 3HVCA 4M8TA 4OT5A 4CEGA 4GK2A 4MF0A 2GQGA 2JIVA 3PVWA 4XH6A 4B4LA 4IAYA 2F2CB 3V5PA 4RX9A 4FSZA 3LQ8A 4ZP5A 4KABA 4OLIA 3F88A 3VBQA 3MJ2A 2FSMX 1J1CA 3IW5A 4RJ7A 4EKLA 3KRXA 4FZFB 3F3ZA 3R9OA 5I9VA 5IU2A 4IZ5A 2PHKA 3AT4A 4X3FA 3OUKA 4FTJA 3QHWA 5LWNA 2QKRA 2EXCX 2R3KA 4J8NA 5CEPA 4C62A 1U59A 3JR1A 3FDNA 4DLJA 2X2KA 2W1CA 3BGPA 3CR0A 3MBLA 4PP9A 3EWHA 4Y8DA 4APCA 4NL0A 3BE2A 1JLUE 3BU6A 4IJ9A 5IDPA 5KZ0A 3OOGA 3GQIA 1KV1A 2OI4X 2VTAA 3OCTA 3V51A 2WMRA 4AZVA 4OTPA 3BYSA 5BVWA 4FKPA 5BYLA 5HCYA 4L8MA 4IVBA 4XG2A 3QA8A 2QD9A 3UYTA 1ZMUA 3W32A 5EKNA 1REKA 2C5OA 2C4GA 2C5NA 3KY2A 4XBUA 3E63A 3G15A 3R9RA 4OUCA 3QQUA 5EM6A 2FUMA 3TNHA 2VO6A 3EZVA 4V0GB 3D5WA 4IEBA 4GG5A 2GFSA 4C2VA 3VWAA 4BDHA 2X6DA 2PVJA 4QPSA 4FTIA 3Q9YA 4Y72A 4M67A 5EW3A 3QALE 3VUKA 4DFZE 2ITWA 3PZEA 4M15A 4CLJA 5JN2A 1WBTA 4F9AA 2VGOA 5TR6A 2QCSA 4O83A 4D9UA 4O7WA 2ERZE 3KMMA 4ARKA 4MXXA 1FMKA 3MA6A 4D4YA 4DN5A 3LXKA 3IGOA 3P5KA 2JDSA 2Z02A 3HAMA 4U80A 3NAYA 4JX7A 4YSMA 3NMUF 3PPJA 1M2QA 1KOAA 4AZSA 5ETAA 4LOOA 4BCIA 5GINE 5LCKA 4BKZA 3MGYA 4GT3A 1OBDA 1XHAA 5AR2A 1PHKA 1MUOA 3DNDA 3WF5A 3WZEA 4HCVA 2WTWA 4LMNA 2UW6A 4RZWA 3QTRA 1NVSA 4GT4A 5GJDA 4J52A 4RX7A 5E90A 1NVQA 1U4DA 5K4JA 5TO8A 2FGIA 3CTHA 4RJ6A 3RNYA 4USFA 1GZKA 1PMVA 3HV4A 5M06A 2G01A 3QRJA 3VIDA 4DEGA 4L45A 4GU6A 2C3JA 4C4JA 4E1ZA 4BIDA 3HECA 3N4UA 3GT8A 4H1MA 3VUDA 5HVJA 3UODA 4YZMA 4FL2A 3C9WA 1QL6A 3BX5A 5EYMA 5LVOA 4CFVA 3LFBA 5AP0A 1ZLTA 4CRSA 3IECA 4DGGA 4PRJA 2J90A 3QLGA 3GC8A 4UV0A 4F65A 4C4HA 3H0ZA 4DFNA 1J7UA 4CV9A 3NLBA 3C0IA 3QCYA 3D7TB 5HNIX 5D12A 4J99A 5L6WL 1JNKA 4BDKA 4TT7A 4BR3A 5LJJA 3Q5ZA 4ITHA 3WIGA 3CLYA 3LHJA 1XO2B 4X2KA 4FKVA 4QQTA 2FO0A 3BGQA 4GIHA 4EH5A 5CXHA 3VS0A 2CGUA 1IR3A 2OXDA 3EL8A 3L8PA 4FSWA 3TDWA 2G9XA 2XS0A 4NM7A 4WA9A 3EIDA 1PF8A 3UDBA 3I0QA 1ZAOA 2WMQA 1JVPP 4WSQA 3DQWA 4EWQA 3IONA 2JD5A 3KFAA 5FEDA 3RGFA 5KMMA 3R2YA 4FTTA 4JOAA 4CQGA 1Q3DA 1X8BA 2J2IB 5J8IA 3HMPA 2P4IA 3VS7A 3H10A 1B39A 1CSNA 4EORA 4U3ZA 3E3PA 4L46A 2DQ7X 2WOTA 5BYZA 2B53A 3CTJA 1YXXA 2C6LA 3AC3A 4GU9A 2YAKA 3RP9A 3EFWA 3VBVA 4K18A 2O3PA 4V01A 5J5SA 2GQRA 3UNJA 2W1EA 5FD2A 3UP2A 4IIRA 1U54A 4L00A 3RNIA 1J91A 4WNOA 3R21A 4ZY6A 3WF8A 4C37A 3KMUA 4P5ZA 3RKBA 3VUIA 4BCMA 3R7UA 4IHPA 4HNFA 3QD0A 2PYWA 4O0XA 4YC8A 2W96B 2AC3A 3F66A 4Q2AA 2BR1A 5M51A 3O17A 2FA2A 5HHWA 1YOLA 3O7LB 4OTFA 4EHGA 4NM5A 2VWWA 4DITA 3IDCA 3LFAA 4R7BA 1ZYJA 4X3FC 4DT9A 4F7SA 2C1AA 4A7CA 3GVUA 2CSNA 5EOLA 2HIWA 3ZCLA 2GSFA 4Q9SA 3W2PA 4AACA 4YPDA 2JFLA 4XRLA 4YC3A 1T46A 2UZLA 1LPUA 1EH4A 2GQSA 4GFMA 4BB4A 1FBNA 3K54A 5F1ZA 3RAWA 4R5SA 3IDBA 4I5CA 4AW0A 4F7NA 2X4ZA 3UMWA 4QTAA 2VWBA 3LM0A 4WNPA 4YO6A 2J50A 5BVNA 4Z7HA 4WUNA 3VS5A 1MQ4A 4IDTA 3F2NA 2ETRA 4QQJA 3E93A 2G2IA 4FTCA 4I5HA 3KXNA 3TM0A 3AC4A 4DC2A 3QRIA 2VX1A 3KF4A 4S30A 3P7CA 4AA5A 5CSHA 2NO3A 2CGWA 4QMMA 5CF5A 3GI3A 4D2VA 4FSNA 4C3PA 2XCKA 4O1PA 4RVLA 3VULA 3EYGA 4FOCA 4BCFA 4QMNA 3W8LA 3LCDA 3CIKA 3QYWA 3BHUA 3W2OA 2XKCA 5DHJA 2JAVA 2QOLA 4BTKA 3U9NA 4FEUA 5A3XA 4L53A 2GNFA 4J95A 5FRIA 5L2SA 5E8XA 4RC2A 5HG7A 3KK8A 4C3RA 2WGJA 4CQEA 1GIJA 3RPSA 4A4LA 5CSVA 2WMWA 1JSVA 3NYVA 5K5NA 3TZ9A 1BL7A 1FVVA 2IWIA 2OXXA 5HGIA 4FSQA 4DEAA 3GOKA 4I5PA 4PPBA 4O7SA 4WKQA 1WBPA 3UNKA 3O50A 5ANJA 3FI2A 5IQDA 4HOKA 3FHRA 1XH4A 4NM0A 4GRBA 4KBKA 3RMFA 4YJRA 3JVRA 3BYOA 2FVDA 2XP2A 3A7FA 3VS6A 5CNOA 1K9AA 4KKHA 3U6HA 4AQCA 3GU4A 4L7SA 2F49A 3L9PA 3U4WA 3NUXA 3KB7A 4NIFA 3W18A 4KSQA 1WBOA 4Y73A 3DZQA 4KBAA 1F3MC 4Z16A 5HG5A 3KN5A 2JITA 2QQ7A 4GH2A 2WQOA 5HCXA 3U51A 5E4HA 4U0IA 4BKYA 3FMNA 4ZS4A 3C4FA 4BTJA 4FIGA 5D7AA 3I7BA 2OK1A 4FTMA 4NUSA 