4YMNA

Structure of human dna polymerase beta complexed with n7bg in the template base paired with incoming non-hydrolyzable ctp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural and kinetic studies of the effect of guanine-N7 alkylation and metal cofactors on DNA replication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 101
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ymnA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ymnA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ymnA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ymnA03
3OHAA 4MFFA 4TUSA 1S77D 1JXEA 3ZD8A 2WTFA 4DSJA 4I2BA 2XY5A 2GWSA 2XC9A 4O5CA 4I2GA 7ICGA 3N97B 4QZAA 4EBJA 1KFDA 1NK7A 1ZQAA 3EW9A 4DFJA 4G3IA 4C8MA 4O3QA 2Y1JA 5KFQA 3MR2A 1NKBA 3H37A 1QTMA 4K4IA 4J9KA 1AROP 1X9MA 3EWAA 5CA7A 5J0WA 4GLXA 1U4BA 1RZTA 1BPZA 2FMQA 3C66A 4JK1A 5F2VO 2FPMA 3H7IA 4F5QA 3QE9Y 4EBKA 4KLLA 2JZBA 4UD5A 5KFEA 1WCLA 5J2AA 1UT8A 5KFVA 4Q43A 4F4YA 2BGWA 3V72A 3IHQB 1U45A 1U48A 4UAWA 4ZH4A 4O3NA 3V6HA 3ZDDA 4MFCA 3HT3A 1K1SA 2FLPA 4J9NA 5J0YA 2ZUDA 2W9CB 2HHVA 1RYRA 4C8KA 1QSLA 4DL4A 3MABA 8ICXA 2KP7A 5KFRA 4FH3A 5HR9A 1S97A 3ZDEA 4RUCA 4LT6A 3PY8A 5HC9A 1UT5A 5DG7A 2VA2A 7ICRA 5CHGA 5DB7A 4YQWA 4WBYA 1DOQA 4I2FA 3GV8B 4X4OA 1QSYA 4M9NA 2DVIA 5DGBA 2FMPA 4EBCA 2FMSA 2R8GA 9ICLA 3H8SA 5DDMA 1T3NA 3LQCB 1ZETA 4RPYA 5KG6A 4FS2A 3UQ2A 4ATBB 4EYIB 5IIIA 2BCQA 3C1ZA 5DLFA 3N4MB 4AT8A 2JEIA 8ICFA 1B43A 3NTUA 3RBDA 5D4BA 1JN3A 3LK9A 4B9UA 4KLUA 4RWNA 5IINA 4E7XA 4RQ1A 4KN7A 4RNMA 2W9AA 4DOCA 4QZHA 3GIMA 5J2HA 1ZQOA 8ICKA 1X9WA 8ICGA 4QWEA 4FHYA 1TFYA 4JV1A 4RQ8A 5L1JA 4FH5A 2ZTEA 4KITB 3PNCA 4M6WB 5J2FA 3TFRA 4F2RA 4IQWA 3ETLA 2AJQA 4FHVA 4QZIA 4R65A 3RJKA 2HVIA 3WFQE 5KT6A 3EPIA 2Q66A 2W9MA 5DKWA 3H4BA 3WFRE 8ICRA 4KLTA 5J2EA 5DQHA 5KFSA 3MBYA 1EXNA 4DLGA 4ELVA 2VA8A 3GQCA 5IIMA 4YG2A 5KFMA 5KG3A 7ICJA 1NKCA 4RQ7A 8ICMA 1S10A 5HMMA 3JYYA 4PHAA 5J2CA 4DS5A 1KFSA 3JPSA 4WC7A 4UB5A 1ZQBA 5KFLA 4J9LA 4WC3A 2W8KA 2JEGA 1A76A 4RNNA 4Z6CA 5KFIA 3OGUA 2V9WA 5HREA 9ICOA 1BPBA 9ICKA 1SKWA 5KFPA 5KFCA 1MC8A 2ZTDA 4NXZA 2HVHA 4I28A 4MEXA 3H39A 1ZQLA 1ZQQA 4P4MA 3T5HA 4WC6A 2HHWA 7ICEA 4NKTA 3RAQA 2KZZA 1F5AA 3UXPA 3C18A 4DSIA 1UETA 4R8UA 4FBUA 3H38A 2A1JA 2BR0A 4FS1A 8ICOA 7ICQA 1R8CA 4UBBA 7ICLA 3OUYA 3FDSA 5DBAA 5KT4A 4XUSA 3H4DA 3EPGA 1SKRA 2UVWA 3PO4A 5HRHA 1CEZA 2KZMA 4I2JA 8ICJA 2NRVA 3RH4A 4B9LA 4ECSA 4DSFA 2BPGA 4F5NA 4DSLA 4X0BA 3KTQA 5J0RA 5D49A 5DBCA 2DR5A 4UB3A 3Q8QB 3TARA 5CJ7A 1NK9A 2MUTA 4KLOA 2HHSA 3G6VA 3C2MA 5KFUA 3RR7A 4GC7A 2P6RA 3ZDBA 4O3SA 2M2TA 3LWMA 4RT2A 1ZQTA 4FHPA 9ICCA 5KFFA 2ZJAA 2HHTA 2AGQA 4IRKA 3GFKB 1NK8A 1L3VA 5TZVA 4X0AA 1XS9D 5EOZA 2DRBA 5IIOA 4DL3A 4DOBA 1X2IA 5L1IA 4WC5A 3JPNA 1UA1A 3JPRA 3V7LA 5DB6A 1XO1A 8ICNA 4F4KA 2VANA 4XA5A 3NGDA 2W9BB 7ICUA 1UEUA 1ZQXA 5KFHA 3V7KA 5J0TA 5J2BA 5C5JA 3MGHA 3TAQA 1UA0A 1S0NA 2FPKA 4KLQA 2BQUA 2HHUA 4JV0A 4YXJA 3RRHA 4YMNA 2J6TA 2OWOA 9ICPA 9ICRA 1WOTA 5J0SA 3ISCA 4O3OA 4S3NA 1XWLA 1S9FA 1MQ3A 2HW3A 1NJXA 2NRKA 5KFTA 5F9LA 4DFPA 3JPOA 4DL2A 5DQIA 1XSNA 5IILA 1SL0A 4KLJA 2R8KA 4WBZA 1OU5A 5DLGA 5KFZA 4WC2A 2ZH5A 1KEJA 4QWBA 4ECUA 4Z6DA 5CR0A 4DQRA 3PX4A 4RPXA 3EYZA 2UVRA 1MQ2A 5HRBA 4QW9A 5KFWA 4NLKA 4M0AA 4KLDA 2Y1IA 1IXRA 1ZQYA 4YR3A 1ZQGA 4QWAA 1SL1A 1SKSA 1PZNA 2ASJA 3NYBA 1SZPA 5EWEA 3PMNA 1NOMA 3UXNA 3ZD9A 3Q8PB 1S0VA 1Z00A 3KHHA 2BKEA 5BPCA 2ZHAA 5KT5A 5L1LA 4GXKA 4ED8A 1HJPA 2AU0A 1NK5A 4RT3A 2M9NA 7ICFA 2ID1A 7ICKA 5KG0A 9ICVA 1LV5A 4RQ0A 3AU6A 3C1YA 4NY8A 5DQGA 4YD2A 3RB0A 3RJGA 4IR9A 2F1JA 1JIHA 2NRXA 2KTQA 4IR1A 4B9SA 4B9TA 3TAPA 4JWMA 3RH6A 7ICOA 3PX6A 3BQ1A 5J2JA 3BDPA 2XCAA 5J2KA 1JAJA 4X4QA 2BPFA 8ICWA 2XY6A 4PHEA 4ECWA 5DBBA 2ASDA 4YXMA 3SI8A 2I1QA 4IQVA 4RQ6A 2R8IA 4ECTA 4ED1A 5HRLA 4ELUA 4I2DA 4F50A 1ZQEA 3M9MB 4BWMA 5KG2A 4E8FA 3OUYB 4YFKA 3MFHA 2P66A 4RQ3A 1VJ7A 4I29A 4KMUA 4DLEA 9ICWA 3OJSA 1IM4A 4R64A 1MIWA 3BJYA 3E2EA 1NO5A 8ICAA 3M9OB 9ICEA 2M2WA 4ECRA 4J9QA 2KN7A 2V4RA 2PXIA 3PW4A 4EZ6A 1JX4A 4TUQA 3C5GA 4BDPA 4QZFA 3GIJA 4Q8FA 1T4GA 2BQ3A 1Q79A 1BGXT 4DFKA 4M9GA 4UAYA 3JPTA 3GILA 5J0OA 1BVSA 2P6UA 4RUAA 3QZ8A 3HX0A 1R8AA 3TI0A 1TV9A 4DEZA 2ZUCA 4I2IA 2BCUA 3ZDCA 5J0PA 3Q8MA 5KFAA 4DQPA 3AUOA 2M2UA 4BXOA 4F3OA 4UD4A 4C8LA 2J6UA 5J2GA 1TK5A 3OVAA 1BPDA 3C21A 2BQRA 3RJEA 5L9XA 4AT9B 4DL6A 2XCPA 3MR6A 4B9NA 3MDCA 3Q8LA 4EEYA 1KNYA 3UPQA 1Z3EB 4TQSA 2HHQA 3SV3A 8ICYA 1UEVA 3BQTA 5HP4A 5KG5A 4NM2A 4RQ4A 3Q8KA 3T5LA 3JZ0A 4WC0A 3OVSA 3PMLA 4DOAA 5J0QA 5DECA 4F4WA 2FPLA 4EYHB 4ECYA 3PVXA 4GXIA 1RPLA 4BXOB 4ECQA 4KLHA 9ICUA 3RJJA 4QZ9A 3G6YA 1TK0A 5HRFA 3TQ1A 1V4AA 1HUZA 1R8BA 4X5VA 2B21A 2IHNA 1BPYA 2C22A 4UAZA 5KFYA 1NKEA 1BNPA 2V4QA 1JMSA 2IBKA 4KLIA 4F2SA 4RNOA 1XU4A 2ISOA 3JPQA 8ICSA 4O5EA 8ICIA 2JZBB 2KFNA 9ICQA 2RFFA 4WC4A 5J0XA 2R8HA 4ECXA 1N48A 4X4NA 4F5OA 2XGPA 4YMOA 3UXOA 1Z00B 3H8WA 3Q8SB 3EZ5A 1XC9A 1HUOA 2BCSA 3HW8A 9ICBA 7ICVA 4R66A 2PI5A 4ATBA 4CCHA 2NRZA 4YR2A 4RQ5A 3GIKA 5HRGA 3GV7B 4LZGA 2PFOA 5HHHA 3K75D 5D46A 2F1HA 3MDAA 1TAUA 4UB1A 4ELTA 4E80A 3RAXA 5IIKA 1ZJNA 7ICSA 1MIYA 4FHXA 4M9LA 2PFPA 4Z6EA 2O5AA 1ZQSA 1U9LA 4QW8A 5DDYA 4YVZA 5CB1A 1TFWA 2HHPA 1YLQA 2ZJ5A 2M2VA 4M6WA 3RB3A 1ZQMA 4J9RA 4UB2A 3GV5B 5KG4A 1ZQRA 1BPEA 9ICMA 7ICPA 3AU2A 2KFZA 2ZH7A 4KLSA 2DR7A 4RPZA 3OJUA 3KHGA 3RBEA 5DB8A 5J0UA 3HP6A 2C2EA 5L1KA 1BPXA 5HMLA 1ZQIA 2IHMA 7ICHA 4AT8B 3PR4A 4X4VA 4P4OA 4B9VA 4WC1A 3ORYA 3MFIA 5KT7A 2DFLA 3C5FA 3PV8A 4X4PA 3OV7A 1Q78A 2ZH1A 2ATLA 2ZUBA 1L3SA 1RXWA 1MIVA 3QZ7A 2Q0ZX 4QWCA 4I2HA 9ICGA 1R89A 2O1PA 3UPSA 4DQSA 5HHIA 8ICZA 2NRWA 5KTQA 4PHDA 4DFMA 7ICTA 3C2LA 1D9FA 4X4TA 1ZQNA 4NM1A 1KFTA 3M9NB 9ICIA 1L3TA 4DSEA 1ZQKA 4MF2A 1NJZA 4IRCA 2AGOA 4O5KA 1KTQA 2BDPA 1D8LA 4P4PA 1QLNA 5HRIA 4Q8EA 5KFBA 4F93B 1NJWA 3MGIA 4YR0A 4M9HA 1NK0A 4P2HA 4UB4A 1L3UA 5KFKA 2JEFA 3T5JA 4PGXA 2XGQA 5DG9A 4DF8A 4QZCA 4TQRA 1ZJMA 4RQ2A 1N56A 3RJHA 4FBTA 4C8OA 3OSNA 3V6JA 4X4UA 8ICLA 4I2AA 4YP3A 3G6XA 1TVAA 4DS4A 4Q44A 1BNOA 3GIIA 4BGDA 3QEBZ 2ZJ8A 1U47A 2DRAA 2DPJA 3B0XA 3C2KA 3QEAZ 1ZQFA 2VA3A 4M2YA 4KLGA 1K1QA 1RYSA 1ZQDA 3RJFA 4XQ8A 4JWNA 2RDJA 4NLZA 2PBEA 3K4GA 4F5RA 1ZQVA 4MEYA 9ICHA 1TAQA 1V9PA 2DPIA 4K4GA 4XRHA 4R8UB 4AT7A 4F91B 4IG8A 4NKUA 2A1JB 2ZH2A 4MFAA 1XSLA 2BCRA 4IQTA 3SZ2A 3V6KA 4I27A 2AQ4A 4M5DA 1SL2A 5BOLA 5JUMA 4ED3A 4ED7A 2C28A 5KG7A 2KZ3A 4TUPA 3TANA 3MR3A 1JXLA 7ICMA 8ICEA 1PX5A 3T5KA 5KT3A 3H8JA 3HIYA 4EBDA 4M04A 4E0DA 1QSSA 1KSPA 1DGSA 3UQ0A 3H3AA 2XY7A 2FLNA 1X9SA 8ICVA 4JUZA 2W9BA 3WFOA 3HJ1A 2MUTB 1NK4A 1D9DA 4YCXA 2IA6A 4PH5A 9ICFA 1B22A 3OVBA 4DO9A 4Z6FA 3PR5B 5KFJA 4KN4A 1ZQWA 1JQRA 3C23A 4ED2A 2BCVA 3M8RA 4IQUA 2FLLA 1CUKA 1ZQZA 3RH5A 5J29A 4QZEA 3ISBA 3FYHA 2W8LA 2PI4A 1ZQHA 3TFSA 5EWGA 4F92B 4JV2A 2AQ0A 4QWDA 2XO7A 1C7YA 3RR8A 4EP7A 5IIJA 2BPCA 4M47A 3SV4A 4IRDA 4O3PA 3PX0A 5DG8A 4EZ9A 4QZ8A 2ZH8A 4O9MA 4KTQA 4EBEA 5BOMA 2R8JA 3LDAA 3AQLA 1RXVA 1LB2B 1COOA 7ICNA 4UQGA 5DEDA 5HRKA 9ICNA 3HWTA 8ICBA 4HYKA 9ICTA 3AQMA 4FO6A 3IM1A 5HNKA 1S0OA 8ICPA 4XQ7A 4X4SA 1VFGA 3WFPA 2H5XA 1ZQPA 2I9GA 3B0YA 3RJIA 3KHLA 1DK2A 1L5UA 4J9MA 1NZPA 5DB9A 4J9OA 3ISDA 4DL5A 3RB6A 1MSWD 4RWPA 8ICQA 2ASLA 3PO5A 3AQNA 1T7PA 2W9CA 4J9PA 2RDIA 4GXJA 4ED0A 4YMMA 4Q45A 3PW7A 4QZBA 4PHPA 4DWIA 9ICAA 4M9JA 4DSKA 4RZRA 2ALZA 4R63A 3OHBA 4DL7A 3PW0A 3PW5A 4LZDA 5KFDA 8ICUA 5KFXA 3LWLA 2ZH9A 2C2DA 3RTVA 2ZTCA 4TURA 3RRGA 2BHNA 4NLNA 4I2EA 9ICSA 4FHWA 4ED6A 4RU9A 1D8YA 2J6SA 4LVSA 1DK3A 2BE3A 2PFQA 4O3RA 3AQKA 4WCWA 2PFNA 2C2RA 2ISPA 3JPPA 3M8SA 3Q8RB 3H40A 1ZYQA 4YD1A 4I2CA 1KLNA 5DGAA 4PPXA 5KFNA 5J2IA 1TFRA 4UBCA 4BWJA 2DR8A 2ZH4A 4DF4A 1TKDA 4KLFA 4DQIA 7ICIA 4MF8A 4F8RA 4F5PA 1NK6A 1KRPA 2HHXA 3ZDAA 4K4HA 4X4RA 2UVVA 1A77A 5KFGA 2DR9A 2ZH6A 1Y88A 4YN4A 3PW2A 4ECZA 1WCNA 2MAXA 5F9NA 5J2DA 3MR5A 3HPOA 4ECVA 3BQ2A 2UVUA 4QZDA 4F4XA 1TK8A 2IMWP 4RWOA 1NJYA 9ICJA 5HRDA 4AT7B 4F4ZA 4DQQA 3OSPA 3BQ0A 3T3FA 2ZHBA 4O0IA 1XSPA 3RB4A 4C8NA 1T8EA 1S0MA 2LYHA 3THVA 4B9MA 8ICTA 1U49A 4NLGA 1ZQJA 2ZH3A 4RWQA 5CP2A 3KHRA 8ICHA 2NRTA 5KG1A 2JEJA 5CWRA 9ICXA 4PGQA 1ZQCA 5KFOA 1S76D 4KLMA 5KT2A 3SYZA 1KDHA 4KLEA 8ICCA 1H38A 2F1IA 4PGYA 1FA0A 1ZQUA 4GC6A 3GDXA 4QZGA 3V7JA 3HJ4A 3L9DA 4J9SA 4AT9A 3WFSC 2AGPA 5EWFA
chains in the Genus database with same CATH superfamily
