4YMYA

Crystal structure of mutant nitrobindin m75a/h76l/q96c/m148l/h158a (nb11) from arabidopsis thaliana
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
153
structure length
153
Chain Sequence
b'PPVHPFVAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESGAPALAESGYFRPRPDGSIEVVIACSTGLVEVQKGTYNVDEQSIKLKSDLVGNASKVKEISREFELVDGKLSYVVRLSTTTNPLQPALKAILDKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UPF0678 fatty acid-binding protein-like protein At1g79260
publication title A Highly Active Biohybrid Catalyst for Olefin Metathesis in Water: Impact of a Hydrophobic Cavity in a beta-Barrel Protein
doi rcsb
source organism Arabidopsis thaliana
molecule tags Transport protein
total genus 36
structure length 153
sequence length 153
ec nomenclature
pdb deposition date 2015-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF08768 DUF1794 Domain of unknown function (DUF1794)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.40.128.20 Mainly Beta Beta Barrel Lipocalin Lipocalin 4ymyA00
4IAXA 3CWKA 5KIDA 1GKAB 3HWEA 4YKOA 1TOWA 1ADLA 3VG5A 1BLRA 4ZH6A 4RUNA 1GT4A 1FTPA 1OBUA 4NP1A 4CK4A 1KT7A 1D2UA 3HWDA 4YH0A 2AMMX 1O1UA 3NX2A 2N93A 4YFRA 1LIEA 3AKNA 4GH7A 1KOIA 5HA1A 2AT3X 2W2AA 1UZ2X 1A18A 3PH5A 5H9LA 4ORYA 3VG7A 5L8OA 5FENA 3C78X 1EXSA 4ZHCA 3P6CA 1X8QA 3P6DA 3CQRA 1SY1A 5LJHA 1PBOA 1QY2A 1E00A 1KT6A 4GRJA 1GGLA 1SY2A 2OVDA 4OS0A 2GJ5A 1R0UA 2NNDA 1XCAA 1DFVA 1XKIA 3PH6A 3L4RA 5LJBA 2R56A 2ASNX 2Q4NA 3WXQA 4O9SA 3WVMA 4GKCA 1FENA 2QO5A 5KICA 5LJKA 2L5PA 1MVGA 4HFOA 5EDBA 1TOUA 4A8ZA 5HCDC 3EMMA 5HA0A 4KIIA 1VYGA 3BU1A 2YG2A 1E06A 4IAWA 5EDCA 2OVEA 3STKA 3BU9A 1YWCA 1ZNHA 2FT9A 4YGHA 1KXOA 4R0BA 1YWDA 2JU3A 3B2KA 5F58A 5BVSA 1BRPA 1ZNEA 4YCEA 2RA6A 2OFMX 4TJZA 1YIVA 2K62A 4ZH9A 2ALLX 3NADA 2O62A 3U9PC 2HNXA 2HZQA 4QYPA 1TW4A 1YP7A 1OBPA 2FTBA 1OPAA 1SXUA 1FELA 2JU7A 1EPBA 1ML7A 1MDCA 5IO5A 2CZUA 2NNQA 3BSZE 5HZ6A 3B2IA 4XMCA 4PSQA 1NP4A 2AL0X 1MX7A 3FA7A 4HPDA 1SXWA 1IKEA 2WQAE 1LIFA 4ORUA 1DF3A 3FR2A 3KFHA 5DPQA 3KQ0A 4EDEA 3NR3A 3FENA 1BEBA 2CM9A 3QKGA 4XMFA 2ACPX 1JYDA 4YFQA 3KFFA 2WEWA 3F9DA 5HTEA 4D6BA 3CR6A 5LJEA 5C0NA 1KT5A 2QO6A 1KQXA 4LKPA 1QFVA 1QWDA 3CQNA 3ZUIA 4I3CA 3WJEA 1RLBE 3Q6LA 4ARHA 5B29A 1BSQA 2W2BA 1VYFA 2CBSA 2FR2A 4BVMA 1AVGI 1GT3A 2JOZA 3BX8A 3ELXA 1JV4A 2P8GA 1EUOA 4ODDA 3D97A 3RZYA 2G7BA 3WBGA 1NGLA 1YP6A 1B56A 3D96A 1QY1A 3APWA 3EYCA 1JBHA 1LICA 4BOEA 2K23A 2G79A 2KT4B 5HWZA 3MBTA 4Y0QA 3BY0A 2FRSA 3STNA 1OEKA 3UEVA 2ACOA 2R74A 3NQ9A 4TKBA 1LIBA 4WFVA 3VG2A 1BWYA 1X8UA 5LKEA 4ALBA 2WQ9A 3S26A 3WJBA 1T8VA 1MX8A 1OBQA 3MVFA 1T68X 1U17A 3FA6A 3K3LA 5EEDA 2CZTA 4AZMA 1E02A 1EQDA 3AKMA 1EW3A 4OS8A 4ZCBA 1OEEA 4QGWA 5F1EA 4A1YA 4IB7A 5D47A 3APVA 5F7GA 4TKJA 3I0AA 1GM6A 3BX7A 5IO7A 4I9SA 1KT3A 2X46A 3FMZA 2RQ0A 1FE3A 5H8TA 1GXAA 1SXXA 2Q2MA 2HYSA 1E5PA 4YDBA 1LIDA 3NX1A 1QQSA 1JJXA 5EEEA 4M6SA 5JR8A 1AQBA 4NLJA 4ZHFA 1ICNA 1RBPA 3VG6A 4XMGA 1EIOA 1SY0A 4AW8A 2AKQA 3ZUOA 1S7DA 3DTQA 1GX9A 3HWGA 2AT6X 3BDRA 4TLJA 3NQ3A 2FS7A 4ZR2A 1G74A 1IW2A 2FLJA 3C77X 3P6GA 4YFPA 1I4UA 4YCHA 1CBIA 2RD7C 2R73A 1A2DA 4LZUA 3U03A 3SAOA 5HZ9A 4IB9A 2NP1A 2LBVA 3B2HA 4NYRA 1PM1X 5K06A 4YDAA 1EPAA 4TNNA 3PPTA 1BM5A 1L6MA 4I3DA 5H9KA 3C76X 1D3SA 2IFBA 5B27A 3O2YA 4YBPA 3BRNA 1BRQA 5D45A 1CBRA 4HPCA 1SXYA 3APUA 4ORXA 1N0SA 1GT5A 1DZKA 2QO4A 3BLGA 4IMOA 2Q9SA 4MVIA 1GX8A 5EPQA 4AZOA 5HZ8A 5FAZA 4UU2A 1ICMA 4GETA 2Q2PA 4NNSA 1I05A 1GT1A 2CM4A 3WJCA 3UEUA 5LKFA 4YGGA 5D8JA 1ERXA 3G7XA 3D95A 1OPBA 2AH7X 4ZJ0A 4WBKA 4D6AA 1CJ5A 2JN3A 3FELA 3FA8A 1DV9A 3NPOA 1U0XA 5H9NA 4I3BA 3OJYC 1BSOA 3JSQA 2FR3A 1ZNDA 4AZPA 4ALOA 2A2UA 1HQPA 4TKHA 4AZNA 1Z24A 3B2JA 1NP1A 4EXZA 1IIUA 5F6ZA 5AQ6A 5LJGA 1X71A 4LKTA 2W2FA 4IBAA 4ORWA 3KFGA 3FR4A 1ZNKA 3VG4A 1BSYA 2RCTA 1UREA 1SA8A 3FLLA 2A13A 1HMSA 3HK1A 1G5WA 4AZQA 2WSJA 1KGLA 5CE4A 5L8IA 2MM3A 3WJGA 1MUPA 2MO5A 1ALBA 1LKEA 1TVQA 1ZNGA 2GTFX 3CBCA 3F8AA 4YKMA 3VG3A 2ANSA 4NYQA 5EZ2A 3O19A 5HAEA 3WJDA 5BVQA 2G78A 1DZPA 4GNWA 4YGZA 4NNTA 1YWBA 4DQ4A 4ORSA 2Q39A 5HTDA 1CBSA 3PEDA 3UEXA 1BBPA 1BJ7A 4NLIA 1FDQA 4HPBA 3T1DA 2RCQA 3KFIA 4A1HA 1LNMA 2XKLA 2WUTA 2LBAA 5DG4A 4Y0SA 5IO6A 4A60A 1CBQA 1KT4A 3IA8A 5H9AA 4QGXA 4YBUA 3TGBA 4K19A 2E4JA 2OZQA 1X8NA 5LJDA 4ZGUA 1SY3A 1CRBA 4I9RA 2MJIA 2X45A 2OFRX 1HN2A 3EBKA 1B0OA 5F6BA 4IB8A 1JZUA 3CBSA 1I06A 1PEEA 5HCEC 4ZHGA 1P6PA 3O22A 3PECA 3ZQ3A 3UEWA 1ERBA 2GC9A 3U0DA 2WEXA 5HCCC 3TF6A 3IFBA 1EALA 1QABE 1YUPA 1ZNLA 2L68A 3FA9A 5D48A 3WJFA 2HZRA 1OEJA 4IB6A 4XMHA 2A3FX 2CBRA 2F73A 1T0VA 1HBQA 3P6HA 4RUUA 1AELA 4MVLA 4EEJA 4WFUA 2POAA 4M7MA 1U18A 2A2GA 2DM5A 4TQ2A 1B4MA 3DSZA 3KZAA 4N7CA 2A0AA 2HMBA 3NP1A 3FR5A 3FEPA 4GE1A 2WWPA 4QZUA 3PP6A 2NNEA 2OVAA 3FW5A 4QYNA 1A3YA 5HZQA 5KHPA 3JS1A 2JU8A 1YWAA 2AT0X 1JYJA 4ZHHA 1KQWA 1QG5A 3B2LA 2LFOA 2EU7X 1IFBA 4ZFXA 2PY1A 4Y0RA 2AT5X 4QGVA 1A57A 1H91A 4YMYA 1X89A 1X8OA 1DZJA 4MVKA 1QFTA 1IKJA 3EM0A 2QOSC 1EIIA 3FIQA 4OMXA 4ES7A 4XMDA 1KZWA 4N7DA 2AT8X 3GAQA 4GNYA 1DZMA 5HBSA 1GKAA 1FEMA 1LF7A 1ACDA 3I17A 1LPJA 5L8NA 3ELZA 4AZRA 1B8EA 3P6EA 2FS6A 3FEKA 4LZVA 1O8VA 2BLGA 3STMX 4EFGA 5D4AA 4BQUA 1PMPA 2L67A 3CMPA 4IMNA 4AYHA 2LB6A 4QAEA 1O1VA 4QZTA 3TGAA 2WR6A 3EBWA 2HLVA 5BVTA 1G7NA 1X8PA 1IFCA 1TXLA 3BS2A 4ZHDA 1KZXA 1I04A 2L9CA 1HMRA 1LFOA 1HMTA 1QY0A 2FWVA 4UU3A 1G85A 2XSTA 3P6FA 4HPAA 3TZSA 1HBPA 2KTDA 4OS3A 4Y0PA 1ZRYA 4ORRA 3HWFA 3RSWA 1VPRA 1S2PA 3FW4A 5FFHA 1JJJA 4XMEA 2LKKA 3APXA 5HZ5A 2QM9A 1AB0A 1DC9A 1S44A 3TGCA 5LJCA 4DQ3A 4OMWA
