4YN0B

Crystal structure of app e2 domain in complex with dr6 crd domain
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
202
structure length
202
Chain Sequence
TPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor receptor superfamily member 21
publication title The crystal structure of DR6 in complex with the amyloid precursor protein provides insight into death receptor activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis/cell adhesion
total genus 92
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2015-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yn0B00
4RDAA 3UMKA 3Q7GA 3NYJA 3UMIA 3NYLA 4YN0B 5BUOA 3K6BA 3Q7LA 4RD9A 1TKNA 3QMKA 3K66A 3UMHA 3PMRA
chains in the Genus database with same CATH superfamily
4LERA 3O6XA 3DAGA 5D92A 5B3SC 2IOQA 4AX2A 4U5DE 4PK4A 3G50A 1ZW2A 3T4RA 5L0DA 1HY5A 2JPUA 2LCHA 1YYXA 3BEHA 1H6GA 3K33A 3Q6MA 4IGGA 4EWCA 2J45A 1V4AA 3IQCA 4J7TA 2R7TA 4ULVA 1LI7A 2HKVA 1CGNA 2YRFA 2HSQA 3EGDA 4LLEA 3SNHA 3SXZA 3V5XA 4OIPF 3EGDB 4JE9A 1G4WR 3JSEO 3S28A 3CQZA 5L0JA 2A1DD 1S7ZA 4JTCB 1JOGA 2YLIA 3V5ZA 1TR2A 1D1AA 4M63A 4U5BE 1BR2A 2XLVA 4JKVA 4G7OF 4NC3A 3RF3A 2QNLA 1RKEA 2B0HA 2QE9A 1M56C 4WGZA 1B68A 2W45A 3T6JA 1Q0DA 4ZLDA 3DKAA 5CI8A 2R7OA 1LIHA 2BC5A 2RSEB 5COFA 3EH2A 3EFOB 3E70C 2BE5F 2XRHA 3CSKA 1IZMA 1VYKA 3I4UA 2R7VA 2KYHA 4MVOA 4KI2A 4BG0A 5B1AC 3VAYA 1QZXA 2OG2A 1ZVZA 2WB7A 2YWAA 3LEVA 4JVSA 5GPGB 3POVA 2KK1A 3C62A 1TKNA 2LFDA 3C7JA 3U3FA 4MVMA 3L0IA 2EPKX 4LACB 1LKXA 4KNVA 2L81A 3DE9A 3RYLA 3Q7LA 2CGEA 1E86A 4JW1A 2YZSA 3LESA 4O6YA 4XWJA 4EBKA 1WASA 3UGPA 3US6A 2XSEA 2KSFA 2VB6A 4U9DA 3RFYA 1JR8A 2JX0A 3SXYA 4XQ1A 4JRZA 1T01A 3NMJA 3ITFA 2OJQA 2YL3A 3H65A 2FFHA 3IQ6A 3NYMA 1PV3A 4G0HA 4H4KC 2ZPAA 1OCCC 2IBFA 1CGOA 4XPXA 2V3CC 1I5NA 4BJ6C 1WOLA 4KC9A 3BRJA 3HNJA 4AE4A 3ASNC 2EPMX 1YA9A 1KU2A 1E85A 2XL4A 4YL1A 4YK5A 3RQEA 4YT8A 3EG9A 2VCCA 2Z15A 3EG9B 4LLCA 3KKBA 5L3QA 3LNRA 2OKUA 4O7GA 1OR3A 4HFFB 3TOMA 3GEIA 3SXKA 4A4AA 1GQAA 4MVZA 4DBRA 1QSPA 2CCYA 1ZU5A 1F1MA 3ZTMA 5A6JA 3S29A 4EIYA 1M6TA 4PFOA 1FMWA 2NSFA 3DD7A 1BR1A 4C7OA 5COMA 3VRCA 4C7OB 1QPUA 3T9OA 1QVXA 4CS7A 5KYYA 1KTMA 3M79A 1NSGB 4RD9A 3HNKA 1WWPA 5E3AA 2CNWA 2P61A 4L6RA 4FAPB 1E2XA 2OU6A 2MHRA 3FXHA 4GYTA 4MS2A 4XEVA 3AG4C 3ZG1A 4JZAA 3IEEA 4PJNA 1PCXA 3EGXA 2XLHA 1OKKA 2M64A 1HMOA 1LS4A 1N1CA 2HJ3A 3GM3A 3N2ZB 3ZVRA 1E84A 1Y6DA 2VCBA 3K66A 3O10A 2A69F 3NRHA 3PCVA 4RBNA 2PNOA 3FAJA 4YL3A 3X1OA 5DS6A 5JT4A 4OIQF 1J8MF 2A68F 3SEOA 3U2MA 1D1BA 1SZIA 1YLMA 3TQOA 2X0CA 3ZQVA 4PR9A 3SYNA 3IQ5A 3C18A 3KMIA 4BPMA 1T9KA 1DOWA 1NG1A 1BR4A 1U89A 2EIKC 2NUPB 2WVQA 1Z3IX 3ATPA 3MBGA 3QMKA 1ZHZA 2WZLA 4NTAA 4K7BA 5E2QA 3GODA 1EI7A 4IRUA 2YQYA 5TJ5E 3UNGC 3WG7C 4CS9A 1FNTc 2XL8A 1OQCA 3MFNA 2R7QA 1GM5A 4QI2A 4GQHA 1I4YA 1FAPB 2A6EF 3O55A 4OD5A 3WHNA 1MQVA 2XS8A 2GDCA 2EPLX 2HMZA 3QZCA 2EILC 4MW3A 4DRIB 2Q00A 1JPJA 3NYJA 4WABA 2B0JA 1ZHYA 2J46A 3ABLC 5DLJA 4XPWA 1H9GA 3GEEA 1AVOB 3GM2A 1BDJB 3FOPA 4G78A 4IAOA 3VM6A 4CS8C 4J32B 3UMKA 2R7RA 3UMIA 3TK0A 5JVEA 1QQ3A 1D1CA 1VLTA 1ORJA 1HE1A 5AC5A 3UMHA 3AQCA 1OCOC 1RKCA 2AWYA 2Q9AA 1R5ID 2HS5A 1Q0KA 1U6HA 4N6CA 1HMDA 3NKEA 5KYNA 2PFDA 2HUJA 1RMVA 2OJED 2Y3HA 2QLAA 4EBBA 3ABMC 4QI0A 3AG3C 4CSAC 2ICWG 3B0PA 2OEXA 3L34A 4OD4A 3EZHA 3AG2C 3B0VC 3ABKC 1CPQA 3EHNA 2Q4FA 2Q9CA 3LAYA 2ETSA 3H2UA 3HNIA 1BZ4A 5T1DB 4DRHB 1VYIA 3GWLA 2HV7A 4DBQA 3RQGA 1XZQA 3M15A 2HFIA 2QY9A 4Q7CA 1VOMA 5A6BA 2WZGA 4JTDB 4MNDA 3DE8A 3U0CA 5HV9A 2YL1A 3ZTZA 