4YN0B

Crystal structure of app e2 domain in complex with dr6 crd domain
Total Genus 92
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
92
sequence length
202
structure length
202
Chain Sequence
TPGDENEHAHFQKAKERLEAKHRERMSQVMREWEEAERQAKNLPKADKKAVIQHFQEKVESLEQEAANERQQLVETHMARVEAMLNDRRRLALENYITALQAVPPRPHHVFNMLKKYVRAEQKDRQHTLKHFEHVRMVDPKKAAQIRSQVMTHLRVIYERMNQSLSLLYNVPAVAEEIQDEVDELLQKEQNYSDDVLANMIS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Tumor necrosis factor receptor superfamily member 21
publication title The crystal structure of DR6 in complex with the amyloid precursor protein provides insight into death receptor activation.
pubmed doi rcsb
source organism Mus musculus
molecule tags Apoptosis/cell adhesion
total genus 92
structure length 202
sequence length 202
ec nomenclature
pdb deposition date 2015-03-08
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.120.770 Mainly Alpha Up-down Bundle Four Helix Bundle (Hemerythrin (Met), subunit A) Four Helix Bundle (Hemerythrin (Met), subunit A) 4yn0B00
3PMRA 1TKNA 3K66A 3K6BA 5BUOA 4RD9A 4RDAA 3UMHA 3NYLA 3Q7LA 4YN0B 3UMIA 3QMKA 3Q7GA 3UMKA 3NYJA
chains in the Genus database with same CATH superfamily
1TKNA 4CX9A 1RCPA 1U6HA 5DS6A 1JPJA 3VAYA 2J9BA 3JSEO 2EPNA 3UR3C 2QTVA 4DVZA 2GFHA 4CIPA 3B71A 1QZXA 5DS4A 5KYXB 1HY5A 1PD0A 4XLPF 1NBBA 2JX0A 4ZLDA 2A0UA 2VCBA 4IAOA 4MTFA 3ZWIA 4EKWA 2C04A 3LJBA 3I4UA 4CIHA 3LLIA 5L0GA 3M1CB 1NG1A 4G78A 4YL3A 2XL8A 2KQ9A 3DJUB 2J8WA 2HV6A 4O6NA 3T6GB 3J06A 4O6YA 5L0CA 1GM5A 2YL1A 1CPQA 3AQCA 3S27A 2D4UA 2H8AA 3JZ0A 2XM4A 2D5RB 2L81A 2VASA 3BRJA 3EGXB 1C03A 1Z63A 4I3MA 5KYWA 1M2VB 1NSGB 2Q9BA 2OG2A 3FDQA 3GORA 3H65A 1E86A 1K05A 4JTCB 3EG9B 1BBHA 1H6GA 1LE4A 1V4AA 1LS1A 1YAUO 2LCHA 4K0DA 1T9KA 4AK9A 2UUIA 2R7RA 4I1OB 4A2NB 3EHNA 4IAQA 3V5YA 3V5XA 3SYNA 2KSFA 5EHHA 2KC3A 2ASRA 1A7VA 3Q6MA 1V55C 2AVKA 2CYDA 2X0CA 3KYIA 4FESA 4LLCA 4C7OB 1OW8A 2Z15A 3JYYA 4OD5A 5HSWA 1D0ZA 3NMIA 4XPXA 3JT1A 4CS8C 4E0HA 1RJ9B 3M79A 5A6BD 1YYJA 5COGA 3LESA 1BZ4A 3ITFA 1VMAA 3AG4C 4WGZA 2E87A 1NZEA 3K1IA 4XQ1A 1Z6AA 4UDVA 3GEHA 1O3UA 3EZIA 1ZHYA 1NU9C 3RQEA 1QVXA 1VYIA 2WZLA 1MNEA 3Q7GA 4GQHA 1Q0DA 1EI7A 3JRTA 3C7JA 4HFFB 5F5FA 1XZQA 1WASA 2NPUA 5GPGB 4C3BA 4WGYA 4ONSA 1AEPA 2NG1A 4AX2A 4EHPA 1RMVA 1OKKA 1ZHXA 5E33A 4U5GA 1MNDA 4A4AA 2HZ8A 3B0PA 5T3WA 2V26A 3DE8A 3EGDB 3U9JA 2G62A 1E85A 1A0BA 2BC5A 3U8PA 4G0HA 3VYWA 1FTSA 4NTBA 2OQMA 4XEKA 5KYYA 5BQGA 2GWWA 2R03A 2MWQA 3SXZA 3DD7A 1SF8A 3MYFA 3K66A 4H54A 3TK0A 4MTOA 1VK5A 4YT5A 2UUHA 1T6UA 1IW7F 1J8MF 2XLOA 2Q4FA 1APCA 1OW7A 2A68F 3C8GB 5DQZA 1YARO 2IM8A 4JTAB 4IB4A 2HSBA 4DRJB 3PDMP 4G7ZF 3K7DA 2A69F 4W8KA 3ZDLA 4JURI 3L8JA 4R32A 3U3FA 4J7YA 2FFHA 1YA7O 3DZAA 1HMOA 1PCXA 5A6AA 1AUEA 3DM9B 3KMIA 4LDQA 1CGNA 2H7BA 2R9RB 2YLGA 3ZG1A 1RKEB 1JAFA 4CBEA 5A6KA 2PF4E 3EQLF 2WZFA 4K7BA 5BUOA 1FAPB 1TWHA 1ZW3A 3LNMB 3WAQA 3R7CA 1SMYF 4JTDB 4XTKA 1TWGA 4L6RA 1SR2A 1LS4A 4JCZA 1R4TA 1FR0A 3HLZA 2P7VA 1R5ID 3NMJA 3GANA 4HFKB 4I44A 3I5QA 1G4WR 2B0HA 5TJ5E 4JE9A 2LIGA 3FAPB 1A41A 3IPMO 1G8XA 1OKKD 1M57C 4XPWA 3UMHA 5CIVA 3EZHA 2LP4A 2HV7A 3OA1A 2VB6A 4DOZA 5JSLA 3WG7C 2EIKC 2QNLA 2JPUA 3SXMA 4JVSA 4PJJA 1WGWA 1MMGA 3LS0A 5E2QA 2YHSA 2XS1A 3EH1A 3ABMC 1YZAA 1U89A 3IQ5A 3MYIA 5L3VA 4O7GA 5FZTA 3DJNB 3E70C 2VH3A 1VOMA 2KW3C 3ZTZA 1D0XA 1VLTA 2DYSC 3FOPA 3L0IA 3N0TA 3W4YA 3X2QC 4LERA 5BQIA 5K0IA 2ZXRA 1ORYA 1WATA 1XWJA 3DM5A 3O6XA 4MVRA 3TD7A 2XLVA 2R02A 2F22A 5DVWA 4CDYA 3HTKC 2PP4A 3HNLA 1LIHA 5A6JA 5AC4A 3NYJA 2Q00A 5D91A 