4MFFA 4TUSA 1JXEA 4DSJA 3DDHA 2XY5A 4O5CA 7ICGA 1Q8KA 4NL9C 1KFDA 1ZQAA 4KM5A 2L5YA 4DFJA 4G3IA 1J2MA 2HBKA 4C8MA 1NKBA 1QTMA 4K4IA 1X9MA 1AROP 3ER8C 2YY6A 2JZBA 1UT8A 4F4YA 2F77X 3V72A 1X66A 4ZH4A 4O3NA 5KNIA 4UAWA 2FLPA 4WQLA 4AYBF 2W9CB 3MABA 4FH3A 2IOFK 4UB6U 4RUCA 3PHZA 5DG7A 2FE9A 1ZQ1C 4Y2QA 1X40A 1QSYA 5DGBA 2A19A 1N60A 4RPYA 2BCQA 3I76A 4KLUA 4K9AA 4DOCA 4QZHA 1ZQOA 8ICGA 4QWEA 5AK6A 1JRPA 4JV1A 5L1JA 2ZTEA 4IQWA 1WWUA 5J2FA 3RJKA 5H2FU 1B0XA 2W9MA 1PVPA 5J2EA 1SV0C 5DQHA 3MBYA 1EXNA 4DLGA 7ICJA 2VA8A 3JYYA 5KFMA 8ICMA 1NKCA 5HMMA 5J2CA 4WC7A 5KFLA 3H0RB 2JEGA 1A76A 3WK5A 5KAIU 1F5SA 3OGUA 3I1YA 2GOLA 5E79U 2HVHA 4I28A 1ZQLA 1VDVA 4XJEA 4NKTA 2KZZA 3UXPA 4DSIA 4FS1A 3KZXA 2W43A 5AM3A 7ICQA 1JUDA 2G5IB 3OUYA 3FDSA 3ICXA 2HSZA 5ALZA 4ECSA 2BPGA 3NRZA 4U6PA 3F53A 5D49A 2DR5A 1NK9A 2HHSA 3C2MA 2M2TA 3LWMA 1NK8A 5TZVA 4UASA 1XS9D 2G07A 2DRBA 5IIOA 1UA1A 1XO1A 5AKZA 7ICUA 1UEUA 3ER9B 5J0TA 1TE2A 3MGHA 1S0NA 2BQUA 2OWOA 2K60A 1XWLA 2NRKA 2VKQA 4DL2A 3JPOA 1KBUA 5DQIA 5IILA 2R8KA 1OU5A 5DLGA 5KFZA 2ZG6A 1KEJA 4ECUA 3EYZA 2UVRA 2KICA 5ALEA 3DEEA 4NLKA 4KLDA 1IXRA 2FI1A 3QUCA 1SKSA 5ALLA 3WK8A 1K5OA 3PMNA 1NOMA 2E1FA 1KW4A 1Z00A 3C28A 5L1LA 2AU0A 1HJPA 2EWRA 7ICFA 5KG0A 2KJ8A 3C1YA 4NY8A 4IR9A 2GA9D 2KTQA 1S8OA 1N62A 3PX6A 4OCZA 2KVSA 3K1ZA 2G0AA 2I1QA 4ECTA 5JTGA 4P0QB 3M9MB 5KG2A 3OUYB 2P66A 4I29A 2WF6A 9ICWA 5HR6A 4R64A 3NRWA 4NXUA 3OPXA 4Y2JA 1NO5A 2M2WA 1LKYA 1V97A 2E8NA 2EAMA 4KMOB 2BQ3A 4M9GA 1OW5A 3GILA 2B4VA 3HX0A 2ZUCA 1ECWA 4DQPA 3AUOA 2DWQA 2OM6A 2J6UA 5J2GA 1TK5A 4C8LA 3OVAA 1GPJA 3ERCC 1GO3F 3MR6A 1AQ6A 4K9BA 4EEYA 3UPQA 1Z3EB 4TQSA 1SIJA 2N1RA 4O3MA 3T5LA 3PMLA 3RF9A 3HILA 4EYHB 4ECYA 1FFUA 4GXIA 4UAZA 2V4QA 4F2SA 2XVTA 4RNOA 2ZIUA 8ICSA 4WC4A 9ICQA 2K4PA 4ECXA 2R8HA 5JU5A 2XGPA 4EV6A 1Z00B 2H3QA 3NVZA 3EZ5A 1XC9A 2NV3A 4R66A 3GIKA 5HRGA 5HHHA 5IIKA 1MIYA 2PFPA 4QW8A 5DDYA 4RQNA 4YVZA 1TFWA 3M6ZA 4UB2A 3GV5B 4J03A 5EE1A 7ICPA 2KFZA 4KLSA 4RPZA 3OJUA 3KHGA 5AKJA 2BBHA 4AT8B 2IHMA 5KT7A 3PV8A 3OV7A 2ZH1A 2ATLA 2ZUBA 5ALXA 1Q46A 4QWCA 4I2HA 5GTHU 3AMZA 4US9A 8ICZA 2NRWA 4X4TA 1D9FA 1ZQNA 4EGWA 1ZD2P 4DSEA 4PL2A 1NJZA 2AGOA 4P4PA 2ZIVA 1RM6C 4US8A 1NK0A 5KFKA 4DF8A 1ZJMA 1N56A 5AKLA 4QZCA 4RQ2A 2BZFA 3V6JA 2RQ5A 4X4UA 1TVAA 1BNOA 4K97A 1FFVA 3QEAZ 3UM9A 2VA3A 1XO0A 4M2YA 4WC1A 4NLZA 2YQEA 2RDJA 3K4GA 1ZQVA 9ICHA 2OHFA 4K4GA 4PJ0U 4I0UA 2YN4A 2KEYA 4IG8A 3CRXA 2A1JB 4MFAA 2LPEA 4OO1J 4IQTA 2A3VA 1SL2A 5BOLA 4Y2PA 3TANA 1PX5A 5ALUA 4OD0A 2ZIUB 2KG5A 3H3AA 2KIWA 2FLNA 2W9BA 2QB0B 2Y0SC 1JQRA 4FO1A 1Z1BA 4UARA 4LEVA 4QZEA 3ISBA 2W8LA 3TFSA 4JV2A 4F92B 2AQ0A 1C7YA 4M47A 4EZ9A 4WOYA 2VIXA 2R8JA 3LDAA 1RXVA 4X4VA 8ICBA 2GAFD 2EZXA 1VFGA 2W04A 1IIPA 1PK1B 3KHLA 2D8CA 1DK2A 4J9MA 5CFUA 5DB9A 2VJ4A 2GH1A 3ISDA 3RB6A 4RWPA 2ASLA 1ZXIA 1T7PA 3QU7A 4QZBA 2ALZA 1WUDA 4UB8U 2Z7JA 2ZH9A 4TURA 4WC3A 4I2EA 2W54A 2J6SA 2BE3A 3AQKA 4WCWA 2ISPA 3H40A 1KLNA 4OAIZ 3D2NA 1TFRA 5KL8B 1O03A 4Y2TA 3WK6A 2QARB 1KQQA 4DQIA 1P7DA 4MF8A 4F8RA 1NK6A 3BZKA 2DUYA 1WCNA 1ZOLA 4BX9C 4ECVA 4F4XA 2IMWP 2CXYA 5HRDA 4F4ZA 3OSPA 4K8VA 3PSPA 3T3FA 3M7DA 3AQEA 1ZQJA 2ZH3A 4RWQA 3N7SC 3BS7A 5CWRA 1ZQCA 5KFOA 1KDHA 2HOQA 3A0HU 4JB3A 3GDXA 3V7JA 3WFSC 4J9SA 3FAHA 5EWFA 4M04A 2F8KA 2WAQC 4I2BA 1L6NA 5AKYA 4Y2SA 2KJ5A 2Y1JA 3MR2A 4J9KA 1RZTA 4BXOB 3EWAA 4GLXA 4WC5A 3WKBA 3H7IA 3QE9Y 1T3QA 5J2AA 1SZHA 1U45A 2EDUA 2BGWA 5AM0A 4MFCA 3V6HA 1K1SA 2ZUDA 1QSLA 1L8OA 2KP7A 3QYPA 2E8OA 3F2BA 1ED1A 3ZDEA 3PY8A 5HC9A 2VA2A 7ICRA 3D6JA 3TKAA 4I2FA 3LQCB 1ZETA 4FS2A 5KG6A 2MSNA 4ATBB 2QKQA 3C1ZA 3RBDA 4E7XA 2GLEA 2W9AA 2Y9UA 8ICKA 1X9WA 3QU5A 4RQ8A 4FH5A 4M6WB 4FHVA 3TFRA 2AJQA 3ETLA 5AKGA 3U26A 5DKWA 2AHOB 3WFRE 1X6IA 4KLTA 2F3NA 5KFSA 3GQCA 2ZXIA 2JGAA 5ALRA 5AI9A 3IP4B 4PHAA 4DS5A 1N61A 1ZQBA 3ONNA 2W8KA 5AHXA 4RNNA 5KFIA 1BPBA 9ICKA 2ZIWB 3H39A 1Z4OA 1ZQQA 4P4MA 3T5HA 7ICEA 4NV0A 3H38A 5AIBA 3GU3A 2BR0A 2KNJA 4UBBA 3NVYA 4XUSA 2UVWA 1QQ6A 3PO4A 2KZMA 8ICJA 2RHFA 3BQ7A 1WYGA 4F5NA 4B6JA 5J0RA 5DBCA 2KV2A 2K8AA 2MUTA 3N7RC 5KFUA 4GC7A 4UAVA 1ZQTA 4FHPA 9ICCA 2YMLA 2YMMA 3M1YA 3GFKB 3MGVA 4X0AA 5EOZA 3JPRA 2HOFA 4F4KA 3PSTA 1ZQXA 3TAQA 5AK4A 2WF5A 5C5JA 5J2BA 1UA0A 4KLQA 2HHUA 2FPKA 4ICAA 2J6TA 3RRHA 9ICRA 1UPHA 4O3OA 4S3NA 2HW3A 3NVWA 5KFTA 5F9LA 1SL0A 4UATA 1XSNA 5GTIU 4QWBA 2KK0A 4Z6DA 2HN2A 1MQ2A 4M0AA 2NYVA 1SWVA 4QWAA 1ZQGA 2WFAA 4CGZA 4MHVA 5EWEA 5ALDA 2K8BB 3UXNA 3IG5A 3ZD9A 3Q8PB 2E8MA 4O69A 1JALA 5BPCA 1Q3UA 5KT5A 4ED8A 2WB1C 2JRZA 1NK5A 4HAIA 4NLBA 4RQ0A 4YD2A 2F1JA 1RG6A 1JIHA 2NRXA 4IR1A 4B9SA 3RH6A 7ICOA 2LHTA 3BQ1A 5J2JA 3F2DA 2XCAA 4PHEA 5CFTA 5AKEA 4RQ6A 2R8IA 3AM9A 2PKEA 4F50A 1ZQEA 4BWMA 4YFKA 4RQ3A 1VJ7A 2Y0SF 4KMUA 4DLEA 1MIWA 1SXDA 4KX3A 4C80A 3M9OB 9ICEA 4EZ6A 5CEHA 1JX4A 4TUQA 3C5GA 2HI0A 2G5HB 4I2IA 1IV8A 5J0PA 5KFAA 2ESEA 3OTQA 3EF2A 4UD4A 2HBMA 5ALQA 3C21A 4AT9B 5HR7A 3Q8LA 2OEHA 2WF9A 5HP4A 5KG5A 4RQ4A 4HX0A 3OVSA 4DOAA 5J0QA 4F4WA 2FPLA 3HJEA 2B56A 1RPLA 1V4AA 3G6YA 2JHDA 3BS5A 3TQ1A 4ZOHC 1R8BA 2B21A 2IHNA 1BPYA 1NKEA 3QU2A 1JMSA 1XU4A 8ICIA 2JZBB 1UQVA 3F2CA 5EE9A 4F72A 1HUOA 3D2SA 4CCHA 2PFOA 4IC9A 3MDAA 3K75D 5D46A 2F1HA 2XICA 4UB1A 4Y2XA 2EAPA 4Z6EA 4G9BA 2HHPA 1YLQA 3HKZF 2M2VA 4J9RA 3TADA 1ZQRA 9ICMA 3AU2A 2ZH7A 2NO5A 5J0UA 2C2EA 4NL9A 3PR4A 4B9VA 3MFIA 2DFLA 5AI8A 1L3SA 5AKHA 2Q0ZX 3KOOA 2WAQF 4PHDA 4DFMA 3C2LA 2LBOA 1O08A 4LEYA 4NM1A 3M9NB 2RRDA 9ICIA 1ZQKA 5HRIA 4IRCA 4O5KA 1KTQA 1D8LA 1QLNA 2HBJA 4Q8EA 5AM2A 2LKYA 1NJWA 2W3SA 2AH5A 2W3RA 2MA1A 4M9HA 5ALHA 1L3UA 4PGXA 4EEBA 4EX7A 4FZMA 2H3FA 4YP3A 3G6XA 4Q44A 3GIIA 4BGDA 3PZPA 4QJFB 2LYBA 2PBEA 1K1QA 1RYSA 5AI4A 4XQ8A 4A8EA 4F5RA 4LJXA 4AP9A 1S5LU 3NVOA 1CI4A 3K1RB 1JROA 3IDWA 3KD3A 4PZNA 1XSLA 3V6KA 2KSOA 3BS5B 2AQ4A 5JUMA 3DV9A 5KG7A 4C7ZA 5KT3A 4UAUA 3HIYA 3IRUA 1T94A 3UQ0A 2XY7A 4JUZA 1SV0A 1NK4A 2IA6A 9ICFA 3ETRA 4PH5A 4WJ3B 4Z6FA 3M8RA 1ZQZA 5J29A 3WKEA 1ZQHA 3RR8A 5IIJA 1L8LA 4O3PA 3CK6A 4KTQA 4EBEA 5BOMA 2D6FC 7ICNA 1COOA 4UQGA 5DEDA 5HRKA 3HWTA 4X4SA 3IM1A 5HNKA 1HIWA 1ZQPA 3RJIA 3UMGA 3NKUA 1KL9A 3L3FX 3PO5A 3AQNA 4GXJA 4ED0A 3PW7A 5AICA 4DL7A 3PW0A 3PW5A 5KFXA 2W11A 3R9KA 4ED6A 4CF4A 1DK3A 3QNMA 5AKKA 2PFQA 4O3RA 2PFNA 3M8SA 3Q8RB 3WKDA 3CYMA 1ZYQA 4YD1A 4I2CA 5DGAA 3K7DA 4UBCA 4BWJA 2G09A 1MA7A 4K99A 4DF4A 3CNHA 4F5PA 3ZDAA 5AI0A 3RFAA 2ZH6A 1Y88A 4ECZA 5F9NA 3BQ2A 2H3ZA 3BQ0A 3H0MB 2KD1A 2VJ5A 2ZXHA 4RQMA 5FP0A 1T8EA 8ICTA 2KSOB 4NLGA 2H3VA 1COKA 5F3XB 2NRTA 2IOFA 1LKYB 4KLEA 3SQIA 1FA0A 3L9DA 2BDUA 3OHAA 1S77D 3ZD8A 4NXVA 2GWSA 2XC9A 4I2GA 4QZAA 4EBJA 1NK7A 3UMCA 5KFQA 3H37A 5CA7A 5J0WA 1U4BA 3C66A 2JH7A 1BPZA 5AM4A 2IHOA 4JK1A 2WB1F 2FPMA 1ZD5A 4F5QA 2W7OA 4EBKA 4KLLA 4FZLA 4UD5A 5KFEA 4Q43A 5KFVA 1U48A 4NLCA 3ZDDA 3HT3A 2PMZC 4J9NA 5J0YA 4C8KA 4DL4A 4GIBA 5KFRA 2EH9A 1S97A 1FIQA 4LT6A 3NVVA 1UT5A 2DQNB 5CHGA 2YMQA 5ALIA 5DB7A 4WBYA 1DOQA 3GV8B 4X4OA 4AYBC 4M9NA 2DVIA 4EBCA 1ZD4A 2KE7A 5DDMA 3T79A 2LI6A 4EYIB 5IIIA 2JEIA 4LEWA 8ICFA 4OJPA 5D4BA 1JN3A 4B9UA 4RWNA 5IINA 2WHEA 4KN7A 4RNMA 4JMUA 3GIMA 3SD7A 3VCBA 1RQNA 3KFUF 3PNCA 4QZIA 4R65A 2Q66A 1Q3VA 3H4BA 2OH2A 4ELVA 5IIMA 4RQ7A 3KBBA 1S10A 1KFSA 3JPSA 4UB5A 4J9LA 2P35A 3IG8A 2KKVA 4Z6CA 2V9WA 3H0LB 1SKWA 5KFPA 5KFCA 4MEXA 1V85A 4WC6A 1SGGA 2HHWA 2ZIVB 2CRXA 4DFDA 3C18A 4OAFA 3WKCA 1UETA 4R8UA 4FBUA 4CE6A 8ICOA 5ALOA 7ICLA 5DBAA 5KT4A 3H4DA 1SKRA 1V38A 4I2JA 3RH4A 4B9LA 4DSFA 4X0BA 3ZI4A 3I28A 1X6JA 4UB3A 3TARA 5CJ7A 3G6VA 3RR7A 2P6RA 1PUZA 3ZDBA 5KAFU 1VJ5A 5KFFA 2G08A 3CP8A 4IRKA 2FDRA 4QIWC 4DL3A 4DOBA 1X2IA 5L1IA 2YTUA 5B3QA 2ZIXA 3V7LA 8ICNA 4XA5A 2W9BB 2F2AB 3V7KA 4JV0A 4YXJA 9ICPA 5J0SA 2AXTU 1NJXA 4ACOA 2KVCA 4WC2A 2ZH5A 5CR0A 5B5EU 5HRBA 3BZCA 2KIVA 5KFWA 2Y1IA 1PZNA 3MC1A 1SZPA 1QQ5A 3NUQA 4Y2RA 2HDOA 3E58A 2OYYA 3KHHA 1HEKA 2K4HA 2ZHAA 4GXKA 4RT3A 2M9NA 4CF5A 7ICKA 1LV5A 4Y2YA 4WH5A 2D3DA 2E8PA 5DQGA 3EUB2 4Y2UA 4NXTA 4EEDA 1PVQA 4X4QA 2BPFA 8ICWA 2XY6A 2ASDA 3ALRA 4YXMA 3SI8A 4IQVA 1L7OA 2E5SA 3SAHA 4E8FA 3NWIA 5ALMA 5D63A 5EE0A 1XNSA 3E2EA 8ICAA 1FO4A 1NNLA 4ECRA 3PW4A 2PXIA 3F5EA 4NWIA 4BDPA 4QZFA 2XI9A 4Q8FA 5J8YA 3M6KA 1Q79A 3QZ8A 4RUAA 2I5HA 1TV9A 3ZDCA 2M2UA 4F3OA 1ZD3A 1BPDA 3C29A 2BQRA 2YMPA 4Y2VA 5K4LA 2XCPA 1QH9A 4EENA 3MDCA 1KNYA 8ICYA 3BQTA 4WC0A 2K8CB 1F44A 3JZ0A 5DECA 3PVXA 9ICUA 5HRFA 4ECQA 4KLHA 3RJJA 3N7PD 4QZ9A 1TK0A 1IG6A 2JV3A 3AEVA 2C22A 2IBKA 4KLIA 2ISOA 4O5EA 3NS1A 1N48A 4F5OA 4YMOA 7ICVA 2EANA 2H3IA 5B3PA 3KKAA 1TAUA 2KMDA 4ELTA 4E80A 3RAXA 4FHXA 2O5AA 1M6YA 5CB1A 2ZJ5A 3RB3A 1RYUA 2M0NA 1BPEA 3PSFA 4CDGA 5CFSA 3RBEA 1RQLA 3HP6A 5L1KA 5HMLA 2MRLA 4P4OA 2FJ6A 3ORYA 5ALYA 4X4PA 2O6KA 3AQFA 2RLTA 3QZ7A 9ICGA 5ALGA 2O1PA 1R89A 4DQSA 5KTQA 1KFTA 1J2NA 1L3TA 4MF2A 1SWWA 5KFBA 3MGIA 2JEFA 1LVHA 5DG9A 4TQRA 1Z1VA 2B0CA 2ODGA 4I2AA 3IN5A 3QEBZ 1U47A 2DRAA 2PMZF 2KJ9A 1ZQFA 1ZQDA 3RJFA 1D8BA 4MEYA 5AIAA 1TAQA 2K4EA 4XRHA 5AK3A 2ZH2A 2JR5A 2BCRA 4M5DA 3SZ2A 2C28A 1CRXA 4KB6A 4OAHA 2KZ3A 4TUPA 2RP5A 1JXLA 3KZIU 3T5KA 4EBDA 4E0DA 1SXEA 1DGJA 1NI3A 1QSSA 1KSPA 3QUQA 1DGSA 2W03A 8ICVA 3WFOA 2MUTB 1D9DA 3OVBA 4JLZA 4DO9A 3PR5B 4KN4A 1ZQWA 4ED2A 2FLLA 2BCVA 1CUKA 4O6AA 2PI4A 3D2QA 1QCKA 3SAGA 2BPCA 3PX0A 4QZ8A 4O9MA 3AQLA 3AQMA 4HYKA 8ICPA 2I9GA 2MU2A 4OJOA 3B0YA 1L5UA 2DL0A 3HRDD 4J9OA 1MSWD 3AN1A 2RDIA 4PHPA 9ICAA 4M9JA 4DSKA 4RZRA 2EAOA 5JTIA 4LZDA 1N2XA 8ICUA 2B51A 3RTVA 2ZTCA 4NLNA 3WK4A 4FHWA 3LVVA 1D8YA 2KKPA 4PPXA 5KFNA 4P0QA 1UHUA 2DR8A 1TKDA 7ICIA 4USAA 1N5XA 3OWGA 2LYAA 4X4RA 1A77A 2DR9A 1J97A 2MAXA 3HPOA 2OXOA 1TK8A 