4YN4A

Structure of human dna polymerase beta complexed with n7bg in the template opposite to incoming non-hydrolyzable dttp with manganese in the active site
Total Genus 105
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
105
sequence length
329
structure length
327
Chain Sequence
b'PQETLNGGITDMLTELANFEKNVSQAIHKYNAYRKAASVIAKYPHKIKSGAEAKKLPGVGTKIAEKIDEFLATGKLRKLEKIRQDDTSSSINFLTRVSGIGPSAARKFVDEGIKTLEDLRKNEDKLNHHQRIGLKYFGDFEKRIPREEMLQMQDIVLNEVKKVDSEYIATVCGSFRRGAESSGDMDVLLTHPSFTSESQPKLLHQVVEQLQKVHFITDTLSKGETKFMGVCQLPSKNDEKEYPHRRIDIRLIPKDQYYCGVLYFTGSDIFNKNMRAHALEKGFTINEYTIRPLGVTGVAGEPLPVDSEKDIFDYIQWKYREPKDRSE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA polymerase beta
publication title Structural and kinetic studies of the effect of guanine-N7 alkylation and metal cofactors on DNA replication.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase/dna
total genus 105
structure length 327
sequence length 329
ec nomenclature ec 2.7.7.7: DNA-directed DNA polymerase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF10391 DNA_pol_lambd_f Fingers domain of DNA polymerase lambda
A PF14716 HHH_8 Helix-hairpin-helix domain
A PF14791 DNA_pol_B_thumb DNA polymerase beta thumb
A PF14792 DNA_pol_B_palm DNA polymerase beta palm
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.150.20 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 5' to 3' exonuclease, C-terminal subdomain 4yn4A02
1.10.150.110 Mainly Alpha Orthogonal Bundle DNA polymerase; domain 1 DNA polymerase beta, N-terminal domain-like 4yn4A01
3.30.210.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 3 DNA polymerase, thumb domain 4yn4A04
3.30.460.10 Alpha Beta 2-Layer Sandwich Beta Polymerase; domain 2 Beta Polymerase, domain 2 4yn4A03
5J0QA 8ICRA 4MF8A 3OJSA 4ELUA 4RT3A 4O5CA 2NRKA 1OU5A 4I2JA 1UA1A 4KITB 4DFPA 4YXMA 7ICSA 3H8SA 4ECVA 3V6KA 1LV5A 4IQTA 5J2DA 3MR3A 5L9XA 3M9NB 2BPFA 3RJJA 1CEZA 1U4BA 1MIVA 5KFLA 3HJ1A 3GDXA 3C21A 3OHBA 3JPTA 3RJKA 2PI4A 1XO1A 3Q8LA 3ZDDA 3MGHA 3PW4A 1B22A 4TUSA 4E7XA 3WFPA 4X4RA 8ICYA 2DR7A 5KT3A 2HHQA 3H4BA 4I2CA 3V7LA 2KZZA 1TAQA 4ED0A 1KNYA 3OGUA 1MIYA 2XGQA 3TQ1A 3PW2A 2PI5A 5KFVA 3H8JA 5CB1A 3KTQA 2NRXA 5KFQA 3OHAA 3C2KA 2ASJA 2DPIA 5D4BA 1WCNA 2F1JA 5KT4A 8ICAA 9ICSA 3Q8MA 2FLNA 1XWLA 1JAJA 5J2BA 2AJQA 3EW9A 2ISPA 5KG3A 7ICUA 5CHGA 2MUTB 1NKBA 1BPDA 4KLGA 4QZGA 3EYZA 4R65A 3BQ1A 1D8YA 4QW8A 4LVSA 4DOBA 3OVBA 2V4RA 2UVRA 3OSNA 3H4DA 3PO4A 7ICJA 4Z6FA 5KFOA 5DBAA 4Q8EA 3C5FA 3TFRA 2Y1IA 1TKDA 4YMNA 1MSWD 1JN3A 2F1IA 5J0PA 1ZQWA 4TQRA 5J2HA 3FYHA 8ICUA 4UB4A 3JPPA 4F5NA 7ICKA 4M5DA 1DGSA 5IIOA 9ICLA 7ICTA 4WC5A 2PXIA 5CR0A 4I29A 4M0AA 1NKEA 1R8AA 4M9LA 2ZH2A 2MUTA 5D46A 3C1ZA 5CP2A 2DPJA 4ED2A 4R8UA 5J0UA 4F4KA 3LQCB 3PMLA 3UQ0A 3AQNA 4Z6CA 3GILA 4NM1A 5DDYA 3HWTA 8ICLA 2MAXA 2C2EA 4EYIB 5J2JA 3TAQA 4UD5A 2V4QA 4EP7A 2HHWA 7ICNA 2ZH1A 1A77A 4M04A 4YP3A 1TAUA 8ICNA 2FLLA 8ICIA 4EZ6A 3C1YA 5IIJA 4QZIA 1SL1A 4FHVA 4UAWA 1KTQA 4IQWA 2Y1JA 8ICWA 4XQ7A 2I9GA 4FHYA 4QZAA 4RWPA 5DDMA 1T4GA 3MFHA 1JIHA 5KFBA 1X2IA 4ECXA 4Q44A 2BQ3A 4O3SA 4YMOA 2FLPA 4FBUA 4DL3A 4C8KA 3L9DA 4NKTA 1T8EA 1ZQNA 5KFEA 3ISCA 3EWAA 3JPNA 4E0DA 2FMPA 4KLQA 4O3RA 5KG5A 2M2VA 3UQ2A 2DR5A 4RQ4A 4O3NA 3NYBA 4NLNA 4XRHA 1NJYA 5KFHA 3GV8B 5J0TA 4DL4A 4C8LA 2A1JA 4KN7A 5EWEA 4YR0A 4KLMA 4J9MA 5J0YA 4UBBA 1BPEA 2NRZA 3RJGA 4PHEA 1S0NA 2HHSA 2KFZA 4MEYA 1Q78A 1S0OA 1TFYA 2ZTEA 3IM1A 3N4MB 1RYRA 5KFPA 5HHHA 3QE9Y 1KRPA 3Q8KA 5L1IA 4B9SA 3PNCA 4ED3A 4J9RA 1X9SA 2P66A 4WC4A 2DRBA 2KFNA 1ZQHA 4J9SA 3PO5A 2BCSA 4DSLA 4DSKA 3M9MB 2XCAA 4M6WB 3T5HA 4K4IA 2HHXA 1U45A 5DG8A 5JUMA 2WTFA 2UVVA 2DR9A 3ZD8A 1RZTA 4EZ9A 3K4GA 3IHQB 5KFSA 2ZTDA 1BPZA 2ZUCA 2AGOA 4ATBB 3PVXA 1X9WA 1ZQQA 4XA5A 4J9OA 4ED7A 4TUQA 3ZDAA 4JWNA 1AROP 1TFRA 2RDJA 4M9JA 4O9MA 4RWQA 1TFWA 4ECQA 1ZQCA 4ECRA 9ICHA 3EPGA 5KFJA 4YD1A 4RQ5A 4E8FA 1ZETA 1ZQZA 4RQ0A 4ECYA 4I2IA 5KFWA 3SYZA 3KHGA 4P2HA 4M6WA 5KG1A 4YFKA 1H38A 4M47A 3PW0A 2JEGA 2VANA 9ICWA 4CCHA 3AU6A 5J2EA 3MFIA 1TV9A 3B0YA 3C2LA 4X0AA 4IR9A 3ZDEA 4IR1A 4ATBA 5KFTA 4FHPA 4QZBA 3RH6A 3RRGA 1TK5A 3G6YA 1UEUA 4X4PA 5J0WA 4UBCA 5HP4A 3PMNA 3RJFA 5KFRA 1QSSA 4K4GA 1D9DA 4IG8A 1BNPA 5L1KA 1ZQIA 4DWIA 3BQ2A 2PFPA 5HRDA 1MQ3A 3QZ7A 4PHAA 3V7KA 4J9QA 2AGQA 1DK2A 2FPLA 