chains in the Genus database with same CATH superfamily
4IAXA 1EI5A 3CWKA 2OY5O 5KIDA 1GKAB 3HWEA 4BJ8A 4YKOA 1TOWA 1ADLA 3VG5A 1BLRA 4ZH6A 4RUNA 1GT4A 1SWTA 1FTPA 1OBUA 4NP1A 4CK4A 1KT7A 1D2UA 3HWDA 4ML7B 4YH0A 2AMMX 1O1UA 2C1SA 2N93A 3NX2A 4YFRA 4QQ1A 1LIEA 3AKNA 4GH7A 1KOIA 2ZAGA 2AT3X 2WPUA 1KL5A 1UZ2X 2W2AA 5H8TA 5HA1A 5B2AO 3T2WA 1A18A 3PH5A 5H9LA 4ORYA 5IRUA 3VG7A 5L8OA 5FENA 3C78X 1EXSA 3ZWEA 4ZHCA 3P6CA 2RTRB 1X8QA 3P02A 3P6DA 3CQRA 2X34A 1SY1A 5LJHA 1PBOA 1QY2A 1E00A 1KT6A 1NDJA 4GRJA 4BX5B 4BCSA 2BSZA 2GTLN 1GGLA 3ZI8A 1SY2A 2OVDA 4OS0A 2GJ5A 1R0UA 5CHKA 3WZQA 1MEPA 1XCAA 2NNDA 1DFVA 1XKIA 2A8GA 3L4RA 3PH6A 5LJBA 2R56A 2ASNX 3T6LA 2Q4NA 3WXQA 4JGLA 4O9SA 3WVMA 4GKCA 1FENA 2IZIA 1SRJA 2QO5A 4GDAA 4O4OA 5KICA 1SWAA 3SLJA 5LJKA 2L5PA 1SWCA 5B5GA 1MVGA 4HFOA 5EDBA 4BGFA 3HTYA 1TOUA 3UAQA 4A8ZA 5HCDC 1VWPB 2BS5A 4NV7A 5IRWA 2MHDA 3EMMA 5HA0A 4KIIA 1VYGA 3BU1A 2YG2A 3PDFA 1E06A 1SWEA 4IAWA 2VDFA 5EDCA 2OVEA 3STKA 3BU9A 1YWCA 1ZNHA 3GE2A 2FT9A 4YGHA 1KXOA 1OSPO 4R0BA 1YWDA 2JU3A 2X55A 3B2KA 5F58A 5AEOA 4GU8A 2X32A 4CPIA 5BVSA 1BRPA 1ZNEA 4YCEA 2RA6A 2C1QA 2OFMX 4TJZA 4L1NA 1YIVA 2K62A 4ZH9A 3SLOA 3WOVA 3ZW1B 2ALLX 3NADA 4FBVA 2O62A 3U9PC 4GK9A 1K24A 3FIDA 2HNXA 2HZQA 2BT9A 4JO6A 3OE3A 1STPA 2RTHB 4QYPA 4Z2VA 1TW4A 1YP7A 1OBPA 1HXZA 3X00A 5IXGA 4U8UM 2FTBA 4CPFA 3NQKA 1OPAA 1VWGB 1SXUA 2OL6O 3VHIA 3OD9A 4OEMA 1NC9A 1FELA 2JU7A 1EPBA 1SWNA 1ML7A 1MDCA 5IO5A 2CZUA 2NNQA 4MISA 3BSZE 5HZ6A 3B2IA 4COTA 5L3YA 4XMCA 4PSQA 1NP4A 2AL0X 1MX7A 2RTBB 3FA7A 4HPDA 1SXWA 1IKEA 3D9WA 4CSBA 2WQAE 2X4MA 2X8TA 4IRWA 1LIFA 1RSTB 4ORUA 4GZVA 3EC5A 1DF3A 1VWBB 3FR2A 4FBOA 3KFHA 5DPQA 2Y3FA 3KQ0A 4EDEA 1JMXA 1VWDB 3NR3A 4LQZA 1E2TA 1VWQB 1W6FA 1WUBA 3SZIA 3FENA 2F09A 1EALA 1BEBA 2CM9A 3QKGA 4XMFA 1Y9LA 2ACPX 3MX7A 1AVEA 1JYDA 2QOMA 3KFFA 2WEWA 3KVNA 4YFQA 5K68A 3F9DA 5HTEA 3RWXA 3CR6A 4D6BA 5LJEA 4NV8A 4Z2OA 5C0NA 1KT5A 2DJFA 2QO6A 4U9CA 1KQXA 4LKPA 1QFVA 1QWDA 3CQNA 3ZUIA 4I3CA 3WJEA 4Z27A 1RLBE 3Q6LA 4CPEA 2CAMA 4ARHA 2LA7A 1BSQA 5B29A 1MM9A 2OYBO 2W2BA 2IZCB 1VYFA 2CBSA 2FR2A 1SWDA 4BVMA 4YVBA 1AVGI 1GT3A 2GH7A 2JOZA 3BX8A 3ELXA 4KH8A 1JV4A 2P8GA 1EUOA 2G8CO 3D97A 1VWAB 2G7BA 4ODDA 1NGLA 1VWKB 1YP6A 2C4IA 1B56A 3RZYA 3WBGA 3WYPA 3D96A 3RDMA 1QY1A 3APWA 3EYCA 1N9MA 3Q34A 1JBHA 1LICA 3V8UA 4BOEA 3MG5A 2HKDA 2G79A 2K23A 2KT4B 5HWZA 3MBTA 3N91A 4Y0QA 3VE1A 3BY0A 2FRSA 4I60A 3STNA 2VFBA 1JJXA 2IZDB 1OEKA 3UEVA 2ACOA 2R74A 4BX6A 1LCVA 3NQ9A 1Y0GA 1LIBA 4GDZA 4WFVA 3VG2A 4TKBA 1BWYA 1X8UA 1JMZA 1RXHA 5B3MO 4ALBA 5LKEA 2WQ9A 3S26A 1SRGA 3WJBA 2UYWA 1T8VA 1MX8A 1OBQA 1KL4A 2IZAA 2OY8A 1SWSA 1T68X 1U17A 1SRFA 3FA6A 3MVFA 3WYQA 3K3LA 5EEDA 2CZTA 1PBYA 1E02A 1EQDA 2X8FA 4ON1A 4AZMA 3RDUA 1VWCB 1EW3A 3AKMA 4KT5A 4OS8A 4ZCBA 3RY2A 2IZLB 1OEEA 4QGWA 4Y5DA 5F1EA 4IB7A 5D47A 4A1YA 1RXJA 3APVA 4FBRA 5F7GA 3HPEA 4TKJA 3I0AA 1GM6A 3PQUA 3RKGA 3BX7A 1VWEB 5IO7A 4JHQA 4I9SA 1KT3A 2RTPB 2X46A 3FMZA 2RQ0A 1FE3A 2BC3A 1GXAA 1SXXA 2Q2MA 2HYSA 1E5PA 4GUZA 1LIDA 3NX1A 1QQSA 1Y53X 4YDBA 4M6SA 5EEEA 2RTQB 1AQBA 1Y55X 2DJGA 4BX7B 5JR8A 4NLJA 4ZHFA 1ICNA 4EQAC 1RBPA 4Z28A 3LV4A 3VG6A 4XMGA 1EIOA 1SY0A 4AW8A 2AKQA 1NBXA 4OKAA 1S7DA 3DTQA 1GX9A 3ZUOA 3HWGA 2AT6X 3BDRA 5AJBA 4TLJA 3NQ3A 2AVIA 4GGRA 2FS7A 1N4JA 4ZR2A 1G74A 4ID2A 1N7YA 1IW2A 2FLJA 3C77X 3P6GA 4YFPA 2RTLA 1I4UA 4YCHA 1LCWA 5B10O 3T2XA 1CBIA 2RD7C 2R73A 1A2DA 4LZUA 4KCAA 3SAOA 3U03A 2KD2A 3FYFA 5BYPA 2Z4IA 5HZ9A 4MIRA 4IB9A 2NP1A 2LBVA 2RTKA 3B2HA 1I78A 4NYRA 1VWJB 1PM1X 5K06A 4YDAA 1EPAA 2RTEB 4NW4A 4CDEA 4TNNA 1VWIB 3PPTA 1BM5A 1L6MA 2G5LA 4I3DA 5H9KA 5IRAA 3C76X 2RTNB 1D3SA 2X56A 1VWMB 2IZFB 1UYOX 2IFBA 1N43A 4GGZA 3O2YA 1SWJA 5B27A 3BRNA 1BRQA 4FQBB 1VWHB 4CDCA 4YBPA 5D45A 1SWKA 1CBRA 4HPCA 1SXYA 3QQ2A 2QMIA 3APUA 3PK2A 4ORXA 4BBOA 1N0SA 1GT5A 1LELA 1DZKA 2QO4A 3BLGA 4MVEA 2OFBA 2Q9SA 2YMSA 1SWUA 1SWFA 4IMOA 2JW1A 4MVIA 4QRLA 3WZPA 1GX8A 5EPQA 3ZW2A 4AZOA 4Z2PA 5FAZA 5HZ8A 2AF5A 4U8UO 2GTLM 4UU2A 2OL7A 1ICMA 2OFAA 4GETA 3S5VA 2Q2PA 2IZBA 1I05A 4NNSA 1GT1A 2CM4A 3WJCA 3UEUA 3FDCA 5LKFA 4YGGA 4CPHA 5LJCA 5D8JA 1ERXA 4HWMA 3CKFA 1HY2A 3G7XA 3D95A 1OPBA 1STSB 2AH7X 4ZJ0A 2IZGB 2RTOB 4WBKA 4D6AA 1LUQA 1CJ5A 2IZEB 1SWOA 2JN3A 1UYNX 3FELA 3FA8A 2OY7A 5LJGA 3NPOA 3EW1A 1DV9A 1U0XA 1VYOA 1DF8A 5H9NA 4I3BA 3OJYC 1BSOA 3JSQA 2FR3A 1ZNDA 5CSEA 4AZPA 4ALOA 3AEHA 2A2UA 1HQPA 1MK5A 2OY1O 4TKHA 4AZNA 3VU1A 1Z24A 3B2JA 1NP1A 4EXZA 3E3CA 1IIUA 4KC7A 4O3XB 5AQ6A 5F6ZA 1X71A 4LKTA 2W2FA 4IBAA 4ORWA 4O4UA 3KFGA 3FR4A 1LDOA 3HOLA 4B55A 1ZNKA 4I95A 4QNIA 2I5ZO 2BHVA 1BSYA 3VG4A 1JQPA 5B5FA 1I9HA 2RCTA 2A5BA 3ZZVA 2FKJA 1UREA 1SA8A 3FLLA 2A13A 2UZ2A 3S5XA 1HMSA 1W4TA 3HK1A 1G5WA 2FHNX 4AZQA 2WSJA 1KGLA 4INNA 5CE4A 5L8IA 1IJ8A 4GJSA 2MM3A 1SWBA 3WJGA 4FGIB 2RTFB 1MUPA 2MO5A 1ALBA 1LKEA 1TVQA 1ZNGA 2GTFX 2OL8O 1STRB 3CBCA 3F8AA 4YKMA 1MOYA 1N9YA 2ANSA 4NYQA 3VG3A 4DCBA 5EZ2A 1NQMA 2PI3O 3O19A 5HAEA 2RN4A 3WJDA 2RTAA 5BVQA 2G78A 1DZPA 4GNWA 4YGZA 4NNTA 1YWBA 4DQ4A 4CPHB 4ORSA 2Q39A 4EKVA 5HTDA 3WZNA 2IZJA 1CBSA 5B11O 3PEDA 1AVDA 1W5RA 3CKGA 4GD9A 4OELA 2FGSA 3UEXA 1BBPA 1BJ7A 4NLIA 1FDQA 4O49A 2JMBA 4HPBA 1RXKA 4PJ2A 3T1DA 2RCQA 1PTSA 3KFIA 4A1HA 1LNMA 1SLGB 2XKLA 2WUTA 2LBAA 5DG4A 5F2BA 3SZHA 4Y0SA 2F01A 4U46A 4Z6JA 5IO6A 4A60A 3VHHA 1CBQA 3MM0A 1KT4A 2OF9A 3IA8A 4QGXA 4YBUA 1KL3A 5H9AA 2Z4HA 3RE6A 4WHIA 3TGBA 4K19A 2E4JA 2OZQA 4U8UN 1X8NA 5LJDA 4ZGUA 4GJVA 1SY3A 1CRBA 4I9RA 4ZGFA 1WBIA 2MF6A 2MJIA 2X45A 2RTDB 3RDOA 3ZW1A 2OFRX 2X8SA 1HN2A 3EBKA 1B0OA 5F6BA 1VWLB 4IB8A 3CBSA 3F6ZB 1I06A 3SZJA 1JZUA 1PEEA 