5L0GA 1WTYA 4FWVA 5DVWA 1Y4CA 3Q7GA 4JIOA 3B9QA 3K1IC 3M4BA 1M57C 3EFOA 4C3BA 3L1MA 3OEOA 1Z63A 2VC9A 4FESA 4XLPF 1OW6A 4P6IC 2QTVA 2Q7RA 3SZRA 3ZC4A 4C3DA 1V54C 2OQMA 4Z9HA 5CI9A 4A2NB 3V5YA 4PJLA 2R7UA 1LE2A 3RKOF 3NKDA 2XLMA 1GGQA 1YARO 4K0DA 2CW0F 1AUEA 3M1CB 5KYUA 2IXPA 3WODF 5FZTA 1TQGA 3VF0A 2UUIA 5A6KA 2WVOA 3V7OA 5KYUB 2J0XA 2NG1A 3N0TA 4NTFA 1GS9A 3DWWA 3DZAA 4BJ6A 4YT5A 1TWAA 2KC3A 1TFKB 1VTMP 1MNEA 1NFOA 3IPMO 5T3TA 3I5PA 4B6IA 1NFNA 4JTAB 2XXAB 1JRAA 1PD0A 2XLOA 3QVYA 3QVZA 3SXMA 4CJOA 4DOZA 2R7XA 4MQ9F 1C03A 5F28E 4YJWA 5E33A 2Y3GA 4J30B 3S9OA 1O3UA 4CX9A 3NMKA 4KBLA 2FAPB 5KYWB 3ZQYA 2MYSA 1PD1A 1QLEC 2HSBA 2P1AA 3FHDA 3LNMB 1NU9C 3E9VA 4DVYP 1QKRA 3ZWIA 4IB4A 2PX0A 4YWQA 4DRJB 2E87A 1NZEA 3W4YA 4H54A 4CJGA 5AC4A 5F5FA 4XEFA 4N06A 1A41A 4U9EA 3RVZA 4C3EA 4O79A 2A6HF 3S0XA 1M2OA 2QUPA 4WGYA 1K05A 1A7DA 2CNWD 2LSEA 2L9JA 4IARA 2J8WA 3RIPA 1T5OA 3FAPB 4XPYA 4DJ9A 5HSWA 2NSGA 3KYJA 3W8HA 1OKKD 3C8GD 3AGUA 3HNLA 5F5HA 3PHF2 3ZSUA 1FMVA 4J7YA 4ANJA 2LK4A 1Q0FA 3L8IA 1D0ZA 1VB5A 3U9MA 3ZIBA 2YLDA 4FX5A 4AL0A 3HLZA 4ULWA 3QW0A 2KQ9A 1WATA 2V26A 4U5EE 4U5CE 4EBJA 3K1HA 4BEMJ 3W2WA 2C04A 2XL6A 4KNWA 2J0WA 1FTSA 2P0NA 1YJGA 1EA8A 4P9TA 3TOLA 3RH3A 2EPNA 3LJBA 2VCAA 4BJTA 3IHUA 5E3CA 2H8AA 3AJMA 4O6MA 2DYSC 3F47A 2EPOA 3ECSA 2IXMA 5IY5C 3MYFA 2OCCC 4PACA 1O87A 3MLGA 3LS0A 3AOUA 1TWHA 3F46A 2D4UA 5JP7A 2Y3DA 2P6VA 1VLSA 1ZHXA 2NUPA 3LLKA 1NBBA 4IAQA 4XTKA 3JT1A 2OEVA 3T6GB 3WAQA 2J7PD 3EJNA 2KNHA 4O6NA 1YA7O 1ZYRF 2XLDA 3N24A 4U5HA 4CS8A 3MYIA 2AVKA 5T3WA 2YL0A 3QW1A 2R7WA 3U3BA 4N6HA 5D91A 1TFOB 2Y3BA 3C63A 2R02A 4U5FE 2DYRC 5L0FA 2J9BA 4BJ5C 1A7VA 1H7IA 3EHMA 1IW7F 2ZXOA 3CAXA 3U8VA 1LPEA 4DXWA 1ZU4A 1MMGA 4CSAA 3JRMO 5FCLA 2ZXPA 3R2PA 1ST6A 1YZAA 2R9RB 1XWJA 4I1OB 1Z23A 4UDVA 2X51A 2DB4A 2YLGA 5KYXB 3LS1A 5BQIA 3FVYA 5DQZA 2MWQA 2PBEA 4NY3A 4PFPA 1Z6AA 4XLNF 3NMIA 1UG7A 4OIRF 4MTFA 4JC7A 4JEBA 4X0RA 4Q4ZF 5JLIA 1M2VB 1U0BB 3O39A 5K0IA 1KNYA 2EINC 4JEAA 3R7CA 1K40A 5B1BC 1HW1A 3KPHA 4JCHA 2GAQA 4PJMA 1LS1A 3K1IA 4I1MA 3TJ6A 3HKKA 1W2WA 2AP3A 5CIVA 4U5GA 2R25A 1Z7Qc 1LM3B 3DM5A 3B71A 4BJ1A 3J06A 3OWTA 1OCZC 2PF4E 1OR2A 3B29A 4CDAA 4Q5SF 1JMWA 3GANA 3LEOA 4MTGA 1C17M 1TWCA 4F4BA 4MVRA 4Z9IA 5JS5A 2YEVA 2YHSA 1YYJA 2Q3TA 2R03A 3FMSA 1L7CA 3PMRA 4IJJA 3T6BA 4E7SA 2O9XA 4XEKA 4YT4A 2IM8A 3AGTA 1MMDA 2R05A 3DJNB 2XM4A 5JSLA 1K04A 1OCRC 1C02A 4W8KA 3JSZA 5BQGA 4OINF 1A0BA 2IXNA 2LP4A 4AK9A 3TD7A 4MVUA 5BQHA 3QTHA 5A69A 2YKZA 2ZXWC 3AQBA 5B3IA 1T6IA 3U9JA 5AGFA 2IXOA 4E7ZA 2HJMA 1S05A 3U2LA 3KYIA 1RKEB 2P7VA 3S90A 3U8PA 2I15A 3JYYA 3OA1A 2XXAA 3EZIA 4NCQA 2BL2A 3JZ0A 3GM1A 3K7DA 4IWBA 4LDRA 4E0HA 5JRAA 5EK0A 1FFHA 4ONSA 4ER9A 2DGJA 3GEHA 3LLIA 5KYWA 3U5SA 1APCA 3JCUQ 1YDIA 4HE8D 2H7BA 2ZD9A 4MVQA 1A7EA 1H9TA 2L7AA 1DOVA 3LUTB 1EKYA 4NTBA 3S27A 3NDBB 3IQTA 3HJCA 4HFKB 2G3KA 4YL0A 3W8IA 3Q6NA 2VH3A 1D0YA 2Y39A 4D4NA 1G4US 2G3VA 2FGYA 3ASOC 2L6FA 1LI5A 2L6GA 3C8ZA 4K1OA 4CDYA 5L0CA 3H2VA 3A9CA 3JYHA 4ZLCA 3EPVA 1BBHA 4CIHA 1YVIA 3I5QA 5L0IA 1FR0A 2WZFA 3SP1A 4G7ZF 1MNDA 3UR3C 1ZHTA 4MTOA 2A0UA 4Z9JA 1L3PA 1J8YF 1G5ZA 3FDQA 2KW3C 2NPUA 2EIMC 4N4WA 1I4ZA 5L3VA 2GA0A 4E17A 4AE4B 5EHHA 4PJJA 4QDLA 3S84A 2D5RB 5DQTA 1EQ1A 4EHPA 2XM0A 3GORA 4WJ0A 1LVKA 4D4XA 1WN0A 2XS1A 4E18A 1OW8A 4MVSA 2TMVP 1CGME 3G4ZA 3KH2A 1MMAA 1RXQA 1T6QA 2CDQA 4EUKB 3KL4A 4I44A 1SR2A 2Q9BA 2DI3A 1LE4A 2I8BA 1Q0MA 1Q0GA 256BA 2H7VC 3NG1A 1E83A 1XZPA 2C03A 2GFHA 3K6BA 1ORSC 4HEAJ 1YAUO 1YZCA 1NU7D 3TJ5A 1T6UA 2WL8A 