4YMNA

Structure of human dna polymerase beta complexed with n7bg in the template base paired with incoming non-hydrolyzable ctp
Total Genus 101
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
101
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and kinetic studies of the effect of guanine-N7 alkylation and metal cofactors on DNA replication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 101
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-03-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4ymnA02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4ymnA01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4ymnA04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4ymnA03
4ELUA 5TZVA 1KTQA 4HYKA 4PGXA 1TV9A 3AQMA 4S3NA 1ZQUA 4R8UB 5J0QA 3RBEA 1ZQPA 5KFKA 4J9QA 1U47A 1RXWA 3C5FA 4F3OA 1BNPA 1TFWA 4RQ7A 4R66A 5HREA 5EOZA 9ICLA 4G3IA 8ICZA 4O3OA 2RDIA 4RQ5A 2RDJA 7ICTA 3EYZA 1X9SA 5KFOA 4LVSA 3OUYB 1XSNA 3G6VA 3TAQA 2A1JA 5KFVA 5J0XA 4B9NA 5J2KA 2A1JB 1ZQRA 4XRHA 2BCRA 4O5CA 4O3QA 7ICSA 1SZPA 5KT5A 2UVUA 2IA6A 9ICHA 2ID1A 4TQSA 3MR2A 4QZGA 4RUAA 1X2IA 4M9JA 4O3PA 2ASJA 1ZQCA 4GXJA 4WC0A 1YLQA 3C2LA 1ZQTA 2IHMA 4X4RA 4M9NA 3H3AA 2ZHAA 4E7XA 3GIJA 4F5RA 7ICPA 2DR8A 1SKSA 3LK9A 4DOBA 1ZQDA 4ELVA 2HHXA 5KFYA 4UAWA 3BQ0A 5J0YA 1BPYA 1Y88A 5KFNA 5KFGA 5BPCA 1C7YA 5IILA 4DWIA 3BDPA 1ZQQA 4F50A 3PW0A 1KLNA 3UXOA 3RRGA 4PHEA 5KFHA 4F4KA 1T4GA 1NK0A 9ICGA 5KFLA 4UBCA 5J2JA 2PI5A 4ATBB 3OVAA 2XO7A 3C2KA 3G6YA 4DEZA 4X4TA 4IQTA 2VA2A 3H37A 2BCQA 3C23A 2XGQA 4FH3A 4YXMA 4YCXA 4M2YA 9ICKA 4EBJA 3OHBA 4R64A 3H39A 5HRFA 5D49A 3HX0A 1NZPA 5DDYA 4O5EA 1XS9D 3NYBA 2R8IA 5KT6A 3H7IA 1BPXA 4DL5A 5J2DA 3V72A 1ZQFA 4B9MA 7ICVA 2FPKA 4DQSA 3T5KA 2W9BB 3RJJA 2W9MA 1UEUA 4YMOA 2BPCA 7ICUA 5DGAA 1BPDA 5J0WA 3LWMA 3PMNA 4YR2A 5KG5A 2R8KA 3JPQA 1NK7A 4I2BA 3IHQB 4KLIA 2M2TA 4RT3A 3H38A 2FLNA 2P66A 1JAJA 1UEVA 3V6HA 4J9KA 2BDPA 3NTUA 5KFWA 4QZCA 4JK1A 4F4WA 1N48A 2W9BA 4RT2A 2UVRA 3L9DA 2HHPA 3OV7A 4DLEA 1KFDA 5D46A 3ORYA 4YVZA 5IIJA 3OHAA 2PFOA 1NK4A 4WCWA 4IG8A 1XC9A 2VANA 3RJHA 1ZQLA 4ECRA 1MQ2A 3AQKA 3GFKB 1WCLA 1XWLA 3MBYA 5KFCA 4RPYA 3EPIA 2BHNA 3T5JA 3THVA 3RR7A 4KLQA 2HVHA 4X4PA 2BKEA 5KFFA 2R8JA 4ED0A 4YFKA 1X9MA 4M04A 3GQCA 1D9DA 2JZBA 4UD4A 3Q8PB 3MFHA 1BNOA 4J9MA 3KHLA 3HWTA 7ICLA 3HJ1A 2M9NA 4WBZA 2AU0A 3PO4A 4F4ZA 2ZTCA 1ZQOA 2PFNA 4O0IA 8ICUA 9ICUA 9ICWA 4I27A 4X4UA 5KFBA 3JPNA 4JWMA 5KT4A 1EXNA 2BQ3A 9ICOA 3C1ZA 5KG2A 4PHPA 5BOLA 3GIKA 3V7LA 5DB6A 4DSFA 3BQ1A 4ECQA 2AQ4A 8ICQA 4B9TA 3EPGA 5KG1A 1NK6A 4NY8A 3BQ2A 3AQLA 1Z00A 8ICLA 4K4HA 4J9PA 5J2EA 3C2MA 4F5OA 2WTFA 4ED8A 3PX6A 1UA0A 2HHVA 9ICIA 4QWDA 2IMWP 3OGUA 1TKDA 4PGYA 4JUZA 2DR7A 4QZ9A 4BWMA 4UAZA 4DF8A 5D4BA 4KLOA 4ECZA 2BR0A 4B9LA 3WFOA 1XU4A 5DBAA 5HRGA 3C21A 3B0YA 7ICFA 4GXKA 9ICRA 4DL4A 4FBTA 4KMUA 4JV1A 2DRBA 5KG7A 1WCNA 4EBDA 7ICJA 2ZH9A 1BPEA 2MUTA 4XQ7A 1V9PA 7ICEA 4WC6A 4DSLA 2F1IA 2PFQA 5KFPA 3PR5B 3RJFA 5DKWA 5J0TA 8ICSA 1MIYA 3ZDBA 2O5AA 4DF4A 3TFSA 8ICNA 2J6UA 3SV4A 9ICSA 4UQGA 3RB3A 3V6JA 5EWGA 2ZH6A 3K75D 5J0PA 2OWOA 4I2CA 4AT8A 5J0SA 4I2IA 3JPRA 5J2IA 3KHHA 4Q43A 4ECUA 1RPLA 3RR8A 1IXRA 4EZ6A 4M5DA 4IQWA 2ZH1A 2FMSA 2PXIA 3WFSC 4LT6A 2ASLA 7ICOA 1VFGA 2ZTDA 3FYHA 3V6KA 4UB4A 3MFIA 2V9WA 4TUPA 3HPOA 2ZH4A 3TFRA 1TFRA 1ZQEA 4AT8B 3KTQA 2R8GA 1NKCA 3Q8QB 1MIWA 4QZBA 3AU2A 5J2BA 2ZJ8A 4P4OA 4O3NA 3QEAZ 1NJZA 1RXVA 1LV5A 5KFXA 5DBBA 3EZ5A 4F8RA 4X0BA 8ICRA 2DR5A 3PW4A 4RU9A 4ED2A 4EBCA 4DQPA 4I2HA 1KFTA 4JV2A 3PX0A 4KLHA 1BGXT 2NRZA 5J2FA 5KFMA 1NO5A 5IIOA 5KFSA 3PX4A 4I2FA 3MDAA 1MQ3A 5HRHA 4EP7A 3RJGA 5DGBA 4ECYA 1D9FA 3MR3A 4RWOA 1R8BA 1B43A 4DFMA 3MABA 4F5QA 1SL2A 4IRCA 2XY6A 2IHNA 4Q8EA 5IIKA 3RJKA 4BXOB 5HNKA 1ZQSA 1R8AA 1BPZA 4ZH4A 5EWEA 3UQ0A 1U4BA 1A77A 4QWCA 4F93B 4TUQA 3G6XA 4C8OA 4K4GA 1N56A 4UB3A 2KZ3A 4RZRA 4M6WA 2HHQA 5CR0A 4M47A 4MEYA 1HUZA 1K1SA 1F5AA 3JYYA 2ZH7A 4F4YA 4YN4A 4DQIA 1ZQKA 7ICGA 9ICCA 5KFQA 4QZIA 2NRTA 2AGPA 3AU6A 2VA8A 3PW2A 1ZQGA 2MAXA 1ZQHA 4EEYA 2W9CA 1R89A 3PO5A 4M9HA 4LZDA 5IIMA 1A76A 1T7PA 9ICTA 5CB1A 8ICWA 2M2VA 3UPSA 1U49A 2KP7A 2Q66A 1ZQVA 3N4MB 3H40A 2PFPA 3NGDA 4UD5A 4ECXA 2I1QA 1TK5A 1SL0A 4NM2A 4DL6A 1TAQA 1ZQYA 3RB4A 3UQ2A 4C8MA 4EYHB 1UT5A 3ISDA 4RQ1A 5L1JA 4J9NA 4DLGA 3Q8LA 2UVVA 1L3SA 5L1KA 4MFCA 3LDAA 2BGWA 1BVSA 2ALZA 2HHUA 4DOAA 4XQ8A 5J0RA 1S76D 1IM4A 3BJYA 4ED1A 2BQUA 4P4MA 4B9UA 3K4GA 2V4QA 1L3VA 1Z3EB 4KTQA 1K1QA 4QWEA 3AUOA 1L5UA 1NJYA 4FBUA 2HW3A 8ICCA 4X4QA 5EWFA 4AT9A 1TK8A 4PPXA 8ICGA 4PHAA 3RJEA 2AGQA 3V7JA 4RUCA 4NLNA 3JPSA 3H4DA 4KLMA 4RNNA 2HHSA 2XC9A 5HRLA 3ZD8A 3FDSA 2XCAA 2V4RA 5DB7A 3JPOA 4Q8FA 1ZQNA 4BWJA 4F5NA 4KLSA 4PGQA 1MIVA 8ICAA 2DR9A 1SL1A 4UAYA 5KT2A 5F9LA 4YQWA 2XY5A 3RH4A 4TURA 9ICXA 3OSNA 3HIYA 2XGPA 2BCUA 4PHDA 3M9NB 4DSKA 4KLJA 3H8WA 2ZH2A 3LQCB 4Q44A 4RPXA 4DQQA 5KG6A 3OUYA 5DB9A 2F1HA 3OJSA 4KITB 1QSYA 4IQVA 4UB5A 5KFTA 3PW5A 1UETA 4NXZA 5HRIA 5DECA 4BGDA 4RWPA 5HMMA 4RPZA 2MUTB 5J2HA 2ATLA 2W9CB 3SZ2A 8ICIA 3WFQE 4DFPA 2VA3A 2LYHA 4RNOA 3V7KA 2RFFA 4DSJA 2HHTA 4FS2A 8ICYA 4X4SA 2ZJ5A 3ZDAA 4O3SA 4YP3A 2C2EA 5DQGA 3QE9Y 5CJ7A 1ZQBA 1X9WA 1ZQWA 4FO6A 4IRKA 3KHGA 3H4BA 5KFEA 2R8HA 5HC9A 5KFAA 4J9RA 4YMNA 4ED7A 1H38A 7ICMA 4MF2A 3Q8KA 4KLFA 4QW9A 4QWAA 1ZQJA 1NOMA 1JXEA 4JWNA 5J2AA 8ICHA 4I2DA 1Q79A 2BE3A 1PZNA 1NKBA 1S10A 3TI0A 3H8JA 5KT3A 2NRWA 2BCSA 1Q78A 3WFRE 5KFUA 2M2UA 2DPJA 2FMQA 3C5GA 1S0VA 1V4AA 5HRKA 5DBCA 1T3NA 3PR4A 3PW7A 4KLLA 8ICPA 9ICPA 2HVIA 3UPQA 2ISOA 9ICNA 1JXLA 4YG2A 5HHHA 4NM1A 1NJXA 2FLLA 7ICKA 2NRKA 4EBEA 4FHVA 2JZBB 4J9LA 3QZ7A 1RZTA 4I2EA 2Q0ZX 4QZDA 1ZYQA 2BPGA 4EZ9A 3GDXA 4NKUA 4XA5A 3RBDA 4QZFA 3C66A 3GV8B 2FLPA 4QZEA 4X4NA 5CWRA 8ICKA 4YXJA 5L9XA 1TK0A 3EWAA 2FPLA 3EW9A 3TQ1A 5HP4A 5KFZA 3RH5A 9ICMA 1RYRA 4YD2A 4IRDA 3RB6A 4X5VA 3SYZA 1UA1A 3ISBA 3C18A 4P2HA 4X0AA 1BPBA 4F91B 2ZH3A 4TUSA 4ECTA 2P6RA 4F5PA 2J6TA 7ICNA 5KG4A 4E80A 4TQRA 4ELTA 8ICJA 4PH5A 1FA0A 4RWQA 3TARA 1RYSA 8ICTA 9ICJA 4MFFA 1VJ7A 4EBKA 4RQ6A 3GIMA 3T3FA 2H5XA 3PNCA 1ZQAA 4QW8A 4NLZA 1B22A 1DK3A 2O1PA 4WC5A 2ZH8A 8ICXA 4X4OA 3TAPA 4Q45A 8ICBA 4DS4A 2AGOA 1QLNA 3C1YA 3ZDCA 3RAQA 3MDCA 4C8NA 5C5JA 4O5KA 4M9LA 4O3RA 2KFNA 4FHXA 3KHRA 4R65A 2XCPA 3Q8MA 3SI8A 4FHWA 2ZUCA 4QZHA 4MF8A 1ZQMA 1S9FA 4F2SA 2ZTEA 4Z6FA 2B21A 3GV7B 4R63A 2NRVA 2XY7A 3B0XA 9ICQA 4DSEA 1ZJNA 1JX4A 1KSPA 3H8SA 3M9OB 4UB1A 5HHIA 5KFDA 3T5HA 4J9OA 3PVXA 3GV5B 1NK9A 4FH5A 1KRPA 4WC7A 4QWBA 1S0OA 5F9NA 4KLGA 1D8LA 3ZD9A 4F2RA 4FHPA 4AT9B 4WC3A 2P6UA 3QEBZ 2KTQA 5HMLA 5J0UA 9ICEA 2DFLA 1DGSA 2HHWA 4DOCA 9ICFA 1LB2B 1ZQIA 2JEGA 3PMLA 3OVBA 4X4VA 4ECWA 1CUKA 2AJQA 1KDHA 1U45A 4BDPA 2C2RA 8ICFA 5J2CA 2BPFA 7ICRA 2DVIA 4M6WB 5DEDA 3UXNA 2GWSA 3RAXA 5F2VO 3JPTA 4YD1A 8ICEA 4UB2A 1XSLA 4UBBA 1UT8A 4BXOA 3M8RA 1ZETA 1ZQZA 3MR6A 5J2GA 4XUSA 4B9VA 4WC2A 3M8SA 9ICAA 3E2EA 4CCHA 5CP2A 4Z6CA 2F1JA 5IIIA 4RQ3A 2I9GA 4C8LA 4I28A 1AROP 3JPPA 4I2JA 2W8LA 2ZUDA 2ASDA 2IBKA 3RRHA 4DL2A 1NJWA 4GC7A 5HR9A 5KTQA 5JUMA 1S77D 2KZZA 4KLUA 2J6SA 4NKTA 1JIHA 4F4XA 2FPMA 4EYIB 4IR9A 5CHGA 1TFYA 9ICVA 4KLDA 1R8CA 1KEJA 2BCVA 4M0AA 1PX5A 1U9LA 3HW8A 3TANA 1NKEA 4KN7A 4KN4A 4RNMA 2DPIA 4WBYA 5DLFA 4WC4A 3ZDEA 4RQ4A 3N97B 1HJPA 4DQRA 5DQHA 3WFPA 4MEXA 4WC1A 4DFJA 4I2AA 7ICIA 1WOTA 1KFSA 5DG9A 3Q8SB 5HRDA 3LWLA 2JEFA 1HUOA 4O9MA 1CEZA 2W8KA 1XSPA 5DG7A 1ZQXA 2C22A 4B9SA 1JQRA 5DB8A 1XO1A 1S0MA 5KFIA 4K4IA 4KLTA 3GIIA 2KFZA 3T5LA 4DSIA 4QZAA 4NLGA 4IR1A 2KZMA 4AT7A 3ISCA 4Z6DA 3UXPA 3GILA 4ECVA 2AQ0A 1MC8A 2BQRA 3MR5A 3HP6A 5BOMA 1NK8A 3QZ8A 4QZ8A 1COOA 4RQ8A 1QSLA 4YR3A 5IINA 5KFRA 1MSWD 1SKRA 4FHYA 4E8FA 4JV0A 4MFAA 3MGIA 3RJIA 1L3UA 3OVSA 4P4PA 2ZH5A 4E0DA 2Y1JA 4ED6A 4FS1A 1S97A 4I2GA 3BQTA 2W9AA 4M9GA 3OSPA 1QSSA 4I29A 5KFJA 1JMSA 4GC6A 2Y1IA 7ICHA 1D8YA 4RWNA 4YMMA 3IM1A 4DS5A 2C2DA 7ICQA 1DK2A 5J0OA 1SKWA 5L1LA 3Q8RB 5KG0A 2FMPA 1S0NA 3PY8A 1ZJMA 3M9MB 5KG3A 2ZHBA 5HRBA 4F92B 3MGHA 5DDMA 1T8EA 4DFKA 2UVWA 1OU5A 4J9SA 5DLGA 2ZUBA 2NRXA 3SV3A 2JEIA 4C8KA 1NK5A 4ECSA 4KLEA 3ZDDA 3PV8A 3HT3A 2KN7A 2ZJAA 1DOQA 1TAUA 8ICVA 1KNYA 3RTVA 4LZGA 1Z00B 5L1IA 1TVAA 3OJUA 5CA7A 2ISPA 3JZ0A 9ICBA 4ATBA 3RB0A 4Z6EA 5J29A 4YR0A 4RQ2A 4NLKA 2PBEA 4ED3A 4DL3A 4RQ0A 3HJ4A 5DG8A 4DL7A 5KT7A 1U48A 1QTMA 4AT7B 2JEJA 3RH6A 4R8UA 8ICOA 3ETLA 2DRAA 4GLXA 2C28A 2PI4A 1JN3A 5DQIA 4GXIA 3AQNA 1L3TA 2M2WA 8ICMA 4DO9A 4IQUA
chains in the Genus database with same CATH superfamily
