4YN4A

Structure of human dna polymerase beta complexed with n7bg in the template opposite to incoming non-hydrolyzable dttp with manganese in the active site
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
327
Chain Sequence
PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural and kinetic studies of the effect of guanine-N7 alkylation and metal cofactors on DNA replication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 105
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4yn4A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4yn4A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4yn4A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4yn4A03
4KLUA 1NJWA 4Q8EA 4J9OA 4QZBA 3PX0A 5DGBA 4KLIA 5J0PA 4UB5A 4TQSA 4IG8A 3RB3A 4JV0A 3MDCA 5D4BA 8ICRA 5HHHA 1TKDA 3AQNA 4NKTA 1B22A 2VANA 1TAQA 1KDHA 4KLQA 3G6YA 2ZUCA 3GV8B 1YLQA 2I1QA 5KFEA 5KFZA 4MFAA 4M9NA 5IIOA 4R63A 1RPLA 4RT3A 4R65A 5KG6A 2AGPA 4XA5A 4XQ8A 4J9PA 4K4GA 2HHXA 2ZH8A 3EPIA 4E7XA 3PV8A 4X4TA 4DQRA 4IQWA 1XO1A 3ZD8A 5DBBA 4TURA 5L9XA 1KRPA 2R8KA 4F3OA 4QZAA 3M9OB 3V6HA 2VA3A 1S0OA 5HRGA 1UT5A 4KLDA 5KFGA 4EZ6A 4S3NA 4ED2A 3OVSA 5IIIA 5KFWA 2IHMA 4KLTA 2P6UA 4PH5A 1DGSA 1JX4A 4NM2A 3GIJA 1KSPA 4ZH4A 2M9NA 1Z3EB 4Z6DA 3RH4A 3HIYA 5HMMA 1BPEA 1MIVA 4DSFA 2BCRA 4I2IA 4QZEA 2HHQA 5DECA 1SL1A 8ICSA 3M8SA 4WC6A 5DB7A 2R8GA 1ZQIA 2H5XA 1ZQOA 3IHQB 3WFOA 4O3OA 4QWEA 2DPIA 4DFMA 3PX6A 3PW2A 1SL0A 4I2FA 4KTQA 4DOBA 2FMSA 1NK0A 4QZCA 5J0QA 5J0SA 4DSLA 3N4MB 3Q8MA 2AQ0A 9ICSA 2PBEA 4EYIB 3AU6A 5KT5A 2XGQA 3H8SA 7ICIA 2ZH1A 4ED8A 4UD5A 5BOLA 1SL2A 1BVSA 4RNMA 2JEJA 3RB6A 2HHVA 3M9NB 4RUCA 8ICPA 5DB6A 1LB2B 4BWJA 2XY5A 3OUYA 3T5JA 4DEZA 3UQ0A 3GILA 3HJ4A 4LT6A 1CUKA 4RQ2A 4DS5A 3PR4A 3ZDBA 2IA6A 2XC9A 4RQ3A 3JPNA 4F4ZA 3QEAZ 1CEZA 3ZD9A 4WC0A 9ICQA 4KLHA 5L1JA 4RQ5A 3RR7A 4YD2A 8ICKA 4WBZA 5D49A 4EYHB 3C23A 4F50A 4RWNA 2KZZA 2ZH3A 3KHLA 3TAPA 1QSYA 5J0XA 4KMUA 4MF8A 3AQLA 5KG0A 3SV3A 3C5FA 4F5PA 3QEBZ 2FLPA 1ZQGA 7ICNA 9ICXA 4Z6FA 2UVUA 2DR9A 1TFWA 5J2AA 3RH5A 1RZTA 5D46A 5J0YA 4ECRA 2PFQA 2IHNA 8ICCA 2DRAA 5KG4A 3EWAA 1BPXA 1ZQNA 1ZQSA 1ZJMA 4LZGA 2UVVA 4B9VA 4ECSA 2AGQA 2NRTA 1TV9A 1NK9A 4I2DA 4DLEA 4FS2A 5KFOA 5KG5A 4F5NA 2ATLA 1S9FA 2BPCA 1XSPA 3OVAA 4XUSA 5J2FA 2XCPA 1NKEA 3RJKA 4UD4A 4F92B 2Y1JA 4I2EA 5DKWA 1KFDA 3AUOA 1LV5A 4MFFA 4DL7A 4X4PA 2KFNA 2R8IA 5DBCA 4RNNA 5L1IA 4X4SA 1L3SA 3JYYA 4DF8A 4F5OA 3MR3A 1SZPA 1C7YA 3RAXA 5KT6A 4J9NA 1KLNA 3RAQA 1XSLA 5DGAA 3PO5A 4B9TA 4FH3A 5HP4A 9ICVA 4DL3A 2HHTA 3PVXA 2IMWP 3RR8A 9ICKA 2PI4A 3NTUA 4YVZA 4RUAA 2ZTDA 3PMNA 3C2LA 4KLFA 4M6WB 2B21A 5DG7A 4BXOB 4GC7A 3RB0A 1JXLA 3EW9A 4O3RA 8ICZA 1Z00B 5J2CA 3V7KA 1ZQRA 4E8FA 3OVBA 3C21A 1HUZA 2ISPA 2ID1A 5EWGA 1KFTA 4UB2A 1SKWA 1U4BA 4DL2A 3UXNA 1S0NA 2IBKA 5DG8A 4EBCA 2J6UA 4R8UA 2FPMA 3RBEA 1ZQCA 3KTQA 4DLGA 4WCWA 4DSEA 5HRFA 4DL4A 2BCSA 4YMMA 4F4YA 1NK4A 1S0MA 2XO7A 4QWBA 4DQPA 4KN4A 1T7PA 4NLKA 4AT7B 4P2HA 4I2CA 2ZUBA 5J0OA 4EBDA 4F4KA 7ICFA 5KFNA 4QZDA 7ICHA 4QZFA 1ZQJA 1XSNA 4DO9A 2ASLA 4B9UA 4B9SA 4RQ6A 3ETLA 1PZNA 3JPPA 4IQVA 4F5RA 3T5HA 1QSSA 9ICGA 2W9AA 2HHPA 1MC8A 3GIIA 5EWEA 2BQ3A 7ICLA 4X0BA 4YG2A 3RH6A 4IRDA 3KHRA 1ZETA 1KFSA 3RJFA 4RQ7A 5J2HA 4DQSA 1VFGA 4YFKA 4G3IA 1UETA 4EEYA 2UVWA 4ECZA 4F8RA 2Q66A 5EWFA 4QZIA 3OHBA 4AT9B 1NJZA 1DK3A 3H40A 2KZMA 1U47A 3BQ0A 3GV7B 5KFFA 5J0WA 3G6VA 2PXIA 4P4MA 4K4IA 4Q8FA 5KFDA 2JEIA 7ICPA 2ZJAA 4M04A 4NLGA 1S0VA 2Y1IA 1WOTA 3UXOA 3Q8SB 3QE9Y 4KITB 1ZQPA 5CA7A 1UT8A 4DSKA 1JXEA 5DG9A 5HNKA 3BJYA 2W9CA 2I9GA 4YMOA 4YQWA 1FA0A 2HVHA 2KP7A 2RDIA 4EZ9A 5DEDA 1U9LA 3RJJA 9ICRA 4C8MA 4M9HA 4X0AA 4PPXA 4J9SA 5J2KA 1Y88A 7ICGA 3C18A 5J29A 4WBYA 2A1JA 4RNOA 3V7LA 4UAZA 3B0XA 4F2RA 2J6SA 1TAUA 4FBUA 4ATBA 4DWIA 4DL5A 4M9JA 4TUPA 5CR0A 1UEVA 2AJQA 4PGQA 4TUSA 1KEJA 3PW0A 4C8NA 4ELVA 7ICQA 2JZBB 1BGXT 3LDAA 4PHAA 4IRCA 1NZPA 1IXRA 3BQ2A 8ICHA 4IR9A 7ICMA 7ICUA 2W8KA 4RQ0A 1R89A 5IIJA 4UAYA 4ECWA 5KFMA 3HWTA 3V6KA 2FMQA 2ZTEA 1NK5A 3L9DA 1ZQZA 5J2IA 5IIMA 5HREA 1ZYQA 4I28A 4GXJA 5BOMA 4JWNA 4F91B 4KLEA 3OV7A 3PMLA 4X5VA 4KLLA 2ASJA 4DQQA 5J2DA 5EOZA 3H4BA 2DR8A 4PGXA 8ICIA 3MGHA 4F4XA 1ZQEA 3ZDDA 3H7IA 4KLSA 4Q43A 5F2VO 4YR0A 4ED0A 3AQKA 4X4VA 4UQGA 3ISCA 4JV1A 8ICXA 3EYZA 1ZJNA 3PR5B 4RQ8A 2WTFA 3SI8A 3TQ1A 4DSIA 4DOAA 4E0DA 1BPYA 4O5CA 1A77A 4WC1A 1QLNA 5DLGA 3RB4A 7ICKA 5KFBA 4RU9A 5HRKA 1BPZA 5HRIA 2W9BB 1TFRA 5DB9A 2JEFA 4KLMA 2O5AA 1T4GA 2ZH6A 4JV2A 4O5KA 3JPRA 2XY6A 2BPFA 4AT8B 5IINA 3OHAA 5HR9A 1NOMA 4ED1A 1D8LA 3JPQA 1UA0A 8ICMA 5KG3A 3Q8LA 3FYHA 3T5KA 9ICMA 3V6JA 2BCUA 5KFHA 1X9WA 2HW3A 1BNOA 4UB1A 4WC7A 9ICOA 2AU0A 8ICFA 4B9MA 4FHWA 4EBEA 4UBCA 2AGOA 5CB1A 2VA2A 3RJHA 4ELTA 4BGDA 3HPOA 4C8LA 4K4HA 1NK7A 3C5GA 1TK5A 4IQTA 5KFKA 4EBJA 4X4NA 3UXPA 1U45A 5KFQA 2PFOA 3JPSA 4DFKA 3RBDA 3UPQA 2V9WA 1KNYA 4J9KA 4UB4A 4M2YA 8ICWA 2P66A 3Q8RB 8ICGA 1V4AA 9ICCA 4FO6A 4ED7A 3OSNA 3MDAA 2C2RA 2NRVA 3HW8A 1NJXA 3EPGA 2NRKA 2NRWA 3NYBA 3JPOA 8ICJA 4ELUA 1NKCA 2JEGA 3C1YA 3MR5A 1X2IA 1NKBA 1A76A 4F2SA 4QZ8A 2BE3A 1HJPA 4RPYA 3Q8KA 4WC2A 1L3TA 1N56A 1JMSA 4FBTA 9ICAA 1XS9D 3K75D 1ZQHA 2DVIA 4QWAA 3NGDA 1TK8A 1NK6A 2ALZA 2KFZA 2ZUDA 4O3PA 4ECXA 2BCQA 2ZH5A 1QSLA 1JQRA 4KLJA 5HC9A 5KG1A 4J9RA 1R8BA 4ED6A 4UBBA 4NLNA 1L3VA 3RTVA 3OSPA 1Q78A 4DL6A 1JN3A 3KHHA 3M9MB 3H4DA 1RYSA 5HRDA 4RWQA 4X4OA 2DRBA 4J9QA 1L3UA 3AQMA 2BGWA 2HHSA 4NXZA 4WC4A 4YD1A 5F9LA 1RYRA 9ICBA 3GV5B 4FHVA 2DFLA 1DOQA 5DLFA 8ICLA 2R8JA 4PHPA 3PNCA 2FMPA 5J2BA 4P4PA 3HT3A 5KT4A 4XRHA 3N97B 1DK2A 5HRLA 3ISDA 4DS4A 3RJGA 7ICOA 1T8EA 4M47A 3Q8QB 4I2GA 5DQIA 3MBYA 3TFSA 4O5EA 3FDSA 4RQ4A 3C2KA 5HHIA 4I2JA 1RXWA 4KLGA 1EXNA 4LZDA 9ICHA 2M2VA 5CJ7A 3PY8A 4B9LA 4FHXA 4O3NA 1D9FA 8ICUA 4GLXA 4RPZA 3H37A 5KFVA 4ECYA 2ZJ8A 4EBKA 3TARA 5CWRA 1D9DA 3G6XA 5KFLA 4PHDA 3OGUA 4WC5A 4X4RA 2W9MA 4YR3A 2C22A 4RT2A 5KFIA 2DR7A 9ICPA 4GXIA 4Z6EA 2FPKA 4F5QA 2VA8A 4FHPA 3GIKA 3UQ2A 8ICBA 1S10A 2GWSA 2F1HA 2ZJ5A 3PO4A 2M2UA 2M2TA 3WFSC 3TFRA 4MFCA 2PI5A 4X4QA 2MUTA 1ZQAA 4M6WA 5J0TA 4GC6A 2BKEA 4Q45A 4BXOA 7ICJA 4QZHA 3WFRE 4CCHA 1Z00A 2Q0ZX 3ORYA 3JPTA 5L1KA 2FLNA 4M9LA 4YP3A 1BPBA 3MFIA 5DDMA 4MEXA 1OU5A 2F1IA 1RXVA 1U49A 4YCXA 4YR2A 4O9MA 2HVIA 5TZVA 3RRHA 1MQ2A 3GIMA 3TANA 3B0YA 4WC3A 3JZ0A 1K1QA 4QWDA 2ZHBA 4F93B 4LVSA 4AT7A 4TQRA 2ZTCA 1N48A 3MFHA 4QWCA 4DOCA 4J9LA 4JWMA 2ASDA 3OUYB 3AU2A 4YMNA 2O1PA 4ED3A 1H38A 4DSJA 3LK9A 4NY8A 1IM4A 7ICVA 4PGYA 4M9GA 3PW7A 3WFPA 1ZQXA 1XU4A 5KT2A 4IR1A 4DFPA 4MEYA 8ICTA 2M2WA 8ICVA 2PFPA 3MGIA 3GQCA 9ICLA 9ICWA 4RZRA 3QZ7A 2BR0A 1D8YA 9ICJA 4FHYA 3K4GA 2DR5A 3HP6A 3MR6A 4AT9A 1ZQTA 4C8OA 8ICEA 1BNPA 4JK1A 5HMLA 5KG7A 5KT3A 4NKUA 3C1ZA 5JUMA 2ZH2A 1MSWD 2R8HA 4ECQA 5KFYA 4ECUA 4JUZA 3ZDCA 2HHWA 4KN7A 2AQ4A 2RFFA 8ICYA 9ICTA 5HRHA 4M5DA 1MIYA 4MF2A 7ICEA 7ICRA 3BDPA 5CP2A 4BWMA 5KFRA 4PHEA 4NM1A 1XWLA 5KFXA 4O0IA 3PW5A 3TAQA 1V9PA 4E80A 2C28A 1S97A 1R8AA 4FS1A 3H39A 4DFJA 1UEUA 3RRGA 3GDXA 3RJEA 1X9SA 3WFQE 3V7JA 2C2DA 5IIKA 4YXMA 3RJIA 2BQUA 1TVAA 9ICUA 2V4QA 3HX0A 1PX5A 1JAJA 3BQTA 1T3NA 2XCAA 5KFUA 1ZQWA 1MQ3A 2W8LA 2ISOA 2DPJA 2JZBA 2OWOA 2KZ3A 2XGPA 2UVRA 4RPXA 4GXKA 1AROP 3SYZA 4I2HA 5DQHA 2BQRA 4QW8A 5BPCA 1F5AA 8ICOA 3BQ1A 3OJSA 3C2MA 5HRBA 3H8JA 4R8UB 4RQ1A 1TK0A 3ISBA 8ICNA 1VJ7A 5L1LA 4C8KA 4IRKA 4O3SA 5KFJA 3C66A 1ZQKA 8ICAA 1ZQQA 5KTQA 1UA1A 4P4OA 5J0UA 4QW9A 3ZDAA 4Q44A 4DQIA 7ICSA 4FH5A 3EZ5A 4EP7A 5C5JA 2J6TA 3LWMA 4QZGA 5KFTA 9ICEA 3MR2A 4KLOA 3T3FA 4UAWA 4J9MA 4NLZA 9ICFA 5KFCA 2BCVA 3H38A 4TUQA 2NRZA 3M8RA 2FLLA 5J2JA 3SZ2A 1WCLA 5DBAA 5J2EA 2KN7A 1ZQDA 3V72A 1XC9A 5KFAA 2PFNA 4QZ9A 4R66A 4I2AA 3LQCB 1TFYA 4X4UA 1ZQUA 4M0AA 2W9BA 1ZQYA 3IM1A 1S76D 4B9NA 4UB3A 2LYHA 3HJ1A 5J0RA 4AT8A 3E2EA 4R64A 3OJUA 1NO5A 2ZH7A 3Q8PB 2HHUA 4DF4A 1WCNA 3UPSA 2MAXA 1S77D 4RWPA 3ZDEA 2ZH4A 1B43A 1COOA 4F4WA 1ZQMA 4YN4A 3LWLA 1ZQVA 4O3QA 1L5UA 1K1SA 2FPLA 5IILA 1NJYA 1ZQLA 4I29A 3H3AA 1KTQA 4XQ7A 1SKSA 2MUTB 5J2GA 1ZQBA 4ECTA 9ICNA 2W9CB 2ZHAA 4IQUA 3SV4A 2P6RA 3PX4A 5DB8A 4I27A 5CHGA 2KTQA 2V4RA 3THVA 4RWOA 5DDYA 4I2BA 1Q79A 1U48A 3PW4A 5KG2A 4YXJA 9ICIA 5KFPA 1BPDA 2F1JA 3GFKB 2A1JB 4ECVA 1SKRA 2C2EA 1JIHA 1HUOA 1QTMA 2BHNA 2BDPA 4BDPA 4ATBB 3TI0A 3QZ8A 1X9MA 5KFSA 5F9NA 1ZQFA 1R8CA 5KT7A 3T5LA 5DQGA 2XY7A 7ICTA 4Z6CA 3MABA 2NRXA 2RDJA 8ICQA 1MIWA 2ZH9A 3H8WA 1NK8A 2BPGA 3KHGA 4HYKA
chains in the Genus database with same CATH superfamily