1HQQA 5HCEC 1VWNB 4ZHGA 1P6PA 1VWOB 2KTSA 3O22A 4O3ZA 1Y52X 3PECA 3ZQ3A 3UEWA 1ERBA 2GC9A 3U0DA 2WEXA 5HCCC 3TF6A 3IFBA 1HXLA 1K3BA 1QABE 1YUPA 1SRIA 1ZNLA 2FHLA 2L68A 1Y9TA 2OVSA 3FA9A 5D48A 3WJFA 3T6FA 2HZRA 1OEJA 3HOEA 4IB6A 3RE5A 4XMHA 2A3FX 2CBRA 1SWHA 4BX6B 3RDQA 1GX3A 2F73A 1T0VA 1HBQA 3P6HA 2I5VO 3AUMO 3PQSA 4RUUA 4MVLA 1AELA 4EEJA 4WFUA 2POAA 3H3IA 4M7MA 1U18A 2A2GA 2DM5A 3D4RA 4I6SA 4TQ2A 1NQNA 1B4MA 3DSZA 3KZAA 3LTWA 4N7CA 2A0AA 4DNEA 4Y59A 1LDQA 2HMBA 3NP1A 3FR5A 3FEPA 2Y32A 3OBLA 4GE1A 2WWPA 4O3WA 4QZUA 3PP6A 2IZKA 5FQ7E 2NNEA 1KFFA 1SWGA 4MEEA 2OVAA 3FW5A 4QYNA 3SLTA 1A3YA 5HZQA 3JQOA 3RDSA 3JS1A 2BS6A 5KHPA 2ZAIA 2JU8A 1YWAA 4O4SA 1SWRA 1JYJA 2AT0X 4ZHHA 2Y3EA 3RBYA 1KQWA 1QG5A 3B2LA 2LFOA 1SLEB 2EU7X 1IFBA 4JNJA 4O4XA 4ZFXA 2PY1A 1FJ1E 2OF8A 4Y0RA 2AT5X 4KC8A 1RSUB 5K67A 4QGVA 5FQ8E 4CDFA 1A57A 1H91A 1VWRB 4YMYA 1X89A 1X8OA 5FQ6E 2RTGB 3ZW0A 1DZJA 4MVKA 1QFTA 3NBXX 2RTJA 5JD2A 1IKJA 4U3QA 3RY1A 5AJCA 3EM0A 1JJUA 1JIWI 2QOSC 4CDDA 2JGSA 1EIIA 3FIQA 4IABA 4OMXA 4XMDA 4ES7A 1KZWA 4N7DA 2AT8X 2GTLO 3GAQA 3SOTA 4GNYA 1DZMA 3VE2A 5HBSA 1GKAA 3VGWA 1FEMA 1LF7A 1ACDA 2RTMA 1SWQA 1LPJA 2FKGA 1SLDB 3ELZA 3I17A 3S60A 2KW1A 2RTCB 2RTIB 2ZSCA 1SWPA 4AZRA 3P24A 1B8EA 5L8NA 3P6EA 2FS6A 3FEKA 4LZVA 1O8VA 2BLGA 3STMX 4EFGA 5D4AA 3VHMA 4BQUA 1PMPA 2L67A 3CMPA 3LHNA 4IMNA 2LB6A 4QAEA 4AYHA 1O1VA 4QZTA 3TGAA 3EW2A 1RAVA 2WR6A 3EBWA 2HLVA 5BVTA 1G7NA 5CYBA 1X8PA 1IFCA 1TXLA 3BS2A 4ZHDA 1KZXA 1I04A 2L9CA 1HMRA 1LFOA 4O3YA 4BX5A 1HMTA 1QY0A 2FWVA 4UU3A 1G85A 2XSTA 3P6FA 4HPAA 3TZSA 1HBPA 2KTDA 4OS3A 4CV7A 2MWHA 2VFCA 4Y0PA 3VPJE 1SLFB 1LCZA 3RDXA 1ZRYA 4ORRA 3HWFA 4GGTA 3RSWA 1VPRA 4BX7A 3ZW0B 1S2PA 3FW4A 5FFHA 4C5PA 1SRHA 1SMPI 1JJJA 4L3RA 2IZHB 4XMEA 2LKKA 3APXA 1SWLA 2QM9A 1AB0A 3WZOA 5HZ5A 2A5CA 1DC9A 1S44A 1SREA 2QCBA 1VWFB 3TGCA 2M4LA 4DQ3A 4OMWA
chains in the Genus database with same CATH topology
4IAXA 1EI5A 3CWKA 5KIDA 1GKAB 3HWEA 4YKOA 1TOWA 1ADLA 3VG5A 1BLRA 4ZH6A 4RUNA 1GT4A 1FTPA 1OBUA 4NP1A 4CK4A 1KT7A 1D2UA 3HWDA 4ML7B 4YH0A 2AMMX 1O1UA 3NX2A 2N93A 4YFRA 4QQ1A 1LIEA 3AKNA 4GH7A 1KOIA 2ZAGA 2AT3X 5HA1A 2W2AA 1UZ2X 1A18A 3PH5A 5H9LA 4ORYA 3VG7A 5L8OA 5FENA 3C78X 1EXSA 3ZWEA 4ZHCA 3P6CA 1X8QA 3P02A 3P6DA 3CQRA 1SY1A 5LJHA 1PBOA 1QY2A 1E00A 1KT6A 4GRJA 2GTLN 1GGLA 3ZI8A 1SY2A 2OVDA 4OS0A 2GJ5A 1R0UA 2NNDA 1XCAA 1DFVA 1XKIA 3PH6A 3L4RA 5LJBA 2R56A 2ASNX 2Q4NA 3WXQA 4JGLA 4O9SA 3WVMA 4GKCA 1FENA 2QO5A 4O4OA 5KICA 5LJKA 2L5PA 1MVGA 4HFOA 5EDBA 3HTYA 1TOUA 3UAQA 4A8ZA 5HCDC 2BS5A 2MHDA 3EMMA 5HA0A 4KIIA 1VYGA 3BU1A 2YG2A 1E06A 4IAWA 5EDCA 2OVEA 3STKA 3BU9A 1YWCA 1ZNHA 2FT9A 4YGHA 1KXOA 4R0BA 1YWDA 2JU3A 3B2KA 5AEOA 5F58A 4GU8A 5BVSA 1BRPA 1ZNEA 4YCEA 2RA6A 2OFMX 4TJZA 4L1NA 1YIVA 2K62A 4ZH9A 3ZW1B 3WOVA 2ALLX 3NADA 4FBVA 2O62A 3U9PC 4GK9A 2HNXA 2HZQA 2BT9A 3OE3A 4QYPA 1TW4A 1YP7A 1OBPA 4U8UM 2FTBA 3NQKA 1OPAA 1SXUA 3OD9A 1FELA 2JU7A 1EPBA 1ML7A 1MDCA 5IO5A 2CZUA 2NNQA 4MISA 3BSZE 5HZ6A 3B2IA 4COTA 4XMCA 4PSQA 1NP4A 2AL0X 1MX7A 3FA7A 4HPDA 1SXWA 1IKEA 4CSBA 2WQAE 2X8TA 1LIFA 4ORUA 4GZVA 1DF3A 3FR2A 4FBOA 3KFHA 5DPQA 3KQ0A 4EDEA 3NR3A 4LQZA 3FENA 2F09A 1BEBA 2CM9A 3QKGA 4XMFA 1Y9LA 2ACPX 3MX7A 1JYDA 4YFQA 3KFFA 2WEWA 3F9DA 5HTEA 3RWXA 3CR6A 4D6BA 5LJEA 5C0NA 1KT5A 2QO6A 4U9CA 1KQXA 4LKPA 1QFVA 1QWDA 3CQNA 3ZUIA 4I3CA 3WJEA 1RLBE 3Q6LA 4ARHA 2LA7A 1BSQA 5B29A 2W2BA 1VYFA 2CBSA 2FR2A 4BVMA 1AVGI 1GT3A 2JOZA 3BX8A 3ELXA 4KH8A 1JV4A 2P8GA 1EUOA 4ODDA 3D97A 3RZYA 2G7BA 3WBGA 1NGLA 1YP6A 1B56A 3D96A 1QY1A 3APWA 3EYCA 1JBHA 1LICA 3V8UA 4BOEA 2K23A 2G79A 2KT4B 5HWZA 3MBTA 3N91A 4Y0QA 3VE1A 3BY0A 2FRSA 3STNA 1OEKA 3UEVA 2ACOA 2R74A 3NQ9A 4TKBA 1LIBA 4GDZA 4WFVA 3VG2A 1BWYA 1X8UA 5LKEA 4ALBA 2WQ9A 3S26A 3WJBA 1T8VA 1MX8A 1OBQA 3MVFA 1T68X 1U17A 3FA6A 3K3LA 5EEDA 2CZTA 4AZMA 1E02A 1EQDA 2X8FA 4ON1A 3AKMA 1EW3A 4KT5A 4OS8A 4ZCBA 1OEEA 4QGWA 5F1EA 4A1YA 4IB7A 5D47A 4FBRA 3APVA 5F7GA 4TKJA 3I0AA 1GM6A 3PQUA 3RKGA 3BX7A 5IO7A 4I9SA 1KT3A 2X46A 3FMZA 2RQ0A 1FE3A 5H8TA 1GXAA 1SXXA 2Q2MA 2HYSA 1E5PA 4YDBA 1LIDA 3NX1A 1QQSA 1JJXA 5EEEA 4M6SA 5JR8A 1AQBA 4NLJA 4ZHFA 1ICNA 4EQAC 1RBPA 3LV4A 3VG6A 4XMGA 1EIOA 1SY0A 4AW8A 2AKQA 3ZUOA 1S7DA 3DTQA 1GX9A 3HWGA 2AT6X 3BDRA 5AJBA 4TLJA 3NQ3A 2FS7A 4ZR2A 1G74A 4ID2A 1IW2A 2FLJA 3C77X 3P6GA 4YFPA 1I4UA 4YCHA 1CBIA 2RD7C 2R73A 1A2DA 4LZUA 4KCAA 3SAOA 3U03A 2KD2A 3FYFA 5BYPA 2Z4IA 5HZ9A 4MIRA 4IB9A 2NP1A 2LBVA 3B2HA 4NYRA 1PM1X 5K06A 4YDAA 1EPAA 4NW4A 4TNNA 3PPTA 1BM5A 1L6MA 4I3DA 5H9KA 3C76X 1D3SA 2IFBA 5B27A 3O2YA 4YBPA 3BRNA 1BRQA 4FQBB 5D45A 1CBRA 4HPCA 1SXYA 2QMIA 3APUA 4ORXA 1N0SA 1GT5A 1DZKA 2QO4A 3BLGA 4MVEA 4IMOA 2Q9SA 2YMSA 4QRLA 2JW1A 4MVIA 3ZW2A 1GX8A 5EPQA 4AZOA 5HZ8A 5FAZA 4U8UO 2GTLM 4UU2A 1ICMA 4GETA 3S5VA 2Q2PA 4NNSA 1I05A 1GT1A 2CM4A 3WJCA 3UEUA 5LKFA 4YGGA 5LJCA 5D8JA 1ERXA 4HWMA 3G7XA 3D95A 1OPBA 2AH7X 4ZJ0A 4WBKA 4D6AA 1CJ5A 2JN3A 3FELA 3FA8A 1DV9A 5LJGA 3NPOA 1U0XA 5H9NA 4I3BA 3OJYC 1BSOA 3JSQA 2FR3A 1ZNDA 4AZPA 4ALOA 2A2UA 1HQPA 4TKHA 4AZNA 3VU1A 1Z24A 3B2JA 1NP1A 4EXZA 3E3CA 1IIUA 4KC7A 4O3XB 5AQ6A 5F6ZA 1X71A 4LKTA 2W2FA 4IBAA 4ORWA 4O4UA 3KFGA 3FR4A 3HOLA 1ZNKA 4I95A 4QNIA 3VG4A 2BHVA 1BSYA 3ZZVA 2RCTA 1UREA 1SA8A 3FLLA 2A13A 3S5XA 1HMSA 3HK1A 1G5WA 4AZQA 2WSJA 1KGLA 4INNA 5CE4A 5L8IA 2MM3A 3WJGA 4FGIB 1MUPA 2MO5A 1ALBA 1LKEA 1TVQA 1ZNGA 2GTFX 3CBCA 3F8AA 4IABA 4YKMA 3VG3A 2ANSA 4NYQA 5EZ2A 3O19A 5HAEA 2RN4A 3WJDA 5BVQA 2G78A 1DZPA 4GNWA 4YGZA 4NNTA 1YWBA 4DQ4A 4ORSA 2Q39A 5HTDA 1CBSA 3PEDA 3UEXA 1BBPA 1BJ7A 4NLIA 1FDQA 4O49A 2JMBA 