4O0RA 3R9HA 3TWJA 4E6DA 3I7CA 3VS4A 2WMBA 2RG6A 1KV2A 2JGZA 1SNXA 2NRYA 3DBEA 3CXWA 4FKLA 3VAPA 3TCPA 2GTNA 2FSTX 4L3PA 3ZRLA 3G9NA 5KKRB 5EDQA 4JXFA 5IQBA 4FV0A 2CPKE 5L4QA 4IDVA 3VS1A 4QTDA 4MKCA 1STCE 4D2RA 4FYNA 1GNGA 4RC4A 5C26A 3LJ1A 4FTOA 4K0YA 4KBCA 3PTGA 3T9IA 4Y85A 3MN3A 3ZUUA 3IGGA 3D4QA 4AA0A 3BLHA 2EB3A 3WE8A 4QP7A 2B7AA 3I6UA 2Y7JA 1CKIA 4XYFA 4QNYA 3LAUA 4FTQA 4S32A 2JC6A 4IBMA 3R8LA 4TYHB 5EYCA 2J0JA 2PE0A 4DGOA 3A4PA 1CKJA 4MXYA 3EJ1A 3R28A 4OAUC 3IW4A 2C68A 2OSCA 4F9WA 4WD5A 4D5HA 5FEQA 3DAJA 3BHHA 2BKZA 3AT2A 3C4ZA 4JDJA 4JBVA 4Y83A 4EOKA 2PU8A 3MPTA 4B8LA 2DUVA 1DAYA 1A9UA 1PYXA 5DN3A 1L8TA 3QGYA 2WELA 2YITA 4PDPA 3QQFA 2V62A 3GU8A 2R7IA 5KMOA 5IG1A 5FP5A 2REIA 3BV2A 3C13A 1UV5A 5IA1A 1NT2A 5AIKA 2BCJA 1OKZA 4BGQA 4FSYA 2Q0BA 1GZNA 3LFDA 4RJ3A 4DFXE 5M57A 2OWBA 1T45A 4ACDA 4WBBB 2XCHA 3BYVA 4JBQA 4I0SA 4MD9E 3E7VA 2I0YA 3B2TA 3R1SA 5FG8A 2B52A 3RWQA 4OAVB 4ZMEA 2UVXA 2O2UA 5M4CA 4EH8A 4J97A 3L1SA 3GCUA 4X7QA 2HAKA 2WTKB 4PY1A 3QHRA 4HCTA 3V8TA 1JOWB 4OTIA 4RFZA 5J7HA 1ZYLA 3EFLA 2F2UA 5KBRA 4C33A 3A7JA 3EN7A 3R0TA 3GEQA 2WTVA 4D0WA 2GS6A 5IUGA 2QOIA 4DG0E 3DDPA 2HY81 3BPRA 3RZBA 1P5EA 2BZHB 4PMSA 3RZFA 4CRLA 2I0VA 2WTCA 4M0ZA 5FTOA 4IACA 4C38A 1Q8ZA 3T8OA 3KXZA 1TKIA 3HZTA 1KE5A 3LJ2A 4A9UA 2RIOA 2J0LA 5FDPA 4DEDA 3DLSA 4XRJA 4E5BA 2W9FB 4ZJIA 2R3OA 5AP4A 2IVUA 4UY9A 1SZMA 1BLXA 4V05A 1YOMA 4FT7A 2J5EA 5HEZA 4D4VA 3QKKA 3VS3A 1JSUA 3OWPA 3PJ2A 4H36A 4M0YA 4BC6A 2VWUA 3SA0A 4NCTC 2YERA 3G6GA 4BI0A 1YOJA 1UWHA 3BCEA 3PRFA 3SXFA 5HVKA 1DI8A 3R73A 4ANMA 4KRDA 3F82A 4IZAA 1OIRA 5K3YA 4Y5QA 4ZZOA 3RWPA 4ZSLA 3PIXA 4R5YA 4IX5A 3TT0A 2ZOQA 2J7TA 4GUEA 5F95A 3TIZA 2VO7A 3PRIA 2PMOX 4HZRA 1J1BA 5HNBA 1OUKA 3FMEA 3FZ1A 4ANLA 5IF1A 4OBQA 2WU6A 4FTRA 2EXMA 3L9MA 3PE1A 4I6BA 5KKRC 4JAIA 1BMKA 3V04A 4CT2A 4DT8A 2OJJA 4BZDA 4MYGA 1H01A 5JFXA 5LVNA 4YO4A 5HOAA 3NRMA 3BQCA 3KREA 3LE6A 2WQEA 4RX5A 3VUTA 5BMSA 2UZNA 3WIKA 4YZDA 2PY3A 4BY9E 5IH6A 4TWNA 4NH1A 2XB7A 4OGRA 4YZ9A 4YJNA 5E8YA 4ACMA 1ZMVA 5A46A 2GNGA 1O6YA 3R22A 3GCPA 3LQ5A 1HOWA 3F3TA 3RBWA 2WMSA 2YIRA 5KE0A 5FXRA 1Q62A 3UBDA 5AX9A 2B9FA 4J71A 3ZC6A 3KA0A 4ANSA 4C36A 3QQLA 2ITYA 4EBWA 3GU6A 3Q4ZA 3NAXA 4ORKA 5AR4A 3PJ1A 4XOZA 2XEYA 4YP8A 4FIFA 1KE7A 4O2ZA 4RLKA 4C0TA 3DJ5A 2UZUE 3VW6A 2W4JA 1OKYA 3DJ7A 4FV1A 4I23A 4U6RA 4QMOA 1IAHA 4U41A 3ROYA 4EZ7A 2X6EA 4EOLA 4CCUA 5CI7A 2XJ0A 4E3CA 3D7ZA 3UG2A 3KKVA 4ZTNA 2P3GX 4QMZA 3NEWA 4X2NA 5JT2A 2OZAB 1IEPA 1G3NA 2YA9A 3OT8A 4RGJA 1E9HA 5L8LA 4BFMA 4K2RA 1KUTA 4PQNA 5EK7A 3ORZA 4NU1A 5E8SA 3U4UA 4M66A 4ANOA 4TNDA 3ZO4A 4LI5A 2Z7SA 4OBPA 3TXOA 5DNRA 2ZV7A 2BALA 3PG1A 2B4SB 4I4EA 2E9VA 2OZAA 1ZY4A 4PTCA 1VEBA 2OJGA 2VTSA 3JYAA 3QU0A 3QTQA 3F5XA 4G2FA 3CD8A 4RA5A 3ZM9A 3OEZA 4QO9A 4APPA 3N9XA 2O65A 3SGCA 4BTMA 2Q83A 2A2AA 3HP5A 3N4TA 3HV6A 3PSBA 4FL3A 4AA4A 2IZSA 3V5JA 4FKOA 4WOVA 1UU8A 2ACXA 2XVDA 3EQGA 2PUIA 5J9ZA 4U5JA 5JFWA 4QQ5A 5KBQA 4WBOA 3NS9A 2YIQA 4J98A 2JKKA 4AS0A 4F9YA 2ETKA 5IEYA 3DCVA 3FI3A 2R3LA 3BELA 4L3JA 2W99B 3TKIA 3EMGA 5CZIA 1H28A 3CPBA 3DBFA 4FKJA 4FOBA 3WARA 4BZNA 4Z3VA 1S9JA 5CVHA 3C0GA 5FEEA 5EOBA 2BZKB 2P55A 4USDA 4ACCA 5HICA 4AN9A 2PPQA 4FTUA 3W2CA 2BTSA 4EZ5A 5BUEA 2ITQA 2Z7QA 2IN6A 3SOAA 4BRXA 2C6TA 3A4OX 3Q9XA 3R7VA 5ANKA 2X1NA 3PXQA 4X2GA 3P4KA 2GMXA 3R7YA 3VBXA 3CY3A 3ORXA 5HLWA 5DGZA 4X3JA 3QX4A 3AOXA 2IG7A 4LV8A 3BI6A 3V8WA 4HPTE 3MB6A 2E9PA 5KMLA 1Y91A 2WMVA 4TRLA 1REJA 4LOPA 3QTSA 3GCQA 4EOOA 4CFNA 1H27A 2I6LA 4C02A 3WYYA 2CKEA 5TOZA 3DLZA 3HKOA 1UNHA 4D55A 3F5GA 3KF7A 2ZB1A 4LGDA 5HO6A 1PXNA 2VTQA 4XNEA 4E7WA 4FG9A 4HYIA 5C03A 3LXPA 4R1VA 5EDRA 2C3KA 