4YMNA

Structure of human dna polymerase beta complexed with n7bg in the template base paired with incoming non-hydrolyzable ctp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural and kinetic studies of the effect of guanine-N7 alkylation and metal cofactors on DNA replication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 101
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ymnA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ymnA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ymnA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ymnA03
2C2RA 3TAPA 5CP2A 3V7KA 4DQPA 3RRGA 7ICNA 4YN4A 5J2FA 4EBJA 2MUTB 3UXOA 1SKWA 5F2VO 3SV4A 5CWRA 3C5FA 4XA5A 1MIWA 2ASDA 1Q78A 4M9GA 4M9JA 3ZDDA 3ZDAA 1NK6A 2W9BA 4F2SA 4B9NA 3JYYA 3T5HA 4X0BA 4JK1A 4DSLA 1KSPA 8ICGA 4P4OA 7ICVA 9ICLA 8ICLA 3H39A 1KRPA 9ICIA 4X4NA 4C8LA 3GIIA 1IXRA 1TVAA 4E0DA 4QWCA 1PX5A 1ZQYA 4EP7A 4F4ZA 3ZDCA 4B9VA 2JZBA 3TFRA 2FMQA 4KLQA 1R8CA 4FHPA 2MAXA 1RXVA 2IHMA 2PFPA 4FS1A 5HRFA 1TAQA 3PMNA 5J0QA 3PW0A 4Q44A 4NKUA 1COOA 4B9UA 4X4TA 2O5AA 2DR9A 2DRBA 1KFSA 4IQWA 1N48A 1ZQPA 4F93B 1NK5A 8ICBA 4TQSA 4J9LA 1RYSA 3C2KA 1TFWA 1NJZA 4IRDA 4J9QA 3UPQA 3V7JA 3OV7A 3WFOA 3H40A 1AROP 4Q43A 3PNCA 4F4XA 4O3RA 2V4QA 4I2GA 4J9PA 2FPMA 4YXJA 5J0TA 5J2KA 1S0NA 3RAXA 8ICIA 2JEJA 4PGXA 4AT7B 5KT5A 5EOZA 4O3SA 5L9XA 2BPGA 5J0SA 4DSIA 4UAYA 4RQ7A 2PFOA 7ICOA 2ZH2A 4KTQA 4BWJA 4M2YA 4KMUA 5J0PA 1ZQXA 3BQTA 3H8WA 3HPOA 1ZQTA 1QSYA 4G3IA 1NZPA 4R66A 3ZDEA 3EYZA 3TANA 2PFNA 3RJJA 5DBBA 2NRWA 4DLGA 4ELVA 3MDCA 3N97B 2J6TA 1JN3A 3HX0A 1SL2A 9ICEA 2ZH3A 4JWNA 4QWEA 3FDSA 2KN7A 4DL2A 1WCNA 3Q8MA 1R89A 2BCVA 2R8HA 7ICUA 3WFSC 3MGIA 3GIMA 5HP4A 1JX4A 3RJEA 3C2MA 3RJIA 1ZQKA 3E2EA 4UBBA 3HJ1A 3GFKB 4K4IA 5IIMA 3H8JA 5DLGA 4ECXA 4IQVA 4KN4A 3AU2A 4Z6CA 1B43A 4Z6EA 2C2DA 4PH5A 5KFAA 2PI5A 3RR8A 2M2TA 1KNYA 2DPJA 1BPEA 4JUZA 8ICRA 5CA7A 1ZQWA 5DEDA 3GV7B 3M9MB 3OVSA 1V9PA 1NK4A 1K1QA 5JUMA 9ICAA 8ICVA 1MC8A 4QWBA 1TV9A 1D8YA 4BXOA 3AQNA 4AT9B 1JXEA 5HRGA 2W9CB 3V72A 2ZTEA 3MDAA 4ED1A 1BPZA 2DR5A 1BGXT 4ATBB 1XS9D 4QZCA 1KFTA 3T5JA 2P66A 1DGSA 1QLNA 4QW9A 4WC7A 2Y1JA 2XCAA 1L3VA 4ED0A 2JEFA 9ICUA 3LDAA 5KFJA 3RBEA 4P4PA 4KITB 5KT2A 5EWEA 1JXLA 4ELTA 4AT8A 3ISCA 3PV8A 3JPOA 1MQ3A 5IINA 9ICVA 3PX0A 1NK8A 4GC7A 5L1KA 5CB1A 4M6WB 4RU9A 3PO4A 5HRHA 4E80A 8ICWA 7ICHA 3OUYA 1H38A 5J2CA 5KG6A 4RQ4A 1ZETA 5DB6A 4DS5A 5J2IA 2UVWA 4MFFA 2HHQA 2KFZA 1TKDA 4DOCA 1NOMA 3C23A 4IR9A 4I2HA 1L5UA 5CR0A 2RDJA 2DR7A 2BHNA 1NK9A 2BPCA 3K4GA 4RNOA 3PW7A 4IQUA 4MFAA 3QE9Y 1S0MA 4I2JA 5DQGA 4DFMA 4LZGA 1JMSA 2FPLA 1EXNA 8ICTA 4DL3A 2IA6A 9ICMA 1JQRA 1YLQA 1QSSA 1KTQA 5F9LA 3GV8B 5DGAA 1TFYA 3M8RA 4RNMA 1U49A 3ORYA 2VA8A 4F4WA 4GC6A 4FBUA 4TQRA 2W8LA 4X4RA 3RAQA 2BQUA 9ICWA 5KG4A 4F91B 3TQ1A 1Z00A 2AU0A 2BR0A 4J9NA 2WTFA 4LZDA 2XY7A 3MFIA 2AQ4A 4QZ9A 4R8UB 2XY5A 1BNPA 4J9RA 4PHDA 3UPSA 2AQ0A 3T5LA 5TZVA 4X4SA 5DG9A 4KLJA 4X4VA 4GXKA 4RQ6A 5F9NA 4PGQA 4RPZA 8ICXA 3WFQE 3NGDA 1ZQJA 3C1ZA 5DLFA 5DDMA 1ZQRA 4F4YA 4QZBA 1BPXA 5KFNA 4QZIA 1S77D 9ICSA 1KEJA 2FMSA 4FHYA 5DBAA 4ECYA 3JPQA 2Q66A 4RQ0A 4RQ8A 4F5NA 4KLOA 4EBKA 4AT9A 4QW8A 5KT4A 1SL1A 1BVSA 4O3NA 4Z6FA 1ZQUA 2C2EA 2ZH6A 3Q8RB 2FMPA 3OHAA 4NLZA 3G6XA 1IM4A 2BQRA 1S97A 1ZQAA 5J0WA 1K1SA 5L1IA 2IHNA 1NJYA 5KFMA 2ISOA 4FH3A 3GIKA 2HHSA 1ZQDA 2HHUA 5KG5A 3V6JA 1Q79A 5HMMA 9ICFA 9ICJA 3AUOA 3MGHA 3M9OB 9ICCA 2DFLA 9ICNA 2KFNA 1Z3EB 4KLHA 4R64A 1F5AA 4FHWA 3IM1A 1VFGA 1L3UA 4ELUA 3C66A 1UT5A 4KLSA 2M9NA 4PHPA 1TK0A 9ICOA 2DVIA 2ZJ8A 4LT6A 1BPYA 2XC9A 1S9FA 2ZH5A 5KG3A 3MR3A 4ZH4A 3JPTA 2ZH4A 4X5VA 4KLIA 2HVIA 4E7XA 3T5KA 3WFRE 3Q8PB 3MR2A 5L1LA 2AJQA 3AQLA 2ZUDA 4YMNA 5HNKA 3BQ1A 4B9TA 4M9LA 1U48A 3RB4A 2J6SA 8ICHA 3AU6A 1NKEA 4PGYA 3RH4A 4BWMA 4BGDA 4DSKA 8ICOA 5KFQA 2C28A 8ICFA 1NKCA 3B0YA 3NYBA 2UVVA 4ECWA 4ECZA 2A1JA 2HHTA 2ISPA 4ECVA 4J9OA 4UD5A 4KLLA 3AQKA 1HUZA 4PHEA 1ZQNA 2RDIA 5KFKA 1DOQA 4JV2A 5KFTA 7ICRA 1UETA 3C21A 4DL5A 4DQRA 4DSFA 4KLTA 4DEZA 1UEUA 3C5GA 2ZH9A 4MF2A 1ZQZA 5EWGA 4J9KA 1ZQBA 7ICTA 4PHAA 4XUSA 4KN7A 9ICRA 2I9GA 4PPXA 3PR5B 2MUTA 4ECUA 4I27A 4IQTA 5HHHA 3LWMA 7ICFA 4DOBA 2BGWA 7ICSA 4DSJA 4I2DA 3ISDA 3KHRA 3RB3A 2M2WA 4DQSA 4RT3A 3B0XA 3FYHA 4QWDA 2P6RA 3TI0A 4S3NA 5HRDA 5KG0A 4F2RA 4P4MA 2PI4A 2GWSA 8ICKA 2KZZA 2R8KA 5CJ7A 4MEXA 2DRAA 4RT2A 1ZQOA 2P6UA 4NM2A 4O5EA 3JPSA 1QSLA 2NRKA 2Y1IA 3HWTA 5DB8A 2ZJAA 4DL4A 4NY8A 3H7IA 2HHVA 3PW2A 5L1JA 2BQ3A 3SYZA 8ICJA 5KTQA 4NLGA 3BQ2A 3H3AA 2LYHA 4FS2A 3PW4A 1BPDA 2BDPA 4IRKA 4UB3A 2Q0ZX 3MABA 2XCPA 1UEVA 4WBYA 1SKSA 1C7YA 7ICEA 4C8NA 5C5JA 4NLKA 1FA0A 1MIYA 1VJ7A 5KFLA 3QZ8A 2PBEA 1XU4A 4WC6A 3PY8A 7ICQA 1BPBA 2VA3A 4X0AA 2NRTA 4B9SA 8ICPA 5KG2A 4AT7A 2BCRA 5J2JA 5KG1A 4YG2A 3HT3A 1ZQGA 2ZH1A 9ICGA 4C8MA 2FLLA 1R8AA 2ATLA 2F1JA 2XGQA 2B21A 1A77A 2R8IA 2BCSA 3N4MB 8ICMA 3TFSA 3BJYA 1T8EA 1R8BA 4IR1A 5IIOA 4ECSA 1ZQSA 1HUOA 4O3QA 2F1IA 5KFOA 4F5QA 4EBCA 1RYRA 3UXNA 7ICIA 8ICAA 4I2FA 4WC1A 4I2EA 2ZH7A 3EW9A 2NRXA 5EWFA 1ZQMA 3LWLA 2W9BB 5KT7A 4RZRA 2IMWP 3PX6A 2V9WA 2ZHAA 2ZJ5A 4RWQA 4TUSA 3JPNA 5KFVA 1X2IA 4EBDA 2O1PA 1U9LA 3C18A 1S0OA 4O3OA 3Q8QB 3RB0A 5KFDA 3PW5A 5HRLA 5HRBA 2ZUBA 2JZBB 5HMLA 2FPKA 4RWNA 2ZH8A 1DK3A 4I2IA 4DQIA 4YP3A 5KFCA 3HIYA 5KFRA 3PR4A 4QZFA 4RPXA 4EEYA 4I2AA 2NRZA 4EYHB 3G6YA 4ED6A 1X9WA 4NM1A 4ED7A 4YXMA 7ICJA 4X4PA 3ZD9A 5IIKA 5J0XA 9ICPA 4NLNA 4KLGA 4FHVA 2W9CA 4DQQA 4DO9A 3WFPA 2XO7A 1X9SA 1ZQFA 4QZEA 3EZ5A 4F4KA 2AGQA 4JWMA 4ATBA 4FO6A 4IRCA 1ZQHA 3HP6A 4F5PA 3M9NB 4RUAA 1A76A 2I1QA 2W9AA 8ICQA 3KTQA 8ICYA 3EWAA 3TARA 4MEYA 3ETLA 1U45A 4DFPA 3IHQB 4DOAA 1U47A 4R65A 3Q8SB 4AT8B 4M9NA 2KZMA 3H38A 1TFRA 4M6WA 5IILA 2W9MA 3PO5A 2BE3A 1XSLA 4RWOA 5KFUA 4KLMA 2ZTDA 1SZPA 4WCWA 3OJUA 3PVXA 4DWIA 3GV5B 4WC5A 5DDYA 5BPCA 4ECRA 1KDHA 3Q8KA 3RJKA 4YQWA 4C8OA 4X4OA 3JPPA 4YR0A 2XY6A 4FHXA 2KZ3A 2HHWA 4DFJA 3H4DA 5DGBA 1RZTA 9ICBA 3RH5A 5IIIA 5J0UA 2BCQA 2M2VA 4ED3A 5KFZA 4RNNA 3MR5A 5KG7A 1BNOA 4RQ1A 5HHIA 3OGUA 1B22A 2ID1A 2HVHA 4X4QA 4YMOA 1XSPA 7ICLA 5CHGA 1T7PA 3RJGA 3HJ4A 4WBZA 5KT6A 4WC0A 2ZUCA 3KHHA 4GXJA 4B9MA 4DL6A 3NTUA 5KFSA 3T3FA 4ED2A 3RRHA 1XC9A 2AGPA 1NKBA 3GQCA 1N56A 8ICUA 9ICQA 4BXOB 2HHXA 4C8KA 3BQ0A 5DG7A 1SL0A 4YVZA 4R8UA 2ZHBA 4EYIB 5D46A 4QZGA 4M47A 4O3PA 1ZQLA 3AQMA 4Z6DA 3OSNA 3KHLA 2AGOA 3V6HA 1NK0A 1L3TA 3BDPA 3SI8A 4RUCA 2DPIA 4FBTA 3H4BA 1D9FA 8ICSA 3L9DA 5HR9A 5DQIA 1UT8A 4I28A 1NK7A 3UXPA 4EZ9A 4UD4A 5KFXA 1ZJMA 4DF8A 2UVRA 3OJSA 4I29A 4M04A 3V7LA 4O5KA 3V6KA 4DLEA 1NO5A 1KFDA 2XGPA 2C22A 1JAJA 1T4GA 5DG8A 4F5OA 1ZQIA 3MBYA 4I2CA 4ECQA 4XQ8A 3OHBA 4WC4A 3KHGA 5DB7A 3OUYB 3LQCB 4KLUA 4MF8A 2NRVA 4TUQA 5J29A 3QZ7A 5D49A 2R8GA 4TUPA 1WOTA 5KFYA 4Q8EA 2ZTCA 4R63A 1ZQVA 4QZ8A 4YR3A 4TURA 1S10A 3C2LA 5KFIA 2PXIA 4I2BA 4UQGA 4DL7A 3THVA 3PX4A 8ICCA 4O5CA 3UQ0A 5KT3A 1D9DA 4ECTA 4K4GA 2KTQA 2UVUA 2DR8A 1LB2B 4YMMA 2J6UA 3QEBZ 1RXWA 5HRKA 4E8FA 4KLEA 2HHPA 5J0OA 3G6VA 4K4HA 5HREA 1U4BA 4JV0A 4O0IA 3M8SA 2OWOA 1CEZA 3EPGA 1JIHA 3OVAA 4FH5A 3PMLA 4ED8A 4YR2A 3QEAZ 4LVSA 3RTVA 3K75D 4JV1A 3EPIA 1QTMA 1TK5A 1S76D 5DQHA 3RR7A 1ZJNA 1Z00B 8ICEA 7ICGA 2VANA 5KFEA 3ZD8A 3OSPA 7ICMA 1D8LA 2F1HA 4DSEA 1SKRA 3GDXA 4UAWA 1KLNA 3ZDBA 4F3OA 2JEGA 2ASJA 5J2BA 3RJHA 3RB6A 4J9SA 3OVBA 5KFFA 8ICNA 4DS4A 4IG8A 1XO1A 2FLNA 1CUKA 4XRHA 4GXIA 1ZQEA 7ICKA 4F5RA 4QZAA 1TK8A 1NJXA 4M0AA 4UB4A 4O9MA 1PZNA 2RFFA 4NKTA 4M5DA 2V4RA 1MQ2A 2BPFA 4UB1A 3HW8A 2BCUA 7ICPA 4UB5A 2JEIA 4EBEA 5BOMA 3ISBA 1MIVA 1RPLA 5KFPA 4CCHA 4DF4A 9ICXA 3MFHA 1LV5A 4YCXA 3RJFA 4J9MA 1OU5A 3JZ0A 5J2EA 4F92B 2KP7A 5DB9A 2BKEA 5HRIA 3H37A 1XWLA 2R8JA 3GIJA 1Y88A 4KLFA 3H8SA 5J0RA 4P2HA 2FLPA 4HYKA 3RH6A 4QZDA 2H5XA 3GILA 5J2HA 5IIJA 5KFHA 2W8KA 4F50A 4RQ5A 4XQ7A 4RPYA 1L3SA 1ZQQA 4RQ3A 5J2AA 4EZ6A 5J0YA 1HJPA 4RQ2A 3MR6A 4KLDA 5J2DA 2ASLA 4M9HA 4X4UA 1NJWA 3C1YA 1T3NA 4MFCA 4Q8FA 4WC3A 5KFWA 3UQ2A 3LK9A 3TAQA 5KFBA 2PFQA 4UB2A 1XSNA 9ICHA 5BOLA 1UA0A 4YFKA 4UBCA 1TAUA 4B9LA 3SV3A 4BDPA 4F8RA 1ZQCA 1S0VA 4QZHA 2M2UA 1X9MA 2A1JB 1MSWD 9ICTA 5KFGA 5DBCA 1WCLA 2IBKA 5DECA 2VA2A 1ZYQA 5HC9A 1DK2A 4NXZA 4QWAA 2HW3A 4YD1A 5J2GA 4DFKA 3Q8LA 4UAZA 2ALZA 1UA1A 8ICZA 1V4AA 4YD2A 3RBDA 3JPRA 4Q45A 4WC2A 3SZ2A 4GLXA 4RWPA 5DKWA 5D4BA 9ICKA
chains in the Genus database with same CATH superfamily