3CEXA 3CZ6A 3DXJF 1D0XA 2HZ8A 1O5HA 2IYLD 1SYQA 3JRTA 1ORYA 1ZHWA 3G4XA 3RQFA 3JTLO 1VMAA 3X2QC 5KYYB 2LQGA 2Y69C 1RCPA 1CPRA 2AWCA 4AL1A 3TULA 5DS5A 2YL7A 1JPNA 2NUTA 2XLEA 3DM9B 4GEHA 4BEJA 1OXKA 3HTKC 4BJ5A 2NUTB 1HE9A 4JJGA 5L0HA 2W9YA 3A11A 4JCZA 2M4EA 3EH1A 4G7HF 3C8GA 1WGWA 1V74B 1ZZPA 2ASRA 3EGXB 3C8GB 2PP4A 3ZDLA 3B0UX 4CBEA 1OW7A 1UFBA 3RVYA 2AU5A 2LFFA 3DAFA 3NYLA 1Z5ZA 2CYDA 3EQLF 2HMQA 2YVKA 4DVZA 1R4TA 3DJUB 1V55C 2RD9A 2R7SA 2UUHA 3MX3A 1AEPA 4R32A 1NLXA 3VYWA 2F22A 4JJFA 2GWWA 2LD6A 3M4CA 1HW2A 2LIGA 2L6HA 3UGOA 3L8JA 1VK5A 2ZXRA 5KYXA 1MMNA 3AG1C 3FOOA 5EGYA 2EIJC 1G8XA 2J9WA 4NQFA 5DS4A 4YT2A 2J9VA 2G62A 2OOCA 5COGA 2JD3A 2J9UA 2WVNA 3PDMP 4E0IA 2VASA 5A6BD 3GWNA 4LDKA 1M2VA 1JAFA 4W8PA 3W2VA 2W4MA 1SMYF 1SF8A 4I3MA 5JUAA 4CIPA 5BUOA 2J7PA 3DMDA 4MW8A 2W4BA 4YN0B 5A6AA 4CS9C 2PX3A 4EKWA 1TWGA 1ZW3A 3DI5A 4JURI 4LDQA 2KJGA 4P9FA 1OXBA 1FFTC 2KGOA 2XLWA 4RDAA 3RW0A 1RJ9A 4CDVA 2HV6A 4OIOF 1RJ9B 2A0BA 2H7OA
chains in the Genus database with same CATH topology
4LERA 3O6XA 3DAGA 5D92A 5B3SC 2IOQA 4AX2A 4U5DE 4PK4A 3T4RA 4EWCA 3K33A 3Q6MA 2J45A 2R7TA 3B0VC 3SNHA 3EGDA 4LLEA 4OIPF 3EGDB 3S28A 3CQZA 2A1DD 1S7ZA 1TR2A 1D1AA 4M63A 4U5BE 1BR2A 4G7OF 1M56C 2W45A 3T6JA 4ZLDA 5CI8A 2R7OA 3EH2A 3EFOB 3E70C 2BE5F 2XRHA 3CSKA 1IZMA 1VYKA 3I4UA 2R7VA 4BG0A 5B1AC 3VAYA 1QZXA 2OG2A 3LEVA 2WB7A 4JVSA 3POVA 1TKNA 3RYLA 3L0IA 4LACB 1LKXA 4KNVA 2L81A 3Q7LA 2CGEA 4JW1A 2YZSA 3LESA 4O6YA 4XWJA 3UGPA 2XSEA 2VB6A 3RFYA 3ITFA 4G0HA 3H65A 4H4KC 2FFHA 3NYMA 4KI2A 2ZPAA 1OCCC 2V3CC 4BJ6C 4KC9A 4AE4A 3ASNC 1KU2A 2XL4A 4YT8A 3EG9A 2Z15A 3EG9B 4LLCA 3KKBA 5L3QA 3LNRA 4O7GA 4HFFB 4DBRA 1ZU5A 3S29A 4PFOA 1FMWA 3DD7A 1BR1A 4C7OA 4C7OB 4CS7A 5KYYA 4RD9A 5E3AA 2CNWA 4GYTA 3ZG1A 3AG4C 4JZAA 3IEEA 4PJNA 1PCXA 3EGXA 1OKKA 1N1CA 3N2ZB 3ZVRA 3K66A 4RBNA 2A69F 3NRHA 5DS6A 4OIQF 3FAJA 3X1OA 1J8MF 2A68F 3SEOA 1D1BA 1SZIA 3SYNA 3KMIA 3N24A 1NG1A 1BR4A 2NUPB 2EIKC 2WVQA 3QMKA 1Z3IX 3NDBB 1ZHZA 2WZLA 3UNGC 4K7BA 5E2QA 3GODA 4IRUA 3WG7C 4CS9A 4QI2A 2R7QA 2A6EF 4OD5A 3QZCA 2EILC 1JPJA 3NYJA 2B0JA 1ZHYA 2J46A 3ABLC 5DLJA 4IAOA 4CS8C 4J32B 3UMKA 2R7RA 3UMIA 1D1CA 3UMHA 3AQCA 1OCOC 2Q9AA 5KYNA 3NKEA 2PFDA 2Y3HA 4EBBA 3ABMC 4QI0A 3AG3C 4CSAC 3B0PA 3L34A 4OD4A 3EZHA 3AG2C 3ABKC 3EHNA 2Q9CA 3LAYA 5T1DB 1VYIA 2HV7A 4DBQA 2QY9A 4Q7CA 1VOMA 2WZGA 4MNDA 4FWVA 5DVWA 3Q7GA 4C3BA 3B9QA 3K1IC 1M57C 3EFOA 3OEOA 1Z63A 4FESA 4XLPF 4P6IC 2QTVA 3SZRA 3ZC4A 4C3DA 1V54C 5CI9A 4A2NB 4PJLA 2R7UA 3RKOF 3NKDA 4K0DA 2CW0F 3M1CB 5KYUA 2IXPA 3WODF 5KYUB 2WVOA 3V7OA 2J0XA 2NG1A 3N0TA 3DZAA 4BJ6A 4YT5A 1TWAA 1MNEA 5T3TA 3I5PA 4B6IA 2XXAB 1PD0A 2R7XA 4DOZA 4MQ9F 4YJWA 5E33A 2Y3GA 4J30B 4KBLA 5KYWB 2MYSA 1PD1A 1QLEC 3FHDA 1NU9C 3E9VA 4DVYP 2PX0A 4YWQA 2E87A 1NZEA 5F5FA 4N06A 4C3EA 4O79A 2A6HF 3S0XA 1M2OA 2CNWD 2LSEA 2L9JA 5HSWA 3RIPA 3W8HA 1OKKD 3PHF2 5F5HA 3ZSUA 1FMVA 4ANJA 1D0ZA 3ZIBA 4FX5A 3HLZA 4ULWA 2KQ9A 2V26A 4U5EE 4U5CE 3K1HA 3W2WA 2C04A 4KNWA 2J0WA 1FTSA 3RH3A 3LJBA 4BJTA 5E3CA 4O6MA 2DYSC 3F47A 3ECSA 2IXMA 5IY5C 2OCCC 1O87A 3MLGA 3LS0A 1TWHA 3F46A 2Y3DA 2P6VA 1ZHXA 2NUPA 3LLKA 4XTKA 3JT1A 2J7PD 3EJNA 2KNHA 4O6NA 1ZYRF 4U5HA 4CS8A 5T3WA 2R7WA 5D91A 2Y3BA 4U5FE 2DYRC 4BJ5C 3EHMA 1IW7F 2ZXOA 1ZU4A 1MMGA 4CSAA 5FCLA 2ZXPA 1ST6A 4I1OB 1Z23A 2X51A 5KYXB 3LS1A 3FVYA 5DQZA 2MWQA 4NY3A 4PFPA 1Z6AA 4XLNF 4OIRF 4X0RA 4Q4ZF 1M2VB 3O39A 2EINC 5B1BC 4JCHA 4PJMA 1LS1A 4I1MA 1W2WA 4U5GA 3DM5A 4BJ1A 3OWTA 1OCZC 2PF4E 4Q5SF 3GANA 1TWCA 4F4BA 2YEVA 