4YMNA

Structure of human dna polymerase beta complexed with n7bg in the template base paired with incoming non-hydrolyzable ctp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural and kinetic studies of the effect of guanine-N7 alkylation and metal cofactors on DNA replication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 101
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ymnA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ymnA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ymnA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ymnA03
4NLNA 4WC1A 5HR9A 2JEIA 7ICHA 9ICTA 2ZUDA 1ZQLA 4KLQA 4PHPA 8ICMA 8ICXA 2W8KA 3C2KA 4IRKA 4XQ8A 5EWGA 3MGIA 3PMLA 4GXIA 4GC6A 4ED2A 4K4GA 4NLGA 4M9NA 4RQ6A 2RFFA 4RPXA 3JPTA 1LB2B 5KFXA 3V72A 4FHYA 3KHRA 1UA1A 4I2AA 5DLFA 1DK2A 4I2JA 1NK7A 3MGHA 2FPKA 3PX4A 4UBCA 1NK5A 3H40A 4YMNA 1XSLA 3RRGA 4QZEA 4Z6EA 3OHBA 4R64A 1VJ7A 1A77A 4I2HA 2PBEA 3ZDDA 1ZQNA 2XY5A 5KFKA 1NOMA 7ICUA 2R8KA 4KLJA 1KEJA 4X4OA 5DDYA 5HMMA 5J29A 5DECA 5KFQA 3THVA 5KFTA 4M9GA 2ZH9A 3MFHA 2ZH3A 3RBDA 1JN3A 1T8EA 2C2RA 3HP6A 9ICWA 4DOAA 4PGQA 1UETA 2DRBA 2NRXA 1DGSA 5KFGA 5KFEA 1ZQAA 4LZDA 4ATBA 2XO7A 4QZCA 2ZJAA 2H5XA 5J2CA 2V9WA 4MEYA 4MFCA 1BPBA 2O1PA 4PHEA 3RB4A 3EYZA 8ICWA 2ZH8A 3KTQA 4RPYA 4RQ4A 3AQNA 3T3FA 5CP2A 5J2AA 4IR1A 2W9BA 4RQ0A 3C2MA 1H38A 8ICRA 1FA0A 4DEZA 4RT2A 2O5AA 1SZPA 4DLGA 1JQRA 4WC5A 5CHGA 4KLEA 5KT4A 2NRZA 4UAZA 4EYHB 3C5FA 4R65A 1ZYQA 1JXLA 5J0WA 1T7PA 5TZVA 3LWLA 2ZJ5A 1XU4A 3H8WA 4O3NA 5CB1A 3RR7A 4YG2A 5J0RA 1U48A 9ICLA 3UXOA 3IM1A 4E80A 4DS4A 3QZ7A 1NK0A 5J2BA 4J9NA 4TQRA 5KT6A 5KT3A 2AGOA 1NJYA 1ZQMA 1ZQHA 3H4BA 4J9LA 4X4UA 4DLEA 1A76A 1ZQUA 3JPRA 4DO9A 1C7YA 8ICUA 4I2IA 1L3VA 2BPFA 5IIOA 4B9NA 4I27A 1KRPA 4UAWA 1JIHA 1R8CA 1ZQVA 3H7IA 2J6TA 1KFTA 2KZMA 9ICHA 5JUMA 3ZD9A 1CUKA 4RNMA 3MR6A 2V4QA 3MABA 3TAQA 2PI4A 4MEXA 2DPJA 1OU5A 1MC8A 3TQ1A 2W9AA 5HRBA 4XQ7A 4UBBA 3RTVA 5DDMA 4F3OA 5KFSA 4JV2A 2PFPA 8ICYA 4DL3A 2ISPA 4J9SA 2V4RA 2BE3A 4GXKA 5KFCA 3RJHA 8ICAA 3QZ8A 5CWRA 3RH4A 4YXJA 1XSPA 3JPPA 5KFYA 2VA2A 4E8FA 1UEUA 9ICFA 4QZGA 1ZETA 5KT7A 4YN4A 4X4QA 3GDXA 1U49A 3GQCA 5KFLA 4M0AA 4WC2A 1ZQXA 4YCXA 4RUAA 4NM1A 3JZ0A 4X4TA 1Q78A 3HX0A 2ZHAA 4ECRA 4XRHA 2IMWP 8ICJA 4F91B 4KLFA 4BXOB 4O9MA 4YMMA 2ZH4A 5DG9A 1U47A 1MIYA 3PW0A 2KZZA 3LDAA 4ELVA 9ICNA 9ICMA 3Q8RB 3RJIA 5J0SA 1ZQDA 4NLKA 2BGWA 2ALZA 1ZQWA 9ICPA 3MR3A 1S77D 3V7KA 4AT8A 5KG7A 2A1JA 2BDPA 5J2HA 7ICPA 4J9RA 1S97A 4UB1A 5HRLA 8ICCA 5DBAA 3V7LA 2P66A 4RNNA 2LYHA 4KN7A 2FLNA 5J2IA 3RH5A 3PY8A 3HT3A 4M2YA 3WFQE 4ZH4A 8ICIA 5CA7A 4PPXA 3T5JA 4F93B 3ETLA 5KG2A 4P4MA 3Q8QB 4ECWA 4ELTA 1XO1A 5HRKA 4X4NA 1ZQSA 1QTMA 8ICZA 4M9JA 5DQHA 2UVUA 5HMLA 5IINA 4ECZA 1UT8A 5EWEA 5KFOA 4K4HA 4YXMA 2FLLA 4UD4A 2BQRA 4M5DA 4EP7A 4O5CA 3EZ5A 3B0XA 1ZJNA 4Z6DA 3JPOA 3BQ0A 4F4ZA 4Q44A 1X9MA 4UB3A 4J9OA 4RZRA 3UQ0A 2FLPA 4IRDA 8ICEA 4R66A 2BQ3A 5F2VO 3H8SA 2C28A 8ICLA 3TANA 1U45A 4AT8B 4BWJA 2A1JB 4BGDA 4J9QA 3RAQA 2IHMA 4RWNA 2ZH6A 4NKUA 4EBCA 3JPQA 5J0XA 3GV5B 3KHHA 1NJWA 3GILA 3SZ2A 3T5LA 2DR7A 4PGYA 5KG0A 4KLTA 3L9DA 2KTQA 1NKEA 2VA8A 3HPOA 4B9VA 4I28A 1X2IA 4I2BA 3E2EA 2NRVA 2ID1A 9ICUA 4Z6FA 4I29A 3LQCB 5BPCA 4RQ7A 4NXZA 3GV8B 4DFJA 3K75D 2HHXA 3GIJA 3M9NB 1DOQA 5J0PA 4RWPA 2RDJA 4BDPA 4X0BA 7ICFA 7ICIA 2Y1JA 4WBZA 5J2KA 4O5EA 4KMUA 3AQKA 1XWLA 1L5UA 8ICPA 4QW8A 1N48A 2F1JA 1B43A 3JPSA 1ZQKA 7ICNA 4WC0A 3BQTA 4GC7A 5KFAA 4ECYA 4DOCA 3NGDA 3PO4A 5DLGA 3AUOA 1ZQPA 2DPIA 5HRGA 4QW9A 2BHNA 1R8BA 5J0TA 3OV7A 1KNYA 2BPCA 3BQ1A 1TK8A 2VA3A 4C8NA 1D8LA 3PR4A 4ECUA 4DQPA 3C1ZA 4ECTA 3Q8PB 4UB4A 3TFSA 4Z6CA 3MDCA 2F1IA 4UB5A 4TUSA 2BPGA 3Q8LA 3V6HA 7ICQA 2BCRA 1MQ2A 4KTQA 2KFZA 3PMNA 4ED8A 5IILA 2IBKA 4WCWA 5J0OA 4B9TA 2BQUA 4PHDA 4B9LA 4NKTA 2M2WA 3T5HA 2BKEA 3C1YA 2FMQA 4JV1A 3TARA 9ICOA 4IQTA 4M6WB 4EBDA 1XC9A 5KFHA 2FMSA 1K1QA 2AJQA 4J9KA 2ZHBA 8ICFA 2PFQA 1ZQZA 4DFMA 5KFNA 4ED1A 3RB3A 2KN7A 2J6SA 4I2GA 5IIKA 3RJEA 4WBYA 4I2DA 5BOMA 3AU2A 1R8AA 5DG7A 2PXIA 1ZQRA 1S76D 1F5AA 1NK8A 2JEJA 5KG4A 5J0QA 2ZTCA 3PW5A 4O3RA 5KG1A 3AQMA 1TK5A 3HJ1A 4S3NA 4QZAA 2RDIA 3UXNA 4QWDA 1S9FA 9ICVA 1NKCA 4BXOA 1LV5A 2DR5A 5KFUA 1KLNA 4RWOA 3WFSC 3ZDEA 4B9MA 4KLUA 7ICMA 2C2EA 4QZDA 4M9HA 3G6XA 4GXJA 3MR5A 4F5RA 2BR0A 9ICXA 4P4PA 3ZDAA 2HHPA 1IXRA 4DQQA 5J2JA 1ZQTA 8ICVA 4WC7A 1MQ3A 1RZTA 2ZH5A 3T5KA 4EZ9A 3HWTA 3H8JA 3H4DA 5EWFA 4O0IA 1TK0A 3BDPA 4DSJA 1ZQOA 3SI8A 4Q43A 5DB8A 2W9MA 1D9FA 1WCNA 1S0NA 3TI0A 4QZIA 9ICJA 2HHQA 4FHPA 2DVIA 3ZDCA 1DK3A 2IA6A 3C66A 3V7JA 2XCPA 2C22A 1R89A 3UPQA 4YR2A 1U4BA 1TAQA 4KLSA 4DL2A 2ASDA 4F4XA 4I2CA 3GIKA 4FO6A 4I2FA 5DKWA 2PFNA 4M9LA 9ICRA 3ISBA 5HRFA 9ICCA 4EBJA 3OVBA 5KFWA 1BPEA 3RJKA 5D49A 2XY6A 4KLIA 3PW7A 4FH3A 4EBEA 7ICSA 5BOLA 4IG8A 5KG5A 3PR5B 3RB0A 4DQIA 1MSWD 5HRHA 4E0DA 1S0MA 3ISDA 1KSPA 4FHVA 2Q66A 4LVSA 1NK4A 5DBBA 2HHSA 1VFGA 1WCLA 3ISCA 2R8HA 2OWOA 3PW2A 4RQ3A 4O3SA 2P6UA 3NYBA 4ED0A 8ICGA 5DB7A 4YR3A 4I2EA 4EZ6A 1TAUA 4XA5A 3EPGA 1RXVA 3FDSA 3PO5A 2PI5A 4LZGA 2HHUA 3GIMA 4AT9B 3WFRE 3OJUA 1SKRA 3IHQB 3H37A 2BCVA 4FHWA 4P4OA 3PW4A 4FBTA 3NTUA 5D4BA 4F2SA 4DS5A 4NLZA 4UQGA 8ICNA 1IM4A 5DGAA 3HJ4A 2M9NA 4YP3A 4IQWA 8ICBA 8ICKA 1BNOA 4EBKA 3LWMA 4P2HA 2XGQA 3M9OB 5KFVA 4DQSA 4FS1A 4ELUA 8ICQA 1SL1A 5EOZA 2JZBA 5DGBA 2FPMA 5L1LA 2MAXA 3RBEA 1UA0A 2M2VA 4IRCA 4X4SA 3JPNA 1U9LA 1NKBA 9ICIA 3C18A 3FYHA 5IIMA 4QZFA 1TKDA 4TURA 5HP4A 4KLMA 3RAXA 1NJZA 4KLOA 7ICRA 4WC6A 1K1SA 3UPSA 3N97B 4WC3A 5KFJA 3C21A 2ZH1A 2ZJ8A 1HJPA 3H3AA 4YR0A 4TUPA 2AU0A 2AGPA 4M04A 2HVHA 4NM2A 9ICAA 4F2RA 4O3QA 4KLLA 2DFLA 5J2DA 4YD1A 1RPLA 4MFFA 4UD5A 4C8KA 5KFZA 3B0YA 4EEYA 1AROP 1S0VA 5KFDA 4KITB 3BQ2A 3Q8SB 1TFRA 4B9UA 4RQ1A 4R63A 2DR8A 5HHIA 4DQRA 4DSKA 4DL4A 1BPYA 2JZBB 4M6WA 4DWIA 4FBUA 3MBYA 4DF4A 3C23A 1ZQIA 7ICJA 3ZDBA 3SV3A 4ECSA 4ED6A 2JEFA 4DOBA 2R8JA 4ED3A 4LT6A 1Z00B 5KFMA 1QSSA 2Y1IA 9ICSA 2ZH2A 4DF8A 5J2FA 1WOTA 3K4GA 2XY7A 4M47A 2HHWA 3G6YA 4QWCA 2I9GA 2UVRA 3WFOA 1SL0A 1B22A 1SL2A 3MFIA 4X5VA 4O3OA 1KDHA 1ZJMA 1L3SA 4KLHA 5CJ7A 4RQ5A 4RU9A 3PX0A 1TVAA 4RNOA 3TFRA 1XSNA 4RPZA 4X4VA 3UXPA 1X9SA 2P6RA 4DSEA 9ICEA 3MR2A 2ATLA 1QSLA 3AU6A 4YMOA 2WTFA 1COOA 4C8LA 1Q79A 1HUZA 1D9DA 1UEVA 4JV0A 1ZQJA 3OJSA 4GLXA 5KFFA 4ED7A 2FMPA 2J6UA 3AQLA 4DFKA 4QWBA 4DFPA 4PGXA 4F4KA 4JWNA 5F9LA 5DQIA 1QSYA 5DQGA 4O5KA 3WFPA 1UT5A 3RRHA 8ICOA 5J0YA 1MIVA 2XGPA 2XC9A 4F8RA 2AQ0A 4NY8A 2AQ4A 2FPLA 1JX4A 4KLGA 7ICLA 5HRDA 4DL7A 3GIIA 3C2LA 3QEAZ 2Q0ZX 4RWQA 4G3IA 2C2DA 4RQ2A 1BPDA 2W8LA 2R8IA 2ZTDA 7ICGA 5HC9A 4YD2A 4QZ9A 1BVSA 5D46A 1NK9A 1JAJA 4ECXA 2DR9A 1ZQYA 2KFNA 2ISOA 1TFYA 1PZNA 5KFRA 3M8SA 4CCHA 3OUYA 1NO5A 1V4AA 3SYZA 5DEDA 4RQ8A 4KN4A 5J2GA 4MF2A 4X4PA 1BPZA 5J0UA 3LK9A 5KG3A 4F4WA 2W9CA 1T3NA 3HIYA 3HW8A 4F4YA 3RJFA 4B9SA 4AT9A 3TAPA 3RJGA 4IR9A 3ORYA 2UVWA 4YFKA 8ICSA 2GWSA 2MUTA 3SV4A 4O3PA 1TFWA 1ZQBA 2NRKA 3GV7B 3MDAA 3V6JA 4R8UA 3OSPA 2JEGA 5L1IA 2R8GA 1BNPA 3M8RA 5HNKA 2PFOA 1PX5A 2BCUA 4DSLA 5C5JA 4FS2A 1T4GA 5KFIA 3RB6A 4ATBB 1ZQEA 8ICTA 4F5NA 3H38A 3GFKB 2KZ3A 5J2EA 4JK1A 3OSNA 4C8OA 5HREA 9ICKA 2UVVA 1YLQA 3OUYB 3RR8A 4QZBA 2W9BB 5DB9A 3RJJA 1KTQA 1TV9A 1RYSA 2ZUBA 2ZUCA 1ZQQA 1ZQGA 1L3UA 2M2UA 2W9CB 3V6KA 7ICTA 4F5QA 1X9WA 2ZTEA 9ICQA 4JUZA 3OGUA 4TQSA 1NZPA 3OVAA 4WC4A 3EWAA 1D8YA 5KTQA 4IQUA 5L9XA 4MF8A 4C8MA 4F5PA 1JXEA 5HHHA 3UQ2A 2MUTB 1N56A 1Y88A 5KT2A 1S0OA 1NJXA 4DSIA 7ICVA 4TUQA 4R8UB 4AT7A 5F9NA 1SKWA 4FHXA 4F5OA 3Q8KA 1BGXT 4DL5A 4YVZA 2AGQA 1HUOA 1EXNA 3ZD8A 4X4RA 2BCQA 2DRAA 3PX6A 1L3TA 2BCSA 5CR0A 4J9PA 3BJYA 1XS9D 3H39A 1CEZA 1KFDA 1Z3EB 4MFAA 4RT3A 3N4MB 3OVSA 4KLDA 4HYKA 3EW9A 5KT5A 3KHGA 4IQVA 3OHAA 3QEBZ 4YQWA 4EYIB 1RYRA 1Z00A 3M9MB 2I1QA 4JWMA 8ICHA 2HHVA 1ZQCA 2VANA 9ICBA 2KP7A 5HRIA 5KFBA 4J9MA 4FH5A 4XUSA 3EPIA 2NRWA 4Q45A 5KFPA 4UB2A 2ASJA 1ZQFA 2XCAA 5IIJA 4F50A 4Q8FA 4DL6A 3PVXA 1KFSA 5DB6A 4ECVA 9ICGA 4QZ8A 4F92B 4QWEA 5L1JA 4K4IA 3PNCA 4X0AA 5IIIA 4AT7B 5DBCA 7ICOA 1V9PA 4BWMA 1SKSA 1NK6A 2IHNA 3G6VA 3KHLA 2HHTA 2ASLA 4PH5A 4Q8EA 5L1KA 3RH6A 5KG6A 4PHAA 5DG8A 2HW3A 2NRTA 1S10A 1BPXA 2B21A 3PV8A 1RXWA 4QZHA 4DSFA 2F1HA 1QLNA 1MIWA 3JYYA 4ECQA 2ZH7A 4RUCA 7ICKA 3QE9Y 3Q8MA 2HVIA 3C5GA 4UAYA 1JMSA 2M2TA 4QWAA 7ICEA 4E7XA
chains in the Genus database with same CATH superfamily