4HPBA 4PJ2A 3T1DA 2RCQA 3KFIA 4A1HA 1LNMA 2XKLA 2WUTA 2LBAA 5DG4A 4Y0SA 5IO6A 4A60A 1CBQA 1KT4A 3IA8A 5H9AA 4QGXA 4YBUA 2Z4HA 4WHIA 3TGBA 4K19A 2E4JA 2OZQA 4U8UN 1X8NA 5LJDA 4ZGUA 1SY3A 1CRBA 4I9RA 4ZGFA 2MJIA 2X45A 3ZW1A 2OFRX 2X8SA 1HN2A 3EBKA 1B0OA 5F6BA 4IB8A 1JZUA 3CBSA 3F6ZB 1I06A 1PEEA 5HCEC 4ZHGA 1P6PA 2KTSA 3O22A 4O3ZA 3PECA 3ZQ3A 3UEWA 1ERBA 2GC9A 3U0DA 2WEXA 5HCCC 3TF6A 3IFBA 3GE2A 1EALA 1QABE 1YUPA 1ZNLA 2L68A 3FA9A 1Y9TA 2OVSA 5D48A 3WJFA 2HZRA 1OEJA 3HOEA 4IB6A 4XMHA 2A3FX 2CBRA 2F73A 1T0VA 1HBQA 3P6HA 4RUUA 3PQSA 1AELA 4MVLA 4EEJA 4WFUA 2POAA 3H3IA 4M7MA 1U18A 2A2GA 2DM5A 3D4RA 4I6SA 4TQ2A 1B4MA 3DSZA 3KZAA 4N7CA 2A0AA 2HMBA 3NP1A 3FR5A 3FEPA 3OBLA 4O3WA 4GE1A 2WWPA 4QZUA 3PP6A 5FQ7E 2NNEA 2OVAA 3FW5A 4QYNA 1A3YA 5HZQA 3JQOA 5KHPA 3JS1A 2BS6A 2ZAIA 2JU8A 1YWAA 4O4SA 2AT0X 1JYJA 4ZHHA 3RBYA 1KQWA 1QG5A 3B2LA 2LFOA 2EU7X 1IFBA 4O4XA 4ZFXA 2PY1A 4Y0RA 2AT5X 4KC8A 4QGVA 5FQ8E 1A57A 1H91A 4YMYA 1X89A 1X8OA 5FQ6E 3ZW0A 1DZJA 4MVKA 1QFTA 3NBXX 1IKJA 4U3QA 5AJCA 3EM0A 1JIWI 2QOSC 1EIIA 3FIQA 4OMXA 4ES7A 4XMDA 1KZWA 4N7DA 2AT8X 2GTLO 3GAQA 3SOTA 4GNYA 1DZMA 3VE2A 5HBSA 1GKAA 1FEMA 1LF7A 1ACDA 3I17A 3S60A 1LPJA 5L8NA 3ELZA 4AZRA 2KW1A 3P24A 1B8EA 3P6EA 2FS6A 3FEKA 4LZVA 1O8VA 2BLGA 3STMX 4EFGA 5D4AA 4BQUA 1PMPA 2L67A 3CMPA 3LHNA 4IMNA 2LB6A 4QAEA 4AYHA 1O1VA 4QZTA 3TGAA 2WR6A 3EBWA 2HLVA 5BVTA 1G7NA 5CYBA 1X8PA 1IFCA 1TXLA 3BS2A 4ZHDA 1KZXA 1I04A 2L9CA 1HMRA 1LFOA 4O3YA 1HMTA 1QY0A 2FWVA 4UU3A 1G85A 2XSTA 3P6FA 4HPAA 3TZSA 1HBPA 2KTDA 4OS3A 4CV7A 2MWHA 4Y0PA 3VPJE 1ZRYA 4ORRA 3HWFA 3RSWA 1VPRA 3ZW0B 1S2PA 3FW4A 5FFHA 1SMPI 1JJJA 4L3RA 4XMEA 2LKKA 3APXA 5HZ5A 2QM9A 1AB0A 1DC9A 1S44A 3TGCA 2M4LA 4DQ3A 4OMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4IAX A;  3CWK A;  5KID A;  1GKA B;  3HWE A;  4YKO A;  1TOW A;  1ADL A;  3VG5 A;  1BLR A;  4ZH6 A;  4RUN A;  1GT4 A;  1FTP A;  1OBU A;  4NP1 A;  4CK4 A;  1KT7 A;  1D2U A;  3HWD A;  4YH0 A;  2AMM X;  1O1U A;  3NX2 A;  2N93 A;  4YFR A;  1LIE A;  3AKN A;  4GH7 A;  1KOI A;  5HA1 A;  2AT3 X;  2W2A A;  1UZ2 X;  1A18 A;  3PH5 A;  5H9L A;  4ORY A;  3VG7 A;  5L8O A;  5FEN A;  3C78 X;  1EXS A;  4ZHC A;  3P6C A;  1X8Q A;  3P6D A;  3CQR A;  1SY1 A;  5LJH A;  1PBO A;  1QY2 A;  1E00 A;  1KT6 A;  4GRJ A;  1GGL A;  1SY2 A;  2OVD A;  4OS0 A;  2GJ5 A;  1R0U A;  2NND A;  1XCA A;  1DFV A;  1XKI A;  3PH6 A;  3L4R A;  5LJB A;  2R56 A;  2ASN X;  2Q4N A;  3WXQ A;  4O9S A;  3WVM A;  4GKC A;  1FEN A;  2QO5 A;  5KIC A;  5LJK A;  2L5P A;  1MVG A;  4HFO A;  5EDB A;  1TOU A;  4A8Z A;  5HCD C;  3EMM A;  5HA0 A;  4KII A;  1VYG A;  3BU1 A;  2YG2 A;  1E06 A;  4IAW A;  5EDC A;  2OVE A;  3STK A;  3BU9 A;  1YWC A;  1ZNH A;  2FT9 A;  4YGH A;  1KXO A;  4R0B A;  1YWD A;  2JU3 A;  3B2K A;  5F58 A;  5BVS A;  1BRP A;  1ZNE A;  4YCE A;  2RA6 A;  2OFM X;  4TJZ A;  1YIV A;  2K62 A;  4ZH9 A;  2ALL X;  3NAD A;  2O62 A;  3U9P C;  2HNX A;  2HZQ A;  4QYP A;  1TW4 A;  1YP7 A;  1OBP A;  2FTB A;  1OPA A;  1SXU A;  1FEL A;  2JU7 A;  1EPB A;  1ML7 A;  1MDC A;  5IO5 A;  2CZU A;  2NNQ A;  3BSZ E;  5HZ6 A;  3B2I A;  4XMC A;  4PSQ A;  1NP4 A;  2AL0 X;  1MX7 A;  3FA7 A;  4HPD A;  1SXW A;  1IKE A;  2WQA E;  1LIF A;  4ORU A;  1DF3 A;  3FR2 A;  3KFH A;  5DPQ A;  3KQ0 A;  4EDE A;  3NR3 A;  3FEN A;  1BEB A;  2CM9 A;  3QKG A;  4XMF A;  2ACP X;  1JYD A;  4YFQ A;  3KFF A;  2WEW A;  3F9D A;  5HTE A;  4D6B A;  3CR6 A;  5LJE A;  5C0N A;  1KT5 A;  2QO6 A;  1KQX A;  4LKP A;  1QFV A;  1QWD A;  3CQN A;  3ZUI A;  4I3C A;  3WJE A;  1RLB E;  3Q6L A;  4ARH A;  5B29 A;  1BSQ A;  2W2B A;  1VYF A;  2CBS A;  2FR2 A;  4BVM A;  1AVG I;  1GT3 A;  2JOZ A;  3BX8 A;  3ELX A;  1JV4 A;  2P8G A;  1EUO A;  4ODD A;  3D97 A;  3RZY A;  2G7B A;  3WBG A;  1NGL A;  1YP6 A;  1B56 A;  3D96 A;  1QY1 A;  3APW A;  3EYC A;  1JBH A;  1LIC A;  4BOE A;  2K23 A;  2G79 A;  2KT4 B;  5HWZ A;  3MBT A;  4Y0Q A;  3BY0 A;  2FRS A;  3STN A;  1OEK A;  3UEV A;  2ACO A;  2R74 A;  3NQ9 A;  4TKB A;  1LIB A;  4WFV A;  3VG2 A;  1BWY A;  1X8U A;  5LKE A;  4ALB A;  2WQ9 A;  3S26 A;  3WJB A;  1T8V A;  1MX8 A;  1OBQ A;  3MVF A;  1T68 X;  1U17 A;  3FA6 A;  3K3L A;  5EED A;  2CZT A;  4AZM A;  1E02 A;  1EQD A;  3AKM A;  1EW3 A;  4OS8 A;  4ZCB A;  1OEE A;  4QGW A;  5F1E A;  4A1Y A;  4IB7 A;  5D47 A;  3APV A;  5F7G A;  4TKJ A;  3I0A A;  1GM6 A;  3BX7 A;  5IO7 A;  4I9S A;  1KT3 A;  2X46 A;  3FMZ A;  2RQ0 A;  1FE3 A;  5H8T A;  1GXA A;  1SXX A;  2Q2M A;  2HYS A;  1E5P A;  4YDB A;  1LID A;  3NX1 A;  1QQS A;  1JJX A;  5EEE A;  4M6S A;  5JR8 A;  1AQB A;  4NLJ A;  4ZHF A;  1ICN A;  1RBP A;  3VG6 A;  4XMG A;  1EIO A;  1SY0 A;  4AW8 A;  2AKQ A;  3ZUO A;  1S7D A;  3DTQ A;  1GX9 A;  3HWG A;  2AT6 X;  3BDR A;  4TLJ A;  3NQ3 A;  2FS7 A;  4ZR2 A;  1G74 A;  1IW2 A;  2FLJ A;  3C77 X;  3P6G A;  4YFP A;  1I4U A;  4YCH A;  1CBI A;  2RD7 C;  2R73 A;  1A2D A;  4LZU A;  3U03 A;  3SAO A;  5HZ9 A;  4IB9 A;  2NP1 A;  2LBV A;  3B2H A;  4NYR A;  1PM1 X;  5K06 A;  4YDA A;  1EPA A;  4TNN A;  3PPT A;  1BM5 A;  1L6M A;  4I3D A;  5H9K A;  3C76 X;  1D3S A;  2IFB A;  5B27 A;  3O2Y A;  4YBP A;  3BRN A;  1BRQ A;  5D45 A;  1CBR A;  4HPC A;  1SXY A;  3APU A;  4ORX A;  1N0S A;  1GT5 A;  1DZK A;  2QO4 A;  3BLG A;  4IMO A;  2Q9S A;  4MVI A;  1GX8 A;  5EPQ A;  4AZO A;  5HZ8 A;  5FAZ A;  4UU2 A;  1ICM A;  4GET A;  2Q2P A;  4NNS A;  1I05 A;  1GT1 A;  2CM4 A;  3WJC A;  3UEU A;  5LKF A;  4YGG A;  5D8J A;  1ERX A;  3G7X A;  3D95 A;  1OPB A;  2AH7 X;  4ZJ0 A;  4WBK A;  4D6A A;  1CJ5 A;  2JN3 A;  