5E79U 4TQSA 3NVZA 2E1EA 1TAQA 2B0CA 3G6YA 1YLQA 1NZBA 5KFZA 4RT3A 5KG6A 1XO0A 5ALKA 3U26A 3TKAA 4J9PA 2HHXA 4BUGA 2ZH8A 2ZIWB 1DXSA 5AK4A 4LJXA 5DBBA 1KRPA 4F3OA 1S0OA 5KFGA 4EZ6A 5IIIA 2A19A 3M7DA 4PH5A 4NM2A 3HIYA 2KHQA 4O68A 5DECA 5ALSA 4BJQA 4WC6A 1ZQIA 2H5XA 1Z4OA 4DFMA 3IN5A 2GLEA 4QZCA 2KJ9A 9ICSA 1Q8KA 2PBEA 2XGQA 7ICIA 2HOQA 2KD1A 1QQ5A 1BVSA 4Y2XA 4RNMA 2VKQA 4RUCA 2KK0A 1KBUA 3HJ4A 1K5OA 4DS5A 3PR4A 2IA6A 4K8VA 1PK1B 2XC9A 4RQ3A 4WC0A 3ZD9A 9ICQA 3RR7A 1Q3UA 2KZZA 5ALUA 2WF5A 3AQLA 5KG0A 2FE9A 1UQVA 3QEBZ 1SZHA 2WB1F 2FLPA 9ICXA 5ALHA 2W55A 1ZQNA 1BPXA 1ZJMA 1IG6A 4ECSA 1O08A 4F5NA 4DCCA 1XSPA 4XUSA 2ZHAA 1KFDA 3AUOA 1LV5A 2IHOA 4X4PA 2YY6A 2R8IA 3MR3A 3PO5A 2KVCA 5HP4A 1SGGA 1FFVA 1JI7A 3PVXA 1KW4A 2WF6A 2PI4A 3NTUA 9ICKA 2G08A 2DKXA 3C2LA 4M6WB 4C0ZA 4GC7A 3I28A 1JXLA 8ICZA 1Z00B 2K60A 1KFTA 2JMGA 1SKWA 3KZXA 4CRXA 2EH9A 4R8UA 1ECWA 2FPMA 3RBEA 3KTQA 4WCWA 3LVVA 3ALRA 4F4YA 2XO7A 5T14A 2KG5A 1UPHA 4AT7B 2OEHA 5J0OA 4EEBA 1PZNA 3H0MB 2HHPA 1MC8A 4PL2A 4YG2A 5ALRA 4Y2JA 1ZETA 3RJFA 5J2HA 4F8RA 2UVWA 4ACOA 4AT9B 1OXJA 3IDWA 3H40A 2KZMA 3M6ZA 3HKZF 3BQ0A 4Y2QA 5JU5A 2ZJAA 4M04A 4DSKA 5DG9A 5HNKA 3BJYA 4YMOA 5ALEA 2KP7A 5DEDA 1YT3A 5CHEA 1M6YA 3RJJA 4J9SA 5J29A 4WBYA 4UAZA 4F2RA 1TAUA 4FBUA 2AJQA 4PGQA 5EE1A 3E58A 4TUSA 3BZCA 2OH2A 7ICQA 3LDAA 4IRCA 3JCFA 3PZPA 1R89A 4LEVA 1NK5A 3L9DA 1ZQZA 5IIMA 5BOMA 3OV7A 2WB1C 2G5HB 4DQQA 3H4BA 5FP0A 5AKZA 3MGHA 3ZDDA 5ALWA 1FFUA 2EZXA 3ISCA 5GTIU 1ZJNA 2WTFA 3SI8A 4DSIA 4WC1A 3GU3A 4E0DA 1A77A 5DLGA 4Y2YA 1TFRA 4FE3A 2ZH6A 2G09A 2XY6A 1AQ6A 1D8LA 1UA0A 3OWGA 3Q8LA 3FYHA 9ICMA 1X6JA 5KFHA 4UB1A 4FHWA 2GAFD 2VA2A 2AGOA 3H39A 2LPEA 4BGDA 4K4HA 3C5GA 2H3VA 1NNLA 5KFQA 2PFOA 3NVWA 1PVRA 8ICWA 4F72A 3Q8RB 2A1AA 2HI0A 2DL0A 2C2RA 2NRVA 3KBBA 1YZ6A 3IV6A 4ELUA 2QB0A 1HJPA 3ZI4A 1L7OA 1KQQA 2B51A 3K75D 2DRAA 3NGDA 1NK6A 3B9JA 1X42A 2NO5A 5HC9A 5JRTA 1L6NA 2EAMA 5AKGA 4NLNA 2EZZA 1L3VA 4DFDA 5KAIU 3RTVA 1JN3A 3KHHA 3M9MB 4OCZA 3WK7A 3DDHA 2DRBA 2JXJA 3FAHA 3HKZC 5AI8A 2HHSA 4OAGA 4UB6U 2HBKA 9ICBA 5J2BA 4P4PA 3HT3A 1X40A 1F44A 1MA7A 4DS4A 3RJGA 3MBYA 3C2KA 9ICHA 5AK6A 1EXNA 4LZDA 5CJ7A 4B9LA 2RQ5A 1D9FA 4RPZA 4ECYA 2FDRA 1ZRNA 1B4FA 2C22A 2DR7A 3GIKA 2K4HA 2GWSA 3WFSC 3TFRA 4MFCA 4X4QA 2EDUA 1RQNA 1NI3A 4QZHA 2Q0ZX 8ICGA 4K98A 3TACB 1OU5A 3KFUF 2MU2A 3RRHA 5AKIA 2H3FA 3TANA 1HIWA 2ZHBA 4F93B 4LVSA 2ZTCA 4DOCA 3WK4A 4JWMA 3OUYB 2HSZA 4YMNA 2XIDA 2EZYA 1ZQ1C 1H38A 1IM4A 5AKXA 3PW7A 4DFPA 2I5HA 2KKVA 2OM6A 2ZG6A 3SENA 9ICLA 4FHYA 3NASA 2ZXIA 3MR6A 5HMLA 3C1ZA 4PZNA 2ZH2A 4KN7A 8ICYA 3F53A 3BDPA 1N61A 5B3PA 1XWLA 4E80A 2C28A 1S97A 2M0NA 2O6KA 3ICXA 3V7JA 2BQUA 1SIJA 3QUQA 4NL9C 3LYSA 1ZQWA 1MQ3A 2W8LA 4O69A 2ISOA 2DPJA 1YZ7A 2B6GA 2OWOA 2XGPA 5DQHA 3KZIU 3C2MA 5HRBA 4C8KA 3C66A 2Y9TA 1UA1A 5J0UA 4FH5A 4EP7A 5AM4A 2J6TA 3QU4A 3UM9A 3T3FA 4UAWA 5KFCA 2BCVA 3M8RA 5ALGA 3O0FA 2G5IB 4GFJA 3WFOA 3LQCB 4X4UA 4Y2RA 4QZ9A 2E1FA 4R66A 2K89A 4NLCA 4B9NA 5J0RA 1Q3VA 3Q8PB 4RWPA 1WCNA 3ZDEA 2ZH4A 2K4IA 4KM5A 1K1SA 3H3AA 1KTQA 4CF3A 4XQ7A 1KL9A 3A0HU 9ICNA 2ZIVA 3SV4A 5F3XB 5CHGA 5DDYA 4I2BA 1Q79A 4OAIZ 4NXUA 4O67A 4NLBA 4Y2SA 2A1JB 2C2EA 2L5YA 2BDPA 2MSNA 4O3MA 2ZIUA 5KFSA 5F9NA 1R8CA 5KT7A 3KD3A 2WAQC 2AXTU 2XY7A 2NRXA 4KLUA 1NJWA 4J9OA 3PX0A 2KJ5A 4UB5A 3RB3A 4JV0A 5D4BA 8ICRA 5HHHA 3AQNA 1B22A 2I1QA 1PK3A 1X9XA 4R65A 1F5SA 1SXDA 2AGPA 4XQ8A 1SXEA 4HAIA 4IQWA 1XO1A 2YQEA 3HRDD 2GO7A 1A6SA 4JMUA 3V6HA 1SWVA 2VA3A 1JX4A 3GIJA 4QNLA 1KSPA 2M9NA 1BPEA 2BCRA 2MRLA 4QZEA 8ICSA 5G5HA 2R8GA 4WOYA 3IHQB 4O3OA 2W3RA 2DPIA 4DOBA 3WKDA 5ALMA 1GO3F 2AQ0A 2ODGA 1VJ5A 3AU6A 5KT5A 2JGAA 1TAMA 4ED8A 1COKA 4K9AA 4U6PA 2EQYA 3M9NB 1LB2B 2XY5A 2QARA 3T5JA 5HR6A 3UQ0A 4LT6A 1CUKA 2NYVA 2E8NA 3ZDBA 3NVVA 3QEAZ 1SV0C 5L1JA 2DKZA 3K1RB 4YD2A 4RQ5A 8ICKA 4EYHB 4LEZA 1QSYA 5J0XA 2F2AB 3SV3A 2KE7A 2UVUA 3RFAA 5D46A 1SV4A 4LZGA 3EWAA 1LVHA 4I2DA 5KFOA 2IOFK 4C4SA 4F92B 2Y1JA 5DKWA 3CRXA 2KFNA 4RNNA 3WK8A 3JYYA 1TE2A 4F5OA 1SZPA 5KT6A 4J9NA 1GPJA 2E8OA 5DGAA 2ZIUB 4B9TA 3N7SC 5AM3A 4DL3A 2HHTA 3RR8A 2QB1A 5ALNA 3PMNA 2E8MA 4KLFA 2B21A 4BXOB 4O3RA 3RB0A 1HUZA 2ISPA 3UXNA 2CXYA 4EBCA 3N7PD 3WKBA 3F2DA 1ZQCA 3WKCA 4DSEA 4DL4A 3L4PA 4QWBA 4P2HA 4I2CA 2ZUBA 3MCRA 1ZQJA 1XSNA 4B9UA 7ICFA 1QSSA 9ICGA 3T5HA 2W7PA 2B56A 2HN1A 3A0BU 2BQ3A 1KFSA 4RQ7A 4G3IA 4EEYA 4ECZA 1NJZA 5EE9A 5AK3A 3BS7A 5KFFA 4IL6U 2JEIA 4P4MA 4A8EA 5KFDA 3S6JA 4LEYA 3UXOA 3Q8SB 4K99A 5CA7A 1UT8A 2HVHA 4EZ9A 1U9LA 4C8MA 4M9HA 4PPXA 4EEKA 3C18A 1T3QA 3H0RB 4ATBA 5B5EU 4M9JA 4AP9A 4NL9A 2E5SA 3PW0A 4C8NA 4HX0A 2JZBB 1VLBA 1NZPA 4IR9A 7ICUA 5IIJA 2FMQA 2ZTEA 4I28A 2KKPA 4KLLA 2DR8A 4PGXA 1ZQEA 4KLSA 4YR0A 8ICXA 3OPXA 2W03A 5CFUA 5AKYA 3RB4A 2W9BB 3N28A 1T4GA 2QKQA 3JPRA 2BPFA 1NOMA 1V97A 8ICMA 1BNOA 1X9WA 2HW3A 4B9MA 2QLTA 2E8PA 1T94A 3RJHA 4ELTA 4EBJA 1NK7A 3UXPA 3RBDA 2V9WA 4WJ3B 1NJXA 5B3QA 3JPOA 1ZD5A 8ICJA 3MR5A 3CNHA 1X2IA 4RPYA 1L3TA 1JMSA 2VIXA 2DVIA 5ALXA 2KFZA 1TK8A 3IP4B 3NVYA 4P0QB 4J9RA 4UBBA 1L7NA 2F44A 1RYSA 2W3SA 2E3TA 2BGWA 5AIAA 4YD1A 1RYRA 3GV5B 8ICLA 2I6XA 3D2NA 4UAUA 3N97B 3ISDA 1T8EA 4M47A 5DQIA 2F76X 3FDSA 4KLGA 3H37A 4EBKA 2ZJ8A 5CWRA 2RHFA 1D9DA 4PHDA 3OGUA 4WC5A 4X4RA 1IIPA 2FPKA 4F5QA 2VA8A 4FHPA 3UQ2A 1S10A 2F1HA 5ALVA 1ZQAA 4GC6A 4Q45A 7ICJA 5L1KA 3JPTA 2A3VA 2FLNA 4YP3A 1BPBA 4MEXA 4NWIA 1V38A 2RP5A 4K96A 2LM4A 1MN8A 1J2MA 4TQRA 3AMZA 4NY8A 3LK9A 4M9GA 2KNJA 3WFPA 1ZQXA 3IG5A 4IR1A 8ICTA 5C0YA 2KJ8A 8ICVA 2PFPA 1SV0A 3QYPA 3QZ7A 2BR0A 9ICWA 5CFTA 1ZQTA 4C8OA 8ICEA 4NKUA 3NRZA 1LKYA 1J97A 5JUMA 3ETRA 2JRZA 4JUZA 2EANA 4M5DA 7ICEA 4BWMA 4MHVA 4PHEA 3BZKA 5KFRA 3PSPA 5KFXA 2XVTA 4F71A 3TAQA 5G5GA 1R8AA 1QQ7A 3GDXA 3RJEA 5ALYA 5IIKA 2C2DA 2V4QA 4J03A 1PX5A 2H3ZA 2GH1A 1C20A 2KZ3A 1AROP 2YX8A 3FM9A 8ICOA 3BQ1A 3H8JA 1QH9A 4R8UB 3ISBA 8ICNA 1VJ7A 3CK6A 4O3SA 5KFJA 1WYGA 1ZQQA 4QW9A 4UATA 4OJ6A 3LWMA 1UCVA 9ICEA 4NLZA 2LI6A 4TUQA 4CF4A 2FLLA 5J2JA 3SZ2A 2KN7A 3DEEA 3V72A 1XC9A 4QIWF 4M0AA 4UB3A 2LYHA 2RRDA 3HJ1A 4AT8A 4R64A 2VJ4A 1NO5A 2HOFA 2MAXA 1COOA 4F4WA 1ZQMA 4YN4A 1ZQVA 1L5UA 2FPLA 5IILA 1NJYA 1ZQLA 4I29A 5DB8A 4NXVA 3THVA 4RWOA 3PW4A 4YXJA 9ICIA 1KKXA 2IOFA 5CRXA 3GFKB 4FZMA 1HUOA 4BDPA 3TI0A 3QZ8A 4JLXA 3PHZA 3F2CA 4Z6CA 2R18A 4C7ZA 1O03A 2FJ6A 1NK8A 2BPGA 3KHGA 2Z7JA 5L1MA 1N63A 4Q8EA 4KLIA 3NVOA 4US8A 4P0PA 4IG8A 3MDCA 1TKDA 3F2BA 2VANA 1KDHA 4KLQA 2YN4A 5KFEA 4XJEA 4MFAA 5IIOA 4R63A 1RPLA 3HJEA 4Y2VA 4K4GA 4E7XA 3PV8A 4DQRA 4NV0A 3ZD8A 5L9XA 5AKHA 2R8KA 3M9OB 2F8LA 5HRGA 3OVSA 5KFWA 2IUBA 4KLTA 3D2QA 1PVQA 4Z6DA 3RH4A 1MIVA 4I2IA 2YTUA 2AHOB 1ZQOA 4CE6A 4QWEA 5JTIA 3PX6A 3PW2A 5J0SA 3N4MB 3Q8MA 5JTGA 3H8SA 4UD5A 4BX9C 5AKEA 5BOLA 1ZD3A 2JEJA 2QB0B 8ICPA 3UMBA 3BQ7A 4RQ2A 4QIWC 3JPNA 4F4ZA 2N1RA 4KLHA 4WBZA 5D49A 1N2XA 3M1YA 2Y9UA 3AM9A 4F50A 4RWNA 5AI9A 3KHLA 4KMUA 3SQIA 4MF8A 7ICNA 3C5FA 4F5PA 3IRUA 1ZQGA 1TFWA 4Z6FA 2PFQA 4N7RA 4ECRA 5ALTA 2IHNA 5KG4A 4EX6A 2AGQA 2NRTA 1TV9A 1NK9A 3QUBA 2ATLA 1S9FA 2BBJA 1NKEA 3RJKA 4MFFA 4FZLA 2KSOA 1KLNA 4Y2TA 3RAQA 1CI4A 3ERCC 1JUDA 2IMWP 4KMOB 2ZTDA 5DG7A 4C4RA 3D2SA 1ZQRA 3OVBA 1WWUA 2ID1A 4UB2A 2IBKA 4DL2A 5DG8A 2J6UA 2IOHA 4DLGA 2DGZA 5AIBA 5HRFA 2OCEA 4YMMA 1NK4A 4NLKA 4KN4A 1T7PA 2ES6A 4PZOA 3LVWA 1J2NA 7ICHA 4QZFA 2ASLA 2F8KA 4B9SA 4IQVA 3SMVA 7ICLA 3RH6A 2DQNB 4IRDA 4DQSA 1VFGA 4YFKA 5AM1A 5EWFA 3OHBA 3E0FA 3AN1A 3GV7B 5J0WA 2PXIA 4K4IA 3NYBA 7ICPA 4Q8FA 2HOIA 2Y1IA 1WOTA 3QE9Y 2KIVA 2W9CA 1P7DA 2H3IA 1FA0A 3GZFA 9ICRA 4X0AA 5J2KA 1Z4NA 7ICGA 4RNOA 3V7LA 5HR7A 2J6SA 2LBOA 4DL5A 4TUPA 1UEVA 3PSIA 3SR6A 4ELVA 3BQ2A 1UHUA 7ICMA 4NXTA 4RQ0A 4GIBA 2DBYA 2G07A 4ECWA 4K9BA 2PMZF 3HWTA 1L7MA 3H8MA 1ZYQA 4JWNA 1JALA 4KLEA 4X5VA 2GOLA 1N60A 2ASJA 5J2DA 2HCFA 1ZRMA 3QUCA 4F4XA 3H7IA 4Q43A 5F2VO 4ED0A 3AQKA 4JV1A 3WU2U 3EYZA 3SAGA 3PR5B 3TQ1A 4O5CA 1RM6C 3QNMA 4DOAA 1QLNA 5HRKA 7ICKA 4RU9A 5AI4A 4US9A 5HRIA 4KLMA 4O5KA 2GA9D 5HR9A 3OHAA 3QXGA 3T5KA 4WC7A 1V85A 8ICFA 1JRPA 2CPRA 4UBCA 3CW2C 3HPOA 4C8LA 2Q4TA 1TK5A 5KFKA 1U45A 2YMQA 2ZIVB 3C28A 4DFKA 4USAA 3UPQA 1KNYA 4J9KA 4M2YA 4FO6A 4ED7A 2K4EA 1N5WA 2NRKA 2NRWA 2Y0SF 2JEGA 3C1YA 1NKBA 3I76A 1X66A 4QZ8A 4WC2A 2D6FC 4FBTA 1L8OA 1ZQHA 3TADC 2WF9A 2ZUDA 4O3PA 1QSLA 5KG1A 1JROA 1PK1A 2YMPA 4ED6A 4OJPA 3WKEA 3T79A 3OSPA 4RWQA 3H4DA 3QU5A 4J9QA 3IG8A 3AQMA 5AK5A 4NXZA 5F9LA 4I0UA 4WC4A 3R9KA 1DOQA 2DFLA 5DLFA 3PNCA 4CDGA 2FMPA 5KT4A 4XRHA 5HRLA 7ICOA 4PL1A 4I2GA 3TFSA 2XICA 4RQ4A 4OJOA 4I2JA 4UW9A 8ICUA 2LYAA 4IS7A 5KFVA 3TARA 4OJLA 5KFLA 2W9MA 4RT2A 9ICPA 3PO4A 2M2UA 2MUTA 1FO4A 4M6WA 2BKEA 1Z00A 3MFIA 2LHTA 2F1IA 1RXVA 1U49A 2F3NA 2HVIA 4O9MA 2K8BB 1ZD4A 2HBJA 1MQ2A 3GIMA 4CNQA 4WC3A 1PUZA 2EAOA 3RF9A 1K1QA 4QWDA 3AL0B 4AT7A 1N48A 4J9LA 2QARB 2ASDA 1WWVA 2O1PA 4ED3A 2KOBA 4DSJA 3QX7A 3FC4A 1XU4A 5KT2A 4OJ5A 3MGIA 3D6JA 3ER9B 4RZRA 9ICJA 3K4GA 3HP6A 4AT9A 5ALZA 4JK1A 5KG7A 1BNPA 2HDOA 5KT3A 4B6JA 1MSWD 4ECQA 5KFYA 3ZDCA 9ICTA 4MF2A 5AI5A 5CP2A 4NM1A 3ONNA 4O0IA 3PW5A 4FS1A 2AH5A 3WK5A 2Y0SC 4DFJA 3RRGA 1UEUA 1X9SA 2DUYA 3WFQE 3L5KA 1TVAA 3RJIA 3HX0A 5D61A 3BQTA 1T3NA 5KFUA 5ALPA 2BDUA 1Z1VA 4WH5A 5CFSA 4OAFA 2KEYA 4RPXA 4GXKA 3QUTA 2BQRA 5BPCA 1F5AA 2JHDA 3OJSA 4RQ1A 2ZIXA 3M6KA 1XNSA 4IRKA 3BS5A 5AM0A 8ICAA 5KTQA 7ICSA 3F5AA 4Q44A 3EZ5A 4QZGA 3MR2A 4KLOA 4J9MA 4X4NA 2NRZA 1ZQDA 1WCLA 5DBAA 1FIQA 5J2EA 1TFYA 4I2AA 1ZQUA 2K8CB 1ZQYA 3IM1A 4ICAA 4WQKA 3KKAC 2WFAA 2WF8A 4DF4A 3SD7A 3LWLA 4O3QA 5KNIA 1SKSA 