4YN0B

Crystal structure of app e2 domain in complex with dr6 crd domain
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
202
structure length
202
Chain Sequence
b'TPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMIS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor receptor superfamily member 21
publication title The crystal structure of DR6 in complex with the amyloid precursor protein provides insight into death receptor activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis/cell adhesion
total genus 92
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2015-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yn0B00
3NYJA 3UMKA 3Q7LA 4RDAA 3UMHA 3K66A 3NYLA 4YN0B 3UMIA 4RD9A 3K6BA 5BUOA 1TKNA 3PMRA 3Q7GA 3QMKA
chains in the Genus database with same CATH superfamily
1IZMA 1V4AA 3S90A 3DJUB 3I5PA 1HE1A 4H54A 1G8XA 1MMAA 4I1OB 4OIRF 1EQ1A 2HFIA 2XL8A 4N06A 3U9MA 1FAPB 1RXQA 1Y4CA 2HUJA 4MS2A 1E84A 1E85A 2R7WA 2KQ9A 2PX3A 1LS4A 1KU2A 3NYMA 2XM0A 3RW0A 3GODA 2CW0F 3GWNA 4CX9A 1IW7F 5KYYA 4L6RA 5COFA 2R7XA 1NU7D 3IPMO 1KNYA 1VLSA 1VYIA 1GGQA 2EIKC 3AG4C 4FWVA 5CI9A 1CGME 1G4WR 4CSAA 5E3CA 3WHNA 2VASA 2XRHA 2LQGA 1E83A 4PACA 5L0HA 2O9XA 3IQ5A 3TJ5A 3IQCA 4G7OF 5L0JA 4BJ6A 2P61A 3EG9A 1J8MF 1APCA 4ULWA 4DRJB 4J7TA 2J45A 3L0IA 3DM5A 3U3FA 1TWAA 3FAJA 3FVYA 3GEIA 3M15A 2UUHA 3V7OA 4OD4A 1OW6A 3KYJA 4PR9A 4C3BA 3WAQA 4PFPA 3I5QA 5BQIA 1I4ZA 1NU9C 4JTDB 2XS1A 2NUPA 4XPXA 4G7ZF 3AQCA 3NYLA 3T6JA 256BA 4IWBA 4I44A 4QI2A 1R5ID 2VC9A 2EPLX 2CCYA 2PFDA 3K33A 3J06A 2PX0A 2YHSA 2EPOA 4O7GA 5COGA 1JR8A 1PD1A 2H8AA 3HJCA 2J8WA 3AG1C 4YK5A 4AE4A 4JCHA 4CJOA 3C63A 5KYXB 4JURI 2L6GA 1YZCA 3HNJA 2H7VC 4ONSA 3SP1A 2M4EA 2R7SA 3B29A 3LEOA 4XQ1A 4HE8D 3ZQVA 1VMAA 1TWCA 1HMOA 1QLEC 2D4UA 4CIPA 4JRZA 1WGWA 3QW1A 4R32A 4YN0B 3S29A 2LSEA 4Q4ZF 3N0TA 2NSFA 2EIMC 2I15A 1JAFA 3W2WA 3AJMA 3JTLO 2W9YA 1NLXA 3MLGA 4BG0A 1FFTC 3B0VC 3WODF 4X0RA 2JPUA 2LK4A 4MVRA 4O79A 4CIHA 4E0IA 3LESA 2X0CA 4PJNA 3U5SA 3UMKA 4MNDA 2ZXPA 2J9WA 3U0CA 2R7VA 5L3VA 3W4YA 2H7BA 2Q00A 3BEHA 3C8ZA 3N24A 1NG1A 1J8YF 3FOPA 5L0CA 3FMSA 4U9DA 3DKAA 1Q0DA 3EPVA 3AGUA 2QNLA 4MVZA 2RD9A 2CNWA 4NTBA 5AGFA 4IGGA 4U9EA 4MVMA 3ITFA 4Z9HA 4MTFA 2IYLD 3TOMA 3KYIA 4G78A 4OIQF 1OCCC 3LS1A 1T6QA 4XEVA 3JYHA 2KSFA 4YL0A 2DB4A 3ZDLA 3UGPA 1YA9A 4XPWA 2R7TA 1AEPA 3DWWA 3L8JA 4GEHA 1JOGA 1D0XA 3H2UA 1OW7A 3DE9A 3EZIA 4JKVA 1D0ZA 4BJ1A 4ANJA 4JEBA 3LLIA 5EGYA 1SYQA 3EHNA 3DJNB 5D92A 2EPNA 2J0XA 5HSWA 1M2VA 1ZU4A 4IRUA 1FMVA 1CPQA 5JRAA 4KBLA 1L7CA 2QUPA 4K0DA 2AU5A 3LAYA 1PD0A 2XXAB 1FR0A 3U2MA 1Z63A 1ST6A 3HTKC 2J9BA 3GM2A 2VCBA 2Z15A 3ABMC 4LLCA 4MTGA 1QPUA 4Q7CA 5AC5A 4E0HA 3MFNA 4P6IC 2XLHA 5KYWB 1HW1A 1FTSA 1JPNA 2HSQA 4PK4A 5JLIA 2IXMA 4CS7A 4D4NA 3H65A 1ZW3A 3BRJA 1SZIA 2M64A 3GWLA 2OQMA 4CS8C 5A6JA 2Y3GA 3EJNA 1SR2A 3HNIA 3HNLA 2HJ3A 1A7EA 2WVQA 3NKDA 1WN0A 3KL4A 4NY3A 1Y6DA 3RYLA 3V5ZA 5COMA 2XM4A 1LE2A 2B0HA 4E17A 2CNWD 3GANA 5KYNA 4BEMJ 1Z3IX 2GAQA 3R7CA 1FFHA 1YJGA 3CAXA 3JRMO 5KYWA 4GYTA 4DJ9A 1LKXA 2AWCA 3PDMP 4G7HF 3GEEA 5A69A 5KYYB 3U2LA 5EK0A 4C3DA 3SXMA 3M1CB 1SF8A 3QW0A 2ZD9A 4CBEA 1E2XA 2L9JA 4NTAA 2Q7RA 4JZAA 1QKRA 4LLEA 4EBJA 3L1MA 4IJJA 4IARA 1R4TA 3TOLA 1PCXA 1RMVA 2YL3A 1E86A 4EHPA 4IAQA 1NSGB 2LD6A 2YRFA 3EG9B 2R7QA 1VYKA 1LPEA 2R02A 4ZLCA 1UFBA 3HNKA 3LJBA 2J46A 3JZ0A 3Q6MA 5EHHA 4Q5SF 4NC3A 1ORJA 2HMQA 2GA0A 3NKEA 2J9VA 2VB6A 1G4US 2Y3DA 1UG7A 3LNMB 5T3TA 4XWJA 4EIYA 4E18A 3Q7LA 1NZEA 1ZU5A 3O6XA 4IAOA 1MMNA 4RDAA 