4D4RA 3FKLA 4EL9A 4DH8A 5LVPA 3A7GA 3OCSA 2W17A 4OTHA 1CDKA 3NYXA 4MXZA 4Q5EA 3MTLA 3QRUA 4ALWA 4IX4A 3A8WA 4FVPA 4C4GA 4AP7A 2XMYA 3AC5A 4E5AX 3O23A 3ZLWA 3F61A 3CJGA 2G15A 3PIZA 4RBLA 2CGVA 3QD4A 4S34A 2GHGA 4UZDA 5FM3A 3QA0A 5A4QA 1XBCA 3KEXA 3D5XA 4ZJJA 3UMXA 4EC9A 3Q3BA 3R00A 5IA0A 3GC0A 2WU7A 3I6WA 4QMXA 5EQEA 3QBNA 3DKOA 4F7JA 2YCSA 1PXKA 3I5NA 4MXAA 3ALNA 4LM5A 2XF0A 2J0MB 3EL7A 3LMHA 4JRNA 5M4IA 1RE8A 1YDSE 4UYNA 5CY3A 5IISA 3ORTA 3C1XA 2WMTA 3RVGA 1P4OA 3MFTA 3O51A 1H1QA 4J1RA 4GKHA 4F08A 4RJ5A 4G6NA 3RI1A 4EQMA 1YXUA 2PVLA 2R3GA 4AW5A 2HY0A 3I5ZA 4KB8A 4AOTA 2XNNA 4JAJA 4FKSA 5I9UA 1BX6A 3MH1A 4R6VA 4JNWA 3P78A 5CZHA 3KCKA 4KD1A 3ZUVA 1Y8YA 2PVYA 4DH5A 4EH9A 4Q5HA 4RZVA 1NA7A 5IKWA 5BVFA 5KMJA 4QOXA 5AUWA 4EOQA 4L67A 3QGWA 5E8VA 4YLLA 5HIEA 4IWOA 2YLFA 3HV5A 5HNGA 3LCOA 1LR4A 4N0SA 4IFCA 4RIXA 3CTQA 3OUNB 3TTIA 4JT3A 2PVHA 2X8IA 3MH2A 5CAOA 5HIBA 3SLSA 2X39A 4HVIA 4R7HA 4U44A 3UO4A 5BVKA 3VO3A 3FLZA 3O2MA 4KS8A 1OB3A 2OFVA 5JQ8A 3GC9A 5C27A 3OCBA 2IPXA 2XK7A 4CD0A 3ZHPC 2W5AA 2ITOA 4ID7A 3SXSA 4YHJA 5IQAA 3L9LA 1OL7A 4I3ZA 4CFMA 3G90X 3PXYA 3U55A 4XP2A 1IASA 4ZTHA 1ZARA 5CAUA 3EN4A 4F9CA 4CYJA 3COKA 4PPCA 4FG8A 4UMPA 4ACGA 5CSXA 4QPMA 3DA6A 4FUYA 5CLPA 2ZMCA 3OROA 2Y4IB 1CM8A 2VWVA 5JK3A 2NPQA 1VR2A 4MBJA 2OJ9A 5KHXA 2XBJA 3QZIA 4TYIA 2ZM1A 5A54A 5DEYA 4BCHA 4ZMFA 2YHVA 4MWHA 4MCVA 2ZVAA 3E92A 3P79A 2EVAA 4AFJA 4BYJA 4WIHA 3DGKA 4RWJA 4ACHA 2R0UA 1ZOEA 2ZMDA 3NUUA 3OY1A 4C4FA 1A48A 3KK9A 4O0TA 3EQDA 5AR8A 5EQPA 2OW3A 2V0DA 3DFAA 4YHTA 3PE2A 3PSCA 2OFUA 3LKMA 3FI4A 3P86A 3ZFXA 4GVAA 3ZYAA 1B6CB 4KS7A 4CSVA 3BEGA 3R7IA 4KSPA 3E8DA 3NIEA 5EW8A 2OIDA 2AC5A 5CEKA 3N4VA 4CTBA 3FY0A 3EH9A 4XLIA 3V5TA 2HCKA 4RX8A 4L9IA 4JI9A 4YPSA 3ODZX 3POZA 4CNHA 3B8QA 3BE9A 4YGAA 3BLQA 4YJPA 3Q6UA 3HAVA 2GNHA 3R2BA 2Z8CA 2PUUA 3BWJA 4QRCA 3WF7A 3UO5A 4FV3A 3ETAA 1FVTA 4FKTA 2ZAZA 3ZC5A 4RIXB 1RW8A 3FZPA 5K9IA 4IWDA 5AA9A 4MQ2A 1S9IA 3UIBA 4U79A 4GSBA 5HE2A 2IW6A 3O8PA 3S0OA 2J5FA 1RQQA 3AD6A 3C4EA 1Q41A 4FA2A 4D2SA 2F7ZE 4UMUA 3GQLA 5IA3A 1QPJA 3NW5A 1I44A 2PVRA 4B99A 2W06A 2W1FA 3OBGA 1SMHA 3H30A 3HL7A 4FIIA 4L01A 4CCBA 4EHVA 5K4IA 3NUNA 3FQHA 3GOPA 1P14A 5BQ0A 3N51A 4G3EA 5HE0A 3DB8A 1Z57A 3GENA 3R8PA 4WG5A 1Q4LA 3NR9A 4MD7E 4CKIA 4CXAA 4KNBA 3EYHA 5DH3A 5AR5A 3RTPA 4X6QC 4EK3A 1Y6AA 1UWJA 2OIQA 2W9ZB 4U40A 5I0BA 5JSMA 5HO7A 4EK5A 2JAMA 4I94A 3W55A 5IPJA 4V04A 5DG5A 5B7VA 2R3HA 3FLYA 3OCGA 2YZAA 4B8MA 3DBDA 4N6ZA 1Y57A 4W8EA 3R9DA 2BAJA 4IJPA 4XEYA 4IE9A 4EK4A 3ZMMA 3OWKA 2QG5A 2R7BA 5EI6A 4EOMA 2OH4A 2W1IA 4NJ3A 4NCTA 4HVGA 3CSVA 5AMNA 3UC3A 3D83A 5HTBA 4XV1A 3H9OA 2PMNX 4X6RA 3LLTA 1H8FA 2ITUA 1OGUA 4FTNA 3G0FA 4C57A 1AD5A 4YSJA 3JPVA 1G8AA 3TV6A 5J79A 1FMOE 2GS2A 1VJYA 5L6PA 1KE8A 2OXYA 3RCJA 5F4NA 3TTJA 2V5QA 3F2AA 4UXLA 3LFFA 2YIWA 5H9BA 3ZBFA 5DYJA 1U54B 4G3GA 2YAAA 4TYJA 1CTPE 2VUWA 3KMWA 4YJVA 4JS8A 1WFCA 2E9NA 3Q9ZA 3PDTA 5AFVA 3MWUA 4U45A 1M17A 1Q61A 2P2IA 4E6AA 4HZSA 4F9BA 1H4LA 3PXFA 4YJOA 3E8NA 4DG2E 2W4OA 2GNIA 4FMQA 2HK5A 4IMYA 1OIQA 4IW0A 3OD6X 4N70A 3R7OA 4GJ2A 5K0XA 2KULA 4IAFA 3R71A 4G9CA 4BVUA 3QC4A 5B0XA 2XK9A 3SKCA 3VN9A 3UTOA 5LWMA 4WRGA 4D9TA 1OL1A 4FSUA 4FSRA 4F1TA 3QWKA 3DZOA 2PMIA 3OHTA 4FV6A 4M97A 5J9YA 3V6SA 5IEVA 2IVTA 4PF4A 4BICA 1ATPE 1HCLA 3QUDA 4FZDB 3DTWA 4BI2A 1ZYCA 3NW6A 2CDZA 2YEXA 3CGFA 3PWYA 4F09A 3VHEA 4FVQA 4R8QA 4A06A 3TJCA 4ANQA 4RIYB 4IANA 3OG7A 3PUPA 1MRUA 3TV4A 2VTLA 5AV0A 2UUEA 5HG8A 3MH3A 4GFOA 4H1JA 1UNGA 3BQRA 2XNPA 4RWIA 4KRCA 4UB7A 4O82A 3ERKA 1XH5A 3MH0A 4O21A 2CJMA 4YHFA 4ZTQA 5LVMA 4CMTA 5EHYA 1BL6A 3A7HA 1OZ1A 3NNXA 4MXOA 3SAYA 5CSPA 2I7QA 