1YYXA 2L6FA 3DXJF 4IARA 4PK4A 5JT4A 1SZIA 3OEOA 5L0IA 5HV9A 3U5SA 1FMWA 2GAQA 4CS8A 2HJMA 2QUPA 3EFOB 4BJ5C 2O9XA 2X51A 4Q4ZF 1Q0KA 3SXYA 3UGPA 4PR9A 3ZTMA 2ICWG 4JC7A 3ECSA 2Y3BA 3F46A 1YDIA 2XLHA 3CEXA 2HUJA 2LK4A 1PD1A 4DRHB 5KYNA 1PV3A 2J0WA 4KNWA 2OJQA 3GM1A 1OR3A 4JW1A 4DVYP 4EIYA 2R7XA 1H9TA 1KTMA 5KYWB 4OIRF 1SYQA 1VLSA 4DXWA 5JP7A 2MYSA 2PFDA 3AJMA 3PHF2 1S05A 1WOLA 1MMAA 4OINF 1EQ1A 4YK5A 1I4YA 1CPRA 2LD6A 2OJED 3US6A 2PX0A 3B0VC 4FAPB 2PNOA 2A6HF 4RD9A 4CSAC 1OCRC 256BA 4JJGA 3TULA 2PBEA 2VCAA 3UMIA 4MW8A 2AP3A 2YL7A 4JJFA 5D92A 3CAXA 1NLXA 2A6EF 2XL6A 4HEAJ 3UMKA 2XLDA 2W45A 3T6JA 2ETSA 2L6HA 1W2WA 2OEVA 1A7DA 5L0FA 4EBBA 1HW2A 3VF0A 4Q7CA 3U8VA 2R7SA 1VB5A 3A9CA 1HE1A 3L1MA 4D4XA 1GQAA 3L34A 1WWPA 3IHUA 3IQCA 5AC5A 1F1MA 3KPHA 1M2VA 2DI3A 1RKCA 2EPMX 1Z23A 3SP1A 3FOOA 1Z7Qc 1LVKA 4KBLA 3NDBB 1QKRA 3L8IA 3N24A 2AU5A 1HW1A 3RH3A 3S9OA 1OCZC 3ATPA 1XZPA 3NRHA 4PACA 1ORJA 1OR2A 2Y3HA 2NUTA 3K6BA 2VC9A 2OKUA 2WVQA 3DMDA 4EUKB 1EA8A 4DRIB 5B3IA 2J7PA 1Q0MA 2GDCA 2G3KA 2XLMA 3Q7LA 3QTHA 4U5FE 4PFPA 1G5ZA 4MS2A 4MVQA 4RBNA 2R7UA 1E2XA 3MLGA 2Q7RA 3QZCA 2YLIA 4J7TA 2CW0F 3MBGA 4XLNF 1TWAA 3QMKA 3LLKA 3DWWA 2J45A 5BQHA 2Q3TA 5KYUA 3K1HA 2P6VA 1JR8A 1L7CA 2W4MA 3PCVA 2QLAA 4AE4A 3FMSA 5FCLA 2XXAA 3CZ6A 4MVOA 4MQ9F 5B1BC 3AG2C 3WODF 2J0XA 3NKEA 2XSEA 1YA9A 2KYHA 2DB4A 5T3TA 3UGOA 4M63A 4IJJA 1QSPA 3E9VA 3BEHA 1T6QA 3O55A 4GEHA 4B6IA 5COMA 4CS9C 2M4EA 1ZHTA 1E84A 3K33A 2R7WA 2EIMC 4J32B 5A6BA 2GA0A 5CI8A 1GGQA 2DGJA 2J9VA 1M56C 3EJNA 3NKDA 3O39A 4C3EA 1BR1A 3C8ZA 3O10A 1ZU5A 1I5NA 2XM0A 5CI9A 2IXPA 4PFOA 2CNWA 3QVYA 2JD3A 4YL1A 4C3DA 4E7ZA 4O79A 3TQOA 1YZCA 2MHRA 3M15A 5COFA 4PJMA 4K1OA 3RQGA 3AG1C 1M6TA 3H2UA 3W8HA 5IY5C 4MTGA 2WVNA 2FAPB 1Z5ZA 4JKVA 2B0JA 4QI0A 4HE8D 3TOMA 3G50A 2OU6A 3LEOA 4NC3A 4E0IA 4YT8A 4GYTA 1TFOB 1VYKA 2YVKA 2J7PD 4LLEA 2WVOA 3AQBA 4XEVA 2R7OA 4RDAA 3NYLA 2YZSA 3ZIBA 4ER9A 3G4ZA 5AGFA 3U2MA 4BJ5A 5F28E 1M2OA 2LFFA 1O5HA 3POVA 1BR2A 2I15A 1G4US 2ZPAA 1D1AA 2Q9CA 3LAYA 2A1DD 2R7VA 3S29A 4E17A 3VRCA 3JCUQ 1ORSC 2KNHA 2NUPA 2Y3DA 3W2VA 3TJ6A 2R25A 3N2ZB 4QDLA 4ANJA 2OEXA 3SEOA 4CDAA 2HFIA 2L6GA 5L3QA 3MX3A 4DJ9A 5L0DA 3SZRA 4G7OF 4U5BE 2KK1A 3ABKC 3MFNA 4FWVA 4JEAA 4XPYA 1ST6A 3M4BA 3U0CA 4CSAA 5JUAA 3FVYA 1ZZPA 1FFTC 2W4BA 3M4CA 4F4BA 4U5CE 1AVOB 3FHDA 3RW0A 3ZSUA 1RXQA 5E3CA 4ZLCA 1JMWA 1MMNA 2OOCA 2PX3A 3EPVA 3NG1A 5E3AA 1NU7D 4DBQA 1CGME 4OD4A 4YJWA 4ULVA 2RD9A 4MW3A 2CNWD 5JS5A 4J30B 2EPKX 1OXBA 3KKBA 3T6BA 3ABLC 2HS5A 4PJNA 2Y39A 1N1CA 2L9JA 4BJ6C 1OCOC 3ZVRA 4E18A 2A0BA 4P9TA 1DOWA 4LDKA 1HMDA 2XLEA 3GEEA 4MVSA 4AL1A 1A7EA 5F5HA 1FFHA 1LE2A 3LUTB 4N6HA 2RSEB 2QY9A 3B29A 2YL0A 1O87A 1Z3IX 1H9GA 4CJGA 2HMQA 3S90A 2ZXPA 3T4RA 5KYXA 4I1MA 3IQ6A 5B1AC 3H2VA 5L0JA 4Z9IA 4YN0B 1JPNA 3RQFA 1S7ZA 4H4KC 4X0RA 3HNKA 1K40A 4IGGA 3EFOA 4NQFA 4U5DE 4W8PA 2P0NA 4ULWA 3AOUA 1TFKB 2XS8A 4NCQA 3DKAA 4CS7A 4YWQA 5JLIA 3I5PA 4LACB 4G7HF 2EINC 1MMDA 1JOGA 2CDQA 3QVZA 3JYHA 2Q9AA 3B0UX 3EGXA 3ZQVA 2QE9A 4JZAA 4EBKA 2P1AA 4KNVA 3ZC4A 1CGOA 4Z9JA 3SXKA 1D1CA 5L0HA 1NFOA 1Y4CA 3LEVA 5DLJA 4XEFA 4YT2A 4CS9A 2HKVA 1D0YA 1YLMA 3EG9A 3LNRA 2AWCA 3C18A 3QW0A 1K04A 4NY3A 2KJGA 2YLDA 3A11A 3SNHA 4OIPF 1GS9A 2NUTB 4BPMA 3CQZA 1TQGA 1E83A 1T5OA 3JSZA 2ZXOA 3GODA 1JRAA 2XL4A 2Y69C 3DE9A 3KH2A 4MVUA 1KU2A 1DOVA 3ASNC 3KL4A 3RKOF 5DS5A 4C7OA 2NSFA 2H7OA 4P9FA 1J8YF 4JIOA 1L3PA 3U9MA 4BJTA 2IYLD 1OCCC 2R7QA 3HNIA 3ZQYA 1RJ9A 2YWAA 2Y3GA 2R05A 4N4WA 5KYUB 4AE4B 2XXAB 5T1DB 3AGUA 2HMZA 1T01A 1TR2A 2H7VC 3ASOC 5A69A 3PMRA 3RIPA 5KYYB 4MNDA 