2MUTB 5AM5A 5J2GA 1ZQBA 3SEIA 2P6RA 1WUDA 4CGZA 2KTQA 4I27A 4O6AA 2PKEA 3QU7A 2EWRA 3NKUA 5KG2A 1CRXA 5KFPA 1SKRA 1JIHA 2G0AA 4ATBB 1X9MA 3NWIA 3T5LA 5DQGA 8ICQA 2RDJA 4HYKA 4WQLA 4AYBF 4QZBA 5DGBA 5J0PA 1S5LU 2YMMA 4NKTA 2ZUCA 3UMCA 5J8YC 3GV8B 1S8OA 2H3QA 4M9NA 2G06A 4XA5A 3EPIA 1RDFA 4X4TA 4TURA 1B0XA 4QZAA 3OTQA 1UT5A 4KLDA 4S3NA 4ED2A 2IHMA 2EAPA 2P6UA 1DGSA 4ZH4A 1Z3EB 5HMMA 4DSFA 2HHQA 1RQLA 1SL1A 3M8SA 5DB7A 4KX5A 5AKKA 4I2FA 1SL0A 4KTQA 2FMSA 1NK0A 5EE3A 5J0QA 4G9BA 4DSLA 4EYIB 1WG8A 2ZH1A 2ZIXB 3BS5B 1ED1A 1SL2A 3RB6A 2HHVA 4JLZA 5DB6A 4RQNA 4BWJA 3SAFA 2OYYA 3OUYA 5H2FU 4DEZA 3GILA 4OO1J 3TADA 4OD0A 1CEZA 3AQFA 3C23A 2ZH3A 4RQMA 3TAPA 4MKPA 4C7YA 2DR9A 5J2AA 3RH5A 4CF5A 1RZTA 5J0YA 8ICCA 1ZQSA 2KV2A 1F0MA 2UVVA 4B9VA 5EE0A 4DLEA 4FS2A 5KG5A 1RG6A 2BPCA 3OVAA 5CEHA 5J2FA 4UD4A 2XCPA 4I2EA 2KVSA 4DL7A 5ALQA 2WF7A 5DBCA 5L1IA 4X4SA 1L3SA 4DF8A 1C7YA 3RAXA 5KL8B 1XSLA 4FH3A 9ICVA 2HMXA 3PSTA 3J81j 4YVZA 4RUAA 1X6IA 3EW9A 4E8FA 5J2CA 3V7KA 3C21A 3HILA 5EWGA 1U4BA 4AYBC 1S0NA 2YB4A 3MGVA 2BCSA 4LEWA 5KAFU 1S0MA 4DQPA 2HBMA 4EBDA 3PSFA 1ZXIA 4F4KA 5KFNA 4QZDA 4DO9A 4RQ6A 2W11A 3ETLA 2OXOA 3JPPA 4F5RA 5KL1B 2W9AA 3GIIA 5EWEA 4X0BA 2VJ5A 3MC1A 2DWQA 4KB6A 3KHRA 1PVPA 1UETA 2Q66A 4QZIA 1DK3A 2OHFA 1U47A 4ZOHC 1LKYB 3G6VA 3EF2A 5B66U 4FO1A 3UMGA 4UAVA 4NLGA 1S0VA 4KITB 1ZQPA 2LKYA 1JXEA 1ZD2P 4EGWA 2I9GA 4YQWA 1HEKA 2RDIA 3F5EA 1L8LA 1Y88A 2CN1A 2RLTA 2BZFA 1L7PA 2A1JA 2KICA 3B0XA 4DWIA 1N62A 5ALLA 5CR0A 1KEJA 3C29A 2WAQF 1BGXT 3NS1A 4PHAA 1IXRA 5K4LA 8ICHA 4U7CA 5TISU 4NXXA 4K97A 2W8KA 4UAYA 5KFMA 3V6KA 5J2IA 5HREA 4GXJA 4F91B 2JR5A 3PMLA 5EOZA 3KOOA 8ICIA 1QQ6A 2KMDA 5ALJA 5D62A 4X4VA 5AM2A 4UQGA 4UB8U 3VCBA 4RQ8A 1BPYA 5KFBA 3CYMA 1BPZA 2O5AA 5DB9A 2JEFA 4IC9A 4JV2A 4AT8B 5IINA 4ED1A 3JPQA 3KKAA 4JB3A 5KG3A 2D8CA 5AI0A 4EELA 3V6JA 2BCUA 9ICOA 2AU0A 4EBEA 5CB1A 3WK6A 4IQTA 3JPSA 4NJ8A 3ED5A 1Z1BA 1V4AA 4UB4A 2P66A 5ALDA 9ICCA 3OSNA 3MDAA 3HW8A 3EPGA 1VDVA 1NKCA 2YMLA 2W04A 4F2SA 1A76A 1QCKA 4FFDA 3Q8KA 1N56A 9ICAA 1FEZA 2F77X 5A0LA 1XS9D 4QWAA 2ALZA 2BCQA 4ECXA 2ZH5A 1JQRA 4KLJA 1R8BA 4PJ0U 4EEDA 2WHEA 1Q78A 2FCLA 4DL6A 3UPSA 4X4OA 4P0PB 5HRDA 1SWWA 1L3UA 5AI6A 2LYBA 4FHVA 2W43A 2R8JA 4PHPA 1Z19A 5J8YA 1DK2A 4C80A 3Q8QB 4O5EA 1RXWA 5HHIA 2M2VA 3PY8A 4OAHA 4FHXA 4O3NA 4GLXA 3G6XA 4YR3A 5KFIA 4GXIA 2LMRA 4Z6EA 8ICBA 2ZJ5A 5AKLA 2M2TA 2PI5A 5D63A 5J0TA 4BXOA 3WFRE 4CCHA 3ORYA 4UARA 4M9LA 5DDMA 4UASA 3NRWA 1ZOLA 4KX3A 4YCXA 4YR2A 5TZVA 2KHVA 3B0YA 2NV3A 3VC8A 3JZ0A 3MFHA 4QWCA 2ESEA 3AU2A 3DV9A 7ICVA 3NUQA 4PGYA 2CRXA 1KN5A 4MEYA 2M2WA 4NXWA 2HN2A 1A0PA 3GQCA 5AICA 3SAHA 5ALOA 1D8YA 2DR5A 2D3DA 5AHXA 2R8HA 3I1YA 4ECUA 2JV3A 2ZXHA 2HHWA 2AQ4A 2RFFA 5HRHA 1MIYA 7ICRA 5ALFA 2ZIWA 2YB1A 1V9PA 3K1ZA 2W7OA 3H0LB 2LM1A 1OW5A 4Y2UA 3ER8C 4YXMA 9ICUA 5GTHU 1JAJA 1OUQA 2KSOB 2MA1A 2XCAA 1SB3C 2W54A 4EV6A 3EUB2 2JZBA 2UVRA 4EX7A 4I2HA 3SYZA 4QW8A 2FI1A 1D8BA 3QU2A 1TK0A 3AEVA 3N7RC 5L1LA 1IV8A 1ZQKA 3QU9A 3ZDAA 4P4OA 4DQIA 2XI9A 5C5JA 4QJFB 2JH1A 5KFTA 9ICFA 2DF4B 1URJA 3H38A 2BE3A 2HBLA 2PFNA 5KFAA 2W9BA 5AKJA 4FZNA 1S76D 2P35A 3E2EA 3OJUA 2ZH7A 2HHUA 1S77D 2NO4A 1B43A 1N5XA 2KIWA 2B4VA 3WK9A 4ECTA 3K7DA 4Y2PA 5ALIA 4C4TA 2W9CB 4EENA 4IQUA 3PX4A 2K8AA 2V4RA 1U48A 1RYUA 3WKAA 1DRGA 1BPDA 1DGJA 2F1JA 4ECVA 1QTMA 2BHNA 2K4PA 3CP8A 3AQEA 1ZQFA 3L3FX 7ICTA 3MABA 1MIWA 2ZH9A 1Q46A 2JH7A 3H8WA 4P0QA 2PMZC 2BBHA
chains in the Genus database with same CATH topology
4KLUA 1NJWA 4Q8EA 4J9OA 4QZBA 3PX0A 5DGBA 4KLIA 5J0PA 4UB5A 4TQSA 4IG8A 3RB3A 4JV0A 3MDCA 5D4BA 8ICRA 5HHHA 1TKDA 3AQNA 4NKTA 1B22A 2VANA 1TAQA 1KDHA 4KLQA 3G6YA 2ZUCA 3GV8B 1YLQA 2I1QA 5KFEA 5KFZA 4MFAA 4M9NA 5IIOA 4R63A 1RPLA 4RT3A 4R65A 5KG6A 2AGPA 4XA5A 4XQ8A 4J9PA 4K4GA 2HHXA 2ZH8A 3EPIA 4E7XA 3PV8A 4X4TA 4DQRA 4IQWA 1XO1A 3ZD8A 5DBBA 4TURA 5L9XA 1KRPA 2R8KA 4F3OA 4QZAA 3M9OB 3V6HA 2VA3A 1S0OA 5HRGA 1UT5A 4KLDA 5KFGA 4EZ6A 4S3NA 4ED2A 3OVSA 5IIIA 5KFWA 2IHMA 4KLTA 2P6UA 4PH5A 1DGSA 1JX4A 4NM2A 3GIJA 1KSPA 4ZH4A 2M9NA 1Z3EB 4Z6DA 3RH4A 3HIYA 5HMMA 1BPEA 1MIVA 4DSFA 2BCRA 4I2IA 4QZEA 2HHQA 5DECA 1SL1A 8ICSA 3M8SA 4WC6A 5DB7A 2R8GA 1ZQIA 2H5XA 1ZQOA 3IHQB 3WFOA 4O3OA 4QWEA 2DPIA 4DFMA 3PX6A 3PW2A 1SL0A 4I2FA 4KTQA 4DOBA 2FMSA 1NK0A 4QZCA 5J0QA 5J0SA 4DSLA 3N4MB 3Q8MA 2AQ0A 9ICSA 2PBEA 4EYIB 3AU6A 5KT5A 2XGQA 3H8SA 7ICIA 2ZH1A 4ED8A 4UD5A 5BOLA 1SL2A 1BVSA 4RNMA 2JEJA 3RB6A 2HHVA 3M9NB 4RUCA 8ICPA 5DB6A 1LB2B 4BWJA 2XY5A 3OUYA 3T5JA 4DEZA 3UQ0A 3GILA 3HJ4A 4LT6A 1CUKA 4RQ2A 4DS5A 3PR4A 3ZDBA 2IA6A 2XC9A 4RQ3A 3JPNA 4F4ZA 3QEAZ 1CEZA 3ZD9A 4WC0A 9ICQA 4KLHA 5L1JA 4RQ5A 3RR7A 4YD2A 8ICKA 4WBZA 5D49A 4EYHB 3C23A 4F50A 4RWNA 2KZZA 2ZH3A 3KHLA 3TAPA 1QSYA 5J0XA 4KMUA 4MF8A 3AQLA 5KG0A 3SV3A 3C5FA 4F5PA 3QEBZ 2FLPA 1ZQGA 7ICNA 9ICXA 4Z6FA 2UVUA 2DR9A 1TFWA 5J2AA 3RH5A 1RZTA 5D46A 5J0YA 4ECRA 2PFQA 2IHNA 8ICCA 2DRAA 5KG4A 3EWAA 1BPXA 1ZQNA 1ZQSA 1ZJMA 4LZGA 2UVVA 4B9VA 4ECSA 2AGQA 2NRTA 1TV9A 1NK9A 4I2DA 4DLEA 4FS2A 5KFOA 5KG5A 4F5NA 2ATLA 1S9FA 2BPCA 1XSPA 3OVAA 4XUSA 5J2FA 2XCPA 1NKEA 3RJKA 4UD4A 4F92B 2Y1JA 4I2EA 5DKWA 1KFDA 3AUOA 1LV5A 4MFFA 4DL7A 4X4PA 2KFNA 2R8IA 5DBCA 4RNNA 5L1IA 4X4SA 1L3SA 3JYYA 4DF8A 4F5OA 3MR3A 1SZPA 1C7YA 3RAXA 5KT6A 4J9NA 1KLNA 3RAQA 1XSLA 5DGAA 3PO5A 4B9TA 4FH3A 5HP4A 9ICVA 4DL3A 2HHTA 3PVXA 2IMWP 3RR8A 9ICKA 2PI4A 3NTUA 4YVZA 4RUAA 2ZTDA 3PMNA 3C2LA 4KLFA 4M6WB 2B21A 5DG7A 4BXOB 4GC7A 3RB0A 1JXLA 3EW9A 4O3RA 8ICZA 1Z00B 5J2CA 3V7KA 1ZQRA 4E8FA 3OVBA 3C21A 1HUZA 2ISPA 2ID1A 5EWGA 1KFTA 4UB2A 1SKWA 1U4BA 4DL2A 3UXNA 1S0NA 2IBKA 5DG8A 4EBCA 2J6UA 4R8UA 2FPMA 3RBEA 1ZQCA 3KTQA 4DLGA 4WCWA 4DSEA 5HRFA 4DL4A 2BCSA 4YMMA 4F4YA 1NK4A 1S0MA 2XO7A 4QWBA 4DQPA 4KN4A 1T7PA 4NLKA 4AT7B 4P2HA 4I2CA 2ZUBA 5J0OA 4EBDA 4F4KA 7ICFA 5KFNA 4QZDA 7ICHA 4QZFA 1ZQJA 1XSNA 4DO9A 2ASLA 4B9UA 4B9SA 4RQ6A 3ETLA 1PZNA 3JPPA 4IQVA 4F5RA 3T5HA 1QSSA 9ICGA 2W9AA 2HHPA 1MC8A 3GIIA 5EWEA 2BQ3A 7ICLA 4X0BA 4YG2A 3RH6A 4IRDA 3KHRA 1ZETA 1KFSA 3RJFA 4RQ7A 5J2HA 4DQSA 1VFGA 4YFKA 4G3IA 1UETA 4EEYA 2UVWA 4ECZA 4F8RA 2Q66A 5EWFA 4QZIA 3OHBA 4AT9B 1NJZA 1DK3A 3H40A 2KZMA 1U47A 3BQ0A 3GV7B 5KFFA 5J0WA 3G6VA 2PXIA 4P4MA 4K4IA 4Q8FA 5KFDA 2JEIA 7ICPA 2ZJAA 4M04A 4NLGA 1S0VA 2Y1IA 1WOTA 3UXOA 3Q8SB 3QE9Y 4KITB 1ZQPA 5CA7A 1UT8A 4DSKA 1JXEA 5DG9A 5HNKA 3BJYA 2W9CA 2I9GA 4YMOA 4YQWA 1FA0A 2HVHA 2KP7A 2RDIA 4EZ9A 5DEDA 1U9LA 3RJJA 9ICRA 4C8MA 4M9HA 4X0AA 4PPXA 4J9SA 5J2KA 1Y88A 7ICGA 3C18A 5J29A 4WBYA 2A1JA 4RNOA 3V7LA 4UAZA 3B0XA 4F2RA 2J6SA 1TAUA 4FBUA 4ATBA 4DWIA 4DL5A 4M9JA 4TUPA 5CR0A 1UEVA 2AJQA 4PGQA 4TUSA 1KEJA 3PW0A 4C8NA 4ELVA 7ICQA 2JZBB 1BGXT 3LDAA 4PHAA 4IRCA 1NZPA 1IXRA 3BQ2A 8ICHA 4IR9A 7ICMA 7ICUA 2W8KA 4RQ0A 1R89A 5IIJA 4UAYA 4ECWA 5KFMA 3HWTA 3V6KA 2FMQA 2ZTEA 1NK5A 3L9DA 1ZQZA 5J2IA 5IIMA 5HREA 1ZYQA 4I28A 4GXJA 5BOMA 4JWNA 4F91B 4KLEA 3OV7A 3PMLA 4X5VA 4KLLA 2ASJA 4DQQA 5J2DA 5EOZA 3H4BA 2DR8A 4PGXA 8ICIA 3MGHA 4F4XA 1ZQEA 3ZDDA 3H7IA 4KLSA 4Q43A 5F2VO 4YR0A 4ED0A 3AQKA 4X4VA 4UQGA 3ISCA 4JV1A 8ICXA 3EYZA 1ZJNA 3PR5B 4RQ8A 2WTFA 3SI8A 3TQ1A 4DSIA 4DOAA 4E0DA 1BPYA 4O5CA 1A77A 4WC1A 1QLNA 5DLGA 3RB4A 7ICKA 5KFBA 4RU9A 5HRKA 1BPZA 5HRIA 2W9BB 1TFRA 5DB9A 2JEFA 4KLMA 2O5AA 1T4GA 2ZH6A 4JV2A 4O5KA 3JPRA 2XY6A 2BPFA 4AT8B 5IINA 3OHAA 5HR9A 1NOMA 4ED1A 1D8LA 3JPQA 1UA0A 8ICMA 5KG3A 3Q8LA 3FYHA 3T5KA 9ICMA 3V6JA 2BCUA 5KFHA 1X9WA 2HW3A 1BNOA 4UB1A 4WC7A 9ICOA 2AU0A 8ICFA 4B9MA 4FHWA 4EBEA 4UBCA 2AGOA 5CB1A 2VA2A 3RJHA 4ELTA 4BGDA 3HPOA 4C8LA 4K4HA 1NK7A 3C5GA 1TK5A 4IQTA 5KFKA 4EBJA 4X4NA 3UXPA 1U45A 5KFQA 2PFOA 3JPSA 4DFKA 3RBDA 3UPQA 2V9WA 1KNYA 4J9KA 4UB4A 4M2YA 8ICWA 2P66A 3Q8RB 8ICGA 1V4AA 9ICCA 4FO6A 4ED7A 3OSNA 3MDAA 2C2RA 2NRVA 3HW8A 1NJXA 3EPGA 2NRKA 2NRWA 3NYBA 3JPOA 8ICJA 4ELUA 1NKCA 2JEGA 3C1YA 3MR5A 1X2IA 1NKBA 1A76A 4F2SA 4QZ8A 2BE3A 1HJPA 4RPYA 3Q8KA 4WC2A 1L3TA 1N56A 1JMSA 4FBTA 9ICAA 1XS9D 3K75D 1ZQHA 2DVIA 4QWAA 3NGDA 1TK8A 1NK6A 2ALZA 2KFZA 2ZUDA 4O3PA 4ECXA 2BCQA 2ZH5A 1QSLA 1JQRA 4KLJA 5HC9A 5KG1A 4J9RA 1R8BA 4ED6A 4UBBA 4NLNA 1L3VA 3RTVA 3OSPA 1Q78A 4DL6A 1JN3A 3KHHA 3M9MB 3H4DA 1RYSA 5HRDA 4RWQA 4X4OA 2DRBA 4J9QA 1L3UA 3AQMA 2BGWA 2HHSA 4NXZA 4WC4A 4YD1A 5F9LA 1RYRA 9ICBA 3GV5B 4FHVA 2DFLA 1DOQA 5DLFA 8ICLA 2R8JA 4PHPA 3PNCA 2FMPA 5J2BA 4P4PA 3HT3A 5KT4A 4XRHA 3N97B 1DK2A 5HRLA 3ISDA 4DS4A 3RJGA 7ICOA 1T8EA 4M47A 3Q8QB 4I2GA 5DQIA 3MBYA 3TFSA 4O5EA 3FDSA 4RQ4A 3C2KA 5HHIA 4I2JA 1RXWA 4KLGA 1EXNA 4LZDA 9ICHA 2M2VA 5CJ7A 3PY8A 4B9LA 4FHXA 4O3NA 1D9FA 8ICUA 4GLXA 4RPZA 3H37A 5KFVA 4ECYA 2ZJ8A 4EBKA 3TARA 5CWRA 1D9DA 3G6XA 5KFLA 4PHDA 3OGUA 4WC5A 4X4RA 2W9MA 4YR3A 2C22A 4RT2A 5KFIA 2DR7A 9ICPA 4GXIA 4Z6EA 2FPKA 4F5QA 2VA8A 4FHPA 3GIKA 3UQ2A 8ICBA 1S10A 2GWSA 2F1HA 2ZJ5A 3PO4A 2M2UA 2M2TA 3WFSC 3TFRA 4MFCA 2PI5A 4X4QA 2MUTA 1ZQAA 4M6WA 5J0TA 4GC6A 2BKEA 4Q45A 4BXOA 7ICJA 4QZHA 3WFRE 4CCHA 1Z00A 2Q0ZX 3ORYA 3JPTA 5L1KA 2FLNA 4M9LA 4YP3A 1BPBA 