3UMHA 3W8HA 1XWJA 1BDJB 4RD9A 2CGEA 4OD5A 1HE9A 5DS5A 2Y39A 3DZAA 1KTMA 2NUPB 2F22A 2KC3A 1M2OA 5A6AA 2A69F 4GQHA 5CIVA 3LEVA 2LIGA 4QI0A 3DAGA 1ZZPA 4XTKA 2XL6A 2GFHA 2ICWG 2YL1A 3L8IA 4PJLA 2L81A 2Y69C 4DOZA 4AE4B 3UGOA 3S28A 3OWTA 1ZHWA 4MW3A 4FAPB 3LNRA 3O55A 5IY5C 3S84A 4DVYP 3SXYA 3T6GB 4EBBA 1EI7A 3DMDA 3AQBA 2H7OA 2LFDA 2OCCC 3HKKA 4DBQA 3TQOA 3C8GA 5JVEA 1RKEB 4CSAC 1RKCA 2C03A 4CDAA 1QSPA 2XLDA 4XEFA 2WL8A 3CSKA 2AVKA 3FHDA 3Q6NA 3RQEA 3W2VA 4O6MA 2JX0A 3FXHA 1Z7Qc 1H6GA 1OXBA 2NSGA 2ASRA 3ASNC 1MNEA 4YWQA 5BUOA 4CDYA 2V3CC 2EPMX 1CGNA 4G0HA 1T6UA 5KYUA 4AK9A 2J9UA 3DI5A 3EQLF 2DYSC 2LCHA 3ZG1A 3NRHA 2IXNA 3NMKA 4HEAJ 1RKEA 2YEVA 3ZSUA 5L3QA 4FESA 4JIOA 1A41A 4LACB 2Q9BA 3C18A 5BQGA 1TWGA 3QZCA 1Z6AA 3ZQYA 2OU6A 1D1BA 3VF0A 2WVOA 3AGTA 3PHF2 3FOOA 1L3PA 1S7ZA 3SXKA 1LS1A 2QE9A 1WWPA 4E7SA 1BZ4A 2Y3HA 4IB4A 4BJ5C 5DQTA 4EBKA 1YLMA 5F28E 3H2VA 1BR4A 1W2WA 2L6HA 3AG2C 3JSZA 1U89A 1ORSC 2EIJC 4LDQA 3RIPA 4OINF 3SEOA 1WATA 3ABKC 1ZVZA 4D4XA 3U3BA 4WABA 3RH3A 3B71A 4JC7A 1T01A 5JSLA 1CGOA 1MNDA 1U0BB 2A1DD 1M2VB 3HLZA 3C8GD 3K1IC 2NPUA 3TD7A 1Q0GA 2HMZA 5F5FA 2W45A 3SXZA 3RQFA 1DOVA 5K0IA 3VAYA 3ZVRA 2NG1A 1M6TA 1O5HA 2YQYA 3DD7A 4MVUA 2FAPB 4MQ9F 3IQ6A 4WGYA 5A6KA 3NYJA 4NTFA 1XZPA 4JTCB 1D1AA 1QZXA 2IBFA 4AL1A 1K04A 1PV3A 4U5HA 2EPKX 3LS0A 1ZW2A 2MYSA 2OG2A 3FAPB 4YT5A 3KPHA 2VCAA 1U6HA 4A4AA 3ZWIA 3VM6A 3I4UA 4EUKB 4YT2A 2MWQA 4JCZA 3CQZA 1VB5A 2EILC 5JUAA 5A6BD 3U9JA 4CS9C 5DLJA 2OJQA 1CPRA 3EHMA 3B0UX 1Q0FA 2J7PA 4P9TA 2IOQA 2LFFA 1YDIA 2KGOA 4MVQA 4UDVA 4YL3A 4JE9A 2TMVP 4DBRA 2XSEA 2HV7A 1YA7O 4YJWA 1B68A 4EWCA 1ORYA 1S05A 3EH2A 2R05A 3IHUA 4BEJA 2R7OA 1V55C 1TKNA 3MYIA 3JRTA 3U8VA 5E2QA 1Z23A 2KK1A 3ATPA 3DE8A 4MTOA 2G3KA 5T1DB 1GM5A 4C7OA 1JRAA 4U5GA 3RVZA 3UMIA 1Q0MA 2WVNA 3O10A 5TJ5E 1RJ9B 4J32B 4JTAB 4EKWA 3EGXB 1HW2A 2PBEA 2R7UA 3IEEA 1VTMP 1I5NA 4JVSA 2DGJA 1M57C 2PP4A 1FNTc 4BJ6C 1G5ZA 4O6NA 2OOCA 2YKZA 1TFOB 3G4ZA 5L0FA 4OIOF 2X51A 2OKUA 2YLDA 4I3MA 1BR1A 1QVXA 1RJ9A 3ECSA 2P7VA 3DXJF 3EGXA 1LE4A 4KNWA 1ZHYA 3ZC4A 2DI3A 2GWWA 3PMRA 2NUTA 4W8KA 2V26A 3QVYA 3GORA 5B3IA 3C7JA 3UR3C 2ZPAA 2A0BA 1H9GA 4LDKA 2J7PD 3GM1A 2Q9AA 3MYFA 3O39A 3JCUQ 3L34A 4XEKA 5CI8A 1SMYF 4XLPF 4KI2A 3T6BA 3VYWA 1LIHA 2IM8A 1T9KA 2QY9A 3AG3C 3WG7C 3TULA 2Q4FA 1YYJA 1H7IA 1M56C 3MBGA 1RCPA 2VH3A 1K40A 2CDQA 2L7AA 3EGDB 2E87A 2RSEB 2AP3A 4WGZA 3C8GB 3MX3A 3U8PA 5DQZA 5L0GA 1NBBA 2HSBA 2BC5A 3N2ZB 5BQHA 1A7DA 2G3VA 3F47A 3CEXA 3EH1A 4I1MA 4MVOA 4P9FA 2R03A 4U5CE 4CS8A 3JSEO 3K6BA 4JJFA 4M63A 3JT1A 1VOMA 1MMDA 3G4XA 1EA8A 5L0IA 2W4BA 4K1OA 4LERA 5KYUB 3AOUA 3EGDA 3PCVA 1T6IA 2DYRC 1OCRC 3S9OA 3TJ6A 3NDBB 2L6FA 3ZTMA 3KH2A 3EZHA 5L0DA 2BL2A 2YLGA 1FMWA 1AUEA 2GDCA 3X1OA 4ZLDA 2R9RB 2XLEA 4O6YA 2A6HF 3V5YA 1HY5A 1XZQA 4U5FE 5JS5A 1O87A 4BJ5A 3K66A 3ZTZA 2ETSA 1YYXA 2J0WA 1JMWA 3POVA 1OKKA 1V54C 3LLKA 4HFFB 4KNVA 1GQAA 4PJJA 2A68F 3QVZA 3C62A 2KW3C 3ASOC 3KKBA 3OEOA 3SNHA 5A6BA 2MHRA 3K7DA 1VLTA 4E7ZA 4DRIB 1A0BA 4U5DE 2KNHA 2IXOA 3E9VA 3GEHA 2QTVA 2Y3BA 4CS9A 3S0XA 1NFOA 2HKVA 1YZAA 2WZFA 1YARO 3QMKA 1OR2A 4AX2A 4QDLA 4W8PA 2ZXOA 1BR2A 1QQ3A 3KMIA 3NG1A 2W4MA 1C03A 4DRHB 3Q7GA 3V5XA 1OR3A 2WB7A 4JEAA 3NMJA 2XLMA 3RF3A 2CYDA 4AL0A 2YLIA 1OCOC 1JPJA 4YT4A 4OIPF 2JD3A 3VRCA 1T5OA 2WZGA 2P0NA 2PF4E 3US6A 1ZHXA 3M4CA 1ZYRF 1TFKB 2P6VA 4NQFA 3LUTB 3NMIA 4J7YA 4FX5A 2Q3TA 5B3SC 2D5RB 2R7RA 1LI7A 5E3AA 3R2PA 2IXPA 1ZHZA 4K7BA 4H4KC 5GPGB 1YVIA 2B0JA 3EFOB 5F5HA 3SZRA 4YT8A 4MVSA 5KYXA 5E33A 3B0PA 4Z9IA 