4YN4A

Structure of human dna polymerase beta complexed with n7bg in the template opposite to incoming non-hydrolyzable dttp with manganese in the active site
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural and kinetic studies of the effect of guanine-N7 alkylation and metal cofactors on DNA replication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
molecule keywords DNA polymerase beta
total genus 105
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4yn4A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4yn4A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4yn4A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4yn4A03
1FA0A 1TFYA 5KG6A 3TAPA 4PHEA 3MR3A 1PZNA 4DS5A 5DLFA 1ZQKA 4XA5A 4ELTA 1ZQLA 3GFKB 3JPQA 3H7IA 4DSJA 3EW9A 2B21A 2MUTB 3LWMA 4O5CA 3TAQA 4ED7A 4F4KA 5KFTA 3MFHA 4EBDA 5CB1A 8ICIA 4WC6A 4YR0A 2DR9A 3V6HA 3GV7B 4F50A 3PW0A 7ICFA 1B22A 2I1QA 4ATBA 4QZAA 3H39A 1ZYQA 1JAJA 1ZJNA 3LWLA 1BPXA 4LVSA 5DBCA 1NJWA 3Q8MA 1ZQQA 1AROP 4M9HA 2ZHBA 3UQ2A 9ICVA 5KG7A 5DB9A 4YG2A 4I2IA 3PX0A 3RH6A 3Q8RB 4DSKA 4EEYA 5DB8A 4KN4A 4NM1A 1Y88A 4O3SA 4QZIA 2ID1A 3RJEA 1CEZA 8ICYA 4ED8A 3KTQA 5KG2A 2BE3A 1KFDA 3ORYA 4RQ5A 1ZQJA 5HMLA 3PR5B 4UQGA 4J9KA 4UBBA 1NK9A 1BPZA 4X0BA 1NK4A 4KITB 5KFHA 3HPOA 4UBCA 1ZQYA 2V4RA 3BQ1A 2ZUBA 5KFUA 1T7PA 4RZRA 4IQUA 4RQ3A 3UQ0A 2ZJAA 1XO1A 4RT2A 4O3NA 4FS2A 5KFYA 1BPYA 3PO5A 1WOTA 5HRDA 2AJQA 4B9VA 4IRDA 2HVHA 1L3UA 2UVRA 1D9FA 4O3RA 4DFMA 5HRKA 4YR2A 1SL0A 1S0VA 4RUAA 1U47A 4MEXA 4QZ9A 3KHGA 4TURA 4XRHA 9ICTA 4WC4A 4X0AA 4HYKA 1DGSA 4IR9A 5KFVA 2W9AA 1RYRA 4RWOA 2RDIA 3E2EA 3RRHA 5KFCA 9ICOA 4QWBA 1BNPA 2A1JA 3KHRA 3RBEA 3OSPA 1T3NA 1MQ2A 3RR8A 1XWLA 5EWEA 4ECZA 3WFQE 2ZTEA 2I9GA 4JK1A 2R8IA 2KZMA 1DK2A 3RAQA 2HHTA 5J2JA 4F5PA 4FHPA 1Q79A 1BPDA 4GC7A 4F5NA 1BNOA 2PBEA 4B9SA 4JV0A 4G3IA 1QTMA 1ZJMA 4DQSA 2PFQA 4FHYA 3MGHA 4WBYA 3M8SA 4EBCA 1XS9D 1KLNA 4QZ8A 2ZH3A 3M8RA 4C8NA 4QWAA 3GIJA 1NJZA 5HR9A 5CHGA 5L1IA 1ZQOA 4RQ8A 1S0MA 2J6SA 2GWSA 3ZDAA 4R8UB 4JV2A 3JPSA 3UPSA 4I2DA 2BCSA 1UEUA 4M0AA 3T5KA 4O3OA 2IBKA 4BWMA 4I2EA 7ICMA 4BDPA 4TUPA 4DL6A 3H3AA 2O1PA 3M9NB 2AGQA 2DRAA 4RNNA 1KDHA 4DEZA 1KFSA 4FBTA 2Y1JA 4P2HA 2NRZA 4M6WA 3PY8A 1MC8A 4RNOA 4ECSA 1X2IA 3JPOA 8ICXA 1TK5A 5KFMA 2XCPA 1RYSA 2KFNA 9ICWA 5J2KA 5F9LA 5L1JA 4KLUA 4MFAA 5DLGA 1RZTA 3T3FA 1X9MA 5HMMA 4KLGA 2DRBA 2MUTA 5IINA 9ICSA 3EWAA 2JEFA 5KFXA 2C2DA 8ICUA 4X4TA 3AQLA 3HX0A 2JZBA 5EWFA 4R64A 1TAQA 3T5LA 3JZ0A 4RNMA 5JUMA 5J2IA 5J0PA 4DFJA 2BQUA 2IMWP 5J0RA 4YXMA 2UVVA 2HHWA 5HREA 3FYHA 2XC9A 2JEJA 5DDYA 5IIIA 1SKWA 3RH5A 3TFRA 3OV7A 5KFGA 5DB6A 1ZQPA 3TARA 3RB6A 2ZH5A 4F5RA 4RWPA 4DF8A 1IM4A 3AU6A 3B0YA 3OHBA 2PFNA 4TQSA 2XO7A 2JEIA 4F4WA 4DS4A 2DPIA 4QZFA 4Q45A 4F8RA 4I2CA 4X4PA 4NXZA 4UB3A 4ELUA 3LDAA 4MEYA 5KFOA 3C2LA 1SL1A 1NK5A 1TAUA 3Q8QB 3V6KA 4QW9A 3UXPA 2BDPA 5EWGA 4B9NA 3HWTA 5DQIA 5DBBA 4DSLA 4NLKA 1SL2A 1DOQA 2BR0A 3RJJA 7ICQA 4UD4A 4UAYA 2FLLA 3C18A 3UPQA 1LB2B 2FPMA 5J2AA 3C23A 3V72A 3WFSC 5KFRA 2BCRA 4BXOA 2HHVA 4XUSA 2F1IA 3OVBA 2BKEA 3PX6A 5DQHA 4Z6FA 5TZVA 4QZHA 5HRLA 8ICVA 4WCWA 5D4BA 4NLZA 9ICAA 4X4RA 3QZ8A 1V9PA 3ZDCA 4J9PA 4MFCA 9ICLA 4M5DA 4GLXA 8ICZA 1UETA 4IQVA 4ECQA 4S3NA 2M2TA 2ZUCA 3RRGA 5HRGA 4BWJA 1WCNA 5HHHA 2FLPA 3RR7A 4O5KA 4QWEA 1ZQCA 1ZQXA 1HUOA 4YFKA 4YXJA 1TV9A 3PMNA 1TK0A 1L3TA 1UA0A 4O3QA 3OJSA 1EXNA 1KFTA 2XGQA 3AUOA 1BVSA 1K1SA 3M9MB 1TK8A 4MFFA 4DO9A 2DR8A 4J9QA 2NRVA 3ZD9A 4NKUA 2DPJA 4DQIA 4EBEA 3WFOA 1ZQHA 4KLQA 4EBJA 1L5UA 1SKRA 2M2WA 2AGOA 4RWNA 4I29A 4KLHA 3GDXA 2ZH7A 1TFWA 8ICBA 9ICEA 5KFPA 1VJ7A 2BCUA 1S97A 2DVIA 2W8LA 3C21A 4YD2A 3UXNA 7ICEA 5EOZA 2R8KA 1KTQA 4TUSA 5J0SA 3JPPA 1D8LA 4RQ6A 1RXVA 4GXIA 2PI4A 4KMUA 4X5VA 5J0OA 7ICHA 1R8CA 4QZEA 4YD1A 5KT5A 4RT3A 3GIMA 3OHAA 4AT8A 4WC3A 1ZETA 3OUYA 3ISCA 2VANA 4IRKA 4JV1A 7ICUA 2PXIA 5KT7A 5DBAA 2BCQA 1LV5A 1NK8A 2KP7A 4GC6A 8ICKA 2PFOA 3PW2A 4YMNA 1MIYA 4FBUA 4RU9A 1PX5A 3PW5A 3UXOA 3QEAZ 1ZQDA 2ISOA 2W9MA 4R8UA 4AT7A 1V4AA 1TKDA 2M2UA 3IHQB 4KLLA 3N97B 2BCVA 7ICPA 2PFPA 1XSNA 3RJFA 5DG9A 3PNCA 3RB4A 2NRKA 2BQRA 2ZHAA 2Q0ZX 3V7LA 2F1HA 4RQ1A 2ZTCA 4DSEA 2NRTA 4NKTA 1T8EA 5KFNA 9ICHA 4QZCA 1JX4A 4J9NA 4JWMA 2C28A 2BHNA 1IXRA 4R66A 3ZDEA 4QZBA 4FS1A 3MGIA 3GQCA 4J9LA 5C5JA 4C8OA 4EZ9A 5KT3A 4O9MA 5IIOA 4PHPA 4EYIB 4ED2A 1TVAA 3ETLA 4DSFA 1NKCA 4Z6EA 4IG8A 4DOBA 1NK6A 5KFJA 3V7KA 3BQ0A 1H38A 2XY7A 1DK3A 1R8BA 5F2VO 5CP2A 2AQ0A 5CJ7A 3OJUA 2IHNA 4YVZA 1NO5A 3TANA 5DGAA 7ICKA 1QLNA 1L3VA 4I27A 4DOAA 4F4YA 3TFSA 2J6UA 1ZQWA 2P6UA 4QZGA 1NZPA 3PW7A 2HVIA 1BPEA 4KLJA 3ISBA 4FHVA 1NK0A 2V4QA 4F2RA 2M2VA 2O5AA 4DFPA 9ICUA 2R8HA 3KHHA 5HRIA 4NY8A 3H8SA 4I2HA 5HC9A 2R8JA 5KFBA 3TQ1A 2AGPA 3RB3A 3ZD8A 3H40A 1UEVA 4JWNA 4FH5A 4J9RA 4PPXA 3WFPA 4ELVA 4CCHA 4K4IA 5D46A 4ZH4A 5KFAA 5L9XA 4DLGA 3BQTA 5CWRA 2AU0A 2KTQA 4MF2A 8ICGA 4AT9B 2RFFA 1N48A 2ZH9A 4F92B 1COOA 3QE9Y 2UVUA 4PGYA 4KLOA 1ZQRA 1ZQSA 1A76A 3EYZA 1U45A 3PVXA 1XU4A 7ICGA 3V7JA 1L3SA 2PI5A 2KFZA 2ISPA 3MABA 1JXLA 3RJIA 5KG1A 5KG4A 4DL2A 4C8KA 1S77D 2ASJA 2NRXA 3SV4A 3T5HA 2VA3A 2LYHA 4O5EA 3QZ7A 5J0QA 3HT3A 4K4GA 1MSWD 4BXOB 1S0OA 5KT4A 4O0IA 4GXKA 1Z3EB 5DDMA 8ICCA 3IM1A 2C2RA 4O3PA 5J0XA 9ICGA 1MIWA 4EP7A 5KFFA 3SI8A 3FDSA 4IRCA 9ICRA 4FH3A 1NJYA 1JIHA 2DR5A 4F2SA 5IIKA 4ED1A 4IQTA 3GIKA 4M04A 4ECVA 2HHXA 3SZ2A 4FHXA 4X4VA 3EPGA 7ICJA 2FPLA 3RAXA 5IILA 1JMSA 5L1KA 4DFKA 4X4OA 3OSNA 3OVSA 2C22A 1ZQIA 4NLNA 4UAWA 4WC7A 3PX4A 1WCLA 4Q43A 4Z6DA 4TUQA 2VA2A 4C8MA 3ZDBA 2XGPA 1YLQA 1SZPA 1ZQAA 2FPKA 2BQ3A 4FHWA 5KFKA 2W8KA 4P4MA 2ZJ5A 4NM2A 3RBDA 1NOMA 1X9WA 9ICCA 5J0TA 9ICBA 1Q78A 4QWCA 1ZQMA 5J0WA 4EZ6A 3EZ5A 2XY6A 4IQWA 1R8AA 4UB5A 4QWDA 5F9NA 3NTUA 3RJKA 1UT5A 7ICSA 5J2BA 2IA6A 4R65A 4F91B 4EYHB 4RPYA 3RH4A 4P4PA 4Z6CA 4RPZA 4DF4A 8ICEA 4F4XA 1ZQEA 3MDAA 5KG0A 3LK9A 2MAXA 4WC1A 3SV3A 3B0XA 3GV5B 5HNKA 4WC5A 4AT7B 3H4BA 3PV8A 2ZTDA 2HW3A 3MFIA 1KNYA 4DQPA 9ICXA 3RB0A 4RQ2A 4ECYA 3C5FA 1SKSA 1JXEA 1U4BA 1KRPA 2KZ3A 4DL7A 3RJGA 2V9WA 4KLIA 5J29A 3HP6A 2ALZA 4R63A 4XQ7A 4QZDA 4B9TA 4E8FA 3JPRA 9ICJA 3G6XA 2XY5A 2ASLA 2M9NA 4ATBB 5KG5A 3K75D 3C66A 4UB2A 4LZDA 5HRFA 8ICAA 4RQ4A 2J6TA 1NK7A 5DKWA 7ICIA 4E0DA 5DECA 4DL3A 5KFEA 5L1LA 3RTVA 2A1JB 2FMSA 4J9OA 1CUKA 4DQQA 4KLSA 2HHSA 3GIIA 8ICWA 2F1JA 4KN7A 4DLEA 3Q8KA 3SYZA 4AT8B 3OUYB 3Q8PB 4X4SA 3C1ZA 4RQ0A 5J2EA 1MIVA 5IIJA 4M9GA 1ZQZA 7ICLA 4KLEA 3MR5A 4WC2A 5DEDA 1N56A 3G6YA 5BOMA 3T5JA 5HRHA 5J0YA 3ZDDA 9ICIA 5KFIA 4JUZA 5J2CA 3PR4A 3EPIA 1RPLA 4DQRA 4QW8A 4DSIA 4KTQA 5J2GA 2FMQA 2HHPA 8ICJA 4M9JA 5KFLA 7ICOA 2W9BB 1ZQGA 3BJYA 4UB1A 4ECXA 1ZQUA 4ECTA 2UVWA 3OVAA 3H8WA 8ICMA 1C7YA 5KG3A 4E80A 5DQGA 2JZBB 2R8GA 2H5XA 4M9NA 2ZH8A 4X4UA 4I2AA 1UA1A 8ICQA 3HW8A 3MR2A 1ZQFA 5KFSA 8ICPA 2ZJ8A 4Q8EA 3V6JA 5KTQA 4YCXA 3WFRE 1BPBA 1S76D 1U48A 2HHUA 9ICMA 2AQ4A 4C8LA 2JEGA 2W9CB 2ZUDA 9ICQA 5BOLA 3ISDA 3QEBZ 4RQ7A 1KSPA 4DWIA 9ICKA 3AQNA 1JN3A 3H4DA 1KEJA 5HHIA 3PO4A 1OU5A 5DB7A 4DL4A 8ICFA 4PHDA 4J9MA 1XC9A 4LZGA 3PW4A 2W9CA 4IR1A 2DFLA 2BPFA 1D8YA 8ICOA 1QSYA 4ED3A 3GILA 5HP4A 1F5AA 4YR3A 4DL5A 8ICLA 5J0UA 2ATLA 5J2HA 4KLMA 5J2DA 2Y1IA 3TI0A 3Q8LA 7ICNA 4EBKA 4K4HA 4B9LA 3MBYA 4F5OA 2ASDA 4YMMA 1XSLA 4I2GA 8ICTA 2BPGA 3LQCB 3HIYA 5KFZA 1TFRA 3AQKA 4PHAA 1NJXA 2RDJA 1X9SA 4ECWA 4E7XA 4ECUA 2W9BA 5DG7A 5KT6A 1UT8A 2C2EA 3GV8B 3L9DA 4UD5A 1A77A 4PH5A 5DGBA 1Z00A 1R89A 2DR7A 2WTFA 4LT6A 2BGWA 1ZQBA 5KFDA 4WBZA 3H37A 3MR6A 4F4ZA 2ZH1A 4I2JA 1VFGA 2P66A 4RPXA 3N4MB 4ECRA 2FLNA 2OWOA 4KLTA 2ZH6A 4X4NA 1ZQVA 5CR0A 1ZQNA 4RUCA 2P6RA 1BGXT 4YQWA 5D49A 3AU2A 4BGDA 9ICPA 1HJPA 4YN4A 4PGQA 3M9OB 1S9FA 4KLDA 1K1QA 4I2BA 4FO6A 2HHQA 9ICNA 4PGXA 2Q66A 7ICTA 3Q8SB 4J9SA 3G6VA 4ED0A 1QSLA 4M2YA 3C2MA 4XQ8A 3K4GA 2KZZA 3C2KA 2ZH2A 8ICHA 4UAZA 3JPNA 7ICRA 3NGDA 4KLFA 3KHLA 8ICSA 1D9DA 4B9MA 3C1YA 4AT9A 3C5GA 4Q44A 1NKBA 3HJ1A 5CA7A 3H8JA 3JPTA 4Q8FA 8ICNA 3NYBA 4MF8A 4F3OA 3MDCA 4DOCA 1RXWA 1NKEA 2BPCA 1S0NA 4NLGA 8ICRA 4GXJA 4M9LA 1MQ3A 5J2FA 2ZH4A 4TQRA 5HRBA 4I2FA 3H38A 4X4QA 1ZQTA 2NRWA 4YMOA 3BQ2A 4B9UA 1B43A 1HUZA 1U9LA 4F5QA 7ICVA 1U49A 4M47A 1JQRA 1T4GA 1Z00B 2KN7A 3BDPA 3PMLA 4YP3A 1QSSA 2FMPA 5DG8A 4ED6A 1S10A 4F93B 5KFWA 3AQMA 4RWQA 4WC0A 3THVA 2VA8A 4P4OA 5BPCA 2XCAA 3RJHA 4UB4A 3OGUA 4I28A 9ICFA 3HJ4A 5IIMA 3JYYA 1XSPA 5KT2A 4M6WB 5KFQA 2IHMA
chains in the Genus database with same CATH superfamily