1NJYA 4QIWF 3A0BU 4JLXA 1X9XA 5AKXA 2ZHBA 4O0IA 1S0MA 2LYHA 3THVA 2G06A 4GFJA 1U49A 5CP2A 3KHRA 8ICHA 2Q4TA 2JEJA 2LMRA 9ICXA 4PGQA 5KT2A 2F1IA 4PGYA 5ALKA 1DXSA 4LEZA 2WTFA 5ALJA 4C7YA 3N97B 1X42A 3EW9A 4O3QA 4CRXA 2FCLA 2FMQA 4O68A 5F2VO 4BJQA 1WCLA 4OJLA 3IHQB 2K89A 3S6JA 2HHVA 1RYRA 8ICXA 5HR9A 2CN1A 4YQWA 4OJ5A 1SB3C 2FMPA 2FMSA 2DF4B 2R8GA 9ICLA 2DKXA 3H8SA 1T3NA 2KHQA 4F71A 3UQ2A 2W7PA 5DLFA 3N4MB 5ALVA 4AT8A 1B43A 3NTUA 3LK9A 2HN1A 5AM1A 4RQ1A 1RDFA 4FHYA 5J2HA 1TFYA 4KITB 4F2RA 3WFQE 3MCRA 2HVIA 1WWVA 5KT6A 3EPIA 8ICRA 1N63A 4YG2A 3SR6A 5KG3A 4NXWA 3O0FA 4UW9A 1QQ7A 2Y9TA 1B4FA 2K4IA 2BBJA 5HREA 9ICOA 1MC8A 2ZTDA 4NXZA 2JH1A 3WKAA 4P0PA 3RAQA 1F5AA 4C0ZA 2A1JA 1R8CA 4QNLA 1F0MA 1Z4NA 3QUBA 3EPGA 5HRHA 3QU9A 1CEZA 1OXJA 1URJA 2NRVA 1WG8A 1PK3A 3VC8A 4DSLA 3KTQA 4O67A 3Q8QB 4KLOA 5A0LA 5AI6A 5G5HA 2QB0A 3AL0B 5ALFA 4O3SA 4RT2A 4KX5A 2CPRA 2ZJAA 2HHTA 2AGQA 1L3VA 3SMVA 5AI5A 3JPNA 5DB6A 2VANA 3NGDA 5KL1B 5KFHA 3LYSA 4PZOA 3QUTA 4YMNA 1WOTA 1PK1A 4OJ6A 3ISCA 1S9FA 1MQ3A 1DRGA 2B6GA 4DFPA 4KLJA 4WBZA 3PX4A 4DQRA 1A6SA 4RPXA 4QW9A 1ZQYA 2KOBA 4YR3A 1SL1A 5L1MA 2ASJA 3NYBA 3L4PA 2HCFA 2LM1A 1S0VA 2BKEA 4C4TA 2ID1A 9ICVA 5EE3A 3AU6A 1YZ6A 3RB0A 2QARA 3E0FA 3RJGA 4B9TA 3CW2C 3TAPA 4JWMA 3BDPA 1JAJA 5ALPA 5J2KA 5CHEA 3WU2U 4ECWA 5DBBA 4P0PB 2DGZA 2F76X 5HRLA 4ED1A 2GO7A 4ELUA 3ED5A 4I2DA 3MFHA 2JXJA 3OJSA 1IM4A 3BJYA 4U7CA 3N28A 3LVWA 2DKZA 4J9QA 2KN7A 2V4RA 2WF7A 2QB1A 2KHVA 2YB1A 3GIJA 1T4GA 2W55A 1BGXT 4DFKA 4UAYA 3JPTA 4N7RA 5J0OA 1BVSA 2P6UA 5TISU 4OAGA 2NO4A 3QU4A 1R8AA 1MN8A 3TI0A 4DEZA 2BCUA 2JMGA 3Q8MA 4BXOA 1OUQA 3RJEA 5D62A 5L9XA 4DL6A 3SAFA 2IUBA 4B9NA 2HMXA 2WF8A 2HHQA 3SV3A 1UEVA 5J8YC 3Q8KA 4NM2A 2E3TA 4EX6A 3QXGA 5ALTA 1HUZA 1L7NA 4X5VA 1BNPA 5KFYA 4FE3A 5D61A 2DBYA 1PVRA 3JPQA 2KFNA 2RFFA 5J0XA 4X4NA 1YZ7A 3UXOA 4C4RA 4DCCA 3H8WA 3Q8SB 9ICBA 2BCSA 3HW8A 2PI5A 5ALNA 4ATBA 2NRZA 4YR2A 4RQ5A 5B66U 3GV7B 2I6XA 4NJ8A 4LZGA 3TACB 1YT3A 4K96A 3PSIA 2EZZA 1ZJNA 4CF3A 7ICSA 4M9LA 4MKPA 1ZQSA 4BUGA 1U9LA 1NZBA 4M6WA 1ZQMA 5KG4A 2XIDA 2DR7A 1KN5A 5DB8A 1BPXA 1ZQIA 3FC4A 3NASA 7ICHA 3SEIA 3HKZC 3C5FA 1Q78A 3FM9A 1RXWA 1MIVA 3KKAC 3UPSA 5HHIA 7ICTA 3QX7A 5ALWA 2A1AA 2ZIWA 2BDPA 4F93B 2LM4A 4YR0A 3L5KA 1TAMA 4P2HA 4UB4A 3T5JA 5AK5A 2XGQA 3RJHA 5C0YA 4FBTA 4C8OA 3OSNA 1A0PA 8ICLA 5CRXA 4DS4A 2ZJ8A 4PL1A 2DPJA 3B0XA 3C2KA 4KLGA 4JWNA 5T14A 5JRTA 1V9PA 2DPIA 3GZFA 5AM5A 4R8UB 4AT7A 4F91B 4NKUA 2EQYA 4C4SA 4FZNA 2ES6A 4I27A 4ED3A 4ED7A 7ICMA 3MR3A 8ICEA 3H8JA 2F44A 1VLBA 1X9SA 2QLTA 3HJ1A 1B22A 4YCXA 2E1EA 3IV6A 5KFJA 3JCFA 3C23A 4IQUA 5ALSA 3RH5A 3FYHA 5EWGA 3UMBA 4QWDA 2XO7A 4EP7A 2OCEA 3SV4A 4IRDA 3WK9A 5DG8A 2ZH8A 2ZIXB 1Z19A 1LB2B 9ICNA 9ICTA 1KKXA 4FO6A 2YX8A 1S0OA 4XQ7A 1L7MA 5AKIA 3WFPA 2H5XA 1C20A 5G5GA 4CNQA 4WQKA 1NZPA 1L7PA 4DL5A 8ICQA 2W9CA 4J9PA 3WK7A 4YMMA 4Q45A 4DWIA 2HBLA 1FEZA 4R63A 3OHBA 5KFDA 3LWLA 2C2DA 2YB4A 3F5AA 1N5WA 3RRGA 2BHNA 9ICSA 1SV4A 4RU9A 4LVSA 2EZYA 4EEKA 2C2RA 3JPPA 5J2IA 4IL6U 2ZH4A 4KLFA 1KRPA 2HHXA 4K4HA 2IOHA 2F8LA 2UVVA 5KFGA 4YN4A 3PW2A 2HOIA 3MR5A 5J2DA 2UVUA 4QZDA 4RWOA 1JI7A 9ICJA 4AT7B 4DQQA 1XSPA 3RB4A 4C8NA 4B9MA 4NXXA 4FFDA 1ZRNA 5KG1A 4K98A 1S76D 4KLMA 4IS7A 2R18A 3H8MA 1UCVA 3SYZA 3J81j 3B9JA 8ICCA 1H38A 1ZRMA 1ZQUA 4GC6A 4QZGA 3HJ4A 4AT9A 3TADC 4EELA 3SENA 2AGPA
chains in the Genus database with same CATH topology
3OHAA 4MFFA 4TUSA 1S77D 1JXEA 3ZD8A 2WTFA 4DSJA 4I2BA 2XY5A 2GWSA 2XC9A 4O5CA 4I2GA 7ICGA 3N97B 4QZAA 4EBJA 1KFDA 1NK7A 1ZQAA 3EW9A 4DFJA 4G3IA 4C8MA 4O3QA 2Y1JA 5KFQA 3MR2A 1NKBA 3H37A 1QTMA 4K4IA 4J9KA 1AROP 1X9MA 3EWAA 5CA7A 5J0WA 4GLXA 1U4BA 1RZTA 1BPZA 2FMQA 3C66A 4JK1A 5F2VO 2FPMA 3H7IA 4F5QA 3QE9Y 4EBKA 4KLLA 2JZBA 4UD5A 5KFEA 1WCLA 5J2AA 1UT8A 5KFVA 4Q43A 4F4YA 2BGWA 3V72A 3IHQB 1U45A 1U48A 4UAWA 4ZH4A 4O3NA 3V6HA 3ZDDA 4MFCA 3HT3A 1K1SA 2FLPA 4J9NA 5J0YA 2ZUDA 2W9CB 2HHVA 1RYRA 4C8KA 1QSLA 4DL4A 3MABA 8ICXA 2KP7A 5KFRA 4FH3A 5HR9A 1S97A 3ZDEA 4RUCA 4LT6A 3PY8A 5HC9A 1UT5A 5DG7A 2VA2A 7ICRA 5CHGA 5DB7A 4YQWA 4WBYA 1DOQA 4I2FA 3GV8B 4X4OA 1QSYA 4M9NA 2DVIA 5DGBA 2FMPA 4EBCA 2FMSA 2R8GA 9ICLA 3H8SA 5DDMA 1T3NA 3LQCB 1ZETA 4RPYA 5KG6A 4FS2A 3UQ2A 4ATBB 4EYIB 5IIIA 2BCQA 3C1ZA 5DLFA 3N4MB 4AT8A 2JEIA 8ICFA 1B43A 3NTUA 3RBDA 5D4BA 1JN3A 3LK9A 4B9UA 4KLUA 4RWNA 5IINA 4E7XA 4RQ1A 4KN7A 4RNMA 2W9AA 4DOCA 4QZHA 3GIMA 5J2HA 1ZQOA 8ICKA 1X9WA 8ICGA 4QWEA 4FHYA 1TFYA 4JV1A 4RQ8A 5L1JA 4FH5A 2ZTEA 4KITB 3PNCA 4M6WB 5J2FA 3TFRA 4F2RA 4IQWA 3ETLA 2AJQA 4FHVA 4QZIA 4R65A 3RJKA 2HVIA 3WFQE 5KT6A 3EPIA 2Q66A 2W9MA 5DKWA 3H4BA 3WFRE 8ICRA 4KLTA 5J2EA 5DQHA 5KFSA 3MBYA 1EXNA 4DLGA 4ELVA 2VA8A 3GQCA 5IIMA 4YG2A 5KFMA 5KG3A 7ICJA 1NKCA 4RQ7A 8ICMA 1S10A 5HMMA 3JYYA 4PHAA 5J2CA 4DS5A 1KFSA 3JPSA 4WC7A 4UB5A 1ZQBA 5KFLA 4J9LA 4WC3A 2W8KA 2JEGA 1A76A 4RNNA 4Z6CA 5KFIA 3OGUA 2V9WA 5HREA 9ICOA 1BPBA 9ICKA 1SKWA 5KFPA 5KFCA 1MC8A 2ZTDA 4NXZA 2HVHA 4I28A 4MEXA 3H39A 1ZQLA 1ZQQA 4P4MA 3T5HA 4WC6A 2HHWA 7ICEA 4NKTA 3RAQA 2KZZA 1F5AA 3UXPA 3C18A 4DSIA 1UETA 4R8UA 4FBUA 3H38A 2A1JA 2BR0A 4FS1A 8ICOA 7ICQA 1R8CA 4UBBA 7ICLA 3OUYA 3FDSA 5DBAA 5KT4A 4XUSA 3H4DA 3EPGA 1SKRA 2UVWA 3PO4A 5HRHA 1CEZA 2KZMA 4I2JA 8ICJA 2NRVA 3RH4A 4B9LA 4ECSA 4DSFA 2BPGA 4F5NA 4DSLA 4X0BA 3KTQA 5J0RA 5D49A 5DBCA 2DR5A 4UB3A 3Q8QB 3TARA 5CJ7A 1NK9A 2MUTA 4KLOA 2HHSA 3G6VA 3C2MA 5KFUA 3RR7A 4GC7A 2P6RA 3ZDBA 4O3SA 2M2TA 3LWMA 4RT2A 1ZQTA 4FHPA 9ICCA 5KFFA 2ZJAA 2HHTA 2AGQA 4IRKA 3GFKB 1NK8A 1L3VA 5TZVA 4X0AA 1XS9D 5EOZA 2DRBA 5IIOA 4DL3A 4DOBA 1X2IA 5L1IA 4WC5A 3JPNA 1UA1A 3JPRA 3V7LA 5DB6A 1XO1A 8ICNA 4F4KA 2VANA 4XA5A 3NGDA 2W9BB 7ICUA 1UEUA 1ZQXA 5KFHA 3V7KA 5J0TA 5J2BA 5C5JA 3MGHA 3TAQA 1UA0A 1S0NA 2FPKA 4KLQA 2BQUA 2HHUA 4JV0A 4YXJA 3RRHA 4YMNA 2J6TA 2OWOA 9ICPA 9ICRA 1WOTA 5J0SA 3ISCA 4O3OA 4S3NA 1XWLA 1S9FA 1MQ3A 2HW3A 1NJXA 2NRKA 5KFTA 5F9LA 4DFPA 3JPOA 4DL2A 5DQIA 1XSNA 5IILA 1SL0A 4KLJA 2R8KA 4WBZA 1OU5A 5DLGA 5KFZA 4WC2A 2ZH5A 1KEJA 4QWBA 4ECUA 4Z6DA 5CR0A 4DQRA 3PX4A 4RPXA 3EYZA 2UVRA 1MQ2A 5HRBA 4QW9A 5KFWA 4NLKA 4M0AA 4KLDA 2Y1IA 1IXRA 1ZQYA 4YR3A 1ZQGA 4QWAA 1SL1A 1SKSA 1PZNA 2ASJA 3NYBA 1SZPA 5EWEA 3PMNA 1NOMA 3UXNA 3ZD9A 3Q8PB 1S0VA 1Z00A 3KHHA 2BKEA 5BPCA 2ZHAA 5KT5A 5L1LA 4GXKA 4ED8A 1HJPA 2AU0A 1NK5A 4RT3A 2M9NA 7ICFA 2ID1A 7ICKA 5KG0A 9ICVA 1LV5A 4RQ0A 3AU6A 3C1YA 4NY8A 5DQGA 4YD2A 3RB0A 3RJGA 4IR9A 2F1JA 1JIHA 2NRXA 2KTQA 4IR1A 4B9SA 4B9TA 3TAPA 4JWMA 3RH6A 7ICOA 3PX6A 3BQ1A 5J2JA 3BDPA 2XCAA 5J2KA 1JAJA 4X4QA 2BPFA 8ICWA 2XY6A 4PHEA 4ECWA 5DBBA 2ASDA 4YXMA 3SI8A 2I1QA 4IQVA 4RQ6A 2R8IA 4ECTA 4ED1A 5HRLA 4ELUA 4I2DA 4F50A 1ZQEA 3M9MB 4BWMA 5KG2A 4E8FA 3OUYB 4YFKA 3MFHA 2P66A 4RQ3A 1VJ7A 4I29A 4KMUA 4DLEA 9ICWA 3OJSA 1IM4A 4R64A 1MIWA 3BJYA 3E2EA 1NO5A 8ICAA 3M9OB 9ICEA 2M2WA 4ECRA 4J9QA 2KN7A 2V4RA 2PXIA 3PW4A 4EZ6A 1JX4A 4TUQA 3C5GA 4BDPA 4QZFA 3GIJA 4Q8FA 1T4GA 2BQ3A 1Q79A 1BGXT 4DFKA 4M9GA 4UAYA 3JPTA 3GILA 5J0OA 1BVSA 2P6UA 4RUAA 3QZ8A 3HX0A 1R8AA 3TI0A 1TV9A 4DEZA 2ZUCA 4I2IA 2BCUA 3ZDCA 5J0PA 3Q8MA 5KFAA 4DQPA 3AUOA 2M2UA 4BXOA 4F3OA 4UD4A 4C8LA 2J6UA 5J2GA 1TK5A 3OVAA 1BPDA 3C21A 2BQRA 3RJEA 5L9XA 4AT9B 4DL6A 2XCPA 3MR6A 4B9NA 3MDCA 3Q8LA 4EEYA 1KNYA 3UPQA 1Z3EB 4TQSA 2HHQA 3SV3A 8ICYA 1UEVA 3BQTA 5HP4A 5KG5A 4NM2A 4RQ4A 3Q8KA 3T5LA 3JZ0A 4WC0A 3OVSA 3PMLA 4DOAA 5J0QA 5DECA 4F4WA 2FPLA 4EYHB 4ECYA 3PVXA 4GXIA 1RPLA 4BXOB 4ECQA 4KLHA 9ICUA 3RJJA 4QZ9A 3G6YA 1TK0A 5HRFA 3TQ1A 1V4AA 1HUZA 1R8BA 4X5VA 2B21A 2IHNA 1BPYA 2C22A 4UAZA 5KFYA 1NKEA 1BNPA 2V4QA 1JMSA 2IBKA 4KLIA 4F2SA 4RNOA 1XU4A 2ISOA 3JPQA 8ICSA 4O5EA 8ICIA 2JZBB 2KFNA 9ICQA 2RFFA 4WC4A 5J0XA 2R8HA 4ECXA 1N48A 4X4NA 4F5OA 2XGPA 4YMOA 3UXOA 1Z00B 3H8WA 3Q8SB 3EZ5A 1XC9A 1HUOA 2BCSA 3HW8A 9ICBA 7ICVA 4R66A 2PI5A 4ATBA 4CCHA 2NRZA 4YR2A 4RQ5A 3GIKA 5HRGA 3GV7B 4LZGA 2PFOA 5HHHA 3K75D 5D46A 2F1HA 3MDAA 1TAUA 4UB1A 4ELTA 4E80A 3RAXA 5IIKA 1ZJNA 7ICSA 1MIYA 4FHXA 4M9LA 2PFPA 4Z6EA 2O5AA 1ZQSA 1U9LA 4QW8A 5DDYA 4YVZA 5CB1A 1TFWA 2HHPA 1YLQA 2ZJ5A 2M2VA 4M6WA 3RB3A 1ZQMA 4J9RA 4UB2A 3GV5B 5KG4A 1ZQRA 1BPEA 9ICMA 7ICPA 3AU2A 2KFZA 2ZH7A 4KLSA 2DR7A 4RPZA 3OJUA 3KHGA 3RBEA 5DB8A 5J0UA 3HP6A 2C2EA 5L1KA 1BPXA 5HMLA 1ZQIA 2IHMA 7ICHA 4AT8B 3PR4A 4X4VA 4P4OA 4B9VA 4WC1A 3ORYA 3MFIA 5KT7A 2DFLA 3C5FA 3PV8A 4X4PA 3OV7A 1Q78A 2ZH1A 2ATLA 2ZUBA 1L3SA 1RXWA 1MIVA 3QZ7A 2Q0ZX 4QWCA 4I2HA 9ICGA 1R89A 2O1PA 3UPSA 4DQSA 5HHIA 8ICZA 2NRWA 5KTQA 4PHDA 4DFMA 7ICTA 3C2LA 1D9FA 4X4TA 1ZQNA 4NM1A 1KFTA 3M9NB 9ICIA 1L3TA 4DSEA 1ZQKA 4MF2A 1NJZA 4IRCA 2AGOA 4O5KA 1KTQA 2BDPA 1D8LA 4P4PA 1QLNA 5HRIA 4Q8EA 5KFBA 4F93B 1NJWA 3MGIA 4YR0A 4M9HA 1NK0A 4P2HA 4UB4A 1L3UA 5KFKA 2JEFA 3T5JA 4PGXA 2XGQA 5DG9A 4DF8A 4QZCA 4TQRA 1ZJMA 4RQ2A 1N56A 3RJHA 4FBTA 4C8OA 3OSNA 3V6JA 4X4UA 8ICLA 4I2AA 4YP3A 3G6XA 1TVAA 4DS4A 4Q44A 1BNOA 3GIIA 4BGDA 3QEBZ 2ZJ8A 1U47A 2DRAA 2DPJA 3B0XA 3C2KA 3QEAZ 1ZQFA 2VA3A 4M2YA 4KLGA 1K1QA 1RYSA 1ZQDA 