1XC9A 5DGAA 3MDCA 2BPGA 3SV4A 2BDPA 4M9HA 4Q8FA 5DEDA 5HR9A 1NOMA 8ICGA 3SV3A 4J9PA 5DB6A 1ZQRA 1U47A 2ZH6A 2DFLA 4ECTA 4DF4A 4I2GA 1ZQOA 4FO6A 4IRDA 1XS9D 9ICKA 4QWBA 2ASDA 3MGIA 5CWRA 4Z6DA 5HRHA 4ED1A 4X5VA 3KHLA 1L3VA 3RB6A 3HIYA 3PX4A 5BPCA 1NK7A 4DO9A 1XSNA 5HRBA 1Q79A 3MR2A 3V6JA 3ISBA 5KFXA 3RR7A 1RPLA 2XC9A 2HVIA 5HRLA 2BE3A 4WC7A 4NXZA 1SKRA 4PH5A 5HRGA 4DQIA 5KG0A 4YG2A 4JV2A 3C18A 3N97B 3RRHA 9ICXA 4FH3A 2ZJ8A 4F5QA 4KLEA 4IQUA 4O0IA 4R8UB 4TURA 4YR3A 2DRAA 5BOLA 4EEYA 1ZQKA 5DB8A 5J2KA 3JPRA 1T7PA 4F91B 4YMMA 1KSPA 3OVAA 4C8NA 4DFJA 4I28A 2JZBB 5F9LA 5EWFA 3G6VA 4I2EA 3G6XA 9ICOA 3AQKA 4YD2A 2R8JA 3WFQE 1XSPA 4J9NA 1QSYA 4E80A 2JEJA 9ICVA 2RFFA 3RBDA 4FBTA 4ED8A 2R8IA 4QZCA 4JV0A 1ZQBA 2BCUA 4GXKA 3TAPA 4DSIA 1R89A 3M8RA 4QWDA 3UXPA 4BXOB 2ASLA 2C28A 2Q66A 2ID1A 3GFKB 4RPYA 2XGPA 2W9CB 4WC0A 3ZD9A 5HREA 1NK5A 1BVSA 5DQIA 7ICVA 4LT6A 7ICMA 3EPIA 3PV8A 4F2SA 2JZBA 2JEIA 1TVAA 3JPSA 4F4ZA 1NK9A 1N48A 1ZQMA 3V72A 4P4MA 3SI8A 5KFCA 5J0OA 4DQQA 4RU9A 2C2RA 3OV7A 2XO7A 4LZDA 2A1JB 1ZQAA 3ZDBA 4FHWA 1NJZA 1Z00A 4UD4A 9ICPA 2HHVA 1NJWA 2HW3A 4QWEA 4EBJA 2ZHAA 4BXOA 5HRIA 4KLSA 2R8KA 2PBEA 2W9BB 4RUAA 5DQHA 3GIIA 5KTQA 2W9CA 4EBCA 2AQ0A 2H5XA 2V9WA 4KTQA 4KLLA 7ICIA 3UXNA 9ICFA 4DL6A 3MABA 3NTUA 4YN4A 1RXVA 4UB1A 7ICGA 4GXJA 8ICSA 3LK9A 1JXEA 1JXLA 4M2YA 4X4QA 8ICZA 1U49A 9ICMA 3JPOA 7ICPA 4AT7A 1A76A 4QW9A 1X9MA 1S77D 9ICQA 1C7YA 2XCPA 4DOAA 4IRKA 5KFAA 1QSLA 3H37A 4KLOA 3M8SA 4DLEA 3LDAA 5HMMA 2Q0ZX 2W9BA 3KHHA 3TFSA 1SL2A 5J2IA 4PPXA 5HRKA 2ZH4A 5J2AA 4RPZA 1NJXA 3C5GA 1BNOA 1JQRA 2IHNA 4KLIA 2M2WA 4I2DA 2W8LA 5L1JA 1ZQEA 1WOTA 1KDHA 1ZQUA 4WCWA 4RQ7A 1KFSA 4PHDA 3MBYA 1U48A 4O3OA 5IIMA 4QWAA 4R66A 2ZH7A 1MC8A 4I2HA 5BOMA 2KN7A 8ICEA 9ICJA 3AUOA 2DR8A 4UB3A 4DL5A 1T3NA 2ZH8A 1UT5A 8ICTA 4BWMA 3T5JA 5J0SA 3OUYA 4RQ6A 3E2EA 4XUSA 3H38A 3T5KA 2M2TA 8ICCA 1D9FA 2AQ4A 4RWOA 1VJ7A 8ICBA 4F50A 4RNOA 2R8GA 8ICJA 1BGXT 3PW7A 4IRCA 5J0RA 4EBEA 7ICLA 2J6SA 5KFGA 2ATLA 1S9FA 3RB3A 4ECWA 5IIIA 3QZ8A 4KLJA 4YR2A 4QZ8A 8ICOA 4EYHB 2O5AA 5IILA 2J6TA 5KFNA 4I27A 3RB0A 4MFFA 1NO5A 3V7JA 2BHNA 2BQUA 1KFDA 3BQTA 3H39A 4DFKA 1PX5A 9ICNA 4WC6A 3M9OB 4M9NA 2ALZA 1S0MA 4KLFA 8ICXA 2O1PA 9ICRA 2LYHA 5KFKA 3TI0A 1NKCA 7ICEA 4EBKA 4FHXA 4X4TA 1K1QA 5HHIA 1ZQLA 5DBCA 3JZ0A 4X4VA 5CJ7A 4ECUA 1Z3EB 4UB5A 4PGXA 4DQSA 4AT8A 3WFSC 5KG2A 1UA0A 3RH4A 1NK8A 1COOA 3OJUA 1V4AA 3Q8SB 4F93B 4TQSA 4FS1A 4RUCA 2HHTA 4RNMA 3MDAA 4KLTA 3QEAZ 5DG7A 3GIMA 4J9KA 5HNKA 3HW8A 1U9LA 5F9NA 1NK0A 4F3OA 3BQ0A 4F4WA 3UPQA 1FA0A 4PGQA 2ISOA 4S3NA 4B9VA 2VA2A 5EWGA 1L5UA 3RAQA 4GC6A 4K4HA 1HUZA 5DLGA 2NRTA 4G3IA 2GWSA 5L1LA 2OWOA 2P6RA 4O5EA 4NLKA 4PHPA 4TUPA 3ISDA 2M2UA 3PX6A 3WFRE 2RDIA 2IBKA 1ZQTA 2IMWP 3ORYA 1DK3A 5KT7A 4QZDA 3T3FA 4P4PA 4JV1A 3H3AA 3GIKA 2ZH3A 2I1QA 5IINA 4YQWA 1ZQYA 2VA3A 4J9LA 5KFYA 4B9MA 8ICHA 9ICCA 4GLXA 4DQRA 1L3TA 2IHMA 1VFGA 4MEXA 2DVIA 1BPBA 3PR5B 9ICUA 1KLNA 3AQMA 2XY5A 1UEVA 4I2BA 1ZQDA 4B9LA 8ICFA 3MR6A 3PR4A 2W8KA 4RQ3A 3LWMA 7ICQA 2VA8A 1L3UA 8ICPA 4AT9B 3RJEA 4YCXA 4LZGA 4FH5A 1NK4A 4PGYA 2FMQA 9ICAA 4ZH4A 5DB9A 5KT6A 1Z00B 9ICTA 1R8BA 3C2MA 1S76D 3RJHA 1ZQJA 5J29A 5DB7A 1ZJMA 1S0VA 4RT2A 3HJ4A 2HHPA 2ZHBA 1ZQSA 1JMSA 4YVZA 1S97A 4WC1A 4X4UA 4F2RA 8ICQA 5KFZA 3RB4A 1V9PA 7ICOA 2IA6A 5KT2A 4YXJA 4P4OA 4QZFA 1RXWA 4KLHA 8ICMA 4AT9A 1JX4A 2HVHA 3C23A 4JWMA 1F5AA 4AT7B 2KZMA 5J2GA 4WBYA 3JPQA 4JK1A 4GC7A 1ZQPA 4MF2A 3Q8QB 4NY8A 4RQ8A 7ICRA 1UT8A 4HYKA 4X4SA 4KMUA 4JUZA 3ZDCA 5F2VO 4QZEA 4F4XA 4WC2A 1L3SA 2PFOA 3H8WA 4WC3A 4KN4A 3PW5A 1K1SA 5EOZA 9ICEA 3RH5A 4M9GA 4Q43A 3PX0A 3K75D 1IXRA 5DG9A 5KG4A 4QZ9A 3GV5B 4ECZA 5KG7A 4B9TA 2ZTCA 4WBZA 3BJYA 1PZNA 1ZQXA 4ECSA 2ZJAA 4DOCA 4DS4A 4DLGA 4DL2A 1ZQGA 3FDSA 1Y88A 1CUKA 3GIJA 8ICKA 3C66A 4FS2A 3B0XA 4F5PA 1SL0A 3OUYB 2AU0A 3V6HA 4EBDA 3RJIA 3NGDA 1BPXA 3KHRA 5DKWA 5J2CA 2UVWA 4ELTA 2KTQA 2ZH5A 4R63A 4DQPA 7ICHA 9ICIA 3OVSA 4GXIA 4DS5A 1ZQVA 2BQRA 1EXNA 3H7IA 4KLDA 2XY7A 1KFTA 4I2AA 3EZ5A 2BCVA 1D8LA 2M9NA 5KFFA 2BGWA 4X0BA 1NK6A 5KFDA 4BWJA 4MFCA 4RWNA 3GQCA 3QEBZ 4X4OA 2XY6A 1SZPA 2C2DA 2J6UA 2PFNA 3RBEA 5KT5A 4MFAA 4DSEA 1UETA 4F4YA 4F5OA 3UPSA 4NLGA 2BR0A 2P6UA 1SKWA 2JEFA 9ICBA 4UAZA 4ELVA 3RR8A 4R64A 4ED6A 4RNNA 4O3PA 4QZHA 2AGPA 5HRFA 1TK8A 4C8OA 3LWLA 2BKEA 5KFMA 1S10A 4Z6EA 3HX0A 1SKSA 3Q8PB 1ZYQA 4BDPA 8ICVA 