1TFYA 3MR3A 1ZQKA 1LKYA 1ZQLA 3GFKB 3JPQA 4O5CA 3EW9A 2B21A 2DQNB 4F4KA 5KFTA 4EBDA 5HR6A 8ICIA 4WC6A 3OPXA 3GV7B 2W11A 1B22A 2I1QA 4ATBA 1MA7A 1ZQQA 5ALDA 4M9HA 2DUYA 9ICVA 3RH6A 2D3DA 5DB8A 4KN4A 3AM9A 2ID1A 3RJEA 4ED8A 3KTQA 3ORYA 4UBBA 1BPZA 1NK4A 3BQ1A 3ZI4A 4RQ3A 2ZJAA 4FS2A 2AH5A 1WOTA 1L3UA 1D9FA 4O3RA 2PMZC 4YR2A 1SL0A 4MEXA 2FDRA 4USAA 1DGSA 2W9AA 2QB0B 1RYRA 2WFAA 3RRHA 4KM5A 3OSPA 3RR8A 2EANA 5EWEA 2I9GA 5J2JA 3ED5A 1Q79A 2F44A 1BPDA 1QTMA 4Y2PA 4JLXA 5HR9A 4WH5A 2J6SA 1S0MA 4EELA 5B5EU 5D63A 2KSOB 4F71A 3JPSA 2NO4A 3T5KA 2FI1A 7ICMA 5ALYA 4DEZA 2QARB 2EWRA 8ICXA 4FFDA 1RYSA 9ICWA 2HOQA 5F9LA 4WQKA 4MFAA 5DLGA 3T3FA 5IINA 3D6JA 5KFXA 2HBMA 1Z1BA 3JZ0A 2L5YA 2BQUA 2IMWP 4YXMA 2UVVA 3FYHA 2KV2A 5AI9A 5KFGA 5DB6A 1ZQPA 2WB1F 2YMMA 4F5RA 3SMVA 3AU6A 2XO7A 2DPIA 4X4PA 4QZFA 4I0UA 5KFOA 1SL1A 1PUZA 1ZD3A 2OEHA 5EWGA 3HWTA 5DQIA 7ICQA 3SENA 3RJJA 3O0FA 4PL2A 4UD4A 4UAYA 4C4RA 3UPQA 1LB2B 2W55A 5J2AA 3C23A 3OVBA 3SAFA 4Z6FA 4QZHA 2G5IB 4NLZA 9ICAA 4X4RA 3QZ8A 1V9PA 4M5DA 2HMXA 4EENA 1UETA 4S3NA 2Z7JA 1DXSA 3QU5A 4CF4A 2YX8A 1UA0A 3OJSA 5AKLA 1PK1B 1K1SA 3M9MB 4MFFA 4DO9A 5AI0A 4NKUA 4EBEA 4RWNA 1L5UA 2AGOA 4I29A 2ZIWB 4OJOA 1VJ7A 7ICEA 2NO5A 5EOZA 1KTQA 1RXVA 2XI9A 4QZEA 2K8CB 4YD1A 3KOOA 4IRKA 5KT7A 5DBAA 2BCQA 3PW2A 1PX5A 3PSPA 3QEAZ 1Q46A 3KFUF 2W9MA 4AT7A 1V4AA 2M2UA 5AM2A 4KLLA 4DCCA 2PFPA 2ZHAA 1TE2A 4P0QA 2Q0ZX 4FZNA 2NRTA 3HJEA 2HCFA 2QB0A 2BHNA 4FS1A 2LKYA 3GQCA 4Y2QA 4AYBC 5AI4A 5KT3A 1Q8KA 5ALGA 1ZRNA 3AMZA 1NKCA 4IG8A 1NK6A 3V7KA 3BQ0A 2XY7A 2AHOB 3OJUA 5CJ7A 7ICKA 4DOAA 2J6UA 4QZGA 1BPEA 1J97A 3QUTA 1NK0A 2V4QA 4F2RA 2O5AA 4LEWA 5HRIA 2YY6A 5HC9A 3A0HU 1VJ5A 2AGPA 3H40A 2WHEA 2AXTU 8ICGA 5CWRA 3NVOA 4MF2A 3QE9Y 4PGYA 4KLOA 2OHFA 2PI5A 5ALSA 2EH9A 4CGZA 3T5HA 2VA3A 4OCZA 4O5EA 5B3PA 5J0QA 2DWQA 4BXOB 1S0OA 5AK5A 3SEIA 1OXJA 9ICGA 2Q4TA 4LEVA 1LKYB 4GFJA 4F2SA 1AQ6A 2HHXA 4X4VA 3QYPA 4DFKA 5L1KA 4MKPA 5H2FU 3WK7A 3PX4A 3ZDBA 1QQ5A 1ZQAA 2BQ3A 1X9WA 1NOMA 4IQWA 3EZ5A 1R8AA 3RJKA 3NTUA 5J2BA 2IA6A 4F91B 3RH4A 8ICEA 3MDAA 5KG0A 1RYUA 4OAFA 2RRDA 2ZTDA 2HW3A 1KNYA 9ICXA 3WU2U 1JXEA 4QJFB 5J29A 3HP6A 4QZDA 2ZIUA 4UB2A 2XIDA 4RQ4A 1D8BA 3F2CA 2A1JB 2FMSA 3GIIA 5CRXA 4KN7A 4DLEA 4J03A 4X4SA 4RQ0A 4ZOHC 4P0PA 3UMCA 4BJQA 2IUBA 1N56A 5BOMA 3T5JA 2MA1A 2KNJA 5AKKA 3EPIA 3LVVA 4KTQA 8ICJA 4M9JA 1ZQGA 4ECTA 5AM0A 8ICMA 1C7YA 5CHEA 1SV0C 4X4UA 4M9NA 4I2AA 4NXXA 2DKZA 8ICPA 2ZJ8A 3SAGA 4Q8EA 4YCXA 1BPBA 2HHUA 1U48A 2JEGA 1L8OA 4RQ7A 4DWIA 3AQNA 1KEJA 5JRTA 5DB7A 4DL4A 1XC9A 3PW4A 2W9CA 4K99A 3VCBA 4IR1A 1D8YA 3H0RB 1QSYA 4O68A 3D2SA 5J2DA 3WKCA 4YMMA 4IL6U 2BPGA 4UB8U 3HIYA 1TFRA 2RDJA 1WG8A 4ECWA 4ECUA 5DG7A 1IV8A 1UT8A 2O6KA 5KFDA 2ZH1A 1UCVA 4RPXA 1T94A 2OWOA 2W43A 4KLTA 4K9BA 4J9SA 1QSLA 4ED0A 4EGWA 4XQ8A 5CFUA 2ZH2A 8ICHA 4UAZA 7ICRA 3NGDA 4Y2JA 4AT9A 4Q44A 4F3OA 3QU7A 1NKEA 8ICRA 2ZH4A 4Y2VA 5J2FA 4EEDA 4I2FA 4YMOA 1Z4OA 3N28A 1RG6A 1U49A 4M47A 5AKEA 4C0ZA 1JQRA 1T4GA 5ALQA 3BDPA 3PMLA 4YP3A 1JRPA 5B3QA 4F93B 3AQMA 4RWQA 4WC0A 4NXVA 2H3ZA 1QQ6A 3WKEA 3MFHA 5KFQA 4B9SA 5KG6A 3TAPA 5DLFA 1LVHA 4CE6A 2FCLA 2MUTB 3LWMA 1SV0A 5KAIU 4ED7A 4PZNA 3M7DA 2W3SA 4C80A 5CB1A 4QZAA 3H39A 1JAJA 1ZJNA 3QXGA 5DBCA 1NJWA 3L4PA 4Y2SA 5K4LA 2ZHBA 5ALPA 3UQ2A 1ZD5A 5DB9A 4YG2A 1WWVA 4EEYA 4OJ5A 2KJ8A 1Y88A 2EZZA 2BE3A 4RQ5A 4C4SA 4KITB 5KFHA 4UBCA 3NUQA 3UQ0A 4IQUA 3PO5A 5KFYA 4IRDA 5ALKA 3AL0B 1O08A 1U47A 3KHGA 4TURA 9ICTA 1XO0A 3E2EA 3RBEA 1RDFA 4F5NA 5ALNA 4JV0A 4FHYA 3MGHA 3F5EA 4QZ8A 2ZH3A 5L1MA 3GIJA 1NJZA 2JHDA 3ZDAA 2BCSA 4TUPA 4DL6A 3E58A 3M9NB 2AGQA 2A1AA 4RNNA 1KDHA 4FBTA 2Y1JA 4M6WA 3PY8A 1X2IA 2XCPA 5L1JA 3PSFA 4KLUA 1Q3VA 1RZTA 1X9MA 5HMMA 3IG8A 2C2DA 1J2NA 4X4TA 2JZBA 1IIPA 1ZD4A 1TAQA 4DFDA 5EWFA 1Z19A 5JUMA 3S6JA 2ZG6A 4C7ZA 3RH5A 2G08A 3TARA 2ZH5A 1CRXA 4DF8A 1IM4A 3B0YA 2PFNA 4F4WA 4Q45A 2HHPA 3LDAA 2M2VA 3Q8QB 2F2AB 4QW9A 3UXPA 2BDPA 1Z1VA 1SL2A 2BR0A 1PVPA 3C18A 4IC9A 2BCRA 2F1IA 1COKA 2KE7A 2BKEA 3PX6A 2JV3A 3VC8A 5HRLA 4WCWA 4F72A 3UM9A 8ICZA 4IQVA 2GO7A 4NLBA 3RRGA 1WCNA 2WF8A 1ZQCA 2YB1A 2H3QA 2D8CA 1ZQXA 2E8MA 4O69A 4YFKA 3IP4B 1TV9A 3PMNA 5JU5A 1L3TA 2K4IA 1KFTA 5ALXA 3AUOA 1TK8A 2WB1C 3WKDA 2K4HA 2DPJA 2E8NA 4DQIA 3WFOA 1ZQHA 2M2WA 3GDXA 2ZH7A 1TFWA 8ICBA 5A0LA 1S97A 1V97A 4TUSA 4RQ6A 1R8CA 5J0OA 2ZIVB 3GIMA 4AT8A 3OUYA 3RFAA 4JV1A 1KQQA 2PXIA 1LV5A 3MGVA 1NK8A 4GC6A 5AK3A 1MIYA 4Y2UA 4FBUA 4RU9A 3PW5A 2ISOA 4R8UA 4PJ0U 1TKDA 3MCRA 3N97B 2BCVA 7ICPA 3RJFA 3RB4A 2NRKA 2G0AA 2F1HA 9ICHA 4J9NA 4JWMA 3ZDEA 4QZBA 3MGIA 4C8OA 2A3VA 4O9MA 5AI6A 5AM5A 3BS7A 4EYIB 1URJA 1DK3A 3AN1A 1R8BA 3DDHA 2AQ0A 5AK4A 4P0PB 1NO5A 3TANA 1QLNA 3TFSA 4KLJA 3ISBA 5JTIA 4FHVA 2WF5A 9ICUA 3KHHA 2ZXHA 2WF7A 3C28A 3RB3A 4JWNA 3QU4A 4FH5A 4PPXA 3WFPA 1OW5A 4CCHA 4ZH4A 4AT9B 3BQTA 2KSOA 2UVUA 1ZQRA 1A76A 2K4EA 3EYZA 1U45A 1L3SA 2ES6A 5C0YA 2KKPA 3SV4A 3WK5A 2LYHA 3NKUA 3UMBA 4GXKA 8ICCA 2C2RA 2CXYA 4O3PA 1MIWA 3SI8A 9ICRA 4FH3A 2DR5A 3GIKA 4ECVA 7ICJA 3RAXA 3WKBA 4X4OA 3OSNA 4NLNA 2YQEA 3NVYA 4OD0A 2ODGA 2OXOA 3BS5A 4Q43A 1N5WA 4Z6DA 4CF3A 2XGPA 1SZPA 2EQYA 2FPKA 5AHXA 2OCEA 3OTQA 3RBDA 4NM2A 9ICBA 9ICCA 2JR5A 5J0TA 2QLTA 2XY6A 5F9NA 3E0FA 4R65A 4K8VA 4AYBF 5HNKA 4AT7B 5ALMA 3H4BA 2BZFA 3I76A 3QUBA 4U6PA 3RB0A 4RQ2A 3C5FA 1NZBA 1JUDA 2KZ3A 3HILA 4DL7A 2V9WA 4CRXA 4R63A 4ATBB 2XY5A 2ASLA 4LZDA 8ICAA 1NK7A 4WJ3B 7ICIA 3RTVA 8ICWA 2HHSA 1IG6A 1X66A 2F1JA 2H3IA 3M6KA 3SYZA 5J2EA 5IIJA 4WC2A 3G6YA 4HX0A 5HRHA 3ZDDA 2QARA 5KFIA 4KX5A 3PR4A 1RPLA 4QW8A 1SIJA 3BJYA 3MC1A 4WQLA 4US8A 2Y0SF 1SWVA 3ALRA 5GTHU 1UA1A 5GTIU 2B0CA 3HW8A 1ZQFA 5KFSA 3V6JA 5KTQA 1HEKA 4C8LA 1QQ7A 1NNLA 3ISDA 3QEBZ 9ICKA 3H4DA 3PO4A 3SR6A 4PHDA 2G06A 3IV6A 1YT3A 1F5AA 4YR3A 2EZYA 4DL5A 8ICLA 5J0UA 4KLMA 5J2HA 2Y1IA 3TI0A 3WK9A 4EBKA 1M6YA 4K4HA 2NYVA 2R18A 3F5AA 4F5OA 8ICTA 3IRUA 4UATA 4UD5A 5EE3A 1A77A 1PK1A 1R89A 2DR7A 3BZCA 3WKAA 4F4ZA 2KG5A 1VFGA 2P66A 4X4NA 2P6RA 4RUCA 4YQWA 3AU2A 4BGDA 9ICPA 4PGQA 4KLDA 2OH2A 9ICNA 5ALHA 1K1QA 3K1RB 3HRDD 7ICTA 3ONNA 1RM6C 3C2MA 4QIWF 1JROA 3JPNA 2JMGA 1KL9A 3A0BU 1D9DA 3C5GA 3HJ1A 2KVSA 1X9XA 1B0XA 5AICA 3JPTA 2CN1A 4MF8A 4DOCA 3IDWA 3I28A 1RXWA 2BPCA 4GXJA 2WF9A 4M9LA 4BX9C 4TQRA 5ALRA 5HRBA 3BQ2A 4UAVA 2OM6A 7ICVA 1WWUA 2HI0A 5JTGA 5DG8A 2XCAA 4UB4A 3OGUA 3JYYA 5KT2A 1FA0A 2KICA 4DS5A 2DBYA 3CYMA 4ELTA 2EAMA 3H7IA 4DSJA 3TAQA 4KB6A 3N7SC 2DKXA 3H8MA 2VIXA 3V6HA 3PW0A 2HOIA 7ICFA 4BUGA 3UMGA 3LWLA 1BPXA 4LVSA 3GU3A 3Q8MA 2WAQF 4I2IA 3Q8RB 1X6IA 4NM1A 4QZIA 1ZQJA 5HMLA 3NVZA 4UQGA 1NK9A 4X0BA 1ECWA 1ZQYA 2V4RA 1T7PA 2ZUBA 3PSIA 5HRDA 4KMOB 2AJQA 4DFMA 5HRKA 1S0VA 1WUDA 4QZ9A 4XRHA 1J2MA 1F0MA 1S8OA 2A19A 4IR9A 5KFVA 2RDIA 5ALLA 2QKQA 5KFCA 9ICOA 2A1JA 3KHRA 1T3NA 1QH9A 4ECZA 2R8IA 2KZMA 1DK2A 2XICA 3RAQA 2PBEA 4G3IA 1ZJMA 4WBYA 3M8SA 1KLNA 3K1ZA 2PKEA 3M8RA 4C8NA 2F8LA 4QWAA 4RQNA 3WK8A 5CHGA 4OJLA 3FC4A 1ZQOA 2GWSA 2EDUA 4R8UB 1UEUA 4NV0A 4M0AA 4O3OA 3N7RC 4BDPA 3H3AA 2DRAA 4JLZA 2GAFD 2G5HB 3BQ7A 1TK5A 5KFMA 2HBJA 5J2KA 5D62A 5KL8B 2DRBA 5G5HA 2MUTA 3EWAA 3HX0A 4R64A 2Y9UA 1FEZA 4DFJA 2EAOA 4NL9C 1SXDA 2HHWA 5HREA 3CW2C 3PZPA 5DDYA 3ER9B 3OV7A 2HDOA 3WK6A 4RWPA 5KL1B 4TQSA 4I2CA 2DR9A 3QUQA 4UAUA 1TAUA 4ELUA 4MEYA 3C2LA 1NK5A 4OAIZ 5ALUA 2ZIXB 5KNIA 5DBBA 1DOQA 3I1YA 2FPMA 3V72A 4BXOA 4XUSA 3CP8A 2HSZA 4Y2YA 3WK4A 5CFTA 5D4BA 4MFCA 2QB1A 3KZIU 4ECQA 3FAHA 2M2TA 2ZUCA 5HHHA 3RR7A 4O5KA 2EAPA 4PZOA 3M1YA 4YXJA 2XGQA 1BVSA 3DEEA 2XVTA 1VLBA 2NRVA 3ZD9A 2FJ6A 4EBJA 1SKRA 3D2QA 2E1EA 1UQVA 2ZIUB 4O67A 4N7RA 9ICEA 5KFPA 2DVIA 1QCKA 3C21A 3UXNA 5J0SA 2PI4A 1D8LA 5J8YA 7ICHA 4GXIA 4X5VA 2E8PA 5KT5A 4WC3A 1ZETA 3ISCA 2VANA 2WAQC 4PL1A 8ICKA 2PFOA 4OJPA 1N63A 3ICXA 4OAGA 3UXOA 1ZQDA 1JI7A 2LYAA 5DG9A 3PNCA 2BQRA 2ZTCA 4DSEA 4CDGA 5KFNA 2YN4A 4QZCA 3NRWA 2PMZF 4R66A 3J81j 4J9LA 1GO3F 2KEYA 5AKGA 1SZHA 4EZ9A 1N2XA 5IIOA 2LPEA 4ED2A 5AIBA 1TVAA 4DSFA 4Z6EA 4DOBA 1K5OA 2LM1A 1H38A 5CP2A 1KBUA 2IHNA 4YVZA 5DGAA 1PVRA 1A0PA 4I27A 4UB6U 4F4YA 3F53A 1T3QA 1NZPA 5G5GA 2M0NA 1ZXIA 2HVIA 1JALA 2RQ5A 2K8AA 3RF9A 4DFPA 5ALZA 3T79A 1VDVA 4I2HA 2R8JA 5KFBA 2DL0A 1UEVA 4J9RA 5ALTA 2KJ9A 4K4IA 2GOLA 5KFAA 5L9XA 2AU0A 2KTQA 2RFFA 4F92B 1COOA 3PVXA 7ICGA 3MABA 1JXLA 3RJIA 5KG1A 5KG4A 1S77D 2NRXA 1CI4A 5AI5A 5EE9A 2JXJA 1MN8A 3QZ7A 3HT3A 2MSNA 4K4GA 1MSWD 4O0IA 1Z3EB 5DDMA 4EP7A 1L7MA 5J0XA 4NXUA 4NXTA 1UHUA 1NJYA 1FO4A 2W3RA 4Y2TA 5IIKA 4ED1A 4IQTA 3H0MB 4FHXA 4G9BA 1SB3C 2KIWA 3K7DA 5IILA 4FZMA 3OWGA 1N5XA 4JB3A 4WC7A 1WCLA 3NS1A 4TUQA 4C8MA 4FHWA 5KFKA 2W8KA 4P4MA 1RQNA 1Q78A 5J0WA 4QWDA 1L7OA 3NWIA 3AQFA 4RPYA 4RPZA 1F44A 4DF4A 1ED1A 2MAXA 3SV3A 3B0XA 5EE1A 3PV8A 4LEYA 4RQMA 1SKSA 1DRGA 1U4BA 1KRPA 3RJGA 2VJ4A 4KLIA 5AKYA 5J8YC 2ALZA 4XQ7A 2H3VA 4B9TA 3JPRA 3G6XA 2M9NA 3K75D 3L5KA 4EEBA 5HRFA 2J6TA 2LM4A 4E0DA 4DL3A 5L1LA 4KLSA 4DQQA 2KK0A 2LI6A 3Q8KA 1F5SA 3Q8PB 1MIVA 1ZQZA 2DGZA 3EF2A 5DEDA 3F2DA 4UW9A 4DQRA 5KFLA 2CPRA 2UVWA 5KG3A 4NWIA 3LYSA 2JZBB 5AKHA 2R8GA 2ZH8A 3MR2A 2W9CB 2KD1A 5BOLA 1YZ6A 4GIBA 2BBJA 2DFLA 2P35A 1N61A 5HP4A 3ER8C 3Q8LA 7ICNA 3NVVA 4Y2XA 2ZIWA 4B9LA 1XSLA 4I2GA 1YZ7A 5KFZA 2B56A 4PHAA 1X9SA 2W9BA 5KT6A 3B9JA 5DGBA 3BS5B 4KX3A 3DV9A 2WTFA 1ZQBA 2IOFA 2KKVA 2FLNA 1ZQVA 5CR0A 1BGXT 2B4VA 1HJPA 4YN4A 1ZD2P 4I2BA 2BBHA 4PGXA 2Q66A 2E1FA 1O03A 3Q8SB 3G6VA 4M2YA 3K4GA 2KZZA 8ICSA 4KLFA 3KHLA 2I5HA 4B9MA 2W7PA 3H8JA 4Q8FA 3NYBA 3PSTA 4CNQA 5AKZA 1S0NA 1ZQ1C 1MQ3A 3H38A 4X4QA 4B9UA 1B43A 1HUZA 1U9LA 2JRZA 