3RJFA 4XQ8A 4JWNA 2RDJA 4NLZA 2PBEA 3K4GA 4F5RA 1ZQVA 4MEYA 9ICHA 1TAQA 1V9PA 2DPIA 4K4GA 4XRHA 4R8UB 4AT7A 4F91B 4IG8A 4NKUA 2A1JB 2ZH2A 4MFAA 1XSLA 2BCRA 4IQTA 3SZ2A 3V6KA 4I27A 2AQ4A 4M5DA 1SL2A 5BOLA 5JUMA 4ED3A 4ED7A 2C28A 5KG7A 2KZ3A 4TUPA 3TANA 3MR3A 1JXLA 7ICMA 8ICEA 1PX5A 3T5KA 5KT3A 3H8JA 3HIYA 4EBDA 4M04A 4E0DA 1QSSA 1KSPA 1DGSA 3UQ0A 3H3AA 2XY7A 2FLNA 1X9SA 8ICVA 4JUZA 2W9BA 3WFOA 3HJ1A 2MUTB 1NK4A 1D9DA 4YCXA 2IA6A 4PH5A 9ICFA 1B22A 3OVBA 4DO9A 4Z6FA 3PR5B 5KFJA 4KN4A 1ZQWA 1JQRA 3C23A 4ED2A 2BCVA 3M8RA 4IQUA 2FLLA 1CUKA 1ZQZA 3RH5A 5J29A 4QZEA 3ISBA 3FYHA 2W8LA 2PI4A 1ZQHA 3TFSA 5EWGA 4F92B 4JV2A 2AQ0A 4QWDA 2XO7A 1C7YA 3RR8A 4EP7A 5IIJA 2BPCA 4M47A 3SV4A 4IRDA 4O3PA 3PX0A 5DG8A 4EZ9A 4QZ8A 2ZH8A 4O9MA 4KTQA 4EBEA 5BOMA 2R8JA 3LDAA 3AQLA 1RXVA 1LB2B 1COOA 7ICNA 4UQGA 5DEDA 5HRKA 9ICNA 3HWTA 8ICBA 4HYKA 9ICTA 3AQMA 4FO6A 3IM1A 5HNKA 1S0OA 8ICPA 4XQ7A 4X4SA 1VFGA 3WFPA 2H5XA 1ZQPA 2I9GA 3B0YA 3RJIA 3KHLA 1DK2A 1L5UA 4J9MA 1NZPA 5DB9A 4J9OA 3ISDA 4DL5A 3RB6A 1MSWD 4RWPA 8ICQA 2ASLA 3PO5A 3AQNA 1T7PA 2W9CA 4J9PA 2RDIA 4GXJA 4ED0A 4YMMA 4Q45A 3PW7A 4QZBA 4PHPA 4DWIA 9ICAA 4M9JA 4DSKA 4RZRA 2ALZA 4R63A 3OHBA 4DL7A 3PW0A 3PW5A 4LZDA 5KFDA 8ICUA 5KFXA 3LWLA 2ZH9A 2C2DA 3RTVA 2ZTCA 4TURA 3RRGA 2BHNA 4NLNA 4I2EA 9ICSA 4FHWA 4ED6A 4RU9A 1D8YA 2J6SA 4LVSA 1DK3A 2BE3A 2PFQA 4O3RA 3AQKA 4WCWA 2PFNA 2C2RA 2ISPA 3JPPA 3M8SA 3Q8RB 3H40A 1ZYQA 4YD1A 4I2CA 1KLNA 5DGAA 4PPXA 5KFNA 5J2IA 1TFRA 4UBCA 4BWJA 2DR8A 2ZH4A 4DF4A 1TKDA 4KLFA 4DQIA 7ICIA 4MF8A 4F8RA 4F5PA 1NK6A 1KRPA 2HHXA 3ZDAA 4K4HA 4X4RA 2UVVA 1A77A 5KFGA 2DR9A 2ZH6A 1Y88A 4YN4A 3PW2A 4ECZA 1WCNA 2MAXA 5F9NA 5J2DA 3MR5A 3HPOA 4ECVA 3BQ2A 2UVUA 4QZDA 4F4XA 1TK8A 2IMWP 4RWOA 1NJYA 9ICJA 5HRDA 4AT7B 4F4ZA 4DQQA 3OSPA 3BQ0A 3T3FA 2ZHBA 4O0IA 1XSPA 3RB4A 4C8NA 1T8EA 1S0MA 2LYHA 3THVA 4B9MA 8ICTA 1U49A 4NLGA 1ZQJA 2ZH3A 4RWQA 5CP2A 3KHRA 8ICHA 2NRTA 5KG1A 2JEJA 5CWRA 9ICXA 4PGQA 1ZQCA 5KFOA 1S76D 4KLMA 5KT2A 3SYZA 1KDHA 4KLEA 8ICCA 1H38A 2F1IA 4PGYA 1FA0A 1ZQUA 4GC6A 3GDXA 4QZGA 3V7JA 3HJ4A 3L9DA 4J9SA 4AT9A 3WFSC 2AGPA 5EWFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OHA A;  4MFF A;  4TUS A;  1S77 D;  1JXE A;  3ZD8 A;  2WTF A;  4DSJ A;  4I2B A;  2XY5 A;  2GWS A;  2XC9 A;  4O5C A;  4I2G A;  7ICG A;  3N97 B;  4QZA A;  4EBJ A;  1KFD A;  1NK7 A;  1ZQA A;  3EW9 A;  4DFJ A;  4G3I A;  4C8M A;  4O3Q A;  2Y1J A;  5KFQ A;  3MR2 A;  1NKB A;  3H37 A;  1QTM A;  4K4I A;  4J9K A;  1ARO P;  1X9M A;  3EWA A;  5CA7 A;  5J0W A;  4GLX A;  1U4B A;  1RZT A;  1BPZ A;  2FMQ A;  3C66 A;  4JK1 A;  5F2V O;  2FPM A;  3H7I A;  4F5Q A;  3QE9 Y;  4EBK A;  4KLL A;  2JZB A;  4UD5 A;  5KFE A;  1WCL A;  5J2A A;  1UT8 A;  5KFV A;  4Q43 A;  4F4Y A;  2BGW A;  3V72 A;  3IHQ B;  1U45 A;  1U48 A;  4UAW A;  4ZH4 A;  4O3N A;  3V6H A;  3ZDD A;  4MFC A;  3HT3 A;  1K1S A;  2FLP A;  4J9N A;  5J0Y A;  2ZUD A;  2W9C B;  2HHV A;  1RYR A;  4C8K A;  1QSL A;  4DL4 A;  3MAB A;  8ICX A;  2KP7 A;  5KFR A;  4FH3 A;  5HR9 A;  1S97 A;  3ZDE A;  4RUC A;  4LT6 A;  3PY8 A;  5HC9 A;  1UT5 A;  5DG7 A;  2VA2 A;  7ICR A;  5CHG A;  5DB7 A;  4YQW A;  4WBY A;  1DOQ A;  4I2F A;  3GV8 B;  4X4O A;  1QSY A;  4M9N A;  2DVI A;  5DGB A;  2FMP A;  4EBC A;  2FMS A;  2R8G A;  9ICL A;  3H8S A;  5DDM A;  1T3N A;  3LQC B;  1ZET A;  4RPY A;  5KG6 A;  4FS2 A;  3UQ2 A;  4ATB B;  4EYI B;  5III A;  2BCQ A;  3C1Z A;  5DLF A;  3N4M B;  4AT8 A;  2JEI A;  8ICF A;  1B43 A;  3NTU A;  3RBD A;  5D4B A;  1JN3 A;  3LK9 A;  4B9U A;  4KLU A;  4RWN A;  5IIN A;  4E7X A;  4RQ1 A;  4KN7 A;  4RNM A;  2W9A A;  4DOC A;  4QZH A;  3GIM A;  5J2H A;  1ZQO A;  8ICK A;  1X9W A;  8ICG A;  4QWE A;  4FHY A;  1TFY A;  4JV1 A;  4RQ8 A;  5L1J A;  4FH5 A;  2ZTE A;  4KIT B;  3PNC A;  4M6W B;  5J2F A;  3TFR A;  4F2R A;  4IQW A;  3ETL A;  2AJQ A;  4FHV A;  4QZI A;  4R65 A;  3RJK A;  2HVI A;  3WFQ E;  5KT6 A;  3EPI A;  2Q66 A;  2W9M A;  5DKW A;  3H4B A;  3WFR E;  8ICR A;  4KLT A;  5J2E A;  5DQH A;  5KFS A;  3MBY A;  1EXN A;  4DLG A;  4ELV A;  2VA8 A;  3GQC A;  5IIM A;  4YG2 A;  5KFM A;  5KG3 A;  7ICJ A;  1NKC A;  4RQ7 A;  8ICM A;  1S10 A;  5HMM A;  3JYY A;  4PHA A;  5J2C A;  4DS5 A;  1KFS A;  3JPS A;  4WC7 A;  4UB5 A;  1ZQB A;  5KFL A;  4J9L A;  4WC3 A;  2W8K A;  2JEG A;  1A76 A;  4RNN A;  4Z6C A;  5KFI A;  3OGU A;  2V9W A;  5HRE A;  9ICO A;  1BPB A;  9ICK A;  1SKW A;  5KFP A;  5KFC A;  1MC8 A;  2ZTD A;  4NXZ A;  2HVH A;  4I28 A;  4MEX A;  3H39 A;  1ZQL A;  1ZQQ A;  4P4M A;  3T5H A;  4WC6 A;  2HHW A;  7ICE A;  4NKT A;  3RAQ A;  2KZZ A;  1F5A A;  3UXP A;  3C18 A;  4DSI A;  1UET A;  4R8U A;  4FBU A;  3H38 A;  2A1J A;  2BR0 A;  4FS1 A;  8ICO A;  7ICQ A;  1R8C A;  4UBB A;  7ICL A;  3OUY A;  3FDS A;  5DBA A;  5KT4 A;  4XUS A;  3H4D A;  3EPG A;  1SKR A;  2UVW A;  3PO4 A;  5HRH A;  1CEZ A;  2KZM A;  4I2J A;  8ICJ A;  2NRV A;  3RH4 A;  4B9L A;  4ECS A;  4DSF A;  2BPG A;  4F5N A;  4DSL A;  4X0B A;  3KTQ A;  5J0R A;  5D49 A;  5DBC A;  2DR5 A;  4UB3 A;  3Q8Q B;  3TAR A;  5CJ7 A;  1NK9 A;  2MUT A;  4KLO A;  2HHS A;  3G6V A;  3C2M A;  5KFU A;  3RR7 A;  4GC7 A;  2P6R A;  3ZDB A;  4O3S A;  2M2T A;  3LWM A;  4RT2 A;  1ZQT A;  4FHP A;  9ICC A;  5KFF A;  2ZJA A;  2HHT A;  2AGQ A;  4IRK A;  3GFK B;  1NK8 A;  1L3V A;  5TZV A;  4X0A A;  1XS9 D;  5EOZ A;  2DRB A;  5IIO A;  4DL3 A;  4DOB A;  1X2I A;  5L1I A;  4WC5 A;  3JPN A;  1UA1 A;  3JPR A;  3V7L A;  5DB6 A;  1XO1 A;  8ICN A;  4F4K A;  2VAN A;  4XA5 A;  3NGD A;  2W9B B;  7ICU A;  1UEU A;  1ZQX A;  5KFH A;  3V7K A;  5J0T A;  5J2B A;  5C5J A;  3MGH A;  3TAQ A;  1UA0 A;  1S0N A;  2FPK A;  4KLQ A;  2BQU A;  2HHU A;  4JV0 A;  4YXJ A;  3RRH A;  4YMN A;  2J6T A;  2OWO A;  9ICP A;  9ICR A;  1WOT A;  5J0S A;  3ISC A;  4O3O A;  4S3N A;  1XWL A;  1S9F A;  1MQ3 A;  2HW3 A;  1NJX A;  2NRK A;  5KFT A;  5F9L A;  4DFP A;  3JPO A;  4DL2 A;  5DQI A;  1XSN A;  5IIL A;  1SL0 A;  4KLJ A;  2R8K A;  4WBZ A;  1OU5 A;  5DLG A;  5KFZ A;  4WC2 A;  2ZH5 A;  1KEJ A;  4QWB A;  4ECU A;  4Z6D A;  5CR0 A;  4DQR A;  3PX4 A;  4RPX A;  3EYZ A;  2UVR A;  1MQ2 A;  5HRB A;  4QW9 A;  5KFW A;  4NLK A;  4M0A A;  4KLD A;  2Y1I A;  1IXR A;  1ZQY A;  4YR3 A;  1ZQG A;  4QWA A;  1SL1 A;  1SKS A;  1PZN A;  2ASJ A;  3NYB A;  1SZP A;  5EWE A;  3PMN A;  1NOM A;  3UXN A;  3ZD9 A;  3Q8P B;  1S0V A;  1Z00 A;  3KHH A;  2BKE A;  5BPC A;  2ZHA A;  5KT5 A;  5L1L A;  4GXK A;  4ED8 A;  1HJP A;  2AU0 A;  1NK5 A;  4RT3 A;  2M9N A;  7ICF A;  2ID1 A;  7ICK A;  5KG0 A;  9ICV A;  1LV5 A;  4RQ0 A;  3AU6 A;  3C1Y A;  4NY8 A;  5DQG A;  4YD2 A;  3RB0 A;  3RJG A;  4IR9 A;  2F1J A;  1JIH A;  2NRX A;  2KTQ A;  4IR1 A;  4B9S A;  4B9T A;  3TAP A;  4JWM A;  3RH6 A;  7ICO A;  3PX6 A;  3BQ1 A;  5J2J A;  3BDP A;  2XCA A;  5J2K A;  1JAJ A;  4X4Q A;  2BPF A;  8ICW A;  2XY6 A;  4PHE A;  4ECW A;  5DBB A;  2ASD A;  4YXM A;  3SI8 A;  2I1Q A;  4IQV A;  4RQ6 A;  2R8I A;  4ECT A;  4ED1 A;  5HRL A;  4ELU A;  4I2D A;  4F50 A;  1ZQE A;  3M9M B;  4BWM A;  5KG2 A;  4E8F A;  3OUY B;  4YFK A;  3MFH A;  2P66 A;  4RQ3 A;  1VJ7 A;  4I29 A;  4KMU A;  4DLE A;  9ICW A;  3OJS A;  1IM4 A;  4R64 A;  1MIW A;  3BJY A;  3E2E A;  1NO5 A;  8ICA A;  3M9O B;  9ICE A;  2M2W A;  4ECR A;  4J9Q A;  2KN7 A;  2V4R A;  2PXI A;  3PW4 A;  4EZ6 A;  1JX4 A;  4TUQ A;  3C5G A;  4BDP A;  4QZF A;  3GIJ A;  4Q8F A;  1T4G A;  2BQ3 A;  1Q79 A;  1BGX T;  4DFK A;  4M9G A;  4UAY A;  3JPT A;  3GIL A;  5J0O A;  1BVS A;  2P6U A;  4RUA A;  3QZ8 A;  3HX0 A;  1R8A A;  3TI0 A;  1TV9 A;  4DEZ A;  2ZUC A;  4I2I A;  2BCU A;  3ZDC A;  5J0P A;  3Q8M A;  5KFA A;  4DQP A;  3AUO A;  2M2U A;  4BXO A;  4F3O A;  4UD4 A;  4C8L A;  2J6U A;  5J2G A;  1TK5 A;  3OVA A;  1BPD A;  3C21 A;  2BQR A;  3RJE A;  5L9X A;  4AT9 B;  4DL6 A;  2XCP A;  3MR6 A;  4B9N A;  3MDC A;  3Q8L A;  4EEY A;  1KNY A;  3UPQ A;  1Z3E B;  4TQS A;  2HHQ A;  3SV3 A;  8ICY A;  1UEV A;  3BQT A;  5HP4 A;  5KG5 A;  4NM2 A;  4RQ4 A;  3Q8K A;  3T5L A;  3JZ0 A;  4WC0 A;  3OVS A;  3PML A;  4DOA A;  5J0Q A;  5DEC A;  4F4W A;  2FPL A;  4EYH B;  4ECY A;  3PVX A;  4GXI A;  1RPL A;  4BXO B;  4ECQ A;  4KLH A;  9ICU A;  3RJJ A;  4QZ9 A;  3G6Y A;  1TK0 A;  5HRF A;  3TQ1 A;  1V4A A;  1HUZ A;  1R8B A;  4X5V A;  2B21 A;  2IHN A;  1BPY A;  2C22 A;  4UAZ A;  5KFY A;  1NKE A;  1BNP A;  2V4Q A;  1JMS A;  2IBK A;  4KLI A;  4F2S A;  4RNO A;  1XU4 A;  2ISO A;  3JPQ A;  8ICS A;  4O5E A;  8ICI A;  2JZB B;  2KFN A;  9ICQ A;  2RFF A;  4WC4 A;  5J0X A;  2R8H A;  4ECX A;  1N48 A;  4X4N A;  4F5O A;  2XGP A;  4YMO A;  3UXO A;  1Z00 B;  3H8W A;  3Q8S B;  3EZ5 A;  1XC9 A;  1HUO A;  2BCS A;  3HW8 A;  9ICB A;  7ICV A;  4R66 A;  2PI5 A;  4ATB A;  4CCH A;  2NRZ A;  4YR2 A;  4RQ5 A;  3GIK A;  5HRG A;  3GV7 B;  4LZG A;  2PFO A;  5HHH A;  3K75 D;  5D46 A;  2F1H A;  3MDA A;  1TAU A;  4UB1 A;  4ELT A;  4E80 A;  3RAX A;  5IIK A;  1ZJN