5AC4A 1OKKD 2FFHA 2ZXRA 2XL4A 3K1HA 4CDVA 5JT4A 3E70C 5DS4A 1A7VA 1OW8A 5T3WA 1C02A 1Z5ZA 2QLAA 4J30B 1LVKA 3OA1A 1N1CA 1WTYA 1MMGA 4C7OB 3A11A 1OXKA 2G62A 3B9QA 1VK5A 3M4BA 4NCQA 1D1CA 4RBNA 2YZSA 4XLNF 3EFOA 2OJED 1F1MA 2PNOA 1MQVA 5FZTA 4KC9A 3G50A 1V74B 2C04A 2R25A 4DXWA 4LDRA 4A2NB 1EKYA 4MW8A 1OCZC 3GM3A 4JJGA 3CZ6A 4WJ0A 3SYNA 2XS8A 3X2QC 2OEXA 2A6EF 2I8BA 2LP4A 1NFNA 2VCCA 2YVKA 5D91A 4XPYA 2FGYA 3S27A 4JW1A 1TR2A 1WOLA 2YWAA 4U5BE 5B1BC 5JP7A 4BJTA 4BPMA 5HV9A 3M79A 2EINC 3DAFA 3RFYA 5DVWA 1O3UA 5DS6A 2NUTB 1WASA 4ULVA 4Z9JA 1BBHA 1LM3B 1OQCA 4N6HA 1AVOB 2XLWA 1H9TA 1LI5A 3T9OA 1GS9A 1Q0KA 3ABLC 4N6CA 5FCLA 2KYHA 1I4YA 3W8IA 3K1IA 1DOWA 3F46A 4F4BA 1TQGA 2OEVA 4CJGA 2HV6A 3QTHA 1HMDA 4HFKB 2BE5F 1D0YA 3UNGC 3RVYA 4B6IA 2HJMA 1C17M 4PFOA 3A9CA 4YL1A 2XXAA 2YL7A 2HS5A 3T4RA 3FDQA 1K05A 2A0UA 4DVZA 2Q9CA 2UUIA 1TWHA 2P1AA 2XLOA 4PJMA 3ZIBA 2HZ8A 3JYYA 4ER9A 4C3EA 4N4WA 3DM9B 4U5EE 5B1AC 3TK0A 3RKOF 2XLVA 2WZLA 3IQTA 2YL0A 3RQGA 2AWYA 2KJGA 1ZHTA 1YAUO 2ZXWC
chains in the Genus database with same CATH topology
1IZMA 3DJUB 3I5PA 4I1OB 4OIRF 1G8XA 1MMAA 4N06A 2R7WA 2KQ9A 2PX3A 1KU2A 3NYMA 3GODA 2CW0F 1IW7F 5KYYA 2R7XA 1NU7D 4FWVA 1VYIA 2EIKC 3AG4C 5CI9A 4CSAA 5E3CA 2VASA 2XRHA 2O9XA 4G7OF 4BJ6A 3EG9A 1J8MF 4ULWA 2J45A 3L0IA 3DM5A 1TWAA 3FAJA 3FVYA 3V7OA 4OD4A 4C3BA 4PFPA 3I5QA 1NU9C 2NUPA 4G7ZF 3AQCA 3NYLA 3T6JA 4IWBA 4I44A 4QI2A 3K33A 2PFDA 2PX0A 2YHSA 4O7GA 1PD1A 3HJCA 3AG1C 4AE4A 4JCHA 5KYXB 4JURI 2H7VC 3SP1A 2M4EA 2R7SA 4HE8D 1VMAA 1TWCA 1QLEC 1WGWA 4YN0B 3S29A 2LSEA 4Q4ZF 3N0TA 2EIMC 3W2WA 2W9YA 3MLGA 1FFTC 3B0VC 3WODF 4X0RA 4O79A 4CIHA 3LESA 4PJNA 3UMKA 4MNDA 2ZXPA 2J9WA 2R7VA 5L3VA 2H7BA 3N24A 1NG1A 1J8YF 3EPVA 2CNWA 3ITFA 2IYLD 4OIQF 1OCCC 3LS1A 3UGPA 3JYHA 2R7TA 4GEHA 1D0XA 3EZIA 1D0ZA 4BJ1A 4ANJA 3LLIA 5EGYA 3EHNA 3DJNB 5D92A 5HSWA 2J0XA 1M2VA 1ZU4A 4IRUA 1FMVA 4KBLA 4K0DA 3LAYA 1PD0A 2XXAB 1Z63A 1ST6A 3HTKC 2Z15A 3ABMC 4LLCA 4Q7CA 4P6IC 5KYWB 1FTSA 1JPNA 4PK4A 2IXMA 4CS7A 3H65A 1SZIA 4CS8C 2Y3GA 3EJNA 5DQTA 3NKDA 2WVQA 4NY3A 3KL4A 3RYLA 2CNWD 3GANA 5KYNA 1Z3IX 4CSAC 1FFHA 5KYWA 4GYTA 1LKXA 4G7HF 5KYYB 4C3DA 3M1CB 1SF8A 4CBEA 2L9JA 4JZAA 4LLEA 4IJJA 1PCXA 3EG9B 2R7QA 1VYKA 4ZLCA 3LJBA 2J46A 5EHHA 3Q6MA 4Q5SF 3NKEA 2J9VA 2VB6A 5T3TA 2Y3DA 4XWJA 3Q7LA 1NZEA 1ZU5A 3O6XA 4IAOA 1MMNA 4RDAA 3UMHA 3W8HA 4RD9A 2CGEA 4OD5A 5DS5A 2Y39A 3DZAA 2NUPB 1M2OA 2A69F 3LEVA 4QI0A 3DAGA 4XTKA 4PJLA 2GFHA 2L81A 2Y69C 4DOZA 4AE4B 3UGOA 3OWTA 1ZHWA 5IY5C 3LNRA 4DVYP 4EBBA 3DMDA 3AQBA 2H7OA 2OCCC 4DBQA 2C03A 2WL8A 3CSKA 3FHDA 3Q6NA 3W2VA 4O6MA 5BUOA 2V3CC 3ASNC 4YWQA 1MNEA 4G0HA 5KYUA 4AK9A 2J9UA 3EQLF 2DYSC 3ZG1A 3NRHA 2IXNA 4HEAJ 2YEVA 3ZSUA 5L3QA 4FESA 4LACB 2Q9BA 1TWGA 3QZCA 1Z6AA 1D1BA 2WVOA 1S7ZA 1LS1A 4E7SA 2Y3HA 4BJ5C 1BR4A 1W2WA 3AG2C 3JSZA 3RIPA 2EIJC 4OINF 3SEOA 3ABKC 3RH3A 1MNDA 2A1DD 1M2VB 3HLZA 3K1IC 3TD7A 5F5FA 2W45A 3VAYA 3ZVRA 2NG1A 3DD7A 1O5HA 4MQ9F 3NYJA 1D1AA 1QZXA 4U5HA 4YT5A 3LS0A 2OG2A 2MYSA 3I4UA 4YT2A 2MWQA 3CQZA 2EILC 4CS9C 5DLJA 3EHMA 3B0UX 2J7PA 2IOQA 2KGOA 4DBRA 2XSEA 2HV7A 4YJWA 4EWCA 3EH2A 4BEJA 2R7OA 1V55C 1TKNA 3JRTA 5E2QA 1Z23A 2G3KA 5T1DB 4C7OA 3UMIA 4U5GA 2WVNA 1RJ9B 4J32B 3EGXB 2R7UA 3IEEA 4JVSA 2DGJA 1M57C 2PP4A 4BJ6C 4O6NA 4OIOF 2X51A 4I3MA 1BR1A 1RJ9A 3ECSA 2P7VA 3DXJF 3EGXA 4KNWA 3ZC4A 1ZHYA 3PMRA 2NUTA 4W8KA 2V26A 3UR3C 2ZPAA 2J7PD 2Q9AA 3O39A 3JCUQ 3L34A 5CI8A 4KI2A 1SMYF 4XLPF 3T6BA 3VYWA 3WG7C 3AG3C 2QY9A 1M56C 2VH3A 3EGDB 2CDQA 2E87A 3MX3A 5DQZA 3N2ZB 