3QAME 4YJTA 4GFGA 1JPAA 5J9LA 5CU3A 3NVKI 3QF9A 4QMSA 4RVKA 4TN6A 2XKFA 3LCTA 4JR3A 2JDOA 5H8BA 5DMZA 3JY0A 3PXRA 2CNUA 2X7GA 3GNIB 4FV7A 3Q32A 4RRVA 3BYUA 4QYGA 5DBXA 2B9JA 4TL0A 4O7YA 3PSDA 3AXWA 4W4VA 3E8CA 5L2WA 3E3BX 4QMVA 2VTJA 2XNGA 3DDQA 2YCFA 1XBBA 1O6LA 2PMLX 3AD4A 1M52A 1WVXA 3NVMB 4RA4A 3QFVA 2P33A 1OITA 2QODA 2BRGA 1F0QA 5JGAA 3EQFA 2DYLA 3PY0A 4MHAA 5DR9A 3ZEPA 1Q24A 2VO3A 5LMBA 1MRYA 2X2MA 5C9CA 3OBJA 4WO5A 5AJQA 3UVRA 3VJNA 4K9YA 3POOA 3LFSA 1GZOA 1KE6A 4I92A 4DH1A 3Q96A 3Q53A 4E4MA 3DNEA 1YKRA 3DBQA 3FSFA 1V0BA 2YCQA 4G5PA 2XNBA 3R63A 1ZMWA 4AWIA 4TNBA 4ZSEA 4XUFA 3COHA 3ZM4A 4ZY4A 2GCDA 1R3CA 3Q60A 4HVSA 5JFSA 1TQMA 2UW4A 4FZAB 4EONA 5I3OA 1PXPA 3FZSA 4AZEA 4FE2A 3OP5A 4LOQA 3QL8A 5GZAA 2BDFA 3GXLA 2UW5A 5CTPA 3IO7A 3QXPA 4NK9A 5M53A 4M13A 4FIEA 3RM7A 1JKKA 3W2RA 2QG7A 5M4UA 3UOHA 2ZV2A 3GFWA 3ORKA 5HLNA 2KTYA 1YHWA 3MFRA 3THBA 5C8MA 3P9JA 4FG7A 2PSQA 3I60A 4GYGA 4QP6A 4UEUA 3KC3A 3RK5A 3VRYA 1H25A 3LPBA 4MVFA 4OTRA 1SVHA 2X8EA 4Y5HA 2CLXA 4P4CA 4F0IA 3MYGA 1ZYDA 4UYAA 5CASA 2EWAA 3QUPA 3PY1A 2OG8A 2OF4A 4GL9A 5AP2A 2OH0E 2PWLA 3FXWA 4O0VA 5IZFA 2C3IB 4N57A 4UMRA 4LRJA 3VNTA 2UW0A 3E8EA 1H08A 3Q6WA 4FUXA 4QYEA 5J95A 5GIOE 3T3VA 3EQHA 1AQ1A 4M12A 3C4WA 3NCGA 3MSSA 4I6QA 4H58A 2XKEA 2FB8A 3E87A 3QC9A 1PW2A 4DTBA 4GEOA 5M55A 3D5UA 4YNOA 4G1WA 3IK3A 4IAAA 4FTKA 4MQ1A 4PX6A 5AIRA 4LGHA 4DHFA 3EQRA 5EHOA 1UU9A 4XJ0A 4EC8A 4JRVA 2UW3A 4QP3A 3WILA 4DFBA 1Q8TA 4RPVA 1YI3A 5E8TA 2R3RA 1GAGA 2PZIA 4FBXA 4IX6A 4AW1A 3GUBA 4XBRA 4JIAA 1V0PA 4C35A 3F69A 4TZRA 2PVFA 2XIXA 2WXVA 3OVVA 3W2SA 2X4FA 4RFYA 2HZ0A 2W1GA 5D11A 1URCA 3CE3A 4MBLA 3ATTA 2F4JA 1LUFA 3OEFX 3CP9A 3HMOA 4U43A 2C0OA 5HKMA 3SVVA 2WEVA 4MBIA 1L3RE 5B2LA 5AR3A 3FMJA 3S4QA 2VTRA 4TY1A 5CQWA 4E4LA 4O1OA 3SW4A 3ZUTA 2B9IA 5D1JA 3LJ0A 4EOJA 5K0KA 2VNYA 4RSSA 1JKLA 4NT4A 5KCVA 4YR8A 3FAAA 5EYKA 5IH5A 4TPTA 5I9WA 1NVRA 1YXVA 2OO8X 4O7ZA 2VWXA 3ACJA 2R3IA 3WE4A 4DFLA 5LQFA 3ANRA 4PNKA 4FT5A 4W8DA 3ZLXA 4O81A 3CJFA 3ZDUA 2YM3A 5K5XA 1OIUA 1CMKE 4ZXTA 4DEIA 4OR5A 5ANDA 3M42A 4PDSA 3KXGA 4M68A 4PUZA 4BDEA 2BRBA 4K6ZA 4CFWA 3TZMA 4NYEA 3TDVA 4QPAA 2OGVA 2YLEA 2QNJA 4CZTA 3DU8A 3QZFA 4LGGA 2CNQA 1K3AA 4M69A 1OVEA 3FZTA 3BYMA 4X0MA 3U6IA 5HLPA 3HA6A 1M7QA 3WF9A 5DR6A 5DA3A 4I21A 4O91A 3TEIA 5ETCA 1YWVA 2X0GA 3UVQA 3ANQA 1XBAA 2XK6A 1VZOA 2WAJA 3H9RA 3A60A 5CVFA 4PL3A 4QP9A 3R83A 3OOMA 3LXNA 3LFNA 3MVJA 5F94A 3SXRA 2CKPA 4C4EA 4IAZA 4HYUA 3OXIA 5AM6A 5AA8A 5H3QA 4H05A 4MNEA 3DXPA 2WFYA 4IC8A 4EQCA 3FKOA 5DEWA 1R78A 2BIYA 2HWOA 2OKRA 3DXNA 4K8AA 5L8KA 4W4YA 2A19B 3FLQA 3NX8A 3OZ6A 3W8QA 1W98A 1AGWA 2XM8A 1KOBA 3PPKA 2ZV8A 1QCFA 4FT9A 5IQFA 3OC1A 4GIIA 2E9OA 2ESMA 2X2LA 4CVAA 3AMAA 4RLLA 5TF9A 4A9TA 3PLAE 2IVVA 5LARA 5CAQA 3DXQA 4NFNA 4MH7A 5BVEA 2AUHA 1M2RA 3QRKA 4BDBA 3K5VA 4J8MA 4FKWA 2WTJA 1OM1A 2BDWA 4MXCA 4XCUA 5DFPA 3KL8A 4C3FA 4I5MA 5LXMA 1M2PA 3WZKA 3KXHA 5A6OA 1H07A 3GU5A 4RT7A 5H2UA 3V01A 4GK3A 4O0UA 2BDJA 4FICA 5ITAA 2JBOA 3SRVA 3FEGA 4EI4A 3FE3A 4JDKA 2X9FA 4AN3A 4E4NA 2YZLA 4XG9A 1OBGA 1H1RA 2CKQA 3OF0A 3FXZA 1PKGA 3V3VA 2WHBA 4ANBA 5T6KA 2Q0NA 4H3PA 4BWXA 2HYYA 1IA9A 1DI9A 4D0XA 3WZUA 2FSLX 4FX3A 4EJ7A 2HELA 1IA8A 2F7EE 2IJMA 2QR7A 4UWCA 4G6OA 3DAKA 4YTIA 5C8NA 3UOJA 5JGDA 4G3DA 4IQ6A 4AOIA 3Q2JA 2YFXA 3F9NA 4FV9A 4QMPA 4JVGA 3W33A 3LXLA 4IC7A 1PXOA 2GPHA 5KZIA 2PZRA 1Z9XA 3MFSA 4QTBA 4QMTA 3ROCA 4F7LA 4QD6A 4DBXA 3IDPA 4EEVA 2VAGA 4ZTMA 5J5TA 3VW8A 3ACKA 2VGPA 4Z55A 2H34A 2UVYA 3FKNA 1PYEA 3LMGA 2QOHA 1YVJA 3HV3A 3JVSA 4I6FA 4P5QA 4R3CA 3UGCA 4EOSA 5AEPA 1BKXA 5IUHA 3QQKA 3TUDA 2UZWE 3C0HA 4PWNA 2G1TA 5CEIA 3UYSA 