A;  7ICS A;  1MIY A;  4FHX A;  4M9L A;  2PFP A;  4Z6E A;  2O5A A;  1ZQS A;  1U9L A;  4QW8 A;  5DDY A;  4YVZ A;  5CB1 A;  1TFW A;  2HHP A;  1YLQ A;  2ZJ5 A;  2M2V A;  4M6W A;  3RB3 A;  1ZQM A;  4J9R A;  4UB2 A;  3GV5 B;  5KG4 A;  1ZQR A;  1BPE A;  9ICM A;  7ICP A;  3AU2 A;  2KFZ A;  2ZH7 A;  4KLS A;  2DR7 A;  4RPZ A;  3OJU A;  3KHG A;  3RBE A;  5DB8 A;  5J0U A;  3HP6 A;  2C2E A;  5L1K A;  1BPX A;  5HML A;  1ZQI A;  2IHM A;  7ICH A;  4AT8 B;  3PR4 A;  4X4V A;  4P4O A;  4B9V A;  4WC1 A;  3ORY A;  3MFI A;  5KT7 A;  2DFL A;  3C5F A;  3PV8 A;  4X4P A;  3OV7 A;  1Q78 A;  2ZH1 A;  2ATL A;  2ZUB A;  1L3S A;  1RXW A;  1MIV A;  3QZ7 A;  2Q0Z X;  4QWC A;  4I2H A;  9ICG A;  1R89 A;  2O1P A;  3UPS A;  4DQS A;  5HHI A;  8ICZ A;  2NRW A;  5KTQ A;  4PHD A;  4DFM A;  7ICT A;  3C2L A;  1D9F A;  4X4T A;  1ZQN A;  4NM1 A;  1KFT A;  3M9N B;  9ICI A;  1L3T A;  4DSE A;  1ZQK A;  4MF2 A;  1NJZ A;  4IRC A;  2AGO A;  4O5K A;  1KTQ A;  2BDP A;  1D8L A;  4P4P A;  1QLN A;  5HRI A;  4Q8E A;  5KFB A;  4F93 B;  1NJW A;  3MGI A;  4YR0 A;  4M9H A;  1NK0 A;  4P2H A;  4UB4 A;  1L3U A;  5KFK A;  2JEF A;  3T5J A;  4PGX A;  2XGQ A;  5DG9 A;  4DF8 A;  4QZC A;  4TQR A;  1ZJM A;  4RQ2 A;  1N56 A;  3RJH A;  4FBT A;  4C8O A;  3OSN A;  3V6J A;  4X4U A;  8ICL A;  4I2A A;  4YP3 A;  3G6X A;  1TVA A;  4DS4 A;  4Q44 A;  1BNO A;  3GII A;  4BGD A;  3QEB Z;  2ZJ8 A;  1U47 A;  2DRA A;  2DPJ A;  3B0X A;  3C2K A;  3QEA Z;  1ZQF A;  2VA3 A;  4M2Y A;  4KLG A;  1K1Q A;  1RYS A;  1ZQD A;  3RJF A;  4XQ8 A;  4JWN A;  2RDJ A;  4NLZ A;  2PBE A;  3K4G A;  4F5R A;  1ZQV A;  4MEY A;  9ICH A;  1TAQ A;  1V9P A;  2DPI A;  4K4G A;  4XRH A;  4R8U B;  4AT7 A;  4F91 B;  4IG8 A;  4NKU A;  2A1J B;  2ZH2 A;  4MFA A;  1XSL A;  2BCR A;  4IQT A;  3SZ2 A;  3V6K A;  4I27 A;  2AQ4 A;  4M5D A;  1SL2 A;  5BOL A;  5JUM A;  4ED3 A;  4ED7 A;  2C28 A;  5KG7 A;  2KZ3 A;  4TUP A;  3TAN A;  3MR3 A;  1JXL A;  7ICM A;  8ICE A;  1PX5 A;  3T5K A;  5KT3 A;  3H8J A;  3HIY A;  4EBD A;  4M04 A;  4E0D A;  1QSS A;  1KSP A;  1DGS A;  3UQ0 A;  3H3A A;  2XY7 A;  2FLN A;  1X9S A;  8ICV A;  4JUZ A;  2W9B A;  3WFO A;  3HJ1 A;  2MUT B;  1NK4 A;  1D9D A;  4YCX A;  2IA6 A;  4PH5 A;  9ICF A;  1B22 A;  3OVB A;  4DO9 A;  4Z6F A;  3PR5 B;  5KFJ A;  4KN4 A;  1ZQW A;  1JQR A;  3C23 A;  4ED2 A;  2BCV A;  3M8R A;  4IQU A;  2FLL A;  1CUK A;  1ZQZ A;  3RH5 A;  5J29 A;  4QZE A;  3ISB A;  3FYH A;  2W8L A;  2PI4 A;  1ZQH A;  3TFS A;  5EWG A;  4F92 B;  4JV2 A;  2AQ0 A;  4QWD A;  2XO7 A;  1C7Y A;  3RR8 A;  4EP7 A;  5IIJ A;  2BPC A;  4M47 A;  3SV4 A;  4IRD A;  4O3P A;  3PX0 A;  5DG8 A;  4EZ9 A;  4QZ8 A;  2ZH8 A;  4O9M A;  4KTQ A;  4EBE A;  5BOM A;  2R8J A;  3LDA A;  3AQL A;  1RXV A;  1LB2 B;  1COO A;  7ICN A;  4UQG A;  5DED A;  5HRK A;  9ICN A;  3HWT A;  8ICB A;  4HYK A;  9ICT A;  3AQM A;  4FO6 A;  3IM1 A;  5HNK A;  1S0O A;  8ICP A;  4XQ7 A;  4X4S A;  1VFG A;  3WFP A;  2H5X A;  1ZQP A;  2I9G A;  3B0Y A;  3RJI A;  3KHL A;  1DK2 A;  1L5U A;  4J9M A;  1NZP A;  5DB9 A;  4J9O A;  3ISD A;  4DL5 A;  3RB6 A;  1MSW D;  4RWP A;  8ICQ A;  2ASL A;  3PO5 A;  3AQN A;  1T7P A;  2W9C A;  4J9P A;  2RDI A;  4GXJ A;  4ED0 A;  4YMM A;  4Q45 A;  3PW7 A;  4QZB A;  4PHP A;  4DWI A;  9ICA A;  4M9J A;  4DSK A;  4RZR A;  2ALZ A;  4R63 A;  3OHB A;  4DL7 A;  3PW0 A;  3PW5 A;  4LZD A;  5KFD A;  8ICU A;  5KFX A;  3LWL A;  2ZH9 A;  2C2D A;  3RTV A;  2ZTC A;  4TUR A;  3RRG A;  2BHN A;  4NLN A;  4I2E A;  9ICS A;  4FHW A;  4ED6 A;  4RU9 A;  1D8Y A;  2J6S A;  4LVS A;  1DK3 A;  2BE3 A;  2PFQ A;  4O3R A;  3AQK A;  4WCW A;  2PFN A;  2C2R A;  2ISP A;  3JPP A;  3M8S A;  3Q8R B;  3H40 A;  1ZYQ A;  4YD1 A;  4I2C A;  1KLN A;  5DGA A;  4PPX A;  5KFN A;  5J2I A;  1TFR A;  4UBC A;  4BWJ A;  2DR8 A;  2ZH4 A;  4DF4 A;  1TKD A;  4KLF A;  4DQI A;  7ICI A;  4MF8 A;  4F8R A;  4F5P A;  1NK6 A;  1KRP A;  2HHX A;  3ZDA A;  4K4H A;  4X4R A;  2UVV A;  1A77 A;  5KFG A;  2DR9 A;  2ZH6 A;  1Y88 A;  4YN4 A;  3PW2 A;  4ECZ A;  1WCN A;  2MAX A;  5F9N A;  5J2D A;  3MR5 A;  3HPO A;  4ECV A;  3BQ2 A;  2UVU A;  4QZD A;  4F4X A;  1TK8 A;  2IMW P;  4RWO A;  1NJY A;  9ICJ A;  5HRD A;  4AT7 B;  4F4Z A;  4DQQ A;  3OSP A;  3BQ0 A;  3T3F A;  2ZHB A;  4O0I A;  1XSP A;  3RB4 A;  4C8N A;  1T8E A;  1S0M A;  2LYH A;  3THV A;  4B9M A;  8ICT A;  1U49 A;  4NLG A;  1ZQJ A;  2ZH3 A;  4RWQ A;  5CP2 A;  3KHR A;  8ICH A;  2NRT A;  5KG1 A;  2JEJ A;  5CWR A;  9ICX A;  4PGQ A;  1ZQC A;  5KFO A;  1S76 D;  4KLM A;  5KT2 A;  3SYZ A;  1KDH A;  4KLE A;  8ICC A;  1H38 A;  2F1I A;  4PGY A;  1FA0 A;  1ZQU A;  4GC6 A;  3GDX A;  4QZG A;  3V7J A;  3HJ4 A;  3L9D A;  4J9S A;  4AT9 A;  3WFS C;  2AGP A;  5EWF A; 
#chains in the Genus database with same CATH topology
 4MFF A;  4TUS A;  1JXE A;  4DSJ A;  3DDH A;  2XY5 A;  4O5C A;  7ICG A;  1Q8K A;  4NL9 C;  1KFD A;  1ZQA A;  4KM5 A;  2L5Y A;  4DFJ A;  4G3I A;  1J2M A;  2HBK A;  4C8M A;  1NKB A;  1QTM A;  4K4I A;  1X9M A;  1ARO P;  3ER8 C;  2YY6 A;  2JZB A;  1UT8 A;  4F4Y A;  2F77 X;  3V72 A;  1X66 A;  4ZH4 A;  4O3N A;  5KNI A;  4UAW A;  2FLP A;  4WQL A;  4AYB F;  2W9C B;  3MAB A;  4FH3 A;  2IOF K;  4UB6 U;  4RUC A;  3PHZ A;  5DG7 A;  2FE9 A;  1ZQ1 C;  4Y2Q A;  1X40 A;  1QSY A;  5DGB A;  2A19 A;  1N60 A;  4RPY A;  2BCQ A;  3I76 A;  4KLU A;  4K9A A;  4DOC A;  4QZH A;  1ZQO A;  8ICG A;  4QWE A;  5AK6 A;  1JRP A;  4JV1 A;  5L1J A;  2ZTE A;  4IQW A;  1WWU A;  5J2F A;  3RJK A;  5H2F U;  1B0X A;  2W9M A;  1PVP A;  5J2E A;  1SV0 C;  5DQH A;  3MBY A;  1EXN A;  4DLG A;  7ICJ A;  2VA8 A;  3JYY A;  5KFM A;  8ICM A;  1NKC A;  5HMM A;  5J2C A;  4WC7 A;  5KFL A;  3H0R B;  2JEG A;  1A76 A;  3WK5 A;  5KAI U;  1F5S A;  3OGU A;  3I1Y A;  2GOL A;  5E79 U;  2HVH A;  4I28 A;  1ZQL A;  1VDV A;  4XJE A;  4NKT A;  2KZZ A;  3UXP A;  4DSI A;  4FS1 A;  3KZX A;  2W43 A;  5AM3 A;  7ICQ A;  1JUD A;  2G5I B;  3OUY A;  3FDS A;  3ICX A;  2HSZ A;  5ALZ A;  4ECS A;  2BPG A;  3NRZ A;  4U6P A;  3F53 A;  5D49 A;  2DR5 A;  1NK9 A;  2HHS A;  3C2M A;  2M2T A;  3LWM A;  1NK8 A;  5TZV A;  4UAS A;  1XS9 D;  2G07 A;  2DRB A;  5IIO A;  1UA1 A;  1XO1 A;  5AKZ A;  7ICU A;  1UEU A;  3ER9 B;  5J0T A;  1TE2 A;  3MGH A;  1S0N A;  2BQU A;  2OWO A;  2K60 A;  1XWL A;  2NRK A;  2VKQ A;  4DL2 A;  3JPO A;  1KBU A;  5DQI A;  5IIL A;  2R8K A;  1OU5 A;  5DLG A;  5KFZ A;  2ZG6 A;  1KEJ A;  4ECU A;  3EYZ A;  2UVR A;  2KIC A;  5ALE A;  3DEE A;  4NLK A;  4KLD A;  1IXR A;  2FI1 A;  3QUC A;  1SKS A;  5ALL A;  3WK8 A;  1K5O A;  3PMN A;  1NOM A;  2E1F A;  1KW4 A;  1Z00 A;  3C28 A;  5L1L A;  2AU0 A;  1HJP A;  2EWR A;  7ICF A;  5KG0 A;  2KJ8 A;  3C1Y A;  4NY8 A;  4IR9 A;  2GA9 D;  2KTQ A;  1S8O A;  1N62 A;  3PX6 A;  4OCZ A;  2KVS A;  3K1Z A;  2G0A A;  2I1Q A;  4ECT A;  5JTG A;  4P0Q B;  3M9M B;  5KG2 A;  3OUY B;  2P66 A;  4I29 A;  2WF6 A;  9ICW A;  5HR6 A;  4R64 A;  3NRW A;  4NXU A;  3OPX A;  4Y2J A;  1NO5 A;  2M2W A;  1LKY A;  1V97 A;  2E8N A;  2EAM A;  4KMO B;  2BQ3 A;  4M9G A;  1OW5 A;  3GIL A;  2B4V A;  3HX0 A;  2ZUC A;  1ECW A;  4DQP A;  3AUO A;  2DWQ A;  2OM6 A;  2J6U A;  5J2G A;  1TK5 A;  4C8L A;  3OVA A;  1GPJ A;  3ERC C;  1GO3 F;  3MR6 A;  1AQ6 A;  4K9B A;  4EEY A;  3UPQ A;  1Z3E B;  4TQS A;  1SIJ A;  2N1R A;  4O3M A;  3T5L A;  3PML A;  3RF9 A;  3HIL A;  4EYH B;  4ECY A;  1FFU A;  4GXI A;  4UAZ A;  2V4Q A;  4F2S A;  2XVT A;  4RNO A;  2ZIU A;  8ICS A;  4WC4 A;  9ICQ A;  2K4P A;  4ECX A;  2R8H A;  5JU5 A;  2XGP A;  4EV6 A;  1Z00 B;  2H3Q A;  3NVZ A;  3EZ5 A;  1XC9 A;  2NV3 A;  4R66 A;  3GIK A;  5HRG A;  5HHH A;  5IIK A;  1MIY A;  2PFP A;  4QW8 A;  5DDY A;  4RQN A;  4YVZ A;  1TFW A;  3M6Z A;  4UB2 A;  3GV5 B;  4J03 A;  5EE1 A;  7ICP A;  2KFZ A;  4KLS A;  4RPZ A;  3OJU A;  3KHG A;  5AKJ A;  2BBH A;  4AT8 B;  2IHM A;  5KT7 A;  3PV8 A;  3OV7 A;  2ZH1 A;  2ATL A;  2ZUB A;  5ALX A;  1Q46 A;  4QWC A;  4I2H A;  5GTH U;  3AMZ A;  4US9 A;  8ICZ A;  2NRW A;  4X4T A;  1D9F A;  1ZQN A;  4EGW A;  1ZD2 P;  4DSE A;  4PL2 A;  1NJZ A;  2AGO A;  4P4P A;  2ZIV A;  1RM6 C;  4US8 A;  1NK0 A;  5KFK A;  4DF8 A;  1ZJM A;  1N56 A;  5AKL A;  4QZC A;  4RQ2 A;  2BZF A;  3V6J A;  2RQ5 A;  4X4U A;  1TVA A;  1BNO A;  4K97 A;  1FFV A;  3QEA Z;  3UM9 A;  2VA3 A;  1XO0 A;  4M2Y A;  4WC1 A;  4NLZ A;  2YQE A;  2RDJ A;  3K4G A;  1ZQV A;  9ICH A;  2OHF A;  4K4G A;  4PJ0 U;  4I0U A;  2YN4 A;  2KEY A;  4IG8 A;  3CRX A;  2A1J B;  4MFA A;  2LPE A;  4OO1 J;  4IQT A;  2A3V A;  1SL2 A;  5BOL A;  4Y2P A;  3TAN A;  1PX5 A;  5ALU A;  4OD0 A;  2ZIU B;  2KG5 A;  3H3A A;  2KIW A;  2FLN A;  2W9B A;  2QB0 B;  2Y0S C;  1JQR A;  4FO1 A;  1Z1B A;  4UAR A;  4LEV A;  4QZE A;  3ISB A;  2W8L A;  3TFS A;  4JV2 A;  4F92 B;  2AQ0 A;  1C7Y A;  4M47 A;  4EZ9 A;  4WOY A;  2VIX A;  2R8J A;  3LDA A;  1RXV A;  4X4V A;  8ICB A;  2GAF D;  2EZX A;  1VFG A;  2W04 A;  1IIP A;  1PK1 B;  3KHL A;  2D8C