3FEL A;  3FA8 A;  1DV9 A;  3NPO A;  1U0X A;  5H9N A;  4I3B A;  3OJY C;  1BSO A;  3JSQ A;  2FR3 A;  1ZND A;  4AZP A;  4ALO A;  2A2U A;  1HQP A;  4TKH A;  4AZN A;  1Z24 A;  3B2J A;  1NP1 A;  4EXZ A;  1IIU A;  5F6Z A;  5AQ6 A;  5LJG A;  1X71 A;  4LKT A;  2W2F A;  4IBA A;  4ORW A;  3KFG A;  3FR4 A;  1ZNK A;  3VG4 A;  1BSY A;  2RCT A;  1URE A;  1SA8 A;  3FLL A;  2A13 A;  1HMS A;  3HK1 A;  1G5W A;  4AZQ A;  2WSJ A;  1KGL A;  5CE4 A;  5L8I A;  2MM3 A;  3WJG A;  1MUP A;  2MO5 A;  1ALB A;  1LKE A;  1TVQ A;  1ZNG A;  2GTF X;  3CBC A;  3F8A A;  4YKM A;  3VG3 A;  2ANS A;  4NYQ A;  5EZ2 A;  3O19 A;  5HAE A;  3WJD A;  5BVQ A;  2G78 A;  1DZP A;  4GNW A;  4YGZ A;  4NNT A;  1YWB A;  4DQ4 A;  4ORS A;  2Q39 A;  5HTD A;  1CBS A;  3PED A;  3UEX A;  1BBP A;  1BJ7 A;  4NLI A;  1FDQ A;  4HPB A;  3T1D A;  2RCQ A;  3KFI A;  4A1H A;  1LNM A;  2XKL A;  2WUT A;  2LBA A;  5DG4 A;  4Y0S A;  5IO6 A;  4A60 A;  1CBQ A;  1KT4 A;  3IA8 A;  5H9A A;  4QGX A;  4YBU A;  3TGB A;  4K19 A;  2E4J A;  2OZQ A;  1X8N A;  5LJD A;  4ZGU A;  1SY3 A;  1CRB A;  4I9R A;  2MJI A;  2X45 A;  2OFR X;  1HN2 A;  3EBK A;  1B0O A;  5F6B A;  4IB8 A;  1JZU A;  3CBS A;  1I06 A;  1PEE A;  5HCE C;  4ZHG A;  1P6P A;  3O22 A;  3PEC A;  3ZQ3 A;  3UEW A;  1ERB A;  2GC9 A;  3U0D A;  2WEX A;  5HCC C;  3TF6 A;  3IFB A;  1EAL A;  1QAB E;  1YUP A;  1ZNL A;  2L68 A;  3FA9 A;  5D48 A;  3WJF A;  2HZR A;  1OEJ A;  4IB6 A;  4XMH A;  2A3F X;  2CBR A;  2F73 A;  1T0V A;  1HBQ A;  3P6H A;  4RUU A;  1AEL A;  4MVL A;  4EEJ A;  4WFU A;  2POA A;  4M7M A;  1U18 A;  2A2G A;  2DM5 A;  4TQ2 A;  1B4M A;  3DSZ A;  3KZA A;  4N7C A;  2A0A A;  2HMB A;  3NP1 A;  3FR5 A;  3FEP A;  4GE1 A;  2WWP A;  4QZU A;  3PP6 A;  2NNE A;  2OVA A;  3FW5 A;  4QYN A;  1A3Y A;  5HZQ A;  5KHP A;  3JS1 A;  2JU8 A;  1YWA A;  2AT0 X;  1JYJ A;  4ZHH A;  1KQW A;  1QG5 A;  3B2L A;  2LFO A;  2EU7 X;  1IFB A;  4ZFX A;  2PY1 A;  4Y0R A;  2AT5 X;  4QGV A;  1A57 A;  1H91 A;  4YMY A;  1X89 A;  1X8O A;  1DZJ A;  4MVK A;  1QFT A;  1IKJ A;  3EM0 A;  2QOS C;  1EII A;  3FIQ A;  4OMX A;  4ES7 A;  4XMD A;  1KZW A;  4N7D A;  2AT8 X;  3GAQ A;  4GNY A;  1DZM A;  5HBS A;  1GKA A;  1FEM A;  1LF7 A;  1ACD A;  3I17 A;  1LPJ A;  5L8N A;  3ELZ A;  4AZR A;  1B8E A;  3P6E A;  2FS6 A;  3FEK A;  4LZV A;  1O8V A;  2BLG A;  3STM X;  4EFG A;  5D4A A;  4BQU A;  1PMP A;  2L67 A;  3CMP A;  4IMN A;  4AYH A;  2LB6 A;  4QAE A;  1O1V A;  4QZT A;  3TGA A;  2WR6 A;  3EBW A;  2HLV A;  5BVT A;  1G7N A;  1X8P A;  1IFC A;  1TXL A;  3BS2 A;  4ZHD A;  1KZX A;  1I04 A;  2L9C A;  1HMR A;  1LFO A;  1HMT A;  1QY0 A;  2FWV A;  4UU3 A;  1G85 A;  2XST A;  3P6F A;  4HPA A;  3TZS A;  1HBP A;  2KTD A;  4OS3 A;  4Y0P A;  1ZRY A;  4ORR A;  3HWF A;  3RSW A;  1VPR A;  1S2P A;  3FW4 A;  5FFH A;  1JJJ A;  4XME A;  2LKK A;  3APX A;  5HZ5 A;  2QM9 A;  1AB0 A;  1DC9 A;  1S44 A;  3TGC A;  5LJC A;  4DQ3 A;  4OMW A; 
#chains in the Genus database with same CATH topology
 4IAX A;  1EI5 A;  3CWK A;  2OY5 O;  5KID A;  1GKA B;  3HWE A;  4BJ8 A;  4YKO A;  1TOW A;  1ADL A;  3VG5 A;  1BLR A;  4ZH6 A;  4RUN A;  1GT4 A;  1SWT A;  1FTP A;  1OBU A;  4NP1 A;  4CK4 A;  1KT7 A;  1D2U A;  3HWD A;  4ML7 B;  4YH0 A;  2AMM X;  1O1U A;  2C1S A;  2N93 A;  3NX2 A;  4YFR A;  4QQ1 A;  1LIE A;  3AKN A;  4GH7 A;  1KOI A;  2ZAG A;  2AT3 X;  2WPU A;  1KL5 A;  1UZ2 X;  2W2A A;  5H8T A;  5HA1 A;  5B2A O;  3T2W A;  1A18 A;  3PH5 A;  5H9L A;  4ORY A;  5IRU A;  3VG7 A;  5L8O A;  5FEN A;  3C78 X;  1EXS A;  3ZWE A;  4ZHC A;  3P6C A;  2RTR B;  1X8Q A;  3P02 A;  3P6D A;  3CQR A;  2X34 A;  1SY1 A;  5LJH A;  1PBO A;  1QY2 A;  1E00 A;  1KT6 A;  1NDJ A;  4GRJ A;  4BX5 B;  4BCS A;  2BSZ A;  2GTL N;  1GGL A;  3ZI8 A;  1SY2 A;  2OVD A;  4OS0 A;  2GJ5 A;  1R0U A;  5CHK A;  3WZQ A;  1MEP A;  1XCA A;  2NND A;  1DFV A;  1XKI A;  2A8G A;  3L4R A;  3PH6 A;  5LJB A;  2R56 A;  2ASN X;  3T6L A;  2Q4N A;  3WXQ A;  4JGL A;  4O9S A;  3WVM A;  4GKC A;  1FEN A;  2IZI A;  1SRJ A;  2QO5 A;  4GDA A;  4O4O A;  5KIC A;  1SWA A;  3SLJ A;  5LJK A;  2L5P A;  1SWC A;  5B5G A;  1MVG A;  4HFO A;  5EDB A;  4BGF A;  3HTY A;  1TOU A;  3UAQ A;  4A8Z A;  5HCD C;  1VWP B;  2BS5 A;  4NV7 A;  5IRW A;  2MHD A;  3EMM A;  5HA0 A;  4KII A;  1VYG A;  3BU1 A;  2YG2 A;  3PDF A;  1E06 A;  1SWE A;  4IAW A;  2VDF A;  5EDC A;  2OVE A;  3STK A;  3BU9 A;  1YWC A;  1ZNH A;  3GE2 A;  2FT9 A;  4YGH A;  1KXO A;  1OSP O;  4R0B A;  1YWD A;  2JU3 A;  2X55 A;  3B2K A;  5F58 A;  5AEO A;  4GU8 A;  2X32 A;  4CPI A;  5BVS A;  1BRP A;  1ZNE A;  4YCE A;  2RA6 A;  2C1Q A;  2OFM X;  4TJZ A;  4L1N A;  1YIV A;  2K62 A;  4ZH9 A;  3SLO A;  3WOV A;  3ZW1 B;  2ALL X;  3NAD A;  4FBV A;  2O62 A;  3U9P C;  4GK9 A;  1K24 A;  3FID A;  2HNX A;  2HZQ A;  2BT9 A;  4JO6 A;  3OE3 A;  1STP A;  2RTH B;  4QYP A;  4Z2V A;  1TW4 A;  1YP7 A;  1OBP A;  1HXZ A;  3X00 A;  5IXG A;  4U8U M;  2FTB A;  4CPF A;  3NQK A;  1OPA A;  1VWG B;  1SXU A;  2OL6 O;  3VHI A;  3OD9 A;  4OEM A;  1NC9 A;  1FEL A;  2JU7 A;  1EPB A;  1SWN A;  1ML7 A;  1MDC A;  5IO5 A;  2CZU A;  2NNQ A;  4MIS A;  3BSZ E;  5HZ6 A;  3B2I A;  4COT A;  5L3Y A;  4XMC A;  4PSQ A;  1NP4 A;  2AL0 X;  1MX7 A;  2RTB B;  3FA7 A;  4HPD A;  1SXW A;  1IKE A;  3D9W A;  4CSB A;  2WQA E;  2X4M A;  2X8T A;  4IRW A;  1LIF A;  1RST B;  4ORU A;  4GZV A;  3EC5 A;  1DF3 A;  1VWB B;  3FR2 A;  4FBO A;  3KFH A;  5DPQ A;  2Y3F A;  3KQ0 A;  4EDE A;  1JMX A;  1VWD B;  3NR3 A;  4LQZ A;  1E2T A;  1VWQ B;  1W6F A;  1WUB A;  3SZI A;  3FEN A;  2F09 A;  1EAL