3U3BA 2G3VA 2HJ3A 1LKXA 4KC9A 3JRMO 1OW6A 1I4ZA 1MQVA 1BDJB 1ZYRF 1ZW2A 3DAFA 1WTYA 1C17M 5JRAA 4IWBA 4U9EA 4N6CA 1Y6DA 3RVYA 2J9WA 3NMKA 1NFNA 2OCCC 2WZGA 3DI5A 2M64A 4Z9HA 2XLWA 2ZD9A 3RF3A 4CJOA 2YRFA 3FAJA 1LI5A 3EGDA 1V74B 1ZU4A 2ZXWC 3U2LA 2LFDA 4BJ1A 2TMVP 3EHMA 4KI2A 4OIOF 2EIJC 2EILC 1QQ3A 2W9YA 2EPLX 4YL0A 5EK0A 3S84A 4Q5SF 3TOLA 1ZHZA 1BR4A 3NYMA 2NSGA 3V5ZA 2WB7A 4N06A 4WJ0A 3X1OA 3AG3C 1FMVA 3KYJA 3DAGA 3EH2A 3C8GA 3G4XA 5EGYA 3B9QA 3HJCA 4AL0A 2KGOA 2R7TA 2WL8A 2YEVA 1KNYA 1LPEA 2P61A 2YL3A 4U9DA 3Q6NA 4JEBA 3RFYA 4NTFA 3RYLA 2IXMA 1ZHWA 2J9UA 2LSEA 3W2WA 3K1IC 2V3CC 1QLEC 3LS1A 2AWYA 4IRUA 2J46A 4U5EE 4BEJA 4PJLA 5DQTA 2LQGA 3TJ5A 4BJ6A 1UG7A 1T6IA 1C02A 4EBJA 1LM3B 4D4NA 1RKEA 2CCYA 2XRHA 4E7SA 4BG0A 2IXNA 2NUPB 1B68A 2FGYA 1YVIA 1ZVZA 2BL2A 2IOQA 3FXHA 3VM6A 4MVZA 2BE5F 4JRZA 1YJGA 1HE9A 1TWCA 1WN0A 3R2PA 2C03A 1Q0FA 4NTAA 3HKKA 1VTMP 2HSQA 3IEEA 4EWCA 3QW1A 4FX5A 3AGTA 1OXKA 1QPUA 1V54C 3OWTA 4XWJA 2EPOA 3GWLA 2YQYA 4DBRA 3HNJA 3JTLO 5B3SC 3GM3A 4LDRA 3CSKA 3W8IA 1IZMA 4CDVA 2L7AA 1UFBA 4U5HA 4BEMJ 1D1BA 4P6IC 4QI2A 1EKYA 1U0BB 3T9OA 2IXOA 3GM2A 4YT4A 3WHNA 5JVEA 2VCCA 1OQCA 2YKZA 3GEIA 1FNTc 3F47A 4MVMA 2DYRC 2IBFA 2I8BA 1H7IA 3UNGC 3S0XA 3RVZA 4OIQF 1LI7A 1Q0GA 2CGEA 4JCHA 3V7OA 3C63A 3C8GD 3GWNA 3C62A 4O6MA 3S28A 4WABA 3IQTA
chains in the Genus database with same CATH topology
1TKNA 5DS6A 1JPJA 3VAYA 3UR3C 2QTVA 4DVZA 2GFHA 1QZXA 5DS4A 5KYXB 4XLPF 1PD0A 4ZLDA 4IAOA 2C04A 3LJBA 3I4UA 4CIHA 3LLIA 3M1CB 1NG1A 2KQ9A 3DJUB 2HV6A 4O6NA 4O6YA 3AQCA 3S27A 2D5RB 2L81A 2VASA 3EGXB 1Z63A 4I3MA 5KYWA 1M2VB 2Q9BA 2OG2A 3FDQA 3H65A 3EG9B 4AK9A 4K0DA 1LS1A 2R7RA 4I1OB 4A2NB 3EHNA 3SYNA 5EHHA 3Q6MA 1V55C 4FESA 4LLCA 4C7OB 2Z15A 5HSWA 4OD5A 1D0ZA 3JT1A 4CS8C 1RJ9B 3LESA 3ITFA 1VMAA 3AG4C 2E87A 1NZEA 1Z6AA 3EZIA 1ZHYA 1NU9C 2WZLA 1VYIA 1MNEA 3Q7GA 3JRTA 4HFFB 5F5FA 4C3BA 4AX2A 2NG1A 1OKKA 1ZHXA 5E33A 4U5GA 1MNDA 3B0PA 5T3WA 2V26A 3EGDB 2G62A 4G0HA 3VYWA 1FTSA 5KYYA 2MWQA 3DD7A 1SF8A 3K66A 1VK5A 4YT5A 1IW7F 1J8MF 2A68F 5DQZA 4G7ZF 3K7DA 2A69F 4W8KA 4JURI 2FFHA 3DZAA 1PCXA 3KMIA 3DM9B 2H7BA 3ZG1A 4CBEA 2PF4E 3EQLF 2WZFA 4K7BA 5BUOA 1TWHA 1SMYF 4XTKA 1TWGA 3HLZA 2P7VA 3GANA 4HFKB 4I44A 3I5QA 1G8XA 1OKKD 1M57C 3UMHA 3EZHA 2HV7A 3OA1A 2VB6A 4DOZA 3WG7C 2EIKC 4JVSA 4PJJA 1WGWA 1MMGA 3LS0A 5E2QA 2YHSA 3EH1A 3ABMC 5L3VA 4O7GA 3DJNB 3E70C 2VH3A 1VOMA 2KW3C 1D0XA 3L0IA 2DYSC 3N0TA 3X2QC 4LERA 2ZXRA 3DM5A 3O6XA 3TD7A 5DVWA 3HTKC 2PP4A 3NYJA 5D91A 3DXJF 4PK4A 1SZIA 3OEOA 1FMWA 4CS8A 3EFOB 4BJ5C 2O9XA 2X51A 4Q4ZF 3UGPA 3ECSA 2Y3BA 3F46A 1PD1A 5KYNA 4KNWA 2J0WA 4DVYP 4JW1A 2R7XA 5KYWB 4OIRF 2MYSA 2PFDA 3PHF2 1MMAA 4OINF 2PX0A 3B0VC 2A6HF 4RD9A 4CSAC 1OCRC 4JJGA 3UMIA 4JJFA 5D92A 3UMKA 2A6EF 4HEAJ 3T6JA 2W45A 1W2WA 4EBBA 4Q7CA 2R7SA 3L34A 1M2VA 1Z23A 3SP1A 3NDBB 1LVKA 4KBLA 3N24A 3RH3A 1OCZC 3NRHA 2Y3HA 2NUTA 3K6BA 2WVQA 3DMDA 2J7PA 3Q7LA 2G3KA 4U5FE 4PFPA 4RBNA 2R7UA 3MLGA 3QZCA 2CW0F 4XLNF 1TWAA 3QMKA 3LLKA 2J45A 2Q3TA 5KYUA 3K1HA 2P6VA 2W4MA 4AE4A 2XXAA 5FCLA 3CZ6A 5B1BC 4MQ9F 3AG2C 3WODF 2J0XA 3NKEA 2XSEA 5T3TA 3UGOA 4M63A 4IJJA 4B6IA 3E9VA 4GEHA 4CS9C 2M4EA 1ZHTA 3K33A 2R7WA 2EIMC 4J32B 5CI8A 2DGJA 2J9VA 3NKDA 1M56C 3EJNA 3O39A 4C3EA 1BR1A 5CI9A 1ZU5A 2IXPA 4PFOA 2CNWA 2JD3A 4C3DA 4E7ZA 4O79A 4PJMA 3AG1C 3W8HA 5IY5C 2WVNA 1Z5ZA 2B0JA 4QI0A 4HE8D 4YT8A 4GYTA 1VYKA 2J7PD 4LLEA 2WVOA 3AQBA 2R7OA 4RDAA 3NYLA 2YZSA 3ZIBA 4BJ5A 1M2OA 1O5HA 3POVA 1BR2A 2ZPAA 3LAYA 2R7VA 1D1AA 2Q9CA 2A1DD 3S29A 3JCUQ 2KNHA 2NUPA 2Y3DA 3W2VA 3N2ZB 4QDLA 4ANJA 3SEOA 