1Q8KA 2K4HA 4HYKA 3AN1A 4R8UB 3RBEA 1ZQPA 2F3NA 1RXWA 1PVPA 4R66A 5HREA 3BS7A 4EV6A 1OXJA 4G3IA 1Z1VA 3EYZA 4LVSA 1XSNA 2P35A 3TAQA 2A1JB 2GAFD 2ID1A 4TQSA 4M9JA 2ASJA 1ZQCA 1ZQTA 1QCKA 1JRPA 4E7XA 2HHXA 1BPYA 5KFNA 5KFGA 5BPCA 4DWIA 4F4KA 4PHEA 1T4GA 2Y9UA 5J2JA 2PI5A 3OVAA 2XO7A 2G07A 4DEZA 2LYBA 4JMUA 4EBJA 3MGVA 5HRFA 4IS7A 5DDYA 2ZG6A 4O5EA 1XS9D 2OYYA 4DL5A 1SXDA 2HCFA 4YMOA 2EZYA 1BPDA 2K8CB 4YR2A 5KG5A 4KLIA 4RT3A 2P66A 4NXUA 4QZCA 1N60A 1N48A 2W9BA 4DLEA 4YVZA 2PFOA 1PVRA 3I28A 1COKA 2LM4A 3AQKA 1N63A 2NO4A 3WU2U 3SMVA 1ZD2P 3T5JA 3M7DA 2R8JA 5AHXA 1X9MA 2F77X 5CHEA 3HJ1A 3S6JA 2JV3A 4I0UA 1GPJA 1EXNA 2BQ3A 3C1ZA 4PHPA 3ALRA 3GIKA 5DB6A 1O08A 3EPGA 2OCEA 3BQ2A 4Y2QA 3BS5A 1QQ7A 1UA0A 1N61A 9ICIA 2B0CA 3H0LB 2GA9D 4DF8A 4KLOA 4ECZA 4EEKA 4B9LA 2CPRA 1XU4A 3C21A 5AKZA 7ICFA 1ZD4A 4PL2A 4DL4A 4KMUA 2DRBA 4EBDA 2AH5A 4DSLA 3NKUA 1OUQA 1L7OA 4WOYA 2J6UA 4A8EA 3F5AA 3V6JA 4LEZA 5J0PA 5CEHA 5J0SA 4M5DA 3UMCA 4PZNA 5AKKA 2ZH1A 1J97A 2F76X 4UB4A 4TUPA 2V9WA 3TFRA 2GOLA 3Q8QB 1J2NA 2RLTA 5G5HA 3AU2A 5J2BA 2JGAA 2ZIWA 3WK4A 1NO5A 5IIOA 2RHFA 3HJEA 5KFSA 5JU5A 4ECYA 5A0LA 3MR3A 1R8BA 1B43A 1SL2A 1RYUA 4FO1A 4ZH4A 4C8OA 1A77A 4K4GA 1N56A 2KZ3A 5ALTA 1IG6A 4M47A 1K1SA 4F4YA 1ZQKA 9ICCA 1URJA 2NRTA 3AU6A 2VA8A 1ZQGA 3O0FA 4NL9C 5CB1A 1WWUA 2Q66A 2PFPA 3NGDA 1J2MA 4RQ1A 4J9NA 2HHUA 1L3SA 3LDAA 1BVSA 2ALZA 4U6PA 4OJOA 3ED5A 4KTQA 2HW3A 3AUOA 4Y2XA 1L5UA 2DUYA 5EWFA 1TK8A 3IN5A 3A0HU 4J03A 1L8LA 3H4DA 1RG6A 2EWRA 2XC9A 2XCAA 2ZXIA 5DB7A 3JPOA 2V4RA 5ALFA 4PGQA 1MIVA 2EAMA 4UAYA 4YQWA 3RH4A 1ZQ1C 1LKYB 3H8WA 5AM3A 5KG6A 1ZRMA 1YZ7A 3OJSA 1QH9A 3PW5A 3IDWA 3QUQA 4N7RA 3QU7A 1SWVA 2MUTB 3SZ2A 2LYHA 4RNOA 3V7KA 2RFFA 8ICYA 4FS2A 2M0NA 1ZQWA 4IRKA 5HC9A 3H4BA 7ICMA 4MF2A 4QW9A 4QWAA 2GLEA 1JXEA 1D8BA 5KT3A 2YB4A 2M2UA 5DBCA 5L1MA 1JI7A 2WAQC 3PR4A 1T3NA 3QYPA 4NM1A 2NRKA 2JZBB 4BX9C 2Q0ZX 2G5IB 4QZFA 3FC4A 3GV8B 3K7DA 3LYSA 2IOHA 3TQ1A 2FPLA 2K8AA 9ICMA 5ALHA 4YD2A 2KVCA 3SYZA 2MRLA 3ISBA 2ZH3A 4ECTA 2DKZA 4F5PA 2ZIUB 2OM6A 1X9XA 2RRDA 8ICTA 2KNJA 3F2DA 3T3FA 3PNCA 3I76A 4WC5A 5HR7A 2YX8A 2AGOA 3C1YA 4C8NA 5AK6A 4FZMA 2Y9TA 2XCPA 4FHWA 2ZUCA 4F2SA 1YT3A 2XY7A 2AXTU 4FZNA 3H8SA 4OCZA 3VCBA 4KMOB 3PVXA 1KRPA 4KLGA 4AT9B 5ALUA 1D8LA 3QEBZ 5HMLA 2HHWA 3OVBA 4ECWA 4BDPA 4MHVA 3N7RC 5J2CA 2GWSA 1WUDA 3JPTA 2W7PA 2HDOA 1UT8A 4BXOA 2FE9A 4B9VA 4CRXA 9ICAA 5ALXA 1WYGA 2D3DA 4Z6CA 2I9GA 3WK8A 1AROP 2ASDA 4I2JA 5KTQA 3R9KA 2J6SA 4K97A 9ICVA 3LVWA 4KN4A 3ZDEA 4RQ4A 3N97B 3WFPA 4MEXA 4WC1A 5DG9A 4PJ0U 4O9MA 1XSPA 2E8MA 1S0MA 3GU3A 4K4IA 3GIIA 4P0QA 1DRGA 1LKYA 4NLGA 3F2BA 4Z6DA 1MC8A 4UB8U 2HOQA 3OTQA 3MR5A 1L8OA 3QZ8A 4QZ8A 5D63A 5IINA 4FHYA 4JV0A 3OVSA 2ZH5A 2Y1JA 1S97A 2Y1IA 3QNMA 4YMMA 1DK2A 2C2DA 1XO0A 5L1LA 3Q8RB 2VJ4A 2FMPA 1PK1B 2QARA 4Y2JA 1N62A 2IHOA 1OU5A 4J9SA 1S8OA 5AI6A 1IIPA 3SV3A 4C8KA 3HT3A 5B5EU 2HI0A 1KNYA 1B0XA 1Z00B 2ISPA 5AICA 5CA7A 3OJUA 4Z6EA 5J29A 2LI6A 3IG5A 4ED3A 2K8BB 2EQYA 2HOFA 5DG8A 5KT7A 8ICOA 3E58A 3AQNA 3IG8A 4IQUA 1L7MA 1KTQA 4PGXA 1TV9A 3AQMA 4S3NA 4KM5A 5B3QA 1U47A 2YMQA 9ICLA 8ICZA 2W55A 5H2FU 5KFOA 3OUYB 4B9NA 5KFVA 5J0XA 2MU2A 4XRHA 4CNQA 4QZGA 4RUAA 3D6JA 2PKEA 5AK3A 4O3PA 4WC0A 4GXJA 5ALKA 4M9NA 3PHZA 2DR8A 3LK9A 1O03A 5CFSA 5J0YA 3AQEA 1C7YA 1KLNA 3OWGA 1NK0A 9ICGA 4UBCA 2W03A 3D2QA 4ATBB 3G6YA 4X4TA 4EEBA 2VA2A 4UAUA 3H37A 2BCQA 2KIWA 4FH3A 4OAIZ 9ICKA 4ZOHC 4UARA 5D49A 2KVSA 4WH5A 3NYBA 2R8IA 3H7IA 1BPXA 3V72A 4B9MA 4DQSA 3RJJA 2H3IA 3NASA 2BPCA 2WF6A 7ICUA 5DGAA 5J0WA 4I2BA 2M2TA 1NK7A 2PMZF 3H38A 2FLNA 1Q46A 2BDPA 4JK1A 4F4WA 1ZD5A 2KV2A 2HHPA 3CW2C 1KFDA 5D46A 4WCWA 1NK4A 1CRXA 4IG8A 5ALQA 2EAPA 3RJHA 1SV0C 4ECRA 2EZZA 1XWLA 2FI1A 4OJPA 3MBYA 4RPYA 3THVA 3NRWA 5KFFA 1SZHA 4UD4A 2JZBA 3MFHA 3KHLA 3PO4A 4F4ZA 1ZQOA 8ICUA 9ICWA 3JPNA 4JWMA 1S5LU 5ALJA 2G08A 5AKIA 1F0MA 3V7LA 2WAQF 2AQ4A 1NK6A 1T94A 3DEEA 4NY8A 2KD1A 4DCCA 3AQLA 5J2EA 3PX6A 2IOFK 2WTFA 2IMWP 4BWMA 1KKXA 4NXXA 5HRGA 3HRDD 3B0YA 4Y2VA 9ICRA 1FIQA 3PSPA 5AM4A 3C29A 1BPEA 2MUTA 1V9PA 2F1IA 1N2XA 3PR5B 5J0TA 8ICSA 2B56A 3ZDBA 8ICNA 3TFSA 2QB0A 3F2CA 4Q43A 4EZ6A 4P0PA 2PXIA 2ASLA 2ZTDA 3FYHA 3V6KA 3MFIA 3HPOA 2ZH4A 1TFRA 1T3QA 2R8GA 1MIWA 1KW4A 5KAFU 1NJZA 2VKQA 5KFXA 5DBBA 2HOIA 4X0BA 8ICRA 3PW4A 4RU9A 4ED2A 4I2HA 2HBMA 1BGXT 4I2FA 3PX4A 2YTUA 4EP7A 3AQFA 5DGBA 4RWOA 4Q8EA 2E8PA 4BXOB 1ZQSA 1NNLA 3TADA 3UQ0A 3G6XA 4TUQA 1HUZA 3ER9B 4DQIA 2EZXA 7ICGA 1A6SA 5KFQA 4QZIA 2AGPA 2YMLA 1ZQHA 2VJ5A 3PO5A 4M9HA 1T7PA 8ICWA 3M6KA 3H40A 3M1YA 4ECXA 1TK5A 4EX6A 1SL0A 4NM2A 1TAQA 1ZQYA 3RB4A 5ALNA 3UQ2A 5AM0A 1UT5A 3ISDA 4DLGA 5L1JA 2UVVA 2KK0A 5L1KA 4XQ8A 4ED1A 4CGZA 1Z3EB 4AYBF 8ICGA 1PUZA 3V7JA 4RUCA 4NLNA 3JPSA 5ALSA 4RNNA 1SXEA 2HHSA 3ZD8A 3FDSA 1Q3UA 1Z4OA 2KKVA 1ZQNA 4BWJA 8ICAA 2A19A 4US8A 2XI9A 3HIYA 2XGPA 4DSKA 4JLXA 3QX7A 4Q44A 4RPXA 3PSTA 3NVZA 2F1HA 4KITB 1QSYA 3NUQA 5HRIA 5ALZA 2G09A 5J2HA 4DFPA 2KMDA 2VA3A 3IRUA 4O3SA 4YP3A 5CJ7A 1ZQBA 2AJQA 2R8HA 2YN4A 5KFAA 4J9RA 4YMNA 1H38A 5AKHA 1ED1A 5J2AA 4I2DA 3B9JA 1NKBA 4AYBC 2WF9A 2DPJA 2FMQA 1S0VA 1V4AA 2WB1C 4KLLA 9ICNA 2LMRA 1NJXA 7ICKA 2B4VA 4EBEA 1RZTA 1ZYQA 4UASA 2K4EA 4JB3A 4YXJA 5HP4A 3EWAA 5KFZA 5AKGA 4X5VA 4X0AA 1L6NA 2GO7A 4F91B 4RQNA 2KHVA 1SV0A 7ICNA 4ELTA 8ICJA 5J8YC 2K60A 2PMZC 1VLBA 2EH9A 4Y2YA 1A0PA 9ICJA 4EBKA 1IV8A 3GIMA 1VFGA 1B22A 2NO5A 1DK3A 4QW8A 5ALLA 5EE0A 3KKAA 8ICBA 1QLNA 2BBJA 4FHXA 3NRZA 3KHRA 1JROA 2HBKA 2ZTEA 2NRVA 3B0XA 1ZJNA 5KAIU 1JX4A 1KSPA 2H3QA 1NK9A 4WC7A 1S0OA 5F9NA 4C4TA 2ZIXB 2BBHA 4GIBA 9ICFA 4DOCA 2JEGA 1CUKA 1X40A 1KDHA 2C2RA 8ICFA 3MC1A 3RAXA 8ICEA 2JRZA 4UB2A 4UBBA 3N28A 1ZETA 3H0RB 4C8LA 4I28A 3JPPA 4WQLA 5HR9A 1NJWA 5JUMA 2F8LA 2B51A 4IL6U 4IR9A 1TFYA 1V85A 2BCVA 4M0AA 1U9LA 3J81j 5DLFA 4DQRA 5DQHA 1KFSA 5HRDA 5ALYA 3LWLA 2JEFA 4B9SA 1FO4A 1ZQXA 5DG7A 5KFIA 3T5LA 2KZMA 2FCLA 2NV3A 1JALA 5ALMA 4ECVA 4NWIA 2BQRA 4C0ZA 3LVVA 2D8CA 2JMGA 1SKRA 5D61A 5ALIA 3RJIA 4P4PA 5AI9A 3OSPA 4F71A 1RQLA 5KFJA 1JMSA 4RWNA 3UMBA 3IM1A 3U26A 5KG0A 2NYVA 2QB1A 3PY8A 3M9MB 2LHTA 2N1RA 5HRBA 2ZHBA 3CYMA 4F92B 3MGHA 1T8EA 3UMGA 2AHOB 3WK5A 4ECSA 4KLEA 3ZDDA 4Y2RA 1L7NA 5AM5A 8ICVA 3RTVA 1TVAA 4ATBA 3MCRA 4RQ2A 2H3ZA 2DWQA 2JEJA 4R8UA 3ETLA 1UPHA 2DRAA 3D2NA 4GLXA 4QNLA 4DO9A 3KZXA 5TZVA 1M6YA 5J0QA 1FFUA 5KFKA 4J9QA 4F3OA 1BNPA 1TFWA 4O3OA 4RQ5A 4C80A 7ICTA 4IRCA 3G6VA 3D2SA 7ICSA 4C4SA 2BCRA 1SZPA 2G06A 2IA6A 9ICHA 2E8NA 1X2IA 3HKZF 4F5RA 2ES6A 1ZQDA 4ELVA 5KFYA 4UAWA 2Y0SF 3BQ0A 1Y88A 4NXTA 2YQEA 4C7YA 3PW0A 3RRGA 5AI8A 3JCFA 5KFHA 1RM6C 4IQTA 5K4LA 4YXMA 4YCXA 4M2YA 3OHBA 4R64A 3H39A 5CFUA 4OJ5A 1PK3A 5KT6A 5KNIA 1MA7A 2IUBA 5J2DA 3A0BU 2WHEA 2W9BB 2W9MA 5J8YA 3LWMA 3C18A 3JPQA 3NTUA 3HILA 5KFWA 2HBJA 2UVRA 3L9DA 3OHAA 5IIJA 2D6FC 5TISU 4US9A 1XC9A 2VANA 1ZQLA 3GZFA 3GFKB 1WCLA 2KOBA 3EPIA 3RR7A 4KLQA 4ED0A 4M04A 1F5SA 1D9DA 1PVQA 4J9MA 7ICLA 3HWTA 4WBZA 2DBYA 2PFNA 3L3FX 3SEIA 2ZIXA 4NJ8A 1OW5A 2Z7JA 5KG2A 4EEDA 4DSFA 3BQ1A 4B9TA 5KG1A 3NVWA 1Z00A 4K4HA 4J9PA 3C2MA 4F5OA 1VDVA 4ED8A 3AL0B 4QWDA 3I1YA 4JUZA 2DR7A 4QZ9A 2BR0A 3AMZA 5DBAA 5AKXA 3WKEA 4OAGA 4FBTA 4XJEA 4JV1A 2EAOA 5AK5A 1QQ5A 5KG7A 1WCNA 7ICJA 4O68A 4LEVA 2PFQA 5KFPA 5ALPA 5DKWA 4MKPA 1ZOLA 4DF4A 9ICSA 1NI3A 3SV4A 4UQGA 2K4PA 4NV0A 5EWGA 2ZH6A 4O69A 4AT8A 2OWOA 5J2IA 4ECUA 3RR8A 4OO1J 4IQWA 2FMSA 2W54A 3WFSC 7ICOA 2LKYA 1V97A 4Y2UA 1ZQEA 2JHDA 4AT8B 4OD0A 1NKCA 4HAIA 2FDRA 2KSOB 4O3NA 3QEAZ 4P4OA 4F8RA 3SAHA 1YZ6A 2YY6A 3EZ5A 3BQ7A 1SB3C 2DR5A 4EBCA 4P0QB 3CK6A 4KLHA 1P7DA 2NRZA 5KFMA 5HR6A 5HRHA 2BDUA 3RJGA 4K96A 1D9FA 4DFMA 5IIKA 4RQMA 5CRXA 2KG5A 4FFDA 1U4BA 4F93B 4UB3A 4M6WA 5CR0A 4O3MA 2ZH7A 4UAVA 2H3FA 4EEYA 5AI5A 1R89A 4U7CA 4LZDA 5IIMA 2M2VA 3UPSA 1U49A 4LEYA 1ZQVA 3WK9A 4UD5A 1PK1A 2I1QA 2HSZA 1RQNA 4DL6A 2ZIUA 4UB6U 2DKXA 3QU9A 2K4IA 3Q8LA 1C20A 4ACOA 1VJ5A 4LJXA 2HMXA 1IM4A 3BJYA 2BQUA 4P4MA 3K4GA 2V4QA 4X4QA 1K1QA 3QU2A 4QWEA 4AT9A 2DL0A 4GFJA 1TE2A 2Y0SC 3SAFA 1WG8A 5HRLA 4Q8FA 4C7ZA 3KOOA 2DR9A 1SL1A 5F9LA 3OSNA 2QKQA 5ALEA 4PHDA 3M9NB 2HBLA 1MN8A 3LQCB 1FFVA 5C0YA 3OUYA 2VIXA 4O6AA 5KFTA 2CN1A 1UETA 4RWPA 5DECA 4RPZA 1SV4A 4AP9A 4DSJA 4X4SA 4CF5A 2C2EA 2Q4TA 4EGWA 1X9WA 3KHGA 5KFEA 4ED7A 5ALGA 3Q8KA 4KLFA 3N7PD 1ZQJA 1NOMA 8ICHA 1Q79A 2BE3A 3TI0A 1Q78A 2BCSA 2LM1A 5KFUA 4K9AA 4Y2SA 8ICPA 2KEYA 2HVIA 5ALWA 4YG2A 1L7PA 2FLLA 4J9LA 3AM9A 4I2EA 3EUB2 4QZDA 4EZ9A 3GDXA 2KJ9A 2FLPA 4X4NA 2GH1A 1TK0A 5L9XA 1N5XA 3ETRA 5JRTA 3RH5A 1RYRA 1CI4A 4IRDA 1UA1A 4P2HA 2W11A 1Z1BA 4TUSA 2P6RA 1FEZA 4TQRA 4WQKA 4PH5A 2E8OA 2KE7A 3TARA 2H5XA 1ZQAA 4NLZA 2ZH8A 2RP5A 4BUGA 2QB0B 8ICXA 4Y2TA 3PSFA 4DS4A 1Z19A 3ZDCA 3RAQA 4O5KA 5C5JA 2KFNA 2YMPA 4M9LA 4O3RA 4G9BA 2W3SA 5D62A 1F44A 1UCVA 3SI8A 5ALDA 4QZHA 2LYAA 1S9FA 4Z6FA 3ICXA 4LEWA 4NXVA 2WB1F 3T5HA 2LBOA 4J9OA 2ZIVA 3GV5B 3ZD9A 2ZXHA 5J0UA 1DGSA 3HKZC 1KQQA 1ZQIA 4USAA 3TADC 1AQ6A 3M6ZA 2BPFA 7ICRA 2DVIA 4QIWF 5DEDA 3UXNA 4PZOA 2H3VA 3EF2A 2CRXA 2KIVA 5JTGA 1ZQZA 3MR6A 5J2GA 4WC2A 4CCHA 3NWIA 5CP2A 4NL9A 5IIIA 4RQ3A 2W8LA 2ZUDA 4EX7A 4GC7A 3KZIU 1S77D 2YMMA 5F3XB 1PX5A 3TANA 1NKEA 4WBYA 5AI4A 2OEHA 4I2AA 7ICIA 3Q8SB 5B66U 2C22A 1JQRA 5DB8A 2EDUA 4KLTA 2ESEA 2B6GA 2KFZA 1ZD3A 4DSIA 4IR1A 1NZBA 3NVOA 3T79A 3ISCA 4F72A 3UXPA 3GILA 1ZXIA 1V38A 5AKJA 3HP6A 4IC9A 1COOA 1QSLA 5AI0A 4EENA 1MSWD 4MFAA 3WKBA 2W43A 3H8MA 4ED6A 5KL1B 4I2GA 1QSSA 7ICHA 2KJ5A 4GC6A 2IOFA 3KD3A 3E0FA 1SKWA 1ZJMA 2WFAA 5KG3A 