A;  1BEB A;  2CM9 A;  3QKG A;  4XMF A;  1Y9L A;  2ACP X;  3MX7 A;  1AVE A;  1JYD A;  2QOM A;  3KFF A;  2WEW A;  3KVN A;  4YFQ A;  5K68 A;  3F9D A;  5HTE A;  3RWX A;  3CR6 A;  4D6B A;  5LJE A;  4NV8 A;  4Z2O A;  5C0N A;  1KT5 A;  2DJF A;  2QO6 A;  4U9C A;  1KQX A;  4LKP A;  1QFV A;  1QWD A;  3CQN A;  3ZUI A;  4I3C A;  3WJE A;  4Z27 A;  1RLB E;  3Q6L A;  4CPE A;  2CAM A;  4ARH A;  2LA7 A;  1BSQ A;  5B29 A;  1MM9 A;  2OYB O;  2W2B A;  2IZC B;  1VYF A;  2CBS A;  2FR2 A;  1SWD A;  4BVM A;  4YVB A;  1AVG I;  1GT3 A;  2GH7 A;  2JOZ A;  3BX8 A;  3ELX A;  4KH8 A;  1JV4 A;  2P8G A;  1EUO A;  2G8C O;  3D97 A;  1VWA B;  2G7B A;  4ODD A;  1NGL A;  1VWK B;  1YP6 A;  2C4I A;  1B56 A;  3RZY A;  3WBG A;  3WYP A;  3D96 A;  3RDM A;  1QY1 A;  3APW A;  3EYC A;  1N9M A;  3Q34 A;  1JBH A;  1LIC A;  3V8U A;  4BOE A;  3MG5 A;  2HKD A;  2G79 A;  2K23 A;  2KT4 B;  5HWZ A;  3MBT A;  3N91 A;  4Y0Q A;  3VE1 A;  3BY0 A;  2FRS A;  4I60 A;  3STN A;  2VFB A;  1JJX A;  2IZD B;  1OEK A;  3UEV A;  2ACO A;  2R74 A;  4BX6 A;  1LCV A;  3NQ9 A;  1Y0G A;  1LIB A;  4GDZ A;  4WFV A;  3VG2 A;  4TKB A;  1BWY A;  1X8U A;  1JMZ A;  1RXH A;  5B3M O;  4ALB A;  5LKE A;  2WQ9 A;  3S26 A;  1SRG A;  3WJB A;  2UYW A;  1T8V A;  1MX8 A;  1OBQ A;  1KL4 A;  2IZA A;  2OY8 A;  1SWS A;  1T68 X;  1U17 A;  1SRF A;  3FA6 A;  3MVF A;  3WYQ A;  3K3L A;  5EED A;  2CZT A;  1PBY A;  1E02 A;  1EQD A;  2X8F A;  4ON1 A;  4AZM A;  3RDU A;  1VWC B;  1EW3 A;  3AKM A;  4KT5 A;  4OS8 A;  4ZCB A;  3RY2 A;  2IZL B;  1OEE A;  4QGW A;  4Y5D A;  5F1E A;  4IB7 A;  5D47 A;  4A1Y A;  1RXJ A;  3APV A;  4FBR A;  5F7G A;  3HPE A;  4TKJ A;  3I0A A;  1GM6 A;  3PQU A;  3RKG A;  3BX7 A;  1VWE B;  5IO7 A;  4JHQ A;  4I9S A;  1KT3 A;  2RTP B;  2X46 A;  3FMZ A;  2RQ0 A;  1FE3 A;  2BC3 A;  1GXA A;  1SXX A;  2Q2M A;  2HYS A;  1E5P A;  4GUZ A;  1LID A;  3NX1 A;  1QQS A;  1Y53 X;  4YDB A;  4M6S A;  5EEE A;  2RTQ B;  1AQB A;  1Y55 X;  2DJG A;  4BX7 B;  5JR8 A;  4NLJ A;  4ZHF A;  1ICN A;  4EQA C;  1RBP A;  4Z28 A;  3LV4 A;  3VG6 A;  4XMG A;  1EIO A;  1SY0 A;  4AW8 A;  2AKQ A;  1NBX A;  4OKA A;  1S7D A;  3DTQ A;  1GX9 A;  3ZUO A;  3HWG A;  2AT6 X;  3BDR A;  5AJB A;  4TLJ A;  3NQ3 A;  2AVI A;  4GGR A;  2FS7 A;  1N4J A;  4ZR2 A;  1G74 A;  4ID2 A;  1N7Y A;  1IW2 A;  2FLJ A;  3C77 X;  3P6G A;  4YFP A;  2RTL A;  1I4U A;  4YCH A;  1LCW A;  5B10 O;  3T2X A;  1CBI A;  2RD7 C;  2R73 A;  1A2D A;  4LZU A;  4KCA A;  3SAO A;  3U03 A;  2KD2 A;  3FYF A;  5BYP A;  2Z4I A;  5HZ9 A;  4MIR A;  4IB9 A;  2NP1 A;  2LBV A;  2RTK A;  3B2H A;  1I78 A;  4NYR A;  1VWJ B;  1PM1 X;  5K06 A;  4YDA A;  1EPA A;  2RTE B;  4NW4 A;  4CDE A;  4TNN A;  1VWI B;  3PPT A;  1BM5 A;  1L6M A;  2G5L A;  4I3D A;  5H9K A;  5IRA A;  3C76 X;  2RTN B;  1D3S A;  2X56 A;  1VWM B;  2IZF B;  1UYO X;  2IFB A;  1N43 A;  4GGZ A;  3O2Y A;  1SWJ A;  5B27 A;  3BRN A;  1BRQ A;  4FQB B;  1VWH B;  4CDC A;  4YBP A;  5D45 A;  1SWK A;  1CBR A;  4HPC A;  1SXY A;  3QQ2 A;  2QMI A;  3APU A;  3PK2 A;  4ORX A;  4BBO A;  1N0S A;  1GT5 A;  1LEL A;  1DZK A;  2QO4 A;  3BLG A;  4MVE A;  2OFB A;  2Q9S A;  2YMS A;  1SWU A;  1SWF A;  4IMO A;  2JW1 A;  4MVI A;  4QRL A;  3WZP A;  1GX8 A;  5EPQ A;  3ZW2 A;  4AZO A;  4Z2P A;  5FAZ A;  5HZ8 A;  2AF5 A;  4U8U O;  2GTL M;  4UU2 A;  2OL7 A;  1ICM A;  2OFA A;  4GET A;  3S5V A;  2Q2P A;  2IZB A;  1I05 A;  4NNS A;  1GT1 A;  2CM4 A;  3WJC A;  3UEU A;  3FDC A;  5LKF A;  4YGG A;  4CPH A;  5LJC A;  5D8J A;  1ERX A;  4HWM A;  3CKF A;  1HY2 A;  3G7X A;  3D95 A;  1OPB A;  1STS B;  2AH7 X;  4ZJ0 A;  2IZG B;  2RTO B;  4WBK A;  4D6A A;  1LUQ A;  1CJ5 A;  2IZE B;  1SWO A;  2JN3 A;  1UYN X;  3FEL A;  3FA8 A;  2OY7 A;  5LJG A;  3NPO A;  3EW1 A;  1DV9 A;  1U0X A;  1VYO A;  1DF8 A;  5H9N A;  4I3B A;  3OJY C;  1BSO A;  3JSQ A;  2FR3 A;  1ZND A;  5CSE A;  4AZP A;  4ALO A;  3AEH A;  2A2U A;  1HQP A;  1MK5 A;  2OY1 O;  4TKH A;  4AZN A;  3VU1 A;  1Z24 A;  3B2J A;  1NP1 A;  4EXZ A;  3E3C A;  1IIU A;  4KC7 A;  4O3X B;  5AQ6 A;  5F6Z A;  1X71 A;  4LKT A;  2W2F A;  4IBA A;  4ORW A;  4O4U A;  3KFG A;  3FR4 A;  1LDO A;  3HOL A;  4B55 A;  1ZNK A;  4I95 A;  4QNI A;  2I5Z O;  2BHV A;  1BSY A;  3VG4 A;  1JQP A;  5B5F A;  1I9H A;  2RCT A;  2A5B A;  3ZZV A;  2FKJ A;  1URE A;  1SA8 A;  3FLL A;  2A13 A;  2UZ2 A;  3S5X A;  1HMS A;  1W4T A;  3HK1 A;  1G5W A;  2FHN X;  4AZQ A;  2WSJ A;  1KGL A;  4INN A;  5CE4 A;  5L8I A;  1IJ8 A;  4GJS A;  2MM3 A;  1SWB A;  3WJG A;  4FGI B;  2RTF B;  1MUP A;  2MO5 A;  1ALB A;  1LKE A;  1TVQ A;  1ZNG A;  2GTF X;  2OL8 O;  1STR B;  3CBC A;  3F8A A;  4YKM A;  1MOY A;  1N9Y A;  2ANS A;  4NYQ A;  3VG3 A;  4DCB A;  5EZ2 A;  1NQM A;  2PI3 O;  3O19 A;  5HAE A;  2RN4 A;  3WJD A;  2RTA A;  5BVQ A;  2G78 A;  1DZP A;  4GNW A;  4YGZ A;  4NNT A;  1YWB A;  4DQ4 A;  4CPH B;  4ORS A;  2Q39 A;  4EKV A;  5HTD A;  3WZN A;  2IZJ A;  1CBS A;  5B11 O;  3PED A;  1AVD A;  1W5R A;  3CKG A;  4GD9 A;  4OEL A;  2FGS A;  3UEX A;  1BBP A;  1BJ7 A;  4NLI A;  1FDQ A;  4O49 A;  2JMB A;  4HPB A;  1RXK A;  4PJ2 A;  3T1D A;  2RCQ A;  1PTS A;  3KFI A;  4A1H A;  1LNM A;  1SLG B;  2XKL A;  2WUT A;  2LBA A;  5DG4 A;  5F2B A;  3SZH A;  4Y0S A;  2F01 A;  4U46 A;  4Z6J A;  5IO6 A;  4A60 A;  3VHH A;  1CBQ A;  3MM0 A;  1KT4 A;  2OF9 A;  3IA8 A;  4QGX A;  4YBU A;  1KL3 A;  5H9A A;  2Z4H A;  3RE6 A;  4WHI A;  3TGB A;  4K19 A;  2E4J A;  2OZQ A;  4U8U N;  1X8N A;  5LJD A;  4ZGU A;  4GJV A;  1SY3 A;  1CRB A;  4I9R A;  4ZGF A;  1WBI A;  2MF6 A;  2MJI A;  2X45 A;  