3TADC 4EX7A 3AMZA 3H0RB 5J2FA 4FE3A 5CWRA 2ASDA 1QH9A 5B3PA 1RYUA 2ZIVA 4B9NA 5ALGA 3H39A 4NL9A 1PX5A 2K8BB 4QWCA 4B9VA 2FMQA 4Y2UA 1VJ5A 3GZFA 4FHPA 3SAGA 4FO1A 2O5AA 3J81j 1N48A 4F93B 2O6KA 2OCEA 1NJZA 4IRDA 2VJ4A 4F4XA 3PNCA 3RAXA 8ICIA 5CFUA 5J0SA 1T3QA 2ZH2A 4KTQA 4BWJA 4AT8A 4KMUA 1OW5A 1ZQXA 5EE0A 3RJJA 5DBBA 4DLGA 1L8LA 1Z1VA 3MDCA 3HX0A 3JCFA 3FDSA 3MGIA 5HP4A 3E2EA 3HJ1A 4K4IA 3H8JA 2C2DA 2LI6A 1A6SA 4JUZA 2F44A 5DEDA 1K1QA 2LHTA 1MC8A 4QWBA 1D8YA 4BXOA 5AI8A 5HRGA 2ZTEA 3T5JA 2P66A 5EE9A 2XCAA 4ED0A 2ZG6A 5KFJA 2KSOA 5AKKA 3RBEA 3EUB2 4ELTA 2E1FA 2FI1A 3ISCA 1MQ3A 3JPOA 5IINA 1NK8A 5CB1A 3HKZF 4Y2VA 5KG6A 4MFFA 4IR9A 3C23A 4LEVA 4I2HA 2E5SA 2DR7A 1NK9A 3K4GA 4FFDA 3PW7A 2D3DA 1S0MA 4I2JA 2QLTA 4LZGA 3WKBA 2IA6A 1YLQA 2PMZF 1KTQA 3GV8B 5DGAA 2F8LA 4RNMA 1T94A 4FBUA 2RHFA 4TQRA 2KIVA 2W8LA 2KHVA 3RAQA 2LMRA 5KG4A 2BR0A 1Z00A 2WTFA 3MFIA 3MC1A 1BNPA 1PVRA 5TZVA 4GXKA 5F9NA 4PGQA 3C1ZA 5DDMA 9ICSA 2CXYA 5KFNA 4ECYA 4OJ6A 2WAQF 4KLOA 4EBKA 4AT9A 4Z6FA 2ZH6A 1OXJA 4NLZA 2BQRA 3NVYA 2IHNA 1NJYA 5KFMA 2HHSA 2HHUA 5HMMA 1RDFA 9ICCA 2DFLA 2KFNA 5AK3A 4ELUA 4OJPA 2NO4A 4LEYA 5AM4A 1BPYA 2XC9A 1S9FA 2ZH5A 3MR3A 2ZH4A 4KLIA 4E7XA 3Q8PB 3MR2A 2AJQA 1PK3A 4FZMA 4M9LA 3WK4A 2C28A 3NYBA 2UVVA 3AM9A 3D6JA 5CRXA 1RG6A 4UD5A 3R9KA 4KLLA 2RDIA 1UETA 1TE2A 1COKA 3NVVA 3C21A 2A3VA 2K8CB 3C5GA 2KJ8A 4J9KA 3UM9A 1ZQBA 4HX0A 1B0XA 1LKYB 4I27A 2BGWA 2LYBA 4DSJA 2HN2A 4NWIA 5AI4A 2IOFK 4RT3A 4QWDA 4S3NA 5HRDA 4F2RA 4P4MA 2GWSA 2DRAA 2KZZA 3KZXA 5ALSA 3IP4B 1QSLA 5B66U 5DB8A 2ZJAA 2DL0A 2HHVA 5L1JA 8ICJA 2QB0A 1CRXA 1F44A 3PZPA 2BDPA 4UB3A 2XCPA 4GFJA 1QCKA 1MIYA 5G5HA 3QZ8A 2PBEA 3SAHA 2VA3A 3BZKA 2MU2A 5KG2A 4YG2A 3H0LB 4C8MA 3GU3A 2ATLA 4US9A 2PMZC 4JLZA 2RP5A 5IIOA 2KHQA 4EV6A 5KFOA 4EBCA 3FAHA 4I2EA 2ZJ5A 2DKXA 3AL0B 3JPNA 1X2IA 4EBDA 3UMBA 4O3OA 3RB0A 5KFDA 3PW5A 2FPKA 4RWNA 4I2IA 4RPXA 4O6AA 2E1EA 1UQVA 4NM1A 4ED7A 4MHVA 2KVSA 2K89A 1SV4A 5IIKA 4Y2PA 5J0XA 4NLNA 3FC4A 4G9BA 4DO9A 2XO7A 1X9SA 1X66A 4QZEA 3EZ5A 4ATBA 3HP6A 3M9NB 2QARB 4IS7A 3T79A 1SB3C 1U45A 5E79U 1X40A 4BJQA 2W54A 2IOHA 1N5WA 4DOAA 3Q8SB 4NXUA 4OD0A 2MA1A 3H38A 2BE3A 1URJA 2ZTDA 4UASA 4WC5A 5BPCA 3E58A 1KDHA 5JTGA 3JPPA 4YR0A 4FHXA 2KZ3A 4DFJA 9ICBA 2WF9A 5AM5A 3ONNA 1BNOA 5KFZA 4RNNA 5KG7A 1B22A 2YX8A 7ICLA 3PSIA 2LM4A 3DDHA 4WBZA 3KHHA 3T3FA 3RRHA 3M1YA 2HBMA 4B6JA 3BQ0A 1HIWA 1SL0A 2ZHBA 3DV9A 4EYIB 4JLXA 3AQMA 3NUQA 1L3TA 2YMQA 3H0MB 1QQ6A 8ICSA 4NLBA 5KFXA 4I29A 2UVRA 3OJSA 4EGWA 4CNQA 1NO5A 1KFDA 2CRXA 3QU7A 3LVWA 4XQ8A 3KHGA 3OUYB 2OHFA 4PZOA 4MF8A 5D49A 1WOTA 4QZ8A 4TURA 5AK6A 4UQGA 4DL7A 8ICCA 5KT3A 4K4GA 2KTQA 2J6UA 4E8FA 3G6VA 4O0IA 3F5AA 3M8SA 3ALRA 1J2NA 2HBKA 3AQFA 2YMLA 3K7DA 3PSTA 2W04A 2B0CA 1TK5A 2W3RA 5DQHA 1S76D 1ZJNA 8ICEA 7ICGA 3ZD8A 3OSPA 4DSEA 2ASJA 5ALEA 2DWQA 2HMXA 5KFFA 8ICNA 1TK8A 1NJXA 4M0AA 5HC9A 4EBEA 1Z4NA 5BOMA 4O67A 1RPLA 5KFPA 4CCHA 3MFHA 2P35A 2W7OA 2G06A 2OH2A 2KP7A 3H37A 4PJ0U 3GIJA 1Y88A 2XICA 2FLPA 3D2SA 3RH6A 3E0FA 1YT3A 2W43A 5IIJA 1A0PA 4F72A 4RQ5A 5J0YA 4KLDA 1UHUA 1AQ6A 2ASLA 1PUZA 2ZIUA 2BZFA 3UQ2A 2PFQA 1JUDA 4B9LA 3SV3A 5CHEA 2M2UA 2K8AA 1DK2A 4NXZA 4QWAA 4ACOA 5AKHA 4XJEA 3SENA 3RBDA 1JRPA 5AKZA 4RWPA 1RM6C 2G5HB 2C2RA 1VDVA 3QNMA 3V7KA 3RRGA 4YN4A 4RQMA 5F2VO 3SV4A 3C5FA 4XA5A 4M9GA 1SZHA 3T5HA 4DSLA 8ICGA 4O68A 5AKJA 9ICLA 5AKGA 2Y9UA 1KRPA 9ICIA 4C8LA 3GIIA 1IXRA 4EP7A 4F4ZA 3ZDCA 3TADA 3QXGA 3NRWA 1RXVA 2IHMA 2WFAA 5HRFA 3PMNA 4Q44A 2M0NA 4X4TA 5ALKA 2DR9A 2DRBA 3ER9B 1ZQPA 1NK5A 3C2KA 3NASA 5AICA 4J9QA 2YMPA 3V7JA 3QUBA 3WFOA 1AROP 4Q43A 4O3RA 2FPMA 5J2KA 5J0TA 1S0NA 4AT7B 2JEJA 4PGXA 3NWIA 5AIAA 1ZOLA 4UAYA 4RQ7A 5B3QA 2PFOA 3I1YA 7ICOA 3KFUF 5J0PA 3HPOA 4R66A 1QQ5A 3IG8A 3ZDEA 5AHXA 4ELVA 3N97B 2EAPA 1SL2A 9ICEA 4MKPA 4JWNA 1R89A 2CPRA 1D8BA 2R8HA 2FJ6A 2GH1A 5ALPA 1JX4A 3RJEA 1ZQKA 3QUCA 4ECXA 4IQVA 4KN4A 3AU2A 1BPEA 8ICRA 3S6JA 1NK4A 1YZ7A 5JUMA 8ICVA 1TV9A 1GPJA 3AQNA 2GOLA 2XI9A 2G09A 2W9CB 2EANA 3WU2U 1X6IA 3DEEA 4IL6U 1BGXT 2KJ5A 1XS9D 2KIWA 1DGSA 4WC7A 2G07A 2KK0A 2JEFA 3LDAA 3CW2C 1KQQA 4P4PA 1JXLA 5EWEA 2AHOB 3M7DA 9ICVA 4OJLA 3PX0A 3PO4A 4M6WB 3QU5A 5ALIA 1H38A 5AM1A 1WWUA 2HHQA 1QQ7A 2KFZA 1TKDA 5GTHU 1NOMA 1L5UA 5CR0A 2RDJA 2BHNA 2BPCA 4RNOA 1L7PA 4MFAA 1ZD3A 4Y2YA 5DQGA 4DFMA 1JMSA 2FPLA 9ICMA 1JQRA 2F76X 1FFUA 2G08A 5F9LA 3ED5A 1O08A 1U49A 4P0PA 3KOOA 4X4RA 1PK1A 2AU0A 4J9NA 4R8UB 3UPSA 2AQ0A 3T5LA 4X4SA 4KLJA 4X4VA 4RQ6A 4RPZA 1L7NA 1ZQRA 2FMSA 4CE6A 5DBAA 3JPQA 1BVSA 2FMPA 3OHAA 1WWVA 2EQYA 3G6XA 2QB1A 1K1SA 5L1IA 4FH3A 3KD3A 4I0UA 1Q79A 3V6JA 9ICJA 5D63A 3IG5A 9ICNA 4CGZA 3IM1A 3C66A 5AM3A 4PHPA 2DVIA 4ZH4A 3WFRE 2HVIA 4YMNA 3BQ1A 4EEBA 3RB4A 1NKEA 4PGYA 4K9AA 3WKCA 4DSKA 2WF7A 2A1JA 2ISPA 4ECVA 1DOQA 4IC9A 5KFTA 4KLTA 1UEUA 5AK5A 4MF2A 5HR6A 7ICTA 3D2QA 9ICRA 2I9GA 5AK4A 4DOBA 3KHRA 3RB3A 2M2WA 3N7RC 4NXTA 2PI4A 8ICKA 4RT2A 4NM2A 3H7IA 3K1ZA 3SYZA 5KTQA 3C28A 3PW4A 4FS2A 5AIBA 4LEZA 3MABA 1C7YA 1FA0A 4C8NA 5C5JA 4NLKA 2XVTA 1LVHA 2KNJA 1DRGA 4WC6A 5KG1A 3I76A 2ZH1A 3NVOA 9ICGA 5KNIA 2YB4A 1R8AA 2E8OA 2XGQA 3BJYA 1T8EA 4O3QA 4CF4A 8ICAA 4I2FA 5EWFA 4EEKA 3LWLA 2W9BB 3BS5B 2V9WA 1FEZA 2G0AA 4TUSA 2IUBA 4CRXA 4EEDA 3WKEA 2GAFD 3PSFA 1N60A 3F2BA 2JZBB 2ZH8A 2LKYA 4YP3A 5KFCA 3HIYA 5KFRA 3PR4A 4QZFA 3QU4A 3G6YA 7ICJA 3NVZA 4X4PA 1HEKA 5AI6A 4OO1J 4C80A 4DQQA 1ZRMA 1ZQFA 3U26A 3IV6A 4F4KA 2AGQA 3CK6A 2I1QA 2W9AA 3FM9A 2JH7A 4P0QB 3IHQB 1U47A 2D6FC 3F5EA 5IILA 2W9MA 3PO5A 4RWOA 4KLMA 2NO5A 1SZPA 3SR6A 4WQKA 1NI3A 4ECRA 3Q8KA 3RJKA 4YQWA 2LYAA 3H4DA 5ALVA 5DGBA 1RZTA 1N5XA 5CFTA 1Z4OA 5IIIA 2E8PA 4RQ1A 3OGUA 2Z7JA 1XSPA 5ALMA 3KZIU 3HJ4A 5KT6A 2ZUCA 4B9MA 1UCVA 1L7MA 1S5LU 5AI5A 3GQCA 8ICUA 9ICQA 5ALFA 2HHXA 5ALNA 4QZGA 4O3PA 1ZQLA 2AGOA 3SI8A 4RUCA 2DPIA 4NXWA 3H4BA 2EZZA 3UXPA 1MN8A 5TISU 4K99A 4M04A 3V7LA 2XGPA 1XO0A 1JAJA 5DG8A 1JI7A 4ECQA 3L3FX 3LQCB 4KLUA 2NRVA 4TUQA 3QZ7A 2R8GA 1JALA 3C29A 2ZTCA 1ZQVA 2NV3A 5AKYA 3HRDD 3C2LA 4I2BA 3THVA 4O5CA 4AP9A 4F71A 2DR8A 3KBBA 2HHPA 1SWWA 5HREA 1U4BA 4JV0A 2OWOA 3EPGA 4FH5A 5EE1A 4YR2A 4AYBF 3SMVA 2VANA 2CN1A 7ICMA 1D8LA 4F3OA 2JEGA 5J2BA 4C7ZA 4US8A 4J9SA 3OVBA 1XO1A 2F77X 2FLNA 4F5RA 4OCZA 2AXTU 2ZH3A 1LKYA 1PZNA 4UB5A 1X42A 4YCXA 3RJFA 1OU5A 4EELA 3JZ0A 1ZD2P 3PSPA 5ALUA 2BKEA 2K4PA 5HRIA 1F5SA 1Q8KA 2A19A 2DKZA 2R8JA 4OAIZ 4KLFA 3H8SA 5J0RA 5KFHA 4RPYA 1ZQQA 3D2NA 5J2DA 3C1YA 4Q8FA 5D61A 1TAMA 3ICXA 4KM5A 9ICHA 4UB2A 1XSNA 4DFDA 3QX7A 4BDPA 1S0VA 1ZQCA 2MRLA 2IBKA 2QKQA 1ZYQA 4YD1A 4DFKA 4WQLA 2ZIWB 4YD2A 2Y9TA 1NNLA 2FCLA 2B21A 5D4BA 3TAPA 5CP2A 4DQPA 4EBJA 4Y2TA 2MUTB 1SKWA 1Q78A 1Q3UA 3ZDAA 4F2SA 3JYYA 4JK1A 4Y2JA 4P4OA 4C4RA 7ICVA 8ICLA 4X4NA 1TVAA 3TFRA 1R8CA 4GIBA 4FS1A 5J0QA 2D8CA 1COOA 4B9UA 4IQWA 2B4VA 4TQSA 3UPQA 3OV7A 2JGAA 2H3FA 4I2GA 4YXJA 2QARA 3WK6A 1WG8A 4O3SA 5L9XA 2BPGA 4DSIA 3RFAA 1J2MA 4M2YA 5AKEA 3BQTA 3H8WA 2KMDA 4UAUA 1QSYA 4AYBC 4G3IA 1NZPA 2NRWA 2J6TA 1JN3A 2FDRA 4DL2A 3Q8MA 2KN7A 3OTQA 3GIMA 2KVCA 2YTUA 3C2MA 5ALYA 5IIMA 4Z6CA 5L1MA 4Z6EA 4PH5A 2M2TA 1KNYA 1FIQA 3OVSA 1ZQWA 1IG6A 1ECWA 2H3ZA 4ED1A 4QZCA 2YY6A 1QLNA 4QW9A 4JMUA 2Y1JA 4NXXA 2L5YA 1L3VA 5K4LA 2ZIXB 4KITB 5KT2A 1SV0C 4C4TA 4NXVA 3ERCC 4GC7A 5HRHA 3OUYA 8ICWA 2VIXA 5J2CA 5J2IA 5T14A 2A1AA 4IQUA 2JRZA 5ALWA 3QE9Y 1KBUA 2EDUA 8ICTA 4DL3A 5CFSA 2F8KA 1YZ6A 3M8RA 1TFYA 3ORYA 2VA8A 4F4WA 2HDOA 2RQ5A 4O69A 5AKLA 5JTIA 1M6YA 1S0OA 2XY7A 2AQ4A 4LZDA 4QZ9A 2HI0A 4J9RA 2EH9A 2K4IA 3NGDA 4K98A 4F4YA 4OJOA 4QZBA 4QZIA 1S77D 1KEJA 4FHYA 4RQ8A 3MGVA 3QUQA 4C7YA 2IOFA 2KOBA 4O3NA 1ZQUA 2C2EA 3O0FA 3Q8RB 5ALQA 1SXEA 1IM4A 2LPEA 1ZQAA 5J0WA 2ESEA 1SIJA 3GIKA 2YB1A 1ZQDA 5KG5A 9ICFA 3AUOA 1Z3EB 4R64A 1F5AA 4FZNA 4FHWA 2K4EA 1L3UA 1F0MA 4KLSA 2M9NA 4K8VA 1ZD4A 5KG3A 4X5VA 3T5KA 5L1LA 3AQLA 2ZUDA 5HNKA 3IN5A 4B9TA 3LYSA 8ICHA 2XIDA 1FO4A 8ICFA 4ECWA 5HR7A 1Q46A 3AQKA 4DL5A 2DUYA 4DSFA 3F2CA 2GLEA 1ZQZA 5EWGA 4PHAA 1FFVA 4ECUA 4IQTA 5HHHA 3LWMA 5AI0A 4I2DA 1Z1BA 2WB1C 4Y2RA 4OAGA 2DBYA 4DQSA 3B0XA 2P6RA 2EAOA 2BBHA 2R8KA 3I28A 2Y1IA 1B4FA 4K97A 4DL4A 4NY8A 3PW2A 4UB6U 2BQ3A 3SQIA 4NLGA 3BQ2A 5ALXA 1WYGA 2LYHA 4IRKA 2Q0ZX 1UEVA 7ICEA 4WJ3B 1VJ7A 5KFLA 4X0AA 2NRTA 4UARA 4AT7A 3WKDA 5J2JA 1IV8A 1N63A 2FLLA 5JU5A 2F1JA 3TKAA 2VJ5A 1X9XA 4CF5A 4ECSA 1ZQSA 2F1IA 4UB8U 7ICIA 4WC1A 2EZXA 2NRXA 1ZQMA 2ZIVB 3PX6A 2IMWP 3AEVA 2JMGA 3C18A 3Q8QB 1X6JA 5HRLA 5ALZA 5HMLA 5B5EU 1DK3A 4I2AA 4ED6A 1OUQA 1X9WA 3OPXA 3IDWA 9ICPA 4WH5A 2W9CA 3WK7A 3CNHA 4JWMA 2ES6A 1ZQHA 4F5PA 4RUAA 4JB3A 8ICQA 3KTQA 8ICYA 2W03A 3ETLA 4DFPA 4R65A 4AT8B 4M9NA 2KZMA 4M6WA 5KFUA 3H8MA 3OJUA 3A0HU 2XY6A 4BX9C 2HHWA 2B6GA 5JRTA 2KKPA 3RH5A 3KKAC 5J0UA 2F2AB 2M2VA 2OYYA 4ED3A 3HILA 2ID1A 4X4QA 4LEWA 3PHZA 4HAIA 4YMOA 5CHGA 4WC0A 4GXJA 4DL6A 3NTUA 4LJXA 2AGPA 1NKBA 3CYMA 4BXOB 5DG7A 4R8UA 2HOIA 5C0YA 4M47A 5D62A 1D9FA 5DQIA 1UT8A 1NK7A 2KSOB 1ZRNA 4UAVA 1ZJMA 4O5KA 4DLEA 1T4GA 1ZQIA 4U7CA 1S8OA 4WC4A 5J29A 4TUPA 5KFYA 4Q8EA 1S10A 5KFIA 3PX4A 3UQ0A 1D9DA 2W3SA 4EX6A 4ECTA 2UVUA 1LB2B 4YMMA 3QEBZ 5HRKA 4KLEA 5J0OA 1CEZA 4OJ5A 3OVAA 3PMLA 4ED8A 4LVSA 3EPIA 1QTMA 2Y0SC 1Z00B 3K1RB 5KFEA 1UPHA 2F1HA 1SKRA 3GDXA 4UAWA 3RJHA 2YN4A 5ALJA 4IG8A 1CUKA 4GXIA 4J03A 7ICKA 4O9MA 4UB4A 2RFFA 4NKTA 4AT9B 1MQ2A 2BPFA 4UB1A 3L4PA 3HW8A 2BCUA 3ER8C 2BDUA 3ISBA 4DF4A 4OAFA 1LV5A 4J9MA 5J2EA 4NV0A 3OWGA 2WF5A 5DB9A 4QIWF 4EENA 5J8YC 2E8MA 4P2HA 4QZDA 2H5XA 5GTIU 4F50A 1L3SA 4RQ3A 3MR6A 4M9HA 4X4UA 4MFCA 3ETRA 3TAQA 1UA0A 3BZCA 4UBCA 4F8RA 5DECA 5KFGA 1WCLA 1IIPA 2OEHA 2HW3A 5J2GA 