2G3VA 4CS8A 3F47A 3EH1A 4I1MA 4U5CE 3K6BA 4JJFA 4M63A 3JT1A 1VOMA 1MMDA 2W4BA 4LERA 5KYUB 3EGDA 2DYRC 1OCRC 3NDBB 3KH2A 3EZHA 1FMWA 3X1OA 4ZLDA 4O6YA 2A6HF 4U5FE 1O87A 3K66A 2J0WA 3POVA 1OKKA 1V54C 3LLKA 4HFFB 4KNVA 4PJJA 2A68F 2KW3C 3ASOC 3KKBA 3OEOA 3SNHA 3K7DA 4E7ZA 4U5DE 2KNHA 2IXOA 3E9VA 3S0XA 2QTVA 2Y3BA 4CS9A 2WZFA 3QMKA 4AX2A 4QDLA 4YT8A 2ZXOA 1BR2A 3NG1A 3KMIA 2W4MA 3Q7GA 2WB7A 1OCOC 1JPJA 4YT4A 4OIPF 2JD3A 2WZGA 2PF4E 1ZHXA 1ZYRF 2P6VA 5B3SC 4FX5A 2Q3TA 2D5RB 2R7RA 5E3AA 2IXPA 1ZHZA 4K7BA 4H4KC 2B0JA 3EFOB 5F5HA 3SZRA 5KYXA 5E33A 3B0PA 1OKKD 2FFHA 2ZXRA 2XL4A 3K1HA 3E70C 5DS4A 3S28A 5T3WA 4BG0A 1Z5ZA 4J30B 1LVKA 3OA1A 1N1CA 1MMGA 4C7OB 3B9QA 2G62A 1VK5A 1D1CA 4RBNA 2YZSA 4XLNF 3EFOA 4KC9A 2C04A 4A2NB 1OCZC 4JJGA 3CZ6A 4WJ0A 3SYNA 3X2QC 2A6EF 2I8BA 5D91A 4BJ5A 3PHF2 2FGYA 3S27A 4JW1A 1TR2A 4U5BE 5B1BC 4BJTA 2EINC 3DAFA 3RFYA 5DVWA 5DS6A 2NUTB 5FCLA 3ABLC 3W8IA 4F4BA 3F46A 2HV6A 4HFKB 2BE5F 1D0YA 3UNGC 4B6IA 4PFOA 2XXAA 3T4RA 3FDQA 4DVZA 2Q9CA 1TWHA 4PJMA 3ZIBA 4C3EA 3DM9B 4U5EE 5B1AC 3RKOF 2WZLA 2KJGA 1ZHTA 2ZXWC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3NYJ A;  3UMK A;  3Q7L A;  4RDA A;  3UMH A;  3K66 A;  3NYL A;  4YN0 B;  3UMI A;  4RD9 A;  3K6B A;  5BUO A;  1TKN A;  3PMR A;  3Q7G A;  3QMK A; 
#chains in the Genus database with same CATH topology
 1IZM A;  1V4A A;  3S90 A;  3DJU B;  3I5P A;  1HE1 A;  4H54 A;  1G8X A;  1MMA A;  4I1O B;  4OIR F;  1EQ1 A;  2HFI A;  2XL8 A;  4N06 A;  3U9M A;  1FAP B;  1RXQ A;  1Y4C A;  2HUJ A;  4MS2 A;  1E84 A;  1E85 A;  2R7W A;  2KQ9 A;  2PX3 A;  1LS4 A;  1KU2 A;  3NYM A;  2XM0 A;  3RW0 A;  3GOD A;  2CW0 F;  3GWN A;  4CX9 A;  1IW7 F;  5KYY A;  4L6R A;  5COF A;  2R7X A;  1NU7 D;  3IPM O;  1KNY A;  1VLS A;  1VYI A;  1GGQ A;  2EIK C;  3AG4 C;  4FWV A;  5CI9 A;  1CGM E;  1G4W R;  4CSA A;  5E3C A;  3WHN A;  2VAS A;  2XRH A;  2LQG A;  1E83 A;  4PAC A;  5L0H A;  2O9X A;  3IQ5 A;  3TJ5 A;  3IQC A;  4G7O F;  5L0J A;  4BJ6 A;  2P61 A;  3EG9 A;  1J8M F;  1APC A;  4ULW A;  4DRJ B;  4J7T A;  2J45 A;  3L0I A;  3DM5 A;  3U3F A;  1TWA A;  3FAJ A;  3FVY A;  3GEI A;  3M15 A;  2UUH A;  3V7O A;  4OD4 A;  1OW6 A;  3KYJ A;  4PR9 A;  4C3B A;  3WAQ A;  4PFP A;  3I5Q A;  5BQI A;  1I4Z A;  1NU9 C;  4JTD B;  2XS1 A;  2NUP A;  4XPX A;  4G7Z F;  3AQC A;  3NYL A;  3T6J A;  256B A;  4IWB A;  4I44 A;  4QI2 A;  1R5I D;  2VC9 A;  2EPL X;  2CCY A;  2PFD A;  3K33 A;  3J06 A;  2PX0 A;  2YHS A;  2EPO A;  4O7G A;  5COG A;  1JR8 A;  1PD1 A;  2H8A A;  3HJC A;  2J8W A;  3AG1 C;  4YK5 A;  4AE4 A;  4JCH A;  4CJO A;  3C63 A;  5KYX B;  4JUR I;  2L6G A;  1YZC A;  3HNJ A;  2H7V C;  4ONS A;  3SP1 A;  2M4E A;  2R7S A;  3B29 A;  3LEO A;  4XQ1 A;  4HE8 D;  3ZQV A;  1VMA A;  1TWC A;  1HMO A;  1QLE C;  2D4U A;  4CIP A;  4JRZ A;  1WGW A;  3QW1 A;  4R32 A;  4YN0 B;  3S29 A;  2LSE A;  4Q4Z F;  3N0T A;  2NSF A;  2EIM C;  2I15 A;  1JAF A;  3W2W A;  3AJM A;  3JTL O;  2W9Y A;  1NLX A;  3MLG A;  4BG0 A;  1FFT C;  3B0V C;  3WOD F;  4X0R A;  2JPU A;  2LK4 A;  4MVR A;  4O79 A;  4CIH A;  4E0I A;  3LES A;  2X0C A;  4PJN A;  3U5S A;  3UMK A;  4MND A;  2ZXP A;  2J9W A;  3U0C A;  2R7V A;  5L3V A;  3W4Y A;  2H7B A;  2Q00 A;  3BEH A;  3C8Z A;  3N24 A;  1NG1 A;  1J8Y F;  3FOP A;  5L0C A;  3FMS A;  4U9D A;  3DKA A;  1Q0D A;  3EPV A;  3AGU A;  2QNL A;  4MVZ A;  2RD9 A;  2CNW A;  4NTB A;  5AGF A;  4IGG A;  4U9E A;  4MVM A;  3ITF A;  4Z9H A;  4MTF A;  2IYL D;  3TOM A;  3KYI A;  4G78 A;  4OIQ F;  1OCC C;  