4MHVA 2KHVA 1Z00B 2KN7A 1Z4NA 1QSSA 5T14A 4ED6A 3THVA 2VA8A 4P4OA 9ICFA 3HJ4A 1XSPA 4PHEA 1PZNA 1SGGA 4XA5A 1FFVA 2MU2A 4NL9A 1HIWA 4ICAA 4YR0A 4F50A 4QIWC 1ZYQA 3CK6A 1AROP 2JH1A 4QNLA 5KG7A 3PX0A 1L8LA 1FFUA 2B51A 1SXEA 4DSKA 2F8KA 4O3SA 1CEZA 8ICYA 5KG2A 1KFDA 3PR5B 4J9KA 3HPOA 2HBKA 3AEVA 3H0LB 5KFUA 4RZRA 7ICOA 1BPYA 1XO1A 4RT2A 4O3NA 2HN2A 4B9VA 2HVHA 4ACOA 2UVRA 2G07A 2KMDA 3KKAC 3SD7A 4RUAA 2JH7A 4Y2RA 2H3FA 4WC4A 4HYKA 4X0AA 4RWOA 2LHTA 2YMPA 5ALEA 5B66U 5AM1A 4QWBA 1BNPA 1L6NA 2F76X 1MQ2A 2G09A 1XWLA 1N60A 3WFQE 2ZTEA 4JK1A 3TADC 2HHTA 4F5PA 4FHPA 2E8OA 1BNOA 4GC7A 2BDUA 4LJXA 4DQSA 2PFQA 5CFSA 4FE3A 4EBCA 1XS9D 4FZLA 5AKIA 5AK6A 5L1IA 4RQ8A 4C4TA 4JV2A 3UPSA 4I2DA 4I2EA 2IBKA 4BWMA 1KFSA 2NRZA 2W7OA 1MC8A 4RNOA 4ECSA 3JPOA 2KFNA 3F2BA 4KLGA 9ICSA 2JEFA 8ICUA 1FIQA 1Q3UA 3AQLA 3T5LA 2MRLA 4RNMA 5J2IA 5J0PA 5ALOA 3R9KA 5J0RA 2WF6A 2JGAA 4CF5A 2XC9A 2JEJA 2ZXIA 5IIIA 1SKWA 3TFRA 5ALIA 3RB6A 2GLEA 3OHBA 3D2NA 2JEIA 1S5LU 4DS4A 4F8RA 3NVWA 2K60A 4NXZA 3QU2A 4UB3A 3FM9A 4C7YA 3V6KA 5D61A 4B9NA 4NLKA 2LBOA 4DSLA 2ESEA 2W54A 5AI8A 2I6XA 2IOFK 2FLLA 4XJEA 3WFSC 5KFRA 2HHVA 3KBBA 3KD3A 5DQHA 5TZVA 8ICVA 9ICLA 3ZDCA 4J9PA 4GLXA 5HRGA 4BWJA 2FLPA 4QWEA 2GH1A 1HUOA 3GZFA 1TK0A 4LEZA 4O3QA 3EUB2 1EXNA 1X6JA 1KN5A 1L7NA 2DR8A 4J9QA 3M6ZA 2YMQA 4KLQA 4AP9A 4KLHA 4UASA 1PK3A 1ZOLA 4K9AA 2BCUA 2W8LA 4YD2A 2LMRA 2R8KA 3L3FX 4P2HA 3JPPA 4A8EA 4KMUA 4RT3A 3OHAA 3U26A 4K96A 7ICUA 3LVWA 2KP7A 3PHZA 4YMNA 2CRXA 2Y0SC 2ZIVA 4HAIA 4NLCA 3IHQB 1XSNA 1UPHA 3V7LA 1N62A 4RQ1A 3TADA 2D6FC 4NKTA 1T8EA 3TKAA 1JX4A 2C28A 1IXRA 3QX7A 2DF4B 5C5JA 1XNSA 4PHPA 1GPJA 3ETLA 3CNHA 5KFJA 2B6GA 5F2VO 4O6AA 4OAHA 2IOHA 1L3VA 4K97A 1ZQWA 2P6UA 5ALWA 3PW7A 2OYYA 2R8HA 3IN5A 4NY8A 3H8SA 2NV3A 3TQ1A 3ZD8A 3AQEA 2YMLA 5E79U 4ELVA 5D46A 4P0QB 4DLGA 2O1PA 4JMUA 2ZH9A 2Y9TA 1N48A 5HR7A 1ZQSA 1XU4A 3V7JA 2GA9D 2KFZA 2ISPA 4DL2A 4C8KA 2ASJA 1TAMA 1C20A 1NI3A 2RHFA 2W03A 4K98A 5KT4A 5TISU 3IM1A 2KJ5A 3C29A 5KFFA 3FDSA 4IRCA 1JIHA 3QUCA 4M04A 3SZ2A 3EPGA 2FPLA 4O3MA 1JMSA 3OVSA 2C22A 3ERCC 1ZQIA 1WYGA 4UAWA 1PVQA 2VA2A 1YLQA 4OJ6A 2ZJ5A 3JCFA 2F77X 1X42A 4QWCA 1ZQMA 4EZ6A 4UB5A 2HOFA 1UT5A 4EYHB 4P4PA 4Z6CA 4F4XA 1ZQEA 3LK9A 4FO1A 1A6SA 4WC1A 1V38A 4WC5A 3GV5B 3MFIA 4DQPA 5KAFU 4NJ8A 4EX6A 5CEHA 4ECYA 5AM4A 2VKQA 4E8FA 9ICJA 2KIVA 2HBLA 5KG5A 3C66A 4B6JA 1V85A 5DKWA 5F3XB 5DECA 5KFEA 2RLTA 5ALJA 4J9OA 1CUKA 4AT8B 3OUYB 2K89A 3C1ZA 2K8BB 4M9GA 7ICLA 4KLEA 3MR5A 1DGJA 5ALVA 4EX7A 5J0YA 9ICIA 2EZXA 4JUZA 5J2CA 4DSIA 5J2GA 1OUQA 2FMQA 2W9BB 4UB1A 3NASA 1ZQUA 4ECXA 3OVAA 2KOBA 3H8WA 2KHQA 4E80A 5DQGA 4NXWA 2H5XA 8ICQA 2IHOA 3WFRE 1S76D 3NRZA 9ICMA 2HN1A 2AQ4A 2ZUDA 9ICQA 3SQIA 1B4FA 1KSPA 3HKZF 2YB4A 1JN3A 5HHIA 4IS7A 1OU5A 2YTUA 8ICFA 4LZGA 4J9MA 5AKJA 3QNMA 2F3NA 2BPFA 8ICOA 4ED3A 3GILA 2E5SA 2ATLA 5EE0A 3MBYA 1L7PA 2N1RA 2ASDA 2W04A 4U7CA 3HKZC 3LQCB 3TACB 3AQKA 1NJXA 4E7XA 2K4PA 3KZXA 3BZKA 3GV8B 2C2EA 3L9DA 4PH5A 1Z00A 3ETRA 1RQLA 1KW4A 4US9A 4WOYA 4LT6A 4WBZA 2BGWA 3H37A 3MR6A 4I2JA 3CRXA 5AKXA 3N4MB 4ECRA 4OO1J 5FP0A 2ZH6A 4EEKA 1ZQNA 5D49A 3SAHA 3M9OB 1S9FA 7ICSA 2HHQA 1KKXA 1SV4A 4FO6A 2KVCA 3IG5A 2FE9A 2VJ5A 1P7DA 3C2KA 5AM3A 2LYBA 5ALFA 3C1YA 4UARA 1NKBA 2RP5A 5CA7A 8ICNA 3MDCA 1ZRMA 2ZIXA 4NLGA 3KKAA 1ZQTA 2NRWA 2E3TA 1SWWA 4F5QA 5AIAA 3N7PD 2FMPA 1S10A 4EV6A 5KFWA 5BPCA 3RJHA 4I28A 3QU9A 5IIMA 1X40A 4M6WB 2IHMA
chains in the Genus database with same CATH topology
1FA0A 1TFYA 5KG6A 3TAPA 4PHEA 3MR3A 1PZNA 4DS5A 5DLFA 1ZQKA 4XA5A 4ELTA 1ZQLA 3GFKB 3JPQA 3H7IA 4DSJA 3EW9A 2B21A 2MUTB 3LWMA 4O5CA 3TAQA 4ED7A 4F4KA 5KFTA 3MFHA 4EBDA 5CB1A 8ICIA 4WC6A 4YR0A 2DR9A 3V6HA 3GV7B 4F50A 3PW0A 7ICFA 1B22A 2I1QA 4ATBA 4QZAA 3H39A 1ZYQA 1JAJA 1ZJNA 3LWLA 1BPXA 4LVSA 5DBCA 1NJWA 3Q8MA 1ZQQA 1AROP 4M9HA 2ZHBA 3UQ2A 9ICVA 5KG7A 5DB9A 4YG2A 4I2IA 3PX0A 3RH6A 3Q8RB 4DSKA 4EEYA 5DB8A 4KN4A 4NM1A 1Y88A 4O3SA 4QZIA 2ID1A 3RJEA 1CEZA 8ICYA 4ED8A 3KTQA 5KG2A 2BE3A 1KFDA 3ORYA 4RQ5A 1ZQJA 5HMLA 3PR5B 4UQGA 4J9KA 4UBBA 1NK9A 1BPZA 4X0BA 1NK4A 4KITB 5KFHA 3HPOA 4UBCA 1ZQYA 2V4RA 3BQ1A 2ZUBA 5KFUA 1T7PA 4RZRA 4IQUA 4RQ3A 3UQ0A 2ZJAA 1XO1A 4RT2A 4O3NA 4FS2A 5KFYA 1BPYA 3PO5A 1WOTA 5HRDA 2AJQA 4B9VA 4IRDA 2HVHA 1L3UA 2UVRA 1D9FA 4O3RA 4DFMA 5HRKA 4YR2A 1SL0A 1S0VA 4RUAA 1U47A 4MEXA 4QZ9A 3KHGA 4TURA 4XRHA 9ICTA 4WC4A 4X0AA 4HYKA 1DGSA 4IR9A 5KFVA 2W9AA 1RYRA 4RWOA 2RDIA 3E2EA 3RRHA 5KFCA 9ICOA 4QWBA 1BNPA 2A1JA 3KHRA 3RBEA 3OSPA 1T3NA 1MQ2A 3RR8A 1XWLA 5EWEA 4ECZA 3WFQE 2ZTEA 2I9GA 4JK1A 2R8IA 2KZMA 1DK2A 3RAQA 2HHTA 5J2JA 4F5PA 4FHPA 1Q79A 1BPDA 4GC7A 4F5NA 1BNOA 2PBEA 4B9SA 4JV0A 4G3IA 1QTMA 1ZJMA 4DQSA 2PFQA 4FHYA 3MGHA 4WBYA 3M8SA 4EBCA 1XS9D 1KLNA 4QZ8A 2ZH3A 3M8RA 4C8NA 4QWAA 3GIJA 1NJZA 5HR9A 5CHGA 5L1IA 1ZQOA 4RQ8A 1S0MA 2J6SA 2GWSA 3ZDAA 4R8UB 4JV2A 3JPSA 3UPSA 4I2DA 2BCSA 1UEUA 4M0AA 3T5KA 4O3OA 2IBKA 4BWMA 4I2EA 7ICMA 4BDPA 4TUPA 4DL6A 3H3AA 2O1PA 3M9NB 2AGQA 2DRAA 4RNNA 1KDHA 4DEZA 1KFSA 4FBTA 2Y1JA 4P2HA 2NRZA 4M6WA 3PY8A 1MC8A 4RNOA 4ECSA 1X2IA 3JPOA 8ICXA 1TK5A 5KFMA 2XCPA 1RYSA 2KFNA 9ICWA 5J2KA 5F9LA 5L1JA 4KLUA 4MFAA 5DLGA 1RZTA 3T3FA 1X9MA 5HMMA 4KLGA 2DRBA 2MUTA 5IINA 9ICSA 3EWAA 2JEFA 5KFXA 2C2DA 8ICUA 4X4TA 3AQLA 3HX0A 2JZBA 5EWFA 4R64A 1TAQA 3T5LA 3JZ0A 4RNMA 5JUMA 5J2IA 5J0PA 4DFJA 2BQUA 2IMWP 5J0RA 4YXMA 2UVVA 2HHWA 5HREA 3FYHA 2XC9A 2JEJA 5DDYA 5IIIA 1SKWA 3RH5A 3TFRA 3OV7A 5KFGA 5DB6A 1ZQPA 3TARA 3RB6A 2ZH5A 4F5RA 4RWPA 4DF8A 1IM4A 3AU6A 3B0YA 3OHBA 2PFNA 4TQSA 2XO7A 2JEIA 4F4WA 4DS4A 2DPIA 4QZFA 4Q45A 4F8RA 4I2CA 4X4PA 4NXZA 4UB3A 4ELUA 3LDAA 4MEYA 5KFOA 3C2LA 1SL1A 1NK5A 1TAUA 3Q8QB 3V6KA 4QW9A 3UXPA 2BDPA 5EWGA 4B9NA 3HWTA 5DQIA 5DBBA 4DSLA 4NLKA 1SL2A 1DOQA 2BR0A 3RJJA 7ICQA 4UD4A 4UAYA 2FLLA 3C18A 3UPQA 1LB2B 2FPMA 5J2AA 3C23A 3V72A 3WFSC 5KFRA 2BCRA 4BXOA 2HHVA 4XUSA 2F1IA 3OVBA 2BKEA 3PX6A 5DQHA 4Z6FA 5TZVA 4QZHA 5HRLA 8ICVA 4WCWA 5D4BA 4NLZA 9ICAA 4X4RA 3QZ8A 1V9PA 3ZDCA 4J9PA 4MFCA 9ICLA 4M5DA 4GLXA 8ICZA 1UETA 4IQVA 4ECQA 4S3NA 2M2TA 2ZUCA 3RRGA 5HRGA 4BWJA 1WCNA 5HHHA 2FLPA 3RR7A 4O5KA 4QWEA 1ZQCA 1ZQXA 1HUOA 4YFKA 4YXJA 1TV9A 3PMNA 1TK0A 1L3TA 1UA0A 4O3QA 3OJSA 1EXNA 1KFTA 2XGQA 3AUOA 1BVSA 1K1SA 3M9MB 1TK8A 4MFFA 4DO9A 2DR8A 4J9QA 2NRVA 3ZD9A 4NKUA 2DPJA 4DQIA 4EBEA 3WFOA 1ZQHA 4KLQA 4EBJA 1L5UA 1SKRA 2M2WA 2AGOA 4RWNA 4I29A 4KLHA 3GDXA 2ZH7A 1TFWA 8ICBA 9ICEA 5KFPA 1VJ7A 2BCUA 1S97A 2DVIA 2W8LA 3C21A 4YD2A 3UXNA 7ICEA 5EOZA 2R8KA 1KTQA 4TUSA 5J0SA 3JPPA 1D8LA 4RQ6A 1RXVA 4GXIA 2PI4A 4KMUA 4X5VA 5J0OA 7ICHA 1R8CA 4QZEA 4YD1A 5KT5A 4RT3A 3GIMA 3OHAA 4AT8A 4WC3A 1ZETA 3OUYA 3ISCA 2VANA 4IRKA 4JV1A 7ICUA 2PXIA 5KT7A 5DBAA 2BCQA 1LV5A 1NK8A 2KP7A 4GC6A 8ICKA 2PFOA 3PW2A 4YMNA 1MIYA 4FBUA 4RU9A 1PX5A 3PW5A 3UXOA 3QEAZ 1ZQDA 2ISOA 2W9MA 4R8UA 4AT7A 1V4AA 1TKDA 2M2UA 3IHQB 4KLLA 3N97B 2BCVA 7ICPA 2PFPA 1XSNA 3RJFA 5DG9A 3PNCA 3RB4A 2NRKA 2BQRA 2ZHAA 2Q0ZX 3V7LA 2F1HA 4RQ1A 2ZTCA 4DSEA 2NRTA 4NKTA 1T8EA 5KFNA 9ICHA 4QZCA 1JX4A 4J9NA 4JWMA 2C28A 2BHNA 1IXRA 4R66A 3ZDEA 4QZBA 4FS1A 3MGIA 3GQCA 4J9LA 5C5JA 4C8OA 4EZ9A 5KT3A 4O9MA 5IIOA 4PHPA 4EYIB 4ED2A 1TVAA 3ETLA 4DSFA 1NKCA 4Z6EA 4IG8A 4DOBA 1NK6A 5KFJA 3V7KA 3BQ0A 1H38A 2XY7A 1DK3A 1R8BA 5F2VO 5CP2A 2AQ0A 5CJ7A 3OJUA 2IHNA 4YVZA 1NO5A 3TANA 5DGAA 7ICKA 1QLNA 1L3VA 4I27A 4DOAA 4F4YA 3TFSA 2J6UA 1ZQWA 2P6UA 4QZGA 1NZPA 3PW7A 2HVIA 1BPEA 4KLJA 3ISBA 4FHVA 1NK0A 2V4QA 4F2RA 2M2VA 2O5AA 4DFPA 9ICUA 2R8HA 3KHHA 5HRIA 4NY8A 3H8SA 4I2HA 5HC9A 2R8JA 5KFBA 3TQ1A 2AGPA 3RB3A 3ZD8A 3H40A 1UEVA 4JWNA 4FH5A 4J9RA 4PPXA 3WFPA 4ELVA 4CCHA 4K4IA 5D46A 4ZH4A 5KFAA 5L9XA 4DLGA 3BQTA 5CWRA 2AU0A 2KTQA 4MF2A 8ICGA 4AT9B 2RFFA 1N48A 2ZH9A 4F92B 1COOA 3QE9Y 2UVUA 4PGYA 4KLOA 1ZQRA 1ZQSA 1A76A 3EYZA 1U45A 3PVXA 1XU4A 7ICGA 3V7JA 1L3SA 2PI5A 2KFZA 2ISPA 3MABA 1JXLA 3RJIA 5KG1A 5KG4A 4DL2A 4C8KA 1S77D 2ASJA 2NRXA 3SV4A 3T5HA 2VA3A 2LYHA 4O5EA 3QZ7A 5J0QA 3HT3A 4K4GA 1MSWD 4BXOB 1S0OA 5KT4A 4O0IA 4GXKA 1Z3EB 5DDMA 8ICCA 3IM1A 2C2RA 4O3PA 5J0XA 9ICGA 1MIWA 4EP7A 5KFFA 3SI8A 3FDSA 4IRCA 9ICRA 4FH3A 1NJYA 1JIHA 2DR5A 4F2SA 5IIKA 4ED1A 4IQTA 3GIKA 4M04A 4ECVA 2HHXA 3SZ2A 4FHXA 4X4VA 3EPGA 7ICJA 2FPLA 3RAXA 5IILA 1JMSA 5L1KA 4DFKA 4X4OA 3OSNA 3OVSA 2C22A 1ZQIA 4NLNA 4UAWA 4WC7A 3PX4A 1WCLA 4Q43A 4Z6DA 4TUQA 2VA2A 4C8MA 3ZDBA 2XGPA 1YLQA 1SZPA 1ZQAA 2FPKA 2BQ3A 4FHWA 5KFKA 2W8KA 4P4MA 2ZJ5A 4NM2A 3RBDA 1NOMA 1X9WA 9ICCA 5J0TA 9ICBA 1Q78A 4QWCA 1ZQMA 5J0WA 4EZ6A 3EZ5A 2XY6A 4IQWA 1R8AA 4UB5A 4QWDA 5F9NA 3NTUA 3RJKA 1UT5A 7ICSA 5J2BA 2IA6A 4R65A 4F91B 4EYHB 4RPYA 3RH4A 4P4PA 4Z6CA 4RPZA 4DF4A 8ICEA 4F4XA 1ZQEA 3MDAA 5KG0A 3LK9A 2MAXA 4WC1A 3SV3A 3B0XA 3GV5B 5HNKA 4WC5A 4AT7B 3H4BA 3PV8A 2ZTDA 2HW3A 3MFIA 1KNYA 4DQPA 9ICXA 3RB0A 4RQ2A 4ECYA 3C5FA 1SKSA 1JXEA 1U4BA 1KRPA 2KZ3A 4DL7A 3RJGA 2V9WA 4KLIA 5J29A 3HP6A 2ALZA 4R63A 4XQ7A 4QZDA 4B9TA 4E8FA 3JPRA 9ICJA 3G6XA 2XY5A 2ASLA 2M9NA 4ATBB 5KG5A 3K75D 3C66A 4UB2A 