4EH3A 2CCIA 4F70A 4BL1A 5C4KA 3FYJX 4P90A 5CQUA 2CMWA 3MY5A 5HTCA 3PVBA 3DB6A 4H3QA 4IWQA 3WF6A 5I9ZA 4FI1A 5J1VA 2YIXA 3ZO2A 4O7RA 4DBNA 5M08A 3O8TA 3F3UA 3EN5A 3HDMA 3HRFA 4W9XA 2BAQA 4JQEA 4MNEB 4O2PA 4QYFA 1YI4A 4C2WA 4HGTA 1YRPA 1OKWA 1PMUA 3PFQA 4USEA 2QLUA 4JDIA 4FV5A 4R7IA 3OWJA 4GKIA 4ZTRA 5A4CA 5BPYA 2WKMA 1H1SA 2OF2A 2R3PA 4C58A 5I9XA 1PXMA 3DV3A 4XG6A 1QPDA 5AM7A 2W05A 3ZSHA 5G6VA 4CTCA 3F7ZA 2W7XA 4MX9A 4ASXA 4IXPA 4E73A 2QU6A 5FXSA 1GJOA 2V22A 4AE9A 4I93A 4AAAA 5M4FA 4XV3A 5HBEA 4UX9A 1ZY5A 1YHSA 2ONLA 3DT1A 3GFEA 4IB1A 2B9HA 4R78A 3D15A 1DS5A 3KRRA 3RINA 1FOTA 3TI1A 3F7WA 3G33A 4IADA 5IDNA 3FMMA 2WZJA 4EK6A 5IEXA 4CG9A 3IPHA 4YTFA 4JDHA 5EM5A 4NM3A 4TXCA 2I1MA 3ORIA 4KIQA 2ZM3A 4RIWB 5DRDA 4BGHA
chains in the Genus database with same CATH superfamily
3ZS5A 3GU7A 1W82A 4MWIA 3E88A 4U3YA 5HX6A 3EN9A 3PA5A 2WB8A 5FDXA 4J7BA 4MF1A 4F6SA 4ITJA 4BHNA 2VWZA 3R8ZA 2BFXA 4EZ3A 5J1WA 3LVPA 3PP0A 4EH6A 3LQ3A 3L8SA 2XJ1A 3W1FA 4LRMA 2JIIA 5HU3A 3AMBA 3V8SA 2R9SA 3VUGA 2ZV9A 3UOLA 4ZAUA 5AV3A 2RSVA 4DGMA 1H0WA 3FMKA 5GJGA 1A06A 3BL7A 3RPRA 4AZFA 4U9AA 3HMIA 4DCEA 1SNUA 4C8BA 4RC3A 4QMQA 2WO6A 5AAFA 4AX8A 1OPLA 2YJRA 3CPCA 2GS7A 5LMKA 2B55A 2WQBA 4IB5A 2O0UA 3K5UA 1IRKA 1OPJA 3MW1A 2XRWA 3FMHA 3OT3A 4FV2A 3ZU7A 3RM6A 4ONAA 4KIOA 2XBAA 2ZFYA 1R0PA 5C01A 3RAKA 4D2TA 4BBEA 1HCKA 3HA8A 5EYDA 2VO0A 1GIHA 2PZYA 2GNLA 3PLSA 1IG1A 1W8CA 4A4OA 4C59A 2QKWB 5CU4A 1ERKA 1VYWA 4YLKA 2WD1A 3O0GA 1UNLA 5IA5A 5B2MA 2C5XA 3NGAA 5JMSA 3WI6A 2WQNA 4XG8A 3FY2A 3V6RA 4IH8A 4DHJA 4TYEA 4V0GA 4EYMA 5FXQA 3BU5A 3HRBA 2C6EA 1XKKA 3D2KA 3ULZA 3DOGA 5A9UA 5CNNA 2Y4PA 4ZY5A 2PZPA 4ZZMA 3EFJA 3BKBA 4AXDA 4GS6A 3DK3A 2UW9A 2XA4A 3EQPA 2GHLA 3F3WA 2QHNA 1PXJA 3MFUA 3HP2A 4IM3A 4IZYA 2QONA 2C1BA 2C0IA 1XH6A 2GHMA 2J6MA 1R39A 3DK7A 4FV8A 3LM5A 3OY3A 4LQMA 2OU7A 3ZXZA 4X21A 3L8VA 3LCSA 2XYNA 5EM7A 3ZO3A 4DFUA 2BZIB 4FKIA 2W0JA 5CF6A 5HIDA 3C4XA 4D1SA 3H9FA 3QCSA 3KXMA 3F5PA 5LOHA 3KRWA 4BF2A 2XAMA 2FH9A 5TT7A 1Q97A 3LZBA 3ZO1A 4CZYB 5AV1A 2PVMA 3BEAA 4DEHA 4P2KA 3KCFA 4YTHA 5ICPA 3UVPA 3MIAA 4TWCA 4PMTA 2QOQA 4QDEA 4W9WA 3UC4A 2PUNA 5KNJA 4AZWA 4G31A 2E9UA 2QR8A 3H4JA 4G16A 4XG3A 5ANOA 5DR2A 5EG3A 3HYHA 5GIPE 2JBPA 4ALVA 1ZZ2A 4AGUA 4CMOA 5IMEA 2A0CX 5AX3A 2WNTA 4IAIA 1FGIA 3BHVA 4WG4A 1OUYA 3VVHA 4QYHA 2C6OA 5CEOA 4H3BA 3NNUA 4I20A 4EUTA 1H1PA 4ZOGA 1YXTA 4M14A 4CLIA 5AUXA 1UU3A 3PJ3A 4RJ8A 5HE3A 4D5KA 1B38A 3EZRA 1LP4A 4LRKA 3S95A 5D41A 4ASDA 3MPMA 5HI2A 4HGEA 3QD2B 5KMNA 3O8UA 2CLQA 2XNMA 3MVMA 5A14A 3QD3A 1GY3A 3CQUA 3MVLA 4Y46A 1R0EA 5HE1A 4CFXA 4BDJA 2QHMA 3SD0A 5CI6A 4FNWA 3VUHA 3S00A 3E62A 1J7IA 1SVEA 5FTQA 3UO6A 1O6KA 3H0YA 4Z7GA 5DPVA 2EUFB 2ITTA 1BYGA 2XK3A 3D14A 3DPKA 1UU7A 3LFCA 3QXOA 3ZBXA 3AKLA 4XLVA 4K1BA 4D58A 3SDJA 3B2WA 4L68A 3R02A 3GBZA 4JQ7A 4TWPA 4ZZNA 1QPCA 2CN8A 4GMYA 5EH0A 3QKLA 4UWBA 4E26A 1QMZA 3LW0A 4XHKB 3BWFA 4O0WA 3OXTA 3ZLYA 2ITPA 3IW8A 1JWHA 2CHLA 4KIKA 3TNWA 4HVDA 4NJDA 4MEDA 3ELJA 1E1XA 4R77A 4FF8A 5L2IA 2H6DA 4YLJA 3A7IA 4DH7A 4DINA 2ZJWA 3NDMA 3NZ0A 2R64A 3MVHA 3WBLA 2F9GA 5BUJA 5CWZA 2IF8A 3SC1A 2W1DA 4DYMA 4YU2A 5IA2A 5L3AA 2YN8A 4LFIA 5E9EA 2JKMA 1W84A 3TACA 2HZ4A 4KIKB 2R3QA 4PPAA 3SX9A 4BBFA 3K2LA 3BHTA 2WMUA 3DJ6A 5AAGA 3P5JC 2PTKA 2QU5A 2X7OA 4KKGA 4FR4A 3R1YA 3TNPC 3G9LX 5LVLA 5AP5A 2XIZA 4YZBA 4NFMA 4BKJA 5AV2A 4GW8A 5CSWA 4RJ4A 5BV3A 4WSYA 4QTCA 3FL4A 4GCJA 4NKSA 3RALA 1RDQE 3CS9A 3MJ1A 3MV5A 4I41A 3WYXA 3A62A 4DAWA 4JL9A 1XJDA 2ZDTA 4XP3A 4EHZA 5L6OA 2Y8OA 4EBVA 2R3JA 4CZUA 5CS6A 3PJ8A 4XX9A 2VN9A 5D9HA 2Y0AA 2YM8A 4ZS0A 2Z7RA 3HRCA 1M14A 1U5QA 2CNVA 4O4FA 4E4XA 3PG3A 4U8ZA 