4WC1A 1Q3UA 3ONNA 2W8KA 4XQ8A 1LB2B 1UA1A 3QU2A 5DLFA 1DK2A 1NK7A 3MGHA 1NK5A 5E79U 3M7DA 1KKXA 3OHBA 5ALIA 1VJ7A 1V38A 2FJ6A 1NOMA 2R8KA 3LVVA 3THVA 4M9GA 3F5EA 3MFHA 2QB1A 3WK5A 1JN3A 4UW9A 1T8EA 2C2RA 1FFVA 2NRXA 4PL1A 5KFGA 5KFEA 3NWIA 1X6JA 4LZDA 4ATBA 4MEYA 1URJA 1BPBA 2LM1A 2W3RA 3MC1A 2WB1C 1Q46A 2RQ5A 8ICWA 3T3FA 1FA0A 1JQRA 5AHXA 1ZYQA 4R65A 1JXLA 2W11A 1SV0A 2H3FA 1ECWA 4E80A 3SEIA 4DO9A 1ZQUA 1C7YA 8ICUA 2BPFA 4UAVA 5IIOA 5B3QA 1FEZA 5AKKA 3D2SA 2JV3A 4XJEA 1JIHA 1ZQVA 2J6TA 3WKCA 9ICHA 3M6KA 5JUMA 3TAQA 2PI4A 4LJXA 3GU3A 4RQNA 3TQ1A 4XQ7A 4UBBA 5DDMA 2QB0B 4DL3A 2ISPA 1L8LA 1HEKA 3QZ8A 2KEYA 5AI5A 5ALOA 1FO4A 3SAFA 4YN4A 3GQCA 5KFLA 3WK8A 4M0AA 1ZQXA 4YCXA 4NM1A 2XVTA 1TFWA 4O9MA 4FFDA 4Y2VA 1KW4A 1MIYA 3PW0A 3LDAA 3Q8RB 4NLKA 1N62A 4FZMA 2HBJA 5J0SA 3MR3A 2NO4A 2BDPA 3L3FX 1S97A 8ICCA 2H3QA 3RH5A 4M2YA 5CA7A 4ECWA 3ETLA 4X4NA 3Q8QB 2HOFA 1QTMA 5DQHA 5IINA 2PKEA 5ALSA 2EDUA 5EWEA 5KFOA 4CGZA 3ER8C 4Z6DA 3JPOA 2WF6A 1V97A 4P0QB 5CFUA 4UB3A 4J9OA 4NXVA 1SZHA 2G5HB 4B6JA 8ICEA 4R66A 4BWJA 2W3SA 2IHMA 4RWNA 4KM5A 3DDHA 3JPQA 2KG5A 4B9VA 2NRVA 4Z6FA 3AN1A 2OEHA 4Y2UA 3K75D 1KL9A 3M9NB 3GIJA 1DOQA 4O69A 3QUTA 3MGVA 2RDJA 4X0BA 4WBZA 2Y1JA 5J2KA 4KMUA 3AL0B 1L5UA 8ICPA 2QARA 2KVCA 2LMRA 1N48A 3JPSA 7ICNA 3BQTA 5KFAA 4ECYA 3NGDA 2DPIA 5J0TA 3BQ1A 3PR4A 2D6FC 3QUBA 5ALXA 1C20A 4UB5A 4TUSA 5AI9A 4Y2YA 7ICQA 2BCRA 3PSTA 4N7RA 2IBKA 4WCWA 4I0UA 4B9TA 3T5HA 1SGGA 3C1YA 3NVVA 3AQFA 4J9KA 2PFQA 4K9BA 4DFMA 2ZIVA 4I2GA 5T14A 5AK5A 2EANA 4LEWA 1NK8A 2JEJA 4O3RA 3HJ1A 2ZTCA 3PW5A 5AK3A 5KG1A 4F71A 2ZXIA 3UXNA 2DR5A 3WFSC 1RYUA 1A6SA 4EENA 3G6XA 2WAQF 3NS1A 4DQQA 4WC7A 1MQ3A 2ZH5A 4EZ9A 3H8JA 5CFSA 3BDPA 4O0IA 4UARA 1F44A 3O0FA 2XCPA 4YR2A 1TAQA 4DL2A 5AKGA 4I2FA 5DKWA 3B9JA 2E5SA 2KICA 5K4LA 1BPEA 3RJKA 1ZRNA 2XY6A 1IIPA 4KLIA 4FH3A 7ICSA 5BOLA 5KG5A 3PR5B 4DQIA 1S0MA 3ISDA 3CP8A 2R8HA 4Y2PA 3OVAA 4MKPA 4ED0A 5DB7A 3EPGA 4C80A 3H37A 4P4OA 2MA1A 1VDVA 4FBTA 1Q3VA 2ZXHA 5DGAA 5KAIU 8ICKA 4EBKA 5ALLA 3M9OB 4DQSA 8ICQA 1SL1A 4IL6U 5DGBA 3RBEA 2M2VA 4IRCA 9ICIA 1NKBA 3FYHA 2KJ5A 4TURA 7ICRA 2P35A 4WC6A 1K1SA 3QNMA 5KFJA 2ZJ8A 3AMZA 1HJPA 2F76X 4F2RA 4FZLA 5KFZA 1AROP 2AHOB 4KITB 3Q8SB 4B9UA 4RQ1A 2DR8A 3MBYA 7ICJA 3ZDBA 2W43A 2I5HA 2R8JA 2GH1A 2Y1IA 5J2FA 2WF5A 2I9GA 4KMOB 4O3OA 2YMLA 1L3SA 3PX0A 1TVAA 3TFRA 4X4VA 2P6RA 2EAPA 9ICEA 2ATLA 3AU6A 1NZBA 1KBUA 1D9DA 2RLTA 4GLXA 2FI1A 4EGWA 3RRHA 8ICOA 4F8RA 4EEKA 2DQNB 1JX4A 7ICLA 5HRDA 2C2DA 4RQ2A 1BVSA 4ECXA 2EWRA 2ISOA 4K99A 3M8SA 1V4AA 2K89A 3SYZA 1BPZA 5J0UA 3LK9A 2RRDA 2W9CA 2IHOA 5JRTA 1PVPA 3A0HU 3HW8A 4F4YA 4B9SA 3QXGA 4AT9A 4C4RA 2GWSA 4O3PA 3MDAA 3OSPA 3SENA 2EAOA 2R8GA 4P0PA 3M8RA 2BCUA 5AKZA 4DSLA 5HR6A 5B66U 4ATBB 5CHEA 1UQVA 5EE0A 2JH7A 4QZBA 5ALUA 3BS5A 4JLZA 2ZUCA 1ZQQA 5AI6A 1X9WA 9ICQA 4LEYA 1NZPA 4O67A 4CDGA 5KTQA 4MF8A 1WG8A 1JXEA 5HHHA 2MUTB 1Y88A 4TUQA 4R8UB 4AT7A 4F5OA 4YVZA 4CF4A 2B6GA 4X4RA 2DRAA 1XO0A 1XS9D 3H39A 1F5SA 5D63A 4RT3A 4CF5A 3OVSA 4KLDA 2E8MA 5KT5A 1RDFA 4YQWA 5HR7A 3M9MB 2I1QA 1ZQCA 5HRIA 1WWUA 4Y2SA 4Q45A 5KFPA 3QU5A 1ZQFA 2OXOA 5IIJA 4F92B 7ICOA 1SKSA 2YB1A 3QUCA 1D8BA 5KG6A 2HW3A 1KQQA 2XIDA 2F77X 3RF9A 3DEEA 2ZH7A 2HOQA 3Q8MA 3C5GA 3OV7A 2LI6A 1JI7A 7ICHA 3L9DA 3C2KA 4NLZA 3E2EA 3PMLA 2RFFA 1L7PA 4K4GA 5A0LA 3JPTA 4FHYA 2ZIXA 1P7DA 5ALMA 3ZI4A 1YZ7A 4R64A 1A77A 4I2HA 2M0NA 2MRLA 5KFKA 4X4OA 1ZD4A 5J29A 5KFQA 2ZH3A 2NO5A 5KFTA 4DOAA 4PGQA 2I6XA 2V9WA 4CF3A 2IOFA 2XI9A 2QLTA 4MFCA 3RB4A 3EYZA 5CP2A 2W9BA 8ICRA 2O5AA 4DEZA 4RT2A 2QARB 2ZIWB 2GAFD 2AH5A 5TZVA 3LWLA 5CB1A 2JH1A 1YZ6A 4O3NA 4AYBF 1ZQ1C 5ALWA 2GO7A 1U48A 1NK0A 5J2BA 4J9NA 4TQRA 5KT6A 5KT3A 1ZQMA 3H4BA 4Y2TA 4I2IA 1L3VA 2YY6A 1R8CA 3VC8A 1CUKA 1T94A 3MR6A 2V4QA 1OU5A 4MEXA 5KL8B 2K4HA 2W9AA 3RTVA 3SMVA 4F3OA 8ICYA 5AKXA 2BE3A 2PMZC 3CYMA 2KNJA 1XSPA 4YXJA 3F53A 5KFYA 2RHFA 2KJ9A 4WC2A 4RUAA 3JZ0A 2O6KA 3HX0A 8ICJA 2ZH4A 4KLFA 3SAGA 2KZZA 4WQLA 9ICMA 5AM1A 3RJIA 2ALZA 1ZQWA 1S77D 5KG7A 2A1JA 4K96A 3K7DA 4UB1A 3PSIA 2HI0A 4OD0A 4RNNA 2LYHA 3WFQE 4F93B 1XO1A 3C28A 3LYSA 3ED5A 3E0FA 5HMLA 3NASA 2FLLA 4M5DA 4EP7A 4O5CA 4GIBA 3BQ0A 4Q44A 2QKQA 1X9MA 4IRDA 3UQ0A 2FLPA 5EE3A 2BQ3A 1A0PA 2KSOA 8ICLA 3TANA 4AT8B 5AIBA 3KFUF 1L8OA 4C4SA 2ES6A 2W54A 2ZIUA 3T5LA 4PGYA 3N7SC 2ID1A 2KVSA 9ICUA 2OM6A 3GV8B 2B56A 1SIJA 2KIVA 2EZYA 3AQKA 1XWLA 2F1JA 1ZQKA 4WC0A 4GC7A 5HRGA 4DOCA 3AUOA 1ZQPA 3HJEA 4QW9A 2BHNA 2Y9TA 2EZZA 2BPCA 4C8NA 3K1ZA 4UB4A 4USAA 4Z6CA 3MDCA 3D2QA 2EH9A 2BPGA 2FDRA 1MQ2A 4KTQA 2KFZA 2BQUA 4PHDA 3WK7A 2BKEA 3TARA 1L7MA 4EBDA 1XC9A 5KFHA 1XNSA 1K1QA 2AJQA 2ZHBA 1HIWA 2J6SA 3RJEA 2MU2A 4I2DA 2D3DA 5BOMA 3ALRA 2ZG6A 1S76D 5KG4A 2K8AA 1KN5A 1TK5A 3FAHA 4QZAA 2RDIA 4C7ZA 2VKQA 3ZDEA 1SB3C 2XICA 2C2EA 4QZDA 2BR0A 3H0LB 9ICXA 1IXRA 1ZQTA 2KHVA 2Y9UA 3H4DA 2B4VA 5EWFA 4DSJA 2BBJA 1UPHA 1S0NA 9ICJA 3TI0A 4QZIA 3ICXA 4FHPA 2KKPA 3C66A 1DK3A 2C22A 2EAMA 1U4BA 9ICRA 2PFNA 4M9LA 5AI0A 4EBJA 4EBEA 3RB0A 4E0DA 2DWQA 3IN5A 1NK4A 3WK6A 3ISCA 3PW2A 4RQ3A 3WU2U 4EZ6A 3PO5A 1RXVA 4AT9B 3GIMA 1ZD3A 4FHWA 4PJ0U 3PW4A 3NVZA 3J81j 3KKAC 3AM9A 4EELA 3UM9A 3HJ4A 1BNOA 8ICBA 5ALEA 5KFVA 4FS1A 2MSNA 5EOZA 2B0CA 2JZBA 2MAXA 1PK3A 4X4SA 1U9LA 2HN2A 3C18A 4QZFA 1VJ5A 4KLMA 1PUZA 5C0YA 1N63A 4FE3A 1LKYA 2KK0A 2AGPA 2HVHA 1N60A 4O3QA 1OXJA 2DFLA 4YD1A 2R18A 2ESEA 4UD5A 4EEYA 2BDUA 1TE2A 5J8YA 1SXEA 5HHIA 4DL4A 3L4PA 4M6WA 4DF4A 4ECSA 4NL9C 4LT6A 3NVYA 1COKA 9ICSA 2ZH2A 1WOTA 1CRXA 2HHWA 3G6YA 4QWCA 1B22A 3F2CA 1ZJMA 1Q8KA 4US9A 4RNOA 4RPZA 3UXPA 1X9SA 4DSEA 2DKZA 2BBHA 5AKLA 4C8LA 4O6AA 3OJSA 4F4KA 4EV6A 4BUGA 1QSYA 5DQGA 5D61A 3WFPA 2XGPA 2XC9A 2K4EA 4A8EA 2AQ0A 1ZXIA 4NY8A 4KLGA 2YN4A 3QEAZ 2ZTDA 2ZIXB 5FP0A 5HC9A 3HKZF 2DR9A 2JR5A 1ZQYA 1TFYA 1PZNA 3OUYA 1NO5A 4MF2A 4X4PA 3NKUA 4UAUA 5AIAA 5KG3A 5KL1B 3EUB2 3RJFA 3RJGA 4IR9A 5ALYA 3UMCA 8ICSA 3SV4A 1O08A 4PL2A 1SXDA 1PK1B 2Y0SF 1X9XA 4OJOA 2PFOA 5HNKA 4O3MA 4MHVA 5ALNA 5C5JA 1T4GA 2B51A 2YB4A 8ICTA 4GFJA 3H38A 1X6IA 2KZ3A 4JK1A 3SQIA 4HAIA 3OSNA 2F2AB 5HREA 9ICKA 2UVVA 2W9BB 3RJJA 1RYSA 3F2BA 1GO3F 1OW5A 2GLEA 3V6KA 7ICTA 1MN8A 3M6ZA 3OGUA 4TQSA 3EWAA 4G9BA 1D8YA 1J2NA 1S0OA 2Q4TA 5KT2A 3IDWA 1NJXA 4DSIA 2GA9D 5F9NA 1HUOA 5GTHU 1J2MA 4LEZA 5G5HA 4MFAA 4QIWF 3QEBZ 1F0MA 3A0BU 2W04A 3WKBA 3EPIA 2NRWA 4UB2A 4F50A 4Q8FA 5DB6A 9ICGA 5L1JA 2YX8A 1RQNA 4DCCA 1NK6A 2ASLA 2IOHA 4OO1J 5L1KA 3KD3A 4PHAA 2D8CA 2NRTA 1BPXA 4QZHA 2F1HA 2YTUA 1MIWA 3JYYA 4ECQA 4ZOHC 4KX5A 3S6JA 7ICKA 2HVIA 3I76A 4NXXA 2M2TA 4QWAA 4NLNA 2HN1A 2ZUDA 1ZQLA 4KLQA 4PHPA 8ICMA 8ICXA 4GC6A 3QUQA 4M9NA 4RPXA 5KFXA 3I1YA 2WF7A 3KHRA 2FPKA 4OJLA 2E8PA 3PX4A 3HKZC 4NXTA 4YMNA 1XSLA 4Y2XA 4CE6A 4QZEA 4Z6EA 2WAQC 3NRWA 3KZXA 2KSOB 1ZQNA 1S5LU 1KEJA 5DDYA 2ZH9A 4K97A 1FIQA 3HP6A 1DGSA 2XO7A 5J2CA 4PHEA 4AP9A 3RFAA 4US8A 2ZH8A 3KTQA 4RPYA 5J2AA 4IR1A 4RQ0A 1JRPA 2JMGA 3C2MA 1H38A 1SZPA 2G09A 4WC5A 1QQ6A 2QB0A 5KT4A 2BZFA 1QCKA 4EYHB 3C5FA 4NV0A 1T7PA 5J0WA 3ER9B 2G0AA 3PSFA 5L1MA 5J0RA 3UXOA 3IM1A 4DS4A 3QZ7A 2JHDA 1CI4A 1ZQHA 2AGOA 4J9LA 4X4UA 4DLEA 5AKJA 1N2XA 3JPRA 1L6NA 4UAWA 4WQKA 2GOLA 3H7IA 3KZIU 5F3XB 4K8VA 3QU9A 3ZD9A 2VIXA 4RNMA 2A3VA 2DPJA 1MC8A 4PZNA 1RM6C 3AEVA 5KFSA 4QJFB 3H0MB 4J9SA 3IG5A 3PZPA 8ICAA 1X40A 4DFDA 1Z1BA 3JPPA 2VA2A 4E8FA 1UEUA 4QZGA 1NI3A 1ZETA 5KT7A 1NNLA 3GDXA 2NYVA 2JRZA 4ECRA 2IMWP 4F91B 4YMMA 4OAGA 1U47A 4P0QA 3WKEA 2YQEA 4ELVA 9ICNA 2WF8A 3BZKA 9ICPA 4NJ8A 2BGWA 4OAHA 7ICPA 4J9RA 2H3VA 3FC4A 4HX0A 3V7LA 2P66A 2FLNA 5J2IA 4ZH4A 8ICIA 4PPXA 3T5JA 1JUDA 4P4MA 4ELTA 1DRGA 2E1FA 8ICZA 1UT8A 4K4HA 3EZ5A 1DXSA 2C28A 5AICA 4BGDA 4J9QA 3RAQA 5ALQA 4C4TA 4NKUA 4UATA 3GV5B 3KHHA 1NJWA 3GILA 2DR7A 5AM4A 5KG0A 2HBKA 3NUQA 5ALRA 2KTQA 1NKEA 3HPOA 4I28A 3TKAA 3QU4A 4I29A 5ALJA 5BPCA 2WF9A 4DFJA 2HHXA 4RQMA 4RWPA 5ALKA 7ICFA 5ALGA 1X42A 4QW8A 5ALDA 3PO4A 5DLGA 1LKYB 1WUDA 1TK8A 4DQPA 4ECUA 3C1ZA 3Q8PB 5ALPA 2F1IA 3NVOA 1L7NA 3PMNA 5AKEA 4B9LA 4NKTA 2M2WA 4M6WB 8ICFA 4WBYA 4ED1A 2KN7A 5IIKA 3CW2C 1R8AA 1ZRMA 1ZQRA 1F5AA 5J0QA 3ERCC 3AQMA 1SWVA 1SV0C 1S9FA 1Z1VA 4BXOA 1LV5A 4B9MA 2LYBA 5AI4A 4M9HA 4GXJA 3MR5A 4F5RA 2HHPA 8ICVA 4K98A 1RZTA 3SI8A 4Q43A 2ZIVB 2DVIA 2HHQA 3ZDCA 2IA6A 3V7JA 3UPQA 2HSZA 4F4XA 4I2CA 3GIKA 4FO6A 2WB1F 3ISBA 3BZCA 5KFWA 4IG8A 2Q66A 2HOIA 4LVSA 5DBBA 2HHSA 1VFGA 5KNIA 1WCLA 2CPRA 3JCFA 2P6UA 8ICGA 4I2EA 2CRXA 1TAUA 2HHUA 2PI5A 2LPEA 3WFRE 3OJUA 3IHQB 2BCVA 1QQ5A 3IRUA 4UB8U 3NTUA 8ICNA 1IM4A 3E58A 2M9NA 4IQWA 1J97A 2OCEA 5L1LA 5AKYA 1UA0A 3IG8A 1TKDA 5IIMA 3CNHA 5HP4A 4KLOA 3RAXA 3UPSA 2CXYA 3N97B 3L5KA 4WC3A 3H3AA 4TUPA 4M04A 9ICAA 4KLLA 1B0XA 5J2DA 4MFFA 1RPLA 4C8KA 3M1YA 5KFDA 4NXWA 1TFRA 4R63A 2H3ZA 4DWIA 1BPYA 5AKHA 3C23A 3QX7A 3R9KA 5EE1A 2OH2A 5KFMA 1QSSA 2UVRA 4AYBC 1SL2A 1KDHA 4KLHA 5CJ7A 4RQ5A 4RU9A 1XSNA 3WK4A 3MR2A 1QSLA 4YMOA 2WTFA 1Q79A 4EEDA 3TADC 4J03A 4JV0A 5JTGA 3KOOA 5KFFA 4ED7A 1O03A 2J6UA 3CK6A 4DFKA 4QWBA 2FE9A 2DGZA 2IOFK 5F9LA 5DQIA 3K1RB 1MIVA 3F2DA 2AQ4A 4DL7A 2WHEA 3GIIA 3C2LA 1UHUA 4G3IA 5EE9A 1BPDA 2R8IA 7ICGA 4F72A 3QYPA 4YD2A 5D46A 1JAJA 2KFNA 2OHFA 5DEDA 4KN4A 5J2GA 1IV8A 4F4WA 4OJ5A 4Y2JA 1T3NA 2E8NA 3ORYA 4YFKA 2MUTA 4WOYA 4WJ3B 2NRKA 3GV7B 3V6JA 4R8UA 5JTIA 5L1IA 1BNPA 1PX5A 1X66A 4Y2RA 3RB6A 1FFUA 1L7OA 3RR8A 5DB9A 1KTQA 1ZQGA 2M2UA 1L3UA 2W9CB 2ZTEA 3N7PD 4JUZA 4WC4A 4IQUA 5L9XA 4C8MA 2HBMA 3DV9A 7ICVA 2YMQA 4P0PB 2AGQA 5ALVA 2F8LA 3ZD8A 1LVHA 2BCQA 1L3TA 2K4PA 2G06A 3BJYA 4J9PA 3SAHA 1SV4A 1KFDA 2OYYA 4HYKA 2KKVA 2H3IA 3BS5B 4IQVA 1GPJA 4EYIB 1Z00A 4JWMA 3D2NA 