2YHSA 2Q3TA 3PMRA 4IJJA 3T6BA 4E7SA 4YT4A 2O9XA 1MMDA 3DJNB 1OCRC 4W8KA 3JSZA 4OINF 2IXNA 4AK9A 3TD7A 2ZXWC 3AQBA 2IXOA 4E7ZA 2P7VA 3OA1A 2XXAA 3EZIA 3K7DA 4IWBA 1FFHA 2DGJA 5KYWA 3LLIA 3JCUQ 4HE8D 2H7BA 3S27A 3HJCA 4HFKB 2G3KA 3W8IA 3Q6NA 2VH3A 1D0YA 2Y39A 2G3VA 3ASOC 2FGYA 3JYHA 4ZLCA 3EPVA 4CIHA 3I5QA 2WZFA 3SP1A 4G7ZF 1MNDA 3UR3C 1ZHTA 1J8YF 3FDQA 2KW3C 2EIMC 5L3VA 4AE4B 5EHHA 4PJJA 4QDLA 2D5RB 5DQTA 4WJ0A 1LVKA 3KH2A 1MMAA 2CDQA 3KL4A 4I44A 2Q9BA 2I8BA 2H7VC 3NG1A 2C03A 2GFHA 3K6BA 4HEAJ 1NU7D 3CZ6A 2WL8A 3DXJF 1D0XA 1O5HA 2IYLD 3JRTA 3X2QC 1ZHWA 1VMAA 5KYYB 2Y69C 5DS5A 1JPNA 2NUTA 3DM9B 4BEJA 4GEHA 3HTKC 4BJ5A 2NUTB 4JJGA 2W9YA 4G7HF 2M4EA 3EH1A 1WGWA 3EGXB 2PP4A 3B0UX 4CBEA 3DAFA 3NYLA 1Z5ZA 3EQLF 4DVZA 3DJUB 1V55C 2R7SA 3MX3A 3VYWA 4JJFA 3UGOA 1VK5A 2ZXRA 5KYXA 1MMNA 3AG1C 5EGYA 2EIJC 1G8XA 2J9WA 5DS4A 4YT2A 2J9VA 2G62A 2JD3A 2J9UA 2WVNA 2VASA 1M2VA 3W2VA 2W4MA 1SMYF 1SF8A 4I3MA 5BUOA 2J7PA 3DMDA 2W4BA 4YN0B 4CS9C 2PX3A 1TWGA 4JURI 2KJGA 2KGOA 1FFTC 4RDAA 1RJ9A 2HV6A 4OIOF 1RJ9B 2H7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4RDA A;  3UMK A;  3Q7G A;  3NYJ A;  3UMI A;  3NYL A;  4YN0 B;  5BUO A;  3K6B A;  3Q7L A;  4RD9 A;  1TKN A;  3QMK A;  3K66 A;  3UMH A;  3PMR A; 
#chains in the Genus database with same CATH topology
 4LER A;  3O6X A;  3DAG A;  5D92 A;  5B3S C;  2IOQ A;  4AX2 A;  4U5D E;  4PK4 A;  3G50 A;  1ZW2 A;  3T4R A;  5L0D A;  1HY5 A;  2JPU A;  2LCH A;  1YYX A;  3BEH A;  1H6G A;  3K33 A;  3Q6M A;  4IGG A;  4EWC A;  2J45 A;  1V4A A;  3IQC A;  4J7T A;  2R7T A;  4ULV A;  1LI7 A;  2HKV A;  1CGN A;  2YRF A;  2HSQ A;  3EGD A;  4LLE A;  3SNH A;  3SXZ A;  3V5X A;  4OIP F;  3EGD B;  4JE9 A;  1G4W R;  3JSE O;  3S28 A;  3CQZ A;  5L0J A;  2A1D D;  1S7Z A;  4JTC B;  1JOG A;  2YLI A;  3V5Z A;  1TR2 A;  1D1A A;  4M63 A;  4U5B E;  1BR2 A;  2XLV A;  4JKV A;  4G7O F;  4NC3 A;  3RF3 A;  2QNL A;  1RKE A;  2B0H A;  2QE9 A;  1M56 C;  4WGZ A;  1B68 A;  2W45 A;  3T6J A;  1Q0D A;  4ZLD A;  3DKA A;  5CI8 A;  2R7O A;  1LIH A;  2BC5 A;  2RSE B;  5COF A;  3EH2 A;  3EFO B;  3E70 C;  2BE5 F;  2XRH A;  3CSK A;  1IZM A;  1VYK A;  3I4U A;  2R7V A;  2KYH A;  4MVO A;  4KI2 A;  4BG0 A;  5B1A C;  3VAY A;  1QZX A;  2OG2 A;  1ZVZ A;  2WB7 A;  2YWA A;  3LEV A;  4JVS A;  5GPG B;  3POV A;  2KK1 A;  3C62 A;  1TKN A;  2LFD A;  3C7J A;  3U3F A;  4MVM A;  3L0I A;  2EPK X;  4LAC B;  1LKX A;  4KNV A;  2L81 A;  3DE9 A;  3RYL A;  3Q7L A;  2CGE A;  1E86 A;  4JW1 A;  2YZS A;  3LES A;  4O6Y A;  4XWJ A;  4EBK A;  1WAS A;  3UGP A;  3US6 A;  2XSE A;  2KSF A;  2VB6 A;  4U9D A;  3RFY A;  1JR8 A;  2JX0 A;  3SXY A;  4XQ1 A;  4JRZ A;  1T01 A;  3NMJ A;  3ITF A;  2OJQ A;  2YL3 A;  3H65 A;  2FFH A;  3IQ6 A;  3NYM A;  1PV3 A;  4G0H A;  4H4K C;  2ZPA A;  1OCC C;  2IBF A;  1CGO A;  4XPX A;  2V3C C;  1I5N A;  4BJ6 C;  1WOL A;  4KC9 A;  3BRJ A;  3HNJ A;  4AE4 A;  3ASN C;  2EPM X;  1YA9 A;  1KU2 A;  1E85 A;  2XL4 A;  4YL1 A;  4YK5 A;  3RQE A;  4YT8 A;  3EG9 A;  2VCC A;  2Z15 A;  3EG9 B;  4LLC A;  3KKB A;  5L3Q A;  3LNR A;  2OKU A;  4O7G A;  1OR3 A;  4HFF B;  3TOM A;  3GEI A;  3SXK A;  4A4A A;  1GQA A;  4MVZ A;  4DBR A;  1QSP A;  2CCY A;  1ZU5 A;  1F1M A;  3ZTM A;  5A6J A;  3S29 A;  4EIY A;  1M6T A;  4PFO A;  1FMW A;  2NSF A;  3DD7 A;  1BR1 A;  4C7O A;  5COM A;  3VRC A;  4C7O B;  1QPU A;  3T9O A;  1QVX A;  4CS7 A;  5KYY A;  1KTM A;  3M79 A;  1NSG B;  4RD9 A;  3HNK A;  1WWP A;  5E3A A;  2CNW A;  2P61 A;  4L6R A;  4FAP B;  1E2X