5L3QA 3MX3A 3SZRA 4G7OF 4U5BE 3ABKC 4FWVA 1ST6A 4CSAA 3FVYA 1FFTC 2W4BA 4F4BA 4U5CE 3FHDA 3ZSUA 5E3CA 4ZLCA 1MMNA 2PX3A 3EPVA 3NG1A 5E3AA 1NU7D 4DBQA 4OD4A 4YJWA 2CNWD 4J30B 3T6BA 3KKBA 3ABLC 4PJNA 2Y39A 1N1CA 2L9JA 4BJ6C 1OCOC 3ZVRA 5F5HA 1FFHA 2QY9A 1O87A 1Z3IX 2ZXPA 3T4RA 5KYXA 4I1MA 5B1AC 4YN0B 1JPNA 1S7ZA 4H4KC 4X0RA 3EFOA 4U5DE 4ULWA 4YWQA 4CS7A 3I5PA 4LACB 2EINC 1MMDA 2CDQA 3JYHA 2Q9AA 3B0UX 3EGXA 4JZAA 4KNVA 3ZC4A 1D1CA 3LEVA 5DLJA 4YT2A 4CS9A 1D0YA 3EG9A 3LNRA 4NY3A 2KJGA 3SNHA 4OIPF 2NUTB 3CQZA 3JSZA 2ZXOA 3GODA 2XL4A 2Y69C 3RKOF 3KH2A 5DS5A 1KU2A 3ASNC 3KL4A 4C7OA 2H7OA 1J8YF 4BJTA 2IYLD 1OCCC 2R7QA 1RJ9A 2Y3GA 5KYUB 4AE4B 2XXAB 5T1DB 3ASOC 1TR2A 2H7VC 3PMRA 3RIPA 5KYYB 4MNDA 2G3VA 1LKXA 4KC9A 1ZYRF 3DAFA 4IWBA 2J9WA 2WZGA 2OCCC 3FAJA 3EGDA 1ZU4A 4BJ1A 2ZXWC 4KI2A 4OIOF 3EHMA 2EIJC 2EILC 2W9YA 4Q5SF 1ZHZA 1BR4A 3NYMA 3X1OA 2WB7A 4N06A 4WJ0A 3AG3C 1FMVA 3DAGA 3EH2A 5EGYA 3HJCA 3B9QA 2KGOA 2R7TA 2WL8A 2YEVA 3RFYA 3Q6NA 3RYLA 2IXMA 1ZHWA 2J9UA 2LSEA 3W2WA 3K1IC 2V3CC 1QLEC 3LS1A 4IRUA 2J46A 4U5EE 4BEJA 4PJLA 5DQTA 4BJ6A 2XRHA 4E7SA 4BG0A 2IXNA 2NUPB 2FGYA 2IOQA 2BE5F 1TWCA 2C03A 3IEEA 4EWCA 4FX5A 1V54C 3OWTA 4XWJA 4DBRA 5B3SC 3CSKA 3W8IA 1IZMA 4U5HA 4QI2A 1D1BA 4P6IC 2IXOA 4YT4A 3F47A 2DYRC 2I8BA 3UNGC 3S0XA 4OIQF 3V7OA 2CGEA 4JCHA 4G7HF 4O6MA 3S28A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3PMR A;  1TKN A;  3K66 A;  3K6B A;  5BUO A;  4RD9 A;  4RDA A;  3UMH A;  3NYL A;  3Q7L A;  4YN0 B;  3UMI A;  3QMK A;  3Q7G A;  3UMK A;  3NYJ A; 
#chains in the Genus database with same CATH topology
 1TKN A;  4CX9 A;  1RCP A;  1U6H A;  5DS6 A;  1JPJ A;  3VAY A;  2J9B A;  3JSE O;  2EPN A;  3UR3 C;  2QTV A;  4DVZ A;  2GFH A;  4CIP A;  3B71 A;  1QZX A;  5DS4 A;  5KYX B;  1HY5 A;  1PD0 A;  4XLP F;  1NBB A;  2JX0 A;  4ZLD A;  2A0U A;  2VCB A;  4IAO A;  4MTF A;  3ZWI A;  4EKW A;  2C04 A;  3LJB A;  3I4U A;  4CIH A;  3LLI A;  5L0G A;  3M1C B;  1NG1 A;  4G78 A;  4YL3 A;  2XL8 A;  2KQ9 A;  3DJU B;  2J8W A;  2HV6 A;  4O6N A;  3T6G B;  3J06 A;  4O6Y A;  5L0C A;  1GM5 A;  2YL1 A;  1CPQ A;  3AQC A;  3S27 A;  2D4U A;  2H8A A;  3JZ0 A;  2XM4 A;  2D5R B;  2L81 A;  2VAS A;  3BRJ A;  3EGX B;  1C03 A;  1Z63 A;  4I3M A;  5KYW A;  1M2V B;  1NSG B;  2Q9B A;  2OG2 A;  3FDQ A;  3GOR A;  3H65 A;  1E86 A;  1K05 A;  4JTC B;  3EG9 B;  1BBH A;  1H6G A;  1LE4 A;  1V4A A;  1LS1 A;  1YAU O;  2LCH A;  4K0D A;  1T9K A;  4AK9 A;  2UUI A;  2R7R A;  4I1O B;  4A2N B;  3EHN A;  4IAQ A;  3V5Y A;  3V5X A;  3SYN A;  2KSF A;  5EHH A;  2KC3 A;  2ASR A;  1A7V A;  3Q6M A;  1V55 C;  2AVK A;  2CYD A;  2X0C A;  3KYI A;  4FES A;  4LLC A;  4C7O B;  1OW8 A;  2Z15 A;  3JYY A;  4OD5 A;  5HSW A;  1D0Z A;  3NMI A;  4XPX A;  3JT1 A;  4CS8 C;  4E0H A;  1RJ9 B;  3M79 A;  5A6B D;  1YYJ A;  5COG A;  3LES A;  1BZ4 A;  3ITF A;  1VMA A;  3AG4 C;  4WGZ A;  2E87 A;  1NZE A;  3K1I A;  4XQ1 A;  1Z6A A;  4UDV A;  3GEH A;  1O3U A;  3EZI A;  1ZHY A;  1NU9 C;  3RQE A;  1QVX A;  1VYI A;  2WZL A;  1MNE A;  3Q7G A;  4GQH A;  1Q0D A;  1EI7 A;  3JRT A;  3C7J A;  4HFF B;  5F5F A;  1XZQ A;  1WAS A;  2NPU A;  5GPG B;  4C3B A;  4WGY A;  4ONS A;  1AEP A;  2NG1 A;  4AX2 A;  4EHP A;  1RMV A;  1OKK A;  1ZHX A;  5E33 A;  4U5G A;  1MND A;  4A4A A;  2HZ8 A;  3B0P A;  5T3W A;  2V26 A;  3DE8 A;  3EGD B;  3U9J A;  2G62 A;  1E85 A;  1A0B A;  2BC5 A;  3U8P A;  4G0H A;  3VYW A;  1FTS A;  4NTB A;  2OQM A;  4XEK A;  5KYY A;  5BQG A;  2GWW A;  2R03 A;  2MWQ A;  3SXZ A;  3DD7 A;  1SF8 A;  3MYF A;  3K66 A;  4H54 A;  3TK0 A;  