3ZI4A 4NXWA 4OJLA 5DLGA 2ZUBA 1DGJA 2NRXA 1NK5A 3PV8A 2DF4B 2KN7A 2ZJAA 1DOQA 1ECWA 1X6JA 4LZGA 5L1IA 3JZ0A 4OAFA 9ICBA 3RB0A 4UW9A 4YR0A 1Z4NA 3L4PA 4NLKA 2PBEA 4NLBA 4DL3A 3QUTA 4K8VA 2A1AA 4DL7A 3KBBA 3F5EA 1U48A 1QTMA 3RH6A 5ALRA 2C28A 2PI4A 2M2WA 8ICMA 2XICA 4ELUA 3AEVA 2E5SA 4CDGA 2EANA 1ZQUA 2JR5A 3C5FA 3L5KA 2A3VA 4RQ7A 5EOZA 2E1EA 2RDIA 1XNSA 2RDJA 1X9SA 2KKPA 5CFTA 3NVYA 3ERCC 1GO3F 2A1JA 5J2KA 1ZQRA 4O5CA 3F53A 4O3QA 2UVUA 5KT5A 2XVTA 3MR2A 4NLCA 4X4RA 1YLQA 3C2LA 1RDFA 2IHMA 3H3AA 2ZHAA 3GIJA 7ICPA 1SKSA 4DOBA 3IP4B 4C4RA 5IILA 3BDPA 3PZPA 1ZQQA 3UM9A 4F50A 3BZKA 3UXOA 5KFLA 3C2KA 3SQIA 3C23A 2XGQA 3WKCA 5EE9A 4PL1A 3K1ZA 3HX0A 1NZPA 1HEKA 2G5HB 1ZQFA 7ICVA 2MSNA 2FPKA 3T5KA 2OXOA 1UEUA 3PMNA 2R8KA 4E80A 3IHQB 1SWWA 1UEVA 1JAJA 4KB6A 3V6HA 4J9KA 2K89A 3KKAC 2DGZA 4RT2A 3OV7A 3ORYA 5FP0A 1MQ2A 4DFDA 2I6XA 5KFCA 4X4PA 2BHNA 2HVHA 2BKEA 4YFKA 3GQCA 5GTHU 3Q8PB 1BNOA 2DQNB 2M9NA 2AU0A 2ZTCA 9ICUA 4O0IA 2ZIWB 4I27A 2XIDA 4X4UA 5KFBA 2E1FA 5KT4A 9ICOA 5BOLA 4ECQA 8ICQA 2WF8A 3QXGA 3WK7A 8ICLA 2HHVA 4HX0A 3OGUA 1TKDA 4PGYA 4UAZA 3WFOA 5D4BA 4JLZA 4GXKA 1HIWA 2WF5A 2ZH9A 4XQ7A 4QIWC 7ICEA 1K5OA 3RJFA 2HN1A 1MIYA 2O5AA 4KX5A 2W3RA 3RB3A 4UATA 3K75D 4I2CA 2JH1A 3SAGA 3K1RB 4I2IA 2QLTA 3JPRA 3KHHA 1RPLA 3IV6A 1IXRA 2I5HA 3QUCA 4LT6A 5AKEA 3KTQA 1WWVA 4QZBA 2ZJ8A 1RXVA 1LV5A 2F8KA 4DQPA 1KFTA 4JV2A 5KL8B 3PX0A 2G0AA 5J2FA 3MDAA 1MQ3A 3MABA 4F5QA 2OH2A 2XY6A 2IHNA 5GTIU 1R8AA 3RJKA 3KFUF 5HNKA 2L5YA 5E79U 3C28A 1BPZA 5EWEA 5EE3A 4QWCA 3VC8A 2HHQA 4RZRA 2KJ8A 1F5AA 4MEYA 3JYYA 4YN4A 2JXJA 4K98A 5ALOA 3PW2A 2MAXA 4EELA 2YB1A 2W9CA 4K9BA 4P0PB 1A76A 9ICTA 2ODGA 2KP7A 3NS1A 3N4MB 4KX3A 4C8MA 4EYHB 4WC6A 3E2EA 4MFCA 2F2AB 2BGWA 2E3TA 4CF3A 4DOAA 5J0RA 1S76D 4B9UA 3CP8A 1L3VA 4FBUA 1NJYA 8ICCA 2FJ6A 4PPXA 4PHAA 3RJEA 2AGQA 3NVVA 3H0MB 3RFAA 4KLMA 5AK4A 4F5NA 4KLSA 9ICXA 5KT2A 3RF9A 2XY5A 4TURA 2KICA 3TKAA 2BCUA 4KLJA 2ZH2A 4DQQA 5DB9A 2OHFA 4IQVA 1SGGA 4UB5A 3SD7A 4NXZA 4BGDA 5HMMA 2QARB 2ATLA 8ICIA 2W9CB 3WFQE 2HHTA 1X66A 2ZJ5A 3ZDAA 5DQGA 3QE9Y 4FO6A 1N5WA 5AM1A 3WKDA 4JWNA 4B6JA 3CRXA 1PZNA 1S10A 3H8JA 3WFRE 2NRWA 3TACB 3C5GA 5HRKA 3PW7A 9ICPA 2W7OA 3UPQA 2ISOA 1JXLA 3BZCA 5HHHA 4FHVA 5AM2A 4O67A 3QZ7A 1UHUA 2RQ5A 2BPGA 4NKUA 5AKLA 4XA5A 3RBDA 3C66A 4QZEA 5CWRA 8ICKA 3EW9A 2KHQA 1X6IA 3PSIA 3RB6A 1DXSA 1BPBA 1X42A 2J6TA 3SENA 5KG4A 2MA1A 3QUBA 4FE3A 4ICAA 1FA0A 4RWQA 1RYSA 1VJ7A 4MFFA 4RQ6A 2O1PA 5AKYA 4X4OA 3TAPA 4Q45A 3WKAA 1ZRNA 3MDCA 3CNHA 4R65A 2ZIVB 3Q8MA 2LPEA 1ZQMA 4MF8A 2B21A 3GV7B 4R63A 9ICQA 4DSEA 3WK6A 3M9OB 4UB1A 1B4FA 5HHIA 5AIBA 5KFDA 2O6KA 4FH5A 4QWBA 4WC3A 4FHPA 3ER8C 4F2RA 2P6UA 2KTQA 9ICEA 2DFLA 4X4VA 1LB2B 3PMLA 1U45A 4M6WB 5F2VO 4YD1A 1XSLA 3M8RA 4XUSA 3M8SA 2HN2A 2F1JA 4BJQA 2IBKA 3RRHA 4DL2A 5EE1A 2KZZA 4OAHA 4KLUA 4NKTA 4WJ3B 1JIHA 4F4XA 2FPMA 4EYIB 5CHGA 4KLDA 1KN5A 1R8CA 1KEJA 3N7SC 5T14A 3HW8A 4KN7A 2W04A 4RNMA 2DPIA 4WC4A 3FM9A 1HJPA 1UQVA 1KBUA 1Q3VA 4FZLA 4DFJA 1WOTA 2CXYA 3DDHA 4Y2PA 1HUOA 2BZFA 4CE6A 2W8KA 1CEZA 3FAHA 1XO1A 2JH7A 4QZAA 4AT7A 1TAMA 3QU5A 3BS5B 2AQ0A 5ALVA 5BOMA 1NK8A 4RQ8A 1QQ6A 4YR3A 5KFRA 4E8FA 1SIJA 3MGIA 1L3UA 4CF4A 4E0DA 5G5GA 3SR6A 4FS1A 3BQTA 2W9AA 4M9GA 4OJ6A 4I29A 3QU4A 1D8YA 4DS5A 7ICQA 5J0OA 5JTIA 1S0NA 5AIAA 5DDMA 2UVWA 4DFKA 2F44A 4K99A 2JEIA 1TAUA 2KSOA 1LVHA 1JUDA 3ONNA 4RQ0A 3HJ4A 4QJFB 4AT7B 2WF7A 3OPXA 1KL9A 2R18A 1JN3A 3DV9A 5DQIA 4GXIA 1L3TA 5B3PA
chains in the Genus database with same CATH topology
4ELUA 5TZVA 1KTQA 4HYKA 4PGXA 1TV9A 3AQMA 4S3NA 1ZQUA 4R8UB 5J0QA 3RBEA 1ZQPA 5KFKA 4J9QA 1U47A 1RXWA 3C5FA 4F3OA 1BNPA 1TFWA 4RQ7A 4R66A 5HREA 5EOZA 9ICLA 4G3IA 8ICZA 4O3OA 2RDIA 4RQ5A 2RDJA 7ICTA 3EYZA 1X9SA 5KFOA 4LVSA 3OUYB 1XSNA 3G6VA 3TAQA 2A1JA 5KFVA 5J0XA 4B9NA 5J2KA 2A1JB 1ZQRA 4XRHA 2BCRA 4O5CA 4O3QA 7ICSA 1SZPA 5KT5A 2UVUA 2IA6A 9ICHA 2ID1A 4TQSA 3MR2A 4QZGA 4RUAA 1X2IA 4M9JA 4O3PA 2ASJA 1ZQCA 4GXJA 4WC0A 1YLQA 3C2LA 1ZQTA 2IHMA 4X4RA 4M9NA 3H3AA 2ZHAA 4E7XA 3GIJA 4F5RA 7ICPA 2DR8A 1SKSA 3LK9A 4DOBA 1ZQDA 4ELVA 2HHXA 5KFYA 4UAWA 3BQ0A 5J0YA 1BPYA 1Y88A 5KFNA 5KFGA 5BPCA 1C7YA 5IILA 4DWIA 3BDPA 1ZQQA 4F50A 3PW0A 1KLNA 3UXOA 3RRGA 4PHEA 5KFHA 4F4KA 1T4GA 1NK0A 9ICGA 5KFLA 4UBCA 5J2JA 2PI5A 4ATBB 3OVAA 2XO7A 3C2KA 3G6YA 4DEZA 4X4TA 4IQTA 2VA2A 3H37A 2BCQA 3C23A 2XGQA 4FH3A 4YXMA 4YCXA 4M2YA 9ICKA 4EBJA 3OHBA 4R64A 3H39A 5HRFA 5D49A 3HX0A 1NZPA 5DDYA 4O5EA 1XS9D 3NYBA 2R8IA 5KT6A 3H7IA 1BPXA 4DL5A 5J2DA 3V72A 1ZQFA 4B9MA 7ICVA 2FPKA 4DQSA 3T5KA 2W9BB 3RJJA 2W9MA 1UEUA 4YMOA 2BPCA 7ICUA 5DGAA 1BPDA 5J0WA 3LWMA 3PMNA 4YR2A 5KG5A 2R8KA 3JPQA 1NK7A 4I2BA 3IHQB 4KLIA 2M2TA 4RT3A 3H38A 2FLNA 2P66A 1JAJA 1UEVA 3V6HA 4J9KA 2BDPA 3NTUA 5KFWA 4QZCA 4JK1A 4F4WA 1N48A 2W9BA 4RT2A 2UVRA 3L9DA 2HHPA 3OV7A 4DLEA 1KFDA 5D46A 3ORYA 4YVZA 5IIJA 3OHAA 2PFOA 1NK4A 4WCWA 4IG8A 1XC9A 2VANA 3RJHA 1ZQLA 4ECRA 1MQ2A 3AQKA 3GFKB 1WCLA 1XWLA 3MBYA 5KFCA 4RPYA 3EPIA 2BHNA 3T5JA 3THVA 3RR7A 4KLQA 2HVHA 4X4PA 2BKEA 5KFFA 2R8JA 4ED0A 4YFKA 1X9MA 4M04A 3GQCA 1D9DA 2JZBA 4UD4A 3Q8PB 3MFHA 1BNOA 4J9MA 3KHLA 3HWTA 7ICLA 3HJ1A 2M9NA 4WBZA 2AU0A 3PO4A 4F4ZA 2ZTCA 1ZQOA 2PFNA 4O0IA 8ICUA 9ICUA 9ICWA 4I27A 4X4UA 5KFBA 3JPNA 4JWMA 5KT4A 1EXNA 2BQ3A 9ICOA 3C1ZA 5KG2A 4PHPA 5BOLA 3GIKA 3V7LA 5DB6A 4DSFA 3BQ1A 4ECQA 2AQ4A 8ICQA 4B9TA 3EPGA 5KG1A 1NK6A 4NY8A 3BQ2A 3AQLA 1Z00A 8ICLA 4K4HA 4J9PA 5J2EA 3C2MA 4F5OA 2WTFA 4ED8A 3PX6A 1UA0A 2HHVA 9ICIA 4QWDA 2IMWP 3OGUA 1TKDA 4PGYA 4JUZA 2DR7A 4QZ9A 4BWMA 4UAZA 4DF8A 5D4BA 4KLOA 4ECZA 2BR0A 4B9LA 3WFOA 1XU4A 5DBAA 5HRGA 3C21A 3B0YA 7ICFA 4GXKA 9ICRA 4DL4A 4FBTA 4KMUA 4JV1A 2DRBA 5KG7A 1WCNA 4EBDA 7ICJA 2ZH9A 1BPEA 2MUTA 4XQ7A 1V9PA 7ICEA 4WC6A 4DSLA 2F1IA 2PFQA 5KFPA 3PR5B 3RJFA 5DKWA 5J0TA 8ICSA 1MIYA 3ZDBA 2O5AA 4DF4A 3TFSA 8ICNA 2J6UA 3SV4A 9ICSA 4UQGA 3RB3A 3V6JA 5EWGA 2ZH6A 3K75D 5J0PA 2OWOA 4I2CA 4AT8A 5J0SA 4I2IA 3JPRA 5J2IA 3KHHA 4Q43A 4ECUA 1RPLA 3RR8A 1IXRA 4EZ6A 4M5DA 4IQWA 2ZH1A 2FMSA 2PXIA 3WFSC 4LT6A 2ASLA 7ICOA 1VFGA 2ZTDA 3FYHA 3V6KA 4UB4A 3MFIA 2V9WA 4TUPA 3HPOA 2ZH4A 3TFRA 1TFRA 1ZQEA 4AT8B 3KTQA 2R8GA 1NKCA 3Q8QB 1MIWA 4QZBA 3AU2A 5J2BA 2ZJ8A 4P4OA 4O3NA 3QEAZ 1NJZA 1RXVA 1LV5A 5KFXA 5DBBA 3EZ5A 4F8RA 4X0BA 8ICRA 2DR5A 3PW4A 4RU9A 4ED2A 4EBCA 4DQPA 4I2HA 1KFTA 4JV2A 3PX0A 4KLHA 1BGXT 2NRZA 5J2FA 5KFMA 1NO5A 5IIOA 5KFSA 3PX4A 4I2FA 3MDAA 1MQ3A 5HRHA 4EP7A 3RJGA 5DGBA 4ECYA 1D9FA 3MR3A 4RWOA 1R8BA 1B43A 4DFMA 3MABA 4F5QA 1SL2A 4IRCA 2XY6A 2IHNA 4Q8EA 5IIKA 3RJKA 4BXOB 5HNKA 1ZQSA 1R8AA 1BPZA 4ZH4A 5EWEA 3UQ0A 1U4BA 1A77A 4QWCA 4F93B 4TUQA 3G6XA 4C8OA 4K4GA 1N56A 4UB3A 2KZ3A 4RZRA 4M6WA 2HHQA 5CR0A 4M47A 4MEYA 1HUZA 1K1SA 1F5AA 3JYYA 2ZH7A 4F4YA 4YN4A 4DQIA 1ZQKA 7ICGA 9ICCA 5KFQA 4QZIA 2NRTA 2AGPA 3AU6A 2VA8A 3PW2A 1ZQGA 2MAXA 1ZQHA 4EEYA 2W9CA 1R89A 3PO5A 4M9HA 4LZDA 5IIMA 1A76A 1T7PA 9ICTA 5CB1A 8ICWA 2M2VA 3UPSA 1U49A 2KP7A 2Q66A 1ZQVA 3N4MB 3H40A 2PFPA 3NGDA 4UD5A 4ECXA 2I1QA 1TK5A 1SL0A 4NM2A 4DL6A 1TAQA 1ZQYA 3RB4A 3UQ2A 4C8MA 4EYHB 1UT5A 3ISDA 4RQ1A 5L1JA 4J9NA 4DLGA 3Q8LA 2UVVA 1L3SA 5L1KA 4MFCA 3LDAA 2BGWA 1BVSA 2ALZA 2HHUA 4DOAA 4XQ8A 5J0RA 1S76D 1IM4A 3BJYA 4ED1A 2BQUA 4P4MA 4B9UA 3K4GA 2V4QA 1L3VA 1Z3EB 4KTQA 1K1QA 4QWEA 3AUOA 1L5UA 1NJYA 4FBUA 2HW3A 8ICCA 4X4QA 5EWFA 4AT9A 1TK8A 4PPXA 8ICGA 4PHAA 3RJEA 2AGQA 3V7JA 4RUCA 4NLNA 3JPSA 3H4DA 4KLMA 4RNNA 2HHSA 2XC9A 5HRLA 3ZD8A 3FDSA 2XCAA 2V4RA 5DB7A 3JPOA 4Q8FA 1ZQNA 4BWJA 4F5NA 4KLSA 4PGQA 1MIVA 8ICAA 2DR9A 1SL1A 4UAYA 5KT2A 5F9LA 4YQWA 2XY5A 3RH4A 4TURA 9ICXA 3OSNA 3HIYA 2XGPA 2BCUA 4PHDA 3M9NB 4DSKA 4KLJA 3H8WA 2ZH2A 3LQCB 4Q44A 4RPXA 4DQQA 5KG6A 3OUYA 5DB9A 2F1HA 3OJSA 4KITB 1QSYA 4IQVA 4UB5A 5KFTA 3PW5A 1UETA 4NXZA 5HRIA 5DECA 4BGDA 4RWPA 5HMMA 4RPZA 2MUTB 5J2HA 2ATLA 2W9CB 3SZ2A 8ICIA 3WFQE 4DFPA 2VA3A 2LYHA 4RNOA 3V7KA 2RFFA 4DSJA 2HHTA 4FS2A 8ICYA 4X4SA 2ZJ5A 3ZDAA 4O3SA 4YP3A 2C2EA 5DQGA 3QE9Y 5CJ7A 1ZQBA 1X9WA 1ZQWA 4FO6A 4IRKA 3KHGA 3H4BA 5KFEA 2R8HA 5HC9A 5KFAA 4J9RA 4YMNA 4ED7A 1H38A 7ICMA 4MF2A 3Q8KA 4KLFA 4QW9A 4QWAA 1ZQJA 1NOMA 1JXEA 4JWNA 5J2AA 8ICHA 4I2DA 1Q79A 2BE3A 1PZNA 1NKBA 1S10A 3TI0A 3H8JA 5KT3A 2NRWA 2BCSA 1Q78A 3WFRE 5KFUA 2M2UA 2DPJA 2FMQA 3C5GA 1S0VA 1V4AA 5HRKA 5DBCA 1T3NA 3PR4A 3PW7A 4KLLA 8ICPA 9ICPA 2HVIA 3UPQA 2ISOA 9ICNA 1JXLA 4YG2A 5HHHA 4NM1A 1NJXA 2FLLA 7ICKA 2NRKA 4EBEA 4FHVA 2JZBB 4J9LA 3QZ7A 1RZTA 4I2EA 2Q0ZX 4QZDA 1ZYQA 2BPGA 4EZ9A 3GDXA 4NKUA 4XA5A 3RBDA 4QZFA 3C66A 3GV8B 2FLPA 4QZEA 4X4NA 5CWRA 8ICKA 4YXJA 5L9XA 1TK0A 3EWAA 2FPLA 3EW9A 3TQ1A 5HP4A 5KFZA 3RH5A 9ICMA 1RYRA 4YD2A 4IRDA 3RB6A 4X5VA 3SYZA 1UA1A 3ISBA 3C18A 4P2HA 4X0AA 1BPBA 4F91B 2ZH3A 4TUSA 4ECTA 2P6RA 4F5PA 2J6TA 7ICNA 5KG4A 4E80A 4TQRA 4ELTA 8ICJA 4PH5A 1FA0A 4RWQA 3TARA 1RYSA 8ICTA 9ICJA 4MFFA 1VJ7A 4EBKA 4RQ6A 3GIMA 3T3FA 2H5XA 3PNCA 1ZQAA 4QW8A 4NLZA 1B22A 1DK3A 2O1PA 4WC5A 2ZH8A 8ICXA 4X4OA 3TAPA 4Q45A 8ICBA 4DS4A 2AGOA 1QLNA 3C1YA 3ZDCA 