2HHUA 4RPXA 4F92B 5DBBA 4AT8B 3THVA 5J0XA 1QLNA 3JYYA 4B9NA 5KG6A 1MIWA 7ICFA 4QWCA 3HP6A 4KLUA 1YLQA 3AQLA 4DF8A 1KEJA 1RYSA 2B21A 5DLFA 3Q8RB 3TARA 2FPMA 1B43A 3HPOA 4UQGA 3ETLA 4I2FA 1R8CA 4O3QA 3MR5A 4B9UA 4RZRA 5D49A 4NM2A 4BGDA 4RQ1A 4F5RA 3UXOA 2FMSA 2KP7A 1XSLA 2W9MA 3TANA 3RAXA 4Q45A 4UB2A 3BDPA 5DGBA 4O5KA 1LB2B 4NLZA 5HC9A 5DECA 1ZQFA 1BPYA 3AU2A 1QTMA 9ICGA 2NRVA 1WCLA 4RQ2A 4XQ8A 1HJPA 2ZUBA 2FPKA 5J2FA 2KZ3A 1MQ2A 2BCRA 3SZ2A 1TK0A 4UAYA 3PY8A 1ZJNA 2BCQA 1HUOA 4C8MA 2UVUA 4F8RA 1DOQA 1NZPA 4DEZA 5KFIA 1IM4A 4DSJA 5HMLA 2C22A 3WFOA 4NKUA 4X4NA 1N56A 1XU4A 5KFUA 2NRWA 3H40A 5CA7A 2BPCA 5DQGA 4DSFA 3T5LA 2ZH9A 5IIKA 5TZVA 5C5JA 3GV7B 3OSPA 2PFQA 3HT3A 4DFMA 2ZUDA 4DL7A 4IQVA 2W9AA 2ZJ5A 2R8HA 2F1HA 3RTVA
chains in the Genus database with same CATH superfamily
3QUBA 4ELUA 4RT3A 1SWVA 5AIBA 2H3VA 4YXMA 1CEZA 2BPFA 3M9NB 4UW9A 2Y9UA 3OHBA 3JPTA 3RJKA 2Y0SF 3ZDDA 3WFPA 3HJEA 2BDUA 5KT3A 3EF2A 4I2CA 5ALLA 2KZZA 1TAQA 4ED0A 2F2AB 1V38A 3KTQA 2NRXA 3TACB 5KFQA 2ASJA 4BUGA 2AJQA 5AKYA 2YN4A 3NWIA 1DRGA 3EYZA 2EAOA 4LVSA 3VC8A 3ED5A 5AI4A 8ICUA 1T94A 4M5DA 1DGSA 9ICLA 4WC5A 4I29A 1NKEA 4NXVA 5D46A 3C1ZA 4ED2A 3ICXA 3HWTA 4EP7A 2HHWA 4XJEA 1A77A 4YP3A 2FDRA 3C28A 2Y1JA 3DV9A 2I9GA 3KZXA 5DDMA 1T4GA 3U26A 1SWWA 2BQ3A 4ECXA 4Q44A 2FLPA 3L9DA 1T8EA 4EX7A 3NYBA 4XRHA 3NVWA 3SD7A 2A1JA 3PHZA 4KB6A 4J9MA 4O68A 4PHEA 4EEDA 4MEYA 1RYRA 4ED3A 2Q4TA 2A19A 3E58A 1ZRNA 5AHXA 3WKAA 5ALEA 2KFNA 1QQ6A 1ZQHA 4J9SA 2FCLA 5AM4A 3M9MB 3NVOA 2H3FA 1U45A 5DG8A 3MC1A 3K4GA 1BPZA 2ZTDA 4LEZA 2W11A 2AGOA 1T3QA 4XA5A 4O9MA 4TUQA 4RWQA 4RQ5A 2N1RA 1ZQZA 4ECYA 1NZBA 4WQKA 5ALQA 2HBKA 2CRXA 5J2EA 1TV9A 3C2LA 4IR9A 4ATBA 5KFTA 3RH6A 3RRGA 1TK5A 1UEUA 4X4PA 1QSSA 1BNPA 5L1KA 1ZQIA 3BQ2A 5AI9A 3HKZC 1DK2A 2YY6A 5HR9A 1FFUA 4J9PA 1U47A 2DFLA 4DF4A 4CRXA 1OXJA 2R18A 2ZIXA 9ICKA 2QB0A 4ED1A 3KHLA 4NXTA 1L3VA 3RB6A 1SV4A 5BPCA 1YZ7A 4DO9A 5HRBA 4I0UA 1ZD5A 5JTIA 1RPLA 4O67A 4EX6A 4WC7A 3NRWA 4NXZA 4PH5A 5HRGA 3I76A 3WKCA 4JV2A 3C18A 4GIBA 3OTQA 9ICXA 4FH3A 4F5QA 4IQUA 4TURA 2DRAA 5DB8A 1A6SA 2D6FC 2JZBB 5F9LA 3G6XA 1RQNA 4FBTA 4GXKA 2JHDA 4K9AA 4JLXA 2Q66A 2OXOA 4WC0A 4WOYA 4NV0A 1BVSA 3UMCA 3SR6A 3JPSA 5JRTA 4F4ZA 4UD5A 4P4MA 2RLTA 1ZQAA 4UD4A 2HHVA 1NJWA 4Y2UA 2QLTA 4BXOA 2KEYA 4KLSA 2ZHAA 4EBCA 4KTQA 4LJXA 2V9WA 2AQ0A 9ICFA 3MABA 1RG6A 4C7YA 4GXJA 1O03A 7ICPA 2IUBA 4AT7A 4Y2TA 4F71A 2XCPA 4DOAA 4IRKA 1QSLA 5AM3A 5J8YC 3JCFA 3K1RB 5J2AA 4RPZA 1NJXA 3C5GA 5AKGA 5D63A 2M2WA 4I2DA 1WOTA 1KDHA 1N5XA 3H0MB 4QWAA 1MC8A 5BOMA 3AUOA 1T3NA 1N5WA 5J0SA 3E2EA 3N28A 2F8LA 2AQ4A 1VJ7A 4F50A 8ICJA 5D62A 3PW7A 1ZXIA 4EBEA 7ICLA 1KKXA 1TE2A 2KKPA 1S9FA 4ECWA 5ALOA 2G08A 3F2BA 4KLJA 8ICOA 4MFFA 1L7MA 4FZNA 3V7JA 2BHNA 2BQUA 4Y2JA 4AP9A 3MGVA 9ICRA 5ALYA 1NKCA 3ALRA 1K1QA 4X4VA 5ALDA 1Z3EB 4UB5A 2QARA 5KG2A 1V4AA 1X6IA 4FFDA 2KIWA 3NKUA 3QEAZ 5HNKA 2DKXA 3PSFA 4F3OA 4F4WA 4PGQA 2VA2A 3RAQA 1HUZA 3QU7A 2AHOB 4O5EA 2DBYA 2EDUA 1ZQTA 3IP4B 5KT7A 4P0PB 4JV1A 3H3AA 4OCZA 2I1QA 5IINA 4YQWA 1ZQYA 4FZLA 4J9LA 5CFSA 2OCEA 2RP5A 1VFGA 2IHMA 5KAFU 9ICUA 3NVYA 1ZQDA 2BBHA 2W8KA 2NYVA 2KICA 2W55A 3AN1A 3RJEA 1IIPA 4Y2QA 1NK4A 2FMQA 9ICTA 2W03A 1O08A 5J29A 4WH5A 1S0VA 2ZHBA 1JMSA 4YVZA 4NLBA 4F2RA 3RB4A 1V9PA 5KT2A 1RXWA 4AT9A 3C23A 4NXWA 2HDOA 4JUZA 1Z4NA 4WC2A 3CYMA 5AI0A 3KBBA 4JMUA 3H8WA 4KN4A 2GOLA 5EOZA 9ICEA 3RH5A 1MA7A 3K75D 3GV5B 1PZNA 4DOCA 3SENA 2FI1A 1ZQGA 3C66A 1Y88A 1CUKA 3GIJA 4FS2A 4C80A 3V6HA 4EBDA 3KHRA 1Q3VA 2WB1F 1N63A 5AI5A 2ZH5A 3OVSA 3WK4A 1J2MA 5AIAA 3EZ5A 4OAIZ 1D8LA 4K96A 5KFFA 2HMXA 4MFCA 4RWNA 3GQCA 3QEBZ 1SZPA 2J6UA 2K8AA 3RBEA 4F4YA 2BR0A 2B0CA 4N7RA 4ED6A 2YTUA 4QZHA 4FZMA 3KKAA 3LWLA 2YMQA 4Y2YA 1S10A 1SKSA 4RPXA 3O0FA 5J0XA 3QX7A 4KMOB 4CF4A 5KG6A 7ICFA 4QWCA 3AQLA 3TARA 2FPMA 5T14A 1B4FA 1SXEA 2H3IA 4WJ3B 3M1YA 4O3QA 4EGWA 4NM2A 4BGDA 4RQ1A 3UXOA 1XSLA 2KOBA 4Q45A 4NLZA 4O5KA 1LB2B 5HC9A 3F5EA 1QTMA 9ICGA 2VIXA 4XQ8A 4I2AA 3PY8A 4UAYA 2ZXHA 1DOQA 1IM4A 4X4NA 4NKUA 2ZH9A 4DSFA 5IIKA 4F72A 3HT3A 4DL7A 2W9AA 4TQSA 2ZJ5A 2W54A 5J0QA 2ZIVA 4MF8A 1OU5A 4I2JA 2Z7JA 4ECVA 1JROA 3V6KA 1LV5A 5J2DA 5L9XA 5KFLA 4USAA 2PI4A 2MRLA 3Q8LA 4E7XA 5ALRA 3H4BA 1MIYA 2XGQA 3TQ1A 3OHAA 3C2KA 5KT4A 9ICSA 1XWLA 4U6PA 1JAJA 5CHGA 1BPDA 2YMPA 4QZGA 4R65A 3I28A 2WHEA 2V4RA 2UVRA 3OSNA 3H4DA 7ICJA 