1TAMA 2VANA 4J9MA 4FH5A 4XUSA 2XCAA 4DL6A 3PVXA 1KFSA 4QZ8A 4QWEA 4OCZA 4K4IA 3PNCA 5IIIA 4AT7B 2HHTA 4BWMA 3G6VA 2B21A 3PV8A 2A1AA 2KOBA 4DSFA 1RXWA 1QLNA 4EX7A 1JROA 4RUCA 4UAYA 1JMSA 5HR9A 2JEIA 9ICTA 2G08A 4Y2QA 2K8CB 4BJQA 4IRKA 5EWGA 3MGIA 4NLGA 4GXIA 4ED2A 4OJ6A 4RQ6A 4FZNA 3N7RC 3V72A 5CRXA 1QH9A 4I2AA 4I2JA 2K60A 4UB6U 3KBBA 4UBCA 3H40A 3RRGA 2LM4A 4OAFA 2ZIWA 4ACOA 2PBEA 3ZDDA 2XY5A 7ICUA 2W7OA 4KLJA 5HMMA 5DECA 4PZOA 3RBDA 9ICWA 3OTQA 3TADA 1UETA 3MCRA 2DRBA 1ZQAA 4QZCA 2ZJAA 2H5XA 2O1PA 3AQNA 3SR6A 4RQ4A 4DLGA 3IP4B 2F8KA 5CHGA 1ZD2P 4KLEA 2NRZA 4UAZA 3OWGA 1JALA 2ZJ5A 1XU4A 2A19A 3H8WA 1QQ7A 3RR7A 4YG2A 9ICLA 4CNQA 5AI8A 1NJYA 4ICAA 4UASA 2YMPA 1A76A 3UMBA 4I27A 4B9NA 4JLXA 1KRPA 2F44A 1KFTA 2KZMA 2DF4B 3MABA 2E8OA 2KIWA 5HRBA 4JV2A 2PFPA 2V4RA 4GXKA 5KFCA 3D6JA 3RJHA 2DL0A 5CWRA 3RH4A 9ICFA 5TISU 4X4QA 1U49A 4X4TA 1Q78A 2ZHAA 4XRHA 4BXOB 5DG9A 1ZQDA 2E1EA 4U7CA 2JGAA 5CEHA 3V7KA 3N28A 4AT8A 5J2HA 5HRLA 3VCBA 3CRXA 3KKAA 5DBAA 5AK4A 4KN7A 3PY8A 4EX6A 3QU7A 2L5YA 3HT3A 5KG2A 3C29A 5HRKA 1ZQSA 4KX3A 4M9JA 2UVUA 4ECZA 4UD4A 4YXMA 1ZOLA 2BQRA 3B0XA 5GTIU 1ZJNA 3ETRA 4O68A 4F4ZA 4CRXA 4JMUA 4RZRA 5F2VO 2KMDA 3H8SA 1U45A 4NXUA 2A1JB 2ZH6A 4EBCA 5J0XA 3SZ2A 4KLTA 2G07A 2VA8A 1X2IA 4I2BA 3LQCB 2K4IA 4RQ7A 4NXZA 2N1RA 5J0PA 2W7PA 5AK6A 4NL9A 4BDPA 7ICIA 1Z4OA 4O5EA 5AM5A 2JXJA 1VLBA 3PHZA 1B43A 2HMXA 1OUQA 1UCVA 3IV6A 1R8BA 2ZIUB 1KNYA 2VA3A 1D8LA 4ECTA 3TFSA 2Y0SC 3Q8LA 3V6HA 4WH5A 5AM0A 1WWVA 4ED8A 1ZD5A 5IILA 2CN1A 5J0OA 2EZXA 5ALHA 1MA7A 2FMQA 4JV1A 9ICOA 4IQTA 2FMSA 3NRZA 1B4FA 1ZQZA 5KFNA 3RB3A 3GZFA 1N5WA 3AU2A 5DG7A 2PXIA 5CFTA 2W03A 4S3NA 3LVWA 4QWDA 9ICVA 1NKCA 4C7YA 5KFUA 1RG6A 1KLNA 4FO1A 4RWOA 4KLUA 7ICMA 3TACB 4P4PA 3ZDAA 5J2JA 4QIWC 3WK9A 3T5KA 3HWTA 1TK0A 1ZQOA 5AM2A 5DB8A 2W9MA 3H8MA 1D9FA 1WCNA 2ODGA 2KJ8A 1IG6A 1DGJA 1R89A 3EF2A 4KLSA 1Z4NA 4BX9C 2ASDA 5HRFA 9ICCA 3OVBA 5D49A 3PW7A 1MSWD 3UMGA 4FHVA 5HRHA 1KSPA 3NYBA 2OWOA 4O3SA 4YR3A 4XA5A 4LZGA 3FDSA 1AQ6A 1SKRA 1RQLA 5D4BA 4F2SA 4DS5A 4UQGA 2RP5A 4YP3A 3T79A 5ALFA 3LWMA 4P2HA 2XGQA 3HILA 2YMMA 4ELUA 2VJ4A 2FPMA 5G5GA 3JPNA 2VJ5A 2PMZF 1NJZA 3NVWA 3C21A 2ZH1A 2Z7JA 3FM9A 4C0ZA 3H0RB 4YR0A 3AQEA 2AU0A 4NM2A 2KE7A 2G5IB 1N61A 3B0YA 1S0VA 3BQ2A 4NLBA 2KV2A 4DQRA 4DSKA 2JZBB 4EEBA 4FBUA 3BS7A 3U26A 1ZQIA 2LYAA 3SV3A 4ED6A 2JEFA 4DOBA 4ED3A 2FCLA 1Z00B 3F5AA 4DF8A 3K4GA 2XY7A 4M47A 3WFOA 4OJPA 1SL0A 2E3TA 3MFIA 4X5VA 5ALTA 1YT3A 2W55A 1COOA 1UEVA 1T3QA 1HUZA 1ZQJA 2HCFA 2FMPA 3AQLA 5AM3A 4DFPA 4PGXA 4JWNA 4O5KA 1PVQA 1UT5A 2LBOA 5J0YA 1PK1A 4K9AA 2DBYA 2FPLA 2AXTU 3HRDD 2Q0ZX 4RWQA 5KAFU 2W8LA 4QZ9A 1NK9A 2IUBA 5KFRA 4CCHA 1ED1A 4JB3A 4RQ8A 1Z19A 4IS7A 3HIYA 3BQ7A 3TAPA 3OPXA 2UVWA 1ZQBA 5D62A 1M6YA 2JEGA 1K5OA 4FS2A 5KFIA 1WYGA 1ZQEA 4F5NA 3GFKB 5J2EA 4LEVA 4C8OA 1YLQA 3OUYB 1TV9A 2ZUBA 5ALZA 5JU5A 4NLCA 4F5QA 3I28A 4F5PA 3UQ2A 1N56A 3SD7A 1SKWA 4FHXA 3Q8KA 1BGXT 1V85A 4DL5A 2LKYA 4QNLA 1EXNA 2HDOA 1S8OA 4IC9A 3PX6A 2BCSA 5CR0A 2DUYA 4OAIZ 1CEZA 1Z3EB 3N4MB 2F3NA 5H2FU 2EQYA 3EW9A 5B5EU 2KD1A 3KHGA 3OHAA 4KB6A 4NWIA 1RYRA 8ICHA 2KP7A 1N5XA 5B3PA 9ICBA 2HHVA 5KFBA 4U6PA 2ASJA 3PSPA 2KHQA 4ECVA 4X0AA 2NV3A 3WKDA 5DBCA 3WKAA 1V9PA 2IHNA 1SWWA 3KHLA 2LHTA 2DKXA 4PH5A 4Q8EA 3RH6A 5DG8A 1PVRA 1S10A 2WFAA 2HBLA 5J8YC 2K8BB 3QE9Y 5AKIA 7ICEA 4E7XA
chains in the Genus database with same CATH topology
4NLNA 4WC1A 5HR9A 2JEIA 7ICHA 9ICTA 2ZUDA 1ZQLA 4KLQA 4PHPA 8ICMA 8ICXA 2W8KA 3C2KA 4IRKA 4XQ8A 5EWGA 3MGIA 3PMLA 4GXIA 4GC6A 4ED2A 4K4GA 4NLGA 4M9NA 4RQ6A 2RFFA 4RPXA 3JPTA 1LB2B 5KFXA 3V72A 4FHYA 3KHRA 1UA1A 4I2AA 5DLFA 1DK2A 4I2JA 1NK7A 3MGHA 2FPKA 3PX4A 4UBCA 1NK5A 3H40A 4YMNA 1XSLA 3RRGA 4QZEA 4Z6EA 3OHBA 4R64A 1VJ7A 1A77A 4I2HA 2PBEA 3ZDDA 1ZQNA 2XY5A 5KFKA 1NOMA 7ICUA 2R8KA 4KLJA 1KEJA 4X4OA 5DDYA 5HMMA 5J29A 5DECA 5KFQA 3THVA 5KFTA 4M9GA 2ZH9A 3MFHA 2ZH3A 3RBDA 1JN3A 1T8EA 2C2RA 3HP6A 9ICWA 4DOAA 4PGQA 1UETA 2DRBA 2NRXA 1DGSA 5KFGA 5KFEA 1ZQAA 4LZDA 4ATBA 2XO7A 4QZCA 2ZJAA 2H5XA 5J2CA 2V9WA 4MEYA 4MFCA 1BPBA 2O1PA 4PHEA 3RB4A 3EYZA 8ICWA 2ZH8A 3KTQA 4RPYA 4RQ4A 3AQNA 3T3FA 5CP2A 5J2AA 4IR1A 2W9BA 4RQ0A 3C2MA 1H38A 8ICRA 1FA0A 4DEZA 4RT2A 2O5AA 1SZPA 4DLGA 1JQRA 4WC5A 5CHGA 4KLEA 5KT4A 2NRZA 4UAZA 4EYHB 3C5FA 4R65A 1ZYQA 1JXLA 5J0WA 1T7PA 5TZVA 3LWLA 2ZJ5A 1XU4A 3H8WA 4O3NA 5CB1A 3RR7A 4YG2A 5J0RA 1U48A 9ICLA 3UXOA 3IM1A 4E80A 4DS4A 3QZ7A 1NK0A 5J2BA 4J9NA 4TQRA 5KT6A 5KT3A 2AGOA 1NJYA 1ZQMA 1ZQHA 3H4BA 4J9LA 4X4UA 4DLEA 1A76A 1ZQUA 3JPRA 4DO9A 1C7YA 8ICUA 4I2IA 1L3VA 2BPFA 5IIOA 4B9NA 4I27A 1KRPA 4UAWA 1JIHA 1R8CA 1ZQVA 3H7IA 2J6TA 1KFTA 2KZMA 9ICHA 5JUMA 3ZD9A 1CUKA 4RNMA 3MR6A 2V4QA 3MABA 3TAQA 2PI4A 4MEXA 2DPJA 1OU5A 1MC8A 3TQ1A 2W9AA 5HRBA 4XQ7A 4UBBA 3RTVA 5DDMA 4F3OA 5KFSA 4JV2A 2PFPA 8ICYA 4DL3A 2ISPA 4J9SA 2V4RA 2BE3A 4GXKA 5KFCA 3RJHA 8ICAA 3QZ8A 5CWRA 3RH4A 4YXJA 1XSPA 3JPPA 5KFYA 2VA2A 4E8FA 1UEUA 9ICFA 4QZGA 1ZETA 5KT7A 4YN4A 4X4QA 3GDXA 1U49A 3GQCA 5KFLA 4M0AA 4WC2A 1ZQXA 4YCXA 4RUAA 4NM1A 3JZ0A 4X4TA 1Q78A 3HX0A 2ZHAA 4ECRA 4XRHA 2IMWP 8ICJA 4F91B 4KLFA 4BXOB 4O9MA 4YMMA 2ZH4A 5DG9A 1U47A 1MIYA 3PW0A 2KZZA 3LDAA 4ELVA 9ICNA 9ICMA 3Q8RB 3RJIA 5J0SA 1ZQDA 4NLKA 2BGWA 2ALZA 1ZQWA 9ICPA 3MR3A 1S77D 3V7KA 4AT8A 5KG7A 2A1JA 2BDPA 5J2HA 7ICPA 4J9RA 1S97A 4UB1A 5HRLA 8ICCA 5DBAA 3V7LA 2P66A 4RNNA 2LYHA 4KN7A 2FLNA 5J2IA 3RH5A 3PY8A 3HT3A 4M2YA 3WFQE 4ZH4A 8ICIA 5CA7A 4PPXA 3T5JA 4F93B 3ETLA 5KG2A 4P4MA 3Q8QB 4ECWA 4ELTA 1XO1A 5HRKA 4X4NA 1ZQSA 1QTMA 8ICZA 4M9JA 5DQHA 2UVUA 5HMLA 5IINA 4ECZA 1UT8A 5EWEA 5KFOA 4K4HA 4YXMA 2FLLA 4UD4A 2BQRA 4M5DA 4EP7A 4O5CA 3EZ5A 3B0XA 1ZJNA 4Z6DA 3JPOA 3BQ0A 4F4ZA 4Q44A 1X9MA 4UB3A 4J9OA 4RZRA 3UQ0A 2FLPA 4IRDA 8ICEA 4R66A 2BQ3A 5F2VO 3H8SA 2C28A 8ICLA 3TANA 1U45A 4AT8B 4BWJA 2A1JB 4BGDA 4J9QA 3RAQA 2IHMA 4RWNA 2ZH6A 4NKUA 4EBCA 3JPQA 5J0XA 3GV5B 3KHHA 1NJWA 3GILA 3SZ2A 3T5LA 2DR7A 4PGYA 5KG0A 4KLTA 3L9DA 2KTQA 1NKEA 2VA8A 3HPOA 4B9VA 4I28A 1X2IA 4I2BA 3E2EA 2NRVA 2ID1A 9ICUA 4Z6FA 4I29A 3LQCB 5BPCA 4RQ7A 4NXZA 3GV8B 4DFJA 3K75D 2HHXA 3GIJA 3M9NB 1DOQA 5J0PA 4RWPA 2RDJA 4BDPA 4X0BA 7ICFA 7ICIA 2Y1JA 4WBZA 5J2KA 4O5EA 4KMUA 3AQKA 1XWLA 1L5UA 8ICPA 4QW8A 1N48A 2F1JA 1B43A 3JPSA 1ZQKA 7ICNA 4WC0A 3BQTA 4GC7A 5KFAA 4ECYA 4DOCA 3NGDA 3PO4A 5DLGA 3AUOA 1ZQPA 2DPIA 5HRGA 4QW9A 2BHNA 1R8BA 5J0TA 3OV7A 1KNYA 2BPCA 3BQ1A 1TK8A 2VA3A 4C8NA 1D8LA 3PR4A 4ECUA 4DQPA 3C1ZA 4ECTA 3Q8PB 4UB4A 3TFSA 4Z6CA 3MDCA 2F1IA 4UB5A 4TUSA 2BPGA 3Q8LA 3V6HA 7ICQA 2BCRA 1MQ2A 4KTQA 2KFZA 3PMNA 4ED8A 5IILA 2IBKA 4WCWA 5J0OA 4B9TA 2BQUA 4PHDA 4B9LA 4NKTA 2M2WA 3T5HA 2BKEA 3C1YA 2FMQA 4JV1A 3TARA 9ICOA 4IQTA 4M6WB 4EBDA 1XC9A 5KFHA 2FMSA 1K1QA 2AJQA 4J9KA 2ZHBA 8ICFA 2PFQA 1ZQZA 4DFMA 5KFNA 4ED1A 3RB3A 2KN7A 2J6SA 4I2GA 5IIKA 3RJEA 4WBYA 4I2DA 5BOMA 3AU2A 1R8AA 5DG7A 2PXIA 1ZQRA 1S76D 1F5AA 1NK8A 2JEJA 5KG4A 5J0QA 2ZTCA 3PW5A 4O3RA 5KG1A 3AQMA 1TK5A 3HJ1A 4S3NA 4QZAA 2RDIA 3UXNA 4QWDA 1S9FA 9ICVA 1NKCA 4BXOA 1LV5A 2DR5A 5KFUA 1KLNA 4RWOA 3WFSC 3ZDEA 4B9MA 4KLUA 7ICMA 2C2EA 4QZDA 4M9HA 3G6XA 4GXJA 3MR5A 4F5RA 2BR0A 9ICXA 4P4PA 3ZDAA 2HHPA 1IXRA 4DQQA 5J2JA 1ZQTA 8ICVA 4WC7A 1MQ3A 1RZTA 2ZH5A 3T5KA 4EZ9A 3HWTA 3H8JA 3H4DA 5EWFA 4O0IA 1TK0A 3BDPA 4DSJA 1ZQOA 3SI8A 4Q43A 5DB8A 2W9MA 1D9FA 1WCNA 1S0NA 3TI0A 4QZIA 9ICJA 2HHQA 4FHPA 2DVIA 3ZDCA 1DK3A 2IA6A 3C66A 3V7JA 2XCPA 2C22A 1R89A 3UPQA 4YR2A 1U4BA 1TAQA 4KLSA 4DL2A 2ASDA 4F4XA 4I2CA 3GIKA 4FO6A 4I2FA 5DKWA 2PFNA 4M9LA 9ICRA 3ISBA 5HRFA 9ICCA 4EBJA 3OVBA 5KFWA 1BPEA 3RJKA 5D49A 2XY6A 4KLIA 3PW7A 4FH3A 4EBEA 7ICSA 5BOLA 4IG8A 5KG5A 3PR5B 3RB0A 4DQIA 1MSWD 5HRHA 4E0DA 1S0MA 3ISDA 1KSPA 4FHVA 2Q66A 4LVSA 1NK4A 5DBBA 2HHSA 1VFGA 1WCLA 3ISCA 2R8HA 2OWOA 3PW2A 4RQ3A 4O3SA 2P6UA 3NYBA 4ED0A 8ICGA 5DB7A 4YR3A 4I2EA 4EZ6A 1TAUA 4XA5A 3EPGA 1RXVA 3FDSA 3PO5A 2PI5A 4LZGA 2HHUA 3GIMA 4AT9B 3WFRE 3OJUA 1SKRA 3IHQB 3H37A 2BCVA 4FHWA 4P4OA 3PW4A 4FBTA 3NTUA 5D4BA 4F2SA 4DS5A 4NLZA 4UQGA 8ICNA 1IM4A 5DGAA 3HJ4A 2M9NA 4YP3A 4IQWA 8ICBA 8ICKA 1BNOA 4EBKA 3LWMA 4P2HA 2XGQA 3M9OB 5KFVA 4DQSA 4FS1A 4ELUA 8ICQA 1SL1A 5EOZA 2JZBA 5DGBA 2FPMA 5L1LA 2MAXA 3RBEA 1UA0A 2M2VA 4IRCA 4X4SA 3JPNA 1U9LA 1NKBA 9ICIA 3C18A 3FYHA 5IIMA 4QZFA 1TKDA 4TURA 5HP4A 4KLMA 3RAXA 1NJZA 4KLOA 7ICRA 4WC6A 1K1SA 3UPSA 3N97B 4WC3A 5KFJA 3C21A 2ZH1A 2ZJ8A 1HJPA 3H3AA 4YR0A 4TUPA 2AU0A 2AGPA 4M04A 2HVHA 4NM2A 9ICAA 4F2RA 4O3QA 4KLLA 2DFLA 5J2DA 4YD1A 1RPLA 4MFFA 4UD5A 4C8KA 5KFZA 3B0YA 4EEYA 1AROP 1S0VA 5KFDA 4KITB 3BQ2A 3Q8SB 1TFRA 4B9UA 4RQ1A 4R63A 2DR8A 5HHIA 4DQRA 4DSKA 4DL4A 1BPYA 2JZBB 4M6WA 4DWIA 4FBUA 3MBYA 4DF4A 3C23A 1ZQIA 7ICJA 3ZDBA 3SV3A 4ECSA 4ED6A 2JEFA 4DOBA 2R8JA 4ED3A 4LT6A 1Z00B 5KFMA 1QSSA 2Y1IA 9ICSA 2ZH2A 4DF8A 5J2FA 1WOTA 3K4GA 2XY7A 4M47A 2HHWA 3G6YA 4QWCA 2I9GA 2UVRA 3WFOA 1SL0A 1B22A 1SL2A 3MFIA 4X5VA 4O3OA 1KDHA 1ZJMA 1L3SA 4KLHA 5CJ7A 4RQ5A 4RU9A 3PX0A 1TVAA 4RNOA 3TFRA 1XSNA 4RPZA 