A;  2OU6 A;  2MHR A;  3FXH A;  4GYT A;  4MS2 A;  4XEV A;  3AG4 C;  3ZG1 A;  4JZA A;  3IEE A;  4PJN A;  1PCX A;  3EGX A;  2XLH A;  1OKK A;  2M64 A;  1HMO A;  1LS4 A;  1N1C A;  2HJ3 A;  3GM3 A;  3N2Z B;  3ZVR A;  1E84 A;  1Y6D A;  2VCB A;  3K66 A;  3O10 A;  2A69 F;  3NRH A;  3PCV A;  4RBN A;  2PNO A;  3FAJ A;  4YL3 A;  3X1O A;  5DS6 A;  5JT4 A;  4OIQ F;  1J8M F;  2A68 F;  3SEO A;  3U2M A;  1D1B A;  1SZI A;  1YLM A;  3TQO A;  2X0C A;  3ZQV A;  4PR9 A;  3SYN A;  3IQ5 A;  3C18 A;  3KMI A;  4BPM A;  1T9K A;  1DOW A;  1NG1 A;  1BR4 A;  1U89 A;  2EIK C;  2NUP B;  2WVQ A;  1Z3I X;  3ATP A;  3MBG A;  3QMK A;  1ZHZ A;  2WZL A;  4NTA A;  4K7B A;  5E2Q A;  3GOD A;  1EI7 A;  4IRU A;  2YQY A;  5TJ5 E;  3UNG C;  3WG7 C;  4CS9 A;  1FNT c;  2XL8 A;  1OQC A;  3MFN A;  2R7Q A;  1GM5 A;  4QI2 A;  4GQH A;  1I4Y A;  1FAP B;  2A6E F;  3O55 A;  4OD5 A;  3WHN A;  1MQV A;  2XS8 A;  2GDC A;  2EPL X;  2HMZ A;  3QZC A;  2EIL C;  4MW3 A;  4DRI B;  2Q00 A;  1JPJ A;  3NYJ A;  4WAB A;  2B0J A;  1ZHY A;  2J46 A;  3ABL C;  5DLJ A;  4XPW A;  1H9G A;  3GEE A;  1AVO B;  3GM2 A;  1BDJ B;  3FOP A;  4G78 A;  4IAO A;  3VM6 A;  4CS8 C;  4J32 B;  3UMK A;  2R7R A;  3UMI A;  3TK0 A;  5JVE A;  1QQ3 A;  1D1C A;  1VLT A;  1ORJ A;  1HE1 A;  5AC5 A;  3UMH A;  3AQC A;  1OCO C;  1RKC A;  2AWY A;  2Q9A A;  1R5I D;  2HS5 A;  1Q0K A;  1U6H A;  4N6C A;  1HMD A;  3NKE A;  5KYN A;  2PFD A;  2HUJ A;  1RMV A;  2OJE D;  2Y3H A;  2QLA A;  4EBB A;  3ABM C;  4QI0 A;  3AG3 C;  4CSA C;  2ICW G;  3B0P A;  2OEX A;  3L34 A;  4OD4 A;  3EZH A;  3AG2 C;  3B0V C;  3ABK C;  1CPQ A;  3EHN A;  2Q4F A;  2Q9C A;  3LAY A;  2ETS A;  3H2U A;  3HNI A;  1BZ4 A;  5T1D B;  4DRH B;  1VYI A;  3GWL A;  2HV7 A;  4DBQ A;  3RQG A;  1XZQ A;  3M15 A;  2HFI A;  2QY9 A;  4Q7C A;  1VOM A;  5A6B A;  2WZG A;  4JTD B;  4MND A;  3DE8 A;  3U0C A;  5HV9 A;  2YL1 A;  3ZTZ A;  5L0G A;  1WTY A;  4FWV A;  5DVW A;  1Y4C A;  3Q7G A;  4JIO A;  3B9Q A;  3K1I C;  3M4B A;  1M57 C;  3EFO A;  4C3B A;  3L1M A;  3OEO A;  1Z63 A;  2VC9 A;  4FES A;  4XLP F;  1OW6 A;  4P6I C;  2QTV A;  2Q7R A;  3SZR A;  3ZC4 A;  4C3D A;  1V54 C;  2OQM A;  4Z9H A;  5CI9 A;  4A2N B;  3V5Y A;  4PJL A;  2R7U A;  1LE2 A;  3RKO F;  3NKD A;  2XLM A;  1GGQ A;  1YAR O;  4K0D A;  2CW0 F;  1AUE A;  3M1C B;  5KYU A;  2IXP A;  3WOD F;  5FZT A;  1TQG A;  3VF0 A;  2UUI A;  5A6K A;  2WVO A;  3V7O A;  5KYU B;  2J0X A;  2NG1 A;  3N0T A;  4NTF A;  1GS9 A;  3DWW A;  3DZA A;  4BJ6 A;  4YT5 A;  1TWA A;  2KC3 A;  1TFK B;  1VTM P;  1MNE A;  1NFO A;  3IPM O;  5T3T A;  3I5P A;  4B6I A;  1NFN A;  4JTA B;  2XXA B;  1JRA A;  1PD0 A;  2XLO A;  3QVY A;  3QVZ A;  3SXM A;  4CJO A;  4DOZ A;  2R7X A;  4MQ9 F;  1C03 A;  5F28 E;  4YJW A;  5E33 A;  2Y3G A;  4J30 B;  3S9O A;  1O3U A;  4CX9 A;  3NMK A;  4KBL A;  2FAP B;  5KYW B;  3ZQY A;  2MYS A;  1PD1 A;  1QLE C;  2HSB A;  2P1A A;  3FHD A;  3LNM B;  1NU9 C;  3E9V A;  4DVY P;  1QKR A;  3ZWI A;  4IB4 A;  2PX0 A;  4YWQ A;  4DRJ B;  2E87 A;  1NZE A;  3W4Y A;  4H54 A;  4CJG A;  5AC4 A;  5F5F A;  4XEF A;  4N06 A;  1A41 A;  4U9E A;  3RVZ A;  4C3E A;  4O79 A;  2A6H F;  3S0X A;  1M2O A;  2QUP A;  4WGY A;  1K05 A;  1A7D A;  2CNW D;  2LSE A;  2L9J A;  4IAR A;  2J8W A;  3RIP A;  1T5O A;  3FAP B;  4XPY A;  4DJ9 A;  5HSW A;  2NSG A;  3KYJ A;  3W8H A;  1OKK D;  3C8G D;  3AGU A;  3HNL A;  5F5H A;  3PHF 2;  3ZSU A;  1FMV A;  4J7Y A;  4ANJ A;  2LK4 A;  1Q0F A;  3L8I A;  1D0Z A;  1VB5 A;  3U9M A;  3ZIB A;  2YLD A;  