5DBAA 4Q8EA 3C5FA 3TFRA 3L3FX 4YMNA 5J0PA 2GH1A 3HILA 1FIQA 3FYHA 4F5NA 7ICKA 5IIOA 2PXIA 2W3RA 1R8AA 1VJ5A 2MUTA 4AYBF 2IOHA 5CP2A 5J0UA 3LQCB 3PMLA 3SEIA 1X42A 2ZIWB 2MAXA 2C2EA 3TAQA 1TAUA 4LEVA 5B3QA 1SL1A 1KTQA 4CNQA 5AM0A 2ODGA 1JIHA 2I5HA 4YMOA 4FBUA 4DL3A 4C8KA 4P0QB 1ZQNA 5B66U 5KFEA 5GTHU 4E0DA 2FMPA 2M2VA 4NLNA 5KFHA 5J0TA 4DL4A 1B0XA 4KN7A 5EWEA 4YR0A 4KLMA 1C20A 3PZPA 1L7PA 2NRZA 3AM9A 2KFZA 3WK7A 4KX5A 5KFPA 5HHHA 1KRPA 3Q8KA 4WC4A 1AQ6A 3IRUA 2BCSA 3T5HA 2UVVA 3ZD8A 1RZTA 4EZ9A 2EZZA 3IG8A 3PVXA 3QU5A 3ZDAA 1AROP 2RDJA 4YD1A 1ZETA 2E8OA 2WF5A 4M6WA 5KG1A 1H38A 3PW0A 2JEGA 2VANA 3WU2U 4CCHA 1X40A 3B0YA 2WAQC 1KL9A 4IG8A 5ALHA 5HRDA 1MQ3A 2K4EA 3V7KA 1FO4A 1Z19A 1XC9A 2AXTU 2M0NA 1CRXA 5DEDA 1NOMA 2HOFA 4NL9A 3SV3A 5JU5A 3LVWA 1ZQOA 2G06A 4FO6A 1XS9D 2RRDA 2GA9D 2P35A 3UMBA 2WF8A 1NK7A 1XSNA 1Q79A 1QCKA 1PK1B 5KFXA 1SKRA 3LVVA 2YMLA 2YMMA 4OD0A 2ZJ8A 4R8UB 4YR3A 5JTGA 1ZQKA 3JPRA 1D8BA 4OAFA 4DFJA 3AQKA 2OHFA 4J9NA 2JEJA 4P0PA 2RFFA 4DSIA 4QWDA 3UXPA 3GFKB 2W9CB 4K99A 4PZNA 1WUDA 4CDGA 2K4HA 2JEIA 1N48A 5ALUA 3OV7A 5J0OA 2XO7A 4FHWA 2W43A 3NVZA 5HRIA 2PBEA 2W9BB 4RUAA 3QU4A 5KTQA 4KLLA 4GFJA 1SV0A 4OJLA 1JXLA 4M2YA 3QXGA 4NXXA 8ICZA 4X4QA 4QW9A 9ICQA 1C7YA 1N2XA 3GZFA 3H37A 5ALKA 3M8SA 3LDAA 5HMMA 2Q0ZX 3KHHA 5HRKA 5J2IA 5ALJA 2ZH4A 1BNOA 4UASA 1JQRA 1FFVA 5L1JA 2W8LA 1ZQEA 1ZQUA 4RQ7A 4PHDA 4O3OA 5IIMA 2HI0A 1J97A 2W7PA 2ZH7A 1PVPA 2KN7A 2ZH8A 8ICTA 4IC9A 1PVRA 2M2TA 4C4SA 1D9FA 5CFUA 5F3XB 8ICBA 3TADC 2W3SA 2Y9TA 2R8GA 4K9BA 1BGXT 4CE6A 4OJ5A 2J6SA 5KFGA 2F8KA 4YR2A 5C0YA 4EYHB 1XO0A 5IILA 2J6TA 5KFNA 4PZOA 1GPJA 1KFDA 3H39A 3M9OB 4EENA 2ALZA 3A0BU 8ICXA 4G9BA 1ZD2P 2DF4B 3I1YA 5CJ7A 4ECUA 3WFSC 1UA0A 3RH4A 1NK8A 4RQMA 4FS1A 4RUCA 3HW8A 5F9NA 1NK0A 4O6AA 4FO1A 1YT3A 1FA0A 2ISOA 3BS5B 5EWGA 4O69A 4K4HA 2GWSA 4NLKA 1PUZA 3M6KA 3WFRE 4QIWC 1UHUA 3ORYA 2KSOB 4QZDA 2HOIA 3GIKA 2ZH3A 3R9KA 2D8CA 5KFYA 8ICHA 4GLXA 2DVIA 1KLNA 1VLBA 2XY5A 4B9LA 8ICFA 3N7RC 3MR6A 4YCXA 1RQLA 9ICAA 3RJHA 5DB7A 2PMZC 4RT2A 2HHPA 4JLZA 1S97A 1TAMA 4X4UA 1ZD3A 5KFZA 7ICOA 4KLHA 8ICMA 2HVHA 4US8A 1F5AA 5J2GA 4JK1A 2EH9A 4FE3A 5F2VO 4QZEA 4F4XA 1L3SA 1OUQA 4WC3A 1JI7A 3PW5A 4Q43A 4ECZA 4B9TA 4HX0A 3BJYA 5G5GA 4OAGA 2ZJAA 2D3DA 4DLGA 8ICKA 2IOFK 1BPXA 5DKWA 1WYGA 2KTQA 2H3ZA 4R63A 2LM1A 9ICIA 4GXIA 2EAMA 1ZQVA 2BQRA 4KLDA 2XY7A 2ZIWA 2BCVA 2KKVA 4X0BA 5AK6A 5KFDA 4A8EA 3F2CA 2LBOA 2ZXIA 4ICAA 2FE9A 2LKYA 2EANA 2KK0A 5AKJA 4MFAA 4DSEA 1UETA 5AKHA 4F5OA 3WK8A 2YQEA 1SKWA 5CRXA 4UAZA 3RR8A 4R64A 5HR7A 2AGPA 2BKEA 5KFMA 1ZYQA 4OJ6A 4F92B 5DBBA 4AT8B 5AK3A 4OJOA 1PVQA 3HP6A 4KLUA 4DF8A 1RYSA 4K8VA 1B43A 3HPOA 2HN2A 2LYAA 2W9MA 3RAXA 2HBJA 2KZ3A 2BCRA 3SZ2A 1TK0A 3CK6A 2JR5A 4F8RA 3QYPA 3QUTA 3WFOA 3WK9A 2WFAA 1XU4A 2E5SA 4CF3A 3H40A 5CA7A 5DQGA 5TZVA 3GV7B 4DFMA 2OEHA 4IQVA 2W7OA 2F1HA 4UATA 3B9JA 3OJSA 4O5CA 1SIJA 1UA1A 1RYUA 4Y2VA 4DFPA 3ONNA 5AM5A 3ZI4A 3HJ1A 3KD3A 5AKKA 3BZKA 3MGHA 3PW4A 2DR7A 4TUSA 2EQYA 3WKBA 2HHQA 3V7LA 3OGUA 2W04A 1MN8A 5E79U 5KFVA 3H8JA 5CB1A 2DPIA 5D4BA 2GAFD 1WCNA 2OH2A 2F1JA 8ICAA 2K8CB 3Q8MA 3EW9A 2ISPA 5KG3A 7ICUA 4KLGA 1D8YA 3OVBA 4Z6FA 4MHVA 5KFOA 3GU3A 1MSWD 2EZXA 2DGZA 1JN3A 5CEHA 1ZQWA 3OWGA 5J2HA 4UB4A 1L8LA 5CR0A 4M0AA 4M9LA 2JH1A 5ALVA 2DPJA 4R8UA 4F4KA 3UQ0A 4Z6CA 3GILA 5DDYA 4KM5A 2IOFA 5J2JA 2V4QA 2F44A 2JRZA 4M04A 2FLLA 1PK3A 4EZ6A 2LHTA 3C1YA 5IIJA 1QQ7A 4QZIA 4FHVA 1URJA 5ALXA 4XQ7A 3MFHA 1X2IA 4NKTA 1X6JA 4U7CA 5KG5A 1L8OA 3AEVA 3PSPA 3GV8B 2OYYA 2HOQA 2XICA 1P7DA 3RJGA 1S0NA 3H0LB 1S0OA 1TFYA 2ZTEA 3N4MB 1V85A 3RFAA 4B9SA 5L1IA 1LKYB 3PNCA 2P66A 5J8YA 5AKEA 3PO5A 4DSLA 4DSKA 2XCAA 4K4IA 3AMZA 2WTFA 3IHQB 5KFSA 5H2FU 2ZUCA 5ALWA 4ATBB 1ZQQA 4JWNA 3F5AA 4K4GA 4ED7A 1F44A 4M9JA 1TFWA 1TFRA 1ZQCA 4ECRA 4E8FA 1ZQ1C 3KHGA 4P2HA 4YFKA 4M47A 4KX3A 5CHEA 4IR1A 4FHPA 1ECWA 4QZBA 5D61A 2KHVA 4UBCA 4QNLA 5HP4A 5KFRA 1D9DA 4NL9C 2QB0B 2PFPA 5ALNA 4PHAA 4K98A 3CNHA 3D2SA 2KNJA 2FPLA 4M9HA 5DGAA 2BDPA 1QH9A 3SV4A 4Q8FA 1ZQRA 4IRDA 2B56A 4QWBA 2ASDA 2LM4A 2VJ5A 1FEZA 1WWUA 4MKPA 2JV3A 2F76X 2JGAA 2DKZA 3ISBA 2K8BB 3V6JA 3RR7A 2XC9A 2HVIA 4DQIA 5KG0A 4YG2A 3N97B 4B6JA 1Z1VA 3M6ZA 4KLEA 2ZG6A 3L5KA 5BOLA 3NUQA 4EEYA 2MSNA 5J2KA 1T7PA 4C8NA 3G6VA 9ICOA 1ZOLA 4YD2A 2R8JA 3WFQE 3VCBA 1XSPA 1QSYA 2E8PA 2KSOA 9ICVA 2PKEA 4BXOB 2ASLA 2C28A 5FP0A 