4X4VA 3UXPA 1X9SA 2P6RA 4DSEA 9ICEA 3MR2A 2ATLA 1QSLA 3AU6A 4YMOA 2WTFA 1COOA 4C8LA 1Q79A 1HUZA 1D9DA 1UEVA 4JV0A 1ZQJA 3OJSA 4GLXA 5KFFA 4ED7A 2FMPA 2J6UA 3AQLA 4DFKA 4QWBA 4DFPA 4PGXA 4F4KA 4JWNA 5F9LA 5DQIA 1QSYA 5DQGA 4O5KA 3WFPA 1UT5A 3RRHA 8ICOA 5J0YA 1MIVA 2XGPA 2XC9A 4F8RA 2AQ0A 4NY8A 2AQ4A 2FPLA 1JX4A 4KLGA 7ICLA 5HRDA 4DL7A 3GIIA 3C2LA 3QEAZ 2Q0ZX 4RWQA 4G3IA 2C2DA 4RQ2A 1BPDA 2W8LA 2R8IA 2ZTDA 7ICGA 5HC9A 4YD2A 4QZ9A 1BVSA 5D46A 1NK9A 1JAJA 4ECXA 2DR9A 1ZQYA 2KFNA 2ISOA 1TFYA 1PZNA 5KFRA 3M8SA 4CCHA 3OUYA 1NO5A 1V4AA 3SYZA 5DEDA 4RQ8A 4KN4A 5J2GA 4MF2A 4X4PA 1BPZA 5J0UA 3LK9A 5KG3A 4F4WA 2W9CA 1T3NA 3HIYA 3HW8A 4F4YA 3RJFA 4B9SA 4AT9A 3TAPA 3RJGA 4IR9A 3ORYA 2UVWA 4YFKA 8ICSA 2GWSA 2MUTA 3SV4A 4O3PA 1TFWA 1ZQBA 2NRKA 3GV7B 3MDAA 3V6JA 4R8UA 3OSPA 2JEGA 5L1IA 2R8GA 1BNPA 3M8RA 5HNKA 2PFOA 1PX5A 2BCUA 4DSLA 5C5JA 4FS2A 1T4GA 5KFIA 3RB6A 4ATBB 1ZQEA 8ICTA 4F5NA 3H38A 3GFKB 2KZ3A 5J2EA 4JK1A 3OSNA 4C8OA 5HREA 9ICKA 2UVVA 1YLQA 3OUYB 3RR8A 4QZBA 2W9BB 5DB9A 3RJJA 1KTQA 1TV9A 1RYSA 2ZUBA 2ZUCA 1ZQQA 1ZQGA 1L3UA 2M2UA 2W9CB 3V6KA 7ICTA 4F5QA 1X9WA 2ZTEA 9ICQA 4JUZA 3OGUA 4TQSA 1NZPA 3OVAA 4WC4A 3EWAA 1D8YA 5KTQA 4IQUA 5L9XA 4MF8A 4C8MA 4F5PA 1JXEA 5HHHA 3UQ2A 2MUTB 1N56A 1Y88A 5KT2A 1S0OA 1NJXA 4DSIA 7ICVA 4TUQA 4R8UB 4AT7A 5F9NA 1SKWA 4FHXA 4F5OA 3Q8KA 1BGXT 4DL5A 4YVZA 2AGQA 1HUOA 1EXNA 3ZD8A 4X4RA 2BCQA 2DRAA 3PX6A 1L3TA 2BCSA 5CR0A 4J9PA 3BJYA 1XS9D 3H39A 1CEZA 1KFDA 1Z3EB 4MFAA 4RT3A 3N4MB 3OVSA 4KLDA 4HYKA 3EW9A 5KT5A 3KHGA 4IQVA 3OHAA 3QEBZ 4YQWA 4EYIB 1RYRA 1Z00A 3M9MB 2I1QA 4JWMA 8ICHA 2HHVA 1ZQCA 2VANA 9ICBA 2KP7A 5HRIA 5KFBA 4J9MA 4FH5A 4XUSA 3EPIA 2NRWA 4Q45A 5KFPA 4UB2A 2ASJA 1ZQFA 2XCAA 5IIJA 4F50A 4Q8FA 4DL6A 3PVXA 1KFSA 5DB6A 4ECVA 9ICGA 4QZ8A 4F92B 4QWEA 5L1JA 4K4IA 3PNCA 4X0AA 5IIIA 4AT7B 5DBCA 7ICOA 1V9PA 4BWMA 1SKSA 1NK6A 2IHNA 3G6VA 3KHLA 2HHTA 2ASLA 4PH5A 4Q8EA 5L1KA 3RH6A 5KG6A 4PHAA 5DG8A 2HW3A 2NRTA 1S10A 1BPXA 2B21A 3PV8A 1RXWA 4QZHA 4DSFA 2F1HA 1QLNA 1MIWA 3JYYA 4ECQA 2ZH7A 4RUCA 7ICKA 3QE9Y 3Q8MA 2HVIA 3C5GA 4UAYA 1JMSA 2M2TA 4QWAA 7ICEA 4E7XA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NLN A;  4WC1 A;  5HR9 A;  2JEI A;  7ICH A;  9ICT A;  2ZUD A;  1ZQL A;  4KLQ A;  4PHP A;  8ICM A;  8ICX A;  2W8K A;  3C2K A;  4IRK A;  4XQ8 A;  5EWG A;  3MGI A;  3PML A;  4GXI A;  4GC6 A;  4ED2 A;  4K4G A;  4NLG A;  4M9N A;  4RQ6 A;  2RFF A;  4RPX A;  3JPT A;  1LB2 B;  5KFX A;  3V72 A;  4FHY A;  3KHR A;  1UA1 A;  4I2A A;  5DLF A;  1DK2 A;  4I2J A;  1NK7 A;  3MGH A;  2FPK A;  3PX4 A;  4UBC A;  1NK5 A;  3H40 A;  4YMN A;  1XSL A;  3RRG A;  4QZE A;  4Z6E A;  3OHB A;  4R64 A;  1VJ7 A;  1A77 A;  4I2H A;  2PBE A;  3ZDD A;  1ZQN A;  2XY5 A;  5KFK A;  1NOM A;  7ICU A;  2R8K A;  4KLJ A;  1KEJ A;  4X4O A;  5DDY A;  5HMM A;  5J29 A;  5DEC A;  5KFQ A;  3THV A;  5KFT A;  4M9G A;  2ZH9 A;  3MFH A;  2ZH3 A;  3RBD A;  1JN3 A;  1T8E A;  2C2R A;  3HP6 A;  9ICW A;  4DOA A;  4PGQ A;  1UET A;  2DRB A;  2NRX A;  1DGS A;  5KFG A;  5KFE A;  1ZQA A;  4LZD A;  4ATB A;  2XO7 A;  4QZC A;  2ZJA A;  2H5X A;  5J2C A;  2V9W A;  4MEY A;  4MFC A;  1BPB A;  2O1P A;  4PHE A;  3RB4 A;  3EYZ A;  8ICW A;  2ZH8 A;  3KTQ A;  4RPY A;  4RQ4 A;  3AQN A;  3T3F A;  5CP2 A;  5J2A A;  4IR1 A;  2W9B A;  4RQ0 A;  3C2M A;  1H38 A;  8ICR A;  1FA0 A;  4DEZ A;  4RT2 A;  2O5A A;  1SZP A;  4DLG A;  1JQR A;  4WC5 A;  5CHG A;  4KLE A;  5KT4 A;  2NRZ A;  4UAZ A;  4EYH B;  3C5F A;  4R65 A;  1ZYQ A;  1JXL A;  5J0W A;  1T7P A;  5TZV A;  3LWL A;  2ZJ5 A;  1XU4 A;  3H8W A;  4O3N A;  5CB1 A;  3RR7 A;  4YG2 A;  5J0R A;  1U48 A;  9ICL A;  3UXO A;  3IM1 A;  4E80 A;  4DS4 A;  3QZ7 A;  1NK0 A;  5J2B A;  4J9N A;  4TQR A;  5KT6 A;  5KT3 A;  2AGO A;  1NJY A;  1ZQM A;  1ZQH A;  3H4B A;  4J9L A;  4X4U A;  4DLE A;  1A76 A;  1ZQU A;  3JPR A;  4DO9 A;  1C7Y A;  8ICU A;  4I2I A;  1L3V A;  2BPF A;  5IIO A;  4B9N A;  4I27 A;  1KRP A;  4UAW A;  1JIH A;  1R8C A;  1ZQV A;  3H7I A;  2J6T A;  1KFT A;  2KZM A;  9ICH A;  5JUM A;  3ZD9 A;  1CUK A;  4RNM A;  3MR6 A;  2V4Q A;  3MAB A;  3TAQ A;  2PI4 A;  4MEX A;  2DPJ A;  1OU5 A;  1MC8 A;  3TQ1 A;  2W9A A;  5HRB A;  4XQ7 A;  4UBB A;  3RTV A;  5DDM A;  4F3O A;  5KFS A;  4JV2 A;  2PFP A;  8ICY A;  4DL3 A;  2ISP A;  4J9S A;  2V4R A;  2BE3 A;  4GXK A;  5KFC A;  3RJH A;  8ICA A;  3QZ8 A;  5CWR A;  3RH4 A;  4YXJ A;  1XSP A;  3JPP A;  5KFY A;  2VA2 A;  4E8F A;  1UEU A;  9ICF A;  4QZG A;  1ZET A;  5KT7 A;  4YN4 A;  4X4Q A;  3GDX A;  1U49 A;  3GQC A;  5KFL A;  4M0A A;  4WC2 A;  1ZQX A;  4YCX A;  4RUA A;  4NM1 A;  3JZ0 A;  4X4T A;  1Q78 A;  3HX0 A;  2ZHA A;  4ECR A;  4XRH A;  2IMW P;  8ICJ A;  4F91 B;  4KLF A;  4BXO B;  4O9M A;  4YMM A;  2ZH4 A;  5DG9 A;  1U47 A;  1MIY A;  3PW0 A;  2KZZ A;  3LDA A;  4ELV A;  9ICN A;  9ICM A;  3Q8R B;  3RJI A;  5J0S A;  1ZQD A;  4NLK A;  2BGW A;  2ALZ A;  1ZQW A;  9ICP A;  3MR3 A;  1S77 D;  3V7K A;  4AT8 A;  5KG7 A;  2A1J A;  2BDP A;  5J2H A;  7ICP A;  4J9R A;  1S97 A;  4UB1 A;  5HRL A;  8ICC A;  5DBA A;  3V7L A;  2P66 A;  4RNN A;  2LYH A;  4KN7 A;  2FLN A;  5J2I A;  3RH5 A;  3PY8 A;  3HT3 A;  4M2Y A;  3WFQ E;  4ZH4 A;  8ICI A;  5CA7 A;  4PPX A;  3T5J A;  4F93 B;  3ETL A;  5KG2 A;  4P4M A;  3Q8Q B;  4ECW A;  4ELT A;  1XO1 A;  5HRK A;  4X4N A;  1ZQS A;  1QTM A;  8ICZ A;  4M9J A;  5DQH A;  2UVU A;  5HML A;  5IIN A;  4ECZ A;  1UT8 A;  5EWE A;  5KFO A;  4K4H A;  4YXM A;  2FLL A;  4UD4 A;  2BQR A;  4M5D A;  4EP7 A;  4O5C A;  3EZ5 A;  3B0X A;  1ZJN A;  4Z6D A;  3JPO A;  3BQ0 A;  4F4Z A;  4Q44 A;  1X9M A;  4UB3 A;  4J9O A;  4RZR A;  3UQ0 A;  2FLP A;  4IRD A;  8ICE A;  4R66 A;  2BQ3 A;  5F2V O;  3H8S A;  2C28 A;  8ICL A;  3TAN A;  1U45 A;  4AT8 B;  4BWJ A;  2A1J B;  4BGD A;  4J9Q A;  3RAQ A;  2IHM A;  4RWN A;  2ZH6 A;  4NKU A;  4EBC A;  3JPQ A;  5J0X A;  3GV5 B;  3KHH A;  1NJW A;  3GIL A;  3SZ2 A;  3T5L A;  2DR7 A;  4PGY A;  5KG0 A;  4KLT A;  3L9D A;  2KTQ A;  1NKE A;  2VA8 A;  3HPO A;  4B9V A;  4I28 A;  1X2I A;  4I2B A;  3E2E A;  2NRV A;  2ID1 A;  9ICU A;  4Z6F A;  4I29 A;  3LQC B;  5BPC A;  4RQ7 A;  4NXZ A;  3GV8 B;  4DFJ A;  3K75 D;  2HHX A;  3GIJ A;  3M9N B;  1DOQ A;  5J0P A;  4RWP A;  2RDJ A;  4BDP A;  4X0B A;  7ICF A;  7ICI A;  2Y1J A;  4WBZ A;  5J2K A;  4O5E A;  4KMU A;  3AQK A;  1XWL A;  1L5U A;  8ICP A;  4QW8 A;  1N48 A;  2F1J A;  1B43 A;  3JPS A;  1ZQK A;  7ICN A;  4WC0 A;  3BQT A;  4GC7 A;  5KFA A;  4ECY A;  4DOC A;  3NGD A;  3PO4 A;  5DLG A;  3AUO A;  1ZQP A;  2DPI A;  5HRG A;  4QW9 A;  2BHN A;  1R8B A;  5J0T A;  3OV7 A;  1KNY A;  2BPC A;  3BQ1 A;  1TK8 A;  2VA3 A;  4C8N A;  1D8L A;  3PR4 A;  4ECU A;  4DQP A;  3C1Z A;  4ECT A;  3Q8P B;  4UB4 A;  3TFS A;  4Z6C A;  3MDC A;  2F1I A;  4UB5 A;  4TUS A;  2BPG A;  3Q8L A;  3V6H A;  7ICQ A;  2BCR A;  1MQ2 A;  4KTQ A;  2KFZ A;  3PMN A;  4ED8 A;  5IIL A;  2IBK A;  4WCW A;  5J0O A;  4B9T A;  2BQU A;  4PHD A;  4B9L A;  4NKT A;  2M2W A;  3T5H A;  2BKE A;  3C1Y A;  2FMQ A;  4JV1 A;  3TAR A;  9ICO A;  4IQT A;  4M6W B;  4EBD A;  1XC9 A;  5KFH A;  2FMS A;  1K1Q A;  2AJQ A;  4J9K A;  2ZHB A;  8ICF A;  2PFQ A;  1ZQZ A;  4DFM A;  5KFN A;  4ED1 A;  3RB3 A;  2KN7 A;  2J6S A;  4I2G A;  5IIK A;  3RJE A;  4WBY A;  4I2D A;  5BOM A;  3AU2 A;  1R8A A;  5DG7 A;  2PXI A;  1ZQR A;  1S76 D;  1F5A A;  1NK8 A;  2JEJ A;  5KG4 A;  5J0Q A;  2ZTC A;  3PW5 A;  4O3R A;  5KG1 A;  3AQM A;  1TK5 A;  3HJ1 A;  4S3N A;  4QZA A;  2RDI A;  3UXN A;  4QWD A;  1S9F A;  9ICV A;  1NKC A;  4BXO A;  1LV5 A;  2DR5 A;  5KFU A;  1KLN A;  4RWO A;  3WFS C;  3ZDE A;  4B9M A;  4KLU A;  7ICM A;  2C2E A;  4QZD A;  4M9H A;  3G6X A;  4GXJ A;  3MR5 A;  4F5R A;  2BR0 A;  9ICX A;  4P4P A;  3ZDA A;  2HHP A;  1IXR A;  4DQQ A;  5J2J A;  1ZQT A;  8ICV A;  4WC7 A;  1MQ3 A;  1RZT A;  2ZH5 A;  3T5K A;  4EZ9 A;  3HWT A;  3H8J A;  3H4D A;  5EWF A;  4O0I A;  1TK0 A;  3BDP A;  4DSJ A;  1ZQO A;  3SI8 A;  4Q43 A;  5DB8 A;  2W9M A;  1D9F A;  1WCN A;  1S0N A;  3TI0 A;  4QZI A;  9ICJ A;  2HHQ A;  4FHP A;  2DVI A;  3ZDC A;  1DK3 A;  2IA6 A;  3C66 A;  3V7J A;  2XCP A;  2C22 A;  1R89 A;  3UPQ A;  4YR2 A;  1U4B A;  1TAQ A;  4KLS A;  4DL2 A;  2ASD A;  4F4X A;  4I2C A;  3GIK A;  4FO6 A;  4I2F A;  5DKW A;  2PFN A;  4M9L A;  9ICR A;  3ISB A;  5HRF A;  9ICC A;  4EBJ A;  3OVB A;  5KFW A;  1BPE A;  3RJK A;  5D49 A;  2XY6 A;  4KLI A;  3PW7 A;  4FH3 A;  4EBE A;  7ICS A;  5BOL A;  4IG8 A;  5KG5 A;  3PR5 B;  3RB0 A;  4DQI A;  1MSW D;  5HRH A;  4E0D A;  1S0M A;  3ISD A;  1KSP A;  4FHV A;  2Q66 A;  4LVS A;  1NK4 A;  5DBB A;  2HHS A;  1VFG A;  1WCL A;  3ISC A;  2R8H A;  2OWO A;  3PW2 A;  4RQ3 A;  4O3S A;  2P6U A;  3NYB A;  4ED0 A;  8ICG A;  5DB7 A;  4YR3 A;  4I2E A;  4EZ6 A;  1TAU A;  4XA5 A;  3EPG A;  1RXV A;  3FDS A;  3PO5 A;  2PI5 A;  4LZG A;  2HHU A;  3GIM A;  4AT9 B;  3WFR E;  3OJU A;  1SKR A;  3IHQ B;  3H37 A;  2BCV