3LS1 A;  1T6Q A;  4XEV A;  3JYH A;  2KSF A;  4YL0 A;  2DB4 A;  3ZDL A;  3UGP A;  1YA9 A;  4XPW A;  2R7T A;  1AEP A;  3DWW A;  3L8J A;  4GEH A;  1JOG A;  1D0X A;  3H2U A;  1OW7 A;  3DE9 A;  3EZI A;  4JKV A;  1D0Z A;  4BJ1 A;  4ANJ A;  4JEB A;  3LLI A;  5EGY A;  1SYQ A;  3EHN A;  3DJN B;  5D92 A;  2EPN A;  2J0X A;  5HSW A;  1M2V A;  1ZU4 A;  4IRU A;  1FMV A;  1CPQ A;  5JRA A;  4KBL A;  1L7C A;  2QUP A;  4K0D A;  2AU5 A;  3LAY A;  1PD0 A;  2XXA B;  1FR0 A;  3U2M A;  1Z63 A;  1ST6 A;  3HTK C;  2J9B A;  3GM2 A;  2VCB A;  2Z15 A;  3ABM C;  4LLC A;  4MTG A;  1QPU A;  4Q7C A;  5AC5 A;  4E0H A;  3MFN A;  4P6I C;  2XLH A;  5KYW B;  1HW1 A;  1FTS A;  1JPN A;  2HSQ A;  4PK4 A;  5JLI A;  2IXM A;  4CS7 A;  4D4N A;  3H65 A;  1ZW3 A;  3BRJ A;  1SZI A;  2M64 A;  3GWL A;  2OQM A;  4CS8 C;  5A6J A;  2Y3G A;  3EJN A;  1SR2 A;  3HNI A;  3HNL A;  2HJ3 A;  1A7E A;  2WVQ A;  3NKD A;  1WN0 A;  3KL4 A;  4NY3 A;  1Y6D A;  3RYL A;  3V5Z A;  5COM A;  2XM4 A;  1LE2 A;  2B0H A;  4E17 A;  2CNW D;  3GAN A;  5KYN A;  4BEM J;  1Z3I X;  2GAQ A;  3R7C A;  1FFH A;  1YJG A;  3CAX A;  3JRM O;  5KYW A;  4GYT A;  4DJ9 A;  1LKX A;  2AWC A;  3PDM P;  4G7H F;  3GEE A;  5A69 A;  5KYY B;  3U2L A;  5EK0 A;  4C3D A;  3SXM A;  3M1C B;  1SF8 A;  3QW0 A;  2ZD9 A;  4CBE A;  1E2X A;  2L9J A;  4NTA A;  2Q7R A;  4JZA A;  1QKR A;  4LLE A;  4EBJ A;  3L1M A;  4IJJ A;  4IAR A;  1R4T A;  3TOL A;  1PCX A;  1RMV A;  2YL3 A;  1E86 A;  4EHP A;  4IAQ A;  1NSG B;  2LD6 A;  2YRF A;  3EG9 B;  2R7Q A;  1VYK A;  1LPE A;  2R02 A;  4ZLC A;  1UFB A;  3HNK A;  3LJB A;  2J46 A;  3JZ0 A;  3Q6M A;  5EHH A;  4Q5S F;  4NC3 A;  1ORJ A;  2HMQ A;  2GA0 A;  3NKE A;  2J9V A;  2VB6 A;  1G4U S;  2Y3D A;  1UG7 A;  3LNM B;  5T3T A;  4XWJ A;  4EIY A;  4E18 A;  3Q7L A;  1NZE A;  1ZU5 A;  3O6X A;  4IAO A;  1MMN A;  4RDA A;  3UMH A;  3W8H A;  1XWJ A;  1BDJ B;  4RD9 A;  2CGE A;  4OD5 A;  1HE9 A;  5DS5 A;  2Y39 A;  3DZA A;  1KTM A;  2NUP B;  2F22 A;  2KC3 A;  1M2O A;  5A6A A;  2A69 F;  4GQH A;  5CIV A;  3LEV A;  2LIG A;  4QI0 A;  3DAG A;  1ZZP A;  4XTK A;  2XL6 A;  2GFH A;  2ICW G;  2YL1 A;  3L8I A;  4PJL A;  2L81 A;  2Y69 C;  4DOZ A;  4AE4 B;  3UGO A;  3S28 A;  3OWT A;  1ZHW A;  4MW3 A;  4FAP B;  3LNR A;  3O55 A;  5IY5 C;  3S84 A;  4DVY P;  3SXY A;  3T6G B;  4EBB A;  1EI7 A;  3DMD A;  3AQB A;  2H7O A;  2LFD A;  2OCC C;  3HKK A;  4DBQ A;  3TQO A;  3C8G A;  5JVE A;  1RKE B;  4CSA C;  1RKC A;  2C03 A;  4CDA A;  1QSP A;  2XLD A;  4XEF A;  2WL8 A;  3CSK A;  2AVK A;  3FHD A;  3Q6N A;  3RQE A;  3W2V A;  4O6M A;  2JX0 A;  3FXH A;  1Z7Q c;  1H6G A;  1OXB A;  2NSG A;  2ASR A;  3ASN C;  1MNE A;  4YWQ A;  5BUO A;  4CDY A;  2V3C C;  2EPM X;  1CGN A;  4G0H A;  1T6U A;  5KYU A;  4AK9 A;  2J9U A;  3DI5 A;  3EQL F;  2DYS C;  2LCH A;  3ZG1 A;  3NRH A;  2IXN A;  3NMK A;  4HEA J;  1RKE A;  2YEV A;  3ZSU A;  5L3Q A;  4FES A;  4JIO A;  1A41 A;  4LAC B;  2Q9B A;  3C18 A;  5BQG A;  1TWG A;  3QZC A;  1Z6A A;  3ZQY A;  2OU6 A;  1D1B A;  3VF0 A;  2WVO A;  3AGT A;  3PHF 2;  3FOO A;  1L3P A;  1S7Z A;  3SXK A;  1LS1 A;  2QE9 A;  1WWP A;  4E7S A;  1BZ4 A;  2Y3H A;  4IB4 A;  4BJ5 C;  5DQT A;  4EBK A;  1YLM A;  5F28 E;  3H2V A;  1BR4 A;  1W2W A;  2L6H A;  3AG2 C;  3JSZ A;  1U89 A;  1ORS C;  2EIJ C;  4LDQ A;  3RIP A;  4OIN F;  3SEO A;  1WAT A;  3ABK C;  1ZVZ A;  4D4X A;  3U3B A;  4WAB A;  3RH3 A;  3B71 A;  4JC7 A;  1T01 A;  5JSL A;  1CGO A;  1MND A;  1U0B B;  2A1D D;  1M2V B;  3HLZ A;  3C8G D;  3K1I C;  2NPU A;  