4RPYA 2LPEA 3ZD9A 1NNLA 2BZFA 5HREA 3K7DA 4LT6A 3K1ZA 1UPHA 4F2SA 2JZBA 2I6XA 1TVAA 1NK9A 1ZQMA 5KFCA 4DQQA 4LZDA 3ZDBA 4CGZA 1SV0C 4EBJA 2NO4A 3ER9B 2R8KA 3GIIA 2H5XA 3UXNA 4DL6A 4YN4A 1RXVA 4UB1A 8ICSA 3LK9A 1JXEA 1U49A 9ICMA 3JPOA 3RF9A 4DCCA 1S77D 2K4PA 3E0FA 3TFSA 4DLEA 4EEKA 4PPXA 2H3QA 2QB1A 2EWRA 2KHQA 4C4RA 4WCWA 1KFSA 4OAHA 2E8MA 9ICJA 2GLEA 3LYSA 4UARA 4UB3A 4BWMA 3T5JA 2KIVA 4RQ6A 3IN5A 4XUSA 2A1AA 3OPXA 3T5KA 4RWOA 3BZCA 4OJPA 3N7SC 3QZ8A 2O5AA 4DFDA 2KG5A 4I27A 1NO5A 3L4PA 4ACOA 2K60A 5G5HA 3BQTA 4WC6A 4M9NA 5K4LA 4KLFA 1S0MA 2O1PA 3BS7A 1YZ6A 2LYHA 5KFKA 7ICEA 4EBKA 4X4TA 1WWVA 5DBCA 3JZ0A 3PSIA 4DQSA 1DXSA 2WF9A 1COOA 3OJUA 4F93B 2Y0SC 4KLTA 4J9KA 3BQ0A 4B9VA 1Q3UA 4IL6U 4GC6A 5DLGA 2G09A 2A3VA 4G3IA 2B4VA 2OWOA 3S6JA 5L1LA 1S5LU 5CFTA 3D2QA 5AKZA 3PX6A 3FM9A 2IMWP 2MA1A 2FJ6A 3J81j 2WAQF 3T3FA 4UAUA 2VA3A 2JMGA 4B9MA 9ICCA 2WF7A 4Y2PA 4DQRA 4MEXA 3AQMA 1UEVA 2CN1A 4I2BA 5KNIA 3PR4A 4RQ3A 2VA8A 1L3UA 4AT9B 5AI8A 4LZGA 4FH5A 4PGYA 4ZH4A 5DB9A 5KT6A 1Z00B 1R8BA 3C2MA 1S76D 1J2NA 1ZJMA 2E3TA 3SQIA 8ICQA 2IA6A 2KJ9A 4QZFA 5ALGA 1JX4A 4WBYA 3JPQA 4NY8A 4RQ8A 1UT8A 4KMUA 5ALMA 2PFOA 3ER8C 1K1SA 2KV2A 4M9GA 4WQLA 3PX0A 3KFUF 3NS1A 2ZTCA 3AQEA 4UB6U 5EE9A 1ZQXA 2KVSA 4DS4A 1SL0A 3OUYB 2ZIUB 2AU0A 4HAIA 3RJIA 1HEKA 1F0MA 2UVWA 4DQPA 7ICHA 1Q8KA 4DS5A 1EXNA 1A0PA 2B51A 2BGWA 4C4TA 1SZHA 1NK6A 4BWJA 4X4OA 2VKQA 2XVTA 5AM2A 5ALFA 2PFNA 3FC4A 3QU9A 1KBUA 2P6UA 9ICBA 4RNNA 5HRFA 3NVVA 2L5YA 2XI9A 4Z6EA 2HHUA 3THVA 5AKXA 1QLNA 3JYYA 4B9NA 1MIWA 2MU2A 2LI6A 2HSZA 1YLQA 2KE7A 2IHOA 3FAHA 2B21A 3Q8RB 3H0RB 1LKYA 3ETLA 4I2FA 3MR5A 1XNSA 4RZRA 5D49A 4F5RA 2FMSA 3NRZA 3TANA 4UB2A 2YX8A 1F5SA 2NRVA 2ZIVB 1WCLA 4RQ2A 5J2FA 2FPKA 1KW4A 2O6KA 1IG6A 4QJFB 1UCVA 1ZJNA 3ERCC 5HMLA 3WKDA 2NRWA 3T5LA 2KMDA 5C5JA 3OSPA 2PFQA 2OM6A 2R8HA 8ICGA 4NWIA 3RTVA 3CP8A 8ICRA 2NRKA 2QKQA 4KITB 3KOOA 7ICSA 3H8SA 3RJJA 4IQTA 3MR3A 1MIVA 4LEWA 3HKZF 1U4BA 3GDXA 2EZYA 3C21A 4IS7A 1XO1A 1B22A 4X4RA 8ICYA 5KL1B 1KNYA 3QNMA 3PW2A 2PI5A 4NJ8A 2FLNA 5J2BA 1COKA 2MUTB 4PL2A 4QIWF 1NKBA 2F77X 3BQ1A 4QW8A 4DOBA 5AM1A 3PO4A 2Y1IA 1TKDA 5TISU 2F1IA 4TQRA 3JPPA 1RDFA 3DEEA 7ICTA 1OW5A 2ZH2A 5AI6A 5AK5A 3SAGA 2DWQA 3AQNA 4EEBA 1ZD4A 1NI3A 4NM1A 3F53A 8ICLA 4EYIB 3A0HU 2EAPA 7ICNA 2ZH1A 1CI4A 2PMZF 2RHFA 8ICNA 2G5HB 8ICIA 3QU2A 4UAWA 4IQWA 8ICWA 5B5EU 4FHYA 4QZAA 4RWPA 4BX9C 5KFBA 4O3SA 1N61A 3ISCA 3EWAA 3JPNA 4KLQA 2YB4A 4O3RA 3UQ2A 2DR5A 4RQ4A 4O3NA 1IV8A 4ZOHC 1NJYA 4Y2XA 4C8LA 3AQFA 5J0YA 3KKAC 4UBBA 1BPEA 4UAVA 2HHSA 1Q78A 1N62A 4P0QA 5AICA 3IM1A 4RQNA 3QE9Y 3IG5A 4J9RA 1X9SA 4EELA 4Y2SA 3T79A 2DRBA 5ALTA 2YB1A 2HHXA 4M6WB 5EE0A 5JUMA 2DR9A 2G07A 1X9WA 9ICPA 4J9OA 1DGJA 3ETRA 2LYBA 2DL0A 4ECQA 9ICHA 3EPGA 5KFJA 1SXDA 4RQ0A 4I2IA 5KFWA 3SYZA 3TADA 4PJ0U 9ICWA 3AU6A 3D6JA 3MFIA 4X0AA 5KAIU 3ZDEA 2KVCA 5AKLA 5EE1A 3G6YA 5J0WA 1RM6C 3RJFA 3PMNA 4K97A 4DWIA 2WF6A 3QZ7A 4J9QA 2AGQA 2BPGA 3MDCA 1SB3C 3MCRA 5DB6A 2ZH6A 2BBJA 4ECTA 4I2GA 4NLCA 4PL1A 3MGIA 5CWRA 4Z6DA 1X9XA 5ALSA 1N60A 5HRHA 4X5VA 3AL0B 3HIYA 3PX4A 3MR2A 2KJ8A 2BE3A 5HRLA 5ALZA 5GTIU 4CF5A 3RRHA 3HRDD 3KZIU 4O0IA 3QUCA 3OVAA 4F91B 2AH5A 4YMMA 1KSPA 4LEYA 4I28A 5EWFA 4I2EA 1WG8A 1PK1A 1L7OA 5AK4A 2DQNB 4E80A 3RBDA 4ED8A 2R8IA 4QZCA 4JV0A 1ZQBA 2BCUA 3TAPA 1R89A 3M8RA 3UM9A 2ID1A 2XGPA 3EUB2 1NK5A 5DQIA 3PSTA 7ICVA 7ICMA 3EPIA 3PV8A 2WB1C 4NXUA 3V72A 3SI8A 2C2RA 4RU9A 2HN1A 3WK6A 2A1JB 1NJZA 1Z00A 2CXYA 2HW3A 4QWEA 1JALA 1UQVA 5DQHA 5ALPA 2W9CA 7ICIA 1LVHA 3NTUA 7ICGA 2HBLA 1SGGA 2NV3A 2G0AA 4Y2RA 1JRPA 1A76A 1X9MA 5B3PA 5KFAA 4KLOA 2W9BA 1SL2A 4EV6A 3CW2C 2IHNA 4KLIA 5HR6A 3MBYA 1U48A 4R66A 2KD1A 4I2HA 2K89A 8ICEA 2HCFA 2DR8A 4DL5A 1UT5A 1L6NA 3OUYA 2ZIUA 4O3MA 3H38A 8ICCA 4RNOA 4IRCA 2NO5A 5J0RA 2ATLA 3SAFA 2ESEA 3RB3A 5IIIA 4QZ8A 3RB0A 4DFKA 1PX5A 9ICNA 3H8MA 1V97A 3D2NA 3TI0A 2ZIXB 4FHXA 5HHIA 1ZQLA 3NASA 2DUYA 4PGXA 4C0ZA 3Q8SB 2HHTA 4RNMA 2RQ5A 3MDAA 5DG7A 3GIMA 1U9LA 2CPRA 3UPQA 4S3NA 1L5UA 5A0LA 2ES6A 2NRTA 2LMRA 2P6RA 4PHPA 4TUPA 3ISDA 2M2UA 2RDIA 2IBKA 5EE3A 1DK3A 4P4PA 1M6YA 3C29A 3BS5A 4UB8U 3BQ7A 1L3TA 2VJ4A 1BPBA 3PR5B 3TKAA 4AYBC 3IDWA 3LWMA 2JH7A 7ICQA 8ICPA 2E1FA 2B6GA 4J03A 2F3NA 1ZQJA 2HBMA 1ZRMA 3HJ4A 2GO7A 1ZQSA 5AKIA 4WC1A 4BJQA 1Q46A 4YXJA 4P4OA 2G5IB 3IV6A 4JWMA 4AT7B 2KZMA 1QQ5A 4GC7A 2E1EA 1ZQPA 3Q8QB 4MF2A 7ICRA 2KJ5A 4HYKA 4X4SA 3ZDCA 2XIDA 1IXRA 5DG9A 5KG4A 4QZ9A 4WBZA 5KG7A 4ECSA 4DL2A 3FDSA 1S8OA 4US9A 3B0XA 4F5PA 1KQQA 3F2DA 3NGDA 1X66A 5J2CA 4ELTA 5L1MA 3H7IA 5KL8B 1KFTA 2M9NA 1Z1BA 2E8NA 2XY6A 2C2DA 3QUQA 5KT5A 3UPSA 3WKEA 4NLGA 1JUDA 3M7DA 2JEFA 4ELVA 3SAHA 3WK5A 4O3PA 3SMVA 1TK8A 4C8OA 3N7PD 2QARB 3HX0A 3Q8PB 4BDPA 8ICVA 1VDVA 1ED1A 1KEJA 1GO3F 5DLFA 4C7ZA 4UQGA 1R8CA 4B9UA 4OO1J 2KP7A 4AT8A 3BDPA 5DGBA 5DECA 1ZQFA 1BPYA 3AU2A 2K4IA 4JB3A 3DDHA 1HJPA 1HIWA 2ZUBA 1MQ2A 3CRXA 3UMGA 2BCQA 1HUOA 4C8MA 2UVUA 1K5OA 2JXJA 1NZPA 1Z4OA 5ALIA 5KFIA 4DEZA 2C22A 4DSJA 1N56A 5KFUA 2BPCA 1L7NA 2ZUDA 1KN5A