A;  4FHW A;  4P4O A;  3PW4 A;  4FBT A;  3NTU A;  5D4B A;  4F2S A;  4DS5 A;  4NLZ A;  4UQG A;  8ICN A;  1IM4 A;  5DGA A;  3HJ4 A;  2M9N A;  4YP3 A;  4IQW A;  8ICB A;  8ICK A;  1BNO A;  4EBK A;  3LWM A;  4P2H A;  2XGQ A;  3M9O B;  5KFV A;  4DQS A;  4FS1 A;  4ELU A;  8ICQ A;  1SL1 A;  5EOZ A;  2JZB A;  5DGB A;  2FPM A;  5L1L A;  2MAX A;  3RBE A;  1UA0 A;  2M2V A;  4IRC A;  4X4S A;  3JPN A;  1U9L A;  1NKB A;  9ICI A;  3C18 A;  3FYH A;  5IIM A;  4QZF A;  1TKD A;  4TUR A;  5HP4 A;  4KLM A;  3RAX A;  1NJZ A;  4KLO A;  7ICR A;  4WC6 A;  1K1S A;  3UPS A;  3N97 B;  4WC3 A;  5KFJ A;  3C21 A;  2ZH1 A;  2ZJ8 A;  1HJP A;  3H3A A;  4YR0 A;  4TUP A;  2AU0 A;  2AGP A;  4M04 A;  2HVH A;  4NM2 A;  9ICA A;  4F2R A;  4O3Q A;  4KLL A;  2DFL A;  5J2D A;  4YD1 A;  1RPL A;  4MFF A;  4UD5 A;  4C8K A;  5KFZ A;  3B0Y A;  4EEY A;  1ARO P;  1S0V A;  5KFD A;  4KIT B;  3BQ2 A;  3Q8S B;  1TFR A;  4B9U A;  4RQ1 A;  4R63 A;  2DR8 A;  5HHI A;  4DQR A;  4DSK A;  4DL4 A;  1BPY A;  2JZB B;  4M6W A;  4DWI A;  4FBU A;  3MBY A;  4DF4 A;  3C23 A;  1ZQI A;  7ICJ A;  3ZDB A;  3SV3 A;  4ECS A;  4ED6 A;  2JEF A;  4DOB A;  2R8J A;  4ED3 A;  4LT6 A;  1Z00 B;  5KFM A;  1QSS A;  2Y1I A;  9ICS A;  2ZH2 A;  4DF8 A;  5J2F A;  1WOT A;  3K4G A;  2XY7 A;  4M47 A;  2HHW A;  3G6Y A;  4QWC A;  2I9G A;  2UVR A;  3WFO A;  1SL0 A;  1B22 A;  1SL2 A;  3MFI A;  4X5V A;  4O3O A;  1KDH A;  1ZJM A;  1L3S A;  4KLH A;  5CJ7 A;  4RQ5 A;  4RU9 A;  3PX0 A;  1TVA A;  4RNO A;  3TFR A;  1XSN A;  4RPZ A;  4X4V A;  3UXP A;  1X9S A;  2P6R A;  4DSE A;  9ICE A;  3MR2 A;  2ATL A;  1QSL A;  3AU6 A;  4YMO A;  2WTF A;  1COO A;  4C8L A;  1Q79 A;  1HUZ A;  1D9D A;  1UEV A;  4JV0 A;  1ZQJ A;  3OJS A;  4GLX A;  5KFF A;  4ED7 A;  2FMP A;  2J6U A;  3AQL A;  4DFK A;  4QWB A;  4DFP A;  4PGX A;  4F4K A;  4JWN A;  5F9L A;  5DQI A;  1QSY A;  5DQG A;  4O5K A;  3WFP A;  1UT5 A;  3RRH A;  8ICO A;  5J0Y A;  1MIV A;  2XGP A;  2XC9 A;  4F8R A;  2AQ0 A;  4NY8 A;  2AQ4 A;  2FPL A;  1JX4 A;  4KLG A;  7ICL A;  5HRD A;  4DL7 A;  3GII A;  3C2L A;  3QEA Z;  2Q0Z X;  4RWQ A;  4G3I A;  2C2D A;  4RQ2 A;  1BPD A;  2W8L A;  2R8I A;  2ZTD A;  7ICG A;  5HC9 A;  4YD2 A;  4QZ9 A;  1BVS A;  5D46 A;  1NK9 A;  1JAJ A;  4ECX A;  2DR9 A;  1ZQY A;  2KFN A;  2ISO A;  1TFY A;  1PZN A;  5KFR A;  3M8S A;  4CCH A;  3OUY A;  1NO5 A;  1V4A A;  3SYZ A;  5DED A;  4RQ8 A;  4KN4 A;  5J2G A;  4MF2 A;  4X4P A;  1BPZ A;  5J0U A;  3LK9 A;  5KG3 A;  4F4W A;  2W9C A;  1T3N A;  3HIY A;  3HW8 A;  4F4Y A;  3RJF A;  4B9S A;  4AT9 A;  3TAP A;  3RJG A;  4IR9 A;  3ORY A;  2UVW A;  4YFK A;  8ICS A;  2GWS A;  2MUT A;  3SV4 A;  4O3P A;  1TFW A;  1ZQB A;  2NRK A;  3GV7 B;  3MDA A;  3V6J A;  4R8U A;  3OSP A;  2JEG A;  5L1I A;  2R8G A;  1BNP A;  3M8R A;  5HNK A;  2PFO A;  1PX5 A;  2BCU A;  4DSL A;  5C5J A;  4FS2 A;  1T4G A;  5KFI A;  3RB6 A;  4ATB B;  1ZQE A;  8ICT A;  4F5N A;  3H38 A;  3GFK B;  2KZ3 A;  5J2E A;  4JK1 A;  3OSN A;  4C8O A;  5HRE A;  9ICK A;  2UVV A;  1YLQ A;  3OUY B;  3RR8 A;  4QZB A;  2W9B B;  5DB9 A;  3RJJ A;  1KTQ A;  1TV9 A;  1RYS A;  2ZUB A;  2ZUC A;  1ZQQ A;  1ZQG A;  1L3U A;  2M2U A;  2W9C B;  3V6K A;  7ICT A;  4F5Q A;  1X9W A;  2ZTE A;  9ICQ A;  4JUZ A;  3OGU A;  4TQS A;  1NZP A;  3OVA A;  4WC4 A;  3EWA A;  1D8Y A;  5KTQ A;  4IQU A;  5L9X A;  4MF8 A;  4C8M A;  4F5P A;  1JXE A;  5HHH A;  3UQ2 A;  2MUT B;  1N56 A;  1Y88 A;  5KT2 A;  1S0O A;  1NJX A;  4DSI A;  7ICV A;  4TUQ A;  4R8U B;  4AT7 A;  5F9N A;  1SKW A;  4FHX A;  4F5O A;  3Q8K A;  1BGX T;  4DL5 A;  4YVZ A;  2AGQ A;  1HUO A;  1EXN A;  3ZD8 A;  4X4R A;  2BCQ A;  2DRA A;  3PX6 A;  1L3T A;  2BCS A;  5CR0 A;  4J9P A;  3BJY A;  1XS9 D;  3H39 A;  1CEZ A;  1KFD A;  1Z3E B;  4MFA A;  4RT3 A;  3N4M B;  3OVS A;  4KLD A;  4HYK A;  3EW9 A;  5KT5 A;  3KHG A;  4IQV A;  3OHA A;  3QEB Z;  4YQW A;  4EYI B;  1RYR A;  1Z00 A;  3M9M B;  2I1Q A;  4JWM A;  8ICH A;  2HHV A;  1ZQC A;  2VAN A;  9ICB A;  2KP7 A;  5HRI A;  5KFB A;  4J9M A;  4FH5 A;  4XUS A;  3EPI A;  2NRW A;  4Q45 A;  5KFP A;  4UB2 A;  2ASJ A;  1ZQF A;  2XCA A;  5IIJ A;  4F50 A;  4Q8F A;  4DL6 A;  3PVX A;  1KFS A;  5DB6 A;  4ECV A;  9ICG A;  4QZ8 A;  4F92 B;  4QWE A;  5L1J A;  4K4I A;  3PNC A;  4X0A A;  5III A;  4AT7 B;  5DBC A;  7ICO A;  1V9P A;  4BWM A;  1SKS A;  1NK6 A;  2IHN A;  3G6V A;  3KHL A;  2HHT A;  2ASL A;  4PH5 A;  4Q8E A;  5L1K A;  3RH6 A;  5KG6 A;  4PHA A;  5DG8 A;  2HW3 A;  2NRT A;  1S10 A;  1BPX A;  2B21 A;  3PV8 A;  1RXW A;  4QZH A;  4DSF A;  2F1H A;  1QLN A;  1MIW A;  3JYY A;  4ECQ A;  2ZH7 A;  4RUC A;  7ICK A;  3QE9 Y;  3Q8M A;  2HVI A;  3C5G A;  4UAY A;  1JMS A;  2M2T A;  4QWA A;  7ICE A;  4E7X A; 
#chains in the Genus database with same CATH topology
 4WC1 A;  1Q3U A;  3ONN A;  2W8K A;  4XQ8 A;  1LB2 B;  1UA1 A;  3QU2 A;  5DLF A;  1DK2 A;  1NK7 A;  3MGH A;  1NK5 A;  5E79 U;  3M7D A;  1KKX A;  3OHB A;  5ALI A;  1VJ7 A;  1V38 A;  2FJ6 A;  1NOM A;  2R8K A;  3LVV A;  3THV A;  4M9G A;  3F5E A;  3MFH A;  2QB1 A;  3WK5 A;  1JN3 A;  4UW9 A;  1T8E A;  2C2R A;  1FFV A;  2NRX A;  4PL1 A;  5KFG A;  5KFE A;  3NWI A;  1X6J A;  4LZD A;  4ATB A;  4MEY A;  1URJ A;  1BPB A;  2LM1 A;  2W3R A;  3MC1 A;  2WB1 C;  1Q46 A;  2RQ5 A;  8ICW A;  3T3F A;  1FA0 A;  1JQR A;  5AHX A;  1ZYQ A;  4R65 A;  1JXL A;  2W11 A;  1SV0 A;  2H3F A;  1ECW A;  4E80 A;  3SEI A;  4DO9 A;  1ZQU A;  1C7Y A;  8ICU A;  2BPF A;  4UAV A;  5IIO A;  5B3Q A;  1FEZ A;  5AKK A;  3D2S A;  2JV3 A;  4XJE A;  1JIH A;  1ZQV A;  2J6T A;  3WKC A;  9ICH A;  3M6K A;  5JUM A;  3TAQ A;  2PI4 A;  4LJX A;  3GU3 A;  4RQN A;  3TQ1 A;  4XQ7 A;  4UBB A;  5DDM A;  2QB0 B;  4DL3 A;  2ISP A;  1L8L A;  1HEK A;  3QZ8 A;  2KEY A;  5AI5 A;  5ALO A;  1FO4 A;  3SAF A;  4YN4 A;  3GQC A;  5KFL A;  3WK8 A;  4M0A A;  1ZQX A;  4YCX A;  4NM1 A;  2XVT A;  1TFW A;  4O9M A;  4FFD A;  4Y2V A;  1KW4 A;  1MIY A;  3PW0 A;  3LDA A;  3Q8R B;  4NLK A;  1N62 A;  4FZM A;  2HBJ A;  5J0S A;  3MR3 A;  2NO4 A;  2BDP A;  3L3F X;  1S97 A;  8ICC A;  2H3Q A;  3RH5 A;  4M2Y A;  5CA7 A;  4ECW A;  3ETL A;  4X4N A;  3Q8Q B;  2HOF A;  1QTM A;  5DQH A;  5IIN A;  2PKE A;  5ALS A;  2EDU A;  5EWE A;  5KFO A;  4CGZ A;  3ER8 C;  4Z6D A;  3JPO A;  2WF6 A;  1V97 A;  4P0Q B;  5CFU A;  4UB3 A;  4J9O A;  4NXV A;  1SZH A;  2G5H B;  4B6J A;  8ICE A;  4R66 A;  4BWJ A;  2W3S A;  2IHM A;  4RWN A;  4KM5 A;  3DDH A;  3JPQ A;  2KG5 A;  4B9V A;  2NRV A;  4Z6F A;  3AN1 A;  2OEH A;  4Y2U A;  3K75 D;  1KL9 A;  3M9N B;  3GIJ A;  1DOQ A;  4O69 A;  3QUT A;  3MGV A;  2RDJ A;  4X0B A;  4WBZ A;  2Y1J A;  5J2K A;  4KMU A;  3AL0 B;  1L5U A;  8ICP A;  2QAR A;  2KVC A;  2LMR A;  1N48 A;  3JPS A;  7ICN A;  3BQT A;  5KFA A;  4ECY A;  3NGD A;  2DPI A;  5J0T A;  3BQ1 A;  3PR4 A;  2D6F C;  3QUB A;  5ALX A;  1C20 A;  4UB5 A;  4TUS A;  5AI9 A;  4Y2Y A;  7ICQ A;  2BCR A;  3PST A;  4N7R A;  2IBK A;  4WCW A;  4I0U A;  4B9T A;  3T5H A;  1SGG A;  3C1Y A;  3NVV A;  3AQF A;  4J9K A;  2PFQ A;  4K9B A;  4DFM A;  2ZIV A;  4I2G A;  5T14 A;  5AK5 A;  2EAN A;  4LEW A;  1NK8 A;  2JEJ A;  4O3R A;  3HJ1 A;  2ZTC A;  3PW5 A;  5AK3 A;  5KG1 A;  4F71 A;  2ZXI A;  3UXN A;  2DR5 A;  3WFS C;  1RYU A;  1A6S A;  4EEN A;  3G6X A;  2WAQ F;  3NS1 A;  4DQQ A;  4WC7 A;  1MQ3 A;  2ZH5 A;  4EZ9 A;  3H8J A;  5CFS A;  3BDP A;  4O0I A;  4UAR A;  1F44 A;  3O0F A;  2XCP A;  4YR2 A;  1TAQ A;  4DL2 A;  5AKG A;  4I2F A;  5DKW A;  3B9J A;  2E5S A;  2KIC A;  5K4L A;  1BPE A;  3RJK A;  1ZRN A;  2XY6 A;  1IIP A;  4KLI A;  4FH3 A;  7ICS A;  5BOL A;  5KG5 A;  3PR5 B;  4DQI A;  1S0M A;  3ISD A;  3CP8 A;  2R8H A;  4Y2P A;  3OVA A;  4MKP A;  4ED0 A;  5DB7 A;  3EPG A;  4C80 A;  3H37 A;  4P4O A;  2MA1 A;  1VDV A;  4FBT A;  1Q3V A;  2ZXH A;  5DGA A;  5KAI U;  8ICK A;  4EBK A;  5ALL A;  3M9O B;  4DQS A;  8ICQ A;  1SL1 A;  4IL6 U;  5DGB A;  3RBE A;  2M2V A;  4IRC A;  9ICI A;  1NKB A;  3FYH A;  2KJ5 A;  4TUR A;  7ICR A;  2P35 A;  4WC6 A;  1K1S A;  3QNM A;  5KFJ A;  2ZJ8 A;  3AMZ A;  1HJP A;  2F76 X;  4F2R A;  4FZL A;  5KFZ A;  1ARO P;  2AHO B;  4KIT B;  3Q8S B;  4B9U A;  4RQ1 A;  2DR8 A;  3MBY A;  7ICJ A;  3ZDB A;  2W43 A;  2I5H A;  2R8J A;  2GH1 A;  2Y1I A;  5J2F A;  2WF5 A;  2I9G A;  4KMO B;  4O3O A;  2YML A;  1L3S A;  3PX0 A;  1TVA A;  3TFR A;  4X4V A;  2P6R A;  2EAP A;  9ICE A;  2ATL A;  3AU6 A;  1NZB A;  1KBU A;  1D9D A;  2RLT A;  4GLX A;  2FI1 A;  4EGW A;  3RRH A;  8ICO A;  4F8R A;  4EEK A;  2DQN B;  1JX4 A;  7ICL A;  5HRD A;  2C2D A;  4RQ2 A;  1BVS A;  4ECX A;  2EWR A;  2ISO A;  4K99 A;  3M8S A;  1V4A A;  2K89 A;  3SYZ A;  1BPZ A;  5J0U A;  3LK9 A;  2RRD A;  2W9C A;  2IHO A;  5JRT A;  1PVP A;  3A0H U;  3HW8 A;  4F4Y A;  4B9S A;  3QXG A;  4AT9 A;  4C4R A;  2GWS A;  4O3P A;  3MDA A;  3OSP A;  3SEN A;  2EAO A;  2R8G A;  4P0P A;  3M8R A;  2BCU A;  5AKZ A;  4DSL A;  5HR6 A;  5B66 U;  4ATB B;  5CHE