3Q8LA 2Q4TA 3QU9A 4NL9C 4Q45A 5DKWA 9ICKA 3QUTA 3NVWA 7ICNA 3EF2A 1XNSA 4KX3A 3UXOA 2KJ9A 1KL9A 4M9JA 3ZDDA 1NK6A 2W9BA 3BS5A 4O3MA 4X0BA 1KSPA 2HBLA 5ALLA 4E0DA 1ZQYA 1CI4A 2JZBA 4KX5A 4KLQA 1O03A 3CP8A 2MAXA 2PFPA 2QB0B 1TAQA 3PW0A 4NKUA 2JHDA 3WK8A 1KFSA 4K96A 8ICBA 4J9LA 1RYSA 1PVQA 1TFWA 3SD7A 3H40A 2V4QA 4J9PA 2B56A 2EWRA 1Z19A 5KT5A 5EOZA 4P0QA 3BQ7A 1ZQTA 2KV2A 3EYZA 3TANA 1RQNA 4Y2XA 2PFNA 2VKQA 4QWEA 1WCNA 2ZXIA 2BCVA 7ICUA 3TACB 5A0LA 3WFSC 2G5IB 1KN5A 3VC8A 3RJIA 4UBBA 3GFKB 2JH1A 5DLGA 2KG5A 1B43A 5KFAA 5KAIU 2PI5A 3RR8A 2DPJA 2RRDA 5CA7A 3GV7B 3M9MB 1V9PA 9ICAA 3WKAA 1JXEA 3V72A 4QIWC 3MDAA 3HKZC 1P7DA 1BPZA 2R18A 2DR5A 4ATBB 2N1RA 1KFTA 1V97A 9ICUA 3SEIA 2GO7A 2ZXHA 2JXJA 3PV8A 2WF8A 5AM2A 3AQEA 5L1KA 4E80A 4RU9A 7ICHA 2PKEA 4RQ4A 1ZETA 5DB6A 4DS5A 2UVWA 2W7PA 3MCRA 4DOCA 4DCCA 5ALDA 1JROA 1N62A 3L5KA 2B51A 1V38A 1SV0A 2LM1A 1EXNA 2IHOA 1L7OA 1QSSA 4PL2A 4GC6A 2WAQC 2BQUA 9ICWA 4F91B 3N28A 3TQ1A 5AI9A 2XY5A 1DGJA 4PHDA 5DG9A 3UMGA 8ICXA 3WFQE 1ZQJA 5DLFA 1BPXA 2Q66A 4RQ0A 4F5NA 2H3VA 4QW8A 5KT4A 1L8OA 3SAFA 2HOQA 1S97A 2ISOA 1DXSA 2OXOA 3MGHA 3M9OB 1L6NA 4KLHA 1VFGA 1UT5A 1TK0A 3QYPA 9ICOA 2ZJ8A 3IRUA 4NLCA 4LT6A 5ALHA 3JPTA 3N7PD 1N61A 1ZXIA 2HOFA 1U48A 2J6SA 1MIWA 1RQLA 3AU6A 1N2XA 3QU2A 4BWMA 4BGDA 3RH4A 8ICOA 1C20A 5KFQA 1NKCA 5G5GA 3B0YA 2F3NA 4WOYA 2H3IA 2HCFA 3F53A 5EE3A 4ECZA 2HHTA 4J9OA 1SGGA 1HUZA 1SWVA 2YQEA 4PHEA 2ZIWA 5KFKA 1ZQNA 4JV2A 7ICRA 2HSZA 4DQRA 2ZH9A 4DEZA 4QJFB 4XUSA 4KN7A 4PPXA 3PR5B 2KKVA 2MUTA 7ICFA 7ICSA 2DQNB 3ISDA 4UW9A 5ALTA 5CEHA 3FYHA 3TI0A 5ALOA 3WK5A 5KG0A 3BS7A 5CJ7A 4MEXA 1ZQOA 2P6UA 4O5EA 2I6XA 2NRKA 3HWTA 2ODGA 2WHEA 4CF3A 2WB1F 3H3AA 2ZIUB 1BPDA 4K9BA 3NKUA 4WBYA 1SKSA 3RF9A 1XU4A 3PY8A 7ICQA 1BPBA 5KL8B 4B9SA 8ICPA 2BCRA 3HT3A 1ZQGA 2BCSA 1WUDA 1A77A 2R8IA 8ICMA 3N4MB 3TFSA 1R8BA 2W11A 3F2DA 4IR1A 3NS1A 1HUOA 4F5QA 1RYRA 4KB6A 3UXNA 2ZH7A 2OM6A 3EW9A 3M6ZA 5KT7A 4RZRA 2ZHAA 4BUGA 4NJ8A 4RWQA 5KFVA 2O1PA 1U9LA 2BBJA 2DF4B 5HRBA 5FP0A 2ZUBA 3VCBA 4DQIA 3LVVA 4EEYA 3HJEA 1NZBA 2LBOA 2NRZA 4EYHB 5KAFU 4YXMA 3ZD9A 4KLGA 4FHVA 3WFPA 2NYVA 2EZYA 4PL1A 3B9JA 4FO6A 4IRCA 1A76A 3EWAA 3TARA 4MEYA 2K4HA 2ZIXA 2KD1A 5F3XB 2E3TA 1MA7A 1TFRA 1XSLA 4Y2SA 4WCWA 5ALRA 3PVXA 4DWIA 3GV5B 5DDYA 2GA9D 4C8OA 4X4OA 4FZLA 3A0BU 4Y2QA 2BCQA 1J97A 2HN1A 3WK9A 3MR5A 5HHIA 2HVHA 1T7PA 3RJGA 5KFSA 4ED2A 1XC9A 1N56A 4ZOHC 4UATA 4C8KA 2E8NA 4YVZA 4ICAA 4N7RA 5D46A 3KKAA 2I5HA 4Z6DA 3OSNA 3KHLA 1PVPA 3V6HA 1NK0A 3BDPA 3NRZA 2JR5A 4FBTA 3N7SC 3L9DA 5HR9A 4I28A 4UD4A 4EZ9A 4DF8A 4RQNA 5AKIA 1SL1A 3ZI4A 3V6KA 2C22A 4USAA 4F5OA 1VLBA 1GO3F 3MBYA 4I2CA 3OHBA 4CDGA 5DB7A 2JV3A 1V85A 1ZD5A 4R63A 2KEYA 2W55A 4YR3A 1Q3VA 2PXIA 4A8EA 5H2FU 1RXWA 2FE9A 4QNLA 4K4HA 2KICA 1JIHA 4P0PB 3QEAZ 3RTVA 3K75D 1SXDA 2RLTA 4JV1A 2MSNA 3CRXA 1PK1B 3RR7A 4U6PA 5KL1B 3ZDBA 2K60A 1KLNA 2WF6A 3RB6A 2DGZA 4DS4A 4XRHA 1ZQEA 3M6KA 1K5OA 4QZAA 1KKXA 2AH5A 4M5DA 2V4RA 2Y0SF 2JEIA 7ICPA 4C0ZA 1MIVA 4PZNA 9ICXA 1ED1A 4C4SA 3AN1A 4F92B 4OAHA 1XWLA 2EAMA 2YMMA 4KMOB 4HYKA 3GILA 5J2HA 2W8KA 4XQ7A 3UMCA 5J2AA 4EZ6A 4RQ2A 1HJPA 2H3QA 2HBJA 1NJWA 1ZQ1C 1T3NA 4WC3A 5KFWA 3LK9A 5KFBA 5AKXA 5BOLA 2KE7A 4YFKA 1KW4A 1TAUA 5J8YA 4QZHA 5AM0A 2A1JB 1X9MA 1MSWD 9ICTA 5DBCA 2VA2A 4UAZA 2ALZA 1UA1A 8ICZA 1V4AA 3JPRA 4WC2A 3SZ2A 4GLXA 3JPSA
chains in the Genus database with same CATH topology
2C2RA 3TAPA 5CP2A 3V7KA 4DQPA 3RRGA 7ICNA 4YN4A 5J2FA 4EBJA 2MUTB 3UXOA 1SKWA 5F2VO 3SV4A 5CWRA 3C5FA 4XA5A 1MIWA 2ASDA 1Q78A 4M9GA 4M9JA 3ZDDA 3ZDAA 1NK6A 2W9BA 4F2SA 4B9NA 3JYYA 3T5HA 4X0BA 4JK1A 4DSLA 1KSPA 8ICGA 4P4OA 7ICVA 9ICLA 8ICLA 3H39A 1KRPA 9ICIA 4X4NA 4C8LA 3GIIA 1IXRA 1TVAA 4E0DA 4QWCA 1PX5A 1ZQYA 4EP7A 4F4ZA 3ZDCA 4B9VA 2JZBA 3TFRA 2FMQA 4KLQA 1R8CA 4FHPA 2MAXA 1RXVA 2IHMA 2PFPA 4FS1A 5HRFA 1TAQA 3PMNA 5J0QA 3PW0A 4Q44A 4NKUA 1COOA 4B9UA 4X4TA 2O5AA 2DR9A 2DRBA 1KFSA 4IQWA 1N48A 1ZQPA 4F93B 1NK5A 8ICBA 4TQSA 4J9LA 1RYSA 3C2KA 1TFWA 1NJZA 4IRDA 4J9QA 3UPQA 3V7JA 3OV7A 3WFOA 3H40A 1AROP 4Q43A 3PNCA 4F4XA 4O3RA 2V4QA 4I2GA 4J9PA 2FPMA 4YXJA 5J0TA 5J2KA 1S0NA 3RAXA 8ICIA 2JEJA 4PGXA 4AT7B 5KT5A 5EOZA 4O3SA 5L9XA 2BPGA 5J0SA 4DSIA 4UAYA 4RQ7A 2PFOA 7ICOA 2ZH2A 4KTQA 4BWJA 4M2YA 4KMUA 5J0PA 1ZQXA 3BQTA 3H8WA 3HPOA 1ZQTA 1QSYA 4G3IA 1NZPA 4R66A 3ZDEA 3EYZA 3TANA 2PFNA 3RJJA 5DBBA 2NRWA 4DLGA 4ELVA 3MDCA 3N97B 2J6TA 1JN3A 3HX0A 1SL2A 9ICEA 2ZH3A 4JWNA 4QWEA 3FDSA 2KN7A 4DL2A 1WCNA 3Q8MA 1R89A 2BCVA 2R8HA 7ICUA 3WFSC 3MGIA 3GIMA 5HP4A 1JX4A 3RJEA 3C2MA 3RJIA 1ZQKA 3E2EA 4UBBA 3HJ1A 3GFKB 4K4IA 5IIMA 3H8JA 5DLGA 4ECXA 4IQVA 4KN4A 3AU2A 4Z6CA 1B43A 4Z6EA 2C2DA 4PH5A 5KFAA 2PI5A 3RR8A 2M2TA 1KNYA 2DPJA 1BPEA 4JUZA 8ICRA 5CA7A 1ZQWA 5DEDA 3GV7B 3M9MB 3OVSA 1V9PA 1NK4A 1K1QA 5JUMA 9ICAA 8ICVA 1MC8A 4QWBA 1TV9A 1D8YA 4BXOA 3AQNA 4AT9B 1JXEA 5HRGA 2W9CB 3V72A 2ZTEA 3MDAA 4ED1A 1BPZA 2DR5A 1BGXT 4ATBB 1XS9D 4QZCA 1KFTA 3T5JA 2P66A 1DGSA 1QLNA 4QW9A 4WC7A 2Y1JA 2XCAA 1L3VA 4ED0A 2JEFA 9ICUA 3LDAA 5KFJA 3RBEA 4P4PA 4KITB 5KT2A 5EWEA 1JXLA 4ELTA 4AT8A 3ISCA 3PV8A 3JPOA 1MQ3A 5IINA 9ICVA 3PX0A 1NK8A 4GC7A 5L1KA 5CB1A 4M6WB 4RU9A 3PO4A 5HRHA 4E80A 8ICWA 7ICHA 3OUYA 1H38A 5J2CA 5KG6A 4RQ4A 1ZETA 5DB6A 4DS5A 5J2IA 2UVWA 4MFFA 2HHQA 2KFZA 1TKDA 4DOCA 1NOMA 3C23A 4IR9A 4I2HA 1L5UA 5CR0A 2RDJA 2DR7A 2BHNA 1NK9A 2BPCA 3K4GA 4RNOA 3PW7A 4IQUA 4MFAA 3QE9Y 1S0MA 4I2JA 5DQGA 4DFMA 4LZGA 1JMSA 2FPLA 1EXNA 8ICTA 4DL3A 2IA6A 9ICMA 1JQRA 1YLQA 1QSSA 1KTQA 5F9LA 3GV8B 5DGAA 1TFYA 3M8RA 4RNMA 1U49A 3ORYA 2VA8A 4F4WA 4GC6A 4FBUA 4TQRA 2W8LA 4X4RA 3RAQA 2BQUA 9ICWA 5KG4A 4F91B 3TQ1A 1Z00A 2AU0A 2BR0A 4J9NA 2WTFA 4LZDA 2XY7A 3MFIA 2AQ4A 4QZ9A 4R8UB 2XY5A 1BNPA 4J9RA 4PHDA 3UPSA 2AQ0A 3T5LA 5TZVA 4X4SA 5DG9A 4KLJA 4X4VA 4GXKA 4RQ6A 5F9NA 4PGQA 4RPZA 8ICXA 3WFQE 3NGDA 1ZQJA 3C1ZA 5DLFA 5DDMA 1ZQRA 4F4YA 4QZBA 1BPXA 5KFNA 4QZIA 1S77D 9ICSA 1KEJA 2FMSA 4FHYA 5DBAA 4ECYA 3JPQA 2Q66A 4RQ0A 4RQ8A 4F5NA 4KLOA 4EBKA 4AT9A 4QW8A 5KT4A 1SL1A 1BVSA 4O3NA 4Z6FA 1ZQUA 2C2EA 2ZH6A 3Q8RB 2FMPA 3OHAA 4NLZA 3G6XA 1IM4A 2BQRA 1S97A 1ZQAA 5J0WA 1K1SA 5L1IA 2IHNA 1NJYA 5KFMA 2ISOA 4FH3A 3GIKA 2HHSA 1ZQDA 2HHUA 5KG5A 3V6JA 1Q79A 5HMMA 9ICFA 9ICJA 3AUOA 3MGHA 3M9OB 9ICCA 2DFLA 9ICNA 2KFNA 1Z3EB 4KLHA 4R64A 1F5AA 4FHWA 3IM1A 1VFGA 1L3UA 4ELUA 3C66A 1UT5A 4KLSA 2M9NA 4PHPA 1TK0A 9ICOA 2DVIA 2ZJ8A 4LT6A 1BPYA 2XC9A 1S9FA 2ZH5A 5KG3A 3MR3A 4ZH4A 3JPTA 2ZH4A 4X5VA 4KLIA 2HVIA 4E7XA 3T5KA 3WFRE 3Q8PB 3MR2A 5L1LA 2AJQA 3AQLA 2ZUDA 4YMNA 5HNKA 3BQ1A 4B9TA 4M9LA 1U48A 3RB4A 2J6SA 8ICHA 3AU6A 1NKEA 4PGYA 3RH4A 4BWMA 4BGDA 4DSKA 8ICOA 5KFQA 2C28A 8ICFA 1NKCA 3B0YA 3NYBA 2UVVA 4ECWA 4ECZA 2A1JA 2HHTA 2ISPA 4ECVA 4J9OA 4UD5A 4KLLA 3AQKA 1HUZA 4PHEA 1ZQNA 2RDIA 5KFKA 1DOQA 4JV2A 5KFTA 7ICRA 1UETA 3C21A 4DL5A 4DQRA 4DSFA 4KLTA 4DEZA 1UEUA 3C5GA 2ZH9A 4MF2A 1ZQZA 5EWGA 4J9KA 1ZQBA 7ICTA 4PHAA 4XUSA 4KN7A 9ICRA 2I9GA 4PPXA 3PR5B 2MUTA 4ECUA 4I27A 4IQTA 5HHHA 3LWMA 7ICFA 4DOBA 2BGWA 7ICSA 4DSJA 4I2DA 3ISDA 3KHRA 3RB3A 2M2WA 4DQSA 4RT3A 3B0XA 3FYHA 4QWDA 2P6RA 3TI0A 4S3NA 5HRDA 5KG0A 4F2RA 4P4MA 2PI4A 2GWSA 8ICKA 2KZZA 2R8KA 5CJ7A 4MEXA 2DRAA 4RT2A 1ZQOA 2P6UA 4NM2A 4O5EA 3JPSA 1QSLA 2NRKA 2Y1IA 3HWTA 5DB8A 2ZJAA 4DL4A 4NY8A 3H7IA 2HHVA 3PW2A 5L1JA 2BQ3A 3SYZA 8ICJA 5KTQA 4NLGA 3BQ2A 3H3AA 2LYHA 4FS2A 3PW4A 1BPDA 2BDPA 4IRKA 4UB3A 2Q0ZX 3MABA 2XCPA 1UEVA 4WBYA 1SKSA 1C7YA 7ICEA 4C8NA 5C5JA 4NLKA 1FA0A 1MIYA 1VJ7A 5KFLA 3QZ8A 2PBEA 1XU4A 4WC6A 3PY8A 7ICQA 1BPBA 2VA3A 4X0AA 2NRTA 4B9SA 8ICPA 5KG2A 4AT7A 2BCRA 5J2JA 5KG1A 4YG2A 3HT3A 1ZQGA 2ZH1A 9ICGA 4C8MA 2FLLA 1R8AA 2ATLA 2F1JA 2XGQA 2B21A 1A77A 2R8IA 2BCSA 3N4MB 8ICMA 3TFSA 3BJYA 1T8EA 1R8BA 4IR1A 5IIOA 4ECSA 1ZQSA 1HUOA 4O3QA 2F1IA 5KFOA 4F5QA 4EBCA 1RYRA 3UXNA 7ICIA 8ICAA 4I2FA 4WC1A 4I2EA 2ZH7A 3EW9A 2NRXA 5EWFA 1ZQMA 3LWLA 2W9BB 5KT7A 4RZRA 2IMWP 3PX6A 2V9WA 2ZHAA 2ZJ5A 4RWQA 4TUSA 3JPNA 5KFVA 1X2IA 4EBDA 2O1PA 1U9LA 3C18A 1S0OA 4O3OA 3Q8QB 3RB0A 5KFDA 3PW5A 5HRLA 5HRBA 2ZUBA 2JZBB 5HMLA 2FPKA 4RWNA 2ZH8A 1DK3A 4I2IA 4DQIA 4YP3A 5KFCA 3HIYA 5KFRA 3PR4A 4QZFA 4RPXA 4EEYA 4I2AA 2NRZA 4EYHB 3G6YA 4ED6A 1X9WA 4NM1A 4ED7A 4YXMA 7ICJA 4X4PA 3ZD9A 5IIKA 5J0XA 9ICPA 4NLNA 4KLGA 4FHVA 2W9CA 4DQQA 4DO9A 3WFPA 2XO7A 1X9SA 1ZQFA 4QZEA 3EZ5A 4F4KA 2AGQA 4JWMA 4ATBA 4FO6A 4IRCA 1ZQHA 3HP6A 4F5PA 3M9NB 4RUAA 1A76A 2I1QA 2W9AA 8ICQA 3KTQA 8ICYA 3EWAA 3TARA 4MEYA 3ETLA 1U45A 4DFPA 3IHQB 4DOAA 1U47A 4R65A 3Q8SB 4AT8B 4M9NA 2KZMA 3H38A 1TFRA 4M6WA 5IILA 2W9MA 3PO5A 2BE3A 1XSLA 4RWOA 5KFUA 4KLMA 2ZTDA 1SZPA 4WCWA 3OJUA 3PVXA 4DWIA 3GV5B 4WC5A 5DDYA 5BPCA 4ECRA 1KDHA 3Q8KA 3RJKA 4YQWA 4C8OA 4X4OA 3JPPA 4YR0A 2XY6A 4FHXA 2KZ3A 2HHWA 4DFJA 3H4DA 5DGBA 1RZTA 9ICBA 3RH5A 5IIIA 5J0UA 2BCQA 2M2VA 4ED3A 5KFZA 4RNNA 3MR5A 5KG7A 1BNOA 4RQ1A 5HHIA 3OGUA 1B22A 2ID1A 2HVHA 4X4QA 4YMOA 1XSPA 7ICLA 5CHGA 1T7PA 3RJGA 3HJ4A 4WBZA 5KT6A 4WC0A 2ZUCA 3KHHA 4GXJA 4B9MA 4DL6A 