chains in the Genus database with same CATH topology
5J0QA 8ICRA 4MF8A 3OJSA 4ELUA 4RT3A 4O5CA 2NRKA 1OU5A 4I2JA 1UA1A 4KITB 4DFPA 4YXMA 7ICSA 3H8SA 4ECVA 3V6KA 1LV5A 4IQTA 5J2DA 3MR3A 5L9XA 3M9NB 2BPFA 3RJJA 1CEZA 1U4BA 1MIVA 5KFLA 3HJ1A 3GDXA 3C21A 3OHBA 3JPTA 3RJKA 2PI4A 1XO1A 3Q8LA 3ZDDA 3MGHA 3PW4A 1B22A 4TUSA 4E7XA 3WFPA 4X4RA 8ICYA 2DR7A 5KT3A 2HHQA 3H4BA 4I2CA 3V7LA 2KZZA 1TAQA 4ED0A 1KNYA 3OGUA 1MIYA 2XGQA 3TQ1A 3PW2A 2PI5A 5KFVA 3H8JA 5CB1A 3KTQA 2NRXA 5KFQA 3OHAA 3C2KA 2ASJA 2DPIA 5D4BA 1WCNA 2F1JA 5KT4A 8ICAA 9ICSA 3Q8MA 2FLNA 1XWLA 1JAJA 5J2BA 2AJQA 3EW9A 2ISPA 5KG3A 7ICUA 5CHGA 2MUTB 1NKBA 1BPDA 4KLGA 4QZGA 3EYZA 4R65A 3BQ1A 1D8YA 4QW8A 4LVSA 4DOBA 3OVBA 2V4RA 2UVRA 3OSNA 3H4DA 3PO4A 7ICJA 4Z6FA 5KFOA 5DBAA 4Q8EA 3C5FA 3TFRA 2Y1IA 1TKDA 4YMNA 1MSWD 1JN3A 2F1IA 5J0PA 1ZQWA 4TQRA 5J2HA 3FYHA 8ICUA 4UB4A 3JPPA 4F5NA 7ICKA 4M5DA 1DGSA 5IIOA 9ICLA 7ICTA 4WC5A 2PXIA 5CR0A 4I29A 4M0AA 1NKEA 1R8AA 4M9LA 2ZH2A 2MUTA 5D46A 3C1ZA 5CP2A 2DPJA 4ED2A 4R8UA 5J0UA 4F4KA 3LQCB 3PMLA 3UQ0A 3AQNA 4Z6CA 3GILA 4NM1A 5DDYA 3HWTA 8ICLA 2MAXA 2C2EA 4EYIB 5J2JA 3TAQA 4UD5A 2V4QA 4EP7A 2HHWA 7ICNA 2ZH1A 1A77A 4M04A 4YP3A 1TAUA 8ICNA 2FLLA 8ICIA 4EZ6A 3C1YA 5IIJA 4QZIA 1SL1A 4FHVA 4UAWA 1KTQA 4IQWA 2Y1JA 8ICWA 4XQ7A 2I9GA 4FHYA 4QZAA 4RWPA 5DDMA 1T4GA 3MFHA 1JIHA 5KFBA 1X2IA 4ECXA 4Q44A 2BQ3A 4O3SA 4YMOA 2FLPA 4FBUA 4DL3A 4C8KA 3L9DA 4NKTA 1T8EA 1ZQNA 5KFEA 3ISCA 3EWAA 3JPNA 4E0DA 2FMPA 4KLQA 4O3RA 5KG5A 2M2VA 3UQ2A 2DR5A 4RQ4A 4O3NA 3NYBA 4NLNA 4XRHA 1NJYA 5KFHA 3GV8B 5J0TA 4DL4A 4C8LA 2A1JA 4KN7A 5EWEA 4YR0A 4KLMA 4J9MA 5J0YA 4UBBA 1BPEA 2NRZA 3RJGA 4PHEA 1S0NA 2HHSA 2KFZA 4MEYA 1Q78A 1S0OA 1TFYA 2ZTEA 3IM1A 3N4MB 1RYRA 5KFPA 5HHHA 3QE9Y 1KRPA 3Q8KA 5L1IA 4B9SA 3PNCA 4ED3A 4J9RA 1X9SA 2P66A 4WC4A 2DRBA 2KFNA 1ZQHA 4J9SA 3PO5A 2BCSA 4DSLA 4DSKA 3M9MB 2XCAA 4M6WB 3T5HA 4K4IA 2HHXA 1U45A 5DG8A 5JUMA 2WTFA 2UVVA 2DR9A 3ZD8A 1RZTA 4EZ9A 3K4GA 3IHQB 5KFSA 2ZTDA 1BPZA 2ZUCA 2AGOA 4ATBB 3PVXA 1X9WA 1ZQQA 4XA5A 4J9OA 4ED7A 4TUQA 3ZDAA 4JWNA 1AROP 1TFRA 2RDJA 4M9JA 4O9MA 4RWQA 1TFWA 4ECQA 1ZQCA 4ECRA 9ICHA 3EPGA 5KFJA 4YD1A 4RQ5A 4E8FA 1ZETA 1ZQZA 4RQ0A 4ECYA 4I2IA 5KFWA 3SYZA 3KHGA 4P2HA 4M6WA 5KG1A 4YFKA 1H38A 4M47A 3PW0A 2JEGA 2VANA 9ICWA 4CCHA 3AU6A 5J2EA 3MFIA 1TV9A 3B0YA 3C2LA 4X0AA 4IR9A 3ZDEA 4IR1A 4ATBA 5KFTA 4FHPA 4QZBA 3RH6A 3RRGA 1TK5A 3G6YA 1UEUA 4X4PA 5J0WA 4UBCA 5HP4A 3PMNA 3RJFA 5KFRA 1QSSA 4K4GA 1D9DA 4IG8A 1BNPA 5L1KA 1ZQIA 4DWIA 3BQ2A 2PFPA 5HRDA 1MQ3A 3QZ7A 4PHAA 3V7KA 4J9QA 2AGQA 1DK2A 2FPLA 1XC9A 5DGAA 3MDCA 2BPGA 3SV4A 2BDPA 4M9HA 4Q8FA 5DEDA 5HR9A 1NOMA 8ICGA 3SV3A 4J9PA 5DB6A 1ZQRA 1U47A 2ZH6A 2DFLA 4ECTA 4DF4A 4I2GA 1ZQOA 4FO6A 4IRDA 1XS9D 9ICKA 4QWBA 2ASDA 3MGIA 5CWRA 4Z6DA 5HRHA 4ED1A 4X5VA 3KHLA 1L3VA 3RB6A 3HIYA 3PX4A 5BPCA 1NK7A 4DO9A 1XSNA 5HRBA 1Q79A 3MR2A 3V6JA 3ISBA 5KFXA 3RR7A 1RPLA 2XC9A 2HVIA 5HRLA 2BE3A 4WC7A 4NXZA 1SKRA 4PH5A 5HRGA 4DQIA 5KG0A 4YG2A 4JV2A 3C18A 3N97B 3RRHA 9ICXA 4FH3A 2ZJ8A 4F5QA 4KLEA 4IQUA 4O0IA 4R8UB 4TURA 4YR3A 2DRAA 5BOLA 4EEYA 1ZQKA 5DB8A 5J2KA 3JPRA 1T7PA 4F91B 4YMMA 1KSPA 3OVAA 4C8NA 4DFJA 4I28A 2JZBB 5F9LA 5EWFA 3G6VA 4I2EA 3G6XA 9ICOA 3AQKA 4YD2A 2R8JA 3WFQE 1XSPA 4J9NA 1QSYA 4E80A 2JEJA 9ICVA 2RFFA 3RBDA 4FBTA 4ED8A 2R8IA 4QZCA 4JV0A 1ZQBA 2BCUA 4GXKA 3TAPA 4DSIA 1R89A 3M8RA 4QWDA 3UXPA 4BXOB 2ASLA 2C28A 2Q66A 2ID1A 3GFKB 4RPYA 2XGPA 2W9CB 4WC0A 3ZD9A 5HREA 1NK5A 1BVSA 5DQIA 7ICVA 4LT6A 7ICMA 3EPIA 3PV8A 4F2SA 2JZBA 2JEIA 1TVAA 3JPSA 4F4ZA 1NK9A 1N48A 1ZQMA 3V72A 4P4MA 3SI8A 5KFCA 5J0OA 4DQQA 4RU9A 2C2RA 3OV7A 2XO7A 4LZDA 2A1JB 1ZQAA 3ZDBA 4FHWA 1NJZA 1Z00A 4UD4A 9ICPA 2HHVA 1NJWA 2HW3A 4QWEA 4EBJA 