3RAQA 3MDCA 4C8NA 5C5JA 4O5KA 4M9LA 4O3RA 2KFNA 4FHXA 3KHRA 4R65A 2XCPA 3Q8MA 3SI8A 4FHWA 2ZUCA 4QZHA 4MF8A 1ZQMA 1S9FA 4F2SA 2ZTEA 4Z6FA 2B21A 3GV7B 4R63A 2NRVA 2XY7A 3B0XA 9ICQA 4DSEA 1ZJNA 1JX4A 1KSPA 3H8SA 3M9OB 4UB1A 5HHIA 5KFDA 3T5HA 4J9OA 3PVXA 3GV5B 1NK9A 4FH5A 1KRPA 4WC7A 4QWBA 1S0OA 5F9NA 4KLGA 1D8LA 3ZD9A 4F2RA 4FHPA 4AT9B 4WC3A 2P6UA 3QEBZ 2KTQA 5HMLA 5J0UA 9ICEA 2DFLA 1DGSA 2HHWA 4DOCA 9ICFA 1LB2B 1ZQIA 2JEGA 3PMLA 3OVBA 4X4VA 4ECWA 1CUKA 2AJQA 1KDHA 1U45A 4BDPA 2C2RA 8ICFA 5J2CA 2BPFA 7ICRA 2DVIA 4M6WB 5DEDA 3UXNA 2GWSA 3RAXA 5F2VO 3JPTA 4YD1A 8ICEA 4UB2A 1XSLA 4UBBA 1UT8A 4BXOA 3M8RA 1ZETA 1ZQZA 3MR6A 5J2GA 4XUSA 4B9VA 4WC2A 3M8SA 9ICAA 3E2EA 4CCHA 5CP2A 4Z6CA 2F1JA 5IIIA 4RQ3A 2I9GA 4C8LA 4I28A 1AROP 3JPPA 4I2JA 2W8LA 2ZUDA 2ASDA 2IBKA 3RRHA 4DL2A 1NJWA 4GC7A 5HR9A 5KTQA 5JUMA 1S77D 2KZZA 4KLUA 2J6SA 4NKTA 1JIHA 4F4XA 2FPMA 4EYIB 4IR9A 5CHGA 1TFYA 9ICVA 4KLDA 1R8CA 1KEJA 2BCVA 4M0AA 1PX5A 1U9LA 3HW8A 3TANA 1NKEA 4KN7A 4KN4A 4RNMA 2DPIA 4WBYA 5DLFA 4WC4A 3ZDEA 4RQ4A 3N97B 1HJPA 4DQRA 5DQHA 3WFPA 4MEXA 4WC1A 4DFJA 4I2AA 7ICIA 1WOTA 1KFSA 5DG9A 3Q8SB 5HRDA 3LWLA 2JEFA 1HUOA 4O9MA 1CEZA 2W8KA 1XSPA 5DG7A 1ZQXA 2C22A 4B9SA 1JQRA 5DB8A 1XO1A 1S0MA 5KFIA 4K4IA 4KLTA 3GIIA 2KFZA 3T5LA 4DSIA 4QZAA 4NLGA 4IR1A 2KZMA 4AT7A 3ISCA 4Z6DA 3UXPA 3GILA 4ECVA 2AQ0A 1MC8A 2BQRA 3MR5A 3HP6A 5BOMA 1NK8A 3QZ8A 4QZ8A 1COOA 4RQ8A 1QSLA 4YR3A 5IINA 5KFRA 1MSWD 1SKRA 4FHYA 4E8FA 4JV0A 4MFAA 3MGIA 3RJIA 1L3UA 3OVSA 4P4PA 2ZH5A 4E0DA 2Y1JA 4ED6A 4FS1A 1S97A 4I2GA 3BQTA 2W9AA 4M9GA 3OSPA 1QSSA 4I29A 5KFJA 1JMSA 4GC6A 2Y1IA 7ICHA 1D8YA 4RWNA 4YMMA 3IM1A 4DS5A 2C2DA 7ICQA 1DK2A 5J0OA 1SKWA 5L1LA 3Q8RB 5KG0A 2FMPA 1S0NA 3PY8A 1ZJMA 3M9MB 5KG3A 2ZHBA 5HRBA 4F92B 3MGHA 5DDMA 1T8EA 4DFKA 2UVWA 1OU5A 4J9SA 5DLGA 2ZUBA 2NRXA 3SV3A 2JEIA 4C8KA 1NK5A 4ECSA 4KLEA 3ZDDA 3PV8A 3HT3A 2KN7A 2ZJAA 1DOQA 1TAUA 8ICVA 1KNYA 3RTVA 4LZGA 1Z00B 5L1IA 1TVAA 3OJUA 5CA7A 2ISPA 3JZ0A 9ICBA 4ATBA 3RB0A 4Z6EA 5J29A 4YR0A 4RQ2A 4NLKA 2PBEA 4ED3A 4DL3A 4RQ0A 3HJ4A 5DG8A 4DL7A 5KT7A 1U48A 1QTMA 4AT7B 2JEJA 3RH6A 4R8UA 8ICOA 3ETLA 2DRAA 4GLXA 2C28A 2PI4A 1JN3A 5DQIA 4GXIA 3AQNA 1L3TA 2M2WA 8ICMA 4DO9A 4IQUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ELU A;  5TZV A;  1KTQ A;  4HYK A;  4PGX A;  1TV9 A;  3AQM A;  4S3N A;  1ZQU A;  4R8U B;  5J0Q A;  3RBE A;  1ZQP A;  5KFK A;  4J9Q A;  1U47 A;  1RXW A;  3C5F A;  4F3O A;  1BNP A;  1TFW A;  4RQ7 A;  4R66 A;  5HRE A;  5EOZ A;  9ICL A;  4G3I A;  8ICZ A;  4O3O A;  2RDI A;  4RQ5 A;  2RDJ A;  7ICT A;  3EYZ A;  1X9S A;  5KFO A;  4LVS A;  3OUY B;  1XSN A;  3G6V A;  3TAQ A;  2A1J A;  5KFV A;  5J0X A;  4B9N A;  5J2K A;  2A1J B;  1ZQR A;  4XRH A;  2BCR A;  4O5C A;  4O3Q A;  7ICS A;  1SZP A;  5KT5 A;  2UVU A;  2IA6 A;  9ICH A;  2ID1 A;  4TQS A;  3MR2 A;  4QZG A;  4RUA A;  1X2I A;  4M9J A;  4O3P A;  2ASJ A;  1ZQC A;  4GXJ A;  4WC0 A;  1YLQ A;  3C2L A;  1ZQT A;  2IHM A;  4X4R A;  4M9N A;  3H3A A;  2ZHA A;  4E7X A;  3GIJ A;  4F5R A;  7ICP A;  2DR8 A;  1SKS A;  3LK9 A;  4DOB A;  1ZQD A;  4ELV A;  2HHX A;  5KFY A;  4UAW A;  3BQ0 A;  5J0Y A;  1BPY A;  1Y88 A;  5KFN A;  5KFG A;  5BPC A;  1C7Y A;  5IIL A;  4DWI A;  3BDP A;  1ZQQ A;  4F50 A;  3PW0 A;  1KLN A;  3UXO A;  3RRG A;  4PHE A;  5KFH A;  4F4K A;  1T4G A;  1NK0 A;  9ICG A;  5KFL A;  4UBC A;  5J2J A;  2PI5 A;  4ATB B;  3OVA A;  2XO7 A;  3C2K A;  3G6Y A;  4DEZ A;  4X4T A;  4IQT A;  2VA2 A;  3H37 A;  2BCQ A;  3C23 A;  2XGQ A;  4FH3 A;  4YXM A;  4YCX A;  4M2Y A;  9ICK A;  4EBJ A;  3OHB A;  4R64 A;  3H39 A;  5HRF A;  5D49 A;  3HX0 A;  1NZP A;  5DDY A;  4O5E A;  1XS9 D;  3NYB A;  2R8I A;  5KT6 A;  3H7I A;  1BPX A;  4DL5 A;  5J2D A;  3V72 A;  1ZQF A;  4B9M A;  7ICV A;  2FPK A;  4DQS A;  3T5K A;  2W9B B;  3RJJ A;  2W9M A;  1UEU A;  4YMO A;  2BPC A;  7ICU A;  5DGA A;  1BPD A;  5J0W A;  3LWM A;  3PMN A;  4YR2 A;  5KG5 A;  2R8K A;  3JPQ A;  1NK7 A;  4I2B A;  3IHQ B;  4KLI A;  2M2T A;  4RT3 A;  3H38 A;  2FLN A;  2P66 A;  1JAJ A;  1UEV A;  3V6H A;  4J9K A;  2BDP A;  3NTU A;  5KFW A;  4QZC A;  4JK1 A;  4F4W A;  1N48 A;  2W9B A;  4RT2 A;  2UVR A;  3L9D A;  2HHP A;  3OV7 A;  4DLE A;  1KFD A;  5D46 A;  3ORY A;  4YVZ A;  5IIJ A;  3OHA A;  2PFO A;  1NK4 A;  4WCW A;  4IG8 A;  1XC9 A;  2VAN A;  3RJH A;  1ZQL A;  4ECR A;  1MQ2 A;  3AQK A;  3GFK B;  1WCL A;  1XWL A;  3MBY A;  5KFC A;  4RPY A;  3EPI A;  2BHN A;  3T5J A;  3THV A;  3RR7 A;  4KLQ A;  2HVH A;  4X4P A;  2BKE A;  5KFF A;  2R8J A;  4ED0 A;  4YFK A;  1X9M A;  4M04 A;  3GQC A;  1D9D A;  2JZB A;  4UD4 A;  3Q8P B;  3MFH A;  1BNO A;  4J9M A;  3KHL A;  3HWT A;  7ICL A;  3HJ1 A;  2M9N A;  4WBZ A;  2AU0 A;  3PO4 A;  4F4Z A;  2ZTC A;  1ZQO A;  2PFN A;  4O0I A;  8ICU A;  9ICU A;  9ICW A;  4I27 A;  4X4U A;  5KFB A;  3JPN A;  4JWM A;  5KT4 A;  1EXN A;  2BQ3 A;  9ICO A;  3C1Z A;  5KG2 A;  4PHP A;  5BOL A;  3GIK A;  3V7L A;  5DB6 A;  4DSF A;  3BQ1 A;  4ECQ A;  2AQ4 A;  8ICQ A;  4B9T A;  3EPG A;  5KG1 A;  1NK6 A;  4NY8 A;  3BQ2 A;  3AQL A;  1Z00 A;  8ICL A;  4K4H A;  4J9P A;  5J2E A;  3C2M A;  4F5O A;  2WTF A;  4ED8 A;  3PX6 A;  1UA0 A;  2HHV A;  9ICI A;  4QWD A;  2IMW P;  3OGU A;  1TKD A;  4PGY A;  4JUZ A;  2DR7 A;  4QZ9 A;  4BWM A;  4UAZ A;  4DF8 A;  5D4B A;  4KLO A;  4ECZ A;  2BR0 A;  4B9L A;  3WFO A;  1XU4 A;  5DBA A;  5HRG A;  3C21 A;  3B0Y A;  7ICF A;  4GXK A;  9ICR A;  4DL4 A;  4FBT A;  4KMU A;  4JV1 A;  2DRB A;  5KG7 A;  1WCN A;  4EBD A;  7ICJ A;  2ZH9 A;  1BPE A;  2MUT A;  4XQ7 A;  1V9P A;  7ICE A;  4WC6 A;  4DSL A;  2F1I A;  2PFQ A;  5KFP A;  3PR5 B;  3RJF A;  5DKW A;  5J0T A;  8ICS A;  1MIY A;  3ZDB A;  2O5A A;  4DF4 A;  3TFS A;  8ICN A;  2J6U A;  3SV4 A;  9ICS A;  4UQG A;  3RB3 A;  3V6J A;  5EWG A;  2ZH6 A;  3K75 D;  5J0P A;  2OWO A;  4I2C A;  4AT8 A;  5J0S A;  4I2I A;  3JPR A;  5J2I A;  3KHH A;  4Q43 A;  4ECU A;  1RPL A;  3RR8 A;  1IXR A;  4EZ6 A;  4M5D A;  4IQW A;  2ZH1 A;  2FMS A;  2PXI A;  3WFS C;  4LT6 A;  2ASL A;  7ICO A;  1VFG A;  2ZTD A;  3FYH A;  3V6K A;  4UB4 A;  3MFI A;  2V9W A;  4TUP A;  3HPO A;  2ZH4 A;  3TFR A;  1TFR A;  1ZQE A;  4AT8 B;  3KTQ A;  2R8G A;  1NKC A;  3Q8Q B;  1MIW A;  4QZB A;  3AU2 A;  5J2B A;  2ZJ8 A;  4P4O A;  4O3N A;  3QEA Z;  1NJZ A;  1RXV A;  1LV5 A;  5KFX A;  5DBB A;  3EZ5 A;  4F8R A;  4X0B A;  8ICR A;  2DR5 A;  3PW4 A;  4RU9 A;  4ED2 A;  4EBC A;  4DQP A;  4I2H A;  1KFT A;  4JV2 A;  3PX0 A;  4KLH A;  1BGX T;  2NRZ A;  5J2F A;  5KFM A;  1NO5 A;  5IIO A;  5KFS A;  3PX4 A;  4I2F A;  3MDA A;  1MQ3 A;  5HRH A;  4EP7 A;  3RJG A;  5DGB A;  4ECY A;  1D9F A;  3MR3 A;  4RWO A;  1R8B A;  1B43 A;  4DFM A;  3MAB A;  4F5Q A;  1SL2 A;  4IRC A;  2XY6 A;  2IHN A;  4Q8E A;  5IIK A;  3RJK A;  4BXO B;  5HNK A;  1ZQS A;  1R8A A;  1BPZ A;  4ZH4 A;  5EWE A;  3UQ0 A;  1U4B A;  1A77 A;  4QWC A;  4F93 B;  4TUQ A;  3G6X A;  4C8O A;  4K4G A;  1N56 A;  4UB3 A;  2KZ3 A;  4RZR A;  4M6W A;  2HHQ A;  5CR0 A;  4M47 A;  4MEY A;  1HUZ A;  1K1S A;  1F5A A;  3JYY A;  2ZH7 A;  4F4Y A;  4YN4 A;  4DQI A;  1ZQK A;  7ICG A;  9ICC A;  5KFQ A;  4QZI A;  2NRT A;  2AGP A;  3AU6 A;  2VA8 A;  3PW2 A;  1ZQG A;  2MAX A;  1ZQH A;  4EEY A;  2W9C A;  1R89 A;  3PO5 A;  4M9H A;  4LZD A;  5IIM A;  1A76 A;  1T7P A;  9ICT A;  5CB1 A;  8ICW A;  2M2V A;  3UPS A;  1U49 A;  2KP7 A;  2Q66 A;  1ZQV A;  3N4M B;  3H40 A;  2PFP A;  3NGD A;  4UD5 A;  4ECX A;  2I1Q A;  1TK5 A;  1SL0 A;  4NM2 A;  4DL6 A;  1TAQ A;  1ZQY A;  3RB4 A;  3UQ2 A;  4C8M A;  4EYH B;  1UT5 A;  3ISD A;  4RQ1 A;  5L1J A;  4J9N A;  4DLG A;  3Q8L A;  2UVV A;  1L3S A;  5L1K A;  4MFC A;  3LDA A;  2BGW A;  1BVS A;  2ALZ A;  2HHU A;  4DOA A;  4XQ8 A;  5J0R A;  1S76 D;  1IM4 A;  3BJY A;  4ED1 A;  2BQU A;  4P4M A;  4B9U A;  3K4G A;  2V4Q A;  1L3V A;  1Z3E B;  4KTQ A;  1K1Q A;  4QWE A;  3AUO A;  1L5U A;  1NJY A;  4FBU A;  2HW3 A;  8ICC A;  4X4Q A;  5EWF A;  4AT9 A;  1TK8 A;  4PPX A;  8ICG A;  4PHA A;  3RJE A;  2AGQ A;  3V7J A;  4RUC A;  4NLN A;  3JPS A;  3H4D A;  4KLM A;  4RNN A;  2HHS A;  2XC9 A;  5HRL A;  3ZD8 A;  3FDS A;  2XCA A;  2V4R A;  5DB7 A;  3JPO A;  4Q8F A;  1ZQN A;  4BWJ A;  4F5N A;  4KLS A;  4PGQ A;  1MIV A;  8ICA A;  2DR9 A;  1SL1 A;  4UAY A;  5KT2 A;  5F9L A;  4YQW A;  2XY5 A;  3RH4 A;  4TUR A;  9ICX A;  3OSN A;  3HIY A;  2XGP A;  2BCU A;  4PHD A;  3M9N B;  4DSK A;  4KLJ A;  3H8W A;  2ZH2 A;  3LQC B;  4Q44 A;  4RPX A;  4DQQ A;  5KG6 A;  3OUY A;  5DB9 A;  2F1H A;  3OJS A;  4KIT B;  1QSY A;  4IQV A;  4UB5 A;  5KFT A;  3PW5 A;  1UET A;  4NXZ A;  5HRI A;  5DEC A;  4BGD A;  4RWP A;  5HMM A;  4RPZ A;  2MUT B;  5J2H A;  2ATL A;  2W9C B;  3SZ2 A;  8ICI A;  3WFQ E;  4DFP A;  2VA3 A;  2LYH A;  4RNO A;  3V7K A;  2RFF A;  4DSJ A;  2HHT A;  4FS2 A;  8ICY A;  4X4S A;  2ZJ5 A;  3ZDA A;  4O3S A;  4YP3 A;  2C2E A;  5DQG A;  3QE9 Y;  5CJ7 A;  1ZQB A;  1X9W A;  1ZQW A;  4FO6 A;  4IRK A;  3KHG A;  