3MFIA 5DDMA 4MEXA 1OU5A 2F1IA 1RXVA 1U49A 4YCXA 4YR2A 4O9MA 2HVIA 5TZVA 3RRHA 1MQ2A 3GIMA 3TANA 3B0YA 4WC3A 3JZ0A 1K1QA 4QWDA 2ZHBA 4F93B 4LVSA 4AT7A 4TQRA 2ZTCA 1N48A 3MFHA 4QWCA 4DOCA 4J9LA 4JWMA 2ASDA 3OUYB 3AU2A 4YMNA 2O1PA 4ED3A 1H38A 4DSJA 3LK9A 4NY8A 1IM4A 7ICVA 4PGYA 4M9GA 3PW7A 3WFPA 1ZQXA 1XU4A 5KT2A 4IR1A 4DFPA 4MEYA 8ICTA 2M2WA 8ICVA 2PFPA 3MGIA 3GQCA 9ICLA 9ICWA 4RZRA 3QZ7A 2BR0A 1D8YA 9ICJA 4FHYA 3K4GA 2DR5A 3HP6A 3MR6A 4AT9A 1ZQTA 4C8OA 8ICEA 1BNPA 4JK1A 5HMLA 5KG7A 5KT3A 4NKUA 3C1ZA 5JUMA 2ZH2A 1MSWD 2R8HA 4ECQA 5KFYA 4ECUA 4JUZA 3ZDCA 2HHWA 4KN7A 2AQ4A 2RFFA 8ICYA 9ICTA 5HRHA 4M5DA 1MIYA 4MF2A 7ICEA 7ICRA 3BDPA 5CP2A 4BWMA 5KFRA 4PHEA 4NM1A 1XWLA 5KFXA 4O0IA 3PW5A 3TAQA 1V9PA 4E80A 2C28A 1S97A 1R8AA 4FS1A 3H39A 4DFJA 1UEUA 3RRGA 3GDXA 3RJEA 1X9SA 3WFQE 3V7JA 2C2DA 5IIKA 4YXMA 3RJIA 2BQUA 1TVAA 9ICUA 2V4QA 3HX0A 1PX5A 1JAJA 3BQTA 1T3NA 2XCAA 5KFUA 1ZQWA 1MQ3A 2W8LA 2ISOA 2DPJA 2JZBA 2OWOA 2KZ3A 2XGPA 2UVRA 4RPXA 4GXKA 1AROP 3SYZA 4I2HA 5DQHA 2BQRA 4QW8A 5BPCA 1F5AA 8ICOA 3BQ1A 3OJSA 3C2MA 5HRBA 3H8JA 4R8UB 4RQ1A 1TK0A 3ISBA 8ICNA 1VJ7A 5L1LA 4C8KA 4IRKA 4O3SA 5KFJA 3C66A 1ZQKA 8ICAA 1ZQQA 5KTQA 1UA1A 4P4OA 5J0UA 4QW9A 3ZDAA 4Q44A 4DQIA 7ICSA 4FH5A 3EZ5A 4EP7A 5C5JA 2J6TA 3LWMA 4QZGA 5KFTA 9ICEA 3MR2A 4KLOA 3T3FA 4UAWA 4J9MA 4NLZA 9ICFA 5KFCA 2BCVA 3H38A 4TUQA 2NRZA 3M8RA 2FLLA 5J2JA 3SZ2A 1WCLA 5DBAA 5J2EA 2KN7A 1ZQDA 3V72A 1XC9A 5KFAA 2PFNA 4QZ9A 4R66A 4I2AA 3LQCB 1TFYA 4X4UA 1ZQUA 4M0AA 2W9BA 1ZQYA 3IM1A 1S76D 4B9NA 4UB3A 2LYHA 3HJ1A 5J0RA 4AT8A 3E2EA 4R64A 3OJUA 1NO5A 2ZH7A 3Q8PB 2HHUA 4DF4A 1WCNA 3UPSA 2MAXA 1S77D 4RWPA 3ZDEA 2ZH4A 1B43A 1COOA 4F4WA 1ZQMA 4YN4A 3LWLA 1ZQVA 4O3QA 1L5UA 1K1SA 2FPLA 5IILA 1NJYA 1ZQLA 4I29A 3H3AA 1KTQA 4XQ7A 1SKSA 2MUTB 5J2GA 1ZQBA 4ECTA 9ICNA 2W9CB 2ZHAA 4IQUA 3SV4A 2P6RA 3PX4A 5DB8A 4I27A 5CHGA 2KTQA 2V4RA 3THVA 4RWOA 5DDYA 4I2BA 1Q79A 1U48A 3PW4A 5KG2A 4YXJA 9ICIA 5KFPA 1BPDA 2F1JA 3GFKB 2A1JB 4ECVA 1SKRA 2C2EA 1JIHA 1HUOA 1QTMA 2BHNA 2BDPA 4BDPA 4ATBB 3TI0A 3QZ8A 1X9MA 5KFSA 5F9NA 1ZQFA 1R8CA 5KT7A 3T5LA 5DQGA 2XY7A 7ICTA 4Z6CA 3MABA 2NRXA 2RDJA 8ICQA 1MIWA 2ZH9A 3H8WA 1NK8A 2BPGA 3KHGA 4HYKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KLU A;  1NJW A;  4Q8E A;  4J9O A;  4QZB A;  3PX0 A;  5DGB A;  4KLI A;  5J0P A;  4UB5 A;  4TQS A;  4IG8 A;  3RB3 A;  4JV0 A;  3MDC A;  5D4B A;  8ICR A;  5HHH A;  1TKD A;  3AQN A;  4NKT A;  1B22 A;  2VAN A;  1TAQ A;  1KDH A;  4KLQ A;  3G6Y A;  2ZUC A;  3GV8 B;  1YLQ A;  2I1Q A;  5KFE A;  5KFZ A;  4MFA A;  4M9N A;  5IIO A;  4R63 A;  1RPL A;  4RT3 A;  4R65 A;  5KG6 A;  2AGP A;  4XA5 A;  4XQ8 A;  4J9P A;  4K4G A;  2HHX A;  2ZH8 A;  3EPI A;  4E7X A;  3PV8 A;  4X4T A;  4DQR A;  4IQW A;  1XO1 A;  3ZD8 A;  5DBB A;  4TUR A;  5L9X A;  1KRP A;  2R8K A;  4F3O A;  4QZA A;  3M9O B;  3V6H A;  2VA3 A;  1S0O A;  5HRG A;  1UT5 A;  4KLD A;  5KFG A;  4EZ6 A;  4S3N A;  4ED2 A;  3OVS A;  5III A;  5KFW A;  2IHM A;  4KLT A;  2P6U A;  4PH5 A;  1DGS A;  1JX4 A;  4NM2 A;  3GIJ A;  1KSP A;  4ZH4 A;  2M9N A;  1Z3E B;  4Z6D A;  3RH4 A;  3HIY A;  5HMM A;  1BPE A;  1MIV A;  4DSF A;  2BCR A;  4I2I A;  4QZE A;  2HHQ A;  5DEC A;  1SL1 A;  8ICS A;  3M8S A;  4WC6 A;  5DB7 A;  2R8G A;  1ZQI A;  2H5X A;  1ZQO A;  3IHQ B;  3WFO A;  4O3O A;  4QWE A;  2DPI A;  4DFM A;  3PX6 A;  3PW2 A;  1SL0 A;  4I2F A;  4KTQ A;  4DOB A;  2FMS A;  1NK0 A;  4QZC A;  5J0Q A;  5J0S A;  4DSL A;  3N4M B;  3Q8M A;  2AQ0 A;  9ICS A;  2PBE A;  4EYI B;  3AU6 A;  5KT5 A;  2XGQ A;  3H8S A;  7ICI A;  2ZH1 A;  4ED8 A;  4UD5 A;  5BOL A;  1SL2 A;  1BVS A;  4RNM A;  2JEJ A;  3RB6 A;  2HHV A;  3M9N B;  4RUC A;  8ICP A;  5DB6 A;  1LB2 B;  4BWJ A;  2XY5 A;  3OUY A;  3T5J A;  4DEZ A;  3UQ0 A;  3GIL A;  3HJ4 A;  4LT6 A;  1CUK A;  4RQ2 A;  4DS5 A;  3PR4 A;  3ZDB A;  2IA6 A;  2XC9 A;  4RQ3 A;  3JPN A;  4F4Z A;  3QEA Z;  1CEZ A;  3ZD9 A;  4WC0 A;  9ICQ A;  4KLH A;  5L1J A;  4RQ5 A;  3RR7 A;  4YD2 A;  8ICK A;  4WBZ A;  5D49 A;  4EYH B;  3C23 A;  4F50 A;  4RWN A;  2KZZ A;  2ZH3 A;  3KHL A;  3TAP A;  1QSY A;  5J0X A;  4KMU A;  4MF8 A;  3AQL A;  5KG0 A;  3SV3 A;  3C5F A;  4F5P A;  3QEB Z;  2FLP A;  1ZQG A;  7ICN A;  9ICX A;  4Z6F A;  2UVU A;  2DR9 A;  1TFW A;  5J2A A;  3RH5 A;  1RZT A;  5D46 A;  5J0Y A;  4ECR A;  2PFQ A;  2IHN A;  8ICC A;  2DRA A;  5KG4 A;  3EWA A;  1BPX A;  1ZQN A;  1ZQS A;  1ZJM A;  4LZG A;  2UVV A;  4B9V A;  4ECS A;  2AGQ A;  2NRT A;  1TV9 A;  1NK9 A;  4I2D A;  4DLE A;  4FS2 A;  5KFO A;  5KG5 A;  4F5N A;  2ATL A;  1S9F A;  2BPC A;  1XSP A;  3OVA A;  4XUS A;  5J2F A;  2XCP A;  1NKE A;  3RJK A;  4UD4 A;  4F92 B;  2Y1J A;  4I2E A;  5DKW A;  1KFD A;  3AUO A;  1LV5 A;  4MFF A;  4DL7 A;  4X4P A;  2KFN A;  2R8I A;  5DBC A;  4RNN A;  5L1I A;  4X4S A;  1L3S A;  3JYY A;  4DF8 A;  4F5O A;  3MR3 A;  1SZP A;  1C7Y A;  3RAX A;  5KT6 A;  4J9N A;  1KLN A;  3RAQ A;  1XSL A;  5DGA A;  3PO5 A;  4B9T A;  4FH3 A;  5HP4 A;  9ICV A;  4DL3 A;  2HHT A;  3PVX A;  2IMW P;  3RR8 A;  9ICK A;  2PI4 A;  3NTU A;  4YVZ A;  4RUA A;  2ZTD A;  3PMN A;  3C2L A;  4KLF A;  4M6W B;  2B21 A;  5DG7 A;  4BXO B;  4GC7 A;  3RB0 A;  1JXL A;  3EW9 A;  4O3R A;  8ICZ A;  1Z00 B;  5J2C A;  3V7K A;  1ZQR A;  4E8F A;  3OVB A;  3C21 A;  1HUZ A;  2ISP A;  2ID1 A;  5EWG A;  1KFT A;  4UB2 A;  1SKW A;  1U4B A;  4DL2 A;  3UXN A;  1S0N A;  2IBK A;  5DG8 A;  4EBC A;  2J6U A;  4R8U A;  2FPM A;  3RBE A;  1ZQC A;  3KTQ A;  4DLG A;  4WCW A;  4DSE A;  5HRF A;  4DL4 A;  2BCS A;  4YMM A;  4F4Y A;  1NK4 A;  1S0M A;  2XO7 A;  4QWB A;  4DQP A;  4KN4 A;  1T7P A;  4NLK A;  4AT7 B;  4P2H A;  4I2C A;  2ZUB A;  5J0O A;  4EBD A;  4F4K A;  7ICF A;  5KFN A;  4QZD A;  7ICH A;  4QZF A;  1ZQJ A;  1XSN A;  4DO9 A;  2ASL A;  4B9U A;  4B9S A;  4RQ6 A;  3ETL A;  1PZN A;  3JPP A;  4IQV A;  4F5R A;  3T5H A;  1QSS A;  9ICG A;  2W9A A;  2HHP A;  1MC8 A;  3GII A;  5EWE A;  2BQ3 A;  7ICL A;  4X0B A;  4YG2 A;  3RH6 A;  4IRD A;  3KHR A;  1ZET A;  1KFS A;  3RJF A;  4RQ7 A;  5J2H A;  4DQS A;  1VFG A;  4YFK A;  4G3I A;  1UET A;  4EEY A;  2UVW A;  4ECZ A;  4F8R A;  2Q66 A;  5EWF A;  4QZI A;  3OHB A;  4AT9 B;  1NJZ A;  1DK3 A;  3H40 A;  2KZM A;  1U47 A;  3BQ0 A;  3GV7 B;  5KFF A;  5J0W A;  3G6V A;  2PXI A;  4P4M A;  4K4I A;  4Q8F A;  5KFD A;  2JEI A;  7ICP A;  2ZJA A;  4M04 A;  4NLG A;  1S0V A;  2Y1I A;  1WOT A;  3UXO A;  3Q8S B;  3QE9 Y;  4KIT B;  1ZQP A;  5CA7 A;  1UT8 A;  4DSK A;  1JXE A;  5DG9 A;  5HNK A;  3BJY A;  2W9C A;  2I9G A;  4YMO A;  4YQW A;  1FA0 A;  2HVH A;  2KP7 A;  2RDI A;  4EZ9 A;  5DED A;  1U9L A;  3RJJ A;  9ICR A;  4C8M A;  4M9H A;  4X0A A;  4PPX A;  4J9S A;  5J2K A;  1Y88 A;  7ICG A;  3C18 A;  5J29 A;  4WBY A;  2A1J A;  4RNO A;  3V7L A;  4UAZ A;  3B0X A;  4F2R A;  2J6S A;  1TAU A;  4FBU A;  4ATB A;  4DWI A;  4DL5 A;  4M9J A;  4TUP A;  5CR0 A;  1UEV A;  2AJQ A;  4PGQ A;  4TUS A;  1KEJ A;  3PW0 A;  4C8N A;  4ELV A;  7ICQ A;  2JZB B;  1BGX T;  3LDA A;  4PHA A;  4IRC A;  1NZP A;  1IXR A;  3BQ2 A;  8ICH A;  4IR9 A;  7ICM A;  7ICU A;  2W8K A;  4RQ0 A;  1R89 A;  5IIJ A;  4UAY A;  4ECW A;  5KFM A;  3HWT A;  3V6K A;  2FMQ A;  2ZTE A;  1NK5 A;  3L9D A;  1ZQZ A;  5J2I A;  5IIM A;  5HRE A;  1ZYQ A;  4I28 A;  4GXJ A;  5BOM A;  4JWN A;  4F91 B;  4KLE A;  3OV7 A;  3PML A;  4X5V A;  4KLL A;  2ASJ A;  4DQQ A;  5J2D A;  5EOZ A;  3H4B A;  2DR8 A;  4PGX A;  8ICI A;  3MGH A;  4F4X A;  1ZQE A;  3ZDD A;  3H7I A;  4KLS A;  4Q43 A;  5F2V O;  4YR0 A;  4ED0 A;  3AQK A;  4X4V A;  4UQG A;  3ISC A;  4JV1 A;  8ICX A;  3EYZ A;  1ZJN A;  3PR5 B;  4RQ8 A;  2WTF A;  3SI8 A;  3TQ1 A;  4DSI A;  4DOA A;  4E0D A;  1BPY A;  4O5C A;  1A77 A;  4WC1 A;  1QLN A;  5DLG A;  3RB4 A;  7ICK A;  5KFB A;  4RU9 A;  5HRK A;  1BPZ A;  5HRI A;  2W9B B;  1TFR A;  5DB9 A;  2JEF A;  4KLM A;  2O5A A;  1T4G A;  2ZH6 A;  4JV2 A;  4O5K A;  3JPR A;  2XY6 A;  2BPF A;  4AT8 B;  5IIN A;  3OHA A;  5HR9 A;  1NOM A;  4ED1 A;  1D8L A;  3JPQ A;  1UA0 A;  8ICM A;  5KG3 A;  3Q8L A;  3FYH A;  3T5K A;  9ICM A;  3V6J A;  2BCU A;  5KFH A;  1X9W A;  2HW3 A;  1BNO A;  4UB1 A;  4WC7 A;  9ICO A;  2AU0 A;  8ICF A;  4B9M A;  4FHW A;  4EBE A;  4UBC A;  2AGO A;  5CB1 A;  2VA2 A;  3RJH A;  4ELT A;  4BGD A;  3HPO A;  4C8L A;  4K4H A;  1NK7 A;  3C5G A;  1TK5 A;  4IQT A;  5KFK A;  4EBJ A;  4X4N A;  3UXP A;  1U45 A;  5KFQ A;  2PFO A;  3JPS A;  4DFK A;  3RBD A;  3UPQ A;  2V9W A;  1KNY A;  4J9K A;  4UB4 A;  4M2Y A;  8ICW A;  2P66 A;  3Q8R B;  8ICG A;  1V4A A;  9ICC A;  4FO6 A;  4ED7 A;  3OSN A;  3MDA A;  2C2R A;  2NRV A;  3HW8 A;  1NJX A;  3EPG A;  2NRK A;  2NRW A;  3NYB A;  3JPO A;  8ICJ A;  4ELU A;  1NKC A;  2JEG A;  3C1Y A;  3MR5 A;  1X2I A;  1NKB A;  1A76 A;  4F2S A;  4QZ8 A;  2BE3 A;  1HJP A;  4RPY A;  3Q8K A;  4WC2 A;  1L3T A;  1N56 A;  1JMS A;  4FBT A;  9ICA A;  1XS9 D;  3K75 D;  1ZQH A;  2DVI A;  4QWA A;  3NGD A;  1TK8 A;  1NK6 