A;  1UQV A;  5EE0 A;  2JH7 A;  4QZB A;  5ALU A;  3BS5 A;  4JLZ A;  2ZUC A;  1ZQQ A;  5AI6 A;  1X9W A;  9ICQ A;  4LEY A;  1NZP A;  4O67 A;  4CDG A;  5KTQ A;  4MF8 A;  1WG8 A;  1JXE A;  5HHH A;  2MUT B;  1Y88 A;  4TUQ A;  4R8U B;  4AT7 A;  4F5O A;  4YVZ A;  4CF4 A;  2B6G A;  4X4R A;  2DRA A;  1XO0 A;  1XS9 D;  3H39 A;  1F5S A;  5D63 A;  4RT3 A;  4CF5 A;  3OVS A;  4KLD A;  2E8M A;  5KT5 A;  1RDF A;  4YQW A;  5HR7 A;  3M9M B;  2I1Q A;  1ZQC A;  5HRI A;  1WWU A;  4Y2S A;  4Q45 A;  5KFP A;  3QU5 A;  1ZQF A;  2OXO A;  5IIJ A;  4F92 B;  7ICO A;  1SKS A;  2YB1 A;  3QUC A;  1D8B A;  5KG6 A;  2HW3 A;  1KQQ A;  2XID A;  2F77 X;  3RF9 A;  3DEE A;  2ZH7 A;  2HOQ A;  3Q8M A;  3C5G A;  3OV7 A;  2LI6 A;  1JI7 A;  7ICH A;  3L9D A;  3C2K A;  4NLZ A;  3E2E A;  3PML A;  2RFF A;  1L7P A;  4K4G A;  5A0L A;  3JPT A;  4FHY A;  2ZIX A;  1P7D A;  5ALM A;  3ZI4 A;  1YZ7 A;  4R64 A;  1A77 A;  4I2H A;  2M0N A;  2MRL A;  5KFK A;  4X4O A;  1ZD4 A;  5J29 A;  5KFQ A;  2ZH3 A;  2NO5 A;  5KFT A;  4DOA A;  4PGQ A;  2I6X A;  2V9W A;  4CF3 A;  2IOF A;  2XI9 A;  2QLT A;  4MFC A;  3RB4 A;  3EYZ A;  5CP2 A;  2W9B A;  8ICR A;  2O5A A;  4DEZ A;  4RT2 A;  2QAR B;  2ZIW B;  2GAF D;  2AH5 A;  5TZV A;  3LWL A;  5CB1 A;  2JH1 A;  1YZ6 A;  4O3N A;  4AYB F;  1ZQ1 C;  5ALW A;  2GO7 A;  1U48 A;  1NK0 A;  5J2B A;  4J9N A;  4TQR A;  5KT6 A;  5KT3 A;  1ZQM A;  3H4B A;  4Y2T A;  4I2I A;  1L3V A;  2YY6 A;  1R8C A;  3VC8 A;  1CUK A;  1T94 A;  3MR6 A;  2V4Q A;  1OU5 A;  4MEX A;  5KL8 B;  2K4H A;  2W9A A;  3RTV A;  3SMV A;  4F3O A;  8ICY A;  5AKX A;  2BE3 A;  2PMZ C;  3CYM A;  2KNJ A;  1XSP A;  4YXJ A;  3F53 A;  5KFY A;  2RHF A;  2KJ9 A;  4WC2 A;  4RUA A;  3JZ0 A;  2O6K A;  3HX0 A;  8ICJ A;  2ZH4 A;  4KLF A;  3SAG A;  2KZZ A;  4WQL A;  9ICM A;  5AM1 A;  3RJI A;  2ALZ A;  1ZQW A;  1S77 D;  5KG7 A;  2A1J A;  4K96 A;  3K7D A;  4UB1 A;  3PSI A;  2HI0 A;  4OD0 A;  4RNN A;  2LYH A;  3WFQ E;  4F93 B;  1XO1 A;  3C28 A;  3LYS A;  3ED5 A;  3E0F A;  5HML A;  3NAS A;  2FLL A;  4M5D A;  4EP7 A;  4O5C A;  4GIB A;  3BQ0 A;  4Q44 A;  2QKQ A;  1X9M A;  4IRD A;  3UQ0 A;  2FLP A;  5EE3 A;  2BQ3 A;  1A0P A;  2KSO A;  8ICL A;  3TAN A;  4AT8 B;  5AIB A;  3KFU F;  1L8O A;  4C4S A;  2ES6 A;  2W54 A;  2ZIU A;  3T5L A;  4PGY A;  3N7S C;  2ID1 A;  2KVS A;  9ICU A;  2OM6 A;  3GV8 B;  2B56 A;  1SIJ A;  2KIV A;  2EZY A;  3AQK A;  1XWL A;  2F1J A;  1ZQK A;  4WC0 A;  4GC7 A;  5HRG A;  4DOC A;  3AUO A;  1ZQP A;  3HJE A;  4QW9 A;  2BHN A;  2Y9T A;  2EZZ A;  2BPC A;  4C8N A;  3K1Z A;  4UB4 A;  4USA A;  4Z6C A;  3MDC A;  3D2Q A;  2EH9 A;  2BPG A;  2FDR A;  1MQ2 A;  4KTQ A;  2KFZ A;  2BQU A;  4PHD A;  3WK7 A;  2BKE A;  3TAR A;  1L7M A;  4EBD A;  1XC9 A;  5KFH A;  1XNS A;  1K1Q A;  2AJQ A;  2ZHB A;  1HIW A;  2J6S A;  3RJE A;  2MU2 A;  4I2D A;  2D3D A;  5BOM A;  3ALR A;  2ZG6 A;  1S76 D;  5KG4 A;  2K8A A;  1KN5 A;  1TK5 A;  3FAH A;  4QZA A;  2RDI A;  4C7Z A;  2VKQ A;  3ZDE A;  1SB3 C;  2XIC A;  2C2E A;  4QZD A;  2BR0 A;  3H0L B;  9ICX A;  1IXR A;  1ZQT A;  2KHV A;  2Y9U A;  3H4D A;  2B4V A;  5EWF A;  4DSJ A;  2BBJ A;  1UPH A;  1S0N A;  9ICJ A;  3TI0 A;  4QZI A;  3ICX A;  4FHP A;  2KKP A;  3C66 A;  1DK3 A;  2C22 A;  2EAM A;  1U4B A;  9ICR A;  2PFN A;  4M9L A;  5AI0 A;  4EBJ A;  4EBE A;  3RB0 A;  4E0D A;  2DWQ A;  3IN5 A;  1NK4 A;  3WK6 A;  3ISC A;  3PW2 A;  4RQ3 A;  3WU2 U;  4EZ6 A;  3PO5 A;  1RXV A;  4AT9 B;  3GIM A;  1ZD3 A;  4FHW A;  4PJ0 U;  3PW4 A;  3NVZ A;  3J81 j;  3KKA C;  3AM9 A;  4EEL A;  3UM9 A;  3HJ4 A;  1BNO A;  8ICB A;  5ALE A;  5KFV A;  4FS1 A;  2MSN A;  5EOZ A;  2B0C A;  2JZB A;  2MAX A;  1PK3 A;  4X4S A;  1U9L A;  2HN2 A;  3C18 A;  4QZF A;  1VJ5 A;  4KLM A;  1PUZ A;  5C0Y A;  1N63 A;  4FE3 A;  1LKY A;  2KK0 A;  2AGP A;  2HVH A;  1N60 A;  4O3Q A;  1OXJ A;  2DFL A;  4YD1 A;  2R18 A;  2ESE A;  4UD5 A;  4EEY A;  2BDU A;  1TE2 A;  5J8Y A;  1SXE A;  5HHI A;  4DL4 A;  3L4P A;  4M6W A;  4DF4 A;  4ECS A;  4NL9 C;  4LT6 A;  3NVY A;  1COK A;  9ICS A;  2ZH2 A;  1WOT A;  1CRX A;  2HHW A;  3G6Y A;  4QWC A;  1B22 A;  3F2C A;  1ZJM A;  1Q8K A;  4US9 A;  4RNO A;  4RPZ A;  3UXP A;  1X9S A;  4DSE A;  2DKZ A;  2BBH A;  5AKL A;  4C8L A;  4O6A A;  3OJS A;  4F4K A;  4EV6 A;  4BUG A;  1QSY A;  5DQG A;  5D61 A;  3WFP A;  2XGP A;  2XC9 A;  2K4E A;  4A8E A;  2AQ0 A;  1ZXI A;  4NY8 A;  4KLG A;  2YN4 A;  3QEA Z;  2ZTD A;  2ZIX B;  5FP0 A;  5HC9 A;  3HKZ F;  2DR9 A;  2JR5 A;  1ZQY A;  1TFY A;  1PZN A;  3OUY A;  1NO5 A;  4MF2 A;  4X4P A;  3NKU A;  4UAU A;  5AIA A;  5KG3 A;  5KL1 B;  3EUB 2;  3RJF A;  3RJG A;  4IR9 A;  5ALY A;  3UMC A;  8ICS A;  3SV4 A;  1O08 A;  4PL2 A;  1SXD A;  1PK1 B;  2Y0S F;  1X9X A;  4OJO A;  2PFO A;  5HNK A;  4O3M A;  4MHV A;  5ALN A;  5C5J A;  1T4G A;  2B51 A;  2YB4 A;  8ICT A;  4GFJ A;  3H38 A;  1X6I A;  2KZ3 A;  4JK1 A;  3SQI A;  4HAI A;  3OSN A;  2F2A B;  5HRE A;  9ICK A;  2UVV A;  2W9B B;  3RJJ A;  1RYS A;  3F2B A;  1GO3 F;  1OW5 A;  2GLE A;  3V6K A;  7ICT A;  1MN8 A;  3M6Z A;  3OGU A;  4TQS A;  3EWA A;  4G9B A;  1D8Y A;  1J2N A;  1S0O A;  2Q4T A;  5KT2 A;  3IDW A;  1NJX A;  4DSI A;  2GA9 D;  5F9N A;  1HUO A;  5GTH U;  1J2M A;  4LEZ A;  5G5H A;  4MFA A;  4QIW F;  3QEB Z;  1F0M A;  3A0B U;  2W04 A;  3WKB A;  3EPI A;  2NRW A;  4UB2 A;  4F50 A;  4Q8F A;  5DB6 A;  9ICG A;  5L1J A;  2YX8 A;  1RQN A;  4DCC A;  1NK6 A;  2ASL A;  2IOH A;  4OO1 J;  5L1K A;  3KD3 A;  4PHA A;  2D8C A;  2NRT A;  1BPX A;  4QZH A;  2F1H A;  2YTU A;  1MIW A;  3JYY A;  4ECQ A;  4ZOH C;  4KX5 A;  3S6J A;  7ICK A;  2HVI A;  3I76 A;  4NXX A;  2M2T A;  4QWA A;  4NLN A;  2HN1 A;  2ZUD A;  1ZQL A;  4KLQ A;  4PHP A;  8ICM A;  8ICX A;  4GC6 A;  3QUQ A;  4M9N A;  4RPX A;  5KFX A;  3I1Y A;  2WF7 A;  3KHR A;  2FPK A;  4OJL A;  2E8P A;  3PX4 A;  3HKZ C;  4NXT A;  4YMN A;  1XSL A;  4Y2X A;  4CE6 A;  4QZE A;  4Z6E A;  2WAQ C;  3NRW A;  3KZX A;  2KSO B;  1ZQN A;  1S5L U;  1KEJ A;  5DDY A;  2ZH9 A;  4K97 A;  1FIQ A;  3HP6 A;  1DGS A;  2XO7 A;  5J2C A;  4PHE A;  4AP9 A;  3RFA A;  4US8 A;  2ZH8 A;  3KTQ A;  4RPY A;  5J2A A;  4IR1 A;  4RQ0 A;  1JRP A;  2JMG A;  3C2M A;  1H38 A;  1SZP A;  2G09 A;  4WC5 A;  1QQ6 A;  2QB0 A;  5KT4 A;  2BZF A;  1QCK A;  4EYH B;  3C5F A;  4NV0 A;  1T7P A;  5J0W A;  3ER9 B;  2G0A A;  3PSF A;  5L1M A;  5J0R A;  3UXO A;  3IM1 A;  4DS4 A;  3QZ7 A;  2JHD A;  1CI4 A;  1ZQH A;  2AGO A;  4J9L A;  4X4U A;  4DLE A;  5AKJ A;  1N2X A;  3JPR A;  1L6N A;  4UAW A;  4WQK A;  2GOL A;  3H7I A;  3KZI U;  5F3X B;  4K8V A;  3QU9 A;  3ZD9 A;  2VIX A;  4RNM A;  2A3V A;  2DPJ A;  1MC8 A;  4PZN A;  1RM6 C;  3AEV A;  5KFS A;  4QJF B;  3H0M B;  4J9S A;  3IG5 A;  3PZP A;  8ICA A;  1X40 A;  4DFD A;  1Z1B A;  3JPP A;  2VA2 A;  4E8F A;  1UEU A;  4QZG A;  1NI3 A;  1ZET A;  5KT7 A;  1NNL A;  3GDX A;  2NYV A;  2JRZ A;  4ECR A;  2IMW P;  4F91 B;  4YMM A;  4OAG A;  1U47 A;  4P0Q A;  3WKE A;  2YQE A;  4ELV A;  9ICN A;  2WF8 A;  3BZK A;  9ICP A;  4NJ8 A;  2BGW A;  4OAH A;  7ICP A;  4J9R A;  2H3V A;  3FC4 A;  4HX0 A;  3V7L A;  2P66 A;  2FLN A;  5J2I A;  4ZH4 A;  8ICI A;  4PPX A;  3T5J A;  1JUD A;  4P4M A;  4ELT A;  1DRG A;  2E1F A;  8ICZ A;  1UT8 A;  4K4H A;  3EZ5 A;  1DXS A;  2C28 A;  5AIC A;  4BGD A;  4J9Q A;  3RAQ A;  5ALQ A;  4C4T A;  4NKU A;  4UAT A;  3GV5 B;  3KHH A;  1NJW A;  3GIL A;  2DR7 A;  5AM4 A;  5KG0 A;  2HBK A;  3NUQ A;  5ALR A;  2KTQ A;  1NKE A;  3HPO A;  4I28 A;  3TKA A;  3QU4 A;  4I29 A;  5ALJ A;  5BPC A;  2WF9 A;  4DFJ A;  2HHX A;  4RQM A;  4RWP A;  5ALK A;  7ICF A;  5ALG A;  1X42 A;  4QW8 A;  5ALD A;  3PO4 A;  5DLG A;  1LKY B;  1WUD A;  1TK8 A;  4DQP A;  4ECU A;  3C1Z A;  3Q8P B;  5ALP A;  2F1I A;  3NVO A;  1L7N A;  3PMN A;  5AKE A;  4B9L A;  4NKT A;  2M2W A;  4M6W B;  8ICF A;  4WBY A;  4ED1 A;  2KN7 A;  5IIK A;  3CW2 C;  1R8A A;  1ZRM A;  1ZQR A;  1F5A A;  5J0Q A;  3ERC C;  3AQM A;  1SWV A;  1SV0 C;  1S9F A;  1Z1V A;  4BXO A;  1LV5 A;  4B9M A;  2LYB A;  5AI4 A;  4M9H A;  4GXJ A;  3MR5 A;  4F5R A;  2HHP A;  8ICV A;  4K98 A;  1RZT A;  3SI8 A;  4Q43 A;  2ZIV B;  2DVI A;  2HHQ A;  3ZDC A;  2IA6 A;  3V7J A;  3UPQ A;  2HSZ A;  4F4X A;  4I2C A;  3GIK A;  4FO6 A;  2WB1 F;  3ISB A;  3BZC A;  5KFW A;  4IG8 A;  2Q66 A;  2HOI A;  4LVS A;  5DBB A;  2HHS A;  1VFG A;  5KNI A;  1WCL A;  2CPR A;  3JCF A;  2P6U A;  8ICG A;  4I2E A;  2CRX A;  1TAU A;  2HHU A;  2PI5 A;  2LPE A;  3WFR E;  3OJU A;  3IHQ B;  2BCV A;  1QQ5 A;  3IRU A;  4UB8 U;  3NTU A;  8ICN A;  1IM4 A;  3E58 A;  2M9N A;  4IQW A;  1J97 A;  2OCE A;  5L1L A;  5AKY A;  1UA0 A;  3IG8 A;  1TKD A;  5IIM A;  3CNH A;  5HP4 A;  4KLO A;  3RAX A;  3UPS A;  2CXY A;  3N97 B;  3L5K A;  4WC3 A;  3H3A A;  4TUP A;  4M04 A;  9ICA A;  4KLL A;  1B0X A;  5J2D A;  4MFF A;  1RPL A;  4C8K A;  3M1Y A;  5KFD A;  4NXW A;  1TFR A;  4R63 A;  2H3Z A;  4DWI A;  1BPY A;  5AKH A;  3C23 A;  3QX7 