3H4B A;  5KFE A;  2R8H A;  5HC9 A;  5KFA A;  4J9R A;  4YMN A;  4ED7 A;  1H38 A;  7ICM A;  4MF2 A;  3Q8K A;  4KLF A;  4QW9 A;  4QWA A;  1ZQJ A;  1NOM A;  1JXE A;  4JWN A;  5J2A A;  8ICH A;  4I2D A;  1Q79 A;  2BE3 A;  1PZN A;  1NKB A;  1S10 A;  3TI0 A;  3H8J A;  5KT3 A;  2NRW A;  2BCS A;  1Q78 A;  3WFR E;  5KFU A;  2M2U A;  2DPJ A;  2FMQ A;  3C5G A;  1S0V A;  1V4A A;  5HRK A;  5DBC A;  1T3N A;  3PR4 A;  3PW7 A;  4KLL A;  8ICP A;  9ICP A;  2HVI A;  3UPQ A;  2ISO A;  9ICN A;  1JXL A;  4YG2 A;  5HHH A;  4NM1 A;  1NJX A;  2FLL A;  7ICK A;  2NRK A;  4EBE A;  4FHV A;  2JZB B;  4J9L A;  3QZ7 A;  1RZT A;  4I2E A;  2Q0Z X;  4QZD A;  1ZYQ A;  2BPG A;  4EZ9 A;  3GDX A;  4NKU A;  4XA5 A;  3RBD A;  4QZF A;  3C66 A;  3GV8 B;  2FLP A;  4QZE A;  4X4N A;  5CWR A;  8ICK A;  4YXJ A;  5L9X A;  1TK0 A;  3EWA A;  2FPL A;  3EW9 A;  3TQ1 A;  5HP4 A;  5KFZ A;  3RH5 A;  9ICM A;  1RYR A;  4YD2 A;  4IRD A;  3RB6 A;  4X5V A;  3SYZ A;  1UA1 A;  3ISB A;  3C18 A;  4P2H A;  4X0A A;  1BPB A;  4F91 B;  2ZH3 A;  4TUS A;  4ECT A;  2P6R A;  4F5P A;  2J6T A;  7ICN A;  5KG4 A;  4E80 A;  4TQR A;  4ELT A;  8ICJ A;  4PH5 A;  1FA0 A;  4RWQ A;  3TAR A;  1RYS A;  8ICT A;  9ICJ A;  4MFF A;  1VJ7 A;  4EBK A;  4RQ6 A;  3GIM A;  3T3F A;  2H5X A;  3PNC A;  1ZQA A;  4QW8 A;  4NLZ A;  1B22 A;  1DK3 A;  2O1P A;  4WC5 A;  2ZH8 A;  8ICX A;  4X4O A;  3TAP A;  4Q45 A;  8ICB A;  4DS4 A;  2AGO A;  1QLN A;  3C1Y A;  3ZDC A;  3RAQ A;  3MDC A;  4C8N A;  5C5J A;  4O5K A;  4M9L A;  4O3R A;  2KFN A;  4FHX A;  3KHR A;  4R65 A;  2XCP A;  3Q8M A;  3SI8 A;  4FHW A;  2ZUC A;  4QZH A;  4MF8 A;  1ZQM A;  1S9F A;  4F2S A;  2ZTE A;  4Z6F A;  2B21 A;  3GV7 B;  4R63 A;  2NRV A;  2XY7 A;  3B0X A;  9ICQ A;  4DSE A;  1ZJN A;  1JX4 A;  1KSP A;  3H8S A;  3M9O B;  4UB1 A;  5HHI A;  5KFD A;  3T5H A;  4J9O A;  3PVX A;  3GV5 B;  1NK9 A;  4FH5 A;  1KRP A;  4WC7 A;  4QWB A;  1S0O A;  5F9N A;  4KLG A;  1D8L A;  3ZD9 A;  4F2R A;  4FHP A;  4AT9 B;  4WC3 A;  2P6U A;  3QEB Z;  2KTQ A;  5HML A;  5J0U A;  9ICE A;  2DFL A;  1DGS A;  2HHW A;  4DOC A;  9ICF A;  1LB2 B;  1ZQI A;  2JEG A;  3PML A;  3OVB A;  4X4V A;  4ECW A;  1CUK A;  2AJQ A;  1KDH A;  1U45 A;  4BDP A;  2C2R A;  8ICF A;  5J2C A;  2BPF A;  7ICR A;  2DVI A;  4M6W B;  5DED A;  3UXN A;  2GWS A;  3RAX A;  5F2V O;  3JPT A;  4YD1 A;  8ICE A;  4UB2 A;  1XSL A;  4UBB A;  1UT8 A;  4BXO A;  3M8R A;  1ZET A;  1ZQZ A;  3MR6 A;  5J2G A;  4XUS A;  4B9V A;  4WC2 A;  3M8S A;  9ICA A;  3E2E A;  4CCH A;  5CP2 A;  4Z6C A;  2F1J A;  5III A;  4RQ3 A;  2I9G A;  4C8L A;  4I28 A;  1ARO P;  3JPP A;  4I2J A;  2W8L A;  2ZUD A;  2ASD A;  2IBK A;  3RRH A;  4DL2 A;  1NJW A;  4GC7 A;  5HR9 A;  5KTQ A;  5JUM A;  1S77 D;  2KZZ A;  4KLU A;  2J6S A;  4NKT A;  1JIH A;  4F4X A;  2FPM A;  4EYI B;  4IR9 A;  5CHG A;  1TFY A;  9ICV A;  4KLD A;  1R8C A;  1KEJ A;  2BCV A;  4M0A A;  1PX5 A;  1U9L A;  3HW8 A;  3TAN A;  1NKE A;  4KN7 A;  4KN4 A;  4RNM A;  2DPI A;  4WBY A;  5DLF A;  4WC4 A;  3ZDE A;  4RQ4 A;  3N97 B;  1HJP A;  4DQR A;  5DQH A;  3WFP A;  4MEX A;  4WC1 A;  4DFJ A;  4I2A A;  7ICI A;  1WOT A;  1KFS A;  5DG9 A;  3Q8S B;  5HRD A;  3LWL A;  2JEF A;  1HUO A;  4O9M A;  1CEZ A;  2W8K A;  1XSP A;  5DG7 A;  1ZQX A;  2C22 A;  4B9S A;  1JQR A;  5DB8 A;  1XO1 A;  1S0M A;  5KFI A;  4K4I A;  4KLT A;  3GII A;  2KFZ A;  3T5L A;  4DSI A;  4QZA A;  4NLG A;  4IR1 A;  2KZM A;  4AT7 A;  3ISC A;  4Z6D A;  3UXP A;  3GIL A;  4ECV A;  2AQ0 A;  1MC8 A;  2BQR A;  3MR5 A;  3HP6 A;  5BOM A;  1NK8 A;  3QZ8 A;  4QZ8 A;  1COO A;  4RQ8 A;  1QSL A;  4YR3 A;  5IIN A;  5KFR A;  1MSW D;  1SKR A;  4FHY A;  4E8F A;  4JV0 A;  4MFA A;  3MGI A;  3RJI A;  1L3U A;  3OVS A;  4P4P A;  2ZH5 A;  4E0D A;  2Y1J A;  4ED6 A;  4FS1 A;  1S97 A;  4I2G A;  3BQT A;  2W9A A;  4M9G A;  3OSP A;  1QSS A;  4I29 A;  5KFJ A;  1JMS A;  4GC6 A;  2Y1I A;  7ICH A;  1D8Y A;  4RWN A;  4YMM A;  3IM1 A;  4DS5 A;  2C2D A;  7ICQ A;  1DK2 A;  5J0O A;  1SKW A;  5L1L A;  3Q8R B;  5KG0 A;  2FMP A;  1S0N A;  3PY8 A;  1ZJM A;  3M9M B;  5KG3 A;  2ZHB A;  5HRB A;  4F92 B;  3MGH A;  5DDM A;  1T8E A;  4DFK A;  2UVW A;  1OU5 A;  4J9S A;  5DLG A;  2ZUB A;  2NRX A;  3SV3 A;  2JEI A;  4C8K A;  1NK5 A;  4ECS A;  4KLE A;  3ZDD A;  3PV8 A;  3HT3 A;  2KN7 A;  2ZJA A;  1DOQ A;  1TAU A;  8ICV A;  1KNY A;  3RTV A;  4LZG A;  1Z00 B;  5L1I A;  1TVA A;  3OJU A;  5CA7 A;  2ISP A;  3JZ0 A;  9ICB A;  4ATB A;  3RB0 A;  4Z6E A;  5J29 A;  4YR0 A;  4RQ2 A;  4NLK A;  2PBE A;  4ED3 A;  4DL3 A;  4RQ0 A;  3HJ4 A;  5DG8 A;  4DL7 A;  5KT7 A;  1U48 A;  1QTM A;  4AT7 B;  2JEJ A;  3RH6 A;  4R8U A;  8ICO A;  3ETL A;  2DRA A;  4GLX A;  2C28 A;  2PI4 A;  1JN3 A;  5DQI A;  4GXI A;  3AQN A;  1L3T A;  2M2W A;  8ICM A;  4DO9 A;  4IQU A; 
#chains in the Genus database with same CATH topology
 1Q8K A;  2K4H A;  4HYK A;  3AN1 A;  4R8U B;  3RBE A;  1ZQP A;  2F3N A;  1RXW A;  1PVP A;  4R66 A;  5HRE A;  3BS7 A;  4EV6 A;  1OXJ A;  4G3I A;  1Z1V A;  3EYZ A;  4LVS A;  1XSN A;  2P35 A;  3TAQ A;  2A1J B;  2GAF D;  2ID1 A;  4TQS A;  4M9J A;  2ASJ A;  1ZQC A;  1ZQT A;  1QCK A;  1JRP A;  4E7X A;  2HHX A;  1BPY A;  5KFN A;  5KFG A;  5BPC A;  4DWI A;  4F4K A;  4PHE A;  1T4G A;  2Y9U A;  5J2J A;  2PI5 A;  3OVA A;  2XO7 A;  2G07 A;  4DEZ A;  2LYB A;  4JMU A;  4EBJ A;  3MGV A;  5HRF A;  4IS7 A;  5DDY A;  2ZG6 A;  4O5E A;  1XS9 D;  2OYY A;  4DL5 A;  1SXD A;  2HCF A;  4YMO A;  2EZY A;  1BPD A;  2K8C B;  4YR2 A;  5KG5 A;  4KLI A;  4RT3 A;  2P66 A;  4NXU A;  4QZC A;  1N60 A;  1N48 A;  2W9B A;  4DLE A;  4YVZ A;  2PFO A;  1PVR A;  3I28 A;  1COK A;  2LM4 A;  3AQK A;  1N63 A;  2NO4 A;  3WU2 U;  3SMV A;  1ZD2 P;  3T5J A;  3M7D A;  2R8J A;  5AHX A;  1X9M A;  2F77 X;  5CHE A;  3HJ1 A;  3S6J A;  2JV3 A;  4I0U A;  1GPJ A;  1EXN A;  2BQ3 A;  3C1Z A;  4PHP A;  3ALR A;  3GIK A;  5DB6 A;  1O08 A;  3EPG A;  2OCE A;  3BQ2 A;  4Y2Q A;  3BS5 A;  1QQ7 A;  1UA0 A;  1N61 A;  9ICI A;  2B0C A;  3H0L B;  2GA9 D;  4DF8 A;  4KLO A;  4ECZ A;  4EEK A;  4B9L A;  2CPR A;  1XU4 A;  3C21 A;  5AKZ A;  7ICF A;  1ZD4 A;  4PL2 A;  4DL4 A;  4KMU A;  2DRB A;  4EBD A;  2AH5 A;  4DSL A;  3NKU A;  1OUQ A;  1L7O A;  4WOY A;  2J6U A;  4A8E A;  3F5A A;  3V6J A;  4LEZ A;  5J0P A;  5CEH A;  5J0S A;  4M5D A;  3UMC A;  4PZN A;  5AKK A;  2ZH1 A;  1J97 A;  2F76 X;  4UB4 A;  4TUP A;  2V9W A;  3TFR A;  2GOL A;  3Q8Q B;  1J2N A;  2RLT A;  5G5H A;  3AU2 A;  5J2B A;  2JGA A;  2ZIW A;  3WK4 A;  1NO5 A;  5IIO A;  2RHF A;  3HJE A;  5KFS A;  5JU5 A;  4ECY A;  5A0L A;  3MR3 A;  1R8B A;  1B43 A;  1SL2 A;  1RYU A;  4FO1 A;  4ZH4 A;  4C8O A;  1A77 A;  4K4G A;  1N56 A;  2KZ3 A;  5ALT A;  1IG6 A;  4M47 A;  1K1S A;  4F4Y A;  1ZQK A;  9ICC A;  1URJ A;  2NRT A;  3AU6 A;  2VA8 A;  1ZQG A;  3O0F A;  4NL9 C;  5CB1 A;  1WWU A;  2Q66 A;  2PFP A;  3NGD A;  1J2M A;  4RQ1 A;  4J9N A;  2HHU A;  1L3S A;  3LDA A;  1BVS A;  2ALZ A;  4U6P A;  4OJO A;  3ED5 A;  4KTQ A;  2HW3 A;  3AUO A;  4Y2X A;  1L5U A;  2DUY A;  5EWF A;  1TK8 A;  3IN5 A;  3A0H U;  4J03 A;  1L8L A;  3H4D A;  1RG6 A;  2EWR A;  2XC9 A;  2XCA A;  2ZXI A;  5DB7 A;  3JPO A;  2V4R A;  5ALF A;  4PGQ A;  1MIV A;  2EAM A;  4UAY A;  4YQW A;  3RH4 A;  1ZQ1 C;  1LKY B;  3H8W A;  5AM3 A;  5KG6 A;  1ZRM A;  1YZ7 A;  3OJS A;  1QH9 A;  3PW5 A;  3IDW A;  3QUQ A;  4N7R A;  3QU7 A;  1SWV A;  2MUT B;  3SZ2 A;  2LYH A;  4RNO A;  3V7K A;  2RFF A;  8ICY A;  4FS2 A;  2M0N A;  1ZQW A;  4IRK A;  5HC9 A;  3H4B A;  7ICM A;  4MF2 A;  4QW9 A;  4QWA A;  2GLE A;  1JXE A;  1D8B A;  5KT3 A;  2YB4 A;  2M2U A;  5DBC A;  5L1M A;  1JI7 A;  2WAQ C;  3PR4 A;  1T3N A;  3QYP A;  4NM1 A;  2NRK A;  2JZB B;  4BX9 C;  2Q0Z X;  2G5I B;  4QZF A;  3FC4 A;  3GV8 B;  3K7D A;  3LYS A;  2IOH A;  3TQ1 A;  2FPL A;  2K8A A;  9ICM A;  5ALH A;  4YD2 A;  2KVC A;  3SYZ A;  2MRL A;  3ISB A;  2ZH3 A;  4ECT A;  2DKZ A;  4F5P A;  2ZIU B;  2OM6 A;  1X9X A;  2RRD A;  8ICT A;  2KNJ A;  3F2D A;  3T3F A;  3PNC A;  3I76 A;  4WC5 A;  5HR7 A;  2YX8 A;  2AGO A;  3C1Y A;  4C8N A;  5AK6 A;  4FZM A;  2Y9T A;  2XCP A;  4FHW A;  2ZUC A;  4F2S A;  1YT3 A;  2XY7 A;  2AXT U;  4FZN A;  3H8S A;  4OCZ A;  3VCB A;  4KMO B;  3PVX A;  1KRP A;  4KLG A;  4AT9 B;  5ALU A;  1D8L A;  3QEB Z;  5HML A;  2HHW A;  3OVB A;  4ECW A;  4BDP A;  4MHV A;  3N7R C;  5J2C A;  2GWS A;  1WUD A;  3JPT A;  2W7P A;  2HDO A;  1UT8 A;  4BXO A;  2FE9 A;  4B9V A;  4CRX A;  9ICA A;  5ALX A;  1WYG A;  2D3D A;  4Z6C A;  2I9G A;  3WK8 A;  1ARO P;  2ASD A;  4I2J A;  5KTQ A;  3R9K A;  2J6S A;  4K97 A;  9ICV A;  3LVW A;  4KN4 A;  3ZDE A;  4RQ4 A;  3N97 B;  3WFP A;  4MEX A;  4WC1 A;  5DG9 A;  4PJ0 U;  4O9M A;  1XSP A;  2E8M A;  1S0M A;  3GU3 A;  4K4I A;  3GII A;  4P0Q A;  1DRG A;  1LKY A;  4NLG A;  3F2B A;  4Z6D A;  1MC8 A;  4UB8 U;  2HOQ A;  3OTQ A;  3MR5 A;  1L8O A;  3QZ8 A;  4QZ8 A;  5D63 A;  5IIN A;  4FHY A;  4JV0 A;  3OVS A;  2ZH5 