4MTO A;  1VK5 A;  4YT5 A;  2UUH A;  1T6U A;  1IW7 F;  1J8M F;  2XLO A;  2Q4F A;  1APC A;  1OW7 A;  2A68 F;  3C8G B;  5DQZ A;  1YAR O;  2IM8 A;  4JTA B;  4IB4 A;  2HSB A;  4DRJ B;  3PDM P;  4G7Z F;  3K7D A;  2A69 F;  4W8K A;  3ZDL A;  4JUR I;  3L8J A;  4R32 A;  3U3F A;  4J7Y A;  2FFH A;  1YA7 O;  3DZA A;  1HMO A;  1PCX A;  5A6A A;  1AUE A;  3DM9 B;  3KMI A;  4LDQ A;  1CGN A;  2H7B A;  2R9R B;  2YLG A;  3ZG1 A;  1RKE B;  1JAF A;  4CBE A;  5A6K A;  2PF4 E;  3EQL F;  2WZF A;  4K7B A;  5BUO A;  1FAP B;  1TWH A;  1ZW3 A;  3LNM B;  3WAQ A;  3R7C A;  1SMY F;  4JTD B;  4XTK A;  1TWG A;  4L6R A;  1SR2 A;  1LS4 A;  4JCZ A;  1R4T A;  1FR0 A;  3HLZ A;  2P7V A;  1R5I D;  3NMJ A;  3GAN A;  4HFK B;  4I44 A;  3I5Q A;  1G4W R;  2B0H A;  5TJ5 E;  4JE9 A;  2LIG A;  3FAP B;  1A41 A;  3IPM O;  1G8X A;  1OKK D;  1M57 C;  4XPW A;  3UMH A;  5CIV A;  3EZH A;  2LP4 A;  2HV7 A;  3OA1 A;  2VB6 A;  4DOZ A;  5JSL A;  3WG7 C;  2EIK C;  2QNL A;  2JPU A;  3SXM A;  4JVS A;  4PJJ A;  1WGW A;  1MMG A;  3LS0 A;  5E2Q A;  2YHS A;  2XS1 A;  3EH1 A;  3ABM C;  1YZA A;  1U89 A;  3IQ5 A;  3MYI A;  5L3V A;  4O7G A;  5FZT A;  3DJN B;  3E70 C;  2VH3 A;  1VOM A;  2KW3 C;  3ZTZ A;  1D0X A;  1VLT A;  2DYS C;  3FOP A;  3L0I A;  3N0T A;  3W4Y A;  3X2Q C;  4LER A;  5BQI A;  5K0I A;  2ZXR A;  1ORY A;  1WAT A;  1XWJ A;  3DM5 A;  3O6X A;  4MVR A;  3TD7 A;  2XLV A;  2R02 A;  2F22 A;  5DVW A;  4CDY A;  3HTK C;  2PP4 A;  3HNL A;  1LIH A;  5A6J A;  5AC4 A;  3NYJ A;  2Q00 A;  5D91 A;  1YYX A;  2L6F A;  3DXJ F;  4IAR A;  4PK4 A;  5JT4 A;  1SZI A;  3OEO A;  5L0I A;  5HV9 A;  3U5S A;  1FMW A;  2GAQ A;  4CS8 A;  2HJM A;  2QUP A;  3EFO B;  4BJ5 C;  2O9X A;  2X51 A;  4Q4Z F;  1Q0K A;  3SXY A;  3UGP A;  4PR9 A;  3ZTM A;  2ICW G;  4JC7 A;  3ECS A;  2Y3B A;  3F46 A;  1YDI A;  2XLH A;  3CEX A;  2HUJ A;  2LK4 A;  1PD1 A;  4DRH B;  5KYN A;  1PV3 A;  2J0W A;  4KNW A;  2OJQ A;  3GM1 A;  1OR3 A;  4JW1 A;  4DVY P;  4EIY A;  2R7X A;  1H9T A;  1KTM A;  5KYW B;  4OIR F;  1SYQ A;  1VLS A;  4DXW A;  5JP7 A;  2MYS A;  2PFD A;  3AJM A;  3PHF 2;  1S05 A;  1WOL A;  1MMA A;  4OIN F;  1EQ1 A;  4YK5 A;  1I4Y A;  1CPR A;  2LD6 A;  2OJE D;  3US6 A;  2PX0 A;  3B0V C;  4FAP B;  2PNO A;  2A6H F;  4RD9 A;  4CSA C;  1OCR C;  256B A;  4JJG A;  3TUL A;  2PBE A;  2VCA A;  3UMI A;  4MW8 A;  2AP3 A;  2YL7 A;  4JJF A;  5D92 A;  3CAX A;  1NLX A;  2A6E F;  2XL6 A;  4HEA J;  3UMK A;  2XLD A;  2W45 A;  3T6J A;  2ETS A;  2L6H A;  1W2W A;  2OEV A;  1A7D A;  5L0F A;  4EBB A;  1HW2 A;  3VF0 A;  4Q7C A;  3U8V A;  2R7S A;  1VB5 A;  3A9C A;  1HE1 A;  3L1M A;  4D4X A;  1GQA A;  3L34 A;  1WWP A;  3IHU A;  3IQC A;  5AC5 A;  1F1M A;  3KPH A;  1M2V A;  2DI3 A;  1RKC A;  2EPM X;  1Z23 A;  3SP1 A;  3FOO A;  1Z7Q c;  1LVK A;  4KBL A;  3NDB B;  1QKR A;  3L8I A;  3N24 A;  2AU5 A;  1HW1 A;  3RH3 A;  3S9O A;  1OCZ C;  3ATP A;  1XZP A;  3NRH A;  4PAC A;  1ORJ A;  1OR2 A;  2Y3H A;  2NUT A;  3K6B A;  2VC9 A;  2OKU A;  2WVQ A;  3DMD A;  4EUK B;  1EA8 A;  4DRI B;  5B3I A;  2J7P A;  1Q0M A;  2GDC A;  2G3K A;  2XLM A;  3Q7L A;  3QTH A;  4U5F E;  4PFP A;  1G5Z A;  4MS2 A;  4MVQ A;  4RBN A;  2R7U A;  1E2X A;  3MLG A;  2Q7R A;  3QZC A;  2YLI A;  4J7T A;  2CW0 F;  3MBG A;  4XLN F;  1TWA A;  3QMK A;  3LLK A;  3DWW A;  2J45 A;  5BQH A;  2Q3T A;  5KYU A;  3K1H A;  2P6V A;  1JR8 A;  1L7C A;  2W4M A;  3PCV A;  2QLA A;  4AE4 A;  3FMS A;  5FCL A;  2XXA A;  3CZ6 A;  4MVO A;  4MQ9 F;  5B1B C;  3AG2 C;  3WOD F;  2J0X A;  3NKE A;  2XSE A;  1YA9 A;  2KYH A;  2DB4 A;  5T3T A;  