3TD7 A;  1Q0G A;  2HMZ A;  5F5F A;  2W45 A;  3SXZ A;  3RQF A;  1DOV A;  5K0I A;  3VAY A;  3ZVR A;  2NG1 A;  1M6T A;  1O5H A;  2YQY A;  3DD7 A;  4MVU A;  2FAP B;  4MQ9 F;  3IQ6 A;  4WGY A;  5A6K A;  3NYJ A;  4NTF A;  1XZP A;  4JTC B;  1D1A A;  1QZX A;  2IBF A;  4AL1 A;  1K04 A;  1PV3 A;  4U5H A;  2EPK X;  3LS0 A;  1ZW2 A;  2MYS A;  2OG2 A;  3FAP B;  4YT5 A;  3KPH A;  2VCA A;  1U6H A;  4A4A A;  3ZWI A;  3VM6 A;  3I4U A;  4EUK B;  4YT2 A;  2MWQ A;  4JCZ A;  3CQZ A;  1VB5 A;  2EIL C;  5JUA A;  5A6B D;  3U9J A;  4CS9 C;  5DLJ A;  2OJQ A;  1CPR A;  3EHM A;  3B0U X;  1Q0F A;  2J7P A;  4P9T A;  2IOQ A;  2LFF A;  1YDI A;  2KGO A;  4MVQ A;  4UDV A;  4YL3 A;  4JE9 A;  2TMV P;  4DBR A;  2XSE A;  2HV7 A;  1YA7 O;  4YJW A;  1B68 A;  4EWC A;  1ORY A;  1S05 A;  3EH2 A;  2R05 A;  3IHU A;  4BEJ A;  2R7O A;  1V55 C;  1TKN A;  3MYI A;  3JRT A;  3U8V A;  5E2Q A;  1Z23 A;  2KK1 A;  3ATP A;  3DE8 A;  4MTO A;  2G3K A;  5T1D B;  1GM5 A;  4C7O A;  1JRA A;  4U5G A;  3RVZ A;  3UMI A;  1Q0M A;  2WVN A;  3O10 A;  5TJ5 E;  1RJ9 B;  4J32 B;  4JTA B;  4EKW A;  3EGX B;  1HW2 A;  2PBE A;  2R7U A;  3IEE A;  1VTM P;  1I5N A;  4JVS A;  2DGJ A;  1M57 C;  2PP4 A;  1FNT c;  4BJ6 C;  1G5Z A;  4O6N A;  2OOC A;  2YKZ A;  1TFO B;  3G4Z A;  5L0F A;  4OIO F;  2X51 A;  2OKU A;  2YLD A;  4I3M A;  1BR1 A;  1QVX A;  1RJ9 A;  3ECS A;  2P7V A;  3DXJ F;  3EGX A;  1LE4 A;  4KNW A;  1ZHY A;  3ZC4 A;  2DI3 A;  2GWW A;  3PMR A;  2NUT A;  4W8K A;  2V26 A;  3QVY A;  3GOR A;  5B3I A;  3C7J A;  3UR3 C;  2ZPA A;  2A0B A;  1H9G A;  4LDK A;  2J7P D;  3GM1 A;  2Q9A A;  3MYF A;  3O39 A;  3JCU Q;  3L34 A;  4XEK A;  5CI8 A;  1SMY F;  4XLP F;  4KI2 A;  3T6B A;  3VYW A;  1LIH A;  2IM8 A;  1T9K A;  2QY9 A;  3AG3 C;  3WG7 C;  3TUL A;  2Q4F A;  1YYJ A;  1H7I A;  1M56 C;  3MBG A;  1RCP A;  2VH3 A;  1K40 A;  2CDQ A;  2L7A A;  3EGD B;  2E87 A;  2RSE B;  2AP3 A;  4WGZ A;  3C8G B;  3MX3 A;  3U8P A;  5DQZ A;  5L0G A;  1NBB A;  2HSB A;  2BC5 A;  3N2Z B;  5BQH A;  1A7D A;  2G3V A;  3F47 A;  3CEX A;  3EH1 A;  4I1M A;  4MVO A;  4P9F A;  2R03 A;  4U5C E;  4CS8 A;  3JSE O;  3K6B A;  4JJF A;  4M63 A;  3JT1 A;  1VOM A;  1MMD A;  3G4X A;  1EA8 A;  5L0I A;  2W4B A;  4K1O A;  4LER A;  5KYU B;  3AOU A;  3EGD A;  3PCV A;  1T6I A;  2DYR C;  1OCR C;  3S9O A;  3TJ6 A;  3NDB B;  2L6F A;  3ZTM A;  3KH2 A;  3EZH A;  5L0D A;  2BL2 A;  2YLG A;  1FMW A;  1AUE A;  2GDC A;  3X1O A;  4ZLD A;  2R9R B;  2XLE A;  4O6Y A;  2A6H F;  3V5Y A;  1HY5 A;  1XZQ A;  4U5F E;  5JS5 A;  1O87 A;  4BJ5 A;  3K66 A;  3ZTZ A;  2ETS A;  1YYX A;  2J0W A;  1JMW A;  3POV A;  1OKK A;  1V54 C;  3LLK A;  4HFF B;  4KNV A;  1GQA A;  4PJJ A;  2A68 F;  3QVZ A;  3C62 A;  2KW3 C;  3ASO C;  3KKB A;  3OEO A;  3SNH A;  5A6B A;  2MHR A;  3K7D A;  1VLT A;  4E7Z A;  4DRI B;  1A0B A;  4U5D E;  2KNH A;  2IXO A;  3E9V A;  3GEH A;  2QTV A;  2Y3B A;  4CS9 A;  3S0X A;  1NFO A;  2HKV A;  1YZA A;  2WZF A;  1YAR O;  3QMK A;  1OR2 A;  4AX2 A;  4QDL A;  4W8P A;  2ZXO A;  1BR2 A;  1QQ3 A;  3KMI A;  3NG1 A;  2W4M A;  1C03 A;  4DRH B;  3Q7G A;  3V5X A;  1OR3 A;  2WB7 A;  4JEA A;  3NMJ A;  2XLM A;  3RF3 A;  2CYD A;  4AL0 A;  2YLI A;  1OCO C;  1JPJ A;  4YT4 A;  4OIP F;  2JD3 A;  3VRC A;  1T5O A;  2WZG A;  2P0N A;  2PF4 E;  3US6 A;  1ZHX A;  3M4C A;  1ZYR F;  1TFK B;  2P6V A;  4NQF A;  3LUT B;  3NMI A;  4J7Y A;  4FX5 A;  2Q3T A;  5B3S C;  2D5R B;  2R7R A;  1LI7 A;  5E3A A;  3R2P A;  2IXP A;  1ZHZ A;  4K7B A;  4H4K C;  5GPG B;  1YVI A;  2B0J