4FX5 A;  4AL0 A;  3HLZ A;  4ULW A;  3QW0 A;  2KQ9 A;  1WAT A;  2V26 A;  4U5E E;  4U5C E;  4EBJ A;  3K1H A;  4BEM J;  3W2W A;  2C04 A;  2XL6 A;  4KNW A;  2J0W A;  1FTS A;  2P0N A;  1YJG A;  1EA8 A;  4P9T A;  3TOL A;  3RH3 A;  2EPN A;  3LJB A;  2VCA A;  4BJT A;  3IHU A;  5E3C A;  2H8A A;  3AJM A;  4O6M A;  2DYS C;  3F47 A;  2EPO A;  3ECS A;  2IXM A;  5IY5 C;  3MYF A;  2OCC C;  4PAC A;  1O87 A;  3MLG A;  3LS0 A;  3AOU A;  1TWH A;  3F46 A;  2D4U A;  5JP7 A;  2Y3D A;  2P6V A;  1VLS A;  1ZHX A;  2NUP A;  3LLK A;  1NBB A;  4IAQ A;  4XTK A;  3JT1 A;  2OEV A;  3T6G B;  3WAQ A;  2J7P D;  3EJN A;  2KNH A;  4O6N A;  1YA7 O;  1ZYR F;  2XLD A;  3N24 A;  4U5H A;  4CS8 A;  3MYI A;  2AVK A;  5T3W A;  2YL0 A;  3QW1 A;  2R7W A;  3U3B A;  4N6H A;  5D91 A;  1TFO B;  2Y3B A;  3C63 A;  2R02 A;  4U5F E;  2DYR C;  5L0F A;  2J9B A;  4BJ5 C;  1A7V A;  1H7I A;  3EHM A;  1IW7 F;  2ZXO A;  3CAX A;  3U8V A;  1LPE A;  4DXW A;  1ZU4 A;  1MMG A;  4CSA A;  3JRM O;  5FCL A;  2ZXP A;  3R2P A;  1ST6 A;  1YZA A;  2R9R B;  1XWJ A;  4I1O B;  1Z23 A;  4UDV A;  2X51 A;  2DB4 A;  2YLG A;  5KYX B;  3LS1 A;  5BQI A;  3FVY A;  5DQZ A;  2MWQ A;  2PBE A;  4NY3 A;  4PFP A;  1Z6A A;  4XLN F;  3NMI A;  1UG7 A;  4OIR F;  4MTF A;  4JC7 A;  4JEB A;  4X0R A;  4Q4Z F;  5JLI A;  1M2V B;  1U0B B;  3O39 A;  5K0I A;  1KNY A;  2EIN C;  4JEA A;  3R7C A;  1K40 A;  5B1B C;  1HW1 A;  3KPH A;  4JCH A;  2GAQ A;  4PJM A;  1LS1 A;  3K1I A;  4I1M A;  3TJ6 A;  3HKK A;  1W2W A;  2AP3 A;  5CIV A;  4U5G A;  2R25 A;  1Z7Q c;  1LM3 B;  3DM5 A;  3B71 A;  4BJ1 A;  3J06 A;  3OWT A;  1OCZ C;  2PF4 E;  1OR2 A;  3B29 A;  4CDA A;  4Q5S F;  1JMW A;  3GAN A;  3LEO A;  4MTG A;  1C17 M;  1TWC A;  4F4B A;  4MVR A;  4Z9I A;  5JS5 A;  2YEV A;  2YHS A;  1YYJ A;  2Q3T A;  2R03 A;  3FMS A;  1L7C A;  3PMR A;  4IJJ A;  3T6B A;  4E7S A;  2O9X A;  4XEK A;  4YT4 A;  2IM8 A;  3AGT A;  1MMD A;  2R05 A;  3DJN B;  2XM4 A;  5JSL A;  1K04 A;  1OCR C;  1C02 A;  4W8K A;  3JSZ A;  5BQG A;  4OIN F;  1A0B A;  2IXN A;  2LP4 A;  4AK9 A;  3TD7 A;  4MVU A;  5BQH A;  3QTH A;  5A69 A;  2YKZ A;  2ZXW C;  3AQB A;  5B3I A;  1T6I A;  3U9J A;  5AGF A;  2IXO A;  4E7Z A;  2HJM A;  1S05 A;  3U2L A;  3KYI A;  1RKE B;  2P7V A;  3S90 A;  3U8P A;  2I15 A;  3JYY A;  3OA1 A;  2XXA A;  3EZI A;  4NCQ A;  2BL2 A;  3JZ0 A;  3GM1 A;  3K7D A;  4IWB A;  4LDR A;  4E0H A;  5JRA A;  5EK0 A;  1FFH A;  4ONS A;  4ER9 A;  2DGJ A;  3GEH A;  3LLI A;  5KYW A;  3U5S A;  1APC A;  3JCU Q;  1YDI A;  4HE8 D;  2H7B A;  2ZD9 A;  4MVQ A;  1A7E A;  1H9T A;  2L7A A;  1DOV A;  3LUT B;  1EKY A;  4NTB A;  3S27 A;  3NDB B;  3IQT A;  3HJC A;  4HFK B;  2G3K A;  4YL0 A;  3W8I A;  3Q6N A;  2VH3 A;  1D0Y A;  2Y39 A;  4D4N A;  1G4U S;  2G3V A;  2FGY A;  3ASO C;  2L6F A;  1LI5 A;  2L6G A;  3C8Z A;  4K1O A;  4CDY A;  5L0C A;  3H2V A;  3A9C A;  3JYH A;  4ZLC A;  3EPV A;  1BBH A;  4CIH A;  1YVI A;  3I5Q A;  5L0I A;  1FR0 A;  2WZF A;  3SP1 A;  4G7Z F;  1MND A;  3UR3 C;  1ZHT A;  4MTO A;  2A0U A;  4Z9J A;  1L3P A;  1J8Y F;  1G5Z A;  3FDQ A;  2KW3 C;  2NPU A;  2EIM C;  4N4W A;  1I4Z A;  5L3V A;  2GA0 A;  4E17 A;  4AE4 B;  5EHH A;  4PJJ A;  4QDL A;  3S84 A;  2D5R B;  5DQT A;  1EQ1 A;  4EHP A;  2XM0 A;  3GOR A;  4WJ0 A;  1LVK A;  4D4X A;  1WN0 A;  2XS1 A;  4E18 A;  1OW8 A;  4MVS A;  2TMV P;  1CGM E;  3G4Z A;  3KH2 A;  1MMA A;  1RXQ A;  1T6Q A;  2CDQ A;  4EUK B;  3KL4 A;  4I44 A;  1SR2 A;  2Q9B A;  2DI3 A;  1LE4 A;  2I8B A;  1Q0M A;  1Q0G A;  256B A;  