4LZDA 5HRFA 8ICAA 4RQ4A 2J6TA 1NK7A 5DKWA 7ICIA 4E0DA 5DECA 4DL3A 5KFEA 5L1LA 3RTVA 2A1JB 2FMSA 4J9OA 1CUKA 4DQQA 4KLSA 2HHSA 3GIIA 8ICWA 2F1JA 4KN7A 4DLEA 3Q8KA 3SYZA 4AT8B 3OUYB 3Q8PB 4X4SA 3C1ZA 4RQ0A 5J2EA 1MIVA 5IIJA 4M9GA 1ZQZA 7ICLA 4KLEA 3MR5A 4WC2A 5DEDA 1N56A 3G6YA 5BOMA 3T5JA 5HRHA 5J0YA 3ZDDA 9ICIA 5KFIA 4JUZA 5J2CA 3PR4A 3EPIA 1RPLA 4DQRA 4QW8A 4DSIA 4KTQA 5J2GA 2FMQA 2HHPA 8ICJA 4M9JA 5KFLA 7ICOA 2W9BB 1ZQGA 3BJYA 4UB1A 4ECXA 1ZQUA 4ECTA 2UVWA 3OVAA 3H8WA 8ICMA 1C7YA 5KG3A 4E80A 5DQGA 2JZBB 2R8GA 2H5XA 4M9NA 2ZH8A 4X4UA 4I2AA 1UA1A 8ICQA 3HW8A 3MR2A 1ZQFA 5KFSA 8ICPA 2ZJ8A 4Q8EA 3V6JA 5KTQA 4YCXA 3WFRE 1BPBA 1S76D 1U48A 2HHUA 9ICMA 2AQ4A 4C8LA 2JEGA 2W9CB 2ZUDA 9ICQA 5BOLA 3ISDA 3QEBZ 4RQ7A 1KSPA 4DWIA 9ICKA 3AQNA 1JN3A 3H4DA 1KEJA 5HHIA 3PO4A 1OU5A 5DB7A 4DL4A 8ICFA 4PHDA 4J9MA 1XC9A 4LZGA 3PW4A 2W9CA 4IR1A 2DFLA 2BPFA 1D8YA 8ICOA 1QSYA 4ED3A 3GILA 5HP4A 1F5AA 4YR3A 4DL5A 8ICLA 5J0UA 2ATLA 5J2HA 4KLMA 5J2DA 2Y1IA 3TI0A 3Q8LA 7ICNA 4EBKA 4K4HA 4B9LA 3MBYA 4F5OA 2ASDA 4YMMA 1XSLA 4I2GA 8ICTA 2BPGA 3LQCB 3HIYA 5KFZA 1TFRA 3AQKA 4PHAA 1NJXA 2RDJA 1X9SA 4ECWA 4E7XA 4ECUA 2W9BA 5DG7A 5KT6A 1UT8A 2C2EA 3GV8B 3L9DA 4UD5A 1A77A 4PH5A 5DGBA 1Z00A 1R89A 2DR7A 2WTFA 4LT6A 2BGWA 1ZQBA 5KFDA 4WBZA 3H37A 3MR6A 4F4ZA 2ZH1A 4I2JA 1VFGA 2P66A 4RPXA 3N4MB 4ECRA 2FLNA 2OWOA 4KLTA 2ZH6A 4X4NA 1ZQVA 5CR0A 1ZQNA 4RUCA 2P6RA 1BGXT 4YQWA 5D49A 3AU2A 4BGDA 9ICPA 1HJPA 4YN4A 4PGQA 3M9OB 1S9FA 4KLDA 1K1QA 4I2BA 4FO6A 2HHQA 9ICNA 4PGXA 2Q66A 7ICTA 3Q8SB 4J9SA 3G6VA 4ED0A 1QSLA 4M2YA 3C2MA 4XQ8A 3K4GA 2KZZA 3C2KA 2ZH2A 8ICHA 4UAZA 3JPNA 7ICRA 3NGDA 4KLFA 3KHLA 8ICSA 1D9DA 4B9MA 3C1YA 4AT9A 3C5GA 4Q44A 1NKBA 3HJ1A 5CA7A 3H8JA 3JPTA 4Q8FA 8ICNA 3NYBA 4MF8A 4F3OA 3MDCA 4DOCA 1RXWA 1NKEA 2BPCA 1S0NA 4NLGA 8ICRA 4GXJA 4M9LA 1MQ3A 5J2FA 2ZH4A 4TQRA 5HRBA 4I2FA 3H38A 4X4QA 1ZQTA 2NRWA 4YMOA 3BQ2A 4B9UA 1B43A 1HUZA 1U9LA 4F5QA 7ICVA 1U49A 4M47A 1JQRA 1T4GA 1Z00B 2KN7A 3BDPA 3PMLA 4YP3A 1QSSA 2FMPA 5DG8A 4ED6A 1S10A 4F93B 5KFWA 3AQMA 4RWQA 4WC0A 3THVA 2VA8A 4P4OA 5BPCA 2XCAA 3RJHA 4UB4A 3OGUA 4I28A 9ICFA 3HJ4A 5IIMA 3JYYA 1XSPA 5KT2A 4M6WB 5KFQA 2IHMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FA0 A;  1TFY A;  5KG6 A;  3TAP A;  4PHE A;  3MR3 A;  1PZN A;  4DS5 A;  5DLF A;  1ZQK A;  4XA5 A;  4ELT A;  1ZQL A;  3GFK B;  3JPQ A;  3H7I A;  4DSJ A;  3EW9 A;  2B21 A;  2MUT B;  3LWM A;  4O5C A;  3TAQ A;  4ED7 A;  4F4K A;  5KFT A;  3MFH A;  4EBD A;  5CB1 A;  8ICI A;  4WC6 A;  4YR0 A;  2DR9 A;  3V6H A;  3GV7 B;  4F50 A;  3PW0 A;  7ICF A;  1B22 A;  2I1Q A;  4ATB A;  4QZA A;  3H39 A;  1ZYQ A;  1JAJ A;  1ZJN A;  3LWL A;  1BPX A;  4LVS A;  5DBC A;  1NJW A;  3Q8M A;  1ZQQ A;  1ARO P;  4M9H A;  2ZHB A;  3UQ2 A;  9ICV A;  5KG7 A;  5DB9 A;  4YG2 A;  4I2I A;  3PX0 A;  3RH6 A;  3Q8R B;  4DSK A;  4EEY A;  5DB8 A;  4KN4 A;  4NM1 A;  1Y88 A;  4O3S A;  4QZI A;  2ID1 A;  3RJE A;  1CEZ A;  8ICY A;  4ED8 A;  3KTQ A;  5KG2 A;  2BE3 A;  1KFD A;  3ORY A;  4RQ5 A;  1ZQJ A;  5HML A;  3PR5 B;  4UQG A;  4J9K A;  4UBB A;  1NK9 A;  1BPZ A;  4X0B A;  1NK4 A;  4KIT B;  5KFH A;  3HPO A;  4UBC A;  1ZQY A;  2V4R A;  3BQ1 A;  2ZUB A;  5KFU A;  1T7P A;  4RZR A;  4IQU A;  4RQ3 A;  3UQ0 A;  2ZJA A;  1XO1 A;  4RT2 A;  4O3N A;  4FS2 A;  5KFY A;  1BPY A;  3PO5 A;  1WOT A;  5HRD A;  2AJQ A;  4B9V A;  4IRD A;  2HVH A;  1L3U A;  2UVR A;  1D9F A;  4O3R A;  4DFM A;  5HRK A;  4YR2 A;  1SL0 A;  1S0V A;  4RUA A;  1U47 A;  4MEX A;  4QZ9 A;  3KHG A;  4TUR A;  4XRH A;  9ICT A;  4WC4 A;  4X0A A;  4HYK A;  1DGS A;  4IR9 A;  5KFV A;  2W9A A;  1RYR A;  4RWO A;  2RDI A;  3E2E A;  3RRH A;  5KFC A;  9ICO A;  4QWB A;  1BNP A;  2A1J A;  3KHR A;  3RBE A;  3OSP A;  1T3N A;  1MQ2 A;  3RR8 A;  1XWL A;  5EWE A;  4ECZ A;  3WFQ E;  2ZTE A;  2I9G A;  4JK1 A;  2R8I A;  2KZM A;  1DK2 A;  3RAQ A;  2HHT A;  5J2J A;  4F5P A;  4FHP A;  1Q79 A;  1BPD A;  4GC7 A;  4F5N A;  1BNO A;  2PBE A;  4B9S A;  4JV0 A;  4G3I A;  1QTM A;  1ZJM A;  4DQS A;  2PFQ A;  4FHY A;  3MGH A;  4WBY A;  3M8S A;  4EBC A;  1XS9 D;  1KLN A;  4QZ8 A;  2ZH3 A;  3M8R A;  4C8N A;  4QWA A;  3GIJ A;  1NJZ A;  5HR9 A;  5CHG A;  5L1I A;  1ZQO A;  4RQ8 A;  1S0M A;  2J6S A;  2GWS A;  3ZDA A;  4R8U B;  4JV2 A;  3JPS A;  3UPS A;  4I2D A;  2BCS A;  1UEU A;  4M0A A;  3T5K A;  4O3O A;  2IBK A;  4BWM A;  4I2E A;  7ICM A;  4BDP A;  4TUP A;  4DL6 A;  3H3A A;  2O1P A;  3M9N B;  2AGQ A;  2DRA A;  4RNN A;  1KDH A;  4DEZ A;  1KFS A;  4FBT A;  2Y1J A;  4P2H A;  2NRZ A;  4M6W A;  3PY8 A;  1MC8 A;  4RNO A;  4ECS A;  1X2I A;  3JPO A;  8ICX A;  1TK5 A;  5KFM A;  2XCP A;  1RYS A;  2KFN A;  9ICW A;  5J2K A;  5F9L A;  5L1J A;  4KLU A;  4MFA A;  5DLG A;  1RZT A;  3T3F A;  1X9M A;  5HMM A;  4KLG A;  2DRB A;  2MUT A;  5IIN A;  9ICS A;  3EWA A;  2JEF A;  5KFX A;  2C2D A;  8ICU A;  4X4T A;  3AQL A;  3HX0 A;  2JZB A;  5EWF A;  4R64 A;  1TAQ A;  3T5L A;  3JZ0 A;  4RNM A;  5JUM A;  5J2I A;  5J0P A;  4DFJ A;  2BQU A;  2IMW P;  5J0R A;  4YXM A;  2UVV A;  2HHW A;  5HRE A;  3FYH A;  2XC9 A;  2JEJ A;  5DDY A;  5III A;  1SKW A;  3RH5 A;  3TFR A;  3OV7 A;  5KFG A;  5DB6 A;  1ZQP A;  3TAR A;  3RB6 A;  2ZH5 A;  4F5R A;  4RWP A;  4DF8 A;  1IM4 A;  3AU6 A;  3B0Y A;  3OHB A;  2PFN A;  4TQS A;  2XO7 A;  2JEI A;  4F4W A;  4DS4 A;  2DPI A;  4QZF A;  4Q45 A;  4F8R A;  4I2C A;  4X4P A;  4NXZ A;  4UB3 A;  4ELU A;  3LDA A;  4MEY A;  5KFO A;  3C2L A;  1SL1 A;  1NK5 A;  1TAU A;  3Q8Q B;  3V6K A;  4QW9 A;  3UXP A;  2BDP A;  5EWG A;  4B9N A;  3HWT A;  5DQI A;  5DBB A;  4DSL A;  4NLK A;  1SL2 A;  1DOQ A;  2BR0 A;  3RJJ A;  7ICQ A;  4UD4 A;  4UAY A;  2FLL A;  3C18 A;  3UPQ A;  1LB2 B;  2FPM A;  5J2A A;  3C23 A;  3V72 A;  3WFS C;  5KFR A;  2BCR A;  4BXO A;  2HHV A;  4XUS A;  2F1I A;  3OVB A;  2BKE A;  3PX6 A;  5DQH A;  4Z6F A;  5TZV A;  4QZH A;  5HRL A;  8ICV A;  4WCW A;  5D4B A;  4NLZ A;  9ICA A;  4X4R A;  3QZ8 A;  1V9P A;  3ZDC A;  4J9P A;  4MFC A;  9ICL A;  4M5D A;  4GLX A;  8ICZ A;  1UET A;  4IQV A;  4ECQ A;  4S3N A;  2M2T A;  2ZUC A;  3RRG A;  5HRG A;  4BWJ A;  1WCN A;  5HHH A;  2FLP A;  3RR7 A;  4O5K A;  4QWE A;  1ZQC A;  1ZQX A;  1HUO A;  4YFK A;  4YXJ A;  1TV9 A;  3PMN A;  1TK0 A;  1L3T A;  1UA0 A;  4O3Q A;  3OJS A;  1EXN A;  1KFT A;  2XGQ A;  3AUO A;  1BVS A;  1K1S A;  3M9M B;  1TK8 A;  4MFF A;  4DO9 A;  2DR8 A;  4J9Q A;  2NRV A;  3ZD9 A;  4NKU A;  2DPJ A;  4DQI A;  4EBE A;  3WFO A;  1ZQH A;  4KLQ A;  4EBJ A;  1L5U A;  1SKR A;  2M2W A;  2AGO A;  4RWN A;  4I29 A;  4KLH A;  3GDX A;  2ZH7 A;  1TFW A;  8ICB A;  9ICE A;  5KFP A;  1VJ7 A;  2BCU A;  1S97 A;  2DVI A;  2W8L A;  3C21 A;  4YD2 A;  3UXN A;  7ICE A;  5EOZ A;  2R8K A;  1KTQ A;  4TUS A;  5J0S A;  3JPP A;  1D8L A;  4RQ6 A;  1RXV A;  4GXI A;  2PI4 A;  4KMU A;  4X5V A;  5J0O A;  7ICH A;  1R8C A;  4QZE A;  4YD1 A;  5KT5 A;  4RT3 A;  3GIM A;  3OHA A;  4AT8 A;  4WC3 A;  1ZET A;  3OUY A;  3ISC A;  2VAN A;  4IRK A;  4JV1 A;  7ICU A;  2PXI A;  5KT7 A;  5DBA A;  2BCQ A;  1LV5 A;  1NK8 A;  2KP7 A;  4GC6 A;  8ICK A;  2PFO A;  3PW2 A;  4YMN A;  1MIY A;  4FBU A;  4RU9 A;  1PX5 A;  3PW5 A;  3UXO A;  3QEA Z;  1ZQD A;  2ISO A;  2W9M A;  4R8U A;  4AT7 A;  1V4A A;  1TKD A;  2M2U A;  3IHQ B;  4KLL A;  3N97 B;  2BCV A;  7ICP A;  2PFP A;  1XSN A;  3RJF A;  5DG9 A;  3PNC A;  3RB4 A;  2NRK A;  2BQR A;  2ZHA A;  2Q0Z X;  3V7L A;  2F1H A;  4RQ1 A;  2ZTC A;  4DSE A;  2NRT A;  4NKT A;  1T8E A;  5KFN A;  9ICH A;  4QZC A;  1JX4 A;  4J9N A;  4JWM A;  2C28 A;  2BHN A;  1IXR A;  4R66 A;  3ZDE A;  4QZB A;  4FS1 A;  3MGI A;  3GQC A;  4J9L A;  5C5J A;  4C8O A;  4EZ9 A;  5KT3 A;  4O9M A;  5IIO A;  4PHP A;  4EYI B;  4ED2 A;  1TVA A;  3ETL A;  4DSF A;  1NKC A;  4Z6E A;  4IG8 A;  4DOB A;  1NK6 A;  5KFJ A;  3V7K A;  3BQ0 A;  1H38 A;  2XY7 A;  1DK3 A;  1R8B A;  5F2V O;  5CP2 A;  2AQ0 A;  5CJ7 A;  3OJU A;  2IHN A;  4YVZ A;  1NO5 A;  3TAN A;  5DGA A;  7ICK A;  1QLN A;  1L3V A;  4I27 A;  4DOA A;  4F4Y A;  3TFS A;  2J6U A;  1ZQW A;  2P6U A;  4QZG A;  1NZP A;  3PW7 A;  2HVI A;  1BPE A;  4KLJ A;  3ISB A;  4FHV A;  1NK0 A;  2V4Q A;  4F2R A;  2M2V A;  2O5A A;  4DFP A;  9ICU A;  2R8H A;  3KHH A;  5HRI A;  4NY8 A;  3H8S A;  4I2H A;  5HC9 A;  2R8J A;  5KFB A;  3TQ1 A;  2AGP A;  3RB3 A;  3ZD8 A;  3H40 A;  1UEV A;  4JWN A;  4FH5 A;  4J9R A;  4PPX A;  3WFP A;  4ELV A;  4CCH A;  4K4I A;  5D46 A;  4ZH4 A;  5KFA A;  5L9X A;  4DLG A;  3BQT A;  5CWR A;  2AU0 A;  2KTQ A;  4MF2 A;  8ICG A;  4AT9 B;  2RFF A;  1N48 A;  2ZH9 A;  4F92 B;  1COO A;  3QE9 Y;  2UVU A;  4PGY A;  4KLO A;  1ZQR A;  1ZQS A;  1A76 A;  3EYZ A;  1U45 A;  3PVX A;  1XU4 A;  7ICG A;  3V7J A;  1L3S A;  2PI5 A;  2KFZ A;  2ISP A;  3MAB A;  1JXL A;  3RJI A;  5KG1 A;  5KG4 A;  4DL2 A;  4C8K A;  1S77 D;  2ASJ A;  2NRX A;  3SV4 A;  3T5H A;  2VA3 A;  2LYH A;  4O5E A;  3QZ7 A;  5J0Q A;  3HT3 A;  4K4G A;  1MSW D;  4BXO B;  