3NTUA 5KFSA 3T3FA 4ED2A 3RRHA 1XC9A 2AGPA 1NKBA 3GQCA 1N56A 8ICUA 9ICQA 4BXOB 2HHXA 4C8KA 3BQ0A 5DG7A 1SL0A 4YVZA 4R8UA 2ZHBA 4EYIB 5D46A 4QZGA 4M47A 4O3PA 1ZQLA 3AQMA 4Z6DA 3OSNA 3KHLA 2AGOA 3V6HA 1NK0A 1L3TA 3BDPA 3SI8A 4RUCA 2DPIA 4FBTA 3H4BA 1D9FA 8ICSA 3L9DA 5HR9A 5DQIA 1UT8A 4I28A 1NK7A 3UXPA 4EZ9A 4UD4A 5KFXA 1ZJMA 4DF8A 2UVRA 3OJSA 4I29A 4M04A 3V7LA 4O5KA 3V6KA 4DLEA 1NO5A 1KFDA 2XGPA 2C22A 1JAJA 1T4GA 5DG8A 4F5OA 1ZQIA 3MBYA 4I2CA 4ECQA 4XQ8A 3OHBA 4WC4A 3KHGA 5DB7A 3OUYB 3LQCB 4KLUA 4MF8A 2NRVA 4TUQA 5J29A 3QZ7A 5D49A 2R8GA 4TUPA 1WOTA 5KFYA 4Q8EA 2ZTCA 4R63A 1ZQVA 4QZ8A 4YR3A 4TURA 1S10A 3C2LA 5KFIA 2PXIA 4I2BA 4UQGA 4DL7A 3THVA 3PX4A 8ICCA 4O5CA 3UQ0A 5KT3A 1D9DA 4ECTA 4K4GA 2KTQA 2UVUA 2DR8A 1LB2B 4YMMA 2J6UA 3QEBZ 1RXWA 5HRKA 4E8FA 4KLEA 2HHPA 5J0OA 3G6VA 4K4HA 5HREA 1U4BA 4JV0A 4O0IA 3M8SA 2OWOA 1CEZA 3EPGA 1JIHA 3OVAA 4FH5A 3PMLA 4ED8A 4YR2A 3QEAZ 4LVSA 3RTVA 3K75D 4JV1A 3EPIA 1QTMA 1TK5A 1S76D 5DQHA 3RR7A 1ZJNA 1Z00B 8ICEA 7ICGA 2VANA 5KFEA 3ZD8A 3OSPA 7ICMA 1D8LA 2F1HA 4DSEA 1SKRA 3GDXA 4UAWA 1KLNA 3ZDBA 4F3OA 2JEGA 2ASJA 5J2BA 3RJHA 3RB6A 4J9SA 3OVBA 5KFFA 8ICNA 4DS4A 4IG8A 1XO1A 2FLNA 1CUKA 4XRHA 4GXIA 1ZQEA 7ICKA 4F5RA 4QZAA 1TK8A 1NJXA 4M0AA 4UB4A 4O9MA 1PZNA 2RFFA 4NKTA 4M5DA 2V4RA 1MQ2A 2BPFA 4UB1A 3HW8A 2BCUA 7ICPA 4UB5A 2JEIA 4EBEA 5BOMA 3ISBA 1MIVA 1RPLA 5KFPA 4CCHA 4DF4A 9ICXA 3MFHA 1LV5A 4YCXA 3RJFA 4J9MA 1OU5A 3JZ0A 5J2EA 4F92B 2KP7A 5DB9A 2BKEA 5HRIA 3H37A 1XWLA 2R8JA 3GIJA 1Y88A 4KLFA 3H8SA 5J0RA 4P2HA 2FLPA 4HYKA 3RH6A 4QZDA 2H5XA 3GILA 5J2HA 5IIJA 5KFHA 2W8KA 4F50A 4RQ5A 4XQ7A 4RPYA 1L3SA 1ZQQA 4RQ3A 5J2AA 4EZ6A 5J0YA 1HJPA 4RQ2A 3MR6A 4KLDA 5J2DA 2ASLA 4M9HA 4X4UA 1NJWA 3C1YA 1T3NA 4MFCA 4Q8FA 4WC3A 5KFWA 3UQ2A 3LK9A 3TAQA 5KFBA 2PFQA 4UB2A 1XSNA 9ICHA 5BOLA 1UA0A 4YFKA 4UBCA 1TAUA 4B9LA 3SV3A 4BDPA 4F8RA 1ZQCA 1S0VA 4QZHA 2M2UA 1X9MA 2A1JB 1MSWD 9ICTA 5KFGA 5DBCA 1WCLA 2IBKA 5DECA 2VA2A 1ZYQA 5HC9A 1DK2A 4NXZA 4QWAA 2HW3A 4YD1A 5J2GA 4DFKA 3Q8LA 4UAZA 2ALZA 1UA1A 8ICZA 1V4AA 4YD2A 3RBDA 3JPRA 4Q45A 4WC2A 3SZ2A 4GLXA 4RWPA 5DKWA 5D4BA 9ICKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2C2R A;  3TAP A;  5CP2 A;  3V7K A;  4DQP A;  3RRG A;  7ICN A;  4YN4 A;  5J2F A;  4EBJ A;  2MUT B;  3UXO A;  1SKW A;  5F2V O;  3SV4 A;  5CWR A;  3C5F A;  4XA5 A;  1MIW A;  2ASD A;  1Q78 A;  4M9G A;  4M9J A;  3ZDD A;  3ZDA A;  1NK6 A;  2W9B A;  4F2S A;  4B9N A;  3JYY A;  3T5H A;  4X0B A;  4JK1 A;  4DSL A;  1KSP A;  8ICG A;  4P4O A;  7ICV A;  9ICL A;  8ICL A;  3H39 A;  1KRP A;  9ICI A;  4X4N A;  4C8L A;  3GII A;  1IXR A;  1TVA A;  4E0D A;  4QWC A;  1PX5 A;  1ZQY A;  4EP7 A;  4F4Z A;  3ZDC A;  4B9V A;  2JZB A;  3TFR A;  2FMQ A;  4KLQ A;  1R8C A;  4FHP A;  2MAX A;  1RXV A;  2IHM A;  2PFP A;  4FS1 A;  5HRF A;  1TAQ A;  3PMN A;  5J0Q A;  3PW0 A;  4Q44 A;  4NKU A;  1COO A;  4B9U A;  4X4T A;  2O5A A;  2DR9 A;  2DRB A;  1KFS A;  4IQW A;  1N48 A;  1ZQP A;  4F93 B;  1NK5 A;  8ICB A;  4TQS A;  4J9L A;  1RYS A;  3C2K A;  1TFW A;  1NJZ A;  4IRD A;  4J9Q A;  3UPQ A;  3V7J A;  3OV7 A;  3WFO A;  3H40 A;  1ARO P;  4Q43 A;  3PNC A;  4F4X A;  4O3R A;  2V4Q A;  4I2G A;  4J9P A;  2FPM A;  4YXJ A;  5J0T A;  5J2K A;  1S0N A;  3RAX A;  8ICI A;  2JEJ A;  4PGX A;  4AT7 B;  5KT5 A;  5EOZ A;  4O3S A;  5L9X A;  2BPG A;  5J0S A;  4DSI A;  4UAY A;  4RQ7 A;  2PFO A;  7ICO A;  2ZH2 A;  4KTQ A;  4BWJ A;  4M2Y A;  4KMU A;  5J0P A;  1ZQX A;  3BQT A;  3H8W A;  3HPO A;  1ZQT A;  1QSY A;  4G3I A;  1NZP A;  4R66 A;  3ZDE A;  3EYZ A;  3TAN A;  2PFN A;  3RJJ A;  5DBB A;  2NRW A;  4DLG A;  4ELV A;  3MDC A;  3N97 B;  2J6T A;  1JN3 A;  3HX0 A;  1SL2 A;  9ICE A;  2ZH3 A;  4JWN A;  4QWE A;  3FDS A;  2KN7 A;  4DL2 A;  1WCN A;  3Q8M A;  1R89 A;  2BCV A;  2R8H A;  7ICU A;  3WFS C;  3MGI A;  3GIM A;  5HP4 A;  1JX4 A;  3RJE A;  3C2M A;  3RJI A;  1ZQK A;  3E2E A;  4UBB A;  3HJ1 A;  3GFK B;  4K4I A;  5IIM A;  3H8J A;  5DLG A;  4ECX A;  4IQV A;  4KN4 A;  3AU2 A;  4Z6C A;  1B43 A;  4Z6E A;  2C2D A;  4PH5 A;  5KFA A;  2PI5 A;  3RR8 A;  2M2T A;  1KNY A;  2DPJ A;  1BPE A;  4JUZ A;  8ICR A;  5CA7 A;  1ZQW A;  5DED A;  3GV7 B;  3M9M B;  3OVS A;  1V9P A;  1NK4 A;  1K1Q A;  5JUM A;  9ICA A;  8ICV A;  1MC8 A;  4QWB A;  1TV9 A;  1D8Y A;  4BXO A;  3AQN A;  4AT9 B;  1JXE A;  5HRG A;  2W9C B;  3V72 A;  2ZTE A;  3MDA A;  4ED1 A;  1BPZ A;  2DR5 A;  1BGX T;  4ATB B;  1XS9 D;  4QZC A;  1KFT A;  3T5J A;  2P66 A;  1DGS A;  1QLN A;  4QW9 A;  4WC7 A;  2Y1J A;  2XCA A;  1L3V A;  4ED0 A;  2JEF A;  9ICU A;  3LDA A;  5KFJ A;  3RBE A;  4P4P A;  4KIT B;  5KT2 A;  5EWE A;  1JXL A;  4ELT A;  4AT8 A;  3ISC A;  3PV8 A;  3JPO A;  1MQ3 A;  5IIN A;  9ICV A;  3PX0 A;  1NK8 A;  4GC7 A;  5L1K A;  5CB1 A;  4M6W B;  4RU9 A;  3PO4 A;  5HRH A;  4E80 A;  8ICW A;  7ICH A;  3OUY A;  1H38 A;  5J2C A;  5KG6 A;  4RQ4 A;  1ZET A;  5DB6 A;  4DS5 A;  5J2I A;  2UVW A;  4MFF A;  2HHQ A;  2KFZ A;  1TKD A;  4DOC A;  1NOM A;  3C23 A;  4IR9 A;  4I2H A;  1L5U A;  5CR0 A;  2RDJ A;  2DR7 A;  2BHN A;  1NK9 A;  2BPC A;  3K4G A;  4RNO A;  3PW7 A;  4IQU A;  4MFA A;  3QE9 Y;  1S0M A;  4I2J A;  5DQG A;  4DFM A;  4LZG A;  1JMS A;  2FPL A;  1EXN A;  8ICT A;  4DL3 A;  2IA6 A;  9ICM A;  1JQR A;  1YLQ A;  1QSS A;  1KTQ A;  5F9L A;  3GV8 B;  5DGA A;  1TFY A;  3M8R A;  4RNM A;  1U49 A;  3ORY A;  2VA8 A;  4F4W A;  4GC6 A;  4FBU A;  4TQR A;  2W8L A;  4X4R A;  3RAQ A;  2BQU A;  9ICW A;  5KG4 A;  4F91 B;  3TQ1 A;  1Z00 A;  2AU0 A;  2BR0 A;  4J9N A;  2WTF A;  4LZD A;  2XY7 A;  3MFI A;  2AQ4 A;  4QZ9 A;  4R8U B;  2XY5 A;  1BNP A;  4J9R A;  4PHD A;  3UPS A;  2AQ0 A;  3T5L A;  5TZV A;  4X4S A;  5DG9 A;  4KLJ A;  4X4V A;  4GXK A;  4RQ6 A;  5F9N A;  4PGQ A;  4RPZ A;  8ICX A;  3WFQ E;  3NGD A;  1ZQJ A;  3C1Z A;  5DLF A;  5DDM A;  1ZQR A;  4F4Y A;  4QZB A;  1BPX A;  5KFN A;  4QZI A;  1S77 D;  9ICS A;  1KEJ A;  2FMS A;  4FHY A;  5DBA A;  4ECY A;  3JPQ A;  2Q66 A;  4RQ0 A;  4RQ8 A;  4F5N A;  4KLO A;  4EBK A;  4AT9 A;  4QW8 A;  5KT4 A;  1SL1 A;  1BVS A;  4O3N A;  4Z6F A;  1ZQU A;  2C2E A;  2ZH6 A;  3Q8R B;  2FMP A;  3OHA A;  4NLZ A;  3G6X A;  1IM4 A;  2BQR A;  1S97 A;  1ZQA A;  5J0W A;  1K1S A;  5L1I A;  2IHN A;  1NJY A;  5KFM A;  2ISO A;  4FH3 A;  3GIK A;  2HHS A;  1ZQD A;  2HHU A;  5KG5 A;  3V6J A;  1Q79 A;  5HMM A;  9ICF A;  9ICJ A;  3AUO A;  3MGH A;  3M9O B;  9ICC A;  2DFL A;  9ICN A;  2KFN A;  1Z3E B;  4KLH A;  4R64 A;  1F5A A;  4FHW A;  3IM1 A;  1VFG A;  1L3U A;  4ELU A;  3C66 A;  1UT5 A;  4KLS A;  2M9N A;  4PHP A;  1TK0 A;  9ICO A;  2DVI A;  2ZJ8 A;  4LT6 A;  1BPY A;  2XC9 A;  1S9F A;  2ZH5 A;  5KG3 A;  3MR3 A;  4ZH4 A;  3JPT A;  2ZH4 A;  4X5V A;  4KLI A;  2HVI A;  4E7X A;  3T5K A;  3WFR E;  3Q8P B;  3MR2 A;  5L1L A;  2AJQ A;  3AQL A;  2ZUD A;  4YMN A;  5HNK A;  3BQ1 A;  4B9T A;  4M9L A;  1U48 A;  3RB4 A;  2J6S A;  8ICH A;  3AU6 A;  1NKE A;  4PGY A;  3RH4 A;  4BWM A;  4BGD A;  4DSK A;  8ICO A;  5KFQ A;  2C28 A;  8ICF A;  1NKC A;  3B0Y A;  3NYB A;  2UVV A;  4ECW A;  4ECZ A;  2A1J A;  2HHT A;  2ISP A;  4ECV A;  4J9O A;  4UD5 A;  4KLL A;  3AQK A;  1HUZ A;  4PHE A;  1ZQN A;  2RDI A;  5KFK A;  1DOQ A;  4JV2 A;  5KFT A;  7ICR A;  1UET A;  3C21 A;  4DL5 A;  4DQR A;  4DSF A;  4KLT A;  4DEZ A;  1UEU A;  3C5G A;  2ZH9 A;  4MF2 A;  1ZQZ A;  5EWG A;  4J9K A;  1ZQB A;  7ICT A;  4PHA A;  4XUS A;  4KN7 A;  9ICR A;  2I9G A;  4PPX A;  3PR5 B;  2MUT A;  4ECU A;  4I27 A;  4IQT A;  5HHH A;  3LWM A;  7ICF A;  4DOB A;  2BGW A;  7ICS A;  4DSJ A;  4I2D A;  3ISD A;  3KHR A;  3RB3 A;  2M2W A;  4DQS A;  4RT3 A;  3B0X A;  3FYH A;  4QWD A;  2P6R A;  3TI0 A;  4S3N A;  5HRD A;  5KG0 A;  4F2R A;  4P4M A;  2PI4 A;  2GWS A;  8ICK A;  2KZZ A;  2R8K A;  5CJ7 A;  4MEX A;  2DRA A;  4RT2 A;  1ZQO A;  2P6U A;  4NM2 A;  4O5E A;  3JPS A;  1QSL A;  2NRK A;  2Y1I A;  3HWT A;  5DB8 A;  2ZJA A;  4DL4 A;  4NY8 A;  3H7I A;  2HHV A;  3PW2 A;  5L1J A;  2BQ3 A;  3SYZ A;  8ICJ A;  5KTQ A;  4NLG A;  3BQ2 A;  3H3A A;  2LYH A;  4FS2 A;  3PW4 A;  1BPD A;  2BDP A;  4IRK A;  4UB3 A;  2Q0Z X;  3MAB A;  2XCP A;  1UEV A;  4WBY A;  1SKS A;  1C7Y A;  7ICE A;  4C8N A;  5C5J A;  4NLK A;  1FA0 A;  1MIY A;  1VJ7 A;  5KFL A;  3QZ8 A;  2PBE A;  1XU4 A;  4WC6 A;  3PY8 A;  7ICQ A;  1BPB A;  2VA3 A;  4X0A A;  2NRT A;  4B9S A;  8ICP A;  5KG2 A;  4AT7 A;  2BCR A;  5J2J A;  5KG1 A;  4YG2 A;  3HT3 A;  1ZQG A;  2ZH1 A;  9ICG A;  4C8M A;  2FLL A;  1R8A A;  2ATL A;  2F1J A;  2XGQ A;  2B21 A;  1A77 A;  2R8I A;  2BCS A;  3N4M B;  8ICM A;  3TFS A;  3BJY A;  1T8E A;  1R8B A;  4IR1 A;  5IIO A;  4ECS A;  1ZQS A;  1HUO A;  4O3Q A;  2F1I A;  5KFO A;  4F5Q A;  4EBC A;  1RYR A;  3UXN A;  7ICI A;  8ICA A;  4I2F A;  4WC1 A;  4I2E A;  2ZH7 A;  3EW9 A;  2NRX A;  5EWF A;  1ZQM A;  3LWL A;  2W9B B;  5KT7 A;  4RZR A;  2IMW P;  3PX6 A;  2V9W A;  2ZHA A;  2ZJ5 A;  4RWQ A;  4TUS A;  3JPN