A;  2ALZ A;  2KFZ A;  2ZUD A;  4O3P A;  4ECX A;  2BCQ A;  2ZH5 A;  1QSL A;  1JQR A;  4KLJ A;  5HC9 A;  5KG1 A;  4J9R A;  1R8B A;  4ED6 A;  4UBB A;  4NLN A;  1L3V A;  3RTV A;  3OSP A;  1Q78 A;  4DL6 A;  1JN3 A;  3KHH A;  3M9M B;  3H4D A;  1RYS A;  5HRD A;  4RWQ A;  4X4O A;  2DRB A;  4J9Q A;  1L3U A;  3AQM A;  2BGW A;  2HHS A;  4NXZ A;  4WC4 A;  4YD1 A;  5F9L A;  1RYR A;  9ICB A;  3GV5 B;  4FHV A;  2DFL A;  1DOQ A;  5DLF A;  8ICL A;  2R8J A;  4PHP A;  3PNC A;  2FMP A;  5J2B A;  4P4P A;  3HT3 A;  5KT4 A;  4XRH A;  3N97 B;  1DK2 A;  5HRL A;  3ISD A;  4DS4 A;  3RJG A;  7ICO A;  1T8E A;  4M47 A;  3Q8Q B;  4I2G A;  5DQI A;  3MBY A;  3TFS A;  4O5E A;  3FDS A;  4RQ4 A;  3C2K A;  5HHI A;  4I2J A;  1RXW A;  4KLG A;  1EXN A;  4LZD A;  9ICH A;  2M2V A;  5CJ7 A;  3PY8 A;  4B9L A;  4FHX A;  4O3N A;  1D9F A;  8ICU A;  4GLX A;  4RPZ A;  3H37 A;  5KFV A;  4ECY A;  2ZJ8 A;  4EBK A;  3TAR A;  5CWR A;  1D9D A;  3G6X A;  5KFL A;  4PHD A;  3OGU A;  4WC5 A;  4X4R A;  2W9M A;  4YR3 A;  2C22 A;  4RT2 A;  5KFI A;  2DR7 A;  9ICP A;  4GXI A;  4Z6E A;  2FPK A;  4F5Q A;  2VA8 A;  4FHP A;  3GIK A;  3UQ2 A;  8ICB A;  1S10 A;  2GWS A;  2F1H A;  2ZJ5 A;  3PO4 A;  2M2U A;  2M2T A;  3WFS C;  3TFR A;  4MFC A;  2PI5 A;  4X4Q A;  2MUT A;  1ZQA A;  4M6W A;  5J0T A;  4GC6 A;  2BKE A;  4Q45 A;  4BXO A;  7ICJ A;  4QZH A;  3WFR E;  4CCH A;  1Z00 A;  2Q0Z X;  3ORY A;  3JPT A;  5L1K A;  2FLN A;  4M9L A;  4YP3 A;  1BPB A;  3MFI A;  5DDM A;  4MEX A;  1OU5 A;  2F1I A;  1RXV A;  1U49 A;  4YCX A;  4YR2 A;  4O9M A;  2HVI A;  5TZV A;  3RRH A;  1MQ2 A;  3GIM A;  3TAN A;  3B0Y A;  4WC3 A;  3JZ0 A;  1K1Q A;  4QWD A;  2ZHB A;  4F93 B;  4LVS A;  4AT7 A;  4TQR A;  2ZTC A;  1N48 A;  3MFH A;  4QWC A;  4DOC A;  4J9L A;  4JWM A;  2ASD A;  3OUY B;  3AU2 A;  4YMN A;  2O1P A;  4ED3 A;  1H38 A;  4DSJ A;  3LK9 A;  4NY8 A;  1IM4 A;  7ICV A;  4PGY A;  4M9G A;  3PW7 A;  3WFP A;  1ZQX A;  1XU4 A;  5KT2 A;  4IR1 A;  4DFP A;  4MEY A;  8ICT A;  2M2W A;  8ICV A;  2PFP A;  3MGI A;  3GQC A;  9ICL A;  9ICW A;  4RZR A;  3QZ7 A;  2BR0 A;  1D8Y A;  9ICJ A;  4FHY A;  3K4G A;  2DR5 A;  3HP6 A;  3MR6 A;  4AT9 A;  1ZQT A;  4C8O A;  8ICE A;  1BNP A;  4JK1 A;  5HML A;  5KG7 A;  5KT3 A;  4NKU A;  3C1Z A;  5JUM A;  2ZH2 A;  1MSW D;  2R8H A;  4ECQ A;  5KFY A;  4ECU A;  4JUZ A;  3ZDC A;  2HHW A;  4KN7 A;  2AQ4 A;  2RFF A;  8ICY A;  9ICT A;  5HRH A;  4M5D A;  1MIY A;  4MF2 A;  7ICE A;  7ICR A;  3BDP A;  5CP2 A;  4BWM A;  5KFR A;  4PHE A;  4NM1 A;  1XWL A;  5KFX A;  4O0I A;  3PW5 A;  3TAQ A;  1V9P A;  4E80 A;  2C28 A;  1S97 A;  1R8A A;  4FS1 A;  3H39 A;  4DFJ A;  1UEU A;  3RRG A;  3GDX A;  3RJE A;  1X9S A;  3WFQ E;  3V7J A;  2C2D A;  5IIK A;  4YXM A;  3RJI A;  2BQU A;  1TVA A;  9ICU A;  2V4Q A;  3HX0 A;  1PX5 A;  1JAJ A;  3BQT A;  1T3N A;  2XCA A;  5KFU A;  1ZQW A;  1MQ3 A;  2W8L A;  2ISO A;  2DPJ A;  2JZB A;  2OWO A;  2KZ3 A;  2XGP A;  2UVR A;  4RPX A;  4GXK A;  1ARO P;  3SYZ A;  4I2H A;  5DQH A;  2BQR A;  4QW8 A;  5BPC A;  1F5A A;  8ICO A;  3BQ1 A;  3OJS A;  3C2M A;  5HRB A;  3H8J A;  4R8U B;  4RQ1 A;  1TK0 A;  3ISB A;  8ICN A;  1VJ7 A;  5L1L A;  4C8K A;  4IRK A;  4O3S A;  5KFJ A;  3C66 A;  1ZQK A;  8ICA A;  1ZQQ A;  5KTQ A;  1UA1 A;  4P4O A;  5J0U A;  4QW9 A;  3ZDA A;  4Q44 A;  4DQI A;  7ICS A;  4FH5 A;  3EZ5 A;  4EP7 A;  5C5J A;  2J6T A;  3LWM A;  4QZG A;  5KFT A;  9ICE A;  3MR2 A;  4KLO A;  3T3F A;  4UAW A;  4J9M A;  4NLZ A;  9ICF A;  5KFC A;  2BCV A;  3H38 A;  4TUQ A;  2NRZ A;  3M8R A;  2FLL A;  5J2J A;  3SZ2 A;  1WCL A;  5DBA A;  5J2E A;  2KN7 A;  1ZQD A;  3V72 A;  1XC9 A;  5KFA A;  2PFN A;  4QZ9 A;  4R66 A;  4I2A A;  3LQC B;  1TFY A;  4X4U A;  1ZQU A;  4M0A A;  2W9B A;  1ZQY A;  3IM1 A;  1S76 D;  4B9N A;  4UB3 A;  2LYH A;  3HJ1 A;  5J0R A;  4AT8 A;  3E2E A;  4R64 A;  3OJU A;  1NO5 A;  2ZH7 A;  3Q8P B;  2HHU A;  4DF4 A;  1WCN A;  3UPS A;  2MAX A;  1S77 D;  4RWP A;  3ZDE A;  2ZH4 A;  1B43 A;  1COO A;  4F4W A;  1ZQM A;  4YN4 A;  3LWL A;  1ZQV A;  4O3Q A;  1L5U A;  1K1S A;  2FPL A;  5IIL A;  1NJY A;  1ZQL A;  4I29 A;  3H3A A;  1KTQ A;  4XQ7 A;  1SKS A;  2MUT B;  5J2G A;  1ZQB A;  4ECT A;  9ICN A;  2W9C B;  2ZHA A;  4IQU A;  3SV4 A;  2P6R A;  3PX4 A;  5DB8 A;  4I27 A;  5CHG A;  2KTQ A;  2V4R A;  3THV A;  4RWO A;  5DDY A;  4I2B A;  1Q79 A;  1U48 A;  3PW4 A;  5KG2 A;  4YXJ A;  9ICI A;  5KFP A;  1BPD A;  2F1J A;  3GFK B;  2A1J B;  4ECV A;  1SKR A;  2C2E A;  1JIH A;  1HUO A;  1QTM A;  2BHN A;  2BDP A;  4BDP A;  4ATB B;  3TI0 A;  3QZ8 A;  1X9M A;  5KFS A;  5F9N A;  1ZQF A;  1R8C A;  5KT7 A;  3T5L A;  5DQG A;  2XY7 A;  7ICT A;  4Z6C A;  3MAB A;  2NRX A;  2RDJ A;  8ICQ A;  1MIW A;  2ZH9 A;  3H8W A;  1NK8 A;  2BPG A;  3KHG A;  4HYK A; 
#chains in the Genus database with same CATH topology
 5E79 U;  4TQS A;  3NVZ A;  2E1E A;  1TAQ A;  2B0C A;  3G6Y A;  1YLQ A;  1NZB A;  5KFZ A;  4RT3 A;  5KG6 A;  1XO0 A;  5ALK A;  3U26 A;  3TKA A;  4J9P A;  2HHX A;  4BUG A;  2ZH8 A;  2ZIW B;  1DXS A;  5AK4 A;  4LJX A;  5DBB A;  1KRP A;  4F3O A;  1S0O A;  5KFG A;  4EZ6 A;  5III A;  2A19 A;  3M7D A;  4PH5 A;  4NM2 A;  3HIY A;  2KHQ A;  4O68 A;  5DEC A;  5ALS A;  4BJQ A;  4WC6 A;  1ZQI A;  2H5X A;  1Z4O A;  4DFM A;  3IN5 A;  2GLE A;  4QZC A;  2KJ9 A;  9ICS A;  1Q8K A;  2PBE A;  2XGQ A;  7ICI A;  2HOQ A;  2KD1 A;  1QQ5 A;  1BVS A;  4Y2X A;  4RNM A;  2VKQ A;  4RUC A;  2KK0 A;  1KBU A;  3HJ4 A;  1K5O A;  4DS5 A;  3PR4 A;  2IA6 A;  4K8V A;  1PK1 B;  2XC9 A;  4RQ3 A;  4WC0 A;  3ZD9 A;  9ICQ A;  3RR7 A;  1Q3U A;  2KZZ A;  5ALU A;  2WF5 A;  3AQL A;  5KG0 A;  2FE9 A;  1UQV A;  3QEB Z;  1SZH A;  2WB1 F;  2FLP A;  9ICX A;  5ALH A;  2W55 A;  1ZQN A;  1BPX A;  1ZJM A;  1IG6 A;  4ECS A;  1O08 A;  4F5N A;  4DCC A;  1XSP A;  4XUS A;  2ZHA A;  1KFD A;  3AUO A;  1LV5 A;  2IHO A;  4X4P A;  2YY6 A;  2R8I A;  3MR3 A;  3PO5 A;  2KVC A;  5HP4 A;  1SGG A;  1FFV A;  1JI7 A;  3PVX A;  1KW4 A;  2WF6 A;  2PI4 A;  3NTU A;  9ICK A;  2G08 A;  2DKX A;  3C2L A;  4M6W B;  4C0Z A;  4GC7 A;  3I28 A;  1JXL A;  8ICZ A;  1Z00 B;  2K60 A;  1KFT A;  2JMG A;  1SKW A;  3KZX A;  4CRX A;  2EH9 A;  4R8U A;  1ECW A;  2FPM A;  3RBE A;  3KTQ A;  4WCW A;  3LVV A;  3ALR A;  4F4Y A;  2XO7 A;  5T14 A;  2KG5 A;  1UPH A;  4AT7 B;  2OEH A;  5J0O A;  4EEB A;  1PZN A;  3H0M B;  2HHP A;  1MC8 A;  4PL2 A;  4YG2 A;  5ALR A;  4Y2J A;  1ZET A;  3RJF A;  5J2H A;  4F8R A;  2UVW A;  4ACO A;  4AT9 B;  1OXJ A;  3IDW A;  3H40 A;  2KZM A;  3M6Z A;  3HKZ F;  3BQ0 A;  4Y2Q A;  5JU5 A;  2ZJA A;  4M04 A;  4DSK A;  5DG9 A;  5HNK A;  3BJY A;  4YMO A;  5ALE A;  2KP7 A;  5DED A;  1YT3 A;  5CHE A;  1M6Y A;  3RJJ A;  4J9S A;  5J29 A;  4WBY A;  4UAZ A;  4F2R A;  1TAU A;  4FBU A;  2AJQ A;  4PGQ A;  5EE1 A;  3E58 A;  4TUS A;  3BZC A;  2OH2 A;  7ICQ A;  3LDA A;  4IRC A;  3JCF A;  3PZP A;  1R89 A;  4LEV A;  1NK5 A;  3L9D A;  1ZQZ A;  5IIM A;  5BOM A;  3OV7 A;  2WB1 C;  2G5H B;  4DQQ A;  3H4B A;  5FP0 A;  5AKZ A;  3MGH A;  3ZDD A;  5ALW A;  1FFU A;  2EZX A;  3ISC A;  5GTI U;  1ZJN A;  2WTF A;  3SI8 A;  4DSI A;  4WC1 A;  3GU3 A;  4E0D A;  1A77 A;  5DLG A;  4Y2Y A;  1TFR A;  4FE3 A;  2ZH6 A;  2G09 A;  2XY6 A;  1AQ6 A;  1D8L A;  1UA0 A;  3OWG A;  3Q8L A;  3FYH A;  9ICM A;  1X6J A;  5KFH A;  4UB1 A;  4FHW A;  2GAF D;  2VA2 A;  2AGO A;  3H39 A;  2LPE A;  4BGD A;  4K4H A;  3C5G A;  2H3V A;  1NNL A;  5KFQ A;  2PFO A;  3NVW A;  1PVR A;  8ICW A;  4F72 A;  3Q8R B;  2A1A A;  2HI0 A;  2DL0 A;  2C2R A;  2NRV A;  3KBB A;  1YZ6 A;  3IV6 A;  4ELU A;  2QB0 A;  1HJP A;  3ZI4 A;  1L7O A;  1KQQ A;  2B51 A;  3K75 D;  2DRA A;  3NGD A;  1NK6 A;  3B9J A;  1X42 A;  2NO5 A;  5HC9 A;  5JRT A;  1L6N A;  2EAM A;  5AKG A;  4NLN A;  2EZZ A;  1L3V A;  4DFD A;  5KAI U;  3RTV A;  1JN3 A;  3KHH A;  3M9M B;  4OCZ A;  3WK7 A;  3DDH A;  2DRB A;  2JXJ A;  3FAH A;  3HKZ C;  5AI8 A;  2HHS A;  4OAG A;  4UB6 U;  2HBK A;  9ICB A;  5J2B A;  4P4P A;  3HT3 A;  1X40 A;  1F44 A;  1MA7 A;  4DS4 A;  3RJG A;  3MBY A;  3C2K A;  9ICH A;  5AK6 A;  1EXN A;  4LZD A;  5CJ7 A;  4B9L A;  2RQ5 A;  1D9F A;  4RPZ A;  4ECY A;  2FDR A;  1ZRN A;  1B4F A;  2C22 A;  2DR7 A;  3GIK A;  2K4H A;  2GWS A;  3WFS C;  3TFR A;  4MFC A;  4X4Q A;  2EDU A;  1RQN A;  1NI3 A;  4QZH A;  2Q0Z X;  8ICG A;  4K98 A;  3TAC B;  1OU5 A;  3KFU F;  2MU2 A;  3RRH A;  5AKI A;  2H3F A;  3TAN A;  1HIW A;  2ZHB A;  4F93 B;  4LVS A;  2ZTC A;  4DOC A;  3WK4 A;  4JWM A;  3OUY B;  2HSZ A;  4YMN A;  2XID A;  2EZY A;  1ZQ1 C;  1H38 A;  1IM4 A;  5AKX A;  3PW7 A;  4DFP A;  2I5H A;  2KKV A;  2OM6 A;  2ZG6 A;  3SEN A;  9ICL A;  4FHY A;  3NAS A;  2ZXI A;  3MR6 A;  5HML A;  3C1Z A;  4PZN A;  2ZH2 A;  4KN7 A;  8ICY A;  3F53 A;  3BDP A;  1N61 A;  5B3P A;  1XWL A;  4E80 A;  2C28 A;  1S97 A;  2M0N A;  2O6K A;  3ICX A;  3V7J A;  2BQU A;  1SIJ A;  3QUQ A;  4NL9 C;  3LYS A;  1ZQW A;  1MQ3 A;  2W8L A;  4O69 A;  