2ZHAA 4BXOA 5HRIA 4KLSA 2R8KA 2PBEA 2W9BB 4RUAA 5DQHA 3GIIA 5KTQA 2W9CA 4EBCA 2AQ0A 2H5XA 2V9WA 4KTQA 4KLLA 7ICIA 3UXNA 9ICFA 4DL6A 3MABA 3NTUA 4YN4A 1RXVA 4UB1A 7ICGA 4GXJA 8ICSA 3LK9A 1JXEA 1JXLA 4M2YA 4X4QA 8ICZA 1U49A 9ICMA 3JPOA 7ICPA 4AT7A 1A76A 4QW9A 1X9MA 1S77D 9ICQA 1C7YA 2XCPA 4DOAA 4IRKA 5KFAA 1QSLA 3H37A 4KLOA 3M8SA 4DLEA 3LDAA 5HMMA 2Q0ZX 2W9BA 3KHHA 3TFSA 1SL2A 5J2IA 4PPXA 5HRKA 2ZH4A 5J2AA 4RPZA 1NJXA 3C5GA 1BNOA 1JQRA 2IHNA 4KLIA 2M2WA 4I2DA 2W8LA 5L1JA 1ZQEA 1WOTA 1KDHA 1ZQUA 4WCWA 4RQ7A 1KFSA 4PHDA 3MBYA 1U48A 4O3OA 5IIMA 4QWAA 4R66A 2ZH7A 1MC8A 4I2HA 5BOMA 2KN7A 8ICEA 9ICJA 3AUOA 2DR8A 4UB3A 4DL5A 1T3NA 2ZH8A 1UT5A 8ICTA 4BWMA 3T5JA 5J0SA 3OUYA 4RQ6A 3E2EA 4XUSA 3H38A 3T5KA 2M2TA 8ICCA 1D9FA 2AQ4A 4RWOA 1VJ7A 8ICBA 4F50A 4RNOA 2R8GA 8ICJA 1BGXT 3PW7A 4IRCA 5J0RA 4EBEA 7ICLA 2J6SA 5KFGA 2ATLA 1S9FA 3RB3A 4ECWA 5IIIA 3QZ8A 4KLJA 4YR2A 4QZ8A 8ICOA 4EYHB 2O5AA 5IILA 2J6TA 5KFNA 4I27A 3RB0A 4MFFA 1NO5A 3V7JA 2BHNA 2BQUA 1KFDA 3BQTA 3H39A 4DFKA 1PX5A 9ICNA 4WC6A 3M9OB 4M9NA 2ALZA 1S0MA 4KLFA 8ICXA 2O1PA 9ICRA 2LYHA 5KFKA 3TI0A 1NKCA 7ICEA 4EBKA 4FHXA 4X4TA 1K1QA 5HHIA 1ZQLA 5DBCA 3JZ0A 4X4VA 5CJ7A 4ECUA 1Z3EB 4UB5A 4PGXA 4DQSA 4AT8A 3WFSC 5KG2A 1UA0A 3RH4A 1NK8A 1COOA 3OJUA 1V4AA 3Q8SB 4F93B 4TQSA 4FS1A 4RUCA 2HHTA 4RNMA 3MDAA 4KLTA 3QEAZ 5DG7A 3GIMA 4J9KA 5HNKA 3HW8A 1U9LA 5F9NA 1NK0A 4F3OA 3BQ0A 4F4WA 3UPQA 1FA0A 4PGQA 2ISOA 4S3NA 4B9VA 2VA2A 5EWGA 1L5UA 3RAQA 4GC6A 4K4HA 1HUZA 5DLGA 2NRTA 4G3IA 2GWSA 5L1LA 2OWOA 2P6RA 4O5EA 4NLKA 4PHPA 4TUPA 3ISDA 2M2UA 3PX6A 3WFRE 2RDIA 2IBKA 1ZQTA 2IMWP 3ORYA 1DK3A 5KT7A 4QZDA 3T3FA 4P4PA 4JV1A 3H3AA 3GIKA 2ZH3A 2I1QA 5IINA 4YQWA 1ZQYA 2VA3A 4J9LA 5KFYA 4B9MA 8ICHA 9ICCA 4GLXA 4DQRA 1L3TA 2IHMA 1VFGA 4MEXA 2DVIA 1BPBA 3PR5B 9ICUA 1KLNA 3AQMA 2XY5A 1UEVA 4I2BA 1ZQDA 4B9LA 8ICFA 3MR6A 3PR4A 2W8KA 4RQ3A 3LWMA 7ICQA 2VA8A 1L3UA 8ICPA 4AT9B 3RJEA 4YCXA 4LZGA 4FH5A 1NK4A 4PGYA 2FMQA 9ICAA 4ZH4A 5DB9A 5KT6A 1Z00B 9ICTA 1R8BA 3C2MA 1S76D 3RJHA 1ZQJA 5J29A 5DB7A 1ZJMA 1S0VA 4RT2A 3HJ4A 2HHPA 2ZHBA 1ZQSA 1JMSA 4YVZA 1S97A 4WC1A 4X4UA 4F2RA 8ICQA 5KFZA 3RB4A 1V9PA 7ICOA 2IA6A 5KT2A 4YXJA 4P4OA 4QZFA 1RXWA 4KLHA 8ICMA 4AT9A 1JX4A 2HVHA 3C23A 4JWMA 1F5AA 4AT7B 2KZMA 5J2GA 4WBYA 3JPQA 4JK1A 4GC7A 1ZQPA 4MF2A 3Q8QB 4NY8A 4RQ8A 7ICRA 1UT8A 4HYKA 4X4SA 4KMUA 4JUZA 3ZDCA 5F2VO 4QZEA 4F4XA 4WC2A 1L3SA 2PFOA 3H8WA 4WC3A 4KN4A 3PW5A 1K1SA 5EOZA 9ICEA 3RH5A 4M9GA 4Q43A 3PX0A 3K75D 1IXRA 5DG9A 5KG4A 4QZ9A 3GV5B 4ECZA 5KG7A 4B9TA 2ZTCA 4WBZA 3BJYA 1PZNA 1ZQXA 4ECSA 2ZJAA 4DOCA 4DS4A 4DLGA 4DL2A 1ZQGA 3FDSA 1Y88A 1CUKA 3GIJA 8ICKA 3C66A 4FS2A 3B0XA 4F5PA 1SL0A 3OUYB 2AU0A 3V6HA 4EBDA 3RJIA 3NGDA 1BPXA 3KHRA 5DKWA 5J2CA 2UVWA 4ELTA 2KTQA 2ZH5A 4R63A 4DQPA 7ICHA 9ICIA 3OVSA 4GXIA 4DS5A 1ZQVA 2BQRA 1EXNA 3H7IA 4KLDA 2XY7A 1KFTA 4I2AA 3EZ5A 2BCVA 1D8LA 2M9NA 5KFFA 2BGWA 4X0BA 1NK6A 5KFDA 4BWJA 4MFCA 4RWNA 3GQCA 3QEBZ 4X4OA 2XY6A 1SZPA 2C2DA 2J6UA 2PFNA 3RBEA 5KT5A 4MFAA 4DSEA 1UETA 4F4YA 4F5OA 3UPSA 4NLGA 2BR0A 2P6UA 1SKWA 2JEFA 9ICBA 4UAZA 4ELVA 3RR8A 4R64A 4ED6A 4RNNA 4O3PA 4QZHA 2AGPA 5HRFA 1TK8A 4C8OA 3LWLA 2BKEA 5KFMA 1S10A 4Z6EA 3HX0A 1SKSA 3Q8PB 1ZYQA 4BDPA 8ICVA 2HHUA 4RPXA 4F92B 5DBBA 4AT8B 3THVA 5J0XA 1QLNA 3JYYA 4B9NA 5KG6A 1MIWA 7ICFA 4QWCA 3HP6A 4KLUA 1YLQA 3AQLA 4DF8A 1KEJA 1RYSA 2B21A 5DLFA 3Q8RB 3TARA 2FPMA 1B43A 3HPOA 4UQGA 3ETLA 4I2FA 1R8CA 4O3QA 3MR5A 4B9UA 4RZRA 5D49A 4NM2A 4BGDA 4RQ1A 4F5RA 3UXOA 2FMSA 2KP7A 1XSLA 2W9MA 3TANA 3RAXA 4Q45A 4UB2A 3BDPA 5DGBA 4O5KA 1LB2B 4NLZA 5HC9A 5DECA 1ZQFA 1BPYA 3AU2A 1QTMA 9ICGA 2NRVA 1WCLA 4RQ2A 4XQ8A 1HJPA 2ZUBA 2FPKA 5J2FA 2KZ3A 1MQ2A 2BCRA 3SZ2A 1TK0A 4UAYA 3PY8A 1ZJNA 2BCQA 1HUOA 4C8MA 2UVUA 4F8RA 1DOQA 1NZPA 4DEZA 5KFIA 1IM4A 4DSJA 5HMLA 2C22A 3WFOA 4NKUA 4X4NA 1N56A 1XU4A 5KFUA 2NRWA 3H40A 5CA7A 2BPCA 5DQGA 4DSFA 3T5LA 2ZH9A 5IIKA 5TZVA 5C5JA 3GV7B 3OSPA 2PFQA 3HT3A 4DFMA 2ZUDA 4DL7A 4IQVA 2W9AA 2ZJ5A 2R8HA 2F1HA 3RTVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5J0Q A;  8ICR A;  4MF8 A;  3OJS A;  4ELU A;  4RT3 A;  4O5C A;  2NRK A;  1OU5 A;  4I2J A;  1UA1 A;  4KIT B;  4DFP A;  4YXM A;  7ICS A;  3H8S A;  4ECV A;  3V6K A;  1LV5 A;  4IQT A;  5J2D A;  3MR3 A;  5L9X A;  3M9N B;  2BPF A;  3RJJ A;  1CEZ A;  1U4B A;  1MIV A;  5KFL A;  3HJ1 A;  3GDX A;  3C21 A;  