A;  5KFV A;  1X2I A;  4EBD A;  2O1P A;  1U9L A;  3C18 A;  1S0O A;  4O3O A;  3Q8Q B;  3RB0 A;  5KFD A;  3PW5 A;  5HRL A;  5HRB A;  2ZUB A;  2JZB B;  5HML A;  2FPK A;  4RWN A;  2ZH8 A;  1DK3 A;  4I2I A;  4DQI A;  4YP3 A;  5KFC A;  3HIY A;  5KFR A;  3PR4 A;  4QZF A;  4RPX A;  4EEY A;  4I2A A;  2NRZ A;  4EYH B;  3G6Y A;  4ED6 A;  1X9W A;  4NM1 A;  4ED7 A;  4YXM A;  7ICJ A;  4X4P A;  3ZD9 A;  5IIK A;  5J0X A;  9ICP A;  4NLN A;  4KLG A;  4FHV A;  2W9C A;  4DQQ A;  4DO9 A;  3WFP A;  2XO7 A;  1X9S A;  1ZQF A;  4QZE A;  3EZ5 A;  4F4K A;  2AGQ A;  4JWM A;  4ATB A;  4FO6 A;  4IRC A;  1ZQH A;  3HP6 A;  4F5P A;  3M9N B;  4RUA A;  1A76 A;  2I1Q A;  2W9A A;  8ICQ A;  3KTQ A;  8ICY A;  3EWA A;  3TAR A;  4MEY A;  3ETL A;  1U45 A;  4DFP A;  3IHQ B;  4DOA A;  1U47 A;  4R65 A;  3Q8S B;  4AT8 B;  4M9N A;  2KZM A;  3H38 A;  1TFR A;  4M6W A;  5IIL A;  2W9M A;  3PO5 A;  2BE3 A;  1XSL A;  4RWO A;  5KFU A;  4KLM A;  2ZTD A;  1SZP A;  4WCW A;  3OJU A;  3PVX A;  4DWI A;  3GV5 B;  4WC5 A;  5DDY A;  5BPC A;  4ECR A;  1KDH A;  3Q8K A;  3RJK A;  4YQW A;  4C8O A;  4X4O A;  3JPP A;  4YR0 A;  2XY6 A;  4FHX A;  2KZ3 A;  2HHW A;  4DFJ A;  3H4D A;  5DGB A;  1RZT A;  9ICB A;  3RH5 A;  5III A;  5J0U A;  2BCQ A;  2M2V A;  4ED3 A;  5KFZ A;  4RNN A;  3MR5 A;  5KG7 A;  1BNO A;  4RQ1 A;  5HHI A;  3OGU A;  1B22 A;  2ID1 A;  2HVH A;  4X4Q A;  4YMO A;  1XSP A;  7ICL A;  5CHG A;  1T7P A;  3RJG A;  3HJ4 A;  4WBZ A;  5KT6 A;  4WC0 A;  2ZUC A;  3KHH A;  4GXJ A;  4B9M A;  4DL6 A;  3NTU A;  5KFS A;  3T3F A;  4ED2 A;  3RRH A;  1XC9 A;  2AGP A;  1NKB A;  3GQC A;  1N56 A;  8ICU A;  9ICQ A;  4BXO B;  2HHX A;  4C8K A;  3BQ0 A;  5DG7 A;  1SL0 A;  4YVZ A;  4R8U A;  2ZHB A;  4EYI B;  5D46 A;  4QZG A;  4M47 A;  4O3P A;  1ZQL A;  3AQM A;  4Z6D A;  3OSN A;  3KHL A;  2AGO A;  3V6H A;  1NK0 A;  1L3T A;  3BDP A;  3SI8 A;  4RUC A;  2DPI A;  4FBT A;  3H4B A;  1D9F A;  8ICS A;  3L9D A;  5HR9 A;  5DQI A;  1UT8 A;  4I28 A;  1NK7 A;  3UXP A;  4EZ9 A;  4UD4 A;  5KFX A;  1ZJM A;  4DF8 A;  2UVR A;  3OJS A;  4I29 A;  4M04 A;  3V7L A;  4O5K A;  3V6K A;  4DLE A;  1NO5 A;  1KFD A;  2XGP A;  2C22 A;  1JAJ A;  1T4G A;  5DG8 A;  4F5O A;  1ZQI A;  3MBY A;  4I2C A;  4ECQ A;  4XQ8 A;  3OHB A;  4WC4 A;  3KHG A;  5DB7 A;  3OUY B;  3LQC B;  4KLU A;  4MF8 A;  2NRV A;  4TUQ A;  5J29 A;  3QZ7 A;  5D49 A;  2R8G A;  4TUP A;  1WOT A;  5KFY A;  4Q8E A;  2ZTC A;  4R63 A;  1ZQV A;  4QZ8 A;  4YR3 A;  4TUR A;  1S10 A;  3C2L A;  5KFI A;  2PXI A;  4I2B A;  4UQG A;  4DL7 A;  3THV A;  3PX4 A;  8ICC A;  4O5C A;  3UQ0 A;  5KT3 A;  1D9D A;  4ECT A;  4K4G A;  2KTQ A;  2UVU A;  2DR8 A;  1LB2 B;  4YMM A;  2J6U A;  3QEB Z;  1RXW A;  5HRK A;  4E8F A;  4KLE A;  2HHP A;  5J0O A;  3G6V A;  4K4H A;  5HRE A;  1U4B A;  4JV0 A;  4O0I A;  3M8S A;  2OWO A;  1CEZ A;  3EPG A;  1JIH A;  3OVA A;  4FH5 A;  3PML A;  4ED8 A;  4YR2 A;  3QEA Z;  4LVS A;  3RTV A;  3K75 D;  4JV1 A;  3EPI A;  1QTM A;  1TK5 A;  1S76 D;  5DQH A;  3RR7 A;  1ZJN A;  1Z00 B;  8ICE A;  7ICG A;  2VAN A;  5KFE A;  3ZD8 A;  3OSP A;  7ICM A;  1D8L A;  2F1H A;  4DSE A;  1SKR A;  3GDX A;  4UAW A;  1KLN A;  3ZDB A;  4F3O A;  2JEG A;  2ASJ A;  5J2B A;  3RJH A;  3RB6 A;  4J9S A;  3OVB A;  5KFF A;  8ICN A;  4DS4 A;  4IG8 A;  1XO1 A;  2FLN A;  1CUK A;  4XRH A;  4GXI A;  1ZQE A;  7ICK A;  4F5R A;  4QZA A;  1TK8 A;  1NJX A;  4M0A A;  4UB4 A;  4O9M A;  1PZN A;  2RFF A;  4NKT A;  4M5D A;  2V4R A;  1MQ2 A;  2BPF A;  4UB1 A;  3HW8 A;  2BCU A;  7ICP A;  4UB5 A;  2JEI A;  4EBE A;  5BOM A;  3ISB A;  1MIV A;  1RPL A;  5KFP A;  4CCH A;  4DF4 A;  9ICX A;  3MFH A;  1LV5 A;  4YCX A;  3RJF A;  4J9M A;  1OU5 A;  3JZ0 A;  5J2E A;  4F92 B;  2KP7 A;  5DB9 A;  2BKE A;  5HRI A;  3H37 A;  1XWL A;  2R8J A;  3GIJ A;  1Y88 A;  4KLF A;  3H8S A;  5J0R A;  4P2H A;  2FLP A;  4HYK A;  3RH6 A;  4QZD A;  2H5X A;  3GIL A;  5J2H A;  5IIJ A;  5KFH A;  2W8K A;  4F50 A;  4RQ5 A;  4XQ7 A;  4RPY A;  1L3S A;  1ZQQ A;  4RQ3 A;  5J2A A;  4EZ6 A;  5J0Y A;  1HJP A;  4RQ2 A;  3MR6 A;  4KLD A;  5J2D A;  2ASL A;  4M9H A;  4X4U A;  1NJW A;  3C1Y A;  1T3N A;  4MFC A;  4Q8F A;  4WC3 A;  5KFW A;  3UQ2 A;  3LK9 A;  3TAQ A;  5KFB A;  2PFQ A;  4UB2 A;  1XSN A;  9ICH A;  5BOL A;  1UA0 A;  4YFK A;  4UBC A;  1TAU A;  4B9L A;  3SV3 A;  4BDP A;  4F8R A;  1ZQC A;  1S0V A;  4QZH A;  2M2U A;  1X9M A;  2A1J B;  1MSW D;  9ICT A;  5KFG A;  5DBC A;  1WCL A;  2IBK A;  5DEC A;  2VA2 A;  1ZYQ A;  5HC9 A;  1DK2 A;  4NXZ A;  4QWA A;  2HW3 A;  4YD1 A;  5J2G A;  4DFK A;  3Q8L A;  4UAZ A;  2ALZ A;  1UA1 A;  8ICZ A;  1V4A A;  4YD2 A;  3RBD A;  3JPR A;  4Q45 A;  4WC2 A;  3SZ2 A;  4GLX A;  4RWP A;  5DKW A;  5D4B A;  9ICK A; 
#chains in the Genus database with same CATH topology
 3TAD C;  4EX7 A;  3AMZ A;  3H0R B;  5J2F A;  4FE3 A;  5CWR A;  2ASD A;  1QH9 A;  5B3P A;  1RYU A;  2ZIV A;  4B9N A;  5ALG A;  3H39 A;  4NL9 A;  1PX5 A;  2K8B B;  4QWC A;  4B9V A;  2FMQ A;  4Y2U A;  1VJ5 A;  3GZF A;  4FHP A;  3SAG A;  4FO1 A;  2O5A A;  3J81 j;  1N48 A;  4F93 B;  2O6K A;  2OCE A;  1NJZ A;  4IRD A;  2VJ4 A;  4F4X A;  3PNC A;  3RAX A;  8ICI A;  5CFU A;  5J0S A;  1T3Q A;  2ZH2 A;  4KTQ A;  4BWJ A;  4AT8 A;  4KMU A;  1OW5 A;  1ZQX A;  5EE0 A;  3RJJ A;  5DBB A;  4DLG A;  1L8L A;  1Z1V A;  3MDC A;  3HX0 A;  3JCF A;  3FDS A;  3MGI A;  5HP4 A;  3E2E A;  3HJ1 A;  4K4I A;  3H8J A;  2C2D A;  2LI6 A;  1A6S A;  4JUZ A;  2F44 A;  5DED A;  1K1Q A;  2LHT A;  1MC8 A;  4QWB A;  1D8Y A;  4BXO A;  5AI8 A;  5HRG A;  2ZTE A;  3T5J A;  2P66 A;  5EE9 A;  2XCA A;  4ED0 A;  2ZG6 A;  5KFJ A;  2KSO A;  5AKK A;  3RBE A;  3EUB 2;  4ELT A;  2E1F A;  2FI1 A;  3ISC A;  1MQ3 A;  3JPO A;  5IIN A;  1NK8 A;  5CB1 A;  3HKZ F;  4Y2V A;  5KG6 A;  4MFF A;  4IR9 A;  3C23 A;  4LEV A;  4I2H A;  2E5S A;  2DR7 A;  1NK9 A;  3K4G A;  4FFD A;  3PW7 A;  2D3D A;  1S0M A;  4I2J A;  2QLT A;  4LZG A;  3WKB A;  2IA6 A;  1YLQ A;  2PMZ F;  1KTQ A;  3GV8 B;  5DGA A;  2F8L A;  4RNM A;  1T94 A;  4FBU A;  2RHF A;  4TQR A;  2KIV A;  2W8L A;  2KHV A;  3RAQ A;  2LMR A;  5KG4 A;  2BR0 A;  1Z00 A;  2WTF A;  3MFI A;  3MC1 A;  1BNP A;  1PVR A;  5TZV A;  4GXK A;  5F9N A;  4PGQ A;  3C1Z A;  5DDM A;  9ICS A;  2CXY A;  5KFN A;  4ECY A;  4OJ6 A;  2WAQ F;  4KLO A;  4EBK A;  4AT9 A;  4Z6F A;  2ZH6 A;  1OXJ A;  4NLZ A;  2BQR A;  3NVY A;  2IHN A;  1NJY A;  5KFM A;  2HHS A;  2HHU A;  5HMM A;  1RDF A;  9ICC A;  2DFL A;  2KFN A;  5AK3 A;  4ELU A;  4OJP A;  2NO4 A;  4LEY A;  5AM4 A;  1BPY A;  2XC9 A;  1S9F A;  2ZH5 A;  3MR3 A;  2ZH4 A;  4KLI A;  4E7X A;  3Q8P B;  3MR2 A;  2AJQ A;  1PK3 A;  4FZM A;  4M9L A;  3WK4 A;  2C28 A;  3NYB A;  2UVV A;  3AM9 A;  3D6J A;  5CRX A;  1RG6 A;  4UD5 A;  3R9K A;  4KLL A;  2RDI A;  1UET A;  1TE2 A;  1COK A;  3NVV A;  3C21 A;  2A3V A;  2K8C B;  3C5G A;  2KJ8 A;  4J9K A;  3UM9 A;  1ZQB A;  4HX0 A;  1B0X A;  1LKY B;  4I27 A;  2BGW A;  2LYB A;  4DSJ A;  2HN2 A;  4NWI A;  5AI4 A;  2IOF K;  4RT3 A;  4QWD A;  4S3N A;  5HRD A;  4F2R A;  4P4M A;  2GWS A;  2DRA A;  2KZZ A;  3KZX A;  5ALS A;  3IP4 B;  1QSL A;  5B66 U;  5DB8 A;  2ZJA A;  2DL0 A;  2HHV A;  5L1J A;  8ICJ A;  2QB0 A;  1CRX A;  1F44 A;  3PZP A;  2BDP A;  4UB3 A;  2XCP A;  4GFJ A;  1QCK A;  1MIY A;  5G5H A;  3QZ8 A;  2PBE A;  3SAH A;  2VA3 A;  3BZK A;  2MU2 A;  5KG2 A;  4YG2 A;  3H0L B;  4C8M A;  3GU3 A;  2ATL A;  4US9 A;  2PMZ C;  4JLZ A;  2RP5 A;  5IIO A;  2KHQ A;  4EV6 A;  5KFO A;  4EBC A;  3FAH A;  4I2E A;  2ZJ5 A;  2DKX A;  3AL0 B;  3JPN A;  1X2I A;  4EBD A;  3UMB A;  4O3O A;  3RB0 A;  5KFD A;  3PW5 A;  2FPK A;  4RWN A;  4I2I A;  4RPX A;  4O6A A;  2E1E A;  1UQV A;  4NM1 A;  4ED7 A;  4MHV A;  2KVS A;  2K89 A;  1SV4 A;  5IIK A;  4Y2P A;  5J0X A;  4NLN A;  3FC4 A;  4G9B A;  4DO9 A;  2XO7 A;  1X9S A;  1X66 A;  4QZE A;  3EZ5 A;  4ATB A;  3HP6 A;  3M9N B;  2QAR B;  4IS7 A;  3T79 A;  1SB3 C;  1U45 A;  5E79 U;  1X40 A;  4BJQ A;  2W54 A;  2IOH A;  1N5W A;  4DOA A;  3Q8S B;  4NXU A;  4OD0 A;  2MA1 A;  3H38 A;  2BE3 A;  1URJ A;  2ZTD A;  4UAS A;  4WC5 A;  5BPC A;  3E58 A;  1KDH A;  5JTG A;  3JPP A;  4YR0 A;  4FHX A;  2KZ3 A;  4DFJ A;  9ICB A;  2WF9 A;  5AM5 A;  3ONN A;  1BNO A;  5KFZ A;  4RNN A;  5KG7 A;  1B22 A;  2YX8 A;  7ICL A;  3PSI A;  2LM4 A;  3DDH A;  4WBZ A;  3KHH A;  3T3F A;  3RRH A;  3M1Y A;  2HBM A;  4B6J A;  3BQ0 A;  1HIW A;  1SL0 A;  2ZHB A;  3DV9 A;  4EYI B;  4JLX A;  3AQM A;  3NUQ A;  1L3T A;  2YMQ A;  3H0M B;  1QQ6 A;  8ICS A;  4NLB A;  5KFX A;  4I29 A;  2UVR A;  3OJS A;  4EGW A;  4CNQ A;  1NO5 A;  1KFD A;  2CRX A;  3QU7 A;  3LVW A;  4XQ8 A;  3KHG A;  3OUY B;  2OHF A;  4PZO A;  4MF8 A;  5D49 A;  1WOT A;  4QZ8 A;  4TUR A;  5AK6 A;  4UQG A;  4DL7 A;  8ICC A;  5KT3 A;  4K4G A;  2KTQ A;  2J6U A;  4E8F A;  3G6V A;  4O0I A;  3F5A A;  3M8S A;  3ALR A;  1J2N A;  2HBK A;  3AQF A;  2YML A;  3K7D A;  3PST A;  2W04 A;  2B0C A;  1TK5 