2ISO A;  2DPJ A;  1YZ7 A;  2B6G A;  2OWO A;  2XGP A;  5DQH A;  3KZI U;  3C2M A;  5HRB A;  4C8K A;  3C66 A;  2Y9T A;  1UA1 A;  5J0U A;  4FH5 A;  4EP7 A;  5AM4 A;  2J6T A;  3QU4 A;  3UM9 A;  3T3F A;  4UAW A;  5KFC A;  2BCV A;  3M8R A;  5ALG A;  3O0F A;  2G5I B;  4GFJ A;  3WFO A;  3LQC B;  4X4U A;  4Y2R A;  4QZ9 A;  2E1F A;  4R66 A;  2K89 A;  4NLC A;  4B9N A;  5J0R A;  1Q3V A;  3Q8P B;  4RWP A;  1WCN A;  3ZDE A;  2ZH4 A;  2K4I A;  4KM5 A;  1K1S A;  3H3A A;  1KTQ A;  4CF3 A;  4XQ7 A;  1KL9 A;  3A0H U;  9ICN A;  2ZIV A;  3SV4 A;  5F3X B;  5CHG A;  5DDY A;  4I2B A;  1Q79 A;  4OAI Z;  4NXU A;  4O67 A;  4NLB A;  4Y2S A;  2A1J B;  2C2E A;  2L5Y A;  2BDP A;  2MSN A;  4O3M A;  2ZIU A;  5KFS A;  5F9N A;  1R8C A;  5KT7 A;  3KD3 A;  2WAQ C;  2AXT U;  2XY7 A;  2NRX A;  4KLU A;  1NJW A;  4J9O A;  3PX0 A;  2KJ5 A;  4UB5 A;  3RB3 A;  4JV0 A;  5D4B A;  8ICR A;  5HHH A;  3AQN A;  1B22 A;  2I1Q A;  1PK3 A;  1X9X A;  4R65 A;  1F5S A;  1SXD A;  2AGP A;  4XQ8 A;  1SXE A;  4HAI A;  4IQW A;  1XO1 A;  2YQE A;  3HRD D;  2GO7 A;  1A6S A;  4JMU A;  3V6H A;  1SWV A;  2VA3 A;  1JX4 A;  3GIJ A;  4QNL A;  1KSP A;  2M9N A;  1BPE A;  2BCR A;  2MRL A;  4QZE A;  8ICS A;  5G5H A;  2R8G A;  4WOY A;  3IHQ B;  4O3O A;  2W3R A;  2DPI A;  4DOB A;  3WKD A;  5ALM A;  1GO3 F;  2AQ0 A;  2ODG A;  1VJ5 A;  3AU6 A;  5KT5 A;  2JGA A;  1TAM A;  4ED8 A;  1COK A;  4K9A A;  4U6P A;  2EQY A;  3M9N B;  1LB2 B;  2XY5 A;  2QAR A;  3T5J A;  5HR6 A;  3UQ0 A;  4LT6 A;  1CUK A;  2NYV A;  2E8N A;  3ZDB A;  3NVV A;  3QEA Z;  1SV0 C;  5L1J A;  2DKZ A;  3K1R B;  4YD2 A;  4RQ5 A;  8ICK A;  4EYH B;  4LEZ A;  1QSY A;  5J0X A;  2F2A B;  3SV3 A;  2KE7 A;  2UVU A;  3RFA A;  5D46 A;  1SV4 A;  4LZG A;  3EWA A;  1LVH A;  4I2D A;  5KFO A;  2IOF K;  4C4S A;  4F92 B;  2Y1J A;  5DKW A;  3CRX A;  2KFN A;  4RNN A;  3WK8 A;  3JYY A;  1TE2 A;  4F5O A;  1SZP A;  5KT6 A;  4J9N A;  1GPJ A;  2E8O A;  5DGA A;  2ZIU B;  4B9T A;  3N7S C;  5AM3 A;  4DL3 A;  2HHT A;  3RR8 A;  2QB1 A;  5ALN A;  3PMN A;  2E8M A;  4KLF A;  2B21 A;  4BXO B;  4O3R A;  3RB0 A;  1HUZ A;  2ISP A;  3UXN A;  2CXY A;  4EBC A;  3N7P D;  3WKB A;  3F2D A;  1ZQC A;  3WKC A;  4DSE A;  4DL4 A;  3L4P A;  4QWB A;  4P2H A;  4I2C A;  2ZUB A;  3MCR A;  1ZQJ A;  1XSN A;  4B9U A;  7ICF A;  1QSS A;  9ICG A;  3T5H A;  2W7P A;  2B56 A;  2HN1 A;  3A0B U;  2BQ3 A;  1KFS A;  4RQ7 A;  4G3I A;  4EEY A;  4ECZ A;  1NJZ A;  5EE9 A;  5AK3 A;  3BS7 A;  5KFF A;  4IL6 U;  2JEI A;  4P4M A;  4A8E A;  5KFD A;  3S6J A;  4LEY A;  3UXO A;  3Q8S B;  4K99 A;  5CA7 A;  1UT8 A;  2HVH A;  4EZ9 A;  1U9L A;  4C8M A;  4M9H A;  4PPX A;  4EEK A;  3C18 A;  1T3Q A;  3H0R B;  4ATB A;  5B5E U;  4M9J A;  4AP9 A;  4NL9 A;  2E5S A;  3PW0 A;  4C8N A;  4HX0 A;  2JZB B;  1VLB A;  1NZP A;  4IR9 A;  7ICU A;  5IIJ A;  2FMQ A;  2ZTE A;  4I28 A;  2KKP A;  4KLL A;  2DR8 A;  4PGX A;  1ZQE A;  4KLS A;  4YR0 A;  8ICX A;  3OPX A;  2W03 A;  5CFU A;  5AKY A;  3RB4 A;  2W9B B;  3N28 A;  1T4G A;  2QKQ A;  3JPR A;  2BPF A;  1NOM A;  1V97 A;  8ICM A;  1BNO A;  1X9W A;  2HW3 A;  4B9M A;  2QLT A;  2E8P A;  1T94 A;  3RJH A;  4ELT A;  4EBJ A;  1NK7 A;  3UXP A;  3RBD A;  2V9W A;  4WJ3 B;  1NJX A;  5B3Q A;  3JPO A;  1ZD5 A;  8ICJ A;  3MR5 A;  3CNH A;  1X2I A;  4RPY A;  1L3T A;  1JMS A;  2VIX A;  2DVI A;  5ALX A;  2KFZ A;  1TK8 A;  3IP4 B;  3NVY A;  4P0Q B;  4J9R A;  4UBB A;  1L7N A;  2F44 A;  1RYS A;  2W3S A;  2E3T A;  2BGW A;  5AIA A;  4YD1 A;  1RYR A;  3GV5 B;  8ICL A;  2I6X A;  3D2N A;  4UAU A;  3N97 B;  3ISD A;  1T8E A;  4M47 A;  5DQI A;  2F76 X;  3FDS A;  4KLG A;  3H37 A;  4EBK A;  2ZJ8 A;  5CWR A;  2RHF A;  1D9D A;  4PHD A;  3OGU A;  4WC5 A;  4X4R A;  1IIP A;  2FPK A;  4F5Q A;  2VA8 A;  4FHP A;  3UQ2 A;  1S10 A;  2F1H A;  5ALV A;  1ZQA A;  4GC6 A;  4Q45 A;  7ICJ A;  5L1K A;  3JPT A;  2A3V A;  2FLN A;  4YP3 A;  1BPB A;  4MEX A;  4NWI A;  1V38 A;  2RP5 A;  4K96 A;  2LM4 A;  1MN8 A;  1J2M A;  4TQR A;  3AMZ A;  4NY8 A;  3LK9 A;  4M9G A;  2KNJ A;  3WFP A;  1ZQX A;  3IG5 A;  4IR1 A;  8ICT A;  5C0Y A;  2KJ8 A;  8ICV A;  2PFP A;  1SV0 A;  3QYP A;  3QZ7 A;  2BR0 A;  9ICW A;  5CFT A;  1ZQT A;  4C8O A;  8ICE A;  4NKU A;  3NRZ A;  1LKY A;  1J97 A;  5JUM A;  3ETR A;  2JRZ A;  4JUZ A;  2EAN A;  4M5D A;  7ICE A;  4BWM A;  4MHV A;  4PHE A;  3BZK A;  5KFR A;  3PSP A;  5KFX A;  2XVT A;  4F71 A;  3TAQ A;  5G5G A;  1R8A A;  1QQ7 A;  3GDX A;  3RJE A;  5ALY A;  5IIK A;  2C2D A;  2V4Q A;  4J03 A;  1PX5 A;  2H3Z A;  2GH1 A;  1C20 A;  2KZ3 A;  1ARO P;  2YX8 A;  3FM9 A;  8ICO A;  3BQ1 A;  3H8J A;  1QH9 A;  4R8U B;  3ISB A;  8ICN A;  1VJ7 A;  3CK6 A;  4O3S A;  5KFJ A;  1WYG A;  1ZQQ A;  4QW9 A;  4UAT A;  4OJ6 A;  3LWM A;  1UCV A;  9ICE A;  4NLZ A;  2LI6 A;  4TUQ A;  4CF4 A;  2FLL A;  5J2J A;  3SZ2 A;  2KN7 A;  3DEE A;  3V72 A;  1XC9 A;  4QIW F;  4M0A A;  4UB3 A;  2LYH A;  2RRD A;  3HJ1 A;  4AT8 A;  4R64 A;  2VJ4 A;  1NO5 A;  2HOF A;  2MAX A;  1COO A;  4F4W A;  1ZQM A;  4YN4 A;  1ZQV A;  1L5U A;  2FPL A;  5IIL A;  1NJY A;  1ZQL A;  4I29 A;  5DB8 A;  4NXV A;  3THV A;  4RWO A;  3PW4 A;  4YXJ A;  9ICI A;  1KKX A;  2IOF A;  5CRX A;  3GFK B;  4FZM A;  1HUO A;  4BDP A;  3TI0 A;  3QZ8 A;  4JLX A;  3PHZ A;  3F2C A;  4Z6C A;  2R18 A;  4C7Z A;  1O03 A;  2FJ6 A;  1NK8 A;  2BPG A;  3KHG A;  2Z7J A;  5L1M A;  1N63 A;  4Q8E A;  4KLI A;  3NVO A;  4US8 A;  4P0P A;  4IG8 A;  3MDC A;  1TKD A;  3F2B A;  2VAN A;  1KDH A;  4KLQ A;  2YN4 A;  5KFE A;  4XJE A;  4MFA A;  5IIO A;  4R63 A;  1RPL A;  3HJE A;  4Y2V A;  4K4G A;  4E7X A;  3PV8 A;  4DQR A;  4NV0 A;  3ZD8 A;  5L9X A;  5AKH A;  2R8K A;  3M9O B;  2F8L A;  5HRG A;  3OVS A;  5KFW A;  2IUB A;  4KLT A;  3D2Q A;  1PVQ A;  4Z6D A;  3RH4 A;  1MIV A;  4I2I A;  2YTU A;  2AHO B;  1ZQO A;  4CE6 A;  4QWE A;  5JTI A;  3PX6 A;  3PW2 A;  5J0S A;  3N4M B;  3Q8M A;  5JTG A;  3H8S A;  4UD5 A;  4BX9 C;  5AKE A;  5BOL A;  1ZD3 A;  2JEJ A;  2QB0 B;  8ICP A;  3UMB A;  3BQ7 A;  4RQ2 A;  4QIW C;  3JPN A;  4F4Z A;  2N1R A;  4KLH A;  4WBZ A;  5D49 A;  1N2X A;  3M1Y A;  2Y9U A;  3AM9 A;  4F50 A;  4RWN A;  5AI9 A;  3KHL A;  4KMU A;  3SQI A;  4MF8 A;  7ICN A;  3C5F A;  4F5P A;  3IRU A;  1ZQG A;  1TFW A;  4Z6F A;  2PFQ A;  4N7R A;  4ECR A;  5ALT A;  2IHN A;  5KG4 A;  4EX6 A;  2AGQ A;  2NRT A;  1TV9 A;  1NK9 A;  3QUB A;  2ATL A;  1S9F A;  2BBJ A;  1NKE A;  3RJK A;  4MFF A;  4FZL A;  2KSO A;  1KLN A;  4Y2T A;  3RAQ A;  1CI4 A;  3ERC C;  1JUD A;  2IMW P;  4KMO B;  2ZTD A;  5DG7 A;  4C4R A;  3D2S A;  1ZQR A;  3OVB A;  1WWU A;  2ID1 A;  4UB2 A;  2IBK A;  4DL2 A;  5DG8 A;  2J6U A;  2IOH A;  4DLG A;  2DGZ A;  5AIB A;  5HRF A;  2OCE A;  4YMM A;  1NK4 A;  4NLK A;  4KN4 A;  1T7P A;  2ES6 A;  4PZO A;  3LVW A;  1J2N A;  7ICH A;  4QZF A;  2ASL A;  2F8K A;  4B9S A;  4IQV A;  3SMV A;  7ICL A;  3RH6 A;  2DQN B;  4IRD A;  4DQS A;  1VFG A;  4YFK A;  5AM1 A;  5EWF A;  3OHB A;  3E0F A;  3AN1 A;  3GV7 B;  5J0W A;  2PXI A;  4K4I A;  3NYB A;  7ICP A;  4Q8F A;  2HOI A;  2Y1I A;  1WOT A;  3QE9 Y;  2KIV A;  2W9C A;  1P7D A;  2H3I A;  1FA0 A;  3GZF A;  9ICR A;  4X0A A;  5J2K A;  1Z4N A;  7ICG A;  4RNO A;  3V7L A;  5HR7 A;  2J6S A;  2LBO A;  4DL5 A;  4TUP A;  1UEV A;  3PSI A;  3SR6 A;  4ELV A;  3BQ2 A;  1UHU A;  7ICM A;  4NXT A;  4RQ0 A;  4GIB A;  2DBY A;  2G07 A;  4ECW A;  4K9B A;  2PMZ F;  3HWT A;  1L7M A;  3H8M A;  1ZYQ A;  4JWN A;  1JAL A;  4KLE A;  4X5V A;  2GOL A;  1N60 A;  2ASJ A;  5J2D A;  2HCF A;  1ZRM A;  3QUC A;  4F4X A;  3H7I A;  4Q43 A;  5F2V O;  4ED0 A;  3AQK A;  4JV1 A;  3WU2 U;  3EYZ A;  3SAG A;  3PR5 B;  3TQ1 A;  4O5C A;  1RM6 C;  3QNM A;  4DOA A;  1QLN A;  5HRK A;  7ICK A;  4RU9 A;  5AI4 A;  4US9 A;  5HRI A;  4KLM A;  4O5K A;  2GA9 D;  5HR9 A;  3OHA A;  3QXG A;  3T5K A;  4WC7 A;  1V85 A;  8ICF A;  1JRP A;  2CPR A;  4UBC A;  3CW2 C;  3HPO A;  4C8L A;  2Q4T A;  1TK5 A;  5KFK A;  1U45 A;  2YMQ A;  2ZIV B;  3C28 A;  4DFK A;  4USA A;  3UPQ A;  1KNY A;  4J9K A;  4M2Y A;  4FO6 A;  4ED7 A;  2K4E A;  1N5W A;  2NRK A;  2NRW A;  2Y0S F;  2JEG A;  3C1Y A;  1NKB A;  3I76 A;  1X66 A;  4QZ8 A;  4WC2 A;  2D6F C;  4FBT A;  1L8O A;  1ZQH A;  3TAD C;  2WF9 A;  2ZUD A;  4O3P A;  1QSL A;  5KG1 A;  1JRO A;  1PK1 A;  2YMP A;  4ED6 A;  4OJP A;  3WKE A;  3T79 A;  3OSP A;  4RWQ A;  3H4D A;  3QU5 A;  4J9Q A;  3IG8 A;  3AQM A;  5AK5 A;  4NXZ A;  5F9L A;  4I0U A;  4WC4 A;  3R9K A;  1DOQ A;  2DFL A;  5DLF A;  3PNC A;  4CDG A;  2FMP A;  5KT4 A;  4XRH A;  5HRL A;  7ICO A;  4PL1 A;  4I2G A;  3TFS A;  2XIC A;  4RQ4 A;  4OJO A;  4I2J A;  4UW9 A;  8ICU A;  2LYA A;  4IS7 A;  5KFV A;  3TAR A;  4OJL A;  5KFL A;  2W9M A;  4RT2 A;  9ICP A;  3PO4 A;  2M2U A;  2MUT A;  1FO4 A;  4M6W A;  2BKE A;  1Z00 A;  3MFI A;  2LHT A;  2F1I A;  1RXV A;  1U49 A;  2F3N A;  2HVI A;  4O9M A;  2K8B B;  1ZD4 A;  2HBJ A;  1MQ2 A;  3GIM A;  4CNQ A;  4WC3 A;  1PUZ A;  2EAO A;  