1S0O A;  5KT4 A;  4O0I A;  4GXK A;  1Z3E B;  5DDM A;  8ICC A;  3IM1 A;  2C2R A;  4O3P A;  5J0X A;  9ICG A;  1MIW A;  4EP7 A;  5KFF A;  3SI8 A;  3FDS A;  4IRC A;  9ICR A;  4FH3 A;  1NJY A;  1JIH A;  2DR5 A;  4F2S A;  5IIK A;  4ED1 A;  4IQT A;  3GIK A;  4M04 A;  4ECV A;  2HHX A;  3SZ2 A;  4FHX A;  4X4V A;  3EPG A;  7ICJ A;  2FPL A;  3RAX A;  5IIL A;  1JMS A;  5L1K A;  4DFK A;  4X4O A;  3OSN A;  3OVS A;  2C22 A;  1ZQI A;  4NLN A;  4UAW A;  4WC7 A;  3PX4 A;  1WCL A;  4Q43 A;  4Z6D A;  4TUQ A;  2VA2 A;  4C8M A;  3ZDB A;  2XGP A;  1YLQ A;  1SZP A;  1ZQA A;  2FPK A;  2BQ3 A;  4FHW A;  5KFK A;  2W8K A;  4P4M A;  2ZJ5 A;  4NM2 A;  3RBD A;  1NOM A;  1X9W A;  9ICC A;  5J0T A;  9ICB A;  1Q78 A;  4QWC A;  1ZQM A;  5J0W A;  4EZ6 A;  3EZ5 A;  2XY6 A;  4IQW A;  1R8A A;  4UB5 A;  4QWD A;  5F9N A;  3NTU A;  3RJK A;  1UT5 A;  7ICS A;  5J2B A;  2IA6 A;  4R65 A;  4F91 B;  4EYH B;  4RPY A;  3RH4 A;  4P4P A;  4Z6C A;  4RPZ A;  4DF4 A;  8ICE A;  4F4X A;  1ZQE A;  3MDA A;  5KG0 A;  3LK9 A;  2MAX A;  4WC1 A;  3SV3 A;  3B0X A;  3GV5 B;  5HNK A;  4WC5 A;  4AT7 B;  3H4B A;  3PV8 A;  2ZTD A;  2HW3 A;  3MFI A;  1KNY A;  4DQP A;  9ICX A;  3RB0 A;  4RQ2 A;  4ECY A;  3C5F A;  1SKS A;  1JXE A;  1U4B A;  1KRP A;  2KZ3 A;  4DL7 A;  3RJG A;  2V9W A;  4KLI A;  5J29 A;  3HP6 A;  2ALZ A;  4R63 A;  4XQ7 A;  4QZD A;  4B9T A;  4E8F A;  3JPR A;  9ICJ A;  3G6X A;  2XY5 A;  2ASL A;  2M9N A;  4ATB B;  5KG5 A;  3K75 D;  3C66 A;  4UB2 A;  4LZD A;  5HRF A;  8ICA A;  4RQ4 A;  2J6T A;  1NK7 A;  5DKW A;  7ICI A;  4E0D A;  5DEC A;  4DL3 A;  5KFE A;  5L1L A;  3RTV A;  2A1J B;  2FMS A;  4J9O A;  1CUK A;  4DQQ A;  4KLS A;  2HHS A;  3GII A;  8ICW A;  2F1J A;  4KN7 A;  4DLE A;  3Q8K A;  3SYZ A;  4AT8 B;  3OUY B;  3Q8P B;  4X4S A;  3C1Z A;  4RQ0 A;  5J2E A;  1MIV A;  5IIJ A;  4M9G A;  1ZQZ A;  7ICL A;  4KLE A;  3MR5 A;  4WC2 A;  5DED A;  1N56 A;  3G6Y A;  5BOM A;  3T5J A;  5HRH A;  5J0Y A;  3ZDD A;  9ICI A;  5KFI A;  4JUZ A;  5J2C A;  3PR4 A;  3EPI A;  1RPL A;  4DQR A;  4QW8 A;  4DSI A;  4KTQ A;  5J2G A;  2FMQ A;  2HHP A;  8ICJ A;  4M9J A;  5KFL A;  7ICO A;  2W9B B;  1ZQG A;  3BJY A;  4UB1 A;  4ECX A;  1ZQU A;  4ECT A;  2UVW A;  3OVA A;  3H8W A;  8ICM A;  1C7Y A;  5KG3 A;  4E80 A;  5DQG A;  2JZB B;  2R8G A;  2H5X A;  4M9N A;  2ZH8 A;  4X4U A;  4I2A A;  1UA1 A;  8ICQ A;  3HW8 A;  3MR2 A;  1ZQF A;  5KFS A;  8ICP A;  2ZJ8 A;  4Q8E A;  3V6J A;  5KTQ A;  4YCX A;  3WFR E;  1BPB A;  1S76 D;  1U48 A;  2HHU A;  9ICM A;  2AQ4 A;  4C8L A;  2JEG A;  2W9C B;  2ZUD A;  9ICQ A;  5BOL A;  3ISD A;  3QEB Z;  4RQ7 A;  1KSP A;  4DWI A;  9ICK A;  3AQN A;  1JN3 A;  3H4D A;  1KEJ A;  5HHI A;  3PO4 A;  1OU5 A;  5DB7 A;  4DL4 A;  8ICF A;  4PHD A;  4J9M A;  1XC9 A;  4LZG A;  3PW4 A;  2W9C A;  4IR1 A;  2DFL A;  2BPF A;  1D8Y A;  8ICO A;  1QSY A;  4ED3 A;  3GIL A;  5HP4 A;  1F5A A;  4YR3 A;  4DL5 A;  8ICL A;  5J0U A;  2ATL A;  5J2H A;  4KLM A;  5J2D A;  2Y1I A;  3TI0 A;  3Q8L A;  7ICN A;  4EBK A;  4K4H A;  4B9L A;  3MBY A;  4F5O A;  2ASD A;  4YMM A;  1XSL A;  4I2G A;  8ICT A;  2BPG A;  3LQC B;  3HIY A;  5KFZ A;  1TFR A;  3AQK A;  4PHA A;  1NJX A;  2RDJ A;  1X9S A;  4ECW A;  4E7X A;  4ECU A;  2W9B A;  5DG7 A;  5KT6 A;  1UT8 A;  2C2E A;  3GV8 B;  3L9D A;  4UD5 A;  1A77 A;  4PH5 A;  5DGB A;  1Z00 A;  1R89 A;  2DR7 A;  2WTF A;  4LT6 A;  2BGW A;  1ZQB A;  5KFD A;  4WBZ A;  3H37 A;  3MR6 A;  4F4Z A;  2ZH1 A;  4I2J A;  1VFG A;  2P66 A;  4RPX A;  3N4M B;  4ECR A;  2FLN A;  2OWO A;  4KLT A;  2ZH6 A;  4X4N A;  1ZQV A;  5CR0 A;  1ZQN A;  4RUC A;  2P6R A;  1BGX T;  4YQW A;  5D49 A;  3AU2 A;  4BGD A;  9ICP A;  1HJP A;  4YN4 A;  4PGQ A;  3M9O B;  1S9F A;  4KLD A;  1K1Q A;  4I2B A;  4FO6 A;  2HHQ A;  9ICN A;  4PGX A;  2Q66 A;  7ICT A;  3Q8S B;  4J9S A;  3G6V A;  4ED0 A;  1QSL A;  4M2Y A;  3C2M A;  4XQ8 A;  3K4G A;  2KZZ A;  3C2K A;  2ZH2 A;  8ICH A;  4UAZ A;  3JPN A;  7ICR A;  3NGD A;  4KLF A;  3KHL A;  8ICS A;  1D9D A;  4B9M A;  3C1Y A;  4AT9 A;  3C5G A;  4Q44 A;  1NKB A;  3HJ1 A;  5CA7 A;  3H8J A;  3JPT A;  4Q8F A;  8ICN A;  3NYB A;  4MF8 A;  4F3O A;  3MDC A;  4DOC A;  1RXW A;  1NKE A;  2BPC A;  1S0N A;  4NLG A;  8ICR A;  4GXJ A;  4M9L A;  1MQ3 A;  5J2F A;  2ZH4 A;  4TQR A;  5HRB A;  4I2F A;  3H38 A;  4X4Q A;  1ZQT A;  2NRW A;  4YMO A;  3BQ2 A;  4B9U A;  1B43 A;  1HUZ A;  1U9L A;  4F5Q A;  7ICV A;  1U49 A;  4M47 A;  1JQR A;  1T4G A;  1Z00 B;  2KN7 A;  3BDP A;  3PML A;  4YP3 A;  1QSS A;  2FMP A;  5DG8 A;  4ED6 A;  1S10 A;  4F93 B;  5KFW A;  3AQM A;  4RWQ A;  4WC0 A;  3THV A;  2VA8 A;  4P4O A;  5BPC A;  2XCA A;  3RJH A;  4UB4 A;  3OGU A;  4I28 A;  9ICF A;  3HJ4 A;  5IIM A;  3JYY A;  1XSP A;  5KT2 A;  4M6W B;  5KFQ A;  2IHM A; 
#chains in the Genus database with same CATH topology
 1TFY A;  3MR3 A;  1ZQK A;  1LKY A;  1ZQL A;  3GFK B;  3JPQ A;  4O5C A;  3EW9 A;  2B21 A;  2DQN B;  4F4K A;  5KFT A;  4EBD A;  5HR6 A;  8ICI A;  4WC6 A;  3OPX A;  3GV7 B;  2W11 A;  1B22 A;  2I1Q A;  4ATB A;  1MA7 A;  1ZQQ A;  5ALD A;  4M9H A;  2DUY A;  9ICV A;  3RH6 A;  2D3D A;  5DB8 A;  4KN4 A;  3AM9 A;  2ID1 A;  3RJE A;  4ED8 A;  3KTQ A;  3ORY A;  4UBB A;  1BPZ A;  1NK4 A;  3BQ1 A;  3ZI4 A;  4RQ3 A;  2ZJA A;  4FS2 A;  2AH5 A;  1WOT A;  1L3U A;  1D9F A;  4O3R A;  2PMZ C;  4YR2 A;  1SL0 A;  4MEX A;  2FDR A;  4USA A;  1DGS A;  2W9A A;  2QB0 B;  1RYR A;  2WFA A;  3RRH A;  4KM5 A;  3OSP A;  3RR8 A;  2EAN A;  5EWE A;  2I9G A;  5J2J A;  3ED5 A;  1Q79 A;  2F44 A;  1BPD A;  1QTM A;  4Y2P A;  4JLX A;  5HR9 A;  4WH5 A;  2J6S A;  1S0M A;  4EEL A;  5B5E U;  5D63 A;  2KSO B;  4F71 A;  3JPS A;  2NO4 A;  3T5K A;  2FI1 A;  7ICM A;  5ALY A;  4DEZ A;  2QAR B;  2EWR A;  8ICX A;  4FFD A;  1RYS A;  9ICW A;  2HOQ A;  5F9L A;  4WQK A;  4MFA A;  5DLG A;  3T3F A;  5IIN A;  3D6J A;  5KFX A;  2HBM A;  1Z1B A;  3JZ0 A;  2L5Y A;  2BQU A;  2IMW P;  4YXM A;  2UVV A;  3FYH A;  2KV2 A;  5AI9 A;  5KFG A;  5DB6 A;  1ZQP A;  2WB1 F;  2YMM A;  4F5R A;  3SMV A;  3AU6 A;  2XO7 A;  2DPI A;  4X4P A;  4QZF A;  4I0U A;  5KFO A;  1SL1 A;  1PUZ A;  1ZD3 A;  2OEH A;  5EWG A;  3HWT A;  5DQI A;  7ICQ A;  3SEN A;  3RJJ A;  3O0F A;  4PL2 A;  4UD4 A;  4UAY A;  4C4R A;  3UPQ A;  1LB2 B;  2W55 A;  5J2A A;  3C23 A;  3OVB A;  3SAF A;  4Z6F A;  4QZH A;  2G5I B;  4NLZ A;  9ICA A;  4X4R A;  3QZ8 A;  1V9P A;  4M5D A;  2HMX A;  4EEN A;  1UET A;  4S3N A;  2Z7J A;  1DXS A;  3QU5 A;  4CF4 A;  2YX8 A;  1UA0 A;  3OJS A;  5AKL A;  1PK1 B;  1K1S A;  3M9M B;  4MFF A;  4DO9 A;  5AI0 A;  4NKU A;  4EBE A;  4RWN A;  1L5U A;  2AGO A;  4I29 A;  2ZIW B;  4OJO A;  1VJ7 A;  7ICE A;  2NO5 A;  5EOZ A;  1KTQ A;  1RXV A;  2XI9 A;  4QZE A;  2K8C B;  4YD1 A;  3KOO A;  4IRK A;  5KT7 A;  5DBA A;  2BCQ A;  3PW2 A;  1PX5 A;  3PSP A;  3QEA Z;  1Q46 A;  3KFU F;  2W9M A;  4AT7 A;  1V4A A;  2M2U A;  5AM2 A;  4KLL A;  4DCC A;  2PFP A;  2ZHA A;  1TE2 A;  4P0Q A;  2Q0Z X;  4FZN A;  2NRT A;  3HJE A;  2HCF A;  2QB0 A;  2BHN A;  4FS1 A;  2LKY A;  3GQC A;  4Y2Q A;  4AYB C;  5AI4 A;  5KT3 A;  1Q8K A;  5ALG A;  1ZRN A;  3AMZ A;  1NKC A;  4IG8 A;  1NK6 A;  3V7K A;  3BQ0 A;  2XY7 A;  2AHO B;  3OJU A;  5CJ7 A;  7ICK A;  4DOA A;  2J6U A;  4QZG A;  1BPE A;  1J97 A;  3QUT A;  1NK0 A;  2V4Q A;  4F2R A;  2O5A A;  4LEW A;  5HRI A;  2YY6 A;  5HC9 A;  3A0H U;  1VJ5 A;  2AGP A;  3H40 A;  2WHE A;  2AXT U;  8ICG A;  5CWR A;  3NVO A;  4MF2 A;  3QE9 Y;  4PGY A;  4KLO A;  2OHF A;  2PI5 A;  5ALS A;  2EH9 A;  4CGZ A;  3T5H A;  2VA3 A;  4OCZ A;  4O5E A;  5B3P A;  5J0Q A;  2DWQ A;  4BXO B;  1S0O A;  5AK5 A;  3SEI A;  1OXJ A;  9ICG A;  2Q4T A;  4LEV A;  1LKY B;  4GFJ A;  4F2S A;  1AQ6 A;  2HHX A;  4X4V A;  3QYP A;  4DFK A;  5L1K A;  4MKP A;  5H2F U;  3WK7 A;  3PX4 A;  3ZDB A;  1QQ5 A;  1ZQA A;  2BQ3 A;  1X9W A;  1NOM A;  4IQW A;  3EZ5 A;  1R8A A;  3RJK A;  3NTU A;  5J2B A;  2IA6 A;  4F91 B;  3RH4 A;  8ICE A;  3MDA A;  5KG0 A;  1RYU A;  4OAF A;  2RRD A;  2ZTD A;  2HW3 A;  1KNY A;  9ICX A;  3WU2 U;  1JXE A;  4QJF B;  5J29 A;  3HP6 A;  4QZD A;  2ZIU A;  4UB2 A;  2XID A;  4RQ4 A;  1D8B A;  3F2C A;  2A1J B;  2FMS A;  3GII A;  5CRX A;  4KN7 A;  4DLE A;  4J03 A;  4X4S A;  4RQ0 A;  4ZOH C;  4P0P A;  3UMC A;  4BJQ A;  2IUB A;  1N56 A;  5BOM A;  3T5J A;  2MA1 A;  2KNJ A;  5AKK A;  3EPI A;  3LVV A;  4KTQ A;  8ICJ A;  4M9J A;  1ZQG A;  4ECT A;  5AM0 A;  8ICM A;  1C7Y A;  5CHE A;  1SV0 C;  4X4U A;  4M9N A;  4I2A A;  4NXX A;  2DKZ A;  8ICP A;  2ZJ8 A;  3SAG A;  4Q8E A;  4YCX A;  1BPB A;  2HHU A;  1U48 A;  2JEG A;  1L8O A;  4RQ7 A;  4DWI A;  3AQN A;  1KEJ A;  5JRT A;  5DB7 A;  4DL4 A;  1XC9 A;  3PW4 A;  2W9C A;  4K99 A;  3VCB A;  4IR1 A;  1D8Y A;  3H0R B;  1QSY A;  4O68 A;  3D2S A;  5J2D A;  3WKC A;  4YMM A;  4IL6 U;  2BPG A;  4UB8 U;  3HIY A;  1TFR A;  2RDJ A;  1WG8 A;  4ECW A;  4ECU A;  5DG7 A;  1IV8 A;  1UT8 A;  2O6K A;  5KFD A;  2ZH1 A;  1UCV A;  