A;  2W3R A;  5DQH A;  1S76 D;  1ZJN A;  8ICE A;  7ICG A;  3ZD8 A;  3OSP A;  4DSE A;  2ASJ A;  5ALE A;  2DWQ A;  2HMX A;  5KFF A;  8ICN A;  1TK8 A;  1NJX A;  4M0A A;  5HC9 A;  4EBE A;  1Z4N A;  5BOM A;  4O67 A;  1RPL A;  5KFP A;  4CCH A;  3MFH A;  2P35 A;  2W7O A;  2G06 A;  2OH2 A;  2KP7 A;  3H37 A;  4PJ0 U;  3GIJ A;  1Y88 A;  2XIC A;  2FLP A;  3D2S A;  3RH6 A;  3E0F A;  1YT3 A;  2W43 A;  5IIJ A;  1A0P A;  4F72 A;  4RQ5 A;  5J0Y A;  4KLD A;  1UHU A;  1AQ6 A;  2ASL A;  1PUZ A;  2ZIU A;  2BZF A;  3UQ2 A;  2PFQ A;  1JUD A;  4B9L A;  3SV3 A;  5CHE A;  2M2U A;  2K8A A;  1DK2 A;  4NXZ A;  4QWA A;  4ACO A;  5AKH A;  4XJE A;  3SEN A;  3RBD A;  1JRP A;  5AKZ A;  4RWP A;  1RM6 C;  2G5H B;  2C2R A;  1VDV A;  3QNM A;  3V7K A;  3RRG A;  4YN4 A;  4RQM A;  5F2V O;  3SV4 A;  3C5F A;  4XA5 A;  4M9G A;  1SZH A;  3T5H A;  4DSL A;  8ICG A;  4O68 A;  5AKJ A;  9ICL A;  5AKG A;  2Y9U A;  1KRP A;  9ICI A;  4C8L A;  3GII A;  1IXR A;  4EP7 A;  4F4Z A;  3ZDC A;  3TAD A;  3QXG A;  3NRW A;  1RXV A;  2IHM A;  2WFA A;  5HRF A;  3PMN A;  4Q44 A;  2M0N A;  4X4T A;  5ALK A;  2DR9 A;  2DRB A;  3ER9 B;  1ZQP A;  1NK5 A;  3C2K A;  3NAS A;  5AIC A;  4J9Q A;  2YMP A;  3V7J A;  3QUB A;  3WFO A;  1ARO P;  4Q43 A;  4O3R A;  2FPM A;  5J2K A;  5J0T A;  1S0N A;  4AT7 B;  2JEJ A;  4PGX A;  3NWI A;  5AIA A;  1ZOL A;  4UAY A;  4RQ7 A;  5B3Q A;  2PFO A;  3I1Y A;  7ICO A;  3KFU F;  5J0P A;  3HPO A;  4R66 A;  1QQ5 A;  3IG8 A;  3ZDE A;  5AHX A;  4ELV A;  3N97 B;  2EAP A;  1SL2 A;  9ICE A;  4MKP A;  4JWN A;  1R89 A;  2CPR A;  1D8B A;  2R8H A;  2FJ6 A;  2GH1 A;  5ALP A;  1JX4 A;  3RJE A;  1ZQK A;  3QUC A;  4ECX A;  4IQV A;  4KN4 A;  3AU2 A;  1BPE A;  8ICR A;  3S6J A;  1NK4 A;  1YZ7 A;  5JUM A;  8ICV A;  1TV9 A;  1GPJ A;  3AQN A;  2GOL A;  2XI9 A;  2G09 A;  2W9C B;  2EAN A;  3WU2 U;  1X6I A;  3DEE A;  4IL6 U;  1BGX T;  2KJ5 A;  1XS9 D;  2KIW A;  1DGS A;  4WC7 A;  2G07 A;  2KK0 A;  2JEF A;  3LDA A;  3CW2 C;  1KQQ A;  4P4P A;  1JXL A;  5EWE A;  2AHO B;  3M7D A;  9ICV A;  4OJL A;  3PX0 A;  3PO4 A;  4M6W B;  3QU5 A;  5ALI A;  1H38 A;  5AM1 A;  1WWU A;  2HHQ A;  1QQ7 A;  2KFZ A;  1TKD A;  5GTH U;  1NOM A;  1L5U A;  5CR0 A;  2RDJ A;  2BHN A;  2BPC A;  4RNO A;  1L7P A;  4MFA A;  1ZD3 A;  4Y2Y A;  5DQG A;  4DFM A;  1JMS A;  2FPL A;  9ICM A;  1JQR A;  2F76 X;  1FFU A;  2G08 A;  5F9L A;  3ED5 A;  1O08 A;  1U49 A;  4P0P A;  3KOO A;  4X4R A;  1PK1 A;  2AU0 A;  4J9N A;  4R8U B;  3UPS A;  2AQ0 A;  3T5L A;  4X4S A;  4KLJ A;  4X4V A;  4RQ6 A;  4RPZ A;  1L7N A;  1ZQR A;  2FMS A;  4CE6 A;  5DBA A;  3JPQ A;  1BVS A;  2FMP A;  3OHA A;  1WWV A;  2EQY A;  3G6X A;  2QB1 A;  1K1S A;  5L1I A;  4FH3 A;  3KD3 A;  4I0U A;  1Q79 A;  3V6J A;  9ICJ A;  5D63 A;  3IG5 A;  9ICN A;  4CGZ A;  3IM1 A;  3C66 A;  5AM3 A;  4PHP A;  2DVI A;  4ZH4 A;  3WFR E;  2HVI A;  4YMN A;  3BQ1 A;  4EEB A;  3RB4 A;  1NKE A;  4PGY A;  4K9A A;  3WKC A;  4DSK A;  2WF7 A;  2A1J A;  2ISP A;  4ECV A;  1DOQ A;  4IC9 A;  5KFT A;  4KLT A;  1UEU A;  5AK5 A;  4MF2 A;  5HR6 A;  7ICT A;  3D2Q A;  9ICR A;  2I9G A;  5AK4 A;  4DOB A;  3KHR A;  3RB3 A;  2M2W A;  3N7R C;  4NXT A;  2PI4 A;  8ICK A;  4RT2 A;  4NM2 A;  3H7I A;  3K1Z A;  3SYZ A;  5KTQ A;  3C28 A;  3PW4 A;  4FS2 A;  5AIB A;  4LEZ A;  3MAB A;  1C7Y A;  1FA0 A;  4C8N A;  5C5J A;  4NLK A;  2XVT A;  1LVH A;  2KNJ A;  1DRG A;  4WC6 A;  5KG1 A;  3I76 A;  2ZH1 A;  3NVO A;  9ICG A;  5KNI A;  2YB4 A;  1R8A A;  2E8O A;  2XGQ A;  3BJY A;  1T8E A;  4O3Q A;  4CF4 A;  8ICA A;  4I2F A;  5EWF A;  4EEK A;  3LWL A;  2W9B B;  3BS5 B;  2V9W A;  1FEZ A;  2G0A A;  4TUS A;  2IUB A;  4CRX A;  4EED A;  3WKE A;  2GAF D;  3PSF A;  1N60 A;  3F2B A;  2JZB B;  2ZH8 A;  2LKY A;  4YP3 A;  5KFC A;  3HIY A;  5KFR A;  3PR4 A;  4QZF A;  3QU4 A;  3G6Y A;  7ICJ A;  3NVZ A;  4X4P A;  1HEK A;  5AI6 A;  4OO1 J;  4C80 A;  4DQQ A;  1ZRM A;  1ZQF A;  3U26 A;  3IV6 A;  4F4K A;  2AGQ A;  3CK6 A;  2I1Q A;  2W9A A;  3FM9 A;  2JH7 A;  4P0Q B;  3IHQ B;  1U47 A;  2D6F C;  3F5E A;  5IIL A;  2W9M A;  3PO5 A;  4RWO A;  4KLM A;  2NO5 A;  1SZP A;  3SR6 A;  4WQK A;  1NI3 A;  4ECR A;  3Q8K A;  3RJK A;  4YQW A;  2LYA A;  3H4D A;  5ALV A;  5DGB A;  1RZT A;  1N5X A;  5CFT A;  1Z4O A;  5III A;  2E8P A;  4RQ1 A;  3OGU A;  2Z7J A;  1XSP A;  5ALM A;  3KZI U;  3HJ4 A;  5KT6 A;  2ZUC A;  4B9M A;  1UCV A;  1L7M A;  1S5L U;  5AI5 A;  3GQC A;  8ICU A;  9ICQ A;  5ALF A;  2HHX A;  5ALN A;  4QZG A;  4O3P A;  1ZQL A;  2AGO A;  3SI8 A;  4RUC A;  2DPI A;  4NXW A;  3H4B A;  2EZZ A;  3UXP A;  1MN8 A;  5TIS U;  4K99 A;  4M04 A;  3V7L A;  2XGP A;  1XO0 A;  1JAJ A;  5DG8 A;  1JI7 A;  4ECQ A;  3L3F X;  3LQC B;  4KLU A;  2NRV A;  4TUQ A;  3QZ7 A;  2R8G A;  1JAL A;  3C29 A;  2ZTC A;  1ZQV A;  2NV3 A;  5AKY A;  3HRD D;  3C2L A;  4I2B A;  3THV A;  4O5C A;  4AP9 A;  4F71 A;  2DR8 A;  3KBB A;  2HHP A;  1SWW A;  5HRE A;  1U4B A;  4JV0 A;  2OWO A;  3EPG A;  4FH5 A;  5EE1 A;  4YR2 A;  4AYB F;  3SMV A;  2VAN A;  2CN1 A;  7ICM A;  1D8L A;  4F3O A;  2JEG A;  5J2B A;  4C7Z A;  4US8 A;  4J9S A;  3OVB A;  1XO1 A;  2F77 X;  2FLN A;  4F5R A;  4OCZ A;  2AXT U;  2ZH3 A;  1LKY A;  1PZN A;  4UB5 A;  1X42 A;  4YCX A;  3RJF A;  1OU5 A;  4EEL A;  3JZ0 A;  1ZD2 P;  3PSP A;  5ALU A;  2BKE A;  2K4P A;  5HRI A;  1F5S A;  1Q8K A;  2A19 A;  2DKZ A;  2R8J A;  4OAI Z;  4KLF A;  3H8S A;  5J0R A;  5KFH A;  4RPY A;  1ZQQ A;  3D2N A;  5J2D A;  3C1Y A;  4Q8F A;  5D61 A;  1TAM A;  3ICX A;  4KM5 A;  9ICH A;  4UB2 A;  1XSN A;  4DFD A;  3QX7 A;  4BDP A;  1S0V A;  1ZQC A;  2MRL A;  2IBK A;  2QKQ A;  1ZYQ A;  4YD1 A;  4DFK A;  4WQL A;  2ZIW B;  4YD2 A;  2Y9T A;  1NNL A;  2FCL A;  2B21 A;  5D4B A;  3TAP A;  5CP2 A;  4DQP A;  4EBJ A;  4Y2T A;  2MUT B;  1SKW A;  1Q78 A;  1Q3U A;  3ZDA A;  4F2S A;  3JYY A;  4JK1 A;  4Y2J A;  4P4O A;  4C4R A;  7ICV A;  8ICL A;  4X4N A;  1TVA A;  3TFR A;  1R8C A;  4GIB A;  4FS1 A;  5J0Q A;  2D8C A;  1COO A;  4B9U A;  4IQW A;  2B4V A;  4TQS A;  3UPQ A;  3OV7 A;  2JGA A;  2H3F A;  4I2G A;  4YXJ A;  2QAR A;  3WK6 A;  1WG8 A;  4O3S A;  5L9X A;  2BPG A;  4DSI A;  3RFA A;  1J2M A;  4M2Y A;  5AKE A;  3BQT A;  3H8W A;  2KMD A;  4UAU A;  1QSY A;  4AYB C;  4G3I A;  1NZP A;  2NRW A;  2J6T A;  1JN3 A;  2FDR A;  4DL2 A;  3Q8M A;  2KN7 A;  3OTQ A;  3GIM A;  2KVC A;  2YTU A;  3C2M A;  5ALY A;  5IIM A;  4Z6C A;  5L1M A;  4Z6E A;  4PH5 A;  2M2T A;  1KNY A;  1FIQ A;  3OVS A;  1ZQW A;  1IG6 A;  1ECW A;  2H3Z A;  4ED1 A;  4QZC A;  2YY6 A;  1QLN A;  4QW9 A;  4JMU A;  2Y1J A;  4NXX A;  2L5Y A;  1L3V A;  5K4L A;  2ZIX B;  4KIT B;  5KT2 A;  1SV0 C;  4C4T A;  4NXV A;  3ERC C;  4GC7 A;  5HRH A;  3OUY A;  8ICW A;  2VIX A;  5J2C A;  5J2I A;  5T14 A;  2A1A A;  4IQU A;  2JRZ A;  5ALW A;  3QE9 Y;  1KBU A;  2EDU A;  8ICT A;  4DL3 A;  5CFS A;  2F8K A;  1YZ6 A;  3M8R A;  1TFY A;  3ORY A;  2VA8 A;  4F4W A;  2HDO A;  2RQ5 A;  4O69 A;  5AKL A;  5JTI A;  1M6Y A;  1S0O A;  2XY7 A;  2AQ4 A;  4LZD A;  4QZ9 A;  2HI0 A;  4J9R A;  2EH9 A;  2K4I A;  3NGD A;  4K98 A;  4F4Y A;  4OJO A;  4QZB A;  4QZI A;  1S77 D;  1KEJ A;  4FHY A;  4RQ8 A;  3MGV A;  3QUQ A;  4C7Y A;  2IOF A;  2KOB A;  4O3N A;  1ZQU A;  2C2E A;  3O0F A;  3Q8R B;  5ALQ A;  1SXE A;  1IM4 A;  2LPE A;  1ZQA A;  5J0W A;  2ESE A;  1SIJ A;  3GIK A;  2YB1 A;  1ZQD A;  5KG5 A;  9ICF A;  3AUO A;  1Z3E B;  4R64 A;  1F5A A;  4FZN A;  4FHW A;  2K4E A;  1L3U A;  1F0M A;  4KLS A;  2M9N A;  4K8V A;  1ZD4 A;  5KG3 A;  4X5V A;  3T5K A;  5L1L A;  3AQL A;  2ZUD A;  5HNK A;  3IN5 A;  4B9T A;  3LYS A;  8ICH A;  2XID A;  1FO4 A;  8ICF A;  4ECW A;  5HR7 A;  1Q46 A;  3AQK A;  4DL5 A;  2DUY A;  4DSF A;  3F2C A;  2GLE A;  1ZQZ A;  5EWG A;  4PHA A;  1FFV A;  4ECU A;  4IQT A;  5HHH A;  3LWM A;  5AI0 A;  4I2D A;  1Z1B A;  2WB1 C;  4Y2R A;  4OAG A;  2DBY A;  4DQS A;  3B0X A;  2P6R A;  2EAO A;  2BBH A;  2R8K A;  3I28 A;  2Y1I A;  1B4F A;  4K97 A;  4DL4 A;  4NY8 A;  3PW2 A;  4UB6 U;  2BQ3 A;  3SQI A;  4NLG A;  3BQ2 A;  5ALX A;  1WYG A;  2LYH A;  4IRK A;  2Q0Z X;  1UEV A;  7ICE A;  4WJ3 B;  1VJ7 A;  5KFL A;  4X0A A;  2NRT A;  4UAR A;  4AT7 A;  3WKD A;  5J2J A;  1IV8 A;  1N63 A;  2FLL A;  5JU5 A;  2F1J A;  3TKA A;  2VJ5 A;  1X9X A;  4CF5 A;  4ECS A;  1ZQS A;  2F1I A;  4UB8 U;  7ICI A;  4WC1 A;  2EZX A;  2NRX A;  1ZQM A;  2ZIV B;  3PX6 A;  2IMW P;  3AEV A;  2JMG A;  3C18 A;  3Q8Q B;  1X6J A;  5HRL A;  5ALZ A;  5HML A;  5B5E U;  1DK3 A;  4I2A A;  4ED6 A;  1OUQ A;  1X9W A;  3OPX A;  3IDW A;  9ICP A;  4WH5 A;  2W9C A;  3WK7 A;  3CNH A;  4JWM A;  2ES6 A;  1ZQH A;  4F5P A;  4RUA A;  4JB3 A;  8ICQ A;  3KTQ A;  8ICY A;  2W03 A;  3ETL A;  4DFP A;  4R65 A;  4AT8 B;  4M9N A;  2KZM A;  4M6W A;  5KFU A;  3H8M A;  3OJU A;  3A0H U;  2XY6 A;  4BX9 C;  2HHW A;  2B6G A;  5JRT A;  2KKP A;  3RH5 A;  3KKA C;  5J0U A;  2F2A B;  2M2V A;  2OYY A;  4ED3 A;  3HIL A;  2ID1 A;  