A;  3R9K A;  5EE1 A;  2OH2 A;  5KFM A;  1QSS A;  2UVR A;  4AYB C;  1SL2 A;  1KDH A;  4KLH A;  5CJ7 A;  4RQ5 A;  4RU9 A;  1XSN A;  3WK4 A;  3MR2 A;  1QSL A;  4YMO A;  2WTF A;  1Q79 A;  4EED A;  3TAD C;  4J03 A;  4JV0 A;  5JTG A;  3KOO A;  5KFF A;  4ED7 A;  1O03 A;  2J6U A;  3CK6 A;  4DFK A;  4QWB A;  2FE9 A;  2DGZ A;  2IOF K;  5F9L A;  5DQI A;  3K1R B;  1MIV A;  3F2D A;  2AQ4 A;  4DL7 A;  2WHE A;  3GII A;  3C2L A;  1UHU A;  4G3I A;  5EE9 A;  1BPD A;  2R8I A;  7ICG A;  4F72 A;  3QYP A;  4YD2 A;  5D46 A;  1JAJ A;  2KFN A;  2OHF A;  5DED A;  4KN4 A;  5J2G A;  1IV8 A;  4F4W A;  4OJ5 A;  4Y2J A;  1T3N A;  2E8N A;  3ORY A;  4YFK A;  2MUT A;  4WOY A;  4WJ3 B;  2NRK A;  3GV7 B;  3V6J A;  4R8U A;  5JTI A;  5L1I A;  1BNP A;  1PX5 A;  1X66 A;  4Y2R A;  3RB6 A;  1FFU A;  1L7O A;  3RR8 A;  5DB9 A;  1KTQ A;  1ZQG A;  2M2U A;  1L3U A;  2W9C B;  2ZTE A;  3N7P D;  4JUZ A;  4WC4 A;  4IQU A;  5L9X A;  4C8M A;  2HBM A;  3DV9 A;  7ICV A;  2YMQ A;  4P0P B;  2AGQ A;  5ALV A;  2F8L A;  3ZD8 A;  1LVH A;  2BCQ A;  1L3T A;  2K4P A;  2G06 A;  3BJY A;  4J9P A;  3SAH A;  1SV4 A;  1KFD A;  2OYY A;  4HYK A;  2KKV A;  2H3I A;  3BS5 B;  4IQV A;  1GPJ A;  4EYI B;  1Z00 A;  4JWM A;  3D2N A;  1TAM A;  2VAN A;  4J9M A;  4FH5 A;  4XUS A;  2XCA A;  4DL6 A;  3PVX A;  1KFS A;  4QZ8 A;  4QWE A;  4OCZ A;  4K4I A;  3PNC A;  5III A;  4AT7 B;  2HHT A;  4BWM A;  3G6V A;  2B21 A;  3PV8 A;  2A1A A;  2KOB A;  4DSF A;  1RXW A;  1QLN A;  4EX7 A;  1JRO A;  4RUC A;  4UAY A;  1JMS A;  5HR9 A;  2JEI A;  9ICT A;  2G08 A;  4Y2Q A;  2K8C B;  4BJQ A;  4IRK A;  5EWG A;  3MGI A;  4NLG A;  4GXI A;  4ED2 A;  4OJ6 A;  4RQ6 A;  4FZN A;  3N7R C;  3V72 A;  5CRX A;  1QH9 A;  4I2A A;  4I2J A;  2K60 A;  4UB6 U;  3KBB A;  4UBC A;  3H40 A;  3RRG A;  2LM4 A;  4OAF A;  2ZIW A;  4ACO A;  2PBE A;  3ZDD A;  2XY5 A;  7ICU A;  2W7O A;  4KLJ A;  5HMM A;  5DEC A;  4PZO A;  3RBD A;  9ICW A;  3OTQ A;  3TAD A;  1UET A;  3MCR A;  2DRB A;  1ZQA A;  4QZC A;  2ZJA A;  2H5X A;  2O1P A;  3AQN A;  3SR6 A;  4RQ4 A;  4DLG A;  3IP4 B;  2F8K A;  5CHG A;  1ZD2 P;  4KLE A;  2NRZ A;  4UAZ A;  3OWG A;  1JAL A;  2ZJ5 A;  1XU4 A;  2A19 A;  3H8W A;  1QQ7 A;  3RR7 A;  4YG2 A;  9ICL A;  4CNQ A;  5AI8 A;  1NJY A;  4ICA A;  4UAS A;  2YMP A;  1A76 A;  3UMB A;  4I27 A;  4B9N A;  4JLX A;  1KRP A;  2F44 A;  1KFT A;  2KZM A;  2DF4 B;  3MAB A;  2E8O A;  2KIW A;  5HRB A;  4JV2 A;  2PFP A;  2V4R A;  4GXK A;  5KFC A;  3D6J A;  3RJH A;  2DL0 A;  5CWR A;  3RH4 A;  9ICF A;  5TIS U;  4X4Q A;  1U49 A;  4X4T A;  1Q78 A;  2ZHA A;  4XRH A;  4BXO B;  5DG9 A;  1ZQD A;  2E1E A;  4U7C A;  2JGA A;  5CEH A;  3V7K A;  3N28 A;  4AT8 A;  5J2H A;  5HRL A;  3VCB A;  3CRX A;  3KKA A;  5DBA A;  5AK4 A;  4KN7 A;  3PY8 A;  4EX6 A;  3QU7 A;  2L5Y A;  3HT3 A;  5KG2 A;  3C29 A;  5HRK A;  1ZQS A;  4KX3 A;  4M9J A;  2UVU A;  4ECZ A;  4UD4 A;  4YXM A;  1ZOL A;  2BQR A;  3B0X A;  5GTI U;  1ZJN A;  3ETR A;  4O68 A;  4F4Z A;  4CRX A;  4JMU A;  4RZR A;  5F2V O;  2KMD A;  3H8S A;  1U45 A;  4NXU A;  2A1J B;  2ZH6 A;  4EBC A;  5J0X A;  3SZ2 A;  4KLT A;  2G07 A;  2VA8 A;  1X2I A;  4I2B A;  3LQC B;  2K4I A;  4RQ7 A;  4NXZ A;  2N1R A;  5J0P A;  2W7P A;  5AK6 A;  4NL9 A;  4BDP A;  7ICI A;  1Z4O A;  4O5E A;  5AM5 A;  2JXJ A;  1VLB A;  3PHZ A;  1B43 A;  2HMX A;  1OUQ A;  1UCV A;  3IV6 A;  1R8B A;  2ZIU B;  1KNY A;  2VA3 A;  1D8L A;  4ECT A;  3TFS A;  2Y0S C;  3Q8L A;  3V6H A;  4WH5 A;  5AM0 A;  1WWV A;  4ED8 A;  1ZD5 A;  5IIL A;  2CN1 A;  5J0O A;  2EZX A;  5ALH A;  1MA7 A;  2FMQ A;  4JV1 A;  9ICO A;  4IQT A;  2FMS A;  3NRZ A;  1B4F A;  1ZQZ A;  5KFN A;  3RB3 A;  3GZF A;  1N5W A;  3AU2 A;  5DG7 A;  2PXI A;  5CFT A;  2W03 A;  4S3N A;  3LVW A;  4QWD A;  9ICV A;  1NKC A;  4C7Y A;  5KFU A;  1RG6 A;  1KLN A;  4FO1 A;  4RWO A;  4KLU A;  7ICM A;  3TAC B;  4P4P A;  3ZDA A;  5J2J A;  4QIW C;  3WK9 A;  3T5K A;  3HWT A;  1TK0 A;  1ZQO A;  5AM2 A;  5DB8 A;  2W9M A;  3H8M A;  1D9F A;  1WCN A;  2ODG A;  2KJ8 A;  1IG6 A;  1DGJ A;  1R89 A;  3EF2 A;  4KLS A;  1Z4N A;  4BX9 C;  2ASD A;  5HRF A;  9ICC A;  3OVB A;  5D49 A;  3PW7 A;  1MSW D;  3UMG A;  4FHV A;  5HRH A;  1KSP A;  3NYB A;  2OWO A;  4O3S A;  4YR3 A;  4XA5 A;  4LZG A;  3FDS A;  1AQ6 A;  1SKR A;  1RQL A;  5D4B A;  4F2S A;  4DS5 A;  4UQG A;  2RP5 A;  4YP3 A;  3T79 A;  5ALF A;  3LWM A;  4P2H A;  2XGQ A;  3HIL A;  2YMM A;  4ELU A;  2VJ4 A;  2FPM A;  5G5G A;  3JPN A;  2VJ5 A;  2PMZ F;  1NJZ A;  3NVW A;  3C21 A;  2ZH1 A;  2Z7J A;  3FM9 A;  4C0Z A;  3H0R B;  4YR0 A;  3AQE A;  2AU0 A;  4NM2 A;  2KE7 A;  2G5I B;  1N61 A;  3B0Y A;  1S0V A;  3BQ2 A;  4NLB A;  2KV2 A;  4DQR A;  4DSK A;  2JZB B;  4EEB A;  4FBU A;  3BS7 A;  3U26 A;  1ZQI A;  2LYA A;  3SV3 A;  4ED6 A;  2JEF A;  4DOB A;  4ED3 A;  2FCL A;  1Z00 B;  3F5A A;  4DF8 A;  3K4G A;  2XY7 A;  4M47 A;  3WFO A;  4OJP A;  1SL0 A;  2E3T A;  3MFI A;  4X5V A;  5ALT A;  1YT3 A;  2W55 A;  1COO A;  1UEV A;  1T3Q A;  1HUZ A;  1ZQJ A;  2HCF A;  2FMP A;  3AQL A;  5AM3 A;  4DFP A;  4PGX A;  4JWN A;  4O5K A;  1PVQ A;  1UT5 A;  2LBO A;  5J0Y A;  1PK1 A;  4K9A A;  2DBY A;  2FPL A;  2AXT U;  3HRD D;  2Q0Z X;  4RWQ A;  5KAF U;  2W8L A;  4QZ9 A;  1NK9 A;  2IUB A;  5KFR A;  4CCH A;  1ED1 A;  4JB3 A;  4RQ8 A;  1Z19 A;  4IS7 A;  3HIY A;  3BQ7 A;  3TAP A;  3OPX A;  2UVW A;  1ZQB A;  5D62 A;  1M6Y A;  2JEG A;  1K5O A;  4FS2 A;  5KFI A;  1WYG A;  1ZQE A;  4F5N A;  3GFK B;  5J2E A;  4LEV A;  4C8O A;  1YLQ A;  3OUY B;  1TV9 A;  2ZUB A;  5ALZ A;  5JU5 A;  4NLC A;  4F5Q A;  3I28 A;  4F5P A;  3UQ2 A;  1N56 A;  3SD7 A;  1SKW A;  4FHX A;  3Q8K A;  1BGX T;  1V85 A;  4DL5 A;  2LKY A;  4QNL A;  1EXN A;  2HDO A;  1S8O A;  4IC9 A;  3PX6 A;  2BCS A;  5CR0 A;  2DUY A;  4OAI Z;  1CEZ A;  1Z3E B;  3N4M B;  2F3N A;  5H2F U;  2EQY A;  3EW9 A;  5B5E U;  2KD1 A;  3KHG A;  3OHA A;  4KB6 A;  4NWI A;  1RYR A;  8ICH A;  2KP7 A;  1N5X A;  5B3P A;  9ICB A;  2HHV A;  5KFB A;  4U6P A;  2ASJ A;  3PSP A;  2KHQ A;  4ECV A;  4X0A A;  2NV3 A;  3WKD A;  5DBC A;  3WKA A;  1V9P A;  2IHN A;  1SWW A;  3KHL A;  2LHT A;  2DKX A;  4PH5 A;  4Q8E A;  3RH6 A;  5DG8 A;  1PVR A;  1S10 A;  2WFA A;  2HBL A;  5J8Y C;  2K8B B;  3QE9 Y;  5AKI A;  7ICE A;  4E7X A; 
#chains in the Genus database with same CATH homology
 4NLN A;  4WC1 A;  5HR9 A;  2JEI A;  7ICH A;  9ICT A;  2ZUD A;  1ZQL A;  4KLQ A;  4PHP A;  8ICM A;  8ICX A;  2W8K A;  3C2K A;  4IRK A;  4XQ8 A;  5EWG A;  3MGI A;  3PML A;  4GXI A;  4GC6 A;  4ED2 A;  4K4G A;  4NLG A;  4M9N A;  4RQ6 A;  2RFF A;  4RPX A;  3JPT A;  1LB2 B;  5KFX A;  3V72 A;  4FHY A;  3KHR A;  1UA1 A;  4I2A A;  5DLF A;  1DK2 A;  4I2J A;  1NK7 A;  3MGH A;  2FPK A;  3PX4 A;  4UBC A;  1NK5 A;  3H40 A;  4YMN A;  1XSL A;  3RRG A;  4QZE A;  4Z6E A;  3OHB A;  4R64 A;  1VJ7 A;  1A77 A;  4I2H A;  2PBE A;  3ZDD A;  1ZQN A;  2XY5 A;  5KFK A;  1NOM A;  7ICU A;  2R8K A;  4KLJ A;  1KEJ A;  4X4O A;  5DDY A;  5HMM A;  5J29 A;  5DEC A;  5KFQ A;  3THV A;  5KFT A;  4M9G A;  2ZH9 A;  3MFH A;  2ZH3 A;  3RBD A;  1JN3 A;  1T8E A;  2C2R A;  3HP6 A;  9ICW A;  4DOA A;  4PGQ A;  1UET A;  2DRB A;  2NRX A;  1DGS A;  5KFG A;  5KFE A;  1ZQA A;  4LZD A;  4ATB A;  2XO7 A;  4QZC A;  2ZJA A;  2H5X A;  5J2C A;  2V9W A;  4MEY A;  4MFC A;  1BPB A;  2O1P A;  4PHE A;  3RB4 A;  3EYZ A;  8ICW A;  2ZH8 A;  3KTQ A;  4RPY A;  4RQ4 A;  3AQN A;  3T3F A;  5CP2 A;  5J2A A;  4IR1 A;  2W9B A;  4RQ0 A;  3C2M A;  1H38 A;  8ICR A;  1FA0 A;  4DEZ A;  4RT2 A;  2O5A A;  1SZP A;  4DLG A;  1JQR A;  4WC5 A;  5CHG A;  4KLE A;  5KT4 A;  2NRZ A;  4UAZ A;  4EYH B;  3C5F A;  4R65 A;  1ZYQ A;  1JXL A;  5J0W A;  1T7P A;  5TZV A;  3LWL A;  2ZJ5 A;  1XU4 A;  3H8W A;  4O3N A;  5CB1 A;  3RR7 A;  4YG2 A;  5J0R A;  1U48 A;  9ICL A;  3UXO A;  3IM1 A;  4E80 A;  4DS4 A;  3QZ7 A;  1NK0 A;  5J2B A;  4J9N A;  4TQR A;  5KT6 A;  5KT3 A;  2AGO A;  1NJY A;  1ZQM A;  1ZQH A;  3H4B A;  4J9L A;  4X4U A;  4DLE A;  1A76 A;  1ZQU A;  3JPR A;  4DO9 A;  1C7Y A;  8ICU A;  4I2I A;  1L3V A;  2BPF A;  5IIO A;  4B9N A;  4I27 A;  1KRP A;  4UAW A;  1JIH A;  1R8C A;  1ZQV A;  3H7I A;  2J6T A;  1KFT A;  2KZM A;  9ICH A;  5JUM A;  3ZD9 A;  1CUK A;  4RNM A;  3MR6 A;  2V4Q A;  3MAB A;  3TAQ A;  2PI4 A;  4MEX A;  2DPJ A;  1OU5 A;  1MC8 A;  3TQ1 A;  2W9A A;  5HRB A;  4XQ7 A;  4UBB A;  3RTV A;  5DDM A;  4F3O A;  5KFS A;  4JV2 A;  2PFP A;  8ICY A;  4DL3 A;  2ISP A;  4J9S A;  2V4R A;  2BE3 A;  4GXK A;  5KFC A;  3RJH A;  8ICA A;  3QZ8 A;  5CWR A;  3RH4 A;  4YXJ A;  1XSP A;  3JPP A;  5KFY A;  2VA2 A;  4E8F A;  1UEU A;  9ICF A;  4QZG A;  1ZET A;  5KT7 A;  4YN4 A;  4X4Q A;  3GDX A;  1U49 A;  3GQC A;  5KFL A;  4M0A A;  4WC2 A;  1ZQX A;  4YCX A;  4RUA A;  4NM1 A;  3JZ0 A;  4X4T A;  1Q78 A;  3HX0 A;  2ZHA A;  4ECR A;  4XRH A;  2IMW P;  8ICJ A;  4F91 B;  4KLF A;  4BXO B;  4O9M A;  4YMM A;  2ZH4 A;  5DG9 A;  1U47 A;  