3RF9 A;  1K1Q A;  4QWD A;  3AL0 B;  4AT7 A;  1N48 A;  4J9L A;  2QAR B;  2ASD A;  1WWV A;  2O1P A;  4ED3 A;  2KOB A;  4DSJ A;  3QX7 A;  3FC4 A;  1XU4 A;  5KT2 A;  4OJ5 A;  3MGI A;  3D6J A;  3ER9 B;  4RZR A;  9ICJ A;  3K4G A;  3HP6 A;  4AT9 A;  5ALZ A;  4JK1 A;  5KG7 A;  1BNP A;  2HDO A;  5KT3 A;  4B6J A;  1MSW D;  4ECQ A;  5KFY A;  3ZDC A;  9ICT A;  4MF2 A;  5AI5 A;  5CP2 A;  4NM1 A;  3ONN A;  4O0I A;  3PW5 A;  4FS1 A;  2AH5 A;  3WK5 A;  2Y0S C;  4DFJ A;  3RRG A;  1UEU A;  1X9S A;  2DUY A;  3WFQ E;  3L5K A;  1TVA A;  3RJI A;  3HX0 A;  5D61 A;  3BQT A;  1T3N A;  5KFU A;  5ALP A;  2BDU A;  1Z1V A;  4WH5 A;  5CFS A;  4OAF A;  2KEY A;  4RPX A;  4GXK A;  3QUT A;  2BQR A;  5BPC A;  1F5A A;  2JHD A;  3OJS A;  4RQ1 A;  2ZIX A;  3M6K A;  1XNS A;  4IRK A;  3BS5 A;  5AM0 A;  8ICA A;  5KTQ A;  7ICS A;  3F5A A;  4Q44 A;  3EZ5 A;  4QZG A;  3MR2 A;  4KLO A;  4J9M A;  4X4N A;  2NRZ A;  1ZQD A;  1WCL A;  5DBA A;  1FIQ A;  5J2E A;  1TFY A;  4I2A A;  1ZQU A;  2K8C B;  1ZQY A;  3IM1 A;  4ICA A;  4WQK A;  3KKA C;  2WFA A;  2WF8 A;  4DF4 A;  3SD7 A;  3LWL A;  4O3Q A;  5KNI A;  1SKS A;  2MUT B;  5AM5 A;  5J2G A;  1ZQB A;  3SEI A;  2P6R A;  1WUD A;  4CGZ A;  2KTQ A;  4I27 A;  4O6A A;  2PKE A;  3QU7 A;  2EWR A;  3NKU A;  5KG2 A;  1CRX A;  5KFP A;  1SKR A;  1JIH A;  2G0A A;  4ATB B;  1X9M A;  3NWI A;  3T5L A;  5DQG A;  8ICQ A;  2RDJ A;  4HYK A;  4WQL A;  4AYB F;  4QZB A;  5DGB A;  5J0P A;  1S5L U;  2YMM A;  4NKT A;  2ZUC A;  3UMC A;  5J8Y C;  3GV8 B;  1S8O A;  2H3Q A;  4M9N A;  2G06 A;  4XA5 A;  3EPI A;  1RDF A;  4X4T A;  4TUR A;  1B0X A;  4QZA A;  3OTQ A;  1UT5 A;  4KLD A;  4S3N A;  4ED2 A;  2IHM A;  2EAP A;  2P6U A;  1DGS A;  4ZH4 A;  1Z3E B;  5HMM A;  4DSF A;  2HHQ A;  1RQL A;  1SL1 A;  3M8S A;  5DB7 A;  4KX5 A;  5AKK A;  4I2F A;  1SL0 A;  4KTQ A;  2FMS A;  1NK0 A;  5EE3 A;  5J0Q A;  4G9B A;  4DSL A;  4EYI B;  1WG8 A;  2ZH1 A;  2ZIX B;  3BS5 B;  1ED1 A;  1SL2 A;  3RB6 A;  2HHV A;  4JLZ A;  5DB6 A;  4RQN A;  4BWJ A;  3SAF A;  2OYY A;  3OUY A;  5H2F U;  4DEZ A;  3GIL A;  4OO1 J;  3TAD A;  4OD0 A;  1CEZ A;  3AQF A;  3C23 A;  2ZH3 A;  4RQM A;  3TAP A;  4MKP A;  4C7Y A;  2DR9 A;  5J2A A;  3RH5 A;  4CF5 A;  1RZT A;  5J0Y A;  8ICC A;  1ZQS A;  2KV2 A;  1F0M A;  2UVV A;  4B9V A;  5EE0 A;  4DLE A;  4FS2 A;  5KG5 A;  1RG6 A;  2BPC A;  3OVA A;  5CEH A;  5J2F A;  4UD4 A;  2XCP A;  4I2E A;  2KVS A;  4DL7 A;  5ALQ A;  2WF7 A;  5DBC A;  5L1I A;  4X4S A;  1L3S A;  4DF8 A;  1C7Y A;  3RAX A;  5KL8 B;  1XSL A;  4FH3 A;  9ICV A;  2HMX A;  3PST A;  3J81 j;  4YVZ A;  4RUA A;  1X6I A;  3EW9 A;  4E8F A;  5J2C A;  3V7K A;  3C21 A;  3HIL A;  5EWG A;  1U4B A;  4AYB C;  1S0N A;  2YB4 A;  3MGV A;  2BCS A;  4LEW A;  5KAF U;  1S0M A;  4DQP A;  2HBM A;  4EBD A;  3PSF A;  1ZXI A;  4F4K A;  5KFN A;  4QZD A;  4DO9 A;  4RQ6 A;  2W11 A;  3ETL A;  2OXO A;  3JPP A;  4F5R A;  5KL1 B;  2W9A A;  3GII A;  5EWE A;  4X0B A;  2VJ5 A;  3MC1 A;  2DWQ A;  4KB6 A;  3KHR A;  1PVP A;  1UET A;  2Q66 A;  4QZI A;  1DK3 A;  2OHF A;  1U47 A;  4ZOH C;  1LKY B;  3G6V A;  3EF2 A;  5B66 U;  4FO1 A;  3UMG A;  4UAV A;  4NLG A;  1S0V A;  4KIT B;  1ZQP A;  2LKY A;  1JXE A;  1ZD2 P;  4EGW A;  2I9G A;  4YQW A;  1HEK A;  2RDI A;  3F5E A;  1L8L A;  1Y88 A;  2CN1 A;  2RLT A;  2BZF A;  1L7P A;  2A1J A;  2KIC A;  3B0X A;  4DWI A;  1N62 A;  5ALL A;  5CR0 A;  1KEJ A;  3C29 A;  2WAQ F;  1BGX T;  3NS1 A;  4PHA A;  1IXR A;  5K4L A;  8ICH A;  4U7C A;  5TIS U;  4NXX A;  4K97 A;  2W8K A;  4UAY A;  5KFM A;  3V6K A;  5J2I A;  5HRE A;  4GXJ A;  4F91 B;  2JR5 A;  3PML A;  5EOZ A;  3KOO A;  8ICI A;  1QQ6 A;  2KMD A;  5ALJ A;  5D62 A;  4X4V A;  5AM2 A;  4UQG A;  4UB8 U;  3VCB A;  4RQ8 A;  1BPY A;  5KFB A;  3CYM A;  1BPZ A;  2O5A A;  5DB9 A;  2JEF A;  4IC9 A;  4JV2 A;  4AT8 B;  5IIN A;  4ED1 A;  3JPQ A;  3KKA A;  4JB3 A;  5KG3 A;  2D8C A;  5AI0 A;  4EEL A;  3V6J A;  2BCU A;  9ICO A;  2AU0 A;  4EBE A;  5CB1 A;  3WK6 A;  4IQT A;  3JPS A;  4NJ8 A;  3ED5 A;  1Z1B A;  1V4A A;  4UB4 A;  2P66 A;  5ALD A;  9ICC A;  3OSN A;  3MDA A;  3HW8 A;  3EPG A;  1VDV A;  1NKC A;  2YML A;  2W04 A;  4F2S A;  1A76 A;  1QCK A;  4FFD A;  3Q8K A;  1N56 A;  9ICA A;  1FEZ A;  2F77 X;  5A0L A;  1XS9 D;  4QWA A;  2ALZ A;  2BCQ A;  4ECX A;  2ZH5 A;  1JQR A;  4KLJ A;  1R8B A;  4PJ0 U;  4EED A;  2WHE A;  1Q78 A;  2FCL A;  4DL6 A;  3UPS A;  4X4O A;  4P0P B;  5HRD A;  1SWW A;  1L3U A;  5AI6 A;  2LYB A;  4FHV A;  2W43 A;  2R8J A;  4PHP A;  1Z19 A;  5J8Y A;  1DK2 A;  4C80 A;  3Q8Q B;  4O5E A;  1RXW A;  5HHI A;  2M2V A;  3PY8 A;  4OAH A;  4FHX A;  4O3N A;  4GLX A;  3G6X A;  4YR3 A;  5KFI A;  4GXI A;  2LMR A;  4Z6E A;  8ICB A;  2ZJ5 A;  5AKL A;  2M2T A;  2PI5 A;  5D63 A;  5J0T A;  4BXO A;  3WFR E;  4CCH A;  3ORY A;  4UAR A;  4M9L A;  5DDM A;  4UAS A;  3NRW A;  1ZOL A;  4KX3 A;  4YCX A;  4YR2 A;  5TZV A;  2KHV A;  3B0Y A;  2NV3 A;  3VC8 A;  3JZ0 A;  3MFH A;  4QWC A;  2ESE A;  3AU2 A;  3DV9 A;  7ICV A;  3NUQ A;  4PGY A;  2CRX A;  1KN5 A;  4MEY A;  2M2W A;  4NXW A;  2HN2 A;  1A0P A;  3GQC A;  5AIC A;  3SAH A;  5ALO A;  1D8Y A;  2DR5 A;  2D3D A;  5AHX A;  2R8H A;  3I1Y A;  4ECU A;  2JV3 A;  2ZXH A;  2HHW A;  2AQ4 A;  2RFF A;  5HRH A;  1MIY A;  7ICR A;  5ALF A;  2ZIW A;  2YB1 A;  1V9P A;  3K1Z A;  2W7O A;  3H0L B;  2LM1 A;  1OW5 A;  4Y2U A;  3ER8 C;  4YXM A;  9ICU A;  5GTH U;  1JAJ A;  1OUQ A;  2KSO B;  2MA1 A;  2XCA A;  1SB3 C;  2W54 A;  4EV6 A;  3EUB 2;  2JZB A;  2UVR A;  4EX7 A;  4I2H A;  3SYZ A;  4QW8 A;  2FI1 A;  1D8B A;  3QU2 A;  1TK0 A;  3AEV A;  3N7R C;  5L1L A;  1IV8 A;  1ZQK A;  3QU9 A;  3ZDA A;  4P4O A;  4DQI A;  2XI9 A;  5C5J A;  4QJF B;  2JH1 A;  5KFT A;  9ICF A;  2DF4 B;  1URJ A;  3H38 A;  2BE3 A;  2HBL A;  2PFN A;  5KFA A;  2W9B A;  5AKJ A;  4FZN A;  1S76 D;  2P35 A;  3E2E A;  3OJU A;  2ZH7 A;  2HHU A;  1S77 D;  2NO4 A;  1B43 A;  1N5X A;  2KIW A;  2B4V A;  3WK9 A;  4ECT A;  3K7D A;  4Y2P A;  5ALI A;  4C4T A;  2W9C B;  4EEN A;  4IQU A;  3PX4 A;  2K8A A;  2V4R A;  1U48 A;  1RYU A;  3WKA A;  1DRG A;  1BPD A;  1DGJ A;  2F1J A;  4ECV A;  1QTM A;  2BHN A;  2K4P A;  3CP8 A;  3AQE A;  1ZQF A;  3L3F X;  7ICT A;  3MAB A;  1MIW A;  2ZH9 A;  1Q46 A;  2JH7 A;  3H8W A;  4P0Q A;  2PMZ C;  2BBH A; 
#chains in the Genus database with same CATH homology
 4KLU A;  1NJW A;  4Q8E A;  4J9O A;  4QZB A;  3PX0 A;  5DGB A;  4KLI A;  5J0P A;  4UB5 A;  4TQS A;  4IG8 A;  3RB3 A;  4JV0 A;  3MDC A;  5D4B A;  8ICR A;  5HHH A;  1TKD A;  3AQN A;  4NKT A;  1B22 A;  2VAN A;  1TAQ A;  1KDH A;  4KLQ A;  3G6Y A;  2ZUC A;  3GV8 B;  1YLQ A;  2I1Q A;  5KFE A;  5KFZ A;  4MFA A;  4M9N A;  5IIO A;  4R63 A;  1RPL A;  4RT3 A;  4R65 A;  5KG6 A;  2AGP A;  4XA5 A;  4XQ8 A;  4J9P A;  4K4G A;  2HHX A;  2ZH8 A;  3EPI A;  4E7X A;  3PV8 A;  4X4T A;  4DQR A;  4IQW A;  1XO1 A;  3ZD8 A;  5DBB A;  4TUR A;  5L9X A;  1KRP A;  2R8K A;  4F3O A;  4QZA A;  3M9O B;  3V6H A;  2VA3 A;  1S0O A;  5HRG A;  1UT5 A;  4KLD A;  5KFG A;  4EZ6 A;  4S3N A;  4ED2 A;  3OVS A;  5III A;  5KFW A;  2IHM A;  4KLT A;  2P6U A;  4PH5 A;  1DGS A;  1JX4 A;  4NM2 A;  3GIJ A;  1KSP A;  4ZH4 A;  2M9N A;  1Z3E B;  4Z6D A;  3RH4 A;  3HIY A;  5HMM A;  1BPE A;  1MIV A;  4DSF A;  2BCR A;  4I2I A;  4QZE A;  2HHQ A;  5DEC A;  1SL1 A;  8ICS A;  3M8S A;  4WC6 A;  5DB7 A;  2R8G A;  1ZQI A;  2H5X A;  1ZQO A;  3IHQ B;  3WFO A;  4O3O A;  4QWE A;  2DPI A;  4DFM A;  3PX6 A;  3PW2 A;  1SL0 A;  4I2F A;  4KTQ A;  4DOB A;  2FMS A;  1NK0 A;  4QZC A;  5J0Q A;  5J0S A;  4DSL A;  3N4M B;  3Q8M A;  2AQ0 A;  9ICS A;  2PBE A;  4EYI B;  3AU6 A;  5KT5 A;  2XGQ A;  3H8S A;  7ICI A;  2ZH1 A;  4ED8 A;  4UD5 A;  5BOL A;  1SL2 A;  1BVS A;  4RNM A;  2JEJ A;  3RB6 A;  2HHV A;  3M9N B;  4RUC A;  8ICP A;  5DB6 A;  1LB2 B;  4BWJ A;  2XY5 A;  3OUY A;  3T5J A;  4DEZ A;  3UQ0 A;  3GIL A;  3HJ4 A;  4LT6 A;  1CUK A;  4RQ2 A;  4DS5 A;  3PR4 A;  3ZDB A;  2IA6 A;  2XC9 A;  4RQ3 A;  3JPN A;  4F4Z A;  3QEA Z;  1CEZ A;  3ZD9 A;  4WC0 A;  9ICQ A;  4KLH A;  5L1J A;  4RQ5 A;  3RR7 A;  4YD2 A;  8ICK A;  4WBZ A;  5D49 A;  4EYH B;  3C23 A;  4F50 A;  4RWN A;  2KZZ A;  2ZH3 A;  3KHL A;  3TAP A;  1QSY A;  5J0X A;  4KMU A;  4MF8 A;  3AQL A;  5KG0 A;  3SV3 A;  3C5F A;  4F5P A;  3QEB Z;  2FLP A;  1ZQG A;  7ICN A;  9ICX A;  4Z6F A;  2UVU A;  2DR9 A;  1TFW A;  5J2A A;  3RH5 A;  1RZT A;  5D46 A;  5J0Y A;  4ECR A;  2PFQ A;  2IHN A;  8ICC A;  2DRA A;  5KG4 A;  3EWA A;  1BPX A;  1ZQN A;  1ZQS A;  1ZJM A;  4LZG A;  2UVV A;  4B9V A;  4ECS A;  2AGQ A;  2NRT A;  1TV9 A;  1NK9 A;  4I2D A;  4DLE A;  4FS2 A;  5KFO A;  5KG5 A;  4F5N A;  2ATL A;  1S9F A;  2BPC A;  1XSP A;  3OVA A;  4XUS A;  5J2F A;  2XCP A;  1NKE A;  3RJK A;  4UD4 A;  4F92 B;  2Y1J A;  4I2E A;  5DKW A;  1KFD A;  3AUO A;  1LV5 A;  4MFF A;  4DL7 A;  4X4P A;  2KFN A;  2R8I A;  5DBC A;  4RNN A;  5L1I A;  4X4S A;  1L3S A;  3JYY A;  4DF8 