A;  2Y1J A;  1S97 A;  2Y1I A;  3QNM A;  4YMM A;  1DK2 A;  2C2D A;  1XO0 A;  5L1L A;  3Q8R B;  2VJ4 A;  2FMP A;  1PK1 B;  2QAR A;  4Y2J A;  1N62 A;  2IHO A;  1OU5 A;  4J9S A;  1S8O A;  5AI6 A;  1IIP A;  3SV3 A;  4C8K A;  3HT3 A;  5B5E U;  2HI0 A;  1KNY A;  1B0X A;  1Z00 B;  2ISP A;  5AIC A;  5CA7 A;  3OJU A;  4Z6E A;  5J29 A;  2LI6 A;  3IG5 A;  4ED3 A;  2K8B B;  2EQY A;  2HOF A;  5DG8 A;  5KT7 A;  8ICO A;  3E58 A;  3AQN A;  3IG8 A;  4IQU A;  1L7M A;  1KTQ A;  4PGX A;  1TV9 A;  3AQM A;  4S3N A;  4KM5 A;  5B3Q A;  1U47 A;  2YMQ A;  9ICL A;  8ICZ A;  2W55 A;  5H2F U;  5KFO A;  3OUY B;  4B9N A;  5KFV A;  5J0X A;  2MU2 A;  4XRH A;  4CNQ A;  4QZG A;  4RUA A;  3D6J A;  2PKE A;  5AK3 A;  4O3P A;  4WC0 A;  4GXJ A;  5ALK A;  4M9N A;  3PHZ A;  2DR8 A;  3LK9 A;  1O03 A;  5CFS A;  5J0Y A;  3AQE A;  1C7Y A;  1KLN A;  3OWG A;  1NK0 A;  9ICG A;  4UBC A;  2W03 A;  3D2Q A;  4ATB B;  3G6Y A;  4X4T A;  4EEB A;  2VA2 A;  4UAU A;  3H37 A;  2BCQ A;  2KIW A;  4FH3 A;  4OAI Z;  9ICK A;  4ZOH C;  4UAR A;  5D49 A;  2KVS A;  4WH5 A;  3NYB A;  2R8I A;  3H7I A;  1BPX A;  3V72 A;  4B9M A;  4DQS A;  3RJJ A;  2H3I A;  3NAS A;  2BPC A;  2WF6 A;  7ICU A;  5DGA A;  5J0W A;  4I2B A;  2M2T A;  1NK7 A;  2PMZ F;  3H38 A;  2FLN A;  1Q46 A;  2BDP A;  4JK1 A;  4F4W A;  1ZD5 A;  2KV2 A;  2HHP A;  3CW2 C;  1KFD A;  5D46 A;  4WCW A;  1NK4 A;  1CRX A;  4IG8 A;  5ALQ A;  2EAP A;  3RJH A;  1SV0 C;  4ECR A;  2EZZ A;  1XWL A;  2FI1 A;  4OJP A;  3MBY A;  4RPY A;  3THV A;  3NRW A;  5KFF A;  1SZH A;  4UD4 A;  2JZB A;  3MFH A;  3KHL A;  3PO4 A;  4F4Z A;  1ZQO A;  8ICU A;  9ICW A;  3JPN A;  4JWM A;  1S5L U;  5ALJ A;  2G08 A;  5AKI A;  1F0M A;  3V7L A;  2WAQ F;  2AQ4 A;  1NK6 A;  1T94 A;  3DEE A;  4NY8 A;  2KD1 A;  4DCC A;  3AQL A;  5J2E A;  3PX6 A;  2IOF K;  2WTF A;  2IMW P;  4BWM A;  1KKX A;  4NXX A;  5HRG A;  3HRD D;  3B0Y A;  4Y2V A;  9ICR A;  1FIQ A;  3PSP A;  5AM4 A;  3C29 A;  1BPE A;  2MUT A;  1V9P A;  2F1I A;  1N2X A;  3PR5 B;  5J0T A;  8ICS A;  2B56 A;  3ZDB A;  8ICN A;  3TFS A;  2QB0 A;  3F2C A;  4Q43 A;  4EZ6 A;  4P0P A;  2PXI A;  2ASL A;  2ZTD A;  3FYH A;  3V6K A;  3MFI A;  3HPO A;  2ZH4 A;  1TFR A;  1T3Q A;  2R8G A;  1MIW A;  1KW4 A;  5KAF U;  1NJZ A;  2VKQ A;  5KFX A;  5DBB A;  2HOI A;  4X0B A;  8ICR A;  3PW4 A;  4RU9 A;  4ED2 A;  4I2H A;  2HBM A;  1BGX T;  4I2F A;  3PX4 A;  2YTU A;  4EP7 A;  3AQF A;  5DGB A;  4RWO A;  4Q8E A;  2E8P A;  4BXO B;  1ZQS A;  1NNL A;  3TAD A;  3UQ0 A;  3G6X A;  4TUQ A;  1HUZ A;  3ER9 B;  4DQI A;  2EZX A;  7ICG A;  1A6S A;  5KFQ A;  4QZI A;  2AGP A;  2YML A;  1ZQH A;  2VJ5 A;  3PO5 A;  4M9H A;  1T7P A;  8ICW A;  3M6K A;  3H40 A;  3M1Y A;  4ECX A;  1TK5 A;  4EX6 A;  1SL0 A;  4NM2 A;  1TAQ A;  1ZQY A;  3RB4 A;  5ALN A;  3UQ2 A;  5AM0 A;  1UT5 A;  3ISD A;  4DLG A;  5L1J A;  2UVV A;  2KK0 A;  5L1K A;  4XQ8 A;  4ED1 A;  4CGZ A;  1Z3E B;  4AYB F;  8ICG A;  1PUZ A;  3V7J A;  4RUC A;  4NLN A;  3JPS A;  5ALS A;  4RNN A;  1SXE A;  2HHS A;  3ZD8 A;  3FDS A;  1Q3U A;  1Z4O A;  2KKV A;  1ZQN A;  4BWJ A;  8ICA A;  2A19 A;  4US8 A;  2XI9 A;  3HIY A;  2XGP A;  4DSK A;  4JLX A;  3QX7 A;  4Q44 A;  4RPX A;  3PST A;  3NVZ A;  2F1H A;  4KIT B;  1QSY A;  3NUQ A;  5HRI A;  5ALZ A;  2G09 A;  5J2H A;  4DFP A;  2KMD A;  2VA3 A;  3IRU A;  4O3S A;  4YP3 A;  5CJ7 A;  1ZQB A;  2AJQ A;  2R8H A;  2YN4 A;  5KFA A;  4J9R A;  4YMN A;  1H38 A;  5AKH A;  1ED1 A;  5J2A A;  4I2D A;  3B9J A;  1NKB A;  4AYB C;  2WF9 A;  2DPJ A;  2FMQ A;  1S0V A;  1V4A A;  2WB1 C;  4KLL A;  9ICN A;  2LMR A;  1NJX A;  7ICK A;  2B4V A;  4EBE A;  1RZT A;  1ZYQ A;  4UAS A;  2K4E A;  4JB3 A;  4YXJ A;  5HP4 A;  3EWA A;  5KFZ A;  5AKG A;  4X5V A;  4X0A A;  1L6N A;  2GO7 A;  4F91 B;  4RQN A;  2KHV A;  1SV0 A;  7ICN A;  4ELT A;  8ICJ A;  5J8Y C;  2K60 A;  2PMZ C;  1VLB A;  2EH9 A;  4Y2Y A;  1A0P A;  9ICJ A;  4EBK A;  1IV8 A;  3GIM A;  1VFG A;  1B22 A;  2NO5 A;  1DK3 A;  4QW8 A;  5ALL A;  5EE0 A;  3KKA A;  8ICB A;  1QLN A;  2BBJ A;  4FHX A;  3NRZ A;  3KHR A;  1JRO A;  2HBK A;  2ZTE A;  2NRV A;  3B0X A;  1ZJN A;  5KAI U;  1JX4 A;  1KSP A;  2H3Q A;  1NK9 A;  4WC7 A;  1S0O A;  5F9N A;  4C4T A;  2ZIX B;  2BBH A;  4GIB A;  9ICF A;  4DOC A;  2JEG A;  1CUK A;  1X40 A;  1KDH A;  2C2R A;  8ICF A;  3MC1 A;  3RAX A;  8ICE A;  2JRZ A;  4UB2 A;  4UBB A;  3N28 A;  1ZET A;  3H0R B;  4C8L A;  4I28 A;  3JPP A;  4WQL A;  5HR9 A;  1NJW A;  5JUM A;  2F8L A;  2B51 A;  4IL6 U;  4IR9 A;  1TFY A;  1V85 A;  2BCV A;  4M0A A;  1U9L A;  3J81 j;  5DLF A;  4DQR A;  5DQH A;  1KFS A;  5HRD A;  5ALY A;  3LWL A;  2JEF A;  4B9S A;  1FO4 A;  1ZQX A;  5DG7 A;  5KFI A;  3T5L A;  2KZM A;  2FCL A;  2NV3 A;  1JAL A;  5ALM A;  4ECV A;  4NWI A;  2BQR A;  4C0Z A;  3LVV A;  2D8C A;  2JMG A;  1SKR A;  5D61 A;  5ALI A;  3RJI A;  4P4P A;  5AI9 A;  3OSP A;  4F71 A;  1RQL A;  5KFJ A;  1JMS A;  4RWN A;  3UMB A;  3IM1 A;  3U26 A;  5KG0 A;  2NYV A;  2QB1 A;  3PY8 A;  3M9M B;  2LHT A;  2N1R A;  5HRB A;  2ZHB A;  3CYM A;  4F92 B;  3MGH A;  1T8E A;  3UMG A;  2AHO B;  3WK5 A;  4ECS A;  4KLE A;  3ZDD A;  4Y2R A;  1L7N A;  5AM5 A;  8ICV A;  3RTV A;  1TVA A;  4ATB A;  3MCR A;  4RQ2 A;  2H3Z A;  2DWQ A;  2JEJ A;  4R8U A;  3ETL A;  1UPH A;  2DRA A;  3D2N A;  4GLX A;  4QNL A;  4DO9 A;  3KZX A;  5TZV A;  1M6Y A;  5J0Q A;  1FFU A;  5KFK A;  4J9Q A;  4F3O A;  1BNP A;  1TFW A;  4O3O A;  4RQ5 A;  4C80 A;  7ICT A;  4IRC A;  3G6V A;  3D2S A;  7ICS A;  4C4S A;  2BCR A;  1SZP A;  2G06 A;  2IA6 A;  9ICH A;  2E8N A;  1X2I A;  3HKZ F;  4F5R A;  2ES6 A;  1ZQD A;  4ELV A;  5KFY A;  4UAW A;  2Y0S F;  3BQ0 A;  1Y88 A;  4NXT A;  2YQE A;  4C7Y A;  3PW0 A;  3RRG A;  5AI8 A;  3JCF A;  5KFH A;  1RM6 C;  4IQT A;  5K4L A;  4YXM A;  4YCX A;  4M2Y A;  3OHB A;  4R64 A;  3H39 A;  5CFU A;  4OJ5 A;  1PK3 A;  5KT6 A;  5KNI A;  1MA7 A;  2IUB A;  5J2D A;  3A0B U;  2WHE A;  2W9B B;  2W9M A;  5J8Y A;  3LWM A;  3C18 A;  3JPQ A;  3NTU A;  3HIL A;  5KFW A;  2HBJ A;  2UVR A;  3L9D A;  3OHA A;  5IIJ A;  2D6F C;  5TIS U;  4US9 A;  1XC9 A;  2VAN A;  1ZQL A;  3GZF A;  3GFK B;  1WCL A;  2KOB A;  3EPI A;  3RR7 A;  4KLQ A;  4ED0 A;  4M04 A;  1F5S A;  1D9D A;  1PVQ A;  4J9M A;  7ICL A;  3HWT A;  4WBZ A;  2DBY A;  2PFN A;  3L3F X;  3SEI A;  2ZIX A;  4NJ8 A;  1OW5 A;  2Z7J A;  5KG2 A;  4EED A;  4DSF A;  3BQ1 A;  4B9T A;  5KG1 A;  3NVW A;  1Z00 A;  4K4H A;  4J9P A;  3C2M A;  4F5O A;  1VDV A;  4ED8 A;  3AL0 B;  4QWD A;  3I1Y A;  4JUZ A;  2DR7 A;  4QZ9 A;  2BR0 A;  3AMZ A;  5DBA A;  5AKX A;  3WKE A;  4OAG A;  4FBT A;  4XJE A;  4JV1 A;  2EAO A;  5AK5 A;  1QQ5 A;  5KG7 A;  1WCN A;  7ICJ A;  4O68 A;  4LEV A;  2PFQ A;  5KFP A;  5ALP A;  5DKW A;  4MKP A;  1ZOL A;  4DF4 A;  9ICS A;  1NI3 A;  3SV4 A;  4UQG A;  2K4P A;  4NV0 A;  5EWG A;  2ZH6 A;  4O69 A;  4AT8 A;  2OWO A;  5J2I A;  4ECU A;  3RR8 A;  4OO1 J;  4IQW A;  2FMS A;  2W54 A;  3WFS C;  7ICO A;  2LKY A;  1V97 A;  4Y2U A;  1ZQE A;  2JHD A;  4AT8 B;  4OD0 A;  1NKC A;  4HAI A;  2FDR A;  2KSO B;  4O3N A;  3QEA Z;  4P4O A;  4F8R A;  3SAH A;  1YZ6 A;  2YY6 A;  3EZ5 A;  3BQ7 A;  1SB3 C;  2DR5 A;  4EBC A;  4P0Q B;  3CK6 A;  4KLH A;  1P7D A;  2NRZ A;  5KFM A;  5HR6 A;  5HRH A;  2BDU A;  3RJG A;  4K96 A;  1D9F A;  4DFM A;  5IIK A;  4RQM A;  5CRX A;  2KG5 A;  4FFD A;  1U4B A;  4F93 B;  4UB3 A;  4M6W A;  5CR0 A;  4O3M A;  2ZH7 A;  4UAV A;  2H3F A;  4EEY A;  5AI5 A;  1R89 A;  4U7C A;  4LZD A;  5IIM A;  2M2V A;  3UPS A;  1U49 A;  4LEY A;  1ZQV A;  3WK9 A;  4UD5 A;  1PK1 A;  2I1Q A;  2HSZ A;  1RQN A;  4DL6 A;  2ZIU A;  4UB6 U;  2DKX A;  3QU9 A;  2K4I A;  3Q8L A;  1C20 A;  4ACO A;  1VJ5 A;  4LJX A;  2HMX A;  1IM4 A;  3BJY A;  2BQU A;  4P4M A;  3K4G A;  2V4Q A;  4X4Q A;  1K1Q A;  3QU2 A;  4QWE A;  4AT9 A;  2DL0 A;  4GFJ A;  1TE2 A;  2Y0S C;  3SAF A;  1WG8 A;  5HRL A;  4Q8F A;  4C7Z A;  3KOO A;  2DR9 A;  1SL1 A;  5F9L A;  3OSN A;  2QKQ A;  5ALE A;  4PHD A;  3M9N B;  2HBL A;  1MN8 A;  3LQC B;  1FFV A;  5C0Y A;  3OUY A;  2VIX A;  4O6A A;  5KFT A;  2CN1 A;  1UET A;  4RWP A;  5DEC A;  4RPZ A;  1SV4 A;  4AP9 A;  4DSJ A;  4X4S A;  4CF5 A;  2C2E A;  2Q4T A;  4EGW A;  1X9W A;  3KHG A;  5KFE A;  4ED7 A;  5ALG A;  3Q8K A;  4KLF A;  3N7P D;  1ZQJ A;  1NOM A;  8ICH A;  1Q79 A;  2BE3 A;  3TI0 A;  1Q78 A;  2BCS A;  2LM1 A;  5KFU A;  4K9A A;  4Y2S A;  8ICP A;  2KEY A;  2HVI A;  5ALW A;  4YG2 A;  1L7P A;  2FLL A;  4J9L A;  3AM9 A;  4I2E A;  3EUB 2;  4QZD A;  4EZ9 A;  3GDX A;  2KJ9 A;  2FLP A;  4X4N A;  2GH1 A;  1TK0 A;  5L9X A;  1N5X A;  3ETR A;  5JRT A;  3RH5 A;  1RYR A;  1CI4 A;  4IRD A;  1UA1 A;  4P2H A;  2W11 A;  1Z1B A;  4TUS A;  2P6R A;  1FEZ A;  4TQR A;  4WQK A;  4PH5 A;  2E8O A;  2KE7 A;  3TAR A;  2H5X A;  1ZQA A;  4NLZ A;  2ZH8 A;  2RP5 A;  4BUG A;  2QB0 B;  8ICX A;  4Y2T A;  3PSF A;  4DS4 A;  1Z19 A;  3ZDC A;  3RAQ A;  4O5K A;  5C5J A;  2KFN A;  2YMP A;  4M9L A;  4O3R