4RPX A;  1T94 A;  2OWO A;  2W43 A;  4KLT A;  4K9B A;  4J9S A;  1QSL A;  4ED0 A;  4EGW A;  4XQ8 A;  5CFU A;  2ZH2 A;  8ICH A;  4UAZ A;  7ICR A;  3NGD A;  4Y2J A;  4AT9 A;  4Q44 A;  4F3O A;  3QU7 A;  1NKE A;  8ICR A;  2ZH4 A;  4Y2V A;  5J2F A;  4EED A;  4I2F A;  4YMO A;  1Z4O A;  3N28 A;  1RG6 A;  1U49 A;  4M47 A;  5AKE A;  4C0Z A;  1JQR A;  1T4G A;  5ALQ A;  3BDP A;  3PML A;  4YP3 A;  1JRP A;  5B3Q A;  4F93 B;  3AQM A;  4RWQ A;  4WC0 A;  4NXV A;  2H3Z A;  1QQ6 A;  3WKE A;  3MFH A;  5KFQ A;  4B9S A;  5KG6 A;  3TAP A;  5DLF A;  1LVH A;  4CE6 A;  2FCL A;  2MUT B;  3LWM A;  1SV0 A;  5KAI U;  4ED7 A;  4PZN A;  3M7D A;  2W3S A;  4C80 A;  5CB1 A;  4QZA A;  3H39 A;  1JAJ A;  1ZJN A;  3QXG A;  5DBC A;  1NJW A;  3L4P A;  4Y2S A;  5K4L A;  2ZHB A;  5ALP A;  3UQ2 A;  1ZD5 A;  5DB9 A;  4YG2 A;  1WWV A;  4EEY A;  4OJ5 A;  2KJ8 A;  1Y88 A;  2EZZ A;  2BE3 A;  4RQ5 A;  4C4S A;  4KIT B;  5KFH A;  4UBC A;  3NUQ A;  3UQ0 A;  4IQU A;  3PO5 A;  5KFY A;  4IRD A;  5ALK A;  3AL0 B;  1O08 A;  1U47 A;  3KHG A;  4TUR A;  9ICT A;  1XO0 A;  3E2E A;  3RBE A;  1RDF A;  4F5N A;  5ALN A;  4JV0 A;  4FHY A;  3MGH A;  3F5E A;  4QZ8 A;  2ZH3 A;  5L1M A;  3GIJ A;  1NJZ A;  2JHD A;  3ZDA A;  2BCS A;  4TUP A;  4DL6 A;  3E58 A;  3M9N B;  2AGQ A;  2A1A A;  4RNN A;  1KDH A;  4FBT A;  2Y1J A;  4M6W A;  3PY8 A;  1X2I A;  2XCP A;  5L1J A;  3PSF A;  4KLU A;  1Q3V A;  1RZT A;  1X9M A;  5HMM A;  3IG8 A;  2C2D A;  1J2N A;  4X4T A;  2JZB A;  1IIP A;  1ZD4 A;  1TAQ A;  4DFD A;  5EWF A;  1Z19 A;  5JUM A;  3S6J A;  2ZG6 A;  4C7Z A;  3RH5 A;  2G08 A;  3TAR A;  2ZH5 A;  1CRX A;  4DF8 A;  1IM4 A;  3B0Y A;  2PFN A;  4F4W A;  4Q45 A;  2HHP A;  3LDA A;  2M2V A;  3Q8Q B;  2F2A B;  4QW9 A;  3UXP A;  2BDP A;  1Z1V A;  1SL2 A;  2BR0 A;  1PVP A;  3C18 A;  4IC9 A;  2BCR A;  2F1I A;  1COK A;  2KE7 A;  2BKE A;  3PX6 A;  2JV3 A;  3VC8 A;  5HRL A;  4WCW A;  4F72 A;  3UM9 A;  8ICZ A;  4IQV A;  2GO7 A;  4NLB A;  3RRG A;  1WCN A;  2WF8 A;  1ZQC A;  2YB1 A;  2H3Q A;  2D8C A;  1ZQX A;  2E8M A;  4O69 A;  4YFK A;  3IP4 B;  1TV9 A;  3PMN A;  5JU5 A;  1L3T A;  2K4I A;  1KFT A;  5ALX A;  3AUO A;  1TK8 A;  2WB1 C;  3WKD A;  2K4H A;  2DPJ A;  2E8N A;  4DQI A;  3WFO A;  1ZQH A;  2M2W A;  3GDX A;  2ZH7 A;  1TFW A;  8ICB A;  5A0L A;  1S97 A;  1V97 A;  4TUS A;  4RQ6 A;  1R8C A;  5J0O A;  2ZIV B;  3GIM A;  4AT8 A;  3OUY A;  3RFA A;  4JV1 A;  1KQQ A;  2PXI A;  1LV5 A;  3MGV A;  1NK8 A;  4GC6 A;  5AK3 A;  1MIY A;  4Y2U A;  4FBU A;  4RU9 A;  3PW5 A;  2ISO A;  4R8U A;  4PJ0 U;  1TKD A;  3MCR A;  3N97 B;  2BCV A;  7ICP A;  3RJF A;  3RB4 A;  2NRK A;  2G0A A;  2F1H A;  9ICH A;  4J9N A;  4JWM A;  3ZDE A;  4QZB A;  3MGI A;  4C8O A;  2A3V A;  4O9M A;  5AI6 A;  5AM5 A;  3BS7 A;  4EYI B;  1URJ A;  1DK3 A;  3AN1 A;  1R8B A;  3DDH A;  2AQ0 A;  5AK4 A;  4P0P B;  1NO5 A;  3TAN A;  1QLN A;  3TFS A;  4KLJ A;  3ISB A;  5JTI A;  4FHV A;  2WF5 A;  9ICU A;  3KHH A;  2ZXH A;  2WF7 A;  3C28 A;  3RB3 A;  4JWN A;  3QU4 A;  4FH5 A;  4PPX A;  3WFP A;  1OW5 A;  4CCH A;  4ZH4 A;  4AT9 B;  3BQT A;  2KSO A;  2UVU A;  1ZQR A;  1A76 A;  2K4E A;  3EYZ A;  1U45 A;  1L3S A;  2ES6 A;  5C0Y A;  2KKP A;  3SV4 A;  3WK5 A;  2LYH A;  3NKU A;  3UMB A;  4GXK A;  8ICC A;  2C2R A;  2CXY A;  4O3P A;  1MIW A;  3SI8 A;  9ICR A;  4FH3 A;  2DR5 A;  3GIK A;  4ECV A;  7ICJ A;  3RAX A;  3WKB A;  4X4O A;  3OSN A;  4NLN A;  2YQE A;  3NVY A;  4OD0 A;  2ODG A;  2OXO A;  3BS5 A;  4Q43 A;  1N5W A;  4Z6D A;  4CF3 A;  2XGP A;  1SZP A;  2EQY A;  2FPK A;  5AHX A;  2OCE A;  3OTQ A;  3RBD A;  4NM2 A;  9ICB A;  9ICC A;  2JR5 A;  5J0T A;  2QLT A;  2XY6 A;  5F9N A;  3E0F A;  4R65 A;  4K8V A;  4AYB F;  5HNK A;  4AT7 B;  5ALM A;  3H4B A;  2BZF A;  3I76 A;  3QUB A;  4U6P A;  3RB0 A;  4RQ2 A;  3C5F A;  1NZB A;  1JUD A;  2KZ3 A;  3HIL A;  4DL7 A;  2V9W A;  4CRX A;  4R63 A;  4ATB B;  2XY5 A;  2ASL A;  4LZD A;  8ICA A;  1NK7 A;  4WJ3 B;  7ICI A;  3RTV A;  8ICW A;  2HHS A;  1IG6 A;  1X66 A;  2F1J A;  2H3I A;  3M6K A;  3SYZ A;  5J2E A;  5IIJ A;  4WC2 A;  3G6Y A;  4HX0 A;  5HRH A;  3ZDD A;  2QAR A;  5KFI A;  4KX5 A;  3PR4 A;  1RPL A;  4QW8 A;  1SIJ A;  3BJY A;  3MC1 A;  4WQL A;  4US8 A;  2Y0S F;  1SWV A;  3ALR A;  5GTH U;  1UA1 A;  5GTI U;  2B0C A;  3HW8 A;  1ZQF A;  5KFS A;  3V6J A;  5KTQ A;  1HEK A;  4C8L A;  1QQ7 A;  1NNL A;  3ISD A;  3QEB Z;  9ICK A;  3H4D A;  3PO4 A;  3SR6 A;  4PHD A;  2G06 A;  3IV6 A;  1YT3 A;  1F5A A;  4YR3 A;  2EZY A;  4DL5 A;  8ICL A;  5J0U A;  4KLM A;  5J2H A;  2Y1I A;  3TI0 A;  3WK9 A;  4EBK A;  1M6Y A;  4K4H A;  2NYV A;  2R18 A;  3F5A A;  4F5O A;  8ICT A;  3IRU A;  4UAT A;  4UD5 A;  5EE3 A;  1A77 A;  1PK1 A;  1R89 A;  2DR7 A;  3BZC A;  3WKA A;  4F4Z A;  2KG5 A;  1VFG A;  2P66 A;  4X4N A;  2P6R A;  4RUC A;  4YQW A;  3AU2 A;  4BGD A;  9ICP A;  4PGQ A;  4KLD A;  2OH2 A;  9ICN A;  5ALH A;  1K1Q A;  3K1R B;  3HRD D;  7ICT A;  3ONN A;  1RM6 C;  3C2M A;  4QIW F;  1JRO A;  3JPN A;  2JMG A;  1KL9 A;  3A0B U;  1D9D A;  3C5G A;  3HJ1 A;  2KVS A;  1X9X A;  1B0X A;  5AIC A;  3JPT A;  2CN1 A;  4MF8 A;  4DOC A;  3IDW A;  3I28 A;  1RXW A;  2BPC A;  4GXJ A;  2WF9 A;  4M9L A;  4BX9 C;  4TQR A;  5ALR A;  5HRB A;  3BQ2 A;  4UAV A;  2OM6 A;  7ICV A;  1WWU A;  2HI0 A;  5JTG A;  5DG8 A;  2XCA A;  4UB4 A;  3OGU A;  3JYY A;  5KT2 A;  1FA0 A;  2KIC A;  4DS5 A;  2DBY A;  3CYM A;  4ELT A;  2EAM A;  3H7I A;  4DSJ A;  3TAQ A;  4KB6 A;  3N7S C;  2DKX A;  3H8M A;  2VIX A;  3V6H A;  3PW0 A;  2HOI A;  7ICF A;  4BUG A;  3UMG A;  3LWL A;  1BPX A;  4LVS A;  3GU3 A;  3Q8M A;  2WAQ F;  4I2I A;  3Q8R B;  1X6I A;  4NM1 A;  4QZI A;  1ZQJ A;  5HML A;  3NVZ A;  4UQG A;  1NK9 A;  4X0B A;  1ECW A;  1ZQY A;  2V4R A;  1T7P A;  2ZUB A;  3PSI A;  5HRD A;  4KMO B;  2AJQ A;  4DFM A;  5HRK A;  1S0V A;  1WUD A;  4QZ9 A;  4XRH A;  1J2M A;  1F0M A;  1S8O A;  2A19 A;  4IR9 A;  5KFV A;  2RDI A;  5ALL A;  2QKQ A;  5KFC A;  9ICO A;  2A1J A;  3KHR A;  1T3N A;  1QH9 A;  4ECZ A;  2R8I A;  2KZM A;  1DK2 A;  2XIC A;  3RAQ A;  2PBE A;  4G3I A;  1ZJM A;  4WBY A;  3M8S A;  1KLN A;  3K1Z A;  2PKE A;  3M8R A;  4C8N A;  2F8L A;  4QWA A;  4RQN A;  3WK8 A;  5CHG A;  4OJL A;  3FC4 A;  1ZQO A;  2GWS A;  2EDU A;  4R8U B;  1UEU A;  4NV0 A;  4M0A A;  4O3O A;  3N7R C;  4BDP A;  3H3A A;  2DRA A;  4JLZ A;  2GAF D;  2G5H B;  3BQ7 A;  1TK5 A;  5KFM A;  2HBJ A;  5J2K A;  5D62 A;  5KL8 B;  2DRB A;  5G5H A;  2MUT A;  3EWA A;  3HX0 A;  4R64 A;  2Y9U A;  1FEZ A;  4DFJ A;  2EAO A;  4NL9 C;  1SXD A;  2HHW A;  5HRE A;  3CW2 C;  3PZP A;  5DDY A;  3ER9 B;  3OV7 A;  2HDO A;  3WK6 A;  4RWP A;  5KL1 B;  4TQS A;  4I2C A;  2DR9 A;  3QUQ A;  4UAU A;  1TAU A;  4ELU A;  4MEY A;  3C2L A;  1NK5 A;  4OAI Z;  5ALU A;  2ZIX B;  5KNI A;  5DBB A;  1DOQ A;  3I1Y A;  2FPM A;  3V72 A;  4BXO A;  4XUS A;  3CP8 A;  2HSZ A;  4Y2Y A;  3WK4 A;  5CFT A;  5D4B A;  4MFC A;  2QB1 A;  3KZI U;  4ECQ A;  3FAH A;  2M2T A;  2ZUC A;  5HHH A;  3RR7 A;  4O5K A;  2EAP A;  4PZO A;  3M1Y A;  4YXJ A;  2XGQ A;  1BVS A;  3DEE A;  2XVT A;  1VLB A;  2NRV A;  3ZD9 A;  2FJ6 A;  4EBJ A;  1SKR A;  3D2Q A;  2E1E A;  1UQV A;  2ZIU B;  4O67 A;  4N7R A;  9ICE A;  5KFP A;  2DVI A;  1QCK A;  3C21 A;  3UXN A;  5J0S A;  2PI4 A;  1D8L A;  5J8Y A;  7ICH A;  4GXI A;  4X5V A;  2E8P A;  5KT5 A;  4WC3 A;  1ZET A;  3ISC A;  2VAN A;  2WAQ C;  4PL1 A;  8ICK A;  2PFO A;  4OJP A;  1N63 A;  3ICX A;  4OAG A;  3UXO A;  1ZQD A;  1JI7 A;  2LYA A;  5DG9 A;  3PNC A;  2BQR A;  2ZTC A;  4DSE A;  4CDG A;  5KFN A;  2YN4 A;  4QZC A;  3NRW A;  2PMZ F;  4R66 A;  3J81 j;  4J9L A;  1GO3 F;  2KEY A;  5AKG A;  1SZH A;  4EZ9 A;  1N2X A;  5IIO A;  2LPE A;  4ED2 A;  5AIB A;  1TVA A;  4DSF A;  4Z6E A;  4DOB A;  1K5O A;  2LM1 A;  1H38 A;  5CP2 A;  1KBU A;  2IHN A;  4YVZ A;  5DGA A;  1PVR A;  1A0P A;  4I27 A;  4UB6 U;  4F4Y A;  3F53 A;  1T3Q A;  1NZP A;  5G5G A;  2M0N A;  1ZXI A;  2HVI A;  1JAL A;  2RQ5 A;  2K8A A;  3RF9 A;  4DFP A;  5ALZ A;  3T79 A;  1VDV A;  4I2H A;  2R8J A;  5KFB A;  2DL0 A;  1UEV A;  4J9R A;  5ALT A;  2KJ9 A;  4K4I A;  2GOL A;  5KFA A;  5L9X A;  2AU0 A;  2KTQ A;  2RFF A;  4F92 B;  1COO A;  3PVX A;  7ICG A;  3MAB A;  1JXL A;  3RJI A;  5KG1 A;  5KG4 A;  1S77 D;  2NRX A;  1CI4 A;  5AI5 A;  5EE9 A;  2JXJ A;  1MN8 A;  3QZ7 A;  3HT3 A;  2MSN A;  4K4G A;  1MSW D;  4O0I A;  1Z3E B;  5DDM A;  4EP7 A;  1L7M A;  5J0X A;  4NXU A;  4NXT A;  1UHU A;  1NJY A;  1FO4 A;  2W3R A;  4Y2T A;  5IIK A;  4ED1 A;  4IQT A;  3H0M B;  4FHX A;  4G9B A;  1SB3 C;  2KIW A;  3K7D A;  5IIL A;  4FZM A;  3OWG A;  1N5X A;  4JB3 A;  4WC7 A;  1WCL A;  3NS1 A;  4TUQ A;  4C8M A;  4FHW A;  5KFK A;  2W8K A;  4P4M A;  1RQN A;  1Q78 A;  5J0W A;  4QWD A;  1L7O A;  3NWI A;  3AQF A;  4RPY A;  4RPZ A;  1F44 A;  4DF4 A;  1ED1 A;  2MAX A;  3SV3 A;  3B0X A;  5EE1 A;  3PV8 A;  4LEY A;  4RQM A;  1SKS A;  1DRG A;  1U4B A;  1KRP A;  3RJG A;  