2RTD B;  3RDO A;  3ZW1 A;  2OFR X;  2X8S A;  1HN2 A;  3EBK A;  1B0O A;  5F6B A;  1VWL B;  4IB8 A;  3CBS A;  3F6Z B;  1I06 A;  3SZJ A;  1JZU A;  1PEE A;  1HQQ A;  5HCE C;  1VWN B;  4ZHG A;  1P6P A;  1VWO B;  2KTS A;  3O22 A;  4O3Z A;  1Y52 X;  3PEC A;  3ZQ3 A;  3UEW A;  1ERB A;  2GC9 A;  3U0D A;  2WEX A;  5HCC C;  3TF6 A;  3IFB A;  1HXL A;  1K3B A;  1QAB E;  1YUP A;  1SRI A;  1ZNL A;  2FHL A;  2L68 A;  1Y9T A;  2OVS A;  3FA9 A;  5D48 A;  3WJF A;  3T6F A;  2HZR A;  1OEJ A;  3HOE A;  4IB6 A;  3RE5 A;  4XMH A;  2A3F X;  2CBR A;  1SWH A;  4BX6 B;  3RDQ A;  1GX3 A;  2F73 A;  1T0V A;  1HBQ A;  3P6H A;  2I5V O;  3AUM O;  3PQS A;  4RUU A;  4MVL A;  1AEL A;  4EEJ A;  4WFU A;  2POA A;  3H3I A;  4M7M A;  1U18 A;  2A2G A;  2DM5 A;  3D4R A;  4I6S A;  4TQ2 A;  1NQN A;  1B4M A;  3DSZ A;  3KZA A;  3LTW A;  4N7C A;  2A0A A;  4DNE A;  4Y59 A;  1LDQ A;  2HMB A;  3NP1 A;  3FR5 A;  3FEP A;  2Y32 A;  3OBL A;  4GE1 A;  2WWP A;  4O3W A;  4QZU A;  3PP6 A;  2IZK A;  5FQ7 E;  2NNE A;  1KFF A;  1SWG A;  4MEE A;  2OVA A;  3FW5 A;  4QYN A;  3SLT A;  1A3Y A;  5HZQ A;  3JQO A;  3RDS A;  3JS1 A;  2BS6 A;  5KHP A;  2ZAI A;  2JU8 A;  1YWA A;  4O4S A;  1SWR A;  1JYJ A;  2AT0 X;  4ZHH A;  2Y3E A;  3RBY A;  1KQW A;  1QG5 A;  3B2L A;  2LFO A;  1SLE B;  2EU7 X;  1IFB A;  4JNJ A;  4O4X A;  4ZFX A;  2PY1 A;  1FJ1 E;  2OF8 A;  4Y0R A;  2AT5 X;  4KC8 A;  1RSU B;  5K67 A;  4QGV A;  5FQ8 E;  4CDF A;  1A57 A;  1H91 A;  1VWR B;  4YMY A;  1X89 A;  1X8O A;  5FQ6 E;  2RTG B;  3ZW0 A;  1DZJ A;  4MVK A;  1QFT A;  3NBX X;  2RTJ A;  5JD2 A;  1IKJ A;  4U3Q A;  3RY1 A;  5AJC A;  3EM0 A;  1JJU A;  1JIW I;  2QOS C;  4CDD A;  2JGS A;  1EII A;  3FIQ A;  4IAB A;  4OMX A;  4XMD A;  4ES7 A;  1KZW A;  4N7D A;  2AT8 X;  2GTL O;  3GAQ A;  3SOT A;  4GNY A;  1DZM A;  3VE2 A;  5HBS A;  1GKA A;  3VGW A;  1FEM A;  1LF7 A;  1ACD A;  2RTM A;  1SWQ A;  1LPJ A;  2FKG A;  1SLD B;  3ELZ A;  3I17 A;  3S60 A;  2KW1 A;  2RTC B;  2RTI B;  2ZSC A;  1SWP A;  4AZR A;  3P24 A;  1B8E A;  5L8N A;  3P6E A;  2FS6 A;  3FEK A;  4LZV A;  1O8V A;  2BLG A;  3STM X;  4EFG A;  5D4A A;  3VHM A;  4BQU A;  1PMP A;  2L67 A;  3CMP A;  3LHN A;  4IMN A;  2LB6 A;  4QAE A;  4AYH A;  1O1V A;  4QZT A;  3TGA A;  3EW2 A;  1RAV A;  2WR6 A;  3EBW A;  2HLV A;  5BVT A;  1G7N A;  5CYB A;  1X8P A;  1IFC A;  1TXL A;  3BS2 A;  4ZHD A;  1KZX A;  1I04 A;  2L9C A;  1HMR A;  1LFO A;  4O3Y A;  4BX5 A;  1HMT A;  1QY0 A;  2FWV A;  4UU3 A;  1G85 A;  2XST A;  3P6F A;  4HPA A;  3TZS A;  1HBP A;  2KTD A;  4OS3 A;  4CV7 A;  2MWH A;  2VFC A;  4Y0P A;  3VPJ E;  1SLF B;  1LCZ A;  3RDX A;  1ZRY A;  4ORR A;  3HWF A;  4GGT A;  3RSW A;  1VPR A;  4BX7 A;  3ZW0 B;  1S2P A;  3FW4 A;  5FFH A;  4C5P A;  1SRH A;  1SMP I;  1JJJ A;  4L3R A;  2IZH B;  4XME A;  2LKK A;  3APX A;  1SWL A;  2QM9 A;  1AB0 A;  3WZO A;  5HZ5 A;  2A5C A;  1DC9 A;  1S44 A;  1SRE A;  2QCB A;  1VWF B;  3TGC A;  2M4L A;  4DQ3 A;  4OMW A; 
#chains in the Genus database with same CATH homology
 4IAX A;  1EI5 A;  3CWK A;  5KID A;  1GKA B;  3HWE A;  4YKO A;  1TOW A;  1ADL A;  3VG5 A;  1BLR A;  4ZH6 A;  4RUN A;  1GT4 A;  1FTP A;  1OBU A;  4NP1 A;  4CK4 A;  1KT7 A;  1D2U A;  3HWD A;  4ML7 B;  4YH0 A;  2AMM X;  1O1U A;  3NX2 A;  2N93 A;  4YFR A;  4QQ1 A;  1LIE A;  3AKN A;  4GH7 A;  1KOI A;  2ZAG A;  2AT3 X;  5HA1 A;  2W2A A;  1UZ2 X;  1A18 A;  3PH5 A;  5H9L A;  4ORY A;  3VG7 A;  5L8O A;  5FEN A;  3C78 X;  1EXS A;  3ZWE A;  4ZHC A;  3P6C A;  1X8Q A;  3P02 A;  3P6D A;  3CQR A;  1SY1 A;  5LJH A;  1PBO A;  1QY2 A;  1E00 A;  1KT6 A;  4GRJ A;  2GTL N;  1GGL A;  3ZI8 A;  1SY2 A;  2OVD A;  4OS0 A;  2GJ5 A;  1R0U A;  2NND A;  1XCA A;  1DFV A;  1XKI A;  3PH6 A;  3L4R A;  5LJB A;  2R56 A;  2ASN X;  2Q4N A;  3WXQ A;  4JGL A;  4O9S A;  3WVM A;  4GKC A;  1FEN A;  2QO5 A;  4O4O A;  5KIC A;  5LJK A;  2L5P A;  1MVG A;  4HFO A;  5EDB A;  3HTY A;  1TOU A;  3UAQ A;  4A8Z A;  5HCD C;  2BS5 A;  2MHD A;  3EMM A;  5HA0 A;  4KII A;  1VYG A;  3BU1 A;  2YG2 A;  1E06 A;  4IAW A;  5EDC A;  2OVE A;  3STK A;  3BU9 A;  1YWC A;  1ZNH A;  2FT9 A;  4YGH A;  1KXO A;  4R0B A;  1YWD A;  2JU3 A;  3B2K A;  5AEO A;  5F58 A;  4GU8 A;  5BVS A;  1BRP A;  1ZNE A;  4YCE A;  2RA6 A;  2OFM X;  4TJZ A;  4L1N A;  1YIV A;  2K62 A;  4ZH9 A;  3ZW1 B;  3WOV A;  2ALL X;  3NAD A;  4FBV A;  2O62 A;  3U9P C;  4GK9 A;  2HNX A;  2HZQ A;  2BT9 A;  3OE3 A;  4QYP A;  1TW4 A;  1YP7 A;  1OBP A;  4U8U M;  2FTB A;  3NQK A;  1OPA A;  1SXU A;  3OD9 A;  1FEL A;  2JU7 A;  1EPB A;  1ML7 A;  1MDC A;  5IO5 A;  2CZU A;  2NNQ A;  4MIS A;  3BSZ E;  5HZ6 A;  3B2I A;  4COT A;  4XMC A;  4PSQ A;  1NP4 A;  2AL0 X;  1MX7 A;  3FA7 A;  4HPD A;  1SXW A;  1IKE A;  4CSB A;  2WQA E;  2X8T A;  1LIF A;  4ORU A;  4GZV A;  1DF3 A;  3FR2 A;  4FBO A;  3KFH A;  5DPQ A;  3KQ0 A;  4EDE A;  3NR3 A;  4LQZ A;  3FEN A;  2F09 A;  1BEB A;  2CM9 A;  3QKG A;  4XMF A;  1Y9L A;  2ACP X;  3MX7 A;  1JYD A;  4YFQ A;  3KFF A;  2WEW A;  3F9D A;  5HTE A;  3RWX A;  3CR6 A;  4D6B A;  5LJE A;  5C0N A;  1KT5 A;  2QO6 A;  4U9C A;  1KQX A;  4LKP A;  1QFV A;  1QWD A;  3CQN A;  3ZUI A;  4I3C A;  3WJE A;  1RLB E;  3Q6L A;  4ARH A;  2LA7 A;  1BSQ A;  5B29 A;  2W2B A;  1VYF A;  2CBS A;  2FR2 A;  4BVM A;  1AVG I;  1GT3 A;  2JOZ A;  3BX8 A;  3ELX A;  4KH8 A;  1JV4 A;  2P8G A;  1EUO A;  4ODD A;  3D97 A;  3RZY A;  2G7B A;  3WBG A;  1NGL A;  1YP6 A;  1B56 A;  3D96 A;  1QY1 A;  3APW A;  3EYC A;  1JBH A;  1LIC A;  3V8U A;  4BOE A;  2K23 A;  2G79 A;  2KT4 B;  5HWZ A;  3MBT A;  3N91 A;  