4HVHA 2QI8A 3W16A 3BV3A 4BYIA 4LL0A 3VUMA 2HOGA 4LG4A 3S3IA 2ZYBA 5CEQA 2I0EA 3KVWA 3FL5A 4QMWA 3II5A 4AN2A 3U54A 3TZ8A 3QTUA 3KULA 5A4LA 4O22A 3ZZEA 4XV9A 3WZJA 3DAEA 5HZNA 3ZDIA 3CQWA 2C5VA 5JZNA 4DTKA 2VWYA 4DLIA 2W5BA 3R8VA 4Y95A 5CEMA 2YJSA 2OZOA 4O27B 1VYZA 3CC6A 4O7VA 2YISA 4FEWA 4OTDA 5AUYA 4O7TA 2W1HA 2B0QA 5M07A 4LUDA 3FYKX 2DWBA 3BHYA 4JIKA 3KRJA 4PTGA 2W4KA 3R8UA 2BUJA 5AP7A 3Q5IA 3MB7A 5BMMA 1MP8A 3FWQA 1YHVA 1Q99A 2CGXA 3DBCA 3VC4A 5BVDA 3DKCA 3RAIA 3JUHA 1JQHA 1WVYA 3ZSGA 5CF8A 4TYGA 2VNWA 3VHKA 3CBLA 5DOSA 4C61A 4B6LA 1DM2A 2WMAA 5L8JA 5HU9A 4BZOA 1APME 1OKVA 4TTHB 4S2ZA 3FZRA 4U7ZA 4YJSA 5I5ZA 3S1HA 4DA5A 1XH9A 2HXQA 2YACA 4BJJB 3L9NA 4EYJA 3QX2A 4F0GA 4KIPA 4DG3E 1WZYA 4RG0A 3TKUA 3DFCB 4L3LA 4R1YA 2XK4A 3KRLA 3LMIA 4NIFB 2BROA 1NXKA 4CKRA 5BVOA 3KU2A 5DE2A 5LMKC 2XJ2A 3FPQA 2IZUA 3I0OA 3D94A 3PPZA 4G6LA 4NEUA 2PE1A 4YZNA 1OL2A 4PNIA 4ALUA 3IQ7A 3NPCA 3R6XA 4FVRA 4YBJA 4F4PA 5HBJA 1FQ1B 1Q5KA 2O5KA 3NCZA 2QOCA 3A99A 2YM6A 5ETFA 3R30A 1PXLA 2BHHA 2C0TA 3TG1A 5AR7A 4F1OA 3AD5A 4GVJA 4GYIA 3COIA 4QP2A 5DI1A 3UOKA 4UALA 5FUTA 4OTWA 4IB0A 4F0FA 5HTIA 4NW5A 4RVMA 5JFVA 4IM2A 3CEKA 3ALOA 4QYYA 3NUSA 5C4LA 1ZYSA 1KWPA 2VTIA 5HD7A 5HD4A 3K3IA 4J96A 2LGCA 3UJGA 2YCRA 3BLAA 4DE4A 1Y6BA 4G3CA 2G2FA 2SRCA 4FEXA 3CKXA 4U97A 5CALA 2DS1A 5F9EA 3D7TA 2VX0A 4I22A 3AKKA 3FSKA 3BIZA 5AUTA 5H8EA 1H1WA 3RHKA 4XG4A 4CKJA 3HGKA 5J87A 1CKPA 1OMWA 3FQSA 2GU8A 4LV5A 1E1VA 3T3UA 5I3RA 1G8SA 2ERKA 3FZOA 5A4TA 4FT3A 3D0EA 5FGKA 4LYNA 5AUUA 2WMXA 3R1QA 1WBSA 4IM0A 3UP7A 5EQYA 4XG7A 5HBHA 4ZEGA 4A9SA 4S31A 5DIAA 3TL8A 4AOJA 1XR1A 2IO6A 1M7NA 3HMNA 3O7LD 4NZWB 4PDOA 4TKSA 4QMUA 4F1MA 3M1SA 3UQFA 2ZM4A 2QO7A 3B8RA 4ERKA 3DKFA 3RAHA 2OJIA 1YWRA 2JKOA 2YDKA 5CAPA 4YBKA 4UN0C 3Q4TA 4EOPA 3AT3A 3QTIA 4D1ZA 3LFEA 2V7OA 5IA4A 2BZJA 3E64A 2WIPA 1P4FA 2XM9A 1GZ8A 4LMUA 3EKKA 5G1XA 2XIYA 3FC1X 4DF3A 2PE2A 5L2TA 3TNIA 2BRMA 2BPMA 2YM7A 3BGZA 2XH5A 3BU3A 3DS6A 2P2HA 2ZDUA 3MDYA 3QRTA 4IVAA 4DHIB 3TZ7A 5GNKA 4ZJVA 3FC2A 4FSTA 4ZSAA 1H26A 4DTAA 5JRQA 4BDDA 5JH6A 5IQHA 2RKUA 4K33A 2YWPA 3CKWA 2EB2A 2F7XE 4WRSA 2RGPA 5AWMA 2R3FA 5DT4A 2W5HA 3QWJA 5CX9A 2GDOA 2EXEA 4M7IA 4PTEA 4LL5A 2ONLC 5M44A 2NRUA 2XUUA 3GP0A 2XNEA 2VZ6A 3GCSA 4ITIA 3MS9A 2O63A 3FLNC 4XOYA 3FUPA 4WG3A 4RFMA 3E7OA 3UPXA 5AADA 4II5A 1KE9A 4DEBA 4KINA 3T9TA 1J3HA 4QP1A 4BCNA 3M11A 3FMDA 4QQCA 4P7EA 4L44A 4O96A 4UZHA 5FBOA 5FTGA 3ZLSA 4C4IA 2FYSA 2HWPA 3VBTA 5BUIA 5JQ5A 1WAKA 5BX0A 3ENHA 5A6NA 3JS2A 4KA3A 5HESA 3RCDA 1YI6A 2NNWB 4OTQA 2HZIA 3Q2MA 1GIIA 5DVRA 4BI1A 3UIMA 1UVRA 4AUAA 4NSTA 3OS3A 3E5AA 3ZRKA 1V1KA 2NP8A 3VQUA 3I1AA 3KVXA 3H3CA 3ET7A 2Y4IC 4AGCA 2Z2WA 3ZXTA 2WOUA 3D9VA 4WNMA 1LEZA 1ZRZA 2R4BA 3QZGA 1F5QA 1OPKA 3KN6A 3OTUA 3P7AA 3AQVA 4IX3A 5ACBC 1SYKA 1ZXEA 2O8YA 2R2PA 3EHAA 5E8UA 2X8DA 3ZH8A 4AF3A 4DFYA 4CGAA 2XK8A 4BTFA 3VBYA 5EFQA 5IQEA 3OTVA 4AXAA 4KAOA 4NW6A 1ZOHA 3KULB 4L43A 4I1ZA 3FXXA 5GJFA 5FM2A 2VX3A 2UZBA 2Z60A 4UXQA 5GZ8A 4ZSGA 5IQCA 3OW3A 5ANEA 4NTSA 2UV2A 4EJNA 1YDRE 4BHZA 2PZ5A 5E8WA 5EI2A 3LLAA 3P08A 5L2QA 4FODA 1WBVA 3EFKA 3MIYA 2BHEA 2WEIA 2PK9A 2XYUA 3FQEA 3PA4A 3LFQA 4W4XA 5T3QA 2PUPA 2VTTA 4EKKA 2YWVA 3TIYA 4PDYA 4F78A 5KUPA 4FTLA 4GK4A 3O96A 1NY3A 1FPUA 3NYOA 4L6QA 4RWLA 3DKGA 4JG8A 3RHXA 2QC6A 3NIZA 4N4SA 3GCVA 4UMTA 3R01A 5HVYA 4MK0A 5AP1A 2ITXA 1P2AA 3HUCA 2JDTA 3NW7A 2YDIA 5DLSA 5EI8A 4FEVA 5ETIA 2UZEA 2C3LA 3NUPA 4ENYA 5DT3A 1YQJA 3P0MA 2I0HA 1OIYA 5ANIA 5JEBA 5H8GA 4E6CA 4PMMA 2PULA 4E5WA 3ODYX 4ZLYA 3IOKA 4O38A 4EHEA 2C6IA 5JKGA 4NKAA 3UQCA 4L7FA 4OTGA 1GOLA 1JAMA 2VTOA 4D28A 4BIEA 5D10A 3C50A 4FNYA 4GT5A 