2VJ4 A;  4KLI A;  5AKY A;  5J8Y C;  2ALZ A;  4XQ7 A;  2H3V A;  4B9T A;  3JPR A;  3G6X A;  2M9N A;  3K75 D;  3L5K A;  4EEB A;  5HRF A;  2J6T A;  2LM4 A;  4E0D A;  4DL3 A;  5L1L A;  4KLS A;  4DQQ A;  2KK0 A;  2LI6 A;  3Q8K A;  1F5S A;  3Q8P B;  1MIV A;  1ZQZ A;  2DGZ A;  3EF2 A;  5DED A;  3F2D A;  4UW9 A;  4DQR A;  5KFL A;  2CPR A;  2UVW A;  5KG3 A;  4NWI A;  3LYS A;  2JZB B;  5AKH A;  2R8G A;  2ZH8 A;  3MR2 A;  2W9C B;  2KD1 A;  5BOL A;  1YZ6 A;  4GIB A;  2BBJ A;  2DFL A;  2P35 A;  1N61 A;  5HP4 A;  3ER8 C;  3Q8L A;  7ICN A;  3NVV A;  4Y2X A;  2ZIW A;  4B9L A;  1XSL A;  4I2G A;  1YZ7 A;  5KFZ A;  2B56 A;  4PHA A;  1X9S A;  2W9B A;  5KT6 A;  3B9J A;  5DGB A;  3BS5 B;  4KX3 A;  3DV9 A;  2WTF A;  1ZQB A;  2IOF A;  2KKV A;  2FLN A;  1ZQV A;  5CR0 A;  1BGX T;  2B4V A;  1HJP A;  4YN4 A;  1ZD2 P;  4I2B A;  2BBH A;  4PGX A;  2Q66 A;  2E1F A;  1O03 A;  3Q8S B;  3G6V A;  4M2Y A;  3K4G A;  2KZZ A;  8ICS A;  4KLF A;  3KHL A;  2I5H A;  4B9M A;  2W7P A;  3H8J A;  4Q8F A;  3NYB A;  3PST A;  4CNQ A;  5AKZ A;  1S0N A;  1ZQ1 C;  1MQ3 A;  3H38 A;  4X4Q A;  4B9U A;  1B43 A;  1HUZ A;  1U9L A;  2JRZ A;  4MHV A;  2KHV A;  1Z00 B;  2KN7 A;  1Z4N A;  1QSS A;  5T14 A;  4ED6 A;  3THV A;  2VA8 A;  4P4O A;  9ICF A;  3HJ4 A;  1XSP A;  4PHE A;  1PZN A;  1SGG A;  4XA5 A;  1FFV A;  2MU2 A;  4NL9 A;  1HIW A;  4ICA A;  4YR0 A;  4F50 A;  4QIW C;  1ZYQ A;  3CK6 A;  1ARO P;  2JH1 A;  4QNL A;  5KG7 A;  3PX0 A;  1L8L A;  1FFU A;  2B51 A;  1SXE A;  4DSK A;  2F8K A;  4O3S A;  1CEZ A;  8ICY A;  5KG2 A;  1KFD A;  3PR5 B;  4J9K A;  3HPO A;  2HBK A;  3AEV A;  3H0L B;  5KFU A;  4RZR A;  7ICO A;  1BPY A;  1XO1 A;  4RT2 A;  4O3N A;  2HN2 A;  4B9V A;  2HVH A;  4ACO A;  2UVR A;  2G07 A;  2KMD A;  3KKA C;  3SD7 A;  4RUA A;  2JH7 A;  4Y2R A;  2H3F A;  4WC4 A;  4HYK A;  4X0A A;  4RWO A;  2LHT A;  2YMP A;  5ALE A;  5B66 U;  5AM1 A;  4QWB A;  1BNP A;  1L6N A;  2F76 X;  1MQ2 A;  2G09 A;  1XWL A;  1N60 A;  3WFQ E;  2ZTE A;  4JK1 A;  3TAD C;  2HHT A;  4F5P A;  4FHP A;  2E8O A;  1BNO A;  4GC7 A;  2BDU A;  4LJX A;  4DQS A;  2PFQ A;  5CFS A;  4FE3 A;  4EBC A;  1XS9 D;  4FZL A;  5AKI A;  5AK6 A;  5L1I A;  4RQ8 A;  4C4T A;  4JV2 A;  3UPS A;  4I2D A;  4I2E A;  2IBK A;  4BWM A;  1KFS A;  2NRZ A;  2W7O A;  1MC8 A;  4RNO A;  4ECS A;  3JPO A;  2KFN A;  3F2B A;  4KLG A;  9ICS A;  2JEF A;  8ICU A;  1FIQ A;  1Q3U A;  3AQL A;  3T5L A;  2MRL A;  4RNM A;  5J2I A;  5J0P A;  5ALO A;  3R9K A;  5J0R A;  2WF6 A;  2JGA A;  4CF5 A;  2XC9 A;  2JEJ A;  2ZXI A;  5III A;  1SKW A;  3TFR A;  5ALI A;  3RB6 A;  2GLE A;  3OHB A;  3D2N A;  2JEI A;  1S5L U;  4DS4 A;  4F8R A;  3NVW A;  2K60 A;  4NXZ A;  3QU2 A;  4UB3 A;  3FM9 A;  4C7Y A;  3V6K A;  5D61 A;  4B9N A;  4NLK A;  2LBO A;  4DSL A;  2ESE A;  2W54 A;  5AI8 A;  2I6X A;  2IOF K;  2FLL A;  4XJE A;  3WFS C;  5KFR A;  2HHV A;  3KBB A;  3KD3 A;  5DQH A;  5TZV A;  8ICV A;  9ICL A;  3ZDC A;  4J9P A;  4GLX A;  5HRG A;  4BWJ A;  2FLP A;  4QWE A;  2GH1 A;  1HUO A;  3GZF A;  1TK0 A;  4LEZ A;  4O3Q A;  3EUB 2;  1EXN A;  1X6J A;  1KN5 A;  1L7N A;  2DR8 A;  4J9Q A;  3M6Z A;  2YMQ A;  4KLQ A;  4AP9 A;  4KLH A;  4UAS A;  1PK3 A;  1ZOL A;  4K9A A;  2BCU A;  2W8L A;  4YD2 A;  2LMR A;  2R8K A;  3L3F X;  4P2H A;  3JPP A;  4A8E A;  4KMU A;  4RT3 A;  3OHA A;  3U26 A;  4K96 A;  7ICU A;  3LVW A;  2KP7 A;  3PHZ A;  4YMN A;  2CRX A;  2Y0S C;  2ZIV A;  4HAI A;  4NLC A;  3IHQ B;  1XSN A;  1UPH A;  3V7L A;  1N62 A;  4RQ1 A;  3TAD A;  2D6F C;  4NKT A;  1T8E A;  3TKA A;  1JX4 A;  2C28 A;  1IXR A;  3QX7 A;  2DF4 B;  5C5J A;  1XNS A;  4PHP A;  1GPJ A;  3ETL A;  3CNH A;  5KFJ A;  2B6G A;  5F2V O;  4O6A A;  4OAH A;  2IOH A;  1L3V A;  4K97 A;  1ZQW A;  2P6U A;  5ALW A;  3PW7 A;  2OYY A;  2R8H A;  3IN5 A;  4NY8 A;  3H8S A;  2NV3 A;  3TQ1 A;  3ZD8 A;  3AQE A;  2YML A;  5E79 U;  4ELV A;  5D46 A;  4P0Q B;  4DLG A;  2O1P A;  4JMU A;  2ZH9 A;  2Y9T A;  1N48 A;  5HR7 A;  1ZQS A;  1XU4 A;  3V7J A;  2GA9 D;  2KFZ A;  2ISP A;  4DL2 A;  4C8K A;  2ASJ A;  1TAM A;  1C20 A;  1NI3 A;  2RHF A;  2W03 A;  4K98 A;  5KT4 A;  5TIS U;  3IM1 A;  2KJ5 A;  3C29 A;  5KFF A;  3FDS A;  4IRC A;  1JIH A;  3QUC A;  4M04 A;  3SZ2 A;  3EPG A;  2FPL A;  4O3M A;  1JMS A;  3OVS A;  2C22 A;  3ERC C;  1ZQI A;  1WYG A;  4UAW A;  1PVQ A;  2VA2 A;  1YLQ A;  4OJ6 A;  2ZJ5 A;  3JCF A;  2F77 X;  1X42 A;  4QWC A;  1ZQM A;  4EZ6 A;  4UB5 A;  2HOF A;  1UT5 A;  4EYH B;  4P4P A;  4Z6C A;  4F4X A;  1ZQE A;  3LK9 A;  4FO1 A;  1A6S A;  4WC1 A;  1V38 A;  4WC5 A;  3GV5 B;  3MFI A;  4DQP A;  5KAF U;  4NJ8 A;  4EX6 A;  5CEH A;  4ECY A;  5AM4 A;  2VKQ A;  4E8F A;  9ICJ A;  2KIV A;  2HBL A;  5KG5 A;  3C66 A;  4B6J A;  1V85 A;  5DKW A;  5F3X B;  5DEC A;  5KFE A;  2RLT A;  5ALJ A;  4J9O A;  1CUK A;  4AT8 B;  3OUY B;  2K89 A;  3C1Z A;  2K8B B;  4M9G A;  7ICL A;  4KLE A;  3MR5 A;  1DGJ A;  5ALV A;  4EX7 A;  5J0Y A;  9ICI A;  2EZX A;  4JUZ A;  5J2C A;  4DSI A;  5J2G A;  1OUQ A;  2FMQ A;  2W9B B;  4UB1 A;  3NAS A;  1ZQU A;  4ECX A;  3OVA A;  2KOB A;  3H8W A;  2KHQ A;  4E80 A;  5DQG A;  4NXW A;  2H5X A;  8ICQ A;  2IHO A;  3WFR E;  1S76 D;  3NRZ A;  9ICM A;  2HN1 A;  2AQ4 A;  2ZUD A;  9ICQ A;  3SQI A;  1B4F A;  1KSP A;  3HKZ F;  2YB4 A;  1JN3 A;  5HHI A;  4IS7 A;  1OU5 A;  2YTU A;  8ICF A;  4LZG A;  4J9M A;  5AKJ A;  3QNM A;  2F3N A;  2BPF A;  8ICO A;  4ED3 A;  3GIL A;  2E5S A;  2ATL A;  5EE0 A;  3MBY A;  1L7P A;  2N1R A;  2ASD A;  2W04 A;  4U7C A;  3HKZ C;  3LQC B;  3TAC B;  3AQK A;  1NJX A;  4E7X A;  2K4P A;  3KZX A;  3BZK A;  3GV8 B;  2C2E A;  3L9D A;  4PH5 A;  1Z00 A;  3ETR A;  1RQL A;  1KW4 A;  4US9 A;  4WOY A;  4LT6 A;  4WBZ A;  2BGW A;  3H37 A;  3MR6 A;  4I2J A;  3CRX A;  5AKX A;  3N4M B;  4ECR A;  4OO1 J;  5FP0 A;  2ZH6 A;  4EEK A;  1ZQN A;  5D49 A;  3SAH A;  3M9O B;  1S9F A;  7ICS A;  2HHQ A;  1KKX A;  1SV4 A;  4FO6 A;  2KVC A;  3IG5 A;  2FE9 A;  2VJ5 A;  1P7D A;  3C2K A;  5AM3 A;  2LYB A;  5ALF A;  3C1Y A;  4UAR A;  1NKB A;  2RP5 A;  5CA7 A;  8ICN A;  3MDC A;  1ZRM A;  2ZIX A;  4NLG A;  3KKA A;  1ZQT A;  2NRW A;  2E3T A;  1SWW A;  4F5Q A;  5AIA A;  3N7P D;  2FMP A;  1S10 A;  4EV6 A;  5KFW A;  5BPC A;  3RJH A;  4I28 A;  3QU9 A;  5IIM A;  1X40 A;  4M6W B;  2IHM A; 
#chains in the Genus database with same CATH homology
 1FA0 A;  1TFY A;  5KG6 A;  3TAP A;  4PHE A;  3MR3 A;  1PZN A;  4DS5 A;  5DLF A;  1ZQK A;  4XA5 A;  4ELT A;  1ZQL A;  3GFK B;  3JPQ A;  3H7I A;  4DSJ A;  3EW9 A;  2B21 A;  2MUT B;  3LWM A;  4O5C A;  3TAQ A;  4ED7 A;  4F4K A;  5KFT A;  3MFH A;  4EBD A;  5CB1 A;  8ICI A;  4WC6 A;  4YR0 A;  2DR9 A;  3V6H A;  3GV7 B;  4F50 A;  3PW0 A;  7ICF A;  1B22 A;  2I1Q A;  4ATB A;  4QZA A;  3H39 A;  1ZYQ A;  1JAJ A;  1ZJN A;  3LWL A;  1BPX A;  4LVS A;  5DBC A;  1NJW A;  3Q8M A;  1ZQQ A;  1ARO P;  4M9H A;  2ZHB A;  3UQ2 A;  9ICV A;  5KG7 A;  5DB9 A;  4YG2 A;  4I2I A;  3PX0 A;  3RH6 A;  3Q8R B;  4DSK A;  4EEY A;  5DB8 A;  4KN4 A;  4NM1 A;  1Y88 A;  4O3S A;  4QZI A;  2ID1 A;  3RJE A;  1CEZ A;  8ICY A;  4ED8 A;  3KTQ A;  5KG2 A;  2BE3 A;  1KFD A;  3ORY A;  4RQ5 A;  1ZQJ A;  5HML A;  3PR5 B;  4UQG A;  4J9K A;  4UBB A;  1NK9 A;  1BPZ A;  4X0B A;  1NK4 A;  4KIT B;  5KFH A;  3HPO A;  4UBC A;  1ZQY A;  2V4R A;  3BQ1 A;  2ZUB A;  5KFU A;  1T7P A;  4RZR A;  4IQU A;  4RQ3 A;  3UQ0 A;  2ZJA A;  1XO1 A;  4RT2 A;  4O3N A;  4FS2 A;  5KFY A;  1BPY A;  3PO5 A;  1WOT A;  5HRD A;  2AJQ A;  4B9V A;  4IRD A;  2HVH A;  1L3U A;  2UVR A;  1D9F A;  4O3R A;  4DFM A;  5HRK A;  4YR2 A;  1SL0 A;  1S0V A;  4RUA A;  1U47 A;  4MEX A;  4QZ9 A;  3KHG A;  4TUR A;  4XRH A;  9ICT A;  4WC4 A;  4X0A A;  4HYK A;  1DGS A;  4IR9 A;  5KFV A;  2W9A A;  1RYR A;  4RWO A;  2RDI A;  3E2E A;  3RRH A;  5KFC A;  9ICO A;  4QWB A;  1BNP A;  2A1J A;  3KHR A;  3RBE A;  3OSP A;  1T3N A;  1MQ2 A;  3RR8 A;  1XWL A;  5EWE A;  4ECZ A;  3WFQ E;  2ZTE A;  2I9G A;  4JK1 A;  2R8I A;  2KZM A;  1DK2 A;  3RAQ A;  2HHT A;  5J2J A;  4F5P A;  4FHP A;  1Q79 A;  1BPD A;  4GC7 A;  4F5N A;  1BNO A;  2PBE A;  4B9S A;  4JV0 A;  4G3I A;  1QTM A;  1ZJM A;  4DQS A;  2PFQ A;  4FHY A;  3MGH A;  4WBY A;  3M8S A;  4EBC A;  1XS9 D;  1KLN A;  4QZ8 A;  2ZH3 A;  3M8R A;  4C8N A;  4QWA A;  3GIJ A;  1NJZ A;  5HR9 A;  5CHG A;  5L1I A;  1ZQO A;  4RQ8 A;  1S0M A;  2J6S A;  2GWS A;  3ZDA A;  4R8U B;  4JV2 A;  3JPS A;  3UPS A;  4I2D A;  2BCS A;  1UEU A;  4M0A A;  3T5K A;  4O3O A;  2IBK A;  4BWM A;  4I2E A;  7ICM A;  4BDP A;  4TUP A;  4DL6 A;  3H3A A;  2O1P A;  3M9N B;  2AGQ A;  2DRA A;  4RNN A;  1KDH A;  4DEZ A;  1KFS A;  4FBT A;  2Y1J A;  4P2H A;  2NRZ A;  4M6W A;  3PY8 A;  1MC8 A;  4RNO A;  4ECS A;  1X2I A;  3JPO A;  8ICX A;  1TK5 A;  5KFM A;  2XCP A;  1RYS A;  2KFN A;  9ICW A;  5J2K A;  5F9L A;  5L1J A;  4KLU A;  4MFA A;  5DLG A;  1RZT A;  3T3F A;  1X9M A;  5HMM A;  4KLG A;  2DRB A;  2MUT A;  5IIN A;  9ICS