A;  4G9B A;  2W3S A;  5D62 A;  1F44 A;  1UCV A;  3SI8 A;  5ALD A;  4QZH A;  2LYA A;  1S9F A;  4Z6F A;  3ICX A;  4LEW A;  4NXV A;  2WB1 F;  3T5H A;  2LBO A;  4J9O A;  2ZIV A;  3GV5 B;  3ZD9 A;  2ZXH A;  5J0U A;  1DGS A;  3HKZ C;  1KQQ A;  1ZQI A;  4USA A;  3TAD C;  1AQ6 A;  3M6Z A;  2BPF A;  7ICR A;  2DVI A;  4QIW F;  5DED A;  3UXN A;  4PZO A;  2H3V A;  3EF2 A;  2CRX A;  2KIV A;  5JTG A;  1ZQZ A;  3MR6 A;  5J2G A;  4WC2 A;  4CCH A;  3NWI A;  5CP2 A;  4NL9 A;  5III A;  4RQ3 A;  2W8L A;  2ZUD A;  4EX7 A;  4GC7 A;  3KZI U;  1S77 D;  2YMM A;  5F3X B;  1PX5 A;  3TAN A;  1NKE A;  4WBY A;  5AI4 A;  2OEH A;  4I2A A;  7ICI A;  3Q8S B;  5B66 U;  2C22 A;  1JQR A;  5DB8 A;  2EDU A;  4KLT A;  2ESE A;  2B6G A;  2KFZ A;  1ZD3 A;  4DSI A;  4IR1 A;  1NZB A;  3NVO A;  3T79 A;  3ISC A;  4F72 A;  3UXP A;  3GIL A;  1ZXI A;  1V38 A;  5AKJ A;  3HP6 A;  4IC9 A;  1COO A;  1QSL A;  5AI0 A;  4EEN A;  1MSW D;  4MFA A;  3WKB A;  2W43 A;  3H8M A;  4ED6 A;  5KL1 B;  4I2G A;  1QSS A;  7ICH A;  2KJ5 A;  4GC6 A;  2IOF A;  3KD3 A;  3E0F A;  1SKW A;  1ZJM A;  2WFA A;  5KG3 A;  3ZI4 A;  4NXW A;  4OJL A;  5DLG A;  2ZUB A;  1DGJ A;  2NRX A;  1NK5 A;  3PV8 A;  2DF4 B;  2KN7 A;  2ZJA A;  1DOQ A;  1ECW A;  1X6J A;  4LZG A;  5L1I A;  3JZ0 A;  4OAF A;  9ICB A;  3RB0 A;  4UW9 A;  4YR0 A;  1Z4N A;  3L4P A;  4NLK A;  2PBE A;  4NLB A;  4DL3 A;  3QUT A;  4K8V A;  2A1A A;  4DL7 A;  3KBB A;  3F5E A;  1U48 A;  1QTM A;  3RH6 A;  5ALR A;  2C28 A;  2PI4 A;  2M2W A;  8ICM A;  2XIC A;  4ELU A;  3AEV A;  2E5S A;  4CDG A;  2EAN A;  1ZQU A;  2JR5 A;  3C5F A;  3L5K A;  2A3V A;  4RQ7 A;  5EOZ A;  2E1E A;  2RDI A;  1XNS A;  2RDJ A;  1X9S A;  2KKP A;  5CFT A;  3NVY A;  3ERC C;  1GO3 F;  2A1J A;  5J2K A;  1ZQR A;  4O5C A;  3F53 A;  4O3Q A;  2UVU A;  5KT5 A;  2XVT A;  3MR2 A;  4NLC A;  4X4R A;  1YLQ A;  3C2L A;  1RDF A;  2IHM A;  3H3A A;  2ZHA A;  3GIJ A;  7ICP A;  1SKS A;  4DOB A;  3IP4 B;  4C4R A;  5IIL A;  3BDP A;  3PZP A;  1ZQQ A;  3UM9 A;  4F50 A;  3BZK A;  3UXO A;  5KFL A;  3C2K A;  3SQI A;  3C23 A;  2XGQ A;  3WKC A;  5EE9 A;  4PL1 A;  3K1Z A;  3HX0 A;  1NZP A;  1HEK A;  2G5H B;  1ZQF A;  7ICV A;  2MSN A;  2FPK A;  3T5K A;  2OXO A;  1UEU A;  3PMN A;  2R8K A;  4E80 A;  3IHQ B;  1SWW A;  1UEV A;  1JAJ A;  4KB6 A;  3V6H A;  4J9K A;  2K89 A;  3KKA C;  2DGZ A;  4RT2 A;  3OV7 A;  3ORY A;  5FP0 A;  1MQ2 A;  4DFD A;  2I6X A;  5KFC A;  4X4P A;  2BHN A;  2HVH A;  2BKE A;  4YFK A;  3GQC A;  5GTH U;  3Q8P B;  1BNO A;  2DQN B;  2M9N A;  2AU0 A;  2ZTC A;  9ICU A;  4O0I A;  2ZIW B;  4I27 A;  2XID A;  4X4U A;  5KFB A;  2E1F A;  5KT4 A;  9ICO A;  5BOL A;  4ECQ A;  8ICQ A;  2WF8 A;  3QXG A;  3WK7 A;  8ICL A;  2HHV A;  4HX0 A;  3OGU A;  1TKD A;  4PGY A;  4UAZ A;  3WFO A;  5D4B A;  4JLZ A;  4GXK A;  1HIW A;  2WF5 A;  2ZH9 A;  4XQ7 A;  4QIW C;  7ICE A;  1K5O A;  3RJF A;  2HN1 A;  1MIY A;  2O5A A;  4KX5 A;  2W3R A;  3RB3 A;  4UAT A;  3K75 D;  4I2C A;  2JH1 A;  3SAG A;  3K1R B;  4I2I A;  2QLT A;  3JPR A;  3KHH A;  1RPL A;  3IV6 A;  1IXR A;  2I5H A;  3QUC A;  4LT6 A;  5AKE A;  3KTQ A;  1WWV A;  4QZB A;  2ZJ8 A;  1RXV A;  1LV5 A;  2F8K A;  4DQP A;  1KFT A;  4JV2 A;  5KL8 B;  3PX0 A;  2G0A A;  5J2F A;  3MDA A;  1MQ3 A;  3MAB A;  4F5Q A;  2OH2 A;  2XY6 A;  2IHN A;  5GTI U;  1R8A A;  3RJK A;  3KFU F;  5HNK A;  2L5Y A;  5E79 U;  3C28 A;  1BPZ A;  5EWE A;  5EE3 A;  4QWC A;  3VC8 A;  2HHQ A;  4RZR A;  2KJ8 A;  1F5A A;  4MEY A;  3JYY A;  4YN4 A;  2JXJ A;  4K98 A;  5ALO A;  3PW2 A;  2MAX A;  4EEL A;  2YB1 A;  2W9C A;  4K9B A;  4P0P B;  1A76 A;  9ICT A;  2ODG A;  2KP7 A;  3NS1 A;  3N4M B;  4KX3 A;  4C8M A;  4EYH B;  4WC6 A;  3E2E A;  4MFC A;  2F2A B;  2BGW A;  2E3T A;  4CF3 A;  4DOA A;  5J0R A;  1S76 D;  4B9U A;  3CP8 A;  1L3V A;  4FBU A;  1NJY A;  8ICC A;  2FJ6 A;  4PPX A;  4PHA A;  3RJE A;  2AGQ A;  3NVV A;  3H0M B;  3RFA A;  4KLM A;  5AK4 A;  4F5N A;  4KLS A;  9ICX A;  5KT2 A;  3RF9 A;  2XY5 A;  4TUR A;  2KIC A;  3TKA A;  2BCU A;  4KLJ A;  2ZH2 A;  4DQQ A;  5DB9 A;  2OHF A;  4IQV A;  1SGG A;  4UB5 A;  3SD7 A;  4NXZ A;  4BGD A;  5HMM A;  2QAR B;  2ATL A;  8ICI A;  2W9C B;  3WFQ E;  2HHT A;  1X66 A;  2ZJ5 A;  3ZDA A;  5DQG A;  3QE9 Y;  4FO6 A;  1N5W A;  5AM1 A;  3WKD A;  4JWN A;  4B6J A;  3CRX A;  1PZN A;  1S10 A;  3H8J A;  3WFR E;  2NRW A;  3TAC B;  3C5G A;  5HRK A;  3PW7 A;  9ICP A;  2W7O A;  3UPQ A;  2ISO A;  1JXL A;  3BZC A;  5HHH A;  4FHV A;  5AM2 A;  4O67 A;  3QZ7 A;  1UHU A;  2RQ5 A;  2BPG A;  4NKU A;  5AKL A;  4XA5 A;  3RBD A;  3C66 A;  4QZE A;  5CWR A;  8ICK A;  3EW9 A;  2KHQ A;  1X6I A;  3PSI A;  3RB6 A;  1DXS A;  1BPB A;  1X42 A;  2J6T A;  3SEN A;  5KG4 A;  2MA1 A;  3QUB A;  4FE3 A;  4ICA A;  1FA0 A;  4RWQ A;  1RYS A;  1VJ7 A;  4MFF A;  4RQ6 A;  2O1P A;  5AKY A;  4X4O A;  3TAP A;  4Q45 A;  3WKA A;  1ZRN A;  3MDC A;  3CNH A;  4R65 A;  2ZIV B;  3Q8M A;  2LPE A;  1ZQM A;  4MF8 A;  2B21 A;  3GV7 B;  4R63 A;  9ICQ A;  4DSE A;  3WK6 A;  3M9O B;  4UB1 A;  1B4F A;  5HHI A;  5AIB A;  5KFD A;  2O6K A;  4FH5 A;  4QWB A;  4WC3 A;  4FHP A;  3ER8 C;  4F2R A;  2P6U A;  2KTQ A;  9ICE A;  2DFL A;  4X4V A;  1LB2 B;  3PML A;  1U45 A;  4M6W B;  5F2V O;  4YD1 A;  1XSL A;  3M8R A;  4XUS A;  3M8S A;  2HN2 A;  2F1J A;  4BJQ A;  2IBK A;  3RRH A;  4DL2 A;  5EE1 A;  2KZZ A;  4OAH A;  4KLU A;  4NKT A;  4WJ3 B;  1JIH A;  4F4X A;  2FPM A;  4EYI B;  5CHG A;  4KLD A;  1KN5 A;  1R8C A;  1KEJ A;  3N7S C;  5T14 A;  3HW8 A;  4KN7 A;  2W04 A;  4RNM A;  2DPI A;  4WC4 A;  3FM9 A;  1HJP A;  1UQV A;  1KBU A;  1Q3V A;  4FZL A;  4DFJ A;  1WOT A;  2CXY A;  3DDH A;  4Y2P A;  1HUO A;  2BZF A;  4CE6 A;  2W8K A;  1CEZ A;  3FAH A;  1XO1 A;  2JH7 A;  4QZA A;  4AT7 A;  1TAM A;  3QU5 A;  3BS5 B;  2AQ0 A;  5ALV A;  5BOM A;  1NK8 A;  4RQ8 A;  1QQ6 A;  4YR3 A;  5KFR A;  4E8F A;  1SIJ A;  3MGI A;  1L3U A;  4CF4 A;  4E0D A;  5G5G A;  3SR6 A;  4FS1 A;  3BQT A;  2W9A A;  4M9G A;  4OJ6 A;  4I29 A;  3QU4 A;  1D8Y A;  4DS5 A;  7ICQ A;  5J0O A;  5JTI A;  1S0N A;  5AIA A;  5DDM A;  2UVW A;  4DFK A;  2F44 A;  4K99 A;  2JEI A;  1TAU A;  2KSO A;  1LVH A;  1JUD A;  3ONN A;  4RQ0 A;  3HJ4 A;  4QJF B;  4AT7 B;  2WF7 A;  3OPX A;  1KL9 A;  2R18 A;  1JN3 A;  3DV9 A;  5DQI A;  4GXI A;  1L3T A;  5B3P A; 
#chains in the Genus database with same CATH homology
 4ELU A;  5TZV A;  1KTQ A;  4HYK A;  4PGX A;  1TV9 A;  3AQM A;  4S3N A;  1ZQU A;  4R8U B;  5J0Q A;  3RBE A;  1ZQP A;  5KFK A;  4J9Q A;  1U47 A;  1RXW A;  3C5F A;  4F3O A;  1BNP A;  1TFW A;  4RQ7 A;  4R66 A;  5HRE A;  5EOZ A;  9ICL A;  4G3I A;  8ICZ A;  4O3O A;  2RDI A;  4RQ5 A;  2RDJ A;  7ICT A;  3EYZ A;  1X9S A;  5KFO A;  4LVS A;  3OUY B;  1XSN A;  3G6V A;  3TAQ A;  2A1J A;  5KFV A;  5J0X A;  4B9N A;  5J2K A;  2A1J B;  1ZQR A;  4XRH A;  2BCR A;  4O5C A;  4O3Q A;  7ICS A;  1SZP A;  5KT5 A;  2UVU A;  2IA6 A;  9ICH A;  2ID1 A;  4TQS A;  3MR2 A;  4QZG A;  4RUA A;  1X2I A;  4M9J A;  4O3P A;  2ASJ A;  1ZQC A;  4GXJ A;  4WC0 A;  1YLQ A;  3C2L A;  1ZQT A;  2IHM A;  4X4R A;  4M9N A;  3H3A A;  2ZHA A;  4E7X A;  3GIJ A;  4F5R A;  7ICP A;  2DR8 A;  1SKS A;  3LK9 A;  4DOB A;  1ZQD A;  4ELV A;  2HHX A;  5KFY A;  4UAW A;  3BQ0 A;  5J0Y A;  1BPY A;  1Y88 A;  5KFN A;  5KFG A;  5BPC A;  1C7Y A;  5IIL A;  4DWI A;  3BDP A;  1ZQQ A;  4F50 A;  3PW0 A;  1KLN A;  3UXO A;  3RRG A;  4PHE A;  5KFH A;  4F4K A;  1T4G A;  1NK0 A;  9ICG A;  5KFL A;  4UBC A;  5J2J A;  2PI5 A;  4ATB B;  3OVA A;  2XO7 A;  3C2K A;  3G6Y A;  4DEZ A;  4X4T A;  4IQT A;  2VA2 A;  3H37 A;  2BCQ A;  3C23 A;  2XGQ A;  4FH3 A;  4YXM A;  4YCX A;  4M2Y A;  9ICK A;  4EBJ A;  3OHB A;  4R64 A;  3H39 A;  5HRF A;  5D49 A;  3HX0 A;  1NZP A;  5DDY A;  4O5E A;  1XS9 D;  3NYB A;  2R8I A;  5KT6 A;  3H7I A;  1BPX A;  4DL5 A;  5J2D A;  3V72 A;  1ZQF A;  4B9M A;  7ICV A;  2FPK A;  4DQS A;  3T5K A;  2W9B B;  3RJJ A;  2W9M A;  1UEU A;  4YMO A;  2BPC A;  7ICU A;  5DGA A;  1BPD A;  5J0W A;  3LWM A;  3PMN A;  4YR2 A;  5KG5 A;  2R8K A;  3JPQ A;  1NK7 A;  4I2B A;  3IHQ B;  4KLI A;  2M2T A;  4RT3 A;  3H38 A;  2FLN A;  2P66 A;  1JAJ A;  1UEV A;  3V6H A;  4J9K A;  2BDP A;  3NTU A;  5KFW A;  4QZC A;  4JK1 A;  4F4W A;  1N48 A;  2W9B A;  4RT2 A;  2UVR A;  3L9D A;  2HHP A;  3OV7 A;  4DLE A;  1KFD A;  5D46 A;  3ORY A;  4YVZ A;  5IIJ A;  3OHA A;  2PFO A;  1NK4 A;  4WCW A;  4IG8 A;  1XC9 A;  2VAN A;  3RJH A;  1ZQL A;  4ECR A;  1MQ2 A;  3AQK A;  3GFK B;  1WCL A;  1XWL A;  3MBY A;  5KFC A;  4RPY A;  3EPI A;  2BHN A;  3T5J A;  3THV A;  3RR7 A;  4KLQ A;  2HVH A;  4X4P A;  2BKE A;  5KFF A;  2R8J A;  4ED0 A;  4YFK A;  1X9M A;  4M04 A;  3GQC A;  1D9D A;  2JZB A;  4UD4 A;  3Q8P B;  3MFH A;  1BNO A;  4J9M A;  3KHL A;  3HWT A;  7ICL A;  3HJ1 A;  2M9N A;  4WBZ A;  2AU0 A;  3PO4 A;  4F4Z A;  2ZTC A;  1ZQO A;  2PFN A;  4O0I A;  8ICU A;  9ICU A;  9ICW A;  4I27 A;  4X4U A;  5KFB A;  3JPN A;  4JWM A;  