3UGO A;  4M63 A;  4IJJ A;  1QSP A;  3E9V A;  3BEH A;  1T6Q A;  3O55 A;  4GEH A;  4B6I A;  5COM A;  4CS9 C;  2M4E A;  1ZHT A;  1E84 A;  3K33 A;  2R7W A;  2EIM C;  4J32 B;  5A6B A;  2GA0 A;  5CI8 A;  1GGQ A;  2DGJ A;  2J9V A;  1M56 C;  3EJN A;  3NKD A;  3O39 A;  4C3E A;  1BR1 A;  3C8Z A;  3O10 A;  1ZU5 A;  1I5N A;  2XM0 A;  5CI9 A;  2IXP A;  4PFO A;  2CNW A;  3QVY A;  2JD3 A;  4YL1 A;  4C3D A;  4E7Z A;  4O79 A;  3TQO A;  1YZC A;  2MHR A;  3M15 A;  5COF A;  4PJM A;  4K1O A;  3RQG A;  3AG1 C;  1M6T A;  3H2U A;  3W8H A;  5IY5 C;  4MTG A;  2WVN A;  2FAP B;  1Z5Z A;  4JKV A;  2B0J A;  4QI0 A;  4HE8 D;  3TOM A;  3G50 A;  2OU6 A;  3LEO A;  4NC3 A;  4E0I A;  4YT8 A;  4GYT A;  1TFO B;  1VYK A;  2YVK A;  2J7P D;  4LLE A;  2WVO A;  3AQB A;  4XEV A;  2R7O A;  4RDA A;  3NYL A;  2YZS A;  3ZIB A;  4ER9 A;  3G4Z A;  5AGF A;  3U2M A;  4BJ5 A;  5F28 E;  1M2O A;  2LFF A;  1O5H A;  3POV A;  1BR2 A;  2I15 A;  1G4U S;  2ZPA A;  1D1A A;  2Q9C A;  3LAY A;  2A1D D;  2R7V A;  3S29 A;  4E17 A;  3VRC A;  3JCU Q;  1ORS C;  2KNH A;  2NUP A;  2Y3D A;  3W2V A;  3TJ6 A;  2R25 A;  3N2Z B;  4QDL A;  4ANJ A;  2OEX A;  3SEO A;  4CDA A;  2HFI A;  2L6G A;  5L3Q A;  3MX3 A;  4DJ9 A;  5L0D A;  3SZR A;  4G7O F;  4U5B E;  2KK1 A;  3ABK C;  3MFN A;  4FWV A;  4JEA A;  4XPY A;  1ST6 A;  3M4B A;  3U0C A;  4CSA A;  5JUA A;  3FVY A;  1ZZP A;  1FFT C;  2W4B A;  3M4C A;  4F4B A;  4U5C E;  1AVO B;  3FHD A;  3RW0 A;  3ZSU A;  1RXQ A;  5E3C A;  4ZLC A;  1JMW A;  1MMN A;  2OOC A;  2PX3 A;  3EPV A;  3NG1 A;  5E3A A;  1NU7 D;  4DBQ A;  1CGM E;  4OD4 A;  4YJW A;  4ULV A;  2RD9 A;  4MW3 A;  2CNW D;  5JS5 A;  4J30 B;  2EPK X;  1OXB A;  3KKB A;  3T6B A;  3ABL C;  2HS5 A;  4PJN A;  2Y39 A;  1N1C A;  2L9J A;  4BJ6 C;  1OCO C;  3ZVR A;  4E18 A;  2A0B A;  4P9T A;  1DOW A;  4LDK A;  1HMD A;  2XLE A;  3GEE A;  4MVS A;  4AL1 A;  1A7E A;  5F5H A;  1FFH A;  1LE2 A;  3LUT B;  4N6H A;  2RSE B;  2QY9 A;  3B29 A;  2YL0 A;  1O87 A;  1Z3I X;  1H9G A;  4CJG A;  2HMQ A;  3S90 A;  2ZXP A;  3T4R A;  5KYX A;  4I1M A;  3IQ6 A;  5B1A C;  3H2V A;  5L0J A;  4Z9I A;  4YN0 B;  1JPN A;  3RQF A;  1S7Z A;  4H4K C;  4X0R A;  3HNK A;  1K40 A;  4IGG A;  3EFO A;  4NQF A;  4U5D E;  4W8P A;  2P0N A;  4ULW A;  3AOU A;  1TFK B;  2XS8 A;  4NCQ A;  3DKA A;  4CS7 A;  4YWQ A;  5JLI A;  3I5P A;  4LAC B;  4G7H F;  2EIN C;  1MMD A;  1JOG A;  2CDQ A;  3QVZ A;  3JYH A;  2Q9A A;  3B0U X;  3EGX A;  3ZQV A;  2QE9 A;  4JZA A;  4EBK A;  2P1A A;  4KNV A;  3ZC4 A;  1CGO A;  4Z9J A;  3SXK A;  1D1C A;  5L0H A;  1NFO A;  1Y4C A;  3LEV A;  5DLJ A;  4XEF A;  4YT2 A;  4CS9 A;  2HKV A;  1D0Y A;  1YLM A;  3EG9 A;  3LNR A;  2AWC A;  3C18 A;  3QW0 A;  1K04 A;  4NY3 A;  2KJG A;  2YLD A;  3A11 A;  3SNH A;  4OIP F;  1GS9 A;  2NUT B;  4BPM A;  3CQZ A;  1TQG A;  1E83 A;  1T5O A;  3JSZ A;  2ZXO A;  3GOD A;  1JRA A;  2XL4 A;  2Y69 C;  3DE9 A;  3KH2 A;  4MVU A;  1KU2 A;  1DOV A;  3ASN C;  3KL4 A;  3RKO F;  5DS5 A;  4C7O A;  2NSF A;  2H7O A;  4P9F A;  1J8Y F;  4JIO A;  1L3P A;  3U9M A;  4BJT A;  2IYL D;  1OCC C;  2R7Q A;  3HNI A;  3ZQY A;  1RJ9 A;  2YWA A;  2Y3G A;  2R05 A;  4N4W A;  5KYU B;  4AE4 B;  2XXA B;  5T1D B;  3AGU A;  2HMZ A;  1T01 A;  1TR2 A;  2H7V C;  3ASO C;  5A69 A;  3PMR A;  3RIP A;  5KYY B;  4MND A;  3U3B A;  2G3V A;  2HJ3 A;  1LKX A;  4KC9 A;  3JRM O;  1OW6 A;  1I4Z A;  1MQV A;  1BDJ B;  1ZYR F;  1ZW2 A;  3DAF A;  1WTY A;  1C17 M;  5JRA A;  4IWB A;  4U9E A;  4N6C A;  1Y6D A;  3RVY A;  2J9W A;  3NMK A;  1NFN A;  2OCC C;  2WZG A;  3DI5 A;  2M64 A;  