3FI8A 2RFDA 4A07A 2GTMA 2UZDA 3NNWA 3U9CA 4ENXA 1WBWA 3OWLA 4BBMA 5IUIA 4FV4A 2IW9A 4FJVA 1Q8YA 2BTRA 5TKDA 1U5RA 4YMJA 4MNFA 2F57A 4HNIA 2VD5A 4CYIA 3TUCA 1XWSA 1Z5MA 4FT0A 2QOOA 4AT4A 2E2BA 3JXWA 5IQIA 4K77A 4IVCA 4UBAA 4X3FB 2BIKB 3CCNA 2O64A 5DT0A 5AUVA 2UW7A 3FLWA 1TVOA 3IS5A 3JY9A 4KWPA 2CN5A 3ORLA 1TQPA 3FPMA 4X2JA 2AYPA 5CXZA 1BI7A 5GHVA 1LEWA 2XIKA 3AC8A 5TE0A 3I79A 2G2HA 3AMYA 2UVZA 4BCGA 3PXZA 3IOPA 2R0IA 4DGLC 5HORA 3ZZWA 3G6HA 4I4FA 3RPYA 4RIYA 3MY1A 1UKIA 5IQGA 5ACKA 3U87A 3OW4A 3QQHA 3D5VA 3MI9A 3RK9A 5HG9A 2ITZA 5CYIA 3BLRA 4PMPA 3U6JA 2CCHA 2JDRA 2R3MA 4FYOA 3GGFA 3RK7A 4QTEA 5B2KA 1PMEA 2LAVA 3DQXA 4C34A 5EHLA 3GC7A 2PL0A 3CD3A 4G17A 4EUUA 3QKMA 4ASEA 4QP8A 4CMUA 5A4EA 4AW2A 1DAWA 3G51A 3AG9A 2RFNA 4L52A 2C30A 4S33A 3DTCA 3REPA 3PY3A 2YM5A 5EKOA 4CFUA 3G5DA 1URWA 1SM2A 3KXXA 4PV0A 4DH3A 5CT7A 2WTKC 3HLLA 4D2PA 3UZPA 2BKKA 1JKTA 3A61A 1BI8A 3VS2A 2ZB0A 4FZ6A 2QURA 3L8XA 4G5JA 3UZRA 1H00A 2ETMA 4ZK5A 4HYSA 2X7FA 1W7HA 2QOBA 2Y9QA 3C51A 3ENMA 1FGKA 4IB3A 3C4CA 1YDTE 3PIYA 4RIWA 3KGAA 1PMNA 3HEGA 3LOKA 3QQJA 4AGWA 3C5IA 2W1ZA 2WPAA 1JKSA 3ORPA 3VF8A 3EKNA 3P1AA 2XEZA 3PA3A 4F63A 2HW7A 5E1SA 3AGLA 3G2FA 4I24A 4FRFA 4IAKA 3LCKA 2UZVA 1I09A 3CQEA 1SVGA 4RIOA 3PFYA 1JBPE 4NWMA 2FSOX 3NSZA 1OL5A 1UKHA 2OBJA 3NUYA 4AXCA 1NW1A 3TJDA 1H24A 4EWHA 1WBNA 4HYHA 1BUHA 3O71A 1OGYA 2PVKA 5E7RA 3F3VA 5EM8A 3QZHA 4JBPA 3SRVB 1UA2A 3A2CA 1FINA 3ORMA 2YIYA 3SG8A 3RPVA 4BCKA 5I4NA 3BZ3A 5I9YA 2BVAA 2JIUA 4GG7A 4BN1A 1KSWA 5CU0A 4C7TA 2XZSA 2YDJA 2A27A 3K3JA 1QPEA 4BDGA 4YURA 5EDPA 3FV8A 2WIHA 4M84A 1OECA 4BIBA 5BYYA 2VTPA 2BFYA 4HGLA 3W2QA 4B0GA 4O84A 3SG9A 2VU3A 1YW2A 4UMQA 2RF9A 2Y6OA 4O6EA 2YM4A 3R04A 4FZ7A 2YABA 2WTDA 4MD8E 1WVWA 3EOCA 5E91A 3RJCA 3ID6C 5CAVA 2XRUA 3ORNA 5KO1A 2C6MA 2B1PA 4JLCA 2JFMA 3Q04A 4HJOA 4I0RA 2X9EA 4XMOA 4BGGA 5KMIA 3R7GA 4R3PA 4W4WA 4CV8A 2WTIA 2X0PA 4AT3A 5ANGA 4AFEA 5J7BA 2VWIA 3C7QA 1PRYA 1V0OA 4DGNA 3UZTA 3BRBA 5FWKK 3VBWA 2R3NA 3FMLA 3NNVA 3ATSA 4PL5A 4H39A 2XAOA 4AQKA 5E92A 3MY0A 3ZFMA 4EH7A 4YTCA 5JZJA 2JKQA 4BCQA 1ND4A 5E8ZA 4AE6A 4O7LA 3QTXA 3I4BA 3ZONA 5HQ0A 4A4XA 4QNAA 5CVGA 3EQIA 3UPZA 4ZTLA 3IW7A 1MRVA 4YZCA 3F5UA 4EQUA 4FIHA 1PKDA 4WNKA 4FKQA 3PXKA 4CT1A 5HO8A 2UW8A 3PVUA 4M69B 2QOKA 4QT1A 4FGBA 3TUBA 4RQKA 4ZIMA 4BDCA 4BDIA 3ML1A 2J0KA 4MTAA 4TWOA 4IVDA 3BBTB 3U8WA 1R1WA 3HV7A 3QTWA 3ZOSA 1XQZA 4L42A 4YNEA 1Q8WA 3FHIA 4UWYA 4E93A 1OL6A 3QTZA 3PWDA 3TN8A 1ZZLA 3SQQA 3WOWA 4ANNA 3TKHA 3LIJA 4BCPA 1YXSA 5FQDC 1K2PA 2V55A 4XV2A 4F99A 2QOFA 4JBOA 4FGRA 3V5WA 2OICA 2RFSA 4JQ8A 3SHEA 3P7BA 4HPUE 2PVNA 4YC6A 4FTAA 4O6LA 4BDFA 1PY5A 5IMXA 3C5UA 3VJOA 2C6KA 3UIXA 4D4SA 2B54A 4FK6A 2IZRA 4JJRA 4M3QA 4ZLOA 2QO9A 2VTMA 2V7AA 2RL5A 3IG7A 1U46A 3HMMA 3FBVA 3Q9WA 2IVSA 4ZTSA 4I0TA 1IAJA 2BAKA 4F6UA 3TNQB 5E1EA 3VQHA 5AAEA 2C5YA 4BCOA 4D2WA 3SOCA 4KUJA 1OI9A 4EOIA 3SW7A 2HENA 5M09A 3A8XA 4PP7A 3VRZA 3P23A 3VF9A 4EH2A 1W2FA 3OMVA 4IFGA 1WCCA 2CKOA 4K11A 4EH4A 4HGSA 3R9NA 2VTHA 4IZ7A 4AZTA 2J4ZA 1PJKA 3PJCA 2GNJA 3SV0A 3ZEWA 4XP0A 3Q4CA 1WMKA 3PP1A 4OBOA 4RQVA 5F20A 5M56A 4OT6A 3ULIA 4I6HA 2IW8A 2I40A 4KKEA 4QMLA 5AP6A 2IZTA 3ZFYA 5CF4A 1PXIA 2HXLA 2A1AB 5JGBA 2BRNA 4AU8A 2OJFE 2H9VA 2J0IA 4NTTA 4CG8A 2P0CA 4BDAA 3KQ7A 5T68A 1XMLA 3Q4UA 4WUAA 3FLSA 3R1NA 2OIBA 4ASZA 2OLCA 3OXZA 3PZHA 2J51A 1XH7A 4JG6A 3Q52A 2WQMA 4O86A 2H8HA 3MPAA 2JEDA 3QQGA 3WZDA 3BBWA 3PYYA 3QUEA 5FBNC 4Z9LA 4FIJA 4TW9A 4JR7A 1XH8A 3DK6A 4BWPA 1JSTA 2BMCA 2XNOA 3AC1A 3COMA 4IWPA 4O0SA 2UZOA 2Y6MA 5EW9A 4F6WA 3D2IA 4HCUA 4RVTA 2EU9A 4DEEA 2JLDA 1G5SA 3AC2A 2VRXA 2Z7LA 3IW6A 2A4LA 2XIRA 3M2WA 4G34A 