5KT4 A;  1EXN A;  2BQ3 A;  9ICO A;  3C1Z A;  5KG2 A;  4PHP A;  5BOL A;  3GIK A;  3V7L A;  5DB6 A;  4DSF A;  3BQ1 A;  4ECQ A;  2AQ4 A;  8ICQ A;  4B9T A;  3EPG A;  5KG1 A;  1NK6 A;  4NY8 A;  3BQ2 A;  3AQL A;  1Z00 A;  8ICL A;  4K4H A;  4J9P A;  5J2E A;  3C2M A;  4F5O A;  2WTF A;  4ED8 A;  3PX6 A;  1UA0 A;  2HHV A;  9ICI A;  4QWD A;  2IMW P;  3OGU A;  1TKD A;  4PGY A;  4JUZ A;  2DR7 A;  4QZ9 A;  4BWM A;  4UAZ A;  4DF8 A;  5D4B A;  4KLO A;  4ECZ A;  2BR0 A;  4B9L A;  3WFO A;  1XU4 A;  5DBA A;  5HRG A;  3C21 A;  3B0Y A;  7ICF A;  4GXK A;  9ICR A;  4DL4 A;  4FBT A;  4KMU A;  4JV1 A;  2DRB A;  5KG7 A;  1WCN A;  4EBD A;  7ICJ A;  2ZH9 A;  1BPE A;  2MUT A;  4XQ7 A;  1V9P A;  7ICE A;  4WC6 A;  4DSL A;  2F1I A;  2PFQ A;  5KFP A;  3PR5 B;  3RJF A;  5DKW A;  5J0T A;  8ICS A;  1MIY A;  3ZDB A;  2O5A A;  4DF4 A;  3TFS A;  8ICN A;  2J6U A;  3SV4 A;  9ICS A;  4UQG A;  3RB3 A;  3V6J A;  5EWG A;  2ZH6 A;  3K75 D;  5J0P A;  2OWO A;  4I2C A;  4AT8 A;  5J0S A;  4I2I A;  3JPR A;  5J2I A;  3KHH A;  4Q43 A;  4ECU A;  1RPL A;  3RR8 A;  1IXR A;  4EZ6 A;  4M5D A;  4IQW A;  2ZH1 A;  2FMS A;  2PXI A;  3WFS C;  4LT6 A;  2ASL A;  7ICO A;  1VFG A;  2ZTD A;  3FYH A;  3V6K A;  4UB4 A;  3MFI A;  2V9W A;  4TUP A;  3HPO A;  2ZH4 A;  3TFR A;  1TFR A;  1ZQE A;  4AT8 B;  3KTQ A;  2R8G A;  1NKC A;  3Q8Q B;  1MIW A;  4QZB A;  3AU2 A;  5J2B A;  2ZJ8 A;  4P4O A;  4O3N A;  3QEA Z;  1NJZ A;  1RXV A;  1LV5 A;  5KFX A;  5DBB A;  3EZ5 A;  4F8R A;  4X0B A;  8ICR A;  2DR5 A;  3PW4 A;  4RU9 A;  4ED2 A;  4EBC A;  4DQP A;  4I2H A;  1KFT A;  4JV2 A;  3PX0 A;  4KLH A;  1BGX T;  2NRZ A;  5J2F A;  5KFM A;  1NO5 A;  5IIO A;  5KFS A;  3PX4 A;  4I2F A;  3MDA A;  1MQ3 A;  5HRH A;  4EP7 A;  3RJG A;  5DGB A;  4ECY A;  1D9F A;  3MR3 A;  4RWO A;  1R8B A;  1B43 A;  4DFM A;  3MAB A;  4F5Q A;  1SL2 A;  4IRC A;  2XY6 A;  2IHN A;  4Q8E A;  5IIK A;  3RJK A;  4BXO B;  5HNK A;  1ZQS A;  1R8A A;  1BPZ A;  4ZH4 A;  5EWE A;  3UQ0 A;  1U4B A;  1A77 A;  4QWC A;  4F93 B;  4TUQ A;  3G6X A;  4C8O A;  4K4G A;  1N56 A;  4UB3 A;  2KZ3 A;  4RZR A;  4M6W A;  2HHQ A;  5CR0 A;  4M47 A;  4MEY A;  1HUZ A;  1K1S A;  1F5A A;  3JYY A;  2ZH7 A;  4F4Y A;  4YN4 A;  4DQI A;  1ZQK A;  7ICG A;  9ICC A;  5KFQ A;  4QZI A;  2NRT A;  2AGP A;  3AU6 A;  2VA8 A;  3PW2 A;  1ZQG A;  2MAX A;  1ZQH A;  4EEY A;  2W9C A;  1R89 A;  3PO5 A;  4M9H A;  4LZD A;  5IIM A;  1A76 A;  1T7P A;  9ICT A;  5CB1 A;  8ICW A;  2M2V A;  3UPS A;  1U49 A;  2KP7 A;  2Q66 A;  1ZQV A;  3N4M B;  3H40 A;  2PFP A;  3NGD A;  4UD5 A;  4ECX A;  2I1Q A;  1TK5 A;  1SL0 A;  4NM2 A;  4DL6 A;  1TAQ A;  1ZQY A;  3RB4 A;  3UQ2 A;  4C8M A;  4EYH B;  1UT5 A;  3ISD A;  4RQ1 A;  5L1J A;  4J9N A;  4DLG A;  3Q8L A;  2UVV A;  1L3S A;  5L1K A;  4MFC A;  3LDA A;  2BGW A;  1BVS A;  2ALZ A;  2HHU A;  4DOA A;  4XQ8 A;  5J0R A;  1S76 D;  1IM4 A;  3BJY A;  4ED1 A;  2BQU A;  4P4M A;  4B9U A;  3K4G A;  2V4Q A;  1L3V A;  1Z3E B;  4KTQ A;  1K1Q A;  4QWE A;  3AUO A;  1L5U A;  1NJY A;  4FBU A;  2HW3 A;  8ICC A;  4X4Q A;  5EWF A;  4AT9 A;  1TK8 A;  4PPX A;  8ICG A;  4PHA A;  3RJE A;  2AGQ A;  3V7J A;  4RUC A;  4NLN A;  3JPS A;  3H4D A;  4KLM A;  4RNN A;  2HHS A;  2XC9 A;  5HRL A;  3ZD8 A;  3FDS A;  2XCA A;  2V4R A;  5DB7 A;  3JPO A;  4Q8F A;  1ZQN A;  4BWJ A;  4F5N A;  4KLS A;  4PGQ A;  1MIV A;  8ICA A;  2DR9 A;  1SL1 A;  4UAY A;  5KT2 A;  5F9L A;  4YQW A;  2XY5 A;  3RH4 A;  4TUR A;  9ICX A;  3OSN A;  3HIY A;  2XGP A;  2BCU A;  4PHD A;  3M9N B;  4DSK A;  4KLJ A;  3H8W A;  2ZH2 A;  3LQC B;  4Q44 A;  4RPX A;  4DQQ A;  5KG6 A;  3OUY A;  5DB9 A;  2F1H A;  3OJS A;  4KIT B;  1QSY A;  4IQV A;  4UB5 A;  5KFT A;  3PW5 A;  1UET A;  4NXZ A;  5HRI A;  5DEC A;  4BGD A;  4RWP A;  5HMM A;  4RPZ A;  2MUT B;  5J2H A;  2ATL A;  2W9C B;  3SZ2 A;  8ICI A;  3WFQ E;  4DFP A;  2VA3 A;  2LYH A;  4RNO A;  3V7K A;  2RFF A;  4DSJ A;  2HHT A;  4FS2 A;  8ICY A;  4X4S A;  2ZJ5 A;  3ZDA A;  4O3S A;  4YP3 A;  2C2E A;  5DQG A;  3QE9 Y;  5CJ7 A;  1ZQB A;  1X9W A;  1ZQW A;  4FO6 A;  4IRK A;  3KHG A;  3H4B A;  5KFE A;  2R8H A;  5HC9 A;  5KFA A;  4J9R A;  4YMN A;  4ED7 A;  1H38 A;  7ICM A;  4MF2 A;  3Q8K A;  4KLF A;  4QW9 A;  4QWA A;  1ZQJ A;  1NOM A;  1JXE A;  4JWN A;  5J2A A;  8ICH A;  4I2D A;  1Q79 A;  2BE3 A;  1PZN A;  1NKB A;  1S10 A;  3TI0 A;  3H8J A;  5KT3 A;  2NRW A;  2BCS A;  1Q78 A;  3WFR E;  5KFU A;  2M2U A;  2DPJ A;  2FMQ A;  3C5G A;  1S0V A;  1V4A A;  5HRK A;  5DBC A;  1T3N A;  3PR4 A;  3PW7 A;  4KLL A;  8ICP A;  9ICP A;  2HVI A;  3UPQ A;  2ISO A;  9ICN A;  1JXL A;  4YG2 A;  5HHH A;  4NM1 A;  1NJX A;  2FLL A;  7ICK A;  2NRK A;  4EBE A;  4FHV A;  2JZB B;  4J9L A;  3QZ7 A;  1RZT A;  4I2E A;  2Q0Z X;  4QZD A;  1ZYQ A;  2BPG A;  4EZ9 A;  3GDX A;  4NKU A;  4XA5 A;  3RBD A;  4QZF A;  3C66 A;  3GV8 B;  2FLP A;  4QZE A;  4X4N A;  5CWR A;  8ICK A;  4YXJ A;  5L9X A;  1TK0 A;  3EWA A;  2FPL A;  3EW9 A;  3TQ1 A;  5HP4 A;  5KFZ A;  3RH5 A;  9ICM A;  1RYR A;  4YD2 A;  4IRD A;  3RB6 A;  4X5V A;  3SYZ A;  1UA1 A;  3ISB A;  3C18 A;  4P2H A;  4X0A A;  1BPB A;  4F91 B;  2ZH3 A;  4TUS A;  4ECT A;  2P6R A;  4F5P A;  2J6T A;  7ICN A;  5KG4 A;  4E80 A;  4TQR A;  4ELT A;  8ICJ A;  4PH5 A;  1FA0 A;  4RWQ A;  3TAR A;  1RYS A;  8ICT A;  9ICJ A;  4MFF A;  1VJ7 A;  4EBK A;  4RQ6 A;  3GIM A;  3T3F A;  2H5X A;  3PNC A;  1ZQA A;  4QW8 A;  4NLZ A;  1B22 A;  1DK3 A;  2O1P A;  4WC5 A;  2ZH8 A;  8ICX A;  4X4O A;  3TAP A;  4Q45 A;  8ICB A;  4DS4 A;  2AGO A;  1QLN A;  3C1Y A;  3ZDC A;  3RAQ A;  3MDC A;  4C8N A;  5C5J A;  4O5K A;  4M9L A;  4O3R A;  2KFN A;  4FHX A;  3KHR A;  4R65 A;  2XCP A;  3Q8M A;  3SI8 A;  4FHW A;  2ZUC A;  4QZH A;  4MF8 A;  1ZQM A;  1S9F A;  4F2S A;  2ZTE A;  4Z6F A;  2B21 A;  3GV7 B;  4R63 A;  2NRV A;  2XY7 A;  3B0X A;  9ICQ A;  4DSE A;  1ZJN A;  1JX4 A;  1KSP A;  3H8S A;  3M9O B;  4UB1 A;  5HHI A;  5KFD A;  3T5H A;  4J9O A;  3PVX A;  3GV5 B;  1NK9 A;  4FH5 A;  1KRP A;  4WC7 A;  4QWB A;  1S0O A;  5F9N A;  4KLG A;  1D8L A;  3ZD9 A;  4F2R A;  4FHP A;  4AT9 B;  4WC3 A;  2P6U A;  3QEB Z;  2KTQ A;  5HML A;  5J0U A;  9ICE A;  2DFL A;  1DGS A;  2HHW A;  4DOC A;  9ICF A;  1LB2 B;  1ZQI A;  2JEG A;  3PML A;  3OVB A;  4X4V A;  4ECW A;  1CUK A;  2AJQ A;  1KDH A;  1U45 A;  4BDP A;  2C2R A;  8ICF A;  5J2C A;  2BPF A;  7ICR A;  2DVI A;  4M6W B;  5DED A;  3UXN A;  2GWS A;  3RAX A;  5F2V O;  3JPT A;  4YD1 A;  8ICE A;  4UB2 A;  1XSL A;  4UBB A;  1UT8 A;  4BXO A;  3M8R A;  1ZET A;  1ZQZ A;  3MR6 A;  5J2G A;  4XUS A;  4B9V A;  4WC2 A;  3M8S A;  9ICA A;  3E2E A;  4CCH A;  5CP2 A;  4Z6C A;  2F1J A;  5III A;  4RQ3 A;  2I9G A;  4C8L A;  4I28 A;  1ARO P;  3JPP A;  4I2J A;  2W8L A;  2ZUD A;  2ASD A;  2IBK A;  3RRH A;  4DL2 A;  1NJW A;  4GC7 A;  5HR9 A;  5KTQ A;  5JUM A;  1S77 D;  2KZZ A;  4KLU A;  2J6S A;  4NKT A;  1JIH A;  4F4X A;  2FPM A;  4EYI B;  4IR9 A;  5CHG A;  1TFY A;  9ICV A;  4KLD A;  1R8C A;  1KEJ A;  2BCV A;  4M0A A;  1PX5 A;  1U9L A;  3HW8 A;  3TAN A;  1NKE A;  4KN7 A;  4KN4 A;  4RNM A;  2DPI A;  4WBY A;  5DLF A;  4WC4 A;  3ZDE A;  4RQ4 A;  3N97 B;  1HJP A;  4DQR A;  5DQH A;  3WFP A;  4MEX A;  4WC1 A;  4DFJ A;  4I2A A;  7ICI A;  1WOT A;  1KFS A;  5DG9 A;  3Q8S B;  5HRD A;  3LWL A;  2JEF A;  1HUO A;  4O9M A;  1CEZ A;  2W8K A;  1XSP A;  5DG7 A;  1ZQX A;  2C22 A;  4B9S A;  1JQR A;  5DB8 A;  1XO1 A;  1S0M A;  5KFI A;  4K4I A;  4KLT A;  3GII A;  2KFZ A;  3T5L A;  4DSI A;  4QZA A;  4NLG A;  4IR1 A;  2KZM A;  4AT7 A;  3ISC A;  4Z6D A;  3UXP A;  3GIL A;  4ECV A;  2AQ0 A;  1MC8 A;  2BQR A;  3MR5 A;  3HP6 A;  5BOM A;  1NK8 A;  3QZ8 A;  4QZ8 A;  1COO A;  4RQ8 A;  1QSL A;  4YR3 A;  5IIN A;  5KFR A;  1MSW D;  1SKR A;  4FHY A;  4E8F A;  4JV0 A;  4MFA A;  3MGI A;  3RJI A;  1L3U A;  3OVS A;  4P4P A;  2ZH5 A;  4E0D A;  2Y1J A;  4ED6 A;  4FS1 A;  1S97 A;  4I2G A;  3BQT A;  2W9A A;  4M9G A;  3OSP A;  1QSS A;  4I29 A;  5KFJ A;  1JMS A;  4GC6 A;  2Y1I A;  7ICH A;  1D8Y A;  4RWN A;  4YMM A;  3IM1 A;  4DS5 A;  2C2D A;  7ICQ A;  1DK2 A;  5J0O A;  1SKW A;  5L1L A;  3Q8R B;  5KG0 A;  2FMP A;  1S0N A;  3PY8 A;  1ZJM A;  3M9M B;  5KG3 A;  2ZHB A;  5HRB A;  4F92 B;  3MGH A;  5DDM A;  1T8E A;  4DFK A;  2UVW A;  1OU5 A;  4J9S A;  5DLG A;  2ZUB A;  2NRX A;  3SV3 A;  2JEI A;  4C8K A;  1NK5 A;  4ECS A;  4KLE A;  3ZDD A;  3PV8 A;  3HT3 A;  2KN7 A;  2ZJA A;  1DOQ A;  1TAU A;  8ICV A;  1KNY A;  3RTV A;  4LZG A;  1Z00 B;  5L1I A;  1TVA A;  3OJU A;  5CA7 A;  2ISP A;  3JZ0 A;  9ICB A;  4ATB A;  3RB0 A;  4Z6E A;  5J29 A;  4YR0 A;  4RQ2 A;  4NLK A;  2PBE A;  4ED3 A;  4DL3 A;  4RQ0 A;  3HJ4 A;  5DG8 A;  4DL7 A;  5KT7 A;  1U48 A;  1QTM A;  4AT7 B;  2JEJ A;  3RH6 A;  4R8U A;  8ICO A;  3ETL A;  2DRA A;  4GLX A;  2C28 A;  2PI4 A;  1JN3 A;  5DQI A;  4GXI A;  3AQN A;  1L3T A;  2M2W A;  8ICM A;  4DO9 A;  4IQU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...