4Z9H A;  2XLW A;  2ZD9 A;  3RF3 A;  4CJO A;  2YRF A;  3FAJ A;  1LI5 A;  3EGD A;  1V74 B;  1ZU4 A;  2ZXW C;  3U2L A;  2LFD A;  4BJ1 A;  2TMV P;  3EHM A;  4KI2 A;  4OIO F;  2EIJ C;  2EIL C;  1QQ3 A;  2W9Y A;  2EPL X;  4YL0 A;  5EK0 A;  3S84 A;  4Q5S F;  3TOL A;  1ZHZ A;  1BR4 A;  3NYM A;  2NSG A;  3V5Z A;  2WB7 A;  4N06 A;  4WJ0 A;  3X1O A;  3AG3 C;  1FMV A;  3KYJ A;  3DAG A;  3EH2 A;  3C8G A;  3G4X A;  5EGY A;  3B9Q A;  3HJC A;  4AL0 A;  2KGO A;  2R7T A;  2WL8 A;  2YEV A;  1KNY A;  1LPE A;  2P61 A;  2YL3 A;  4U9D A;  3Q6N A;  4JEB A;  3RFY A;  4NTF A;  3RYL A;  2IXM A;  1ZHW A;  2J9U A;  2LSE A;  3W2W A;  3K1I C;  2V3C C;  1QLE C;  3LS1 A;  2AWY A;  4IRU A;  2J46 A;  4U5E E;  4BEJ A;  4PJL A;  5DQT A;  2LQG A;  3TJ5 A;  4BJ6 A;  1UG7 A;  1T6I A;  1C02 A;  4EBJ A;  1LM3 B;  4D4N A;  1RKE A;  2CCY A;  2XRH A;  4E7S A;  4BG0 A;  2IXN A;  2NUP B;  1B68 A;  2FGY A;  1YVI A;  1ZVZ A;  2BL2 A;  2IOQ A;  3FXH A;  3VM6 A;  4MVZ A;  2BE5 F;  4JRZ A;  1YJG A;  1HE9 A;  1TWC A;  1WN0 A;  3R2P A;  2C03 A;  1Q0F A;  4NTA A;  3HKK A;  1VTM P;  2HSQ A;  3IEE A;  4EWC A;  3QW1 A;  4FX5 A;  3AGT A;  1OXK A;  1QPU A;  1V54 C;  3OWT A;  4XWJ A;  2EPO A;  3GWL A;  2YQY A;  4DBR A;  3HNJ A;  3JTL O;  5B3S C;  3GM3 A;  4LDR A;  3CSK A;  3W8I A;  1IZM A;  4CDV A;  2L7A A;  1UFB A;  4U5H A;  4BEM J;  1D1B A;  4P6I C;  4QI2 A;  1EKY A;  1U0B B;  3T9O A;  2IXO A;  3GM2 A;  4YT4 A;  3WHN A;  5JVE A;  2VCC A;  1OQC A;  2YKZ A;  3GEI A;  1FNT c;  3F47 A;  4MVM A;  2DYR C;  2IBF A;  2I8B A;  1H7I A;  3UNG C;  3S0X A;  3RVZ A;  4OIQ F;  1LI7 A;  1Q0G A;  2CGE A;  4JCH A;  3V7O A;  3C63 A;  3C8G D;  3GWN A;  3C62 A;  4O6M A;  3S28 A;  4WAB A;  3IQT A; 
#chains in the Genus database with same CATH homology
 1TKN A;  5DS6 A;  1JPJ A;  3VAY A;  3UR3 C;  2QTV A;  4DVZ A;  2GFH A;  1QZX A;  5DS4 A;  5KYX B;  4XLP F;  1PD0 A;  4ZLD A;  4IAO A;  2C04 A;  3LJB A;  3I4U A;  4CIH A;  3LLI A;  3M1C B;  1NG1 A;  2KQ9 A;  3DJU B;  2HV6 A;  4O6N A;  4O6Y A;  3AQC A;  3S27 A;  2D5R B;  2L81 A;  2VAS A;  3EGX B;  1Z63 A;  4I3M A;  5KYW A;  1M2V B;  2Q9B A;  2OG2 A;  3FDQ A;  3H65 A;  3EG9 B;  4AK9 A;  4K0D A;  1LS1 A;  2R7R A;  4I1O B;  4A2N B;  3EHN A;  3SYN A;  5EHH A;  3Q6M A;  1V55 C;  4FES A;  4LLC A;  4C7O B;  2Z15 A;  5HSW A;  4OD5 A;  1D0Z A;  3JT1 A;  4CS8 C;  1RJ9 B;  3LES A;  3ITF A;  1VMA A;  3AG4 C;  2E87 A;  1NZE A;  1Z6A A;  3EZI A;  1ZHY A;  1NU9 C;  2WZL A;  1VYI A;  1MNE A;  3Q7G A;  3JRT A;  4HFF B;  5F5F A;  4C3B A;  4AX2 A;  2NG1 A;  1OKK A;  1ZHX A;  5E33 A;  4U5G A;  1MND A;  3B0P A;  5T3W A;  2V26 A;  3EGD B;  2G62 A;  4G0H A;  3VYW A;  1FTS A;  5KYY A;  2MWQ A;  3DD7 A;  1SF8 A;  3K66 A;  1VK5 A;  4YT5 A;  1IW7 F;  1J8M F;  2A68 F;  5DQZ A;  4G7Z F;  3K7D A;  2A69 F;  4W8K A;  4JUR I;  2FFH A;  3DZA A;  1PCX A;  3KMI A;  3DM9 B;  2H7B A;  3ZG1 A;  4CBE A;  2PF4 E;  3EQL F;  2WZF A;  4K7B A;  5BUO A;  1TWH A;  1SMY F;  4XTK A;  1TWG A;  3HLZ A;  2P7V A;  3GAN A;  4HFK B;  4I44 A;  3I5Q A;  1G8X A;  1OKK D;  1M57 C;  3UMH A;  3EZH A;  2HV7 A;  3OA1 A;  2VB6 A;  4DOZ A;  3WG7 C;  2EIK C;  4JVS A;  4PJJ A;  1WGW A;  1MMG A;  3LS0 A;  5E2Q A;  2YHS A;  3EH1 A;  3ABM C;  5L3V A;  4O7G A;  3DJN B;  3E70 C;  2VH3 A;  1VOM A;  2KW3 C;  1D0X A;  3L0I A;  2DYS C;  3N0T A;  3X2Q C;  4LER A;  2ZXR A;  3DM5 A;  3O6X A;  3TD7 A;  5DVW A;  3HTK C;  2PP4 A;  3NYJ A;  5D91 A;  3DXJ F;  4PK4 A;  1SZI A;  3OEO A;  1FMW A;  4CS8 A;  3EFO B;  4BJ5 C;  2O9X A;  2X51 A;  4Q4Z F;  