A;  1DK2 A;  4J9M A;  5CFU A;  5DB9 A;  2VJ4 A;  2GH1 A;  3ISD A;  3RB6 A;  4RWP A;  2ASL A;  1ZXI A;  1T7P A;  3QU7 A;  4QZB A;  2ALZ A;  1WUD A;  4UB8 U;  2Z7J A;  2ZH9 A;  4TUR A;  4WC3 A;  4I2E A;  2W54 A;  2J6S A;  2BE3 A;  3AQK A;  4WCW A;  2ISP A;  3H40 A;  1KLN A;  4OAI Z;  3D2N A;  1TFR A;  5KL8 B;  1O03 A;  4Y2T A;  3WK6 A;  2QAR B;  1KQQ A;  4DQI A;  1P7D A;  4MF8 A;  4F8R A;  1NK6 A;  3BZK A;  2DUY A;  1WCN A;  1ZOL A;  4BX9 C;  4ECV A;  4F4X A;  2IMW P;  2CXY A;  5HRD A;  4F4Z A;  3OSP A;  4K8V A;  3PSP A;  3T3F A;  3M7D A;  3AQE A;  1ZQJ A;  2ZH3 A;  4RWQ A;  3N7S C;  3BS7 A;  5CWR A;  1ZQC A;  5KFO A;  1KDH A;  2HOQ A;  3A0H U;  4JB3 A;  3GDX A;  3V7J A;  3WFS C;  4J9S A;  3FAH A;  5EWF A;  4M04 A;  2F8K A;  2WAQ C;  4I2B A;  1L6N A;  5AKY A;  4Y2S A;  2KJ5 A;  2Y1J A;  3MR2 A;  4J9K A;  1RZT A;  4BXO B;  3EWA A;  4GLX A;  4WC5 A;  3WKB A;  3H7I A;  3QE9 Y;  1T3Q A;  5J2A A;  1SZH A;  1U45 A;  2EDU A;  2BGW A;  5AM0 A;  4MFC A;  3V6H A;  1K1S A;  2ZUD A;  1QSL A;  1L8O A;  2KP7 A;  3QYP A;  2E8O A;  3F2B A;  1ED1 A;  3ZDE A;  3PY8 A;  5HC9 A;  2VA2 A;  7ICR A;  3D6J A;  3TKA A;  4I2F A;  3LQC B;  1ZET A;  4FS2 A;  5KG6 A;  2MSN A;  4ATB B;  2QKQ A;  3C1Z A;  3RBD A;  4E7X A;  2GLE A;  2W9A A;  2Y9U A;  8ICK A;  1X9W A;  3QU5 A;  4RQ8 A;  4FH5 A;  4M6W B;  4FHV A;  3TFR A;  2AJQ A;  3ETL A;  5AKG A;  3U26 A;  5DKW A;  2AHO B;  3WFR E;  1X6I A;  4KLT A;  2F3N A;  5KFS A;  3GQC A;  2ZXI A;  2JGA A;  5ALR A;  5AI9 A;  3IP4 B;  4PHA A;  4DS5 A;  1N61 A;  1ZQB A;  3ONN A;  2W8K A;  5AHX A;  4RNN A;  5KFI A;  1BPB A;  9ICK A;  2ZIW B;  3H39 A;  1Z4O A;  1ZQQ A;  4P4M A;  3T5H A;  7ICE A;  4NV0 A;  3H38 A;  5AIB A;  3GU3 A;  2BR0 A;  2KNJ A;  4UBB A;  3NVY A;  4XUS A;  2UVW A;  1QQ6 A;  3PO4 A;  2KZM A;  8ICJ A;  2RHF A;  3BQ7 A;  1WYG A;  4F5N A;  4B6J A;  5J0R A;  5DBC A;  2KV2 A;  2K8A A;  2MUT A;  3N7R C;  5KFU A;  4GC7 A;  4UAV A;  1ZQT A;  4FHP A;  9ICC A;  2YML A;  2YMM A;  3M1Y A;  3GFK B;  3MGV A;  4X0A A;  5EOZ A;  3JPR A;  2HOF A;  4F4K A;  3PST A;  1ZQX A;  3TAQ A;  5AK4 A;  2WF5 A;  5C5J A;  5J2B A;  1UA0 A;  4KLQ A;  2HHU A;  2FPK A;  4ICA A;  2J6T A;  3RRH A;  9ICR A;  1UPH A;  4O3O A;  4S3N A;  2HW3 A;  3NVW A;  5KFT A;  5F9L A;  1SL0 A;  4UAT A;  1XSN A;  5GTI U;  4QWB A;  2KK0 A;  4Z6D A;  2HN2 A;  1MQ2 A;  4M0A A;  2NYV A;  1SWV A;  4QWA A;  1ZQG A;  2WFA A;  4CGZ A;  4MHV A;  5EWE A;  5ALD A;  2K8B B;  3UXN A;  3IG5 A;  3ZD9 A;  3Q8P B;  2E8M A;  4O69 A;  1JAL A;  5BPC A;  1Q3U A;  5KT5 A;  4ED8 A;  2WB1 C;  2JRZ A;  1NK5 A;  4HAI A;  4NLB A;  4RQ0 A;  4YD2 A;  2F1J A;  1RG6 A;  1JIH A;  2NRX A;  4IR1 A;  4B9S A;  3RH6 A;  7ICO A;  2LHT A;  3BQ1 A;  5J2J A;  3F2D A;  2XCA A;  4PHE A;  5CFT A;  5AKE A;  4RQ6 A;  2R8I A;  3AM9 A;  2PKE A;  4F50 A;  1ZQE A;  4BWM A;  4YFK A;  4RQ3 A;  1VJ7 A;  2Y0S F;  4KMU A;  4DLE A;  1MIW A;  1SXD A;  4KX3 A;  4C80 A;  3M9O B;  9ICE A;  4EZ6 A;  5CEH A;  1JX4 A;  4TUQ A;  3C5G A;  2HI0 A;  2G5H B;  4I2I A;  1IV8 A;  5J0P A;  5KFA A;  2ESE A;  3OTQ A;  3EF2 A;  4UD4 A;  2HBM A;  5ALQ A;  3C21 A;  4AT9 B;  5HR7 A;  3Q8L A;  2OEH A;  2WF9 A;  5HP4 A;  5KG5 A;  4RQ4 A;  4HX0 A;  3OVS A;  4DOA A;  5J0Q A;  4F4W A;  2FPL A;  3HJE A;  2B56 A;  1RPL A;  1V4A A;  3G6Y A;  2JHD A;  3BS5 A;  3TQ1 A;  4ZOH C;  1R8B A;  2B21 A;  2IHN A;  1BPY A;  1NKE A;  3QU2 A;  1JMS A;  1XU4 A;  8ICI A;  2JZB B;  1UQV A;  3F2C A;  5EE9 A;  4F72 A;  1HUO A;  3D2S A;  4CCH A;  2PFO A;  4IC9 A;  3MDA A;  3K75 D;  5D46 A;  2F1H A;  2XIC A;  4UB1 A;  4Y2X A;  2EAP A;  4Z6E A;  4G9B A;  2HHP A;  1YLQ A;  3HKZ F;  2M2V A;  4J9R A;  3TAD A;  1ZQR A;  9ICM A;  3AU2 A;  2ZH7 A;  2NO5 A;  5J0U A;  2C2E A;  4NL9 A;  3PR4 A;  4B9V A;  3MFI A;  2DFL A;  5AI8 A;  1L3S A;  5AKH A;  2Q0Z X;  3KOO A;  2WAQ F;  4PHD A;  4DFM A;  3C2L A;  2LBO A;  1O08 A;  4LEY A;  4NM1 A;  3M9N B;  2RRD A;  9ICI A;  1ZQK A;  5HRI A;  4IRC A;  4O5K A;  1KTQ A;  1D8L A;  1QLN A;  2HBJ A;  4Q8E A;  5AM2 A;  2LKY A;  1NJW A;  2W3S A;  2AH5 A;  2W3R A;  2MA1 A;  4M9H A;  5ALH A;  1L3U A;  4PGX A;  4EEB A;  4EX7 A;  4FZM A;  2H3F A;  4YP3 A;  3G6X A;  4Q44 A;  3GII A;  4BGD A;  3PZP A;  4QJF B;  2LYB A;  2PBE A;  1K1Q A;  1RYS A;  5AI4 A;  4XQ8 A;  4A8E A;  4F5R A;  4LJX A;  4AP9 A;  1S5L U;  3NVO A;  1CI4 A;  3K1R B;  1JRO A;  3IDW A;  3KD3 A;  4PZN A;  1XSL A;  3V6K A;  2KSO A;  3BS5 B;  2AQ4 A;  5JUM A;  3DV9 A;  5KG7 A;  4C7Z A;  5KT3 A;  4UAU A;  3HIY A;  3IRU A;  1T94 A;  3UQ0 A;  2XY7 A;  4JUZ A;  1SV0 A;  1NK4 A;  2IA6 A;  9ICF A;  3ETR A;  4PH5 A;  4WJ3 B;  4Z6F A;  3M8R A;  1ZQZ A;  5J29 A;  3WKE A;  1ZQH A;  3RR8 A;  5IIJ A;  1L8L A;  4O3P A;  3CK6 A;  4KTQ A;  4EBE A;  5BOM A;  2D6F C;  7ICN A;  1COO A;  4UQG A;  5DED A;  5HRK A;  3HWT A;  4X4S A;  3IM1 A;  5HNK A;  1HIW A;  1ZQP A;  3RJI A;  3UMG A;  3NKU A;  1KL9 A;  3L3F X;  3PO5 A;  3AQN A;  4GXJ A;  4ED0 A;  3PW7 A;  5AIC A;  4DL7 A;  3PW0 A;  3PW5 A;  5KFX A;  2W11 A;  3R9K A;  4ED6 A;  4CF4 A;  1DK3 A;  3QNM A;  5AKK A;  2PFQ A;  4O3R A;  2PFN A;  3M8S A;  3Q8R B;  3WKD A;  3CYM A;  1ZYQ A;  4YD1 A;  4I2C A;  5DGA A;  3K7D A;  4UBC A;  4BWJ A;  2G09 A;  1MA7 A;  4K99 A;  4DF4 A;  3CNH A;  4F5P A;  3ZDA A;  5AI0 A;  3RFA A;  2ZH6 A;  1Y88 A;  4ECZ A;  5F9N A;  3BQ2 A;  2H3Z A;  3BQ0 A;  3H0M B;  2KD1 A;  2VJ5 A;  2ZXH A;  4RQM A;  5FP0 A;  1T8E A;  8ICT A;  2KSO B;  4NLG A;  2H3V A;  1COK A;  5F3X B;  2NRT A;  2IOF A;  1LKY B;  4KLE A;  3SQI A;  1FA0 A;  3L9D A;  2BDU A;  3OHA A;  1S77 D;  3ZD8 A;  4NXV A;  2GWS A;  2XC9 A;  4I2G A;  4QZA A;  4EBJ A;  1NK7 A;  3UMC A;  5KFQ A;  3H37 A;  5CA7 A;  5J0W A;  1U4B A;  3C66 A;  2JH7 A;  1BPZ A;  5AM4 A;  2IHO A;  4JK1 A;  2WB1 F;  2FPM A;  1ZD5 A;  4F5Q A;  2W7O A;  4EBK A;  4KLL A;  4FZL A;  4UD5 A;  5KFE A;  4Q43 A;  5KFV A;  1U48 A;  4NLC A;  3ZDD A;  3HT3 A;  2PMZ C;  4J9N A;  5J0Y A;  4C8K A;  4DL4 A;  4GIB A;  5KFR A;  2EH9 A;  1S97 A;  1FIQ A;  4LT6 A;  3NVV A;  1UT5 A;  2DQN B;  5CHG A;  2YMQ A;  5ALI A;  5DB7 A;  4WBY A;  1DOQ A;  3GV8 B;  4X4O A;  4AYB C;  4M9N A;  2DVI A;  4EBC A;  1ZD4 A;  2KE7 A;  5DDM A;  3T79 A;  2LI6 A;  4EYI B;  5III A;  2JEI A;  4LEW A;  8ICF A;  4OJP A;  5D4B A;  1JN3 A;  4B9U A;  4RWN A;  5IIN A;  2WHE A;  4KN7 A;  4RNM A;  4JMU A;  3GIM A;  3SD7 A;  3VCB A;  1RQN A;  3KFU F;  3PNC A;  4QZI A;  4R65 A;  2Q66 A;  1Q3V A;  3H4B A;  2OH2 A;  4ELV A;  5IIM A;  4RQ7 A;  3KBB A;  1S10 A;  1KFS A;  3JPS A;  4UB5 A;  4J9L A;  2P35 A;  3IG8 A;  2KKV A;  4Z6C A;  2V9W A;  3H0L B;  1SKW A;  5KFP A;  5KFC A;  4MEX A;  1V85 A;  4WC6 A;  1SGG A;  2HHW A;  2ZIV B;  2CRX A;  4DFD A;  3C18 A;  4OAF A;  3WKC A;  1UET A;  4R8U A;  4FBU A;  4CE6 A;  8ICO A;  5ALO A;  7ICL A;  5DBA A;  5KT4 A;  3H4D A;  1SKR A;  1V38 A;  4I2J A;  3RH4 A;  4B9L A;  4DSF A;  4X0B A;  3ZI4 A;  3I28 A;  1X6J A;  4UB3 A;  3TAR A;  5CJ7 A;  3G6V A;  3RR7 A;  2P6R A;  1PUZ A;  3ZDB A;  5KAF U;  1VJ5 A;  5KFF A;  2G08 A;  3CP8 A;  4IRK A;  2FDR A;  4QIW C;  4DL3 A;  4DOB A;  1X2I A;  5L1I A;  2YTU A;  5B3Q A;  2ZIX A;  3V7L A;  8ICN A;  4XA5 A;  2W9B B;  2F2A B;  3V7K A;  4JV0 A;  4YXJ A;  9ICP A;  5J0S A;  2AXT U;  1NJX A;  4ACO A;  2KVC A;  4WC2 A;  2ZH5 A;  5CR0 A;  5B5E U;  5HRB A;  3BZC A;  2KIV A;  5KFW A;  2Y1I A;  1PZN A;  3MC1 A;  1SZP A;  1QQ5 A;  3NUQ A;  4Y2R A;  2HDO A;  3E58 A;  2OYY A;  3KHH A;  1HEK A;  2K4H A;  2ZHA A;  4GXK A;  4RT3 A;  2M9N A;  4CF5 A;  7ICK A;  1LV5 A;  4Y2Y A;  4WH5 A;  2D3D A;  2E8P A;  5DQG A;  3EUB 2;  4Y2U A;  4NXT A;  4EED A;  1PVQ A;  4X4Q A;  2BPF A;  8ICW A;  2XY6 A;  2ASD A;  3ALR A;  4YXM A;  3SI8 A;  4IQV A;  1L7O A;  2E5S A;  3SAH A;  4E8F A;  3NWI A;  5ALM A;  5D63 A;  5EE0 A;  1XNS A;  3E2E A;  8ICA A;  1FO4 A;  1NNL A;  4ECR A;  3PW4 A;  2PXI A;  3F5E A;  4NWI A;  4BDP A;  4QZF A;  2XI9 A;  4Q8F A;  5J8Y A;  3M6K A;  1Q79 A;  3QZ8 A;  4RUA A;  2I5H A;  1TV9 A;  3ZDC A;  2M2U A;  4F3O A;  1ZD3 A;  1BPD A;  3C29 A;  2BQR A;  2YMP A;  4Y2V A;  5K4L A;  2XCP A;  1QH9 A;  4EEN A;  3MDC A;  1KNY A;  8ICY A;  3BQT A;  4WC0 A;  2K8C B;  1F44 A;  3JZ0 A;  5DEC A;  3PVX A;  9ICU A;  5HRF A;  4ECQ A;  4KLH A;  3RJJ A;  3N7P D;  4QZ9 A;  1TK0 A;  1IG6 A;  2JV3 A;  3AEV A;  2C22 A;  2IBK A;  4KLI A;  2ISO A;  4O5E A;  3NS1 A;  1N48 A;  4F5O A;  4YMO A;  7ICV A;  2EAN A;  2H3I A;  5B3P A;  3KKA A;  1TAU A;  2KMD A;  4ELT A;  4E80 A;  3RAX A;  4FHX A;  2O5A A;  1M6Y A;  5CB1 A;  2ZJ5 A;  3RB3 A;  1RYU A;  2M0N A;  1BPE A;  3PSF A;  4CDG A;  5CFS A;  3RBE A;  1RQL A;  3HP6 A;  5L1K A;  5HML A;  2MRL A;  4P4O A;  2FJ6 A;  3ORY A;  5ALY A;  4X4P A;  2O6K A;  3AQF A;  2RLT A;  3QZ7 A;  9ICG A;  5ALG A;  2O1P A;  1R89 A;  4DQS A;  5KTQ A;  1KFT A;  