1MIY A;  3PW0 A;  2KZZ A;  3LDA A;  4ELV A;  9ICN A;  9ICM A;  3Q8R B;  3RJI A;  5J0S A;  1ZQD A;  4NLK A;  2BGW A;  2ALZ A;  1ZQW A;  9ICP A;  3MR3 A;  1S77 D;  3V7K A;  4AT8 A;  5KG7 A;  2A1J A;  2BDP A;  5J2H A;  7ICP A;  4J9R A;  1S97 A;  4UB1 A;  5HRL A;  8ICC A;  5DBA A;  3V7L A;  2P66 A;  4RNN A;  2LYH A;  4KN7 A;  2FLN A;  5J2I A;  3RH5 A;  3PY8 A;  3HT3 A;  4M2Y A;  3WFQ E;  4ZH4 A;  8ICI A;  5CA7 A;  4PPX A;  3T5J A;  4F93 B;  3ETL A;  5KG2 A;  4P4M A;  3Q8Q B;  4ECW A;  4ELT A;  1XO1 A;  5HRK A;  4X4N A;  1ZQS A;  1QTM A;  8ICZ A;  4M9J A;  5DQH A;  2UVU A;  5HML A;  5IIN A;  4ECZ A;  1UT8 A;  5EWE A;  5KFO A;  4K4H A;  4YXM A;  2FLL A;  4UD4 A;  2BQR A;  4M5D A;  4EP7 A;  4O5C A;  3EZ5 A;  3B0X A;  1ZJN A;  4Z6D A;  3JPO A;  3BQ0 A;  4F4Z A;  4Q44 A;  1X9M A;  4UB3 A;  4J9O A;  4RZR A;  3UQ0 A;  2FLP A;  4IRD A;  8ICE A;  4R66 A;  2BQ3 A;  5F2V O;  3H8S A;  2C28 A;  8ICL A;  3TAN A;  1U45 A;  4AT8 B;  4BWJ A;  2A1J B;  4BGD A;  4J9Q A;  3RAQ A;  2IHM A;  4RWN A;  2ZH6 A;  4NKU A;  4EBC A;  3JPQ A;  5J0X A;  3GV5 B;  3KHH A;  1NJW A;  3GIL A;  3SZ2 A;  3T5L A;  2DR7 A;  4PGY A;  5KG0 A;  4KLT A;  3L9D A;  2KTQ A;  1NKE A;  2VA8 A;  3HPO A;  4B9V A;  4I28 A;  1X2I A;  4I2B A;  3E2E A;  2NRV A;  2ID1 A;  9ICU A;  4Z6F A;  4I29 A;  3LQC B;  5BPC A;  4RQ7 A;  4NXZ A;  3GV8 B;  4DFJ A;  3K75 D;  2HHX A;  3GIJ A;  3M9N B;  1DOQ A;  5J0P A;  4RWP A;  2RDJ A;  4BDP A;  4X0B A;  7ICF A;  7ICI A;  2Y1J A;  4WBZ A;  5J2K A;  4O5E A;  4KMU A;  3AQK A;  1XWL A;  1L5U A;  8ICP A;  4QW8 A;  1N48 A;  2F1J A;  1B43 A;  3JPS A;  1ZQK A;  7ICN A;  4WC0 A;  3BQT A;  4GC7 A;  5KFA A;  4ECY A;  4DOC A;  3NGD A;  3PO4 A;  5DLG A;  3AUO A;  1ZQP A;  2DPI A;  5HRG A;  4QW9 A;  2BHN A;  1R8B A;  5J0T A;  3OV7 A;  1KNY A;  2BPC A;  3BQ1 A;  1TK8 A;  2VA3 A;  4C8N A;  1D8L A;  3PR4 A;  4ECU A;  4DQP A;  3C1Z A;  4ECT A;  3Q8P B;  4UB4 A;  3TFS A;  4Z6C A;  3MDC A;  2F1I A;  4UB5 A;  4TUS A;  2BPG A;  3Q8L A;  3V6H A;  7ICQ A;  2BCR A;  1MQ2 A;  4KTQ A;  2KFZ A;  3PMN A;  4ED8 A;  5IIL A;  2IBK A;  4WCW A;  5J0O A;  4B9T A;  2BQU A;  4PHD A;  4B9L A;  4NKT A;  2M2W A;  3T5H A;  2BKE A;  3C1Y A;  2FMQ A;  4JV1 A;  3TAR A;  9ICO A;  4IQT A;  4M6W B;  4EBD A;  1XC9 A;  5KFH A;  2FMS A;  1K1Q A;  2AJQ A;  4J9K A;  2ZHB A;  8ICF A;  2PFQ A;  1ZQZ A;  4DFM A;  5KFN A;  4ED1 A;  3RB3 A;  2KN7 A;  2J6S A;  4I2G A;  5IIK A;  3RJE A;  4WBY A;  4I2D A;  5BOM A;  3AU2 A;  1R8A A;  5DG7 A;  2PXI A;  1ZQR A;  1S76 D;  1F5A A;  1NK8 A;  2JEJ A;  5KG4 A;  5J0Q A;  2ZTC A;  3PW5 A;  4O3R A;  5KG1 A;  3AQM A;  1TK5 A;  3HJ1 A;  4S3N A;  4QZA A;  2RDI A;  3UXN A;  4QWD A;  1S9F A;  9ICV A;  1NKC A;  4BXO A;  1LV5 A;  2DR5 A;  5KFU A;  1KLN A;  4RWO A;  3WFS C;  3ZDE A;  4B9M A;  4KLU A;  7ICM A;  2C2E A;  4QZD A;  4M9H A;  3G6X A;  4GXJ A;  3MR5 A;  4F5R A;  2BR0 A;  9ICX A;  4P4P A;  3ZDA A;  2HHP A;  1IXR A;  4DQQ A;  5J2J A;  1ZQT A;  8ICV A;  4WC7 A;  1MQ3 A;  1RZT A;  2ZH5 A;  3T5K A;  4EZ9 A;  3HWT A;  3H8J A;  3H4D A;  5EWF A;  4O0I A;  1TK0 A;  3BDP A;  4DSJ A;  1ZQO A;  3SI8 A;  4Q43 A;  5DB8 A;  2W9M A;  1D9F A;  1WCN A;  1S0N A;  3TI0 A;  4QZI A;  9ICJ A;  2HHQ A;  4FHP A;  2DVI A;  3ZDC A;  1DK3 A;  2IA6 A;  3C66 A;  3V7J A;  2XCP A;  2C22 A;  1R89 A;  3UPQ A;  4YR2 A;  1U4B A;  1TAQ A;  4KLS A;  4DL2 A;  2ASD A;  4F4X A;  4I2C A;  3GIK A;  4FO6 A;  4I2F A;  5DKW A;  2PFN A;  4M9L A;  9ICR A;  3ISB A;  5HRF A;  9ICC A;  4EBJ A;  3OVB A;  5KFW A;  1BPE A;  3RJK A;  5D49 A;  2XY6 A;  4KLI A;  3PW7 A;  4FH3 A;  4EBE A;  7ICS A;  5BOL A;  4IG8 A;  5KG5 A;  3PR5 B;  3RB0 A;  4DQI A;  1MSW D;  5HRH A;  4E0D A;  1S0M A;  3ISD A;  1KSP A;  4FHV A;  2Q66 A;  4LVS A;  1NK4 A;  5DBB A;  2HHS A;  1VFG A;  1WCL A;  3ISC A;  2R8H A;  2OWO A;  3PW2 A;  4RQ3 A;  4O3S A;  2P6U A;  3NYB A;  4ED0 A;  8ICG A;  5DB7 A;  4YR3 A;  4I2E A;  4EZ6 A;  1TAU A;  4XA5 A;  3EPG A;  1RXV A;  3FDS A;  3PO5 A;  2PI5 A;  4LZG A;  2HHU A;  3GIM A;  4AT9 B;  3WFR E;  3OJU A;  1SKR A;  3IHQ B;  3H37 A;  2BCV A;  4FHW A;  4P4O A;  3PW4 A;  4FBT A;  3NTU A;  5D4B A;  4F2S A;  4DS5 A;  4NLZ A;  4UQG A;  8ICN A;  1IM4 A;  5DGA A;  3HJ4 A;  2M9N A;  4YP3 A;  4IQW A;  8ICB A;  8ICK A;  1BNO A;  4EBK A;  3LWM A;  4P2H A;  2XGQ A;  3M9O B;  5KFV A;  4DQS A;  4FS1 A;  4ELU A;  8ICQ A;  1SL1 A;  5EOZ A;  2JZB A;  5DGB A;  2FPM A;  5L1L A;  2MAX A;  3RBE A;  1UA0 A;  2M2V A;  4IRC A;  4X4S A;  3JPN A;  1U9L A;  1NKB A;  9ICI A;  3C18 A;  3FYH A;  5IIM A;  4QZF A;  1TKD A;  4TUR A;  5HP4 A;  4KLM A;  3RAX A;  1NJZ A;  4KLO A;  7ICR A;  4WC6 A;  1K1S A;  3UPS A;  3N97 B;  4WC3 A;  5KFJ A;  3C21 A;  2ZH1 A;  2ZJ8 A;  1HJP A;  3H3A A;  4YR0 A;  4TUP A;  2AU0 A;  2AGP A;  4M04 A;  2HVH A;  4NM2 A;  9ICA A;  4F2R A;  4O3Q A;  4KLL A;  2DFL A;  5J2D A;  4YD1 A;  1RPL A;  4MFF A;  4UD5 A;  4C8K A;  5KFZ A;  3B0Y A;  4EEY A;  1ARO P;  1S0V A;  5KFD A;  4KIT B;  3BQ2 A;  3Q8S B;  1TFR A;  4B9U A;  4RQ1 A;  4R63 A;  2DR8 A;  5HHI A;  4DQR A;  4DSK A;  4DL4 A;  1BPY A;  2JZB B;  4M6W A;  4DWI A;  4FBU A;  3MBY A;  4DF4 A;  3C23 A;  1ZQI A;  7ICJ A;  3ZDB A;  3SV3 A;  4ECS A;  4ED6 A;  2JEF A;  4DOB A;  2R8J A;  4ED3 A;  4LT6 A;  1Z00 B;  5KFM A;  1QSS A;  2Y1I A;  9ICS A;  2ZH2 A;  4DF8 A;  5J2F A;  1WOT A;  3K4G A;  2XY7 A;  4M47 A;  2HHW A;  3G6Y A;  4QWC A;  2I9G A;  2UVR A;  3WFO A;  1SL0 A;  1B22 A;  1SL2 A;  3MFI A;  4X5V A;  4O3O A;  1KDH A;  1ZJM A;  1L3S A;  4KLH A;  5CJ7 A;  4RQ5 A;  4RU9 A;  3PX0 A;  1TVA A;  4RNO A;  3TFR A;  1XSN A;  4RPZ A;  4X4V A;  3UXP A;  1X9S A;  2P6R A;  4DSE A;  9ICE A;  3MR2 A;  2ATL A;  1QSL A;  3AU6 A;  4YMO A;  2WTF A;  1COO A;  4C8L A;  1Q79 A;  1HUZ A;  1D9D A;  1UEV A;  4JV0 A;  1ZQJ A;  3OJS A;  4GLX A;  5KFF A;  4ED7 A;  2FMP A;  2J6U A;  3AQL A;  4DFK A;  4QWB A;  4DFP A;  4PGX A;  4F4K A;  4JWN A;  5F9L A;  5DQI A;  1QSY A;  5DQG A;  4O5K A;  3WFP A;  1UT5 A;  3RRH A;  8ICO A;  5J0Y A;  1MIV A;  2XGP A;  2XC9 A;  4F8R A;  2AQ0 A;  4NY8 A;  2AQ4 A;  2FPL A;  1JX4 A;  4KLG A;  7ICL A;  5HRD A;  4DL7 A;  3GII A;  3C2L A;  3QEA Z;  2Q0Z X;  4RWQ A;  4G3I A;  2C2D A;  4RQ2 A;  1BPD A;  2W8L A;  2R8I A;  2ZTD A;  7ICG A;  5HC9 A;  4YD2 A;  4QZ9 A;  1BVS A;  5D46 A;  1NK9 A;  1JAJ A;  4ECX A;  2DR9 A;  1ZQY A;  2KFN A;  2ISO A;  1TFY A;  1PZN A;  5KFR A;  3M8S A;  4CCH A;  3OUY A;  1NO5 A;  1V4A A;  3SYZ A;  5DED A;  4RQ8 A;  4KN4 A;  5J2G A;  4MF2 A;  4X4P A;  1BPZ A;  5J0U A;  3LK9 A;  5KG3 A;  4F4W A;  2W9C A;  1T3N A;  3HIY A;  3HW8 A;  4F4Y A;  3RJF A;  4B9S A;  4AT9 A;  3TAP A;  3RJG A;  4IR9 A;  3ORY A;  2UVW A;  4YFK A;  8ICS A;  2GWS A;  2MUT A;  3SV4 A;  4O3P A;  1TFW A;  1ZQB A;  2NRK A;  3GV7 B;  3MDA A;  3V6J A;  4R8U A;  3OSP A;  2JEG A;  5L1I A;  2R8G A;  1BNP A;  3M8R A;  5HNK A;  2PFO A;  1PX5 A;  2BCU A;  4DSL A;  5C5J A;  4FS2 A;  1T4G A;  5KFI A;  3RB6 A;  4ATB B;  1ZQE A;  8ICT A;  4F5N A;  3H38 A;  3GFK B;  2KZ3 A;  5J2E A;  4JK1 A;  3OSN A;  4C8O A;  5HRE A;  9ICK A;  2UVV A;  1YLQ A;  3OUY B;  3RR8 A;  4QZB A;  2W9B B;  5DB9 A;  3RJJ A;  1KTQ A;  1TV9 A;  1RYS A;  2ZUB A;  2ZUC A;  1ZQQ A;  1ZQG A;  1L3U A;  2M2U A;  2W9C B;  3V6K A;  7ICT A;  4F5Q A;  1X9W A;  2ZTE A;  9ICQ A;  4JUZ A;  3OGU A;  4TQS A;  1NZP A;  3OVA A;  4WC4 A;  3EWA A;  1D8Y A;  5KTQ A;  4IQU A;  5L9X A;  4MF8 A;  4C8M A;  4F5P A;  1JXE A;  5HHH A;  3UQ2 A;  2MUT B;  1N56 A;  1Y88 A;  5KT2 A;  1S0O A;  1NJX A;  4DSI A;  7ICV A;  4TUQ A;  4R8U B;  4AT7 A;  5F9N A;  1SKW A;  4FHX A;  4F5O A;  3Q8K A;  1BGX T;  4DL5 A;  4YVZ A;  2AGQ A;  1HUO A;  1EXN A;  3ZD8 A;  4X4R A;  2BCQ A;  2DRA A;  3PX6 A;  1L3T A;  2BCS A;  5CR0 A;  4J9P A;  3BJY A;  1XS9 D;  3H39 A;  1CEZ A;  1KFD A;  1Z3E B;  4MFA A;  4RT3 A;  3N4M B;  3OVS A;  4KLD A;  4HYK A;  3EW9 A;  5KT5 A;  3KHG A;  4IQV A;  3OHA A;  3QEB Z;  4YQW A;  4EYI B;  1RYR A;  1Z00 A;  3M9M B;  2I1Q A;  4JWM A;  8ICH A;  2HHV A;  1ZQC A;  2VAN A;  9ICB A;  2KP7 A;  5HRI A;  5KFB A;  4J9M A;  4FH5 A;  4XUS A;  3EPI A;  2NRW A;  4Q45 A;  5KFP A;  4UB2 A;  2ASJ A;  1ZQF A;  2XCA A;  5IIJ A;  4F50 A;  4Q8F A;  4DL6 A;  3PVX A;  1KFS A;  5DB6 A;  4ECV A;  9ICG A;  4QZ8 A;  4F92 B;  4QWE A;  5L1J A;  4K4I A;  3PNC A;  4X0A A;  5III A;  4AT7 B;  5DBC A;  7ICO A;  1V9P A;  4BWM A;  1SKS A;  1NK6 A;  2IHN A;  3G6V A;  3KHL A;  2HHT A;  2ASL A;  4PH5 A;  4Q8E A;  5L1K A;  3RH6 A;  5KG6 A;  4PHA A;  5DG8 A;  2HW3 A;  2NRT A;  1S10 A;  1BPX A;  2B21 A;  3PV8 A;  1RXW A;  4QZH A;  4DSF A;  2F1H A;  1QLN A;  1MIW A;  3JYY A;  4ECQ A;  2ZH7 A;  4RUC A;  7ICK A;  3QE9 Y;  3Q8M A;  2HVI A;  3C5G A;  4UAY A;  1JMS A;  2M2T A;  4QWA A;  7ICE A;  4E7X A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...