4X4Q A;  4LEW A;  3PHZ A;  4HAI A;  4YMO A;  5CHG A;  4WC0 A;  4GXJ A;  4DL6 A;  3NTU A;  4LJX A;  2AGP A;  1NKB A;  3CYM A;  4BXO B;  5DG7 A;  4R8U A;  2HOI A;  5C0Y A;  4M47 A;  5D62 A;  1D9F A;  5DQI A;  1UT8 A;  1NK7 A;  2KSO B;  1ZRN A;  4UAV A;  1ZJM A;  4O5K A;  4DLE A;  1T4G A;  1ZQI A;  4U7C A;  1S8O A;  4WC4 A;  5J29 A;  4TUP A;  5KFY A;  4Q8E A;  1S10 A;  5KFI A;  3PX4 A;  3UQ0 A;  1D9D A;  2W3S A;  4EX6 A;  4ECT A;  2UVU A;  1LB2 B;  4YMM A;  3QEB Z;  5HRK A;  4KLE A;  5J0O A;  1CEZ A;  4OJ5 A;  3OVA A;  3PML A;  4ED8 A;  4LVS A;  3EPI A;  1QTM A;  2Y0S C;  1Z00 B;  3K1R B;  5KFE A;  1UPH A;  2F1H A;  1SKR A;  3GDX A;  4UAW A;  3RJH A;  2YN4 A;  5ALJ A;  4IG8 A;  1CUK A;  4GXI A;  4J03 A;  7ICK A;  4O9M A;  4UB4 A;  2RFF A;  4NKT A;  4AT9 B;  1MQ2 A;  2BPF A;  4UB1 A;  3L4P A;  3HW8 A;  2BCU A;  3ER8 C;  2BDU A;  3ISB A;  4DF4 A;  4OAF A;  1LV5 A;  4J9M A;  5J2E A;  4NV0 A;  3OWG A;  2WF5 A;  5DB9 A;  4QIW F;  4EEN A;  5J8Y C;  2E8M A;  4P2H A;  4QZD A;  2H5X A;  5GTI U;  4F50 A;  1L3S A;  4RQ3 A;  3MR6 A;  4M9H A;  4X4U A;  4MFC A;  3ETR A;  3TAQ A;  1UA0 A;  3BZC A;  4UBC A;  4F8R A;  5DEC A;  5KFG A;  1WCL A;  1IIP A;  2OEH A;  2HW3 A;  5J2G A;  3Q8L A;  2Q4T A;  3QU9 A;  4NL9 C;  4Q45 A;  5DKW A;  9ICK A;  3QUT A;  3NVW A;  7ICN A;  3EF2 A;  1XNS A;  4KX3 A;  3UXO A;  2KJ9 A;  1KL9 A;  4M9J A;  3ZDD A;  1NK6 A;  2W9B A;  3BS5 A;  4O3M A;  4X0B A;  1KSP A;  2HBL A;  5ALL A;  4E0D A;  1ZQY A;  1CI4 A;  2JZB A;  4KX5 A;  4KLQ A;  1O03 A;  3CP8 A;  2MAX A;  2PFP A;  2QB0 B;  1TAQ A;  3PW0 A;  4NKU A;  2JHD A;  3WK8 A;  1KFS A;  4K96 A;  8ICB A;  4J9L A;  1RYS A;  1PVQ A;  1TFW A;  3SD7 A;  3H40 A;  2V4Q A;  4J9P A;  2B56 A;  2EWR A;  1Z19 A;  5KT5 A;  5EOZ A;  4P0Q A;  3BQ7 A;  1ZQT A;  2KV2 A;  3EYZ A;  3TAN A;  1RQN A;  4Y2X A;  2PFN A;  2VKQ A;  4QWE A;  1WCN A;  2ZXI A;  2BCV A;  7ICU A;  3TAC B;  5A0L A;  3WFS C;  2G5I B;  1KN5 A;  3VC8 A;  3RJI A;  4UBB A;  3GFK B;  2JH1 A;  5DLG A;  2KG5 A;  1B43 A;  5KFA A;  5KAI U;  2PI5 A;  3RR8 A;  2DPJ A;  2RRD A;  5CA7 A;  3GV7 B;  3M9M B;  1V9P A;  9ICA A;  3WKA A;  1JXE A;  3V72 A;  4QIW C;  3MDA A;  3HKZ C;  1P7D A;  1BPZ A;  2R18 A;  2DR5 A;  4ATB B;  2N1R A;  1KFT A;  1V97 A;  9ICU A;  3SEI A;  2GO7 A;  2ZXH A;  2JXJ A;  3PV8 A;  2WF8 A;  5AM2 A;  3AQE A;  5L1K A;  4E80 A;  4RU9 A;  7ICH A;  2PKE A;  4RQ4 A;  1ZET A;  5DB6 A;  4DS5 A;  2UVW A;  2W7P A;  3MCR A;  4DOC A;  4DCC A;  5ALD A;  1JRO A;  1N62 A;  3L5K A;  2B51 A;  1V38 A;  1SV0 A;  2LM1 A;  1EXN A;  2IHO A;  1L7O A;  1QSS A;  4PL2 A;  4GC6 A;  2WAQ C;  2BQU A;  9ICW A;  4F91 B;  3N28 A;  3TQ1 A;  5AI9 A;  2XY5 A;  1DGJ A;  4PHD A;  5DG9 A;  3UMG A;  8ICX A;  3WFQ E;  1ZQJ A;  5DLF A;  1BPX A;  2Q66 A;  4RQ0 A;  4F5N A;  2H3V A;  4QW8 A;  5KT4 A;  1L8O A;  3SAF A;  2HOQ A;  1S97 A;  2ISO A;  1DXS A;  2OXO A;  3MGH A;  3M9O B;  1L6N A;  4KLH A;  1VFG A;  1UT5 A;  1TK0 A;  3QYP A;  9ICO A;  2ZJ8 A;  3IRU A;  4NLC A;  4LT6 A;  5ALH A;  3JPT A;  3N7P D;  1N61 A;  1ZXI A;  2HOF A;  1U48 A;  2J6S A;  1MIW A;  1RQL A;  3AU6 A;  1N2X A;  3QU2 A;  4BWM A;  4BGD A;  3RH4 A;  8ICO A;  1C20 A;  5KFQ A;  1NKC A;  5G5G A;  3B0Y A;  2F3N A;  4WOY A;  2H3I A;  2HCF A;  3F53 A;  5EE3 A;  4ECZ A;  2HHT A;  4J9O A;  1SGG A;  1HUZ A;  1SWV A;  2YQE A;  4PHE A;  2ZIW A;  5KFK A;  1ZQN A;  4JV2 A;  7ICR A;  2HSZ A;  4DQR A;  2ZH9 A;  4DEZ A;  4QJF B;  4XUS A;  4KN7 A;  4PPX A;  3PR5 B;  2KKV A;  2MUT A;  7ICF A;  7ICS A;  2DQN B;  3ISD A;  4UW9 A;  5ALT A;  5CEH A;  3FYH A;  3TI0 A;  5ALO A;  3WK5 A;  5KG0 A;  3BS7 A;  5CJ7 A;  4MEX A;  1ZQO A;  2P6U A;  4O5E A;  2I6X A;  2NRK A;  3HWT A;  2ODG A;  2WHE A;  4CF3 A;  2WB1 F;  3H3A A;  2ZIU B;  1BPD A;  4K9B A;  3NKU A;  4WBY A;  1SKS A;  3RF9 A;  1XU4 A;  3PY8 A;  7ICQ A;  1BPB A;  5KL8 B;  4B9S A;  8ICP A;  2BCR A;  3HT3 A;  1ZQG A;  2BCS A;  1WUD A;  1A77 A;  2R8I A;  8ICM A;  3N4M B;  3TFS A;  1R8B A;  2W11 A;  3F2D A;  4IR1 A;  3NS1 A;  1HUO A;  4F5Q A;  1RYR A;  4KB6 A;  3UXN A;  2ZH7 A;  2OM6 A;  3EW9 A;  3M6Z A;  5KT7 A;  4RZR A;  2ZHA A;  4BUG A;  4NJ8 A;  4RWQ A;  5KFV A;  2O1P A;  1U9L A;  2BBJ A;  2DF4 B;  5HRB A;  5FP0 A;  2ZUB A;  3VCB A;  4DQI A;  3LVV A;  4EEY A;  3HJE A;  1NZB A;  2LBO A;  2NRZ A;  4EYH B;  5KAF U;  4YXM A;  3ZD9 A;  4KLG A;  4FHV A;  3WFP A;  2NYV A;  2EZY A;  4PL1 A;  3B9J A;  4FO6 A;  4IRC A;  1A76 A;  3EWA A;  3TAR A;  4MEY A;  2K4H A;  2ZIX A;  2KD1 A;  5F3X B;  2E3T A;  1MA7 A;  1TFR A;  1XSL A;  4Y2S A;  4WCW A;  5ALR A;  3PVX A;  4DWI A;  3GV5 B;  5DDY A;  2GA9 D;  4C8O A;  4X4O A;  4FZL A;  3A0B U;  4Y2Q A;  2BCQ A;  1J97 A;  2HN1 A;  3WK9 A;  3MR5 A;  5HHI A;  2HVH A;  1T7P A;  3RJG A;  5KFS A;  4ED2 A;  1XC9 A;  1N56 A;  4ZOH C;  4UAT A;  4C8K A;  2E8N A;  4YVZ A;  4ICA A;  4N7R A;  5D46 A;  3KKA A;  2I5H A;  4Z6D A;  3OSN A;  3KHL A;  1PVP A;  3V6H A;  1NK0 A;  3BDP A;  3NRZ A;  2JR5 A;  4FBT A;  3N7S C;  3L9D A;  5HR9 A;  4I28 A;  4UD4 A;  4EZ9 A;  4DF8 A;  4RQN A;  5AKI A;  1SL1 A;  3ZI4 A;  3V6K A;  2C22 A;  4USA A;  4F5O A;  1VLB A;  1GO3 F;  3MBY A;  4I2C A;  3OHB A;  4CDG A;  5DB7 A;  2JV3 A;  1V85 A;  1ZD5 A;  4R63 A;  2KEY A;  2W55 A;  4YR3 A;  1Q3V A;  2PXI A;  4A8E A;  5H2F U;  1RXW A;  2FE9 A;  4QNL A;  4K4H A;  2KIC A;  1JIH A;  4P0P B;  3QEA Z;  3RTV A;  3K75 D;  1SXD A;  2RLT A;  4JV1 A;  2MSN A;  3CRX A;  1PK1 B;  3RR7 A;  4U6P A;  5KL1 B;  3ZDB A;  2K60 A;  1KLN A;  2WF6 A;  3RB6 A;  2DGZ A;  4DS4 A;  4XRH A;  1ZQE A;  3M6K A;  1K5O A;  4QZA A;  1KKX A;  2AH5 A;  4M5D A;  2V4R A;  2Y0S F;  2JEI A;  7ICP A;  4C0Z A;  1MIV A;  4PZN A;  9ICX A;  1ED1 A;  4C4S A;  3AN1 A;  4F92 B;  4OAH A;  1XWL A;  2EAM A;  2YMM A;  4KMO B;  4HYK A;  3GIL A;  5J2H A;  2W8K A;  4XQ7 A;  3UMC A;  5J2A A;  4EZ6 A;  4RQ2 A;  1HJP A;  2H3Q A;  2HBJ A;  1NJW A;  1ZQ1 C;  1T3N A;  4WC3 A;  5KFW A;  3LK9 A;  5KFB A;  5AKX A;  5BOL A;  2KE7 A;  4YFK A;  1KW4 A;  1TAU A;  5J8Y A;  4QZH A;  5AM0 A;  2A1J B;  1X9M A;  1MSW D;  9ICT A;  5DBC A;  2VA2 A;  4UAZ A;  2ALZ A;  1UA1 A;  8ICZ A;  1V4A A;  3JPR A;  4WC2 A;  3SZ2 A;  4GLX A;  3JPS A; 
#chains in the Genus database with same CATH homology
 2C2R A;  3TAP A;  5CP2 A;  3V7K A;  4DQP A;  3RRG A;  7ICN A;  4YN4 A;  5J2F A;  4EBJ A;  2MUT B;  3UXO A;  1SKW A;  5F2V O;  3SV4 A;  5CWR A;  3C5F A;  4XA5 A;  1MIW A;  2ASD A;  1Q78 A;  4M9G A;  4M9J A;  3ZDD A;  3ZDA A;  1NK6 A;  2W9B A;  4F2S A;  4B9N A;  3JYY A;  3T5H A;  4X0B A;  4JK1 A;  4DSL A;  1KSP A;  8ICG A;  4P4O A;  7ICV A;  9ICL A;  8ICL A;  3H39 A;  1KRP A;  9ICI A;  4X4N A;  4C8L A;  3GII A;  1IXR A;  1TVA A;  4E0D A;  4QWC A;  1PX5 A;  1ZQY A;  4EP7 A;  4F4Z A;  3ZDC A;  4B9V A;  2JZB A;  3TFR A;  2FMQ A;  4KLQ A;  1R8C A;  4FHP A;  2MAX A;  1RXV A;  2IHM A;  2PFP A;  4FS1 A;  5HRF A;  1TAQ A;  3PMN A;  5J0Q A;  3PW0 A;  4Q44 A;  4NKU A;  1COO A;  4B9U A;  4X4T A;  2O5A A;  2DR9 A;  2DRB A;  1KFS A;  4IQW A;  1N48 A;  1ZQP A;  4F93 B;  1NK5 A;  8ICB A;  4TQS A;  4J9L A;  1RYS A;  3C2K A;  1TFW A;  1NJZ A;  4IRD A;  4J9Q A;  3UPQ A;  3V7J A;  3OV7 A;  3WFO A;  3H40 A;  1ARO P;  4Q43 A;  3PNC A;  4F4X A;  4O3R A;  2V4Q A;  4I2G A;  4J9P A;  2FPM A;  4YXJ A;  5J0T A;  5J2K A;  1S0N A;  3RAX A;  8ICI A;  2JEJ A;  4PGX A;  4AT7 B;  5KT5 A;  5EOZ A;  4O3S A;  5L9X A;  2BPG A;  5J0S A;  4DSI A;  4UAY A;  4RQ7 A;  2PFO A;  7ICO A;  2ZH2 A;  4KTQ A;  4BWJ A;  4M2Y A;  4KMU A;  5J0P A;  1ZQX A;  3BQT A;  3H8W A;  3HPO A;  1ZQT A;  1QSY A;  4G3I A;  1NZP A;  4R66 A;  3ZDE A;  3EYZ A;  3TAN A;  2PFN A;  3RJJ A;  5DBB A;  2NRW A;  4DLG A;  4ELV A;  3MDC A;  3N97 B;  2J6T A;  1JN3 A;  3HX0 A;  1SL2 A;  9ICE A;  2ZH3 A;  4JWN A;  4QWE A;  3FDS A;  2KN7 A;  4DL2 A;  1WCN A;  3Q8M A;  1R89 A;  2BCV A;  2R8H A;  7ICU A;  3WFS C;  3MGI A;  3GIM A;  5HP4 A;  1JX4 A;  3RJE A;  3C2M A;  3RJI A;  1ZQK A;  3E2E A;  4UBB A;  3HJ1 A;  3GFK B;  4K4I A;  5IIM A;  3H8J A;  5DLG A;  4ECX A;  4IQV A;  4KN4 A;  3AU2 A;  4Z6C A;  1B43 A;  4Z6E A;  2C2D A;  4PH5 A;  5KFA A;  2PI5 A;  3RR8 A;  2M2T A;  1KNY A;  2DPJ A;  1BPE A;  4JUZ A;  8ICR A;  5CA7 A;  1ZQW A;  5DED A;  3GV7 B;  3M9M B;  3OVS A;  1V9P A;  1NK4 A;  1K1Q A;  5JUM A;  9ICA A;  8ICV A;  1MC8 A;  4QWB A;  1TV9 A;  1D8Y A;  4BXO A;  3AQN A;  4AT9 B;  1JXE A;  5HRG A;  2W9C B;  3V72 A;  2ZTE A;  3MDA A;  4ED1 A;  1BPZ A;  2DR5 A;  1BGX T;  4ATB B;  1XS9 D;  4QZC A;  1KFT A;  3T5J A;  2P66 A;  1DGS A;  1QLN A;  4QW9 A;  4WC7 A;  2Y1J A;  2XCA A;  1L3V A;  4ED0 A;  2JEF A;  9ICU A;  3LDA A;  5KFJ A;  3RBE A;  4P4P A;  4KIT B;  5KT2 A;  5EWE A;  1JXL A;  4ELT A;  4AT8 A;  3ISC A;  3PV8 A;  3JPO A;  1MQ3 A;  5IIN A;  9ICV A;  3PX0 A;  1NK8 A;  4GC7 A;  5L1K A;  5CB1 A;  