A;  3EWA A;  2JEF A;  5KFX A;  2C2D A;  8ICU A;  4X4T A;  3AQL A;  3HX0 A;  2JZB A;  5EWF A;  4R64 A;  1TAQ A;  3T5L A;  3JZ0 A;  4RNM A;  5JUM A;  5J2I A;  5J0P A;  4DFJ A;  2BQU A;  2IMW P;  5J0R A;  4YXM A;  2UVV A;  2HHW A;  5HRE A;  3FYH A;  2XC9 A;  2JEJ A;  5DDY A;  5III A;  1SKW A;  3RH5 A;  3TFR A;  3OV7 A;  5KFG A;  5DB6 A;  1ZQP A;  3TAR A;  3RB6 A;  2ZH5 A;  4F5R A;  4RWP A;  4DF8 A;  1IM4 A;  3AU6 A;  3B0Y A;  3OHB A;  2PFN A;  4TQS A;  2XO7 A;  2JEI A;  4F4W A;  4DS4 A;  2DPI A;  4QZF A;  4Q45 A;  4F8R A;  4I2C A;  4X4P A;  4NXZ A;  4UB3 A;  4ELU A;  3LDA A;  4MEY A;  5KFO A;  3C2L A;  1SL1 A;  1NK5 A;  1TAU A;  3Q8Q B;  3V6K A;  4QW9 A;  3UXP A;  2BDP A;  5EWG A;  4B9N A;  3HWT A;  5DQI A;  5DBB A;  4DSL A;  4NLK A;  1SL2 A;  1DOQ A;  2BR0 A;  3RJJ A;  7ICQ A;  4UD4 A;  4UAY A;  2FLL A;  3C18 A;  3UPQ A;  1LB2 B;  2FPM A;  5J2A A;  3C23 A;  3V72 A;  3WFS C;  5KFR A;  2BCR A;  4BXO A;  2HHV A;  4XUS A;  2F1I A;  3OVB A;  2BKE A;  3PX6 A;  5DQH A;  4Z6F A;  5TZV A;  4QZH A;  5HRL A;  8ICV A;  4WCW A;  5D4B A;  4NLZ A;  9ICA A;  4X4R A;  3QZ8 A;  1V9P A;  3ZDC A;  4J9P A;  4MFC A;  9ICL A;  4M5D A;  4GLX A;  8ICZ A;  1UET A;  4IQV A;  4ECQ A;  4S3N A;  2M2T A;  2ZUC A;  3RRG A;  5HRG A;  4BWJ A;  1WCN A;  5HHH A;  2FLP A;  3RR7 A;  4O5K A;  4QWE A;  1ZQC A;  1ZQX A;  1HUO A;  4YFK A;  4YXJ A;  1TV9 A;  3PMN A;  1TK0 A;  1L3T A;  1UA0 A;  4O3Q A;  3OJS A;  1EXN A;  1KFT A;  2XGQ A;  3AUO A;  1BVS A;  1K1S A;  3M9M B;  1TK8 A;  4MFF A;  4DO9 A;  2DR8 A;  4J9Q A;  2NRV A;  3ZD9 A;  4NKU A;  2DPJ A;  4DQI A;  4EBE A;  3WFO A;  1ZQH A;  4KLQ A;  4EBJ A;  1L5U A;  1SKR A;  2M2W A;  2AGO A;  4RWN A;  4I29 A;  4KLH A;  3GDX A;  2ZH7 A;  1TFW A;  8ICB A;  9ICE A;  5KFP A;  1VJ7 A;  2BCU A;  1S97 A;  2DVI A;  2W8L A;  3C21 A;  4YD2 A;  3UXN A;  7ICE A;  5EOZ A;  2R8K A;  1KTQ A;  4TUS A;  5J0S A;  3JPP A;  1D8L A;  4RQ6 A;  1RXV A;  4GXI A;  2PI4 A;  4KMU A;  4X5V A;  5J0O A;  7ICH A;  1R8C A;  4QZE A;  4YD1 A;  5KT5 A;  4RT3 A;  3GIM A;  3OHA A;  4AT8 A;  4WC3 A;  1ZET A;  3OUY A;  3ISC A;  2VAN A;  4IRK A;  4JV1 A;  7ICU A;  2PXI A;  5KT7 A;  5DBA A;  2BCQ A;  1LV5 A;  1NK8 A;  2KP7 A;  4GC6 A;  8ICK A;  2PFO A;  3PW2 A;  4YMN A;  1MIY A;  4FBU A;  4RU9 A;  1PX5 A;  3PW5 A;  3UXO A;  3QEA Z;  1ZQD A;  2ISO A;  2W9M A;  4R8U A;  4AT7 A;  1V4A A;  1TKD A;  2M2U A;  3IHQ B;  4KLL A;  3N97 B;  2BCV A;  7ICP A;  2PFP A;  1XSN A;  3RJF A;  5DG9 A;  3PNC A;  3RB4 A;  2NRK A;  2BQR A;  2ZHA A;  2Q0Z X;  3V7L A;  2F1H A;  4RQ1 A;  2ZTC A;  4DSE A;  2NRT A;  4NKT A;  1T8E A;  5KFN A;  9ICH A;  4QZC A;  1JX4 A;  4J9N A;  4JWM A;  2C28 A;  2BHN A;  1IXR A;  4R66 A;  3ZDE A;  4QZB A;  4FS1 A;  3MGI A;  3GQC A;  4J9L A;  5C5J A;  4C8O A;  4EZ9 A;  5KT3 A;  4O9M A;  5IIO A;  4PHP A;  4EYI B;  4ED2 A;  1TVA A;  3ETL A;  4DSF A;  1NKC A;  4Z6E A;  4IG8 A;  4DOB A;  1NK6 A;  5KFJ A;  3V7K A;  3BQ0 A;  1H38 A;  2XY7 A;  1DK3 A;  1R8B A;  5F2V O;  5CP2 A;  2AQ0 A;  5CJ7 A;  3OJU A;  2IHN A;  4YVZ A;  1NO5 A;  3TAN A;  5DGA A;  7ICK A;  1QLN A;  1L3V A;  4I27 A;  4DOA A;  4F4Y A;  3TFS A;  2J6U A;  1ZQW A;  2P6U A;  4QZG A;  1NZP A;  3PW7 A;  2HVI A;  1BPE A;  4KLJ A;  3ISB A;  4FHV A;  1NK0 A;  2V4Q A;  4F2R A;  2M2V A;  2O5A A;  4DFP A;  9ICU A;  2R8H A;  3KHH A;  5HRI A;  4NY8 A;  3H8S A;  4I2H A;  5HC9 A;  2R8J A;  5KFB A;  3TQ1 A;  2AGP A;  3RB3 A;  3ZD8 A;  3H40 A;  1UEV A;  4JWN A;  4FH5 A;  4J9R A;  4PPX A;  3WFP A;  4ELV A;  4CCH A;  4K4I A;  5D46 A;  4ZH4 A;  5KFA A;  5L9X A;  4DLG A;  3BQT A;  5CWR A;  2AU0 A;  2KTQ A;  4MF2 A;  8ICG A;  4AT9 B;  2RFF A;  1N48 A;  2ZH9 A;  4F92 B;  1COO A;  3QE9 Y;  2UVU A;  4PGY A;  4KLO A;  1ZQR A;  1ZQS A;  1A76 A;  3EYZ A;  1U45 A;  3PVX A;  1XU4 A;  7ICG A;  3V7J A;  1L3S A;  2PI5 A;  2KFZ A;  2ISP A;  3MAB A;  1JXL A;  3RJI A;  5KG1 A;  5KG4 A;  4DL2 A;  4C8K A;  1S77 D;  2ASJ A;  2NRX A;  3SV4 A;  3T5H A;  2VA3 A;  2LYH A;  4O5E A;  3QZ7 A;  5J0Q A;  3HT3 A;  4K4G A;  1MSW D;  4BXO B;  1S0O A;  5KT4 A;  4O0I A;  4GXK A;  1Z3E B;  5DDM A;  8ICC A;  3IM1 A;  2C2R A;  4O3P A;  5J0X A;  9ICG A;  1MIW A;  4EP7 A;  5KFF A;  3SI8 A;  3FDS A;  4IRC A;  9ICR A;  4FH3 A;  1NJY A;  1JIH A;  2DR5 A;  4F2S A;  5IIK A;  4ED1 A;  4IQT A;  3GIK A;  4M04 A;  4ECV A;  2HHX A;  3SZ2 A;  4FHX A;  4X4V A;  3EPG A;  7ICJ A;  2FPL A;  3RAX A;  5IIL A;  1JMS A;  5L1K A;  4DFK A;  4X4O A;  3OSN A;  3OVS A;  2C22 A;  1ZQI A;  4NLN A;  4UAW A;  4WC7 A;  3PX4 A;  1WCL A;  4Q43 A;  4Z6D A;  4TUQ A;  2VA2 A;  4C8M A;  3ZDB A;  2XGP A;  1YLQ A;  1SZP A;  1ZQA A;  2FPK A;  2BQ3 A;  4FHW A;  5KFK A;  2W8K A;  4P4M A;  2ZJ5 A;  4NM2 A;  3RBD A;  1NOM A;  1X9W A;  9ICC A;  5J0T A;  9ICB A;  1Q78 A;  4QWC A;  1ZQM A;  5J0W A;  4EZ6 A;  3EZ5 A;  2XY6 A;  4IQW A;  1R8A A;  4UB5 A;  4QWD A;  5F9N A;  3NTU A;  3RJK A;  1UT5 A;  7ICS A;  5J2B A;  2IA6 A;  4R65 A;  4F91 B;  4EYH B;  4RPY A;  3RH4 A;  4P4P A;  4Z6C A;  4RPZ A;  4DF4 A;  8ICE A;  4F4X A;  1ZQE A;  3MDA A;  5KG0 A;  3LK9 A;  2MAX A;  4WC1 A;  3SV3 A;  3B0X A;  3GV5 B;  5HNK A;  4WC5 A;  4AT7 B;  3H4B A;  3PV8 A;  2ZTD A;  2HW3 A;  3MFI A;  1KNY A;  4DQP A;  9ICX A;  3RB0 A;  4RQ2 A;  4ECY A;  3C5F A;  1SKS A;  1JXE A;  1U4B A;  1KRP A;  2KZ3 A;  4DL7 A;  3RJG A;  2V9W A;  4KLI A;  5J29 A;  3HP6 A;  2ALZ A;  4R63 A;  4XQ7 A;  4QZD A;  4B9T A;  4E8F A;  3JPR A;  9ICJ A;  3G6X A;  2XY5 A;  2ASL A;  2M9N A;  4ATB B;  5KG5 A;  3K75 D;  3C66 A;  4UB2 A;  4LZD A;  5HRF A;  8ICA A;  4RQ4 A;  2J6T A;  1NK7 A;  5DKW A;  7ICI A;  4E0D A;  5DEC A;  4DL3 A;  5KFE A;  5L1L A;  3RTV A;  2A1J B;  2FMS A;  4J9O A;  1CUK A;  4DQQ A;  4KLS A;  2HHS A;  3GII A;  8ICW A;  2F1J A;  4KN7 A;  4DLE A;  3Q8K A;  3SYZ A;  4AT8 B;  3OUY B;  3Q8P B;  4X4S A;  3C1Z A;  4RQ0 A;  5J2E A;  1MIV A;  5IIJ A;  4M9G A;  1ZQZ A;  7ICL A;  4KLE A;  3MR5 A;  4WC2 A;  5DED A;  1N56 A;  3G6Y A;  5BOM A;  3T5J A;  5HRH A;  5J0Y A;  3ZDD A;  9ICI A;  5KFI A;  4JUZ A;  5J2C A;  3PR4 A;  3EPI A;  1RPL A;  4DQR A;  4QW8 A;  4DSI A;  4KTQ A;  5J2G A;  2FMQ A;  2HHP A;  8ICJ A;  4M9J A;  5KFL A;  7ICO A;  2W9B B;  1ZQG A;  3BJY A;  4UB1 A;  4ECX A;  1ZQU A;  4ECT A;  2UVW A;  3OVA A;  3H8W A;  8ICM A;  1C7Y A;  5KG3 A;  4E80 A;  5DQG A;  2JZB B;  2R8G A;  2H5X A;  4M9N A;  2ZH8 A;  4X4U A;  4I2A A;  1UA1 A;  8ICQ A;  3HW8 A;  3MR2 A;  1ZQF A;  5KFS A;  8ICP A;  2ZJ8 A;  4Q8E A;  3V6J A;  5KTQ A;  4YCX A;  3WFR E;  1BPB A;  1S76 D;  1U48 A;  2HHU A;  9ICM A;  2AQ4 A;  4C8L A;  2JEG A;  2W9C B;  2ZUD A;  9ICQ A;  5BOL A;  3ISD A;  3QEB Z;  4RQ7 A;  1KSP A;  4DWI A;  9ICK A;  3AQN A;  1JN3 A;  3H4D A;  1KEJ A;  5HHI A;  3PO4 A;  1OU5 A;  5DB7 A;  4DL4 A;  8ICF A;  4PHD A;  4J9M A;  1XC9 A;  4LZG A;  3PW4 A;  2W9C A;  4IR1 A;  2DFL A;  2BPF A;  1D8Y A;  8ICO A;  1QSY A;  4ED3 A;  3GIL A;  5HP4 A;  1F5A A;  4YR3 A;  4DL5 A;  8ICL A;  5J0U A;  2ATL A;  5J2H A;  4KLM A;  5J2D A;  2Y1I A;  3TI0 A;  3Q8L A;  7ICN A;  4EBK A;  4K4H A;  4B9L A;  3MBY A;  4F5O A;  2ASD A;  4YMM A;  1XSL A;  4I2G A;  8ICT A;  2BPG A;  3LQC B;  3HIY A;  5KFZ A;  1TFR A;  3AQK A;  4PHA A;  1NJX A;  2RDJ A;  1X9S A;  4ECW A;  4E7X A;  4ECU A;  2W9B A;  5DG7 A;  5KT6 A;  1UT8 A;  2C2E A;  3GV8 B;  3L9D A;  4UD5 A;  1A77 A;  4PH5 A;  5DGB A;  1Z00 A;  1R89 A;  2DR7 A;  2WTF A;  4LT6 A;  2BGW A;  1ZQB A;  5KFD A;  4WBZ A;  3H37 A;  3MR6 A;  4F4Z A;  2ZH1 A;  4I2J A;  1VFG A;  2P66 A;  4RPX A;  3N4M B;  4ECR A;  2FLN A;  2OWO A;  4KLT A;  2ZH6 A;  4X4N A;  1ZQV A;  5CR0 A;  1ZQN A;  4RUC A;  2P6R A;  1BGX T;  4YQW A;  5D49 A;  3AU2 A;  4BGD A;  9ICP A;  1HJP A;  4YN4 A;  4PGQ A;  3M9O B;  1S9F A;  4KLD A;  1K1Q A;  4I2B A;  4FO6 A;  2HHQ A;  9ICN A;  4PGX A;  2Q66 A;  7ICT A;  3Q8S B;  4J9S A;  3G6V A;  4ED0 A;  1QSL A;  4M2Y A;  3C2M A;  4XQ8 A;  3K4G A;  2KZZ A;  3C2K A;  2ZH2 A;  8ICH A;  4UAZ A;  3JPN A;  7ICR A;  3NGD A;  4KLF A;  3KHL A;  8ICS A;  1D9D A;  4B9M A;  3C1Y A;  4AT9 A;  3C5G A;  4Q44 A;  1NKB A;  3HJ1 A;  5CA7 A;  3H8J A;  3JPT A;  4Q8F A;  8ICN A;  3NYB A;  4MF8 A;  4F3O A;  3MDC A;  4DOC A;  1RXW A;  1NKE A;  2BPC A;  1S0N A;  4NLG A;  8ICR A;  4GXJ A;  4M9L A;  1MQ3 A;  5J2F A;  2ZH4 A;  4TQR A;  5HRB A;  4I2F A;  3H38 A;  4X4Q A;  1ZQT A;  2NRW A;  4YMO A;  3BQ2 A;  4B9U A;  1B43 A;  1HUZ A;  1U9L A;  4F5Q A;  7ICV A;  1U49 A;  4M47 A;  1JQR A;  1T4G A;  1Z00 B;  2KN7 A;  3BDP A;  3PML A;  4YP3 A;  1QSS A;  2FMP A;  5DG8 A;  4ED6 A;  1S10 A;  4F93 B;  5KFW A;  3AQM A;  4RWQ A;  4WC0 A;  3THV A;  2VA8 A;  4P4O A;  5BPC A;  2XCA A;  3RJH A;  4UB4 A;  3OGU A;  4I28 A;  9ICF A;  3HJ4 A;  5IIM A;  3JYY A;  1XSP A;  5KT2 A;  4M6W B;  5KFQ A;  2IHM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...