A;  3EFO B;  5F5H A;  3SZR A;  4YT8 A;  4MVS A;  5KYX A;  5E33 A;  3B0P A;  4Z9I A;  5AC4 A;  1OKK D;  2FFH A;  2ZXR A;  2XL4 A;  3K1H A;  4CDV A;  5JT4 A;  3E70 C;  5DS4 A;  1A7V A;  1OW8 A;  5T3W A;  1C02 A;  1Z5Z A;  2QLA A;  4J30 B;  1LVK A;  3OA1 A;  1N1C A;  1WTY A;  1MMG A;  4C7O B;  3A11 A;  1OXK A;  2G62 A;  3B9Q A;  1VK5 A;  3M4B A;  4NCQ A;  1D1C A;  4RBN A;  2YZS A;  4XLN F;  3EFO A;  2OJE D;  1F1M A;  2PNO A;  1MQV A;  5FZT A;  4KC9 A;  3G50 A;  1V74 B;  2C04 A;  2R25 A;  4DXW A;  4LDR A;  4A2N B;  1EKY A;  4MW8 A;  1OCZ C;  3GM3 A;  4JJG A;  3CZ6 A;  4WJ0 A;  3SYN A;  2XS8 A;  3X2Q C;  2OEX A;  2A6E F;  2I8B A;  2LP4 A;  1NFN A;  2VCC A;  2YVK A;  5D91 A;  4XPY A;  2FGY A;  3S27 A;  4JW1 A;  1TR2 A;  1WOL A;  2YWA A;  4U5B E;  5B1B C;  5JP7 A;  4BJT A;  4BPM A;  5HV9 A;  3M79 A;  2EIN C;  3DAF A;  3RFY A;  5DVW A;  1O3U A;  5DS6 A;  2NUT B;  1WAS A;  4ULV A;  4Z9J A;  1BBH A;  1LM3 B;  1OQC A;  4N6H A;  1AVO B;  2XLW A;  1H9T A;  1LI5 A;  3T9O A;  1GS9 A;  1Q0K A;  3ABL C;  4N6C A;  5FCL A;  2KYH A;  1I4Y A;  3W8I A;  3K1I A;  1DOW A;  3F46 A;  4F4B A;  1TQG A;  2OEV A;  4CJG A;  2HV6 A;  3QTH A;  1HMD A;  4HFK B;  2BE5 F;  1D0Y A;  3UNG C;  3RVY A;  4B6I A;  2HJM A;  1C17 M;  4PFO A;  3A9C A;  4YL1 A;  2XXA A;  2YL7 A;  2HS5 A;  3T4R A;  3FDQ A;  1K05 A;  2A0U A;  4DVZ A;  2Q9C A;  2UUI A;  1TWH A;  2P1A A;  2XLO A;  4PJM A;  3ZIB A;  2HZ8 A;  3JYY A;  4ER9 A;  4C3E A;  4N4W A;  3DM9 B;  4U5E E;  5B1A C;  3TK0 A;  3RKO F;  2XLV A;  2WZL A;  3IQT A;  2YL0 A;  3RQG A;  2AWY A;  2KJG A;  1ZHT A;  1YAU O;  2ZXW C; 
#chains in the Genus database with same CATH homology
 1IZM A;  3DJU B;  3I5P A;  4I1O B;  4OIR F;  1G8X A;  1MMA A;  4N06 A;  2R7W A;  2KQ9 A;  2PX3 A;  1KU2 A;  3NYM A;  3GOD A;  2CW0 F;  1IW7 F;  5KYY A;  2R7X A;  1NU7 D;  4FWV A;  1VYI A;  2EIK C;  3AG4 C;  5CI9 A;  4CSA A;  5E3C A;  2VAS A;  2XRH A;  2O9X A;  4G7O F;  4BJ6 A;  3EG9 A;  1J8M F;  4ULW A;  2J45 A;  3L0I A;  3DM5 A;  1TWA A;  3FAJ A;  3FVY A;  3V7O A;  4OD4 A;  4C3B A;  4PFP A;  3I5Q A;  1NU9 C;  2NUP A;  4G7Z F;  3AQC A;  3NYL A;  3T6J A;  4IWB A;  4I44 A;  4QI2 A;  3K33 A;  2PFD A;  2PX0 A;  2YHS A;  4O7G A;  1PD1 A;  3HJC A;  3AG1 C;  4AE4 A;  4JCH A;  5KYX B;  4JUR I;  2H7V C;  3SP1 A;  2M4E A;  2R7S A;  4HE8 D;  1VMA A;  1TWC A;  1QLE C;  1WGW A;  4YN0 B;  3S29 A;  2LSE A;  4Q4Z F;  3N0T A;  2EIM C;  3W2W A;  2W9Y A;  3MLG A;  1FFT C;  3B0V C;  3WOD F;  4X0R A;  4O79 A;  4CIH A;  3LES A;  4PJN A;  3UMK A;  4MND A;  2ZXP A;  2J9W A;  2R7V A;  5L3V A;  2H7B A;  3N24 A;  1NG1 A;  1J8Y F;  3EPV A;  2CNW A;  3ITF A;  2IYL D;  4OIQ F;  1OCC C;  3LS1 A;  3UGP A;  3JYH A;  2R7T A;  4GEH A;  1D0X A;  3EZI A;  1D0Z A;  4BJ1 A;  4ANJ A;  3LLI A;  5EGY A;  3EHN A;  3DJN B;  5D92 A;  5HSW A;  2J0X A;  1M2V A;  1ZU4 A;  4IRU A;  1FMV A;  4KBL A;  4K0D A;  3LAY A;  1PD0 A;  2XXA B;  1Z63 A;  1ST6 A;  3HTK C;  2Z15 A;  3ABM C;  4LLC A;  4Q7C A;  4P6I C;  5KYW B;  1FTS A;  1JPN A;  4PK4 A;  2IXM A;  4CS7 A;  3H65 A;  1SZI A;  4CS8 C;  2Y3G A;  3EJN A;  5DQT A;  3NKD A;  2WVQ A;  4NY3 A;  3KL4 A;  3RYL A;  2CNW D;  3GAN A;  5KYN A;  1Z3I X;  4CSA C;  1FFH A;  5KYW A;  4GYT A;  1LKX A;  4G7H F;  5KYY B;  4C3D A;  3M1C B;  1SF8 A;  4CBE A;  2L9J A;  4JZA A;  4LLE A;  4IJJ A;  1PCX A;  3EG9 B;  2R7Q A;  1VYK A;  4ZLC A;  3LJB A;  2J46 A;  5EHH A;  3Q6M A;  4Q5S F;  3NKE A;  2J9V A;  2VB6 A;  5T3T A;  2Y3D A;  