1J2N A;  1L3T A;  4MF2 A;  1SWW A;  5KFB A;  3MGI A;  2JEF A;  1LVH A;  5DG9 A;  4TQR A;  1Z1V A;  2B0C A;  2ODG A;  4I2A A;  3IN5 A;  3QEB Z;  1U47 A;  2DRA A;  2PMZ F;  2KJ9 A;  1ZQF A;  1ZQD A;  3RJF A;  1D8B A;  4MEY A;  5AIA A;  1TAQ A;  2K4E A;  4XRH A;  5AK3 A;  2ZH2 A;  2JR5 A;  2BCR A;  4M5D A;  3SZ2 A;  2C28 A;  1CRX A;  4KB6 A;  4OAH A;  2KZ3 A;  4TUP A;  2RP5 A;  1JXL A;  3KZI U;  3T5K A;  4EBD A;  4E0D A;  1SXE A;  1DGJ A;  1NI3 A;  1QSS A;  1KSP A;  3QUQ A;  1DGS A;  2W03 A;  8ICV A;  3WFO A;  2MUT B;  1D9D A;  3OVB A;  4JLZ A;  4DO9 A;  3PR5 B;  4KN4 A;  1ZQW A;  4ED2 A;  2FLL A;  2BCV A;  1CUK A;  4O6A A;  2PI4 A;  3D2Q A;  1QCK A;  3SAG A;  2BPC A;  3PX0 A;  4QZ8 A;  4O9M A;  3AQL A;  3AQM A;  4HYK A;  8ICP A;  2I9G A;  2MU2 A;  4OJO A;  3B0Y A;  1L5U A;  2DL0 A;  3HRD D;  4J9O A;  1MSW D;  3AN1 A;  2RDI A;  4PHP A;  9ICA A;  4M9J A;  4DSK A;  4RZR A;  2EAO A;  5JTI A;  4LZD A;  1N2X A;  8ICU A;  2B51 A;  3RTV A;  2ZTC A;  4NLN A;  3WK4 A;  4FHW A;  3LVV A;  1D8Y A;  2KKP A;  4PPX A;  5KFN A;  4P0Q A;  1UHU A;  2DR8 A;  1TKD A;  7ICI A;  4USA A;  1N5X A;  3OWG A;  2LYA A;  4X4R A;  1A77 A;  2DR9 A;  1J97 A;  2MAX A;  3HPO A;  2OXO A;  1TK8 A;  1NJY A;  4QIW F;  3A0B U;  4JLX A;  1X9X A;  5AKX A;  2ZHB A;  4O0I A;  1S0M A;  2LYH A;  3THV A;  2G06 A;  4GFJ A;  1U49 A;  5CP2 A;  3KHR A;  8ICH A;  2Q4T A;  2JEJ A;  2LMR A;  9ICX A;  4PGQ A;  5KT2 A;  2F1I A;  4PGY A;  5ALK A;  1DXS A;  4LEZ A;  2WTF A;  5ALJ A;  4C7Y A;  3N97 B;  1X42 A;  3EW9 A;  4O3Q A;  4CRX A;  2FCL A;  2FMQ A;  4O68 A;  5F2V O;  4BJQ A;  1WCL A;  4OJL A;  3IHQ B;  2K89 A;  3S6J A;  2HHV A;  1RYR A;  8ICX A;  5HR9 A;  2CN1 A;  4YQW A;  4OJ5 A;  1SB3 C;  2FMP A;  2FMS A;  2DF4 B;  2R8G A;  9ICL A;  2DKX A;  3H8S A;  1T3N A;  2KHQ A;  4F71 A;  3UQ2 A;  2W7P A;  5DLF A;  3N4M B;  5ALV A;  4AT8 A;  1B43 A;  3NTU A;  3LK9 A;  2HN1 A;  5AM1 A;  4RQ1 A;  1RDF A;  4FHY A;  5J2H A;  1TFY A;  4KIT B;  4F2R A;  3WFQ E;  3MCR A;  2HVI A;  1WWV A;  5KT6 A;  3EPI A;  8ICR A;  1N63 A;  4YG2 A;  3SR6 A;  5KG3 A;  4NXW A;  3O0F A;  4UW9 A;  1QQ7 A;  2Y9T A;  1B4F A;  2K4I A;  2BBJ A;  5HRE A;  9ICO A;  1MC8 A;  2ZTD A;  4NXZ A;  2JH1 A;  3WKA A;  4P0P A;  3RAQ A;  1F5A A;  4C0Z A;  2A1J A;  1R8C A;  4QNL A;  1F0M A;  1Z4N A;  3QUB A;  3EPG A;  5HRH A;  3QU9 A;  1CEZ A;  1OXJ A;  1URJ A;  2NRV A;  1WG8 A;  1PK3 A;  3VC8 A;  4DSL A;  3KTQ A;  4O67 A;  3Q8Q B;  4KLO A;  5A0L A;  5AI6 A;  5G5H A;  2QB0 A;  3AL0 B;  5ALF A;  4O3S A;  4RT2 A;  4KX5 A;  2CPR A;  2ZJA A;  2HHT A;  2AGQ A;  1L3V A;  3SMV A;  5AI5 A;  3JPN A;  5DB6 A;  2VAN A;  3NGD A;  5KL1 B;  5KFH A;  3LYS A;  4PZO A;  3QUT A;  4YMN A;  1WOT A;  1PK1 A;  4OJ6 A;  3ISC A;  1S9F A;  1MQ3 A;  1DRG A;  2B6G A;  4DFP A;  4KLJ A;  4WBZ A;  3PX4 A;  4DQR A;  1A6S A;  4RPX A;  4QW9 A;  1ZQY A;  2KOB A;  4YR3 A;  1SL1 A;  5L1M A;  2ASJ A;  3NYB A;  3L4P A;  2HCF A;  2LM1 A;  1S0V A;  2BKE A;  4C4T A;  2ID1 A;  9ICV A;  5EE3 A;  3AU6 A;  1YZ6 A;  3RB0 A;  2QAR A;  3E0F A;  3RJG A;  4B9T A;  3CW2 C;  3TAP A;  4JWM A;  3BDP A;  1JAJ A;  5ALP A;  5J2K A;  5CHE A;  3WU2 U;  4ECW A;  5DBB A;  4P0P B;  2DGZ A;  2F76 X;  5HRL A;  4ED1 A;  2GO7 A;  4ELU A;  3ED5 A;  4I2D A;  3MFH A;  2JXJ A;  3OJS A;  1IM4 A;  3BJY A;  4U7C A;  3N28 A;  3LVW A;  2DKZ A;  4J9Q A;  2KN7 A;  2V4R A;  2WF7 A;  2QB1 A;  2KHV A;  2YB1 A;  3GIJ A;  1T4G A;  2W55 A;  1BGX T;  4DFK A;  4UAY A;  3JPT A;  4N7R A;  5J0O A;  1BVS A;  2P6U A;  5TIS U;  4OAG A;  2NO4 A;  3QU4 A;  1R8A A;  1MN8 A;  3TI0 A;  4DEZ A;  2BCU A;  2JMG A;  3Q8M A;  4BXO A;  1OUQ A;  3RJE A;  5D62 A;  5L9X A;  4DL6 A;  3SAF A;  2IUB A;  4B9N A;  2HMX A;  2WF8 A;  2HHQ A;  3SV3 A;  1UEV A;  5J8Y C;  3Q8K A;  4NM2 A;  2E3T A;  4EX6 A;  3QXG A;  5ALT A;  1HUZ A;  1L7N A;  4X5V A;  1BNP A;  5KFY A;  4FE3 A;  5D61 A;  2DBY A;  1PVR A;  3JPQ A;  2KFN A;  2RFF A;  5J0X A;  4X4N A;  1YZ7 A;  3UXO A;  4C4R A;  4DCC A;  3H8W A;  3Q8S B;  9ICB A;  2BCS A;  3HW8 A;  2PI5 A;  5ALN A;  4ATB A;  2NRZ A;  4YR2 A;  4RQ5 A;  5B66 U;  3GV7 B;  2I6X A;  4NJ8 A;  4LZG A;  3TAC B;  1YT3 A;  4K96 A;  3PSI A;  2EZZ A;  1ZJN A;  4CF3 A;  7ICS A;  4M9L A;  4MKP A;  1ZQS A;  4BUG A;  1U9L A;  1NZB A;  4M6W A;  1ZQM A;  5KG4 A;  2XID A;  2DR7 A;  1KN5 A;  5DB8 A;  1BPX A;  1ZQI A;  3FC4 A;  3NAS A;  7ICH A;  3SEI A;  3HKZ C;  3C5F A;  1Q78 A;  3FM9 A;  1RXW A;  1MIV A;  3KKA C;  3UPS A;  5HHI A;  7ICT A;  3QX7 A;  5ALW A;  2A1A A;  2ZIW A;  2BDP A;  4F93 B;  2LM4 A;  4YR0 A;  3L5K A;  1TAM A;  4P2H A;  4UB4 A;  3T5J A;  5AK5 A;  2XGQ A;  3RJH A;  5C0Y A;  4FBT A;  4C8O A;  3OSN A;  1A0P A;  8ICL A;  5CRX A;  4DS4 A;  2ZJ8 A;  4PL1 A;  2DPJ A;  3B0X A;  3C2K A;  4KLG A;  4JWN A;  5T14 A;  5JRT A;  1V9P A;  2DPI A;  3GZF A;  5AM5 A;  4R8U B;  4AT7 A;  4F91 B;  4NKU A;  2EQY A;  4C4S A;  4FZN A;  2ES6 A;  4I27 A;  4ED3 A;  4ED7 A;  7ICM A;  3MR3 A;  8ICE A;  3H8J A;  2F44 A;  1VLB A;  1X9S A;  2QLT A;  3HJ1 A;  1B22 A;  4YCX A;  2E1E A;  3IV6 A;  5KFJ A;  3JCF A;  3C23 A;  4IQU A;  5ALS A;  3RH5 A;  3FYH A;  5EWG A;  3UMB A;  4QWD A;  2XO7 A;  4EP7 A;  2OCE A;  3SV4 A;  4IRD A;  3WK9 A;  5DG8 A;  2ZH8 A;  2ZIX B;  1Z19 A;  1LB2 B;  9ICN A;  9ICT A;  1KKX A;  4FO6 A;  2YX8 A;  1S0O A;  4XQ7 A;  1L7M A;  5AKI A;  3WFP A;  2H5X A;  1C20 A;  5G5G A;  4CNQ A;  4WQK A;  1NZP A;  1L7P A;  4DL5 A;  8ICQ A;  2W9C A;  4J9P A;  3WK7 A;  4YMM A;  4Q45 A;  4DWI A;  2HBL A;  1FEZ A;  4R63 A;  3OHB A;  5KFD A;  3LWL A;  2C2D A;  2YB4 A;  3F5A A;  1N5W A;  3RRG A;  2BHN A;  9ICS A;  1SV4 A;  4RU9 A;  4LVS A;  2EZY A;  4EEK A;  2C2R A;  3JPP A;  5J2I A;  4IL6 U;  2ZH4 A;  4KLF A;  1KRP A;  2HHX A;  4K4H A;  2IOH A;  2F8L A;  2UVV A;  5KFG A;  4YN4 A;  3PW2 A;  2HOI A;  3MR5 A;  5J2D A;  2UVU A;  4QZD A;  4RWO A;  1JI7 A;  9ICJ A;  4AT7 B;  4DQQ A;  1XSP A;  3RB4 A;  4C8N A;  4B9M A;  4NXX A;  4FFD A;  1ZRN A;  5KG1 A;  4K98 A;  1S76 D;  4KLM A;  4IS7 A;  2R18 A;  3H8M A;  1UCV A;  3SYZ A;  3J81 j;  3B9J A;  8ICC A;  1H38 A;  1ZRM A;  1ZQU A;  4GC6 A;  4QZG A;  3HJ4 A;  4AT9 A;  3TAD C;  4EEL A;  3SEN A;  2AGP A; 
#chains in the Genus database with same CATH homology
 3OHA A;  4MFF A;  4TUS A;  1S77 D;  1JXE A;  3ZD8 A;  2WTF A;  4DSJ A;  4I2B A;  2XY5 A;  2GWS A;  2XC9 A;  4O5C A;  4I2G A;  7ICG A;  3N97 B;  4QZA A;  4EBJ A;  1KFD A;  1NK7 A;  1ZQA A;  3EW9 A;  4DFJ A;  4G3I A;  4C8M A;  4O3Q A;  2Y1J A;  5KFQ A;  3MR2 A;  1NKB A;  3H37 A;  1QTM A;  4K4I A;  4J9K A;  1ARO P;  1X9M A;  3EWA A;  5CA7 A;  5J0W A;  4GLX A;  1U4B A;  1RZT A;  1BPZ A;  2FMQ A;  3C66 A;  4JK1 A;  5F2V O;  2FPM A;  3H7I A;  4F5Q A;  3QE9 Y;  4EBK A;  4KLL A;  2JZB A;  4UD5 A;  5KFE A;  1WCL A;  5J2A A;  1UT8 A;  5KFV A;  4Q43 A;  4F4Y A;  2BGW A;  3V72 A;  3IHQ B;  1U45 A;  1U48 A;  4UAW A;  4ZH4 A;  4O3N A;  3V6H A;  3ZDD A;  4MFC A;  3HT3 A;  1K1S A;  2FLP A;  4J9N A;  5J0Y A;  2ZUD A;  2W9C B;  2HHV A;  1RYR A;  4C8K A;  1QSL A;  4DL4 A;  3MAB A;  8ICX A;  2KP7 A;  5KFR A;  4FH3 A;  5HR9 A;  1S97 A;  3ZDE A;  4RUC A;  4LT6 A;  3PY8 A;  5HC9 A;  1UT5 A;  5DG7 A;  2VA2 A;  7ICR A;  5CHG A;  5DB7 A;  4YQW A;  4WBY A;  1DOQ A;  4I2F A;  3GV8 B;  4X4O A;  1QSY A;  4M9N A;  2DVI A;  5DGB A;  2FMP A;  4EBC A;  2FMS A;  2R8G A;  9ICL A;  3H8S A;  5DDM A;  1T3N A;  3LQC B;  1ZET A;  4RPY A;  5KG6 A;  4FS2 A;  3UQ2 A;  4ATB B;  4EYI B;  5III A;  2BCQ A;  3C1Z A;  5DLF A;  3N4M B;  4AT8 A;  2JEI A;  8ICF A;  1B43 A;  3NTU A;  3RBD A;  5D4B A;  1JN3 A;  3LK9 A;  4B9U A;  4KLU A;  4RWN A;  5IIN A;  4E7X A;  4RQ1 A;  4KN7 A;  4RNM A;  2W9A A;  4DOC A;  4QZH A;  3GIM A;  5J2H A;  1ZQO A;  8ICK A;  1X9W A;  8ICG A;  4QWE A;  4FHY A;  1TFY A;  4JV1 A;  4RQ8 A;  5L1J A;  4FH5 A;  2ZTE A;  4KIT B;  3PNC A;  4M6W B;  5J2F A;  3TFR A;  4F2R A;  4IQW A;  3ETL A;  2AJQ A;  4FHV A;  4QZI A;  4R65 A;  3RJK A;  2HVI A;  3WFQ E;  5KT6 A;  3EPI A;  2Q66 A;  2W9M A;  5DKW A;  3H4B A;  3WFR E;  8ICR A;  4KLT A;  5J2E A;  5DQH A;  5KFS A;  3MBY A;  1EXN A;  4DLG A;  4ELV A;  2VA8 A;  3GQC A;  5IIM A;  4YG2 A;  5KFM A;  5KG3 A;  7ICJ A;  1NKC A;  4RQ7 A;  8ICM A;  1S10 A;  5HMM A;  3JYY A;  4PHA A;  5J2C A;  4DS5 A;  1KFS A;  3JPS A;  4WC7 A;  4UB5 A;  1ZQB A;  5KFL A;  4J9L A;  4WC3 A;  2W8K A;  2JEG A;  1A76 A;  4RNN A;  4Z6C A;  5KFI A;  3OGU A;  2V9W A;  5HRE A;  9ICO A;  1BPB A;  9ICK A;  1SKW A;  5KFP A;  5KFC A;  1MC8 A;  2ZTD A;  4NXZ A;  2HVH A;  4I28 A;  4MEX A;  3H39 A;  1ZQL A;  1ZQQ A;  4P4M A;  3T5H A;  4WC6 A;  2HHW A;  7ICE A;  4NKT A;  3RAQ A;  2KZZ A;  1F5A A;  3UXP A;  3C18 A;  4DSI A;  1UET A;  4R8U A;  4FBU A;  3H38 A;  2A1J A;  2BR0 A;  4FS1 A;  8ICO A;  7ICQ A;  1R8C A;  4UBB A;  7ICL A;  3OUY A;  3FDS A;  