4M6W B;  4RU9 A;  3PO4 A;  5HRH A;  4E80 A;  8ICW A;  7ICH A;  3OUY A;  1H38 A;  5J2C A;  5KG6 A;  4RQ4 A;  1ZET A;  5DB6 A;  4DS5 A;  5J2I A;  2UVW A;  4MFF A;  2HHQ A;  2KFZ A;  1TKD A;  4DOC A;  1NOM A;  3C23 A;  4IR9 A;  4I2H A;  1L5U A;  5CR0 A;  2RDJ A;  2DR7 A;  2BHN A;  1NK9 A;  2BPC A;  3K4G A;  4RNO A;  3PW7 A;  4IQU A;  4MFA A;  3QE9 Y;  1S0M A;  4I2J A;  5DQG A;  4DFM A;  4LZG A;  1JMS A;  2FPL A;  1EXN A;  8ICT A;  4DL3 A;  2IA6 A;  9ICM A;  1JQR A;  1YLQ A;  1QSS A;  1KTQ A;  5F9L A;  3GV8 B;  5DGA A;  1TFY A;  3M8R A;  4RNM A;  1U49 A;  3ORY A;  2VA8 A;  4F4W A;  4GC6 A;  4FBU A;  4TQR A;  2W8L A;  4X4R A;  3RAQ A;  2BQU A;  9ICW A;  5KG4 A;  4F91 B;  3TQ1 A;  1Z00 A;  2AU0 A;  2BR0 A;  4J9N A;  2WTF A;  4LZD A;  2XY7 A;  3MFI A;  2AQ4 A;  4QZ9 A;  4R8U B;  2XY5 A;  1BNP A;  4J9R A;  4PHD A;  3UPS A;  2AQ0 A;  3T5L A;  5TZV A;  4X4S A;  5DG9 A;  4KLJ A;  4X4V A;  4GXK A;  4RQ6 A;  5F9N A;  4PGQ A;  4RPZ A;  8ICX A;  3WFQ E;  3NGD A;  1ZQJ A;  3C1Z A;  5DLF A;  5DDM A;  1ZQR A;  4F4Y A;  4QZB A;  1BPX A;  5KFN A;  4QZI A;  1S77 D;  9ICS A;  1KEJ A;  2FMS A;  4FHY A;  5DBA A;  4ECY A;  3JPQ A;  2Q66 A;  4RQ0 A;  4RQ8 A;  4F5N A;  4KLO A;  4EBK A;  4AT9 A;  4QW8 A;  5KT4 A;  1SL1 A;  1BVS A;  4O3N A;  4Z6F A;  1ZQU A;  2C2E A;  2ZH6 A;  3Q8R B;  2FMP A;  3OHA A;  4NLZ A;  3G6X A;  1IM4 A;  2BQR A;  1S97 A;  1ZQA A;  5J0W A;  1K1S A;  5L1I A;  2IHN A;  1NJY A;  5KFM A;  2ISO A;  4FH3 A;  3GIK A;  2HHS A;  1ZQD A;  2HHU A;  5KG5 A;  3V6J A;  1Q79 A;  5HMM A;  9ICF A;  9ICJ A;  3AUO A;  3MGH A;  3M9O B;  9ICC A;  2DFL A;  9ICN A;  2KFN A;  1Z3E B;  4KLH A;  4R64 A;  1F5A A;  4FHW A;  3IM1 A;  1VFG A;  1L3U A;  4ELU A;  3C66 A;  1UT5 A;  4KLS A;  2M9N A;  4PHP A;  1TK0 A;  9ICO A;  2DVI A;  2ZJ8 A;  4LT6 A;  1BPY A;  2XC9 A;  1S9F A;  2ZH5 A;  5KG3 A;  3MR3 A;  4ZH4 A;  3JPT A;  2ZH4 A;  4X5V A;  4KLI A;  2HVI A;  4E7X A;  3T5K A;  3WFR E;  3Q8P B;  3MR2 A;  5L1L A;  2AJQ A;  3AQL A;  2ZUD A;  4YMN A;  5HNK A;  3BQ1 A;  4B9T A;  4M9L A;  1U48 A;  3RB4 A;  2J6S A;  8ICH A;  3AU6 A;  1NKE A;  4PGY A;  3RH4 A;  4BWM A;  4BGD A;  4DSK A;  8ICO A;  5KFQ A;  2C28 A;  8ICF A;  1NKC A;  3B0Y A;  3NYB A;  2UVV A;  4ECW A;  4ECZ A;  2A1J A;  2HHT A;  2ISP A;  4ECV A;  4J9O A;  4UD5 A;  4KLL A;  3AQK A;  1HUZ A;  4PHE A;  1ZQN A;  2RDI A;  5KFK A;  1DOQ A;  4JV2 A;  5KFT A;  7ICR A;  1UET A;  3C21 A;  4DL5 A;  4DQR A;  4DSF A;  4KLT A;  4DEZ A;  1UEU A;  3C5G A;  2ZH9 A;  4MF2 A;  1ZQZ A;  5EWG A;  4J9K A;  1ZQB A;  7ICT A;  4PHA A;  4XUS A;  4KN7 A;  9ICR A;  2I9G A;  4PPX A;  3PR5 B;  2MUT A;  4ECU A;  4I27 A;  4IQT A;  5HHH A;  3LWM A;  7ICF A;  4DOB A;  2BGW A;  7ICS A;  4DSJ A;  4I2D A;  3ISD A;  3KHR A;  3RB3 A;  2M2W A;  4DQS A;  4RT3 A;  3B0X A;  3FYH A;  4QWD A;  2P6R A;  3TI0 A;  4S3N A;  5HRD A;  5KG0 A;  4F2R A;  4P4M A;  2PI4 A;  2GWS A;  8ICK A;  2KZZ A;  2R8K A;  5CJ7 A;  4MEX A;  2DRA A;  4RT2 A;  1ZQO A;  2P6U A;  4NM2 A;  4O5E A;  3JPS A;  1QSL A;  2NRK A;  2Y1I A;  3HWT A;  5DB8 A;  2ZJA A;  4DL4 A;  4NY8 A;  3H7I A;  2HHV A;  3PW2 A;  5L1J A;  2BQ3 A;  3SYZ A;  8ICJ A;  5KTQ A;  4NLG A;  3BQ2 A;  3H3A A;  2LYH A;  4FS2 A;  3PW4 A;  1BPD A;  2BDP A;  4IRK A;  4UB3 A;  2Q0Z X;  3MAB A;  2XCP A;  1UEV A;  4WBY A;  1SKS A;  1C7Y A;  7ICE A;  4C8N A;  5C5J A;  4NLK A;  1FA0 A;  1MIY A;  1VJ7 A;  5KFL A;  3QZ8 A;  2PBE A;  1XU4 A;  4WC6 A;  3PY8 A;  7ICQ A;  1BPB A;  2VA3 A;  4X0A A;  2NRT A;  4B9S A;  8ICP A;  5KG2 A;  4AT7 A;  2BCR A;  5J2J A;  5KG1 A;  4YG2 A;  3HT3 A;  1ZQG A;  2ZH1 A;  9ICG A;  4C8M A;  2FLL A;  1R8A A;  2ATL A;  2F1J A;  2XGQ A;  2B21 A;  1A77 A;  2R8I A;  2BCS A;  3N4M B;  8ICM A;  3TFS A;  3BJY A;  1T8E A;  1R8B A;  4IR1 A;  5IIO A;  4ECS A;  1ZQS A;  1HUO A;  4O3Q A;  2F1I A;  5KFO A;  4F5Q A;  4EBC A;  1RYR A;  3UXN A;  7ICI A;  8ICA A;  4I2F A;  4WC1 A;  4I2E A;  2ZH7 A;  3EW9 A;  2NRX A;  5EWF A;  1ZQM A;  3LWL A;  2W9B B;  5KT7 A;  4RZR A;  2IMW P;  3PX6 A;  2V9W A;  2ZHA A;  2ZJ5 A;  4RWQ A;  4TUS A;  3JPN A;  5KFV A;  1X2I A;  4EBD A;  2O1P A;  1U9L A;  3C18 A;  1S0O A;  4O3O A;  3Q8Q B;  3RB0 A;  5KFD A;  3PW5 A;  5HRL A;  5HRB A;  2ZUB A;  2JZB B;  5HML A;  2FPK A;  4RWN A;  2ZH8 A;  1DK3 A;  4I2I A;  4DQI A;  4YP3 A;  5KFC A;  3HIY A;  5KFR A;  3PR4 A;  4QZF A;  4RPX A;  4EEY A;  4I2A A;  2NRZ A;  4EYH B;  3G6Y A;  4ED6 A;  1X9W A;  4NM1 A;  4ED7 A;  4YXM A;  7ICJ A;  4X4P A;  3ZD9 A;  5IIK A;  5J0X A;  9ICP A;  4NLN A;  4KLG A;  4FHV A;  2W9C A;  4DQQ A;  4DO9 A;  3WFP A;  2XO7 A;  1X9S A;  1ZQF A;  4QZE A;  3EZ5 A;  4F4K A;  2AGQ A;  4JWM A;  4ATB A;  4FO6 A;  4IRC A;  1ZQH A;  3HP6 A;  4F5P A;  3M9N B;  4RUA A;  1A76 A;  2I1Q A;  2W9A A;  8ICQ A;  3KTQ A;  8ICY A;  3EWA A;  3TAR A;  4MEY A;  3ETL A;  1U45 A;  4DFP A;  3IHQ B;  4DOA A;  1U47 A;  4R65 A;  3Q8S B;  4AT8 B;  4M9N A;  2KZM A;  3H38 A;  1TFR A;  4M6W A;  5IIL A;  2W9M A;  3PO5 A;  2BE3 A;  1XSL A;  4RWO A;  5KFU A;  4KLM A;  2ZTD A;  1SZP A;  4WCW A;  3OJU A;  3PVX A;  4DWI A;  3GV5 B;  4WC5 A;  5DDY A;  5BPC A;  4ECR A;  1KDH A;  3Q8K A;  3RJK A;  4YQW A;  4C8O A;  4X4O A;  3JPP A;  4YR0 A;  2XY6 A;  4FHX A;  2KZ3 A;  2HHW A;  4DFJ A;  3H4D A;  5DGB A;  1RZT A;  9ICB A;  3RH5 A;  5III A;  5J0U A;  2BCQ A;  2M2V A;  4ED3 A;  5KFZ A;  4RNN A;  3MR5 A;  5KG7 A;  1BNO A;  4RQ1 A;  5HHI A;  3OGU A;  1B22 A;  2ID1 A;  2HVH A;  4X4Q A;  4YMO A;  1XSP A;  7ICL A;  5CHG A;  1T7P A;  3RJG A;  3HJ4 A;  4WBZ A;  5KT6 A;  4WC0 A;  2ZUC A;  3KHH A;  4GXJ A;  4B9M A;  4DL6 A;  3NTU A;  5KFS A;  3T3F A;  4ED2 A;  3RRH A;  1XC9 A;  2AGP A;  1NKB A;  3GQC A;  1N56 A;  8ICU A;  9ICQ A;  4BXO B;  2HHX A;  4C8K A;  3BQ0 A;  5DG7 A;  1SL0 A;  4YVZ A;  4R8U A;  2ZHB A;  4EYI B;  5D46 A;  4QZG A;  4M47 A;  4O3P A;  1ZQL A;  3AQM A;  4Z6D A;  3OSN A;  3KHL A;  2AGO A;  3V6H A;  1NK0 A;  1L3T A;  3BDP A;  3SI8 A;  4RUC A;  2DPI A;  4FBT A;  3H4B A;  1D9F A;  8ICS A;  3L9D A;  5HR9 A;  5DQI A;  1UT8 A;  4I28 A;  1NK7 A;  3UXP A;  4EZ9 A;  4UD4 A;  5KFX A;  1ZJM A;  4DF8 A;  2UVR A;  3OJS A;  4I29 A;  4M04 A;  3V7L A;  4O5K A;  3V6K A;  4DLE A;  1NO5 A;  1KFD A;  2XGP A;  2C22 A;  1JAJ A;  1T4G A;  5DG8 A;  4F5O A;  1ZQI A;  3MBY A;  4I2C A;  4ECQ A;  4XQ8 A;  3OHB A;  4WC4 A;  3KHG A;  5DB7 A;  3OUY B;  3LQC B;  4KLU A;  4MF8 A;  2NRV A;  4TUQ A;  5J29 A;  3QZ7 A;  5D49 A;  2R8G A;  4TUP A;  1WOT A;  5KFY A;  4Q8E A;  2ZTC A;  4R63 A;  1ZQV A;  4QZ8 A;  4YR3 A;  4TUR A;  1S10 A;  3C2L A;  5KFI A;  2PXI A;  4I2B A;  4UQG A;  4DL7 A;  3THV A;  3PX4 A;  8ICC A;  4O5C A;  3UQ0 A;  5KT3 A;  1D9D A;  4ECT A;  4K4G A;  2KTQ A;  2UVU A;  2DR8 A;  1LB2 B;  4YMM A;  2J6U A;  3QEB Z;  1RXW A;  5HRK A;  4E8F A;  4KLE A;  2HHP A;  5J0O A;  3G6V A;  4K4H A;  5HRE A;  1U4B A;  4JV0 A;  4O0I A;  3M8S A;  2OWO A;  1CEZ A;  3EPG A;  1JIH A;  3OVA A;  4FH5 A;  3PML A;  4ED8 A;  4YR2 A;  3QEA Z;  4LVS A;  3RTV A;  3K75 D;  4JV1 A;  3EPI A;  1QTM A;  1TK5 A;  1S76 D;  5DQH A;  3RR7 A;  1ZJN A;  1Z00 B;  8ICE A;  7ICG A;  2VAN A;  5KFE A;  3ZD8 A;  3OSP A;  7ICM A;  1D8L A;  2F1H A;  4DSE A;  1SKR A;  3GDX A;  4UAW A;  1KLN A;  3ZDB A;  4F3O A;  2JEG A;  2ASJ A;  5J2B A;  3RJH A;  3RB6 A;  4J9S A;  3OVB A;  5KFF A;  8ICN A;  4DS4 A;  4IG8 A;  1XO1 A;  2FLN A;  1CUK A;  4XRH A;  4GXI A;  1ZQE A;  7ICK A;  4F5R A;  4QZA A;  1TK8 A;  1NJX A;  4M0A A;  4UB4 A;  4O9M A;  1PZN A;  2RFF A;  4NKT A;  4M5D A;  2V4R A;  1MQ2 A;  2BPF A;  4UB1 A;  3HW8 A;  2BCU A;  7ICP A;  4UB5 A;  2JEI A;  4EBE A;  5BOM A;  3ISB A;  1MIV A;  1RPL A;  5KFP A;  4CCH A;  4DF4 A;  9ICX A;  3MFH A;  1LV5 A;  4YCX A;  3RJF A;  4J9M A;  1OU5 A;  3JZ0 A;  5J2E A;  4F92 B;  2KP7 A;  5DB9 A;  2BKE A;  5HRI A;  3H37 A;  1XWL A;  2R8J A;  3GIJ A;  1Y88 A;  4KLF A;  3H8S A;  5J0R A;  4P2H A;  2FLP A;  4HYK A;  3RH6 A;  4QZD A;  2H5X A;  3GIL A;  5J2H A;  5IIJ A;  5KFH A;  2W8K A;  4F50 A;  4RQ5 A;  4XQ7 A;  4RPY A;  1L3S A;  1ZQQ A;  4RQ3 A;  5J2A A;  4EZ6 A;  5J0Y A;  1HJP A;  4RQ2 A;  3MR6 A;  4KLD A;  5J2D A;  2ASL A;  4M9H A;  4X4U A;  1NJW A;  3C1Y A;  1T3N A;  4MFC A;  4Q8F A;  4WC3 A;  5KFW A;  3UQ2 A;  3LK9 A;  3TAQ A;  5KFB A;  2PFQ A;  4UB2 A;  1XSN A;  9ICH A;  5BOL A;  1UA0 A;  4YFK A;  4UBC A;  1TAU A;  4B9L A;  3SV3 A;  4BDP A;  4F8R A;  1ZQC A;  1S0V A;  4QZH A;  2M2U A;  1X9M A;  2A1J B;  1MSW D;  9ICT A;  5KFG A;  5DBC A;  1WCL A;  2IBK A;  5DEC A;  2VA2 A;  1ZYQ A;  5HC9 A;  1DK2 A;  4NXZ A;  4QWA A;  2HW3 A;  4YD1 A;  5J2G A;  4DFK A;  3Q8L A;  4UAZ A;  2ALZ A;  1UA1 A;  8ICZ A;  1V4A A;  4YD2 A;  3RBD A;  3JPR A;  4Q45 A;  4WC2 A;  3SZ2 A;  4GLX A;  4RWP A;  5DKW A;  5D4B A;  9ICK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...