4Y0Q A;  3VE1 A;  3BY0 A;  2FRS A;  3STN A;  1OEK A;  3UEV A;  2ACO A;  2R74 A;  3NQ9 A;  4TKB A;  1LIB A;  4GDZ A;  4WFV A;  3VG2 A;  1BWY A;  1X8U A;  5LKE A;  4ALB A;  2WQ9 A;  3S26 A;  3WJB A;  1T8V A;  1MX8 A;  1OBQ A;  3MVF A;  1T68 X;  1U17 A;  3FA6 A;  3K3L A;  5EED A;  2CZT A;  4AZM A;  1E02 A;  1EQD A;  2X8F A;  4ON1 A;  3AKM A;  1EW3 A;  4KT5 A;  4OS8 A;  4ZCB A;  1OEE A;  4QGW A;  5F1E A;  4A1Y A;  4IB7 A;  5D47 A;  4FBR A;  3APV A;  5F7G A;  4TKJ A;  3I0A A;  1GM6 A;  3PQU A;  3RKG A;  3BX7 A;  5IO7 A;  4I9S A;  1KT3 A;  2X46 A;  3FMZ A;  2RQ0 A;  1FE3 A;  5H8T A;  1GXA A;  1SXX A;  2Q2M A;  2HYS A;  1E5P A;  4YDB A;  1LID A;  3NX1 A;  1QQS A;  1JJX A;  5EEE A;  4M6S A;  5JR8 A;  1AQB A;  4NLJ A;  4ZHF A;  1ICN A;  4EQA C;  1RBP A;  3LV4 A;  3VG6 A;  4XMG A;  1EIO A;  1SY0 A;  4AW8 A;  2AKQ A;  3ZUO A;  1S7D A;  3DTQ A;  1GX9 A;  3HWG A;  2AT6 X;  3BDR A;  5AJB A;  4TLJ A;  3NQ3 A;  2FS7 A;  4ZR2 A;  1G74 A;  4ID2 A;  1IW2 A;  2FLJ A;  3C77 X;  3P6G A;  4YFP A;  1I4U A;  4YCH A;  1CBI A;  2RD7 C;  2R73 A;  1A2D A;  4LZU A;  4KCA A;  3SAO A;  3U03 A;  2KD2 A;  3FYF A;  5BYP A;  2Z4I A;  5HZ9 A;  4MIR A;  4IB9 A;  2NP1 A;  2LBV A;  3B2H A;  4NYR A;  1PM1 X;  5K06 A;  4YDA A;  1EPA A;  4NW4 A;  4TNN A;  3PPT A;  1BM5 A;  1L6M A;  4I3D A;  5H9K A;  3C76 X;  1D3S A;  2IFB A;  5B27 A;  3O2Y A;  4YBP A;  3BRN A;  1BRQ A;  4FQB B;  5D45 A;  1CBR A;  4HPC A;  1SXY A;  2QMI A;  3APU A;  4ORX A;  1N0S A;  1GT5 A;  1DZK A;  2QO4 A;  3BLG A;  4MVE A;  4IMO A;  2Q9S A;  2YMS A;  4QRL A;  2JW1 A;  4MVI A;  3ZW2 A;  1GX8 A;  5EPQ A;  4AZO A;  5HZ8 A;  5FAZ A;  4U8U O;  2GTL M;  4UU2 A;  1ICM A;  4GET A;  3S5V A;  2Q2P A;  4NNS A;  1I05 A;  1GT1 A;  2CM4 A;  3WJC A;  3UEU A;  5LKF A;  4YGG A;  5LJC A;  5D8J A;  1ERX A;  4HWM A;  3G7X A;  3D95 A;  1OPB A;  2AH7 X;  4ZJ0 A;  4WBK A;  4D6A A;  1CJ5 A;  2JN3 A;  3FEL A;  3FA8 A;  1DV9 A;  5LJG A;  3NPO A;  1U0X A;  5H9N A;  4I3B A;  3OJY C;  1BSO A;  3JSQ A;  2FR3 A;  1ZND A;  4AZP A;  4ALO A;  2A2U A;  1HQP A;  4TKH A;  4AZN A;  3VU1 A;  1Z24 A;  3B2J A;  1NP1 A;  4EXZ A;  3E3C A;  1IIU A;  4KC7 A;  4O3X B;  5AQ6 A;  5F6Z A;  1X71 A;  4LKT A;  2W2F A;  4IBA A;  4ORW A;  4O4U A;  3KFG A;  3FR4 A;  3HOL A;  1ZNK A;  4I95 A;  4QNI A;  3VG4 A;  2BHV A;  1BSY A;  3ZZV A;  2RCT A;  1URE A;  1SA8 A;  3FLL A;  2A13 A;  3S5X A;  1HMS A;  3HK1 A;  1G5W A;  4AZQ A;  2WSJ A;  1KGL A;  4INN A;  5CE4 A;  5L8I A;  2MM3 A;  3WJG A;  4FGI B;  1MUP A;  2MO5 A;  1ALB A;  1LKE A;  1TVQ A;  1ZNG A;  2GTF X;  3CBC A;  3F8A A;  4IAB A;  4YKM A;  3VG3 A;  2ANS A;  4NYQ A;  5EZ2 A;  3O19 A;  5HAE A;  2RN4 A;  3WJD A;  5BVQ A;  2G78 A;  1DZP A;  4GNW A;  4YGZ A;  4NNT A;  1YWB A;  4DQ4 A;  4ORS A;  2Q39 A;  5HTD A;  1CBS A;  3PED A;  3UEX A;  1BBP A;  1BJ7 A;  4NLI A;  1FDQ A;  4O49 A;  2JMB A;  4HPB A;  4PJ2 A;  3T1D A;  2RCQ A;  3KFI A;  4A1H A;  1LNM A;  2XKL A;  2WUT A;  2LBA A;  5DG4 A;  4Y0S A;  5IO6 A;  4A60 A;  1CBQ A;  1KT4 A;  3IA8 A;  5H9A A;  4QGX A;  4YBU A;  2Z4H A;  4WHI A;  3TGB A;  4K19 A;  2E4J A;  2OZQ A;  4U8U N;  1X8N A;  5LJD A;  4ZGU A;  1SY3 A;  1CRB A;  4I9R A;  4ZGF A;  2MJI A;  2X45 A;  3ZW1 A;  2OFR X;  2X8S A;  1HN2 A;  3EBK A;  1B0O A;  5F6B A;  4IB8 A;  1JZU A;  3CBS A;  3F6Z B;  1I06 A;  1PEE A;  5HCE C;  4ZHG A;  1P6P A;  2KTS A;  3O22 A;  4O3Z A;  3PEC A;  3ZQ3 A;  3UEW A;  1ERB A;  2GC9 A;  3U0D A;  2WEX A;  5HCC C;  3TF6 A;  3IFB A;  3GE2 A;  1EAL A;  1QAB E;  1YUP A;  1ZNL A;  2L68 A;  3FA9 A;  1Y9T A;  2OVS A;  5D48 A;  3WJF A;  2HZR A;  1OEJ A;  3HOE A;  4IB6 A;  4XMH A;  2A3F X;  2CBR A;  2F73 A;  1T0V A;  1HBQ A;  3P6H A;  4RUU A;  3PQS A;  1AEL A;  4MVL A;  4EEJ A;  4WFU A;  2POA A;  3H3I A;  4M7M A;  1U18 A;  2A2G A;  2DM5 A;  3D4R A;  4I6S A;  4TQ2 A;  1B4M A;  3DSZ A;  3KZA A;  4N7C A;  2A0A A;  2HMB A;  3NP1 A;  3FR5 A;  3FEP A;  3OBL A;  4O3W A;  4GE1 A;  2WWP A;  4QZU A;  3PP6 A;  5FQ7 E;  2NNE A;  2OVA A;  3FW5 A;  4QYN A;  1A3Y A;  5HZQ A;  3JQO A;  5KHP A;  3JS1 A;  2BS6 A;  2ZAI A;  2JU8 A;  1YWA A;  4O4S A;  2AT0 X;  1JYJ A;  4ZHH A;  3RBY A;  1KQW A;  1QG5 A;  3B2L A;  2LFO A;  2EU7 X;  1IFB A;  4O4X A;  4ZFX A;  2PY1 A;  4Y0R A;  2AT5 X;  4KC8 A;  4QGV A;  5FQ8 E;  1A57 A;  1H91 A;  4YMY A;  1X89 A;  1X8O A;  5FQ6 E;  3ZW0 A;  1DZJ A;  4MVK A;  1QFT A;  3NBX X;  1IKJ A;  4U3Q A;  5AJC A;  3EM0 A;  1JIW I;  2QOS C;  1EII A;  3FIQ A;  4OMX A;  4ES7 A;  4XMD A;  1KZW A;  4N7D A;  2AT8 X;  2GTL O;  3GAQ A;  3SOT A;  4GNY A;  1DZM A;  3VE2 A;  5HBS A;  1GKA A;  1FEM A;  1LF7 A;  1ACD A;  3I17 A;  3S60 A;  1LPJ A;  5L8N A;  3ELZ A;  4AZR A;  2KW1 A;  3P24 A;  1B8E A;  3P6E A;  2FS6 A;  3FEK A;  4LZV A;  1O8V A;  2BLG A;  3STM X;  4EFG A;  5D4A A;  4BQU A;  1PMP A;  2L67 A;  3CMP A;  3LHN A;  4IMN A;  2LB6 A;  4QAE A;  4AYH A;  1O1V A;  4QZT A;  3TGA A;  2WR6 A;  3EBW A;  2HLV A;  5BVT A;  1G7N A;  5CYB A;  1X8P A;  1IFC A;  1TXL A;  3BS2 A;  4ZHD A;  1KZX A;  1I04 A;  2L9C A;  1HMR A;  1LFO A;  4O3Y A;  1HMT A;  1QY0 A;  2FWV A;  4UU3 A;  1G85 A;  2XST A;  3P6F A;  4HPA A;  3TZS A;  1HBP A;  2KTD A;  4OS3 A;  4CV7 A;  2MWH A;  4Y0P A;  3VPJ E;  1ZRY A;  4ORR A;  3HWF A;  3RSW A;  1VPR A;  3ZW0 B;  1S2P A;  3FW4 A;  5FFH A;  1SMP I;  1JJJ A;  4L3R A;  4XME A;  2LKK A;  3APX A;  5HZ5 A;  2QM9 A;  1AB0 A;  1DC9 A;  1S44 A;  3TGC A;  2M4L A;  4DQ3 A;  4OMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...