2H7V C;  3NG1 A;  1E83 A;  1XZP A;  2C03 A;  2GFH A;  3K6B A;  1ORS C;  4HEA J;  1YAU O;  1YZC A;  1NU7 D;  3TJ5 A;  1T6U A;  2WL8 A;  3CEX A;  3CZ6 A;  3DXJ F;  1D0X A;  2HZ8 A;  1O5H A;  2IYL D;  1SYQ A;  3JRT A;  1ORY A;  1ZHW A;  3G4X A;  3RQF A;  3JTL O;  1VMA A;  3X2Q C;  5KYY B;  2LQG A;  2Y69 C;  1RCP A;  1CPR A;  2AWC A;  4AL1 A;  3TUL A;  5DS5 A;  2YL7 A;  1JPN A;  2NUT A;  2XLE A;  3DM9 B;  4GEH A;  4BEJ A;  1OXK A;  3HTK C;  4BJ5 A;  2NUT B;  1HE9 A;  4JJG A;  5L0H A;  2W9Y A;  3A11 A;  4JCZ A;  2M4E A;  3EH1 A;  4G7H F;  3C8G A;  1WGW A;  1V74 B;  1ZZP A;  2ASR A;  3EGX B;  3C8G B;  2PP4 A;  3ZDL A;  3B0U X;  4CBE A;  1OW7 A;  1UFB A;  3RVY A;  2AU5 A;  2LFF A;  3DAF A;  3NYL A;  1Z5Z A;  2CYD A;  3EQL F;  2HMQ A;  2YVK A;  4DVZ A;  1R4T A;  3DJU B;  1V55 C;  2RD9 A;  2R7S A;  2UUH A;  3MX3 A;  1AEP A;  4R32 A;  1NLX A;  3VYW A;  2F22 A;  4JJF A;  2GWW A;  2LD6 A;  3M4C A;  1HW2 A;  2LIG A;  2L6H A;  3UGO A;  3L8J A;  1VK5 A;  2ZXR A;  5KYX A;  1MMN A;  3AG1 C;  3FOO A;  5EGY A;  2EIJ C;  1G8X A;  2J9W A;  4NQF A;  5DS4 A;  4YT2 A;  2J9V A;  2G62 A;  2OOC A;  5COG A;  2JD3 A;  2J9U A;  2WVN A;  3PDM P;  4E0I A;  2VAS A;  5A6B D;  3GWN A;  4LDK A;  1M2V A;  1JAF A;  4W8P A;  3W2V A;  2W4M A;  1SMY F;  1SF8 A;  4I3M A;  5JUA A;  4CIP A;  5BUO A;  2J7P A;  3DMD A;  4MW8 A;  2W4B A;  4YN0 B;  5A6A A;  4CS9 C;  2PX3 A;  4EKW A;  1TWG A;  1ZW3 A;  3DI5 A;  4JUR I;  4LDQ A;  2KJG A;  4P9F A;  1OXB A;  1FFT C;  2KGO A;  2XLW A;  4RDA A;  3RW0 A;  1RJ9 A;  4CDV A;  2HV6 A;  4OIO F;  1RJ9 B;  2A0B A;  2H7O A; 
#chains in the Genus database with same CATH homology
 4LER A;  3O6X A;  3DAG A;  5D92 A;  5B3S C;  2IOQ A;  4AX2 A;  4U5D E;  4PK4 A;  3T4R A;  4EWC A;  3K33 A;  3Q6M A;  2J45 A;  2R7T A;  3B0V C;  3SNH A;  3EGD A;  4LLE A;  4OIP F;  3EGD B;  3S28 A;  3CQZ A;  2A1D D;  1S7Z A;  1TR2 A;  1D1A A;  4M63 A;  4U5B E;  1BR2 A;  4G7O F;  1M56 C;  2W45 A;  3T6J A;  4ZLD A;  5CI8 A;  2R7O A;  3EH2 A;  3EFO B;  3E70 C;  2BE5 F;  2XRH A;  3CSK A;  1IZM A;  1VYK A;  3I4U A;  2R7V A;  4BG0 A;  5B1A C;  3VAY A;  1QZX A;  2OG2 A;  3LEV A;  2WB7 A;  4JVS A;  3POV A;  1TKN A;  3RYL A;  3L0I A;  4LAC B;  1LKX A;  4KNV A;  2L81 A;  3Q7L A;  2CGE A;  4JW1 A;  2YZS A;  3LES A;  4O6Y A;  4XWJ A;  3UGP A;  2XSE A;  2VB6 A;  3RFY A;  3ITF A;  4G0H A;  3H65 A;  4H4K C;  2FFH A;  3NYM A;  4KI2 A;  2ZPA A;  1OCC C;  2V3C C;  4BJ6 C;  4KC9 A;  4AE4 A;  3ASN C;  1KU2 A;  2XL4 A;  4YT8 A;  3EG9 A;  2Z15 A;  3EG9 B;  4LLC A;  3KKB A;  5L3Q A;  3LNR A;  4O7G A;  4HFF B;  4DBR A;  1ZU5 A;  3S29 A;  4PFO A;  1FMW A;  3DD7 A;  1BR1 A;  4C7O A;  4C7O B;  4CS7 A;  5KYY A;  4RD9 A;  5E3A A;  2CNW A;  4GYT A;  3ZG1 A;  3AG4 C;  4JZA A;  3IEE A;  4PJN A;  1PCX A;  3EGX A;  1OKK A;  1N1C A;  3N2Z B;  3ZVR A;  3K66 A;  4RBN A;  2A69 F;  3NRH A;  5DS6 A;  4OIQ F;  3FAJ A;  3X1O A;  1J8M F;  2A68 F;  3SEO A;  1D1B A;  1SZI A;  3SYN A;  3KMI A;  3N24 A;  1NG1 A;  1BR4 A;  2NUP B;  2EIK C;  2WVQ A;  3QMK A;  1Z3I X;  3NDB B;  1ZHZ A;  2WZL A;  3UNG C;  4K7B A;  5E2Q A;  3GOD A;  4IRU A;  3WG7 C;  4CS9 A;  4QI2 A;  2R7Q A;  2A6E F;  4OD5 A;  3QZC A;  2EIL C;  1JPJ A;  3NYJ A;  2B0J A;  1ZHY A;  2J46 A;  3ABL C;  5DLJ A;  4IAO A;  4CS8 C;  4J32 B;  3UMK A;  2R7R A;  3UMI A;  1D1C A;  3UMH A;  3AQC A;  1OCO C;  2Q9A A;  5KYN A;  3NKE A;  2PFD A;  2Y3H A;  4EBB A;  3ABM C;  4QI0 A;  3AG3 C;  4CSA C;  3B0P A;  3L34 