4EK8A 3UNZA 4AG8A 5FLFA 5DWRA 4YUQA 4R3RA 4O0YA 3NYNA 2C69A 3QCQA 4GJ3A 5KMKA 4XS2A 1J7LA 1Q8UA 3DY7A 4G9RA 3AGMA 5JRSA 5D7VA 5HCZA 4ZLZA 5IH4A 3NUAA 3MTFA 2HW6A 2JDVA 4E8AA 2C47A 3MESA 3HX4A 4RMZA 1FVRA 3PVGA 3V5QA 4B7TA 3OFMA 2GFCA 1Y8GA 4J53A 3G0EA 4FEQA 4YJUA 4B9DA 1W0XC 4FSMA 4U81A 5KHWA 3F6XA 3MA3A 1ZWSA 2QO2A 3HUBA 1W83A 3QCXA 4FKUA 4RWKA 4AGDA 4BCJA 4OW8A 3ITZA 4FC0A 5GZ9A 3EQBA 3R8MA 4O7NA 3CY2A 5DRBA 4FK3A 4ERWA 3HNGA 4E20A 1H0VA 2RFEA 3UG1A 5CANA 1ZOGA 5BNJA 3IKAA 4BJJA 1TQIA 3EB0A 4YJQA 5CENA 4QMYA 4A9RA 2C6DA 4E6QA 2BILB 3VONA 5AUZA 3UE4A 4CFFA 2ITVA 1RJBA 2VTNA 3QLFA 4FKGA 4JG7A 4PL4A 4WHZA 4TYHA 1Q3WA 4AT5A 5KX8A 4GUBA 5LMAA 3RPOA 3W10A 2UZTA 3ZTXA 2HZNA 1YWNA 3UIUA 3ZSIA 3GB2A 2ITNA 4FL1A 4GV1A 4Q9ZA 4LUEA 4DCAA 4WT6A 5HX8A 2H96A 5C8KA 3UQGA 2X81A 1MQBA 3I81A 4JX3A 4MAOA 3NWWA 4G3FA 5CU2A 5AV4A 4FNZA 2QVSE 2QLQA 3EQCA 5LCJA 3R7EA 5CT0A 2VV9A 3FJQE 3TV7A 3S2PA 4A9YA 4FKRA 4N6YA 5C1QB 5CU6A 1O9UA 3HDNA 3EN6A 4X2FA 2J9MA 5AP3A 4ZSJA 4U42A 4HW7A 2R5TA 4FNXA 2RG5A 4BWKA 4D1XA 2XKDA 4F64A 3F2RA 5FP6A 4QP4A 3CGOA 3V5LA 2BRHA 3ZRMA 3QYZA 3HVCA 4M8TA 4OT5A 4CEGA 4GK2A 4MF0A 2GQGA 2JIVA 3PVWA 4XH6A 4B4LA 4IAYA 2F2CB 3V5PA 4RX9A 4FSZA 3LQ8A 4ZP5A 4KABA 4OLIA 3F88A 3VBQA 3MJ2A 2FSMX 1J1CA 3IW5A 4RJ7A 4EKLA 3KRXA 4FZFB 3F3ZA 3R9OA 5I9VA 5IU2A 4IZ5A 2PHKA 3AT4A 4X3FA 3OUKA 4FTJA 3AKJA 3QHWA 5LWNA 2QKRA 2EXCX 3W0MA 2R3KA 4J8NA 5CEPA 4C62A 1U59A 3JR1A 3FDNA 4DLJA 2X2KA 2W1CA 3BGPA 3CR0A 3MBLA 4PP9A 3EWHA 4Y8DA 4APCA 4NL0A 3BE2A 1JLUE 3BU6A 4IJ9A 5IDPA 5KZ0A 3OOGA 3GQIA 1KV1A 2OI4X 2VTAA 3OCTA 3V51A 2WMRA 4AZVA 4OTPA 3BYSA 3TMOA 5BVWA 4FKPA 5BYLA 5HCYA 4L8MA 4IVBA 4XG2A 3QA8A 2QD9A 3UYTA 1ZMUA 3W32A 5EKNA 4MUQA 1REKA 2C5OA 2C4GA 2C5NA 3KY2A 4XBUA 3E63A 3G15A 3R9RA 4OUCA 3QQUA 5EM6A 2FUMA 3TNHA 2VO6A 3EZVA 4V0GB 3D5WA 4IEBA 4GG5A 2GFSA 4C2VA 3VWAA 4BDHA 2X6DA 2PVJA 4QPSA 4FTIA 3Q9YA 4Y72A 4M67A 5EW3A 3QALE 3VUKA 4DFZE 2ITWA 3PZEA 4M15A 4CLJA 3NFFB 5JN2A 1WBTA 4F9AA 3UDZA 2VGOA 5TR6A 2QCSA 4O83A 4D9UA 4O7WA 2ERZE 3KMMA 4ARKA 4MXXA 1FMKA 3MA6A 4D4YA 4DN5A 3LXKA 3IGOA 3P5KA 4DDGA 2JDSA 2Z02A 3HAMA 4U80A 3NAYA 4JX7A 4YSMA 3NMUF 3PPJA 1M2QA 1KOAA 4AZSA 5ETAA 4LOOA 4BCIA 5GINE 5LCKA 4BKZA 3MGYA 4GT3A 1OBDA 3PUFC 1XHAA 5AR2A 1PHKA 1MUOA 3DNDA 3WF5A 3WZEA 4HCVA 2WTWA 4LMNA 2UW6A 4RZWA 3QTRA 1NVSA 4GT4A 5GJDA 4J52A 4RX7A 5E90A 1NVQA 1U4DA 5K4JA 5TO8A 2FGIA 3CTHA 4RJ6A 3RNYA 4USFA 1GZKA 1PMVA 3HV4A 5M06A 2G01A 3QRJA 3VIDA 4DEGA 4L45A 4GU6A 2C3JA 4C4JA 4E1ZA 4BIDA 3HECA 3N4UA 3GT8A 4H1MA 3VUDA 5HVJA 3UODA 4YZMA 4FL2A 3C9WA 1QL6A 3BX5A 5EYMA 5LVOA 4CFVA 3LFBA 5AP0A 1ZLTA 4CRSA 3IECA 4DGGA 4PRJA 2J90A 3QLGA 3GC8A 4UV0A 4F65A 4C4HA 3H0ZA 4DFNA 1J7UA 4CV9A 3NLBA 3C0IA 3QCYA 3D7TB 5HNIX 5D12A 4J99A 5L6WL 1JNKA 4BDKA 4TT7A 4BR3A 5LJJA 3Q5ZA 4ITHA 3WIGA 3CLYA 3LHJA 1XO2B 4X2KA 4FKVA 4QQTA 2FO0A 3BGQA 4GIHA 4EH5A 5CXHA 3VS0A 2CGUA 1IR3A 2OXDA 3EL8A 3L8PA 4FSWA 3TDWA 2G9XA 2XS0A 4NM7A 4WA9A 3EIDA 1PF8A 3UDBA 3I0QA 1ZAOA 2WMQA 1JVPP 4WSQA 3DQWA 4EWQA 3IONA 2JD5A 3KFAA 5FEDA 3RGFA 5KMMA 3R2YA 4FTTA 4JOAA 4CQGA 1Q3DA 1X8BA 2J2IB 5J8IA 3HMPA 2P4IA 3VS7A 3H10A 1B39A 1CSNA 4EORA 4U3ZA 3E3PA 4L46A 2DQ7X 2WOTA 3W0RA 5BYZA 2B53A 3CTJA 1YXXA 2C6LA 3AC3A 4GU9A 2YAKA 3RP9A 3EFWA 3VBVA 4K18A 2O3PA 4V01A 5J5SA 2GQRA 3UNJA 2W1EA 5FD2A 3UP2A 4IIRA 1U54A 4L00A 3RNIA 1J91A 4WNOA 3R21A 4ZY6A 3WF8A 4C37A 3KMUA 4P5ZA 3RKBA 3VUIA 4BCMA 3R7UA 4IHPA 4HNFA 3QD0A 2PYWA 4O0XA 4YC8A 2W96B 2AC3A 3F66A 4Q2AA 2BR1A 5M51A 3O17A 2FA2A 5HHWA 1YOLA 3O7LB 4OTFA 4EHGA 4NM5A 2VWWA 4DITA 3IDCA 3LFAA 4R7BA 1ZYJA 4X3FC 4DT9A 4F7SA 2C1AA 4A7CA 3GVUA