4XWJ A;  3Q7L A;  1NZE A;  1ZU5 A;  3O6X A;  4IAO A;  1MMN A;  4RDA A;  3UMH A;  3W8H A;  4RD9 A;  2CGE A;  4OD5 A;  5DS5 A;  2Y39 A;  3DZA A;  2NUP B;  1M2O A;  2A69 F;  3LEV A;  4QI0 A;  3DAG A;  4XTK A;  4PJL A;  2GFH A;  2L81 A;  2Y69 C;  4DOZ A;  4AE4 B;  3UGO A;  3OWT A;  1ZHW A;  5IY5 C;  3LNR A;  4DVY P;  4EBB A;  3DMD A;  3AQB A;  2H7O A;  2OCC C;  4DBQ A;  2C03 A;  2WL8 A;  3CSK A;  3FHD A;  3Q6N A;  3W2V A;  4O6M A;  5BUO A;  2V3C C;  3ASN C;  4YWQ A;  1MNE A;  4G0H A;  5KYU A;  4AK9 A;  2J9U A;  3EQL F;  2DYS C;  3ZG1 A;  3NRH A;  2IXN A;  4HEA J;  2YEV A;  3ZSU A;  5L3Q A;  4FES A;  4LAC B;  2Q9B A;  1TWG A;  3QZC A;  1Z6A A;  1D1B A;  2WVO A;  1S7Z A;  1LS1 A;  4E7S A;  2Y3H A;  4BJ5 C;  1BR4 A;  1W2W A;  3AG2 C;  3JSZ A;  3RIP A;  2EIJ C;  4OIN F;  3SEO A;  3ABK C;  3RH3 A;  1MND A;  2A1D D;  1M2V B;  3HLZ A;  3K1I C;  3TD7 A;  5F5F A;  2W45 A;  3VAY A;  3ZVR A;  2NG1 A;  3DD7 A;  1O5H A;  4MQ9 F;  3NYJ A;  1D1A A;  1QZX A;  4U5H A;  4YT5 A;  3LS0 A;  2OG2 A;  2MYS A;  3I4U A;  4YT2 A;  2MWQ A;  3CQZ A;  2EIL C;  4CS9 C;  5DLJ A;  3EHM A;  3B0U X;  2J7P A;  2IOQ A;  2KGO A;  4DBR A;  2XSE A;  2HV7 A;  4YJW A;  4EWC A;  3EH2 A;  4BEJ A;  2R7O A;  1V55 C;  1TKN A;  3JRT A;  5E2Q A;  1Z23 A;  2G3K A;  5T1D B;  4C7O A;  3UMI A;  4U5G A;  2WVN A;  1RJ9 B;  4J32 B;  3EGX B;  2R7U A;  3IEE A;  4JVS A;  2DGJ A;  1M57 C;  2PP4 A;  4BJ6 C;  4O6N A;  4OIO F;  2X51 A;  4I3M A;  1BR1 A;  1RJ9 A;  3ECS A;  2P7V A;  3DXJ F;  3EGX A;  4KNW A;  3ZC4 A;  1ZHY A;  3PMR A;  2NUT A;  4W8K A;  2V26 A;  3UR3 C;  2ZPA A;  2J7P D;  2Q9A A;  3O39 A;  3JCU Q;  3L34 A;  5CI8 A;  4KI2 A;  1SMY F;  4XLP F;  3T6B A;  3VYW A;  3WG7 C;  3AG3 C;  2QY9 A;  1M56 C;  2VH3 A;  3EGD B;  2CDQ A;  2E87 A;  3MX3 A;  5DQZ A;  3N2Z B;  2G3V A;  4CS8 A;  3F47 A;  3EH1 A;  4I1M A;  4U5C E;  3K6B A;  4JJF A;  4M63 A;  3JT1 A;  1VOM A;  1MMD A;  2W4B A;  4LER A;  5KYU B;  3EGD A;  2DYR C;  1OCR C;  3NDB B;  3KH2 A;  3EZH A;  1FMW A;  3X1O A;  4ZLD A;  4O6Y A;  2A6H F;  4U5F E;  1O87 A;  3K66 A;  2J0W A;  3POV A;  1OKK A;  1V54 C;  3LLK A;  4HFF B;  4KNV A;  4PJJ A;  2A68 F;  2KW3 C;  3ASO C;  3KKB A;  3OEO A;  3SNH A;  3K7D A;  4E7Z A;  4U5D E;  2KNH A;  2IXO A;  3E9V A;  3S0X A;  2QTV A;  2Y3B A;  4CS9 A;  2WZF A;  3QMK A;  4AX2 A;  4QDL A;  4YT8 A;  2ZXO A;  1BR2 A;  3NG1 A;  3KMI A;  2W4M A;  3Q7G A;  2WB7 A;  1OCO C;  1JPJ A;  4YT4 A;  4OIP F;  2JD3 A;  2WZG A;  2PF4 E;  1ZHX A;  1ZYR F;  2P6V A;  5B3S C;  4FX5 A;  2Q3T A;  2D5R B;  2R7R A;  5E3A A;  2IXP A;  1ZHZ A;  4K7B A;  4H4K C;  2B0J A;  3EFO B;  5F5H A;  3SZR A;  5KYX A;  5E33 A;  3B0P A;  1OKK D;  2FFH A;  2ZXR A;  2XL4 A;  3K1H A;  3E70 C;  5DS4 A;  3S28 A;  5T3W A;  4BG0 A;  1Z5Z A;  4J30 B;  1LVK A;  3OA1 A;  1N1C A;  1MMG A;  4C7O B;  3B9Q A;  2G62 A;  1VK5 A;  1D1C A;  4RBN A;  2YZS A;  4XLN F;  3EFO A;  4KC9 A;  2C04 A;  4A2N B;  1OCZ C;  4JJG A;  3CZ6 A;  4WJ0 A;  3SYN A;  3X2Q C;  2A6E F;  2I8B A;  5D91 A;  4BJ5 A;  3PHF 2;  2FGY A;  3S27 A;  4JW1 A;  1TR2 A;  4U5B E;  5B1B C;  4BJT A;  2EIN C;  3DAF A;  3RFY A;  5DVW A;  5DS6 A;  2NUT B;  5FCL A;  3ABL C;  3W8I A;  4F4B A;  3F46 A;  2HV6 A;  4HFK B;  2BE5 F;  1D0Y A;  3UNG C;  4B6I A;  4PFO A;  2XXA A;  3T4R A;  3FDQ A;  4DVZ A;  2Q9C A;  1TWH A;  4PJM A;  3ZIB A;  4C3E A;  3DM9 B;  4U5E E;  5B1A C;  3RKO F;  2WZL A;  2KJG A;  1ZHT A;  2ZXW C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...