3UGP A;  3ECS A;  2Y3B A;  3F46 A;  1PD1 A;  5KYN A;  4KNW A;  2J0W A;  4DVY P;  4JW1 A;  2R7X A;  5KYW B;  4OIR F;  2MYS A;  2PFD A;  3PHF 2;  1MMA A;  4OIN F;  2PX0 A;  3B0V C;  2A6H F;  4RD9 A;  4CSA C;  1OCR C;  4JJG A;  3UMI A;  4JJF A;  5D92 A;  3UMK A;  2A6E F;  4HEA J;  3T6J A;  2W45 A;  1W2W A;  4EBB A;  4Q7C A;  2R7S A;  3L34 A;  1M2V A;  1Z23 A;  3SP1 A;  3NDB B;  1LVK A;  4KBL A;  3N24 A;  3RH3 A;  1OCZ C;  3NRH A;  2Y3H A;  2NUT A;  3K6B A;  2WVQ A;  3DMD A;  2J7P A;  3Q7L A;  2G3K A;  4U5F E;  4PFP A;  4RBN A;  2R7U A;  3MLG A;  3QZC A;  2CW0 F;  4XLN F;  1TWA A;  3QMK A;  3LLK A;  2J45 A;  2Q3T A;  5KYU A;  3K1H A;  2P6V A;  2W4M A;  4AE4 A;  2XXA A;  5FCL A;  3CZ6 A;  5B1B C;  4MQ9 F;  3AG2 C;  3WOD F;  2J0X A;  3NKE A;  2XSE A;  5T3T A;  3UGO A;  4M63 A;  4IJJ A;  4B6I A;  3E9V A;  4GEH A;  4CS9 C;  2M4E A;  1ZHT A;  3K33 A;  2R7W A;  2EIM C;  4J32 B;  5CI8 A;  2DGJ A;  2J9V A;  3NKD A;  1M56 C;  3EJN A;  3O39 A;  4C3E A;  1BR1 A;  5CI9 A;  1ZU5 A;  2IXP A;  4PFO A;  2CNW A;  2JD3 A;  4C3D A;  4E7Z A;  4O79 A;  4PJM A;  3AG1 C;  3W8H A;  5IY5 C;  2WVN A;  1Z5Z A;  2B0J A;  4QI0 A;  4HE8 D;  4YT8 A;  4GYT A;  1VYK A;  2J7P D;  4LLE A;  2WVO A;  3AQB A;  2R7O A;  4RDA A;  3NYL A;  2YZS A;  3ZIB A;  4BJ5 A;  1M2O A;  1O5H A;  3POV A;  1BR2 A;  2ZPA A;  3LAY A;  2R7V A;  1D1A A;  2Q9C A;  2A1D D;  3S29 A;  3JCU Q;  2KNH A;  2NUP A;  2Y3D A;  3W2V A;  3N2Z B;  4QDL A;  4ANJ A;  3SEO A;  5L3Q A;  3MX3 A;  3SZR A;  4G7O F;  4U5B E;  3ABK C;  4FWV A;  1ST6 A;  4CSA A;  3FVY A;  1FFT C;  2W4B A;  4F4B A;  4U5C E;  3FHD A;  3ZSU A;  5E3C A;  4ZLC A;  1MMN A;  2PX3 A;  3EPV A;  3NG1 A;  5E3A A;  1NU7 D;  4DBQ A;  4OD4 A;  4YJW A;  2CNW D;  4J30 B;  3T6B A;  3KKB A;  3ABL C;  4PJN A;  2Y39 A;  1N1C A;  2L9J A;  4BJ6 C;  1OCO C;  3ZVR A;  5F5H A;  1FFH A;  2QY9 A;  1O87 A;  1Z3I X;  2ZXP A;  3T4R A;  5KYX A;  4I1M A;  5B1A C;  4YN0 B;  1JPN A;  1S7Z A;  4H4K C;  4X0R A;  3EFO A;  4U5D E;  4ULW A;  4YWQ A;  4CS7 A;  3I5P A;  4LAC B;  2EIN C;  1MMD A;  2CDQ A;  3JYH A;  2Q9A A;  3B0U X;  3EGX A;  4JZA A;  4KNV A;  3ZC4 A;  1D1C A;  3LEV A;  5DLJ A;  4YT2 A;  4CS9 A;  1D0Y A;  3EG9 A;  3LNR A;  4NY3 A;  2KJG A;  3SNH A;  4OIP F;  2NUT B;  3CQZ A;  3JSZ A;  2ZXO A;  3GOD A;  2XL4 A;  2Y69 C;  3RKO F;  3KH2 A;  5DS5 A;  1KU2 A;  3ASN C;  3KL4 A;  4C7O A;  2H7O A;  1J8Y F;  4BJT A;  2IYL D;  1OCC C;  2R7Q A;  1RJ9 A;  2Y3G A;  5KYU B;  4AE4 B;  2XXA B;  5T1D B;  3ASO C;  1TR2 A;  2H7V C;  3PMR A;  3RIP A;  5KYY B;  4MND A;  2G3V A;  1LKX A;  4KC9 A;  1ZYR F;  3DAF A;  4IWB A;  2J9W A;  2WZG A;  2OCC C;  3FAJ A;  3EGD A;  1ZU4 A;  4BJ1 A;  2ZXW C;  4KI2 A;  4OIO F;  3EHM A;  2EIJ C;  2EIL C;  2W9Y A;  4Q5S F;  1ZHZ A;  1BR4 A;  3NYM A;  3X1O A;  2WB7 A;  4N06 A;  4WJ0 A;  3AG3 C;  1FMV A;  3DAG A;  3EH2 A;  5EGY A;  3HJC A;  3B9Q A;  2KGO A;  2R7T A;  2WL8 A;  2YEV A;  3RFY A;  3Q6N A;  3RYL A;  2IXM A;  1ZHW A;  2J9U A;  2LSE A;  3W2W A;  3K1I C;  2V3C C;  1QLE C;  3LS1 A;  4IRU A;  2J46 A;  4U5E E;  4BEJ A;  4PJL A;  5DQT A;  4BJ6 A;  2XRH A;  4E7S A;  4BG0 A;  2IXN A;  2NUP B;  2FGY A;  2IOQ A;  2BE5 F;  1TWC A;  2C03 A;  3IEE A;  4EWC A;  4FX5 A;  1V54 C;  3OWT A;  4XWJ A;  4DBR A;  5B3S C;  3CSK A;  3W8I A;  1IZM A;  4U5H A;  4QI2 A;  1D1B A;  4P6I C;  2IXO A;  4YT4 A;  3F47 A;  2DYR C;  2I8B A;  3UNG C;  3S0X A;  4OIQ F;  3V7O A;  2CGE A;  4JCH A;  4G7H F;  4O6M A;  3S28 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...