5DBA A;  5KT4 A;  4XUS A;  3H4D A;  3EPG A;  1SKR A;  2UVW A;  3PO4 A;  5HRH A;  1CEZ A;  2KZM A;  4I2J A;  8ICJ A;  2NRV A;  3RH4 A;  4B9L A;  4ECS A;  4DSF A;  2BPG A;  4F5N A;  4DSL A;  4X0B A;  3KTQ A;  5J0R A;  5D49 A;  5DBC A;  2DR5 A;  4UB3 A;  3Q8Q B;  3TAR A;  5CJ7 A;  1NK9 A;  2MUT A;  4KLO A;  2HHS A;  3G6V A;  3C2M A;  5KFU A;  3RR7 A;  4GC7 A;  2P6R A;  3ZDB A;  4O3S A;  2M2T A;  3LWM A;  4RT2 A;  1ZQT A;  4FHP A;  9ICC A;  5KFF A;  2ZJA A;  2HHT A;  2AGQ A;  4IRK A;  3GFK B;  1NK8 A;  1L3V A;  5TZV A;  4X0A A;  1XS9 D;  5EOZ A;  2DRB A;  5IIO A;  4DL3 A;  4DOB A;  1X2I A;  5L1I A;  4WC5 A;  3JPN A;  1UA1 A;  3JPR A;  3V7L A;  5DB6 A;  1XO1 A;  8ICN A;  4F4K A;  2VAN A;  4XA5 A;  3NGD A;  2W9B B;  7ICU A;  1UEU A;  1ZQX A;  5KFH A;  3V7K A;  5J0T A;  5J2B A;  5C5J A;  3MGH A;  3TAQ A;  1UA0 A;  1S0N A;  2FPK A;  4KLQ A;  2BQU A;  2HHU A;  4JV0 A;  4YXJ A;  3RRH A;  4YMN A;  2J6T A;  2OWO A;  9ICP A;  9ICR A;  1WOT A;  5J0S A;  3ISC A;  4O3O A;  4S3N A;  1XWL A;  1S9F A;  1MQ3 A;  2HW3 A;  1NJX A;  2NRK A;  5KFT A;  5F9L A;  4DFP A;  3JPO A;  4DL2 A;  5DQI A;  1XSN A;  5IIL A;  1SL0 A;  4KLJ A;  2R8K A;  4WBZ A;  1OU5 A;  5DLG A;  5KFZ A;  4WC2 A;  2ZH5 A;  1KEJ A;  4QWB A;  4ECU A;  4Z6D A;  5CR0 A;  4DQR A;  3PX4 A;  4RPX A;  3EYZ A;  2UVR A;  1MQ2 A;  5HRB A;  4QW9 A;  5KFW A;  4NLK A;  4M0A A;  4KLD A;  2Y1I A;  1IXR A;  1ZQY A;  4YR3 A;  1ZQG A;  4QWA A;  1SL1 A;  1SKS A;  1PZN A;  2ASJ A;  3NYB A;  1SZP A;  5EWE A;  3PMN A;  1NOM A;  3UXN A;  3ZD9 A;  3Q8P B;  1S0V A;  1Z00 A;  3KHH A;  2BKE A;  5BPC A;  2ZHA A;  5KT5 A;  5L1L A;  4GXK A;  4ED8 A;  1HJP A;  2AU0 A;  1NK5 A;  4RT3 A;  2M9N A;  7ICF A;  2ID1 A;  7ICK A;  5KG0 A;  9ICV A;  1LV5 A;  4RQ0 A;  3AU6 A;  3C1Y A;  4NY8 A;  5DQG A;  4YD2 A;  3RB0 A;  3RJG A;  4IR9 A;  2F1J A;  1JIH A;  2NRX A;  2KTQ A;  4IR1 A;  4B9S A;  4B9T A;  3TAP A;  4JWM A;  3RH6 A;  7ICO A;  3PX6 A;  3BQ1 A;  5J2J A;  3BDP A;  2XCA A;  5J2K A;  1JAJ A;  4X4Q A;  2BPF A;  8ICW A;  2XY6 A;  4PHE A;  4ECW A;  5DBB A;  2ASD A;  4YXM A;  3SI8 A;  2I1Q A;  4IQV A;  4RQ6 A;  2R8I A;  4ECT A;  4ED1 A;  5HRL A;  4ELU A;  4I2D A;  4F50 A;  1ZQE A;  3M9M B;  4BWM A;  5KG2 A;  4E8F A;  3OUY B;  4YFK A;  3MFH A;  2P66 A;  4RQ3 A;  1VJ7 A;  4I29 A;  4KMU A;  4DLE A;  9ICW A;  3OJS A;  1IM4 A;  4R64 A;  1MIW A;  3BJY A;  3E2E A;  1NO5 A;  8ICA A;  3M9O B;  9ICE A;  2M2W A;  4ECR A;  4J9Q A;  2KN7 A;  2V4R A;  2PXI A;  3PW4 A;  4EZ6 A;  1JX4 A;  4TUQ A;  3C5G A;  4BDP A;  4QZF A;  3GIJ A;  4Q8F A;  1T4G A;  2BQ3 A;  1Q79 A;  1BGX T;  4DFK A;  4M9G A;  4UAY A;  3JPT A;  3GIL A;  5J0O A;  1BVS A;  2P6U A;  4RUA A;  3QZ8 A;  3HX0 A;  1R8A A;  3TI0 A;  1TV9 A;  4DEZ A;  2ZUC A;  4I2I A;  2BCU A;  3ZDC A;  5J0P A;  3Q8M A;  5KFA A;  4DQP A;  3AUO A;  2M2U A;  4BXO A;  4F3O A;  4UD4 A;  4C8L A;  2J6U A;  5J2G A;  1TK5 A;  3OVA A;  1BPD A;  3C21 A;  2BQR A;  3RJE A;  5L9X A;  4AT9 B;  4DL6 A;  2XCP A;  3MR6 A;  4B9N A;  3MDC A;  3Q8L A;  4EEY A;  1KNY A;  3UPQ A;  1Z3E B;  4TQS A;  2HHQ A;  3SV3 A;  8ICY A;  1UEV A;  3BQT A;  5HP4 A;  5KG5 A;  4NM2 A;  4RQ4 A;  3Q8K A;  3T5L A;  3JZ0 A;  4WC0 A;  3OVS A;  3PML A;  4DOA A;  5J0Q A;  5DEC A;  4F4W A;  2FPL A;  4EYH B;  4ECY A;  3PVX A;  4GXI A;  1RPL A;  4BXO B;  4ECQ A;  4KLH A;  9ICU A;  3RJJ A;  4QZ9 A;  3G6Y A;  1TK0 A;  5HRF A;  3TQ1 A;  1V4A A;  1HUZ A;  1R8B A;  4X5V A;  2B21 A;  2IHN A;  1BPY A;  2C22 A;  4UAZ A;  5KFY A;  1NKE A;  1BNP A;  2V4Q A;  1JMS A;  2IBK A;  4KLI A;  4F2S A;  4RNO A;  1XU4 A;  2ISO A;  3JPQ A;  8ICS A;  4O5E A;  8ICI A;  2JZB B;  2KFN A;  9ICQ A;  2RFF A;  4WC4 A;  5J0X A;  2R8H A;  4ECX A;  1N48 A;  4X4N A;  4F5O A;  2XGP A;  4YMO A;  3UXO A;  1Z00 B;  3H8W A;  3Q8S B;  3EZ5 A;  1XC9 A;  1HUO A;  2BCS A;  3HW8 A;  9ICB A;  7ICV A;  4R66 A;  2PI5 A;  4ATB A;  4CCH A;  2NRZ A;  4YR2 A;  4RQ5 A;  3GIK A;  5HRG A;  3GV7 B;  4LZG A;  2PFO A;  5HHH A;  3K75 D;  5D46 A;  2F1H A;  3MDA A;  1TAU A;  4UB1 A;  4ELT A;  4E80 A;  3RAX A;  5IIK A;  1ZJN A;  7ICS A;  1MIY A;  4FHX A;  4M9L A;  2PFP A;  4Z6E A;  2O5A A;  1ZQS A;  1U9L A;  4QW8 A;  5DDY A;  4YVZ A;  5CB1 A;  1TFW A;  2HHP A;  1YLQ A;  2ZJ5 A;  2M2V A;  4M6W A;  3RB3 A;  1ZQM A;  4J9R A;  4UB2 A;  3GV5 B;  5KG4 A;  1ZQR A;  1BPE A;  9ICM A;  7ICP A;  3AU2 A;  2KFZ A;  2ZH7 A;  4KLS A;  2DR7 A;  4RPZ A;  3OJU A;  3KHG A;  3RBE A;  5DB8 A;  5J0U A;  3HP6 A;  2C2E A;  5L1K A;  1BPX A;  5HML A;  1ZQI A;  2IHM A;  7ICH A;  4AT8 B;  3PR4 A;  4X4V A;  4P4O A;  4B9V A;  4WC1 A;  3ORY A;  3MFI A;  5KT7 A;  2DFL A;  3C5F A;  3PV8 A;  4X4P A;  3OV7 A;  1Q78 A;  2ZH1 A;  2ATL A;  2ZUB A;  1L3S A;  1RXW A;  1MIV A;  3QZ7 A;  2Q0Z X;  4QWC A;  4I2H A;  9ICG A;  1R89 A;  2O1P A;  3UPS A;  4DQS A;  5HHI A;  8ICZ A;  2NRW A;  5KTQ A;  4PHD A;  4DFM A;  7ICT A;  3C2L A;  1D9F A;  4X4T A;  1ZQN A;  4NM1 A;  1KFT A;  3M9N B;  9ICI A;  1L3T A;  4DSE A;  1ZQK A;  4MF2 A;  1NJZ A;  4IRC A;  2AGO A;  4O5K A;  1KTQ A;  2BDP A;  1D8L A;  4P4P A;  1QLN A;  5HRI A;  4Q8E A;  5KFB A;  4F93 B;  1NJW A;  3MGI A;  4YR0 A;  4M9H A;  1NK0 A;  4P2H A;  4UB4 A;  1L3U A;  5KFK A;  2JEF A;  3T5J A;  4PGX A;  2XGQ A;  5DG9 A;  4DF8 A;  4QZC A;  4TQR A;  1ZJM A;  4RQ2 A;  1N56 A;  3RJH A;  4FBT A;  4C8O A;  3OSN A;  3V6J A;  4X4U A;  8ICL A;  4I2A A;  4YP3 A;  3G6X A;  1TVA A;  4DS4 A;  4Q44 A;  1BNO A;  3GII A;  4BGD A;  3QEB Z;  2ZJ8 A;  1U47 A;  2DRA A;  2DPJ A;  3B0X A;  3C2K A;  3QEA Z;  1ZQF A;  2VA3 A;  4M2Y A;  4KLG A;  1K1Q A;  1RYS A;  1ZQD A;  3RJF A;  4XQ8 A;  4JWN A;  2RDJ A;  4NLZ A;  2PBE A;  3K4G A;  4F5R A;  1ZQV A;  4MEY A;  9ICH A;  1TAQ A;  1V9P A;  2DPI A;  4K4G A;  4XRH A;  4R8U B;  4AT7 A;  4F91 B;  4IG8 A;  4NKU A;  2A1J B;  2ZH2 A;  4MFA A;  1XSL A;  2BCR A;  4IQT A;  3SZ2 A;  3V6K A;  4I27 A;  2AQ4 A;  4M5D A;  1SL2 A;  5BOL A;  5JUM A;  4ED3 A;  4ED7 A;  2C28 A;  5KG7 A;  2KZ3 A;  4TUP A;  3TAN A;  3MR3 A;  1JXL A;  7ICM A;  8ICE A;  1PX5 A;  3T5K A;  5KT3 A;  3H8J A;  3HIY A;  4EBD A;  4M04 A;  4E0D A;  1QSS A;  1KSP A;  1DGS A;  3UQ0 A;  3H3A A;  2XY7 A;  2FLN A;  1X9S A;  8ICV A;  4JUZ A;  2W9B A;  3WFO A;  3HJ1 A;  2MUT B;  1NK4 A;  1D9D A;  4YCX A;  2IA6 A;  4PH5 A;  9ICF A;  1B22 A;  3OVB A;  4DO9 A;  4Z6F A;  3PR5 B;  5KFJ A;  4KN4 A;  1ZQW A;  1JQR A;  3C23 A;  4ED2 A;  2BCV A;  3M8R A;  4IQU A;  2FLL A;  1CUK A;  1ZQZ A;  3RH5 A;  5J29 A;  4QZE A;  3ISB A;  3FYH A;  2W8L A;  2PI4 A;  1ZQH A;  3TFS A;  5EWG A;  4F92 B;  4JV2 A;  2AQ0 A;  4QWD A;  2XO7 A;  1C7Y A;  3RR8 A;  4EP7 A;  5IIJ A;  2BPC A;  4M47 A;  3SV4 A;  4IRD A;  4O3P A;  3PX0 A;  5DG8 A;  4EZ9 A;  4QZ8 A;  2ZH8 A;  4O9M A;  4KTQ A;  4EBE A;  5BOM A;  2R8J A;  3LDA A;  3AQL A;  1RXV A;  1LB2 B;  1COO A;  7ICN A;  4UQG A;  5DED A;  5HRK A;  9ICN A;  3HWT A;  8ICB A;  4HYK A;  9ICT A;  3AQM A;  4FO6 A;  3IM1 A;  5HNK A;  1S0O A;  8ICP A;  4XQ7 A;  4X4S A;  1VFG A;  3WFP A;  2H5X A;  1ZQP A;  2I9G A;  3B0Y A;  3RJI A;  3KHL A;  1DK2 A;  1L5U A;  4J9M A;  1NZP A;  5DB9 A;  4J9O A;  3ISD A;  4DL5 A;  3RB6 A;  1MSW D;  4RWP A;  8ICQ A;  2ASL A;  3PO5 A;  3AQN A;  1T7P A;  2W9C A;  4J9P A;  2RDI A;  4GXJ A;  4ED0 A;  4YMM A;  4Q45 A;  3PW7 A;  4QZB A;  4PHP A;  4DWI A;  9ICA A;  4M9J A;  4DSK A;  4RZR A;  2ALZ A;  4R63 A;  3OHB A;  4DL7 A;  3PW0 A;  3PW5 A;  4LZD A;  5KFD A;  8ICU A;  5KFX A;  3LWL A;  2ZH9 A;  2C2D A;  3RTV A;  2ZTC A;  4TUR A;  3RRG A;  2BHN A;  4NLN A;  4I2E A;  9ICS A;  4FHW A;  4ED6 A;  4RU9 A;  1D8Y A;  2J6S A;  4LVS A;  1DK3 A;  2BE3 A;  2PFQ A;  4O3R A;  3AQK A;  4WCW A;  2PFN A;  2C2R A;  2ISP A;  3JPP A;  3M8S A;  3Q8R B;  3H40 A;  1ZYQ A;  4YD1 A;  4I2C A;  1KLN A;  5DGA A;  4PPX A;  5KFN A;  5J2I A;  1TFR A;  4UBC A;  4BWJ A;  2DR8 A;  2ZH4 A;  4DF4 A;  1TKD A;  4KLF A;  4DQI A;  7ICI A;  4MF8 A;  4F8R A;  4F5P A;  1NK6 A;  1KRP A;  2HHX A;  3ZDA A;  4K4H A;  4X4R A;  2UVV A;  1A77 A;  5KFG A;  2DR9 A;  2ZH6 A;  1Y88 A;  4YN4 A;  3PW2 A;  4ECZ A;  1WCN A;  2MAX A;  5F9N A;  5J2D A;  3MR5 A;  3HPO A;  4ECV A;  3BQ2 A;  2UVU A;  4QZD A;  4F4X A;  1TK8 A;  2IMW P;  4RWO A;  1NJY A;  9ICJ A;  5HRD A;  4AT7 B;  4F4Z A;  4DQQ A;  3OSP A;  3BQ0 A;  3T3F A;  2ZHB A;  4O0I A;  1XSP A;  3RB4 A;  4C8N A;  1T8E A;  1S0M A;  2LYH A;  3THV A;  4B9M A;  8ICT A;  1U49 A;  4NLG A;  1ZQJ A;  2ZH3 A;  4RWQ A;  5CP2 A;  3KHR A;  8ICH A;  2NRT A;  5KG1 A;  2JEJ A;  5CWR A;  9ICX A;  4PGQ A;  1ZQC A;  5KFO A;  1S76 D;  4KLM A;  5KT2 A;  3SYZ A;  1KDH A;  4KLE A;  8ICC A;  1H38 A;  2F1I A;  4PGY A;  1FA0 A;  1ZQU A;  4GC6 A;  3GDX A;  4QZG A;  3V7J A;  3HJ4 A;  3L9D A;  4J9S A;  4AT9 A;  3WFS C;  2AGP A;  5EWF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...