A;  4OD4 A;  3EZH A;  3AG2 C;  3ABK C;  3EHN A;  2Q9C A;  3LAY A;  5T1D B;  1VYI A;  2HV7 A;  4DBQ A;  2QY9 A;  4Q7C A;  1VOM A;  2WZG A;  4MND A;  4FWV A;  5DVW A;  3Q7G A;  4C3B A;  3B9Q A;  3K1I C;  1M57 C;  3EFO A;  3OEO A;  1Z63 A;  4FES A;  4XLP F;  4P6I C;  2QTV A;  3SZR A;  3ZC4 A;  4C3D A;  1V54 C;  5CI9 A;  4A2N B;  4PJL A;  2R7U A;  3RKO F;  3NKD A;  4K0D A;  2CW0 F;  3M1C B;  5KYU A;  2IXP A;  3WOD F;  5KYU B;  2WVO A;  3V7O A;  2J0X A;  2NG1 A;  3N0T A;  3DZA A;  4BJ6 A;  4YT5 A;  1TWA A;  1MNE A;  5T3T A;  3I5P A;  4B6I A;  2XXA B;  1PD0 A;  2R7X A;  4DOZ A;  4MQ9 F;  4YJW A;  5E33 A;  2Y3G A;  4J30 B;  4KBL A;  5KYW B;  2MYS A;  1PD1 A;  1QLE C;  3FHD A;  1NU9 C;  3E9V A;  4DVY P;  2PX0 A;  4YWQ A;  2E87 A;  1NZE A;  5F5F A;  4N06 A;  4C3E A;  4O79 A;  2A6H F;  3S0X A;  1M2O A;  2CNW D;  2LSE A;  2L9J A;  5HSW A;  3RIP A;  3W8H A;  1OKK D;  3PHF 2;  5F5H A;  3ZSU A;  1FMV A;  4ANJ A;  1D0Z A;  3ZIB A;  4FX5 A;  3HLZ A;  4ULW A;  2KQ9 A;  2V26 A;  4U5E E;  4U5C E;  3K1H A;  3W2W A;  2C04 A;  4KNW A;  2J0W A;  1FTS A;  3RH3 A;  3LJB A;  4BJT A;  5E3C A;  4O6M A;  2DYS C;  3F47 A;  3ECS A;  2IXM A;  5IY5 C;  2OCC C;  1O87 A;  3MLG A;  3LS0 A;  1TWH A;  3F46 A;  2Y3D A;  2P6V A;  1ZHX A;  2NUP A;  3LLK A;  4XTK A;  3JT1 A;  2J7P D;  3EJN A;  2KNH A;  4O6N A;  1ZYR F;  4U5H A;  4CS8 A;  5T3W A;  2R7W A;  5D91 A;  2Y3B A;  4U5F E;  2DYR C;  4BJ5 C;  3EHM A;  1IW7 F;  2ZXO A;  1ZU4 A;  1MMG A;  4CSA A;  5FCL A;  2ZXP A;  1ST6 A;  4I1O B;  1Z23 A;  2X51 A;  5KYX B;  3LS1 A;  3FVY A;  5DQZ A;  2MWQ A;  4NY3 A;  4PFP A;  1Z6A A;  4XLN F;  4OIR F;  4X0R A;  4Q4Z F;  1M2V B;  3O39 A;  2EIN C;  5B1B C;  4JCH A;  4PJM A;  1LS1 A;  4I1M A;  1W2W A;  4U5G A;  3DM5 A;  4BJ1 A;  3OWT A;  1OCZ C;  2PF4 E;  4Q5S F;  3GAN A;  1TWC A;  4F4B A;  2YEV A;  2YHS A;  2Q3T A;  3PMR A;  4IJJ A;  3T6B A;  4E7S A;  4YT4 A;  2O9X A;  1MMD A;  3DJN B;  1OCR C;  4W8K A;  3JSZ A;  4OIN F;  2IXN A;  4AK9 A;  3TD7 A;  2ZXW C;  3AQB A;  2IXO A;  4E7Z A;  2P7V A;  3OA1 A;  2XXA A;  3EZI A;  3K7D A;  4IWB A;  1FFH A;  2DGJ A;  5KYW A;  3LLI A;  3JCU Q;  4HE8 D;  2H7B A;  3S27 A;  3HJC A;  4HFK B;  2G3K A;  3W8I A;  3Q6N A;  2VH3 A;  1D0Y A;  2Y39 A;  2G3V A;  3ASO C;  2FGY A;  3JYH A;  4ZLC A;  3EPV A;  4CIH A;  3I5Q A;  2WZF A;  3SP1 A;  4G7Z F;  1MND A;  3UR3 C;  1ZHT A;  1J8Y F;  3FDQ A;  2KW3 C;  2EIM C;  5L3V A;  4AE4 B;  5EHH A;  4PJJ A;  4QDL A;  2D5R B;  5DQT A;  4WJ0 A;  1LVK A;  3KH2 A;  1MMA A;  2CDQ A;  3KL4 A;  4I44 A;  2Q9B A;  2I8B A;  2H7V C;  3NG1 A;  2C03 A;  2GFH A;  3K6B A;  4HEA J;  1NU7 D;  3CZ6 A;  2WL8 A;  3DXJ F;  1D0X A;  1O5H A;  2IYL D;  3JRT A;  3X2Q C;  1ZHW A;  1VMA A;  5KYY B;  2Y69 C;  5DS5 A;  1JPN A;  2NUT A;  3DM9 B;  4BEJ A;  4GEH A;  3HTK C;  4BJ5 A;  2NUT B;  4JJG A;  2W9Y A;  4G7H F;  2M4E A;  3EH1 A;  1WGW A;  3EGX B;  2PP4 A;  3B0U X;  4CBE A;  3DAF A;  3NYL A;  1Z5Z A;  3EQL F;  4DVZ A;  3DJU B;  1V55 C;  2R7S A;  3MX3 A;  3VYW A;  4JJF A;  3UGO A;  1VK5 A;  2ZXR A;  5KYX A;  1MMN A;  3AG1 C;  5EGY A;  2EIJ C;  1G8X A;  2J9W A;  5DS4 A;  4YT2 A;  2J9V A;  2G62 A;  2JD3 A;  2J9U A;  2WVN A;  2VAS A;  1M2V A;  3W2V A;  2W4M A;  1SMY F;  1SF8 A;  4I3M A;  5BUO A;  2J7P A;  3DMD A;  2W4B A;  4YN0 B;  4CS9 C;  2PX3 A;  1TWG A;  4JUR I;  2KJG A;  2KGO A;  1FFT C;  4RDA A;  1RJ9 A;  2HV6 A;  4OIO F;  1RJ9 B;  2H7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...