A;  4F5O A;  3MR3 A;  1SZP A;  1C7Y A;  3RAX A;  5KT6 A;  4J9N A;  1KLN A;  3RAQ A;  1XSL A;  5DGA A;  3PO5 A;  4B9T A;  4FH3 A;  5HP4 A;  9ICV A;  4DL3 A;  2HHT A;  3PVX A;  2IMW P;  3RR8 A;  9ICK A;  2PI4 A;  3NTU A;  4YVZ A;  4RUA A;  2ZTD A;  3PMN A;  3C2L A;  4KLF A;  4M6W B;  2B21 A;  5DG7 A;  4BXO B;  4GC7 A;  3RB0 A;  1JXL A;  3EW9 A;  4O3R A;  8ICZ A;  1Z00 B;  5J2C A;  3V7K A;  1ZQR A;  4E8F A;  3OVB A;  3C21 A;  1HUZ A;  2ISP A;  2ID1 A;  5EWG A;  1KFT A;  4UB2 A;  1SKW A;  1U4B A;  4DL2 A;  3UXN A;  1S0N A;  2IBK A;  5DG8 A;  4EBC A;  2J6U A;  4R8U A;  2FPM A;  3RBE A;  1ZQC A;  3KTQ A;  4DLG A;  4WCW A;  4DSE A;  5HRF A;  4DL4 A;  2BCS A;  4YMM A;  4F4Y A;  1NK4 A;  1S0M A;  2XO7 A;  4QWB A;  4DQP A;  4KN4 A;  1T7P A;  4NLK A;  4AT7 B;  4P2H A;  4I2C A;  2ZUB A;  5J0O A;  4EBD A;  4F4K A;  7ICF A;  5KFN A;  4QZD A;  7ICH A;  4QZF A;  1ZQJ A;  1XSN A;  4DO9 A;  2ASL A;  4B9U A;  4B9S A;  4RQ6 A;  3ETL A;  1PZN A;  3JPP A;  4IQV A;  4F5R A;  3T5H A;  1QSS A;  9ICG A;  2W9A A;  2HHP A;  1MC8 A;  3GII A;  5EWE A;  2BQ3 A;  7ICL A;  4X0B A;  4YG2 A;  3RH6 A;  4IRD A;  3KHR A;  1ZET A;  1KFS A;  3RJF A;  4RQ7 A;  5J2H A;  4DQS A;  1VFG A;  4YFK A;  4G3I A;  1UET A;  4EEY A;  2UVW A;  4ECZ A;  4F8R A;  2Q66 A;  5EWF A;  4QZI A;  3OHB A;  4AT9 B;  1NJZ A;  1DK3 A;  3H40 A;  2KZM A;  1U47 A;  3BQ0 A;  3GV7 B;  5KFF A;  5J0W A;  3G6V A;  2PXI A;  4P4M A;  4K4I A;  4Q8F A;  5KFD A;  2JEI A;  7ICP A;  2ZJA A;  4M04 A;  4NLG A;  1S0V A;  2Y1I A;  1WOT A;  3UXO A;  3Q8S B;  3QE9 Y;  4KIT B;  1ZQP A;  5CA7 A;  1UT8 A;  4DSK A;  1JXE A;  5DG9 A;  5HNK A;  3BJY A;  2W9C A;  2I9G A;  4YMO A;  4YQW A;  1FA0 A;  2HVH A;  2KP7 A;  2RDI A;  4EZ9 A;  5DED A;  1U9L A;  3RJJ A;  9ICR A;  4C8M A;  4M9H A;  4X0A A;  4PPX A;  4J9S A;  5J2K A;  1Y88 A;  7ICG A;  3C18 A;  5J29 A;  4WBY A;  2A1J A;  4RNO A;  3V7L A;  4UAZ A;  3B0X A;  4F2R A;  2J6S A;  1TAU A;  4FBU A;  4ATB A;  4DWI A;  4DL5 A;  4M9J A;  4TUP A;  5CR0 A;  1UEV A;  2AJQ A;  4PGQ A;  4TUS A;  1KEJ A;  3PW0 A;  4C8N A;  4ELV A;  7ICQ A;  2JZB B;  1BGX T;  3LDA A;  4PHA A;  4IRC A;  1NZP A;  1IXR A;  3BQ2 A;  8ICH A;  4IR9 A;  7ICM A;  7ICU A;  2W8K A;  4RQ0 A;  1R89 A;  5IIJ A;  4UAY A;  4ECW A;  5KFM A;  3HWT A;  3V6K A;  2FMQ A;  2ZTE A;  1NK5 A;  3L9D A;  1ZQZ A;  5J2I A;  5IIM A;  5HRE A;  1ZYQ A;  4I28 A;  4GXJ A;  5BOM A;  4JWN A;  4F91 B;  4KLE A;  3OV7 A;  3PML A;  4X5V A;  4KLL A;  2ASJ A;  4DQQ A;  5J2D A;  5EOZ A;  3H4B A;  2DR8 A;  4PGX A;  8ICI A;  3MGH A;  4F4X A;  1ZQE A;  3ZDD A;  3H7I A;  4KLS A;  4Q43 A;  5F2V O;  4YR0 A;  4ED0 A;  3AQK A;  4X4V A;  4UQG A;  3ISC A;  4JV1 A;  8ICX A;  3EYZ A;  1ZJN A;  3PR5 B;  4RQ8 A;  2WTF A;  3SI8 A;  3TQ1 A;  4DSI A;  4DOA A;  4E0D A;  1BPY A;  4O5C A;  1A77 A;  4WC1 A;  1QLN A;  5DLG A;  3RB4 A;  7ICK A;  5KFB A;  4RU9 A;  5HRK A;  1BPZ A;  5HRI A;  2W9B B;  1TFR A;  5DB9 A;  2JEF A;  4KLM A;  2O5A A;  1T4G A;  2ZH6 A;  4JV2 A;  4O5K A;  3JPR A;  2XY6 A;  2BPF A;  4AT8 B;  5IIN A;  3OHA A;  5HR9 A;  1NOM A;  4ED1 A;  1D8L A;  3JPQ A;  1UA0 A;  8ICM A;  5KG3 A;  3Q8L A;  3FYH A;  3T5K A;  9ICM A;  3V6J A;  2BCU A;  5KFH A;  1X9W A;  2HW3 A;  1BNO A;  4UB1 A;  4WC7 A;  9ICO A;  2AU0 A;  8ICF A;  4B9M A;  4FHW A;  4EBE A;  4UBC A;  2AGO A;  5CB1 A;  2VA2 A;  3RJH A;  4ELT A;  4BGD A;  3HPO A;  4C8L A;  4K4H A;  1NK7 A;  3C5G A;  1TK5 A;  4IQT A;  5KFK A;  4EBJ A;  4X4N A;  3UXP A;  1U45 A;  5KFQ A;  2PFO A;  3JPS A;  4DFK A;  3RBD A;  3UPQ A;  2V9W A;  1KNY A;  4J9K A;  4UB4 A;  4M2Y A;  8ICW A;  2P66 A;  3Q8R B;  8ICG A;  1V4A A;  9ICC A;  4FO6 A;  4ED7 A;  3OSN A;  3MDA A;  2C2R A;  2NRV A;  3HW8 A;  1NJX A;  3EPG A;  2NRK A;  2NRW A;  3NYB A;  3JPO A;  8ICJ A;  4ELU A;  1NKC A;  2JEG A;  3C1Y A;  3MR5 A;  1X2I A;  1NKB A;  1A76 A;  4F2S A;  4QZ8 A;  2BE3 A;  1HJP A;  4RPY A;  3Q8K A;  4WC2 A;  1L3T A;  1N56 A;  1JMS A;  4FBT A;  9ICA A;  1XS9 D;  3K75 D;  1ZQH A;  2DVI A;  4QWA A;  3NGD A;  1TK8 A;  1NK6 A;  2ALZ A;  2KFZ A;  2ZUD A;  4O3P A;  4ECX A;  2BCQ A;  2ZH5 A;  1QSL A;  1JQR A;  4KLJ A;  5HC9 A;  5KG1 A;  4J9R A;  1R8B A;  4ED6 A;  4UBB A;  4NLN A;  1L3V A;  3RTV A;  3OSP A;  1Q78 A;  4DL6 A;  1JN3 A;  3KHH A;  3M9M B;  3H4D A;  1RYS A;  5HRD A;  4RWQ A;  4X4O A;  2DRB A;  4J9Q A;  1L3U A;  3AQM A;  2BGW A;  2HHS A;  4NXZ A;  4WC4 A;  4YD1 A;  5F9L A;  1RYR A;  9ICB A;  3GV5 B;  4FHV A;  2DFL A;  1DOQ A;  5DLF A;  8ICL A;  2R8J A;  4PHP A;  3PNC A;  2FMP A;  5J2B A;  4P4P A;  3HT3 A;  5KT4 A;  4XRH A;  3N97 B;  1DK2 A;  5HRL A;  3ISD A;  4DS4 A;  3RJG A;  7ICO A;  1T8E A;  4M47 A;  3Q8Q B;  4I2G A;  5DQI A;  3MBY A;  3TFS A;  4O5E A;  3FDS A;  4RQ4 A;  3C2K A;  5HHI A;  4I2J A;  1RXW A;  4KLG A;  1EXN A;  4LZD A;  9ICH A;  2M2V A;  5CJ7 A;  3PY8 A;  4B9L A;  4FHX A;  4O3N A;  1D9F A;  8ICU A;  4GLX A;  4RPZ A;  3H37 A;  5KFV A;  4ECY A;  2ZJ8 A;  4EBK A;  3TAR A;  5CWR A;  1D9D A;  3G6X A;  5KFL A;  4PHD A;  3OGU A;  4WC5 A;  4X4R A;  2W9M A;  4YR3 A;  2C22 A;  4RT2 A;  5KFI A;  2DR7 A;  9ICP A;  4GXI A;  4Z6E A;  2FPK A;  4F5Q A;  2VA8 A;  4FHP A;  3GIK A;  3UQ2 A;  8ICB A;  1S10 A;  2GWS A;  2F1H A;  2ZJ5 A;  3PO4 A;  2M2U A;  2M2T A;  3WFS C;  3TFR A;  4MFC A;  2PI5 A;  4X4Q A;  2MUT A;  1ZQA A;  4M6W A;  5J0T A;  4GC6 A;  2BKE A;  4Q45 A;  4BXO A;  7ICJ A;  4QZH A;  3WFR E;  4CCH A;  1Z00 A;  2Q0Z X;  3ORY A;  3JPT A;  5L1K A;  2FLN A;  4M9L A;  4YP3 A;  1BPB A;  3MFI A;  5DDM A;  4MEX A;  1OU5 A;  2F1I A;  1RXV A;  1U49 A;  4YCX A;  4YR2 A;  4O9M A;  2HVI A;  5TZV A;  3RRH A;  1MQ2 A;  3GIM A;  3TAN A;  3B0Y A;  4WC3 A;  3JZ0 A;  1K1Q A;  4QWD A;  2ZHB A;  4F93 B;  4LVS A;  4AT7 A;  4TQR A;  2ZTC A;  1N48 A;  3MFH A;  4QWC A;  4DOC A;  4J9L A;  4JWM A;  2ASD A;  3OUY B;  3AU2 A;  4YMN A;  2O1P A;  4ED3 A;  1H38 A;  4DSJ A;  3LK9 A;  4NY8 A;  1IM4 A;  7ICV A;  4PGY A;  4M9G A;  3PW7 A;  3WFP A;  1ZQX A;  1XU4 A;  5KT2 A;  4IR1 A;  4DFP A;  4MEY A;  8ICT A;  2M2W A;  8ICV A;  2PFP A;  3MGI A;  3GQC A;  9ICL A;  9ICW A;  4RZR A;  3QZ7 A;  2BR0 A;  1D8Y A;  9ICJ A;  4FHY A;  3K4G A;  2DR5 A;  3HP6 A;  3MR6 A;  4AT9 A;  1ZQT A;  4C8O A;  8ICE A;  1BNP A;  4JK1 A;  5HML A;  5KG7 A;  5KT3 A;  4NKU A;  3C1Z A;  5JUM A;  2ZH2 A;  1MSW D;  2R8H A;  4ECQ A;  5KFY A;  4ECU A;  4JUZ A;  3ZDC A;  2HHW A;  4KN7 A;  2AQ4 A;  2RFF A;  8ICY A;  9ICT A;  5HRH A;  4M5D A;  1MIY A;  4MF2 A;  7ICE A;  7ICR A;  3BDP A;  5CP2 A;  4BWM A;  5KFR A;  4PHE A;  4NM1 A;  1XWL A;  5KFX A;  4O0I A;  3PW5 A;  3TAQ A;  1V9P A;  4E80 A;  2C28 A;  1S97 A;  1R8A A;  4FS1 A;  3H39 A;  4DFJ A;  1UEU A;  3RRG A;  3GDX A;  3RJE A;  1X9S A;  3WFQ E;  3V7J A;  2C2D A;  5IIK A;  4YXM A;  3RJI A;  2BQU A;  1TVA A;  9ICU A;  2V4Q A;  3HX0 A;  1PX5 A;  1JAJ A;  3BQT A;  1T3N A;  2XCA A;  5KFU A;  1ZQW A;  1MQ3 A;  2W8L A;  2ISO A;  2DPJ A;  2JZB A;  2OWO A;  2KZ3 A;  2XGP A;  2UVR A;  4RPX A;  4GXK A;  1ARO P;  3SYZ A;  4I2H A;  5DQH A;  2BQR A;  4QW8 A;  5BPC A;  1F5A A;  8ICO A;  3BQ1 A;  3OJS A;  3C2M A;  5HRB A;  3H8J A;  4R8U B;  4RQ1 A;  1TK0 A;  3ISB A;  8ICN A;  1VJ7 A;  5L1L A;  4C8K A;  4IRK A;  4O3S A;  5KFJ A;  3C66 A;  1ZQK A;  8ICA A;  1ZQQ A;  5KTQ A;  1UA1 A;  4P4O A;  5J0U A;  4QW9 A;  3ZDA A;  4Q44 A;  4DQI A;  7ICS A;  4FH5 A;  3EZ5 A;  4EP7 A;  5C5J A;  2J6T A;  3LWM A;  4QZG A;  5KFT A;  9ICE A;  3MR2 A;  4KLO A;  3T3F A;  4UAW A;  4J9M A;  4NLZ A;  9ICF A;  5KFC A;  2BCV A;  3H38 A;  4TUQ A;  2NRZ A;  3M8R A;  2FLL A;  5J2J A;  3SZ2 A;  1WCL A;  5DBA A;  5J2E A;  2KN7 A;  1ZQD A;  3V72 A;  1XC9 A;  5KFA A;  2PFN A;  4QZ9 A;  4R66 A;  4I2A A;  3LQC B;  1TFY A;  4X4U A;  1ZQU A;  4M0A A;  2W9B A;  1ZQY A;  3IM1 A;  1S76 D;  4B9N A;  4UB3 A;  2LYH A;  3HJ1 A;  5J0R A;  4AT8 A;  3E2E A;  4R64 A;  3OJU A;  1NO5 A;  2ZH7 A;  3Q8P B;  2HHU A;  4DF4 A;  1WCN A;  3UPS A;  2MAX A;  1S77 D;  4RWP A;  3ZDE A;  2ZH4 A;  1B43 A;  1COO A;  4F4W A;  1ZQM A;  4YN4 A;  3LWL A;  1ZQV A;  4O3Q A;  1L5U A;  1K1S A;  2FPL A;  5IIL A;  1NJY A;  1ZQL A;  4I29 A;  3H3A A;  1KTQ A;  4XQ7 A;  1SKS A;  2MUT B;  5J2G A;  1ZQB A;  4ECT A;  9ICN A;  2W9C B;  2ZHA A;  4IQU A;  3SV4 A;  2P6R A;  3PX4 A;  5DB8 A;  4I27 A;  5CHG A;  2KTQ A;  2V4R A;  3THV A;  4RWO A;  5DDY A;  4I2B A;  1Q79 A;  1U48 A;  3PW4 A;  5KG2 A;  4YXJ A;  9ICI A;  5KFP A;  1BPD A;  2F1J A;  3GFK B;  2A1J B;  4ECV A;  1SKR A;  2C2E A;  1JIH A;  1HUO A;  1QTM A;  2BHN A;  2BDP A;  4BDP A;  4ATB B;  3TI0 A;  3QZ8 A;  1X9M A;  5KFS A;  5F9N A;  1ZQF A;  1R8C A;  5KT7 A;  3T5L A;  5DQG A;  2XY7 A;  7ICT A;  4Z6C A;  3MAB A;  2NRX A;  2RDJ A;  8ICQ A;  1MIW A;  2ZH9 A;  3H8W A;  1NK8 A;  2BPG A;  3KHG A;  4HYK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...