3OHB A;  3JPT A;  3RJK A;  2PI4 A;  1XO1 A;  3Q8L A;  3ZDD A;  3MGH A;  3PW4 A;  1B22 A;  4TUS A;  4E7X A;  3WFP A;  4X4R A;  8ICY A;  2DR7 A;  5KT3 A;  2HHQ A;  3H4B A;  4I2C A;  3V7L A;  2KZZ A;  1TAQ A;  4ED0 A;  1KNY A;  3OGU A;  1MIY A;  2XGQ A;  3TQ1 A;  3PW2 A;  2PI5 A;  5KFV A;  3H8J A;  5CB1 A;  3KTQ A;  2NRX A;  5KFQ A;  3OHA A;  3C2K A;  2ASJ A;  2DPI A;  5D4B A;  1WCN A;  2F1J A;  5KT4 A;  8ICA A;  9ICS A;  3Q8M A;  2FLN A;  1XWL A;  1JAJ A;  5J2B A;  2AJQ A;  3EW9 A;  2ISP A;  5KG3 A;  7ICU A;  5CHG A;  2MUT B;  1NKB A;  1BPD A;  4KLG A;  4QZG A;  3EYZ A;  4R65 A;  3BQ1 A;  1D8Y A;  4QW8 A;  4LVS A;  4DOB A;  3OVB A;  2V4R A;  2UVR A;  3OSN A;  3H4D A;  3PO4 A;  7ICJ A;  4Z6F A;  5KFO A;  5DBA A;  4Q8E A;  3C5F A;  3TFR A;  2Y1I A;  1TKD A;  4YMN A;  1MSW D;  1JN3 A;  2F1I A;  5J0P A;  1ZQW A;  4TQR A;  5J2H A;  3FYH A;  8ICU A;  4UB4 A;  3JPP A;  4F5N A;  7ICK A;  4M5D A;  1DGS A;  5IIO A;  9ICL A;  7ICT A;  4WC5 A;  2PXI A;  5CR0 A;  4I29 A;  4M0A A;  1NKE A;  1R8A A;  4M9L A;  2ZH2 A;  2MUT A;  5D46 A;  3C1Z A;  5CP2 A;  2DPJ A;  4ED2 A;  4R8U A;  5J0U A;  4F4K A;  3LQC B;  3PML A;  3UQ0 A;  3AQN A;  4Z6C A;  3GIL A;  4NM1 A;  5DDY A;  3HWT A;  8ICL A;  2MAX A;  2C2E A;  4EYI B;  5J2J A;  3TAQ A;  4UD5 A;  2V4Q A;  4EP7 A;  2HHW A;  7ICN A;  2ZH1 A;  1A77 A;  4M04 A;  4YP3 A;  1TAU A;  8ICN A;  2FLL A;  8ICI A;  4EZ6 A;  3C1Y A;  5IIJ A;  4QZI A;  1SL1 A;  4FHV A;  4UAW A;  1KTQ A;  4IQW A;  2Y1J A;  8ICW A;  4XQ7 A;  2I9G A;  4FHY A;  4QZA A;  4RWP A;  5DDM A;  1T4G A;  3MFH A;  1JIH A;  5KFB A;  1X2I A;  4ECX A;  4Q44 A;  2BQ3 A;  4O3S A;  4YMO A;  2FLP A;  4FBU A;  4DL3 A;  4C8K A;  3L9D A;  4NKT A;  1T8E A;  1ZQN A;  5KFE A;  3ISC A;  3EWA A;  3JPN A;  4E0D A;  2FMP A;  4KLQ A;  4O3R A;  5KG5 A;  2M2V A;  3UQ2 A;  2DR5 A;  4RQ4 A;  4O3N A;  3NYB A;  4NLN A;  4XRH A;  1NJY A;  5KFH A;  3GV8 B;  5J0T A;  4DL4 A;  4C8L A;  2A1J A;  4KN7 A;  5EWE A;  4YR0 A;  4KLM A;  4J9M A;  5J0Y A;  4UBB A;  1BPE A;  2NRZ A;  3RJG A;  4PHE A;  1S0N A;  2HHS A;  2KFZ A;  4MEY A;  1Q78 A;  1S0O A;  1TFY A;  2ZTE A;  3IM1 A;  3N4M B;  1RYR A;  5KFP A;  5HHH A;  3QE9 Y;  1KRP A;  3Q8K A;  5L1I A;  4B9S A;  3PNC A;  4ED3 A;  4J9R A;  1X9S A;  2P66 A;  4WC4 A;  2DRB A;  2KFN A;  1ZQH A;  4J9S A;  3PO5 A;  2BCS A;  4DSL A;  4DSK A;  3M9M B;  2XCA A;  4M6W B;  3T5H A;  4K4I A;  2HHX A;  1U45 A;  5DG8 A;  5JUM A;  2WTF A;  2UVV A;  2DR9 A;  3ZD8 A;  1RZT A;  4EZ9 A;  3K4G A;  3IHQ B;  5KFS A;  2ZTD A;  1BPZ A;  2ZUC A;  2AGO A;  4ATB B;  3PVX A;  1X9W A;  1ZQQ A;  4XA5 A;  4J9O A;  4ED7 A;  4TUQ A;  3ZDA A;  4JWN A;  1ARO P;  1TFR A;  2RDJ A;  4M9J A;  4O9M A;  4RWQ A;  1TFW A;  4ECQ A;  1ZQC A;  4ECR A;  9ICH A;  3EPG A;  5KFJ A;  4YD1 A;  4RQ5 A;  4E8F A;  1ZET A;  1ZQZ A;  4RQ0 A;  4ECY A;  4I2I A;  5KFW A;  3SYZ A;  3KHG A;  4P2H A;  4M6W A;  5KG1 A;  4YFK A;  1H38 A;  4M47 A;  3PW0 A;  2JEG A;  2VAN A;  9ICW A;  4CCH A;  3AU6 A;  5J2E A;  3MFI A;  1TV9 A;  3B0Y A;  3C2L A;  4X0A A;  4IR9 A;  3ZDE A;  4IR1 A;  4ATB A;  5KFT A;  4FHP A;  4QZB A;  3RH6 A;  3RRG A;  1TK5 A;  3G6Y A;  1UEU A;  4X4P A;  5J0W A;  4UBC A;  5HP4 A;  3PMN A;  3RJF A;  5KFR A;  1QSS A;  4K4G A;  1D9D A;  4IG8 A;  1BNP A;  5L1K A;  1ZQI A;  4DWI A;  3BQ2 A;  2PFP A;  5HRD A;  1MQ3 A;  3QZ7 A;  4PHA A;  3V7K A;  4J9Q A;  2AGQ A;  1DK2 A;  2FPL A;  1XC9 A;  5DGA A;  3MDC A;  2BPG A;  3SV4 A;  2BDP A;  4M9H A;  4Q8F A;  5DED A;  5HR9 A;  1NOM A;  8ICG A;  3SV3 A;  4J9P A;  5DB6 A;  1ZQR A;  1U47 A;  2ZH6 A;  2DFL A;  4ECT A;  4DF4 A;  4I2G A;  1ZQO A;  4FO6 A;  4IRD A;  1XS9 D;  9ICK A;  4QWB A;  2ASD A;  3MGI A;  5CWR A;  4Z6D A;  5HRH A;  4ED1 A;  4X5V A;  3KHL A;  1L3V A;  3RB6 A;  3HIY A;  3PX4 A;  5BPC A;  1NK7 A;  4DO9 A;  1XSN A;  5HRB A;  1Q79 A;  3MR2 A;  3V6J A;  3ISB A;  5KFX A;  3RR7 A;  1RPL A;  2XC9 A;  2HVI A;  5HRL A;  2BE3 A;  4WC7 A;  4NXZ A;  1SKR A;  4PH5 A;  5HRG A;  4DQI A;  5KG0 A;  4YG2 A;  4JV2 A;  3C18 A;  3N97 B;  3RRH A;  9ICX A;  4FH3 A;  2ZJ8 A;  4F5Q A;  4KLE A;  4IQU A;  4O0I A;  4R8U B;  4TUR A;  4YR3 A;  2DRA A;  5BOL A;  4EEY A;  1ZQK A;  5DB8 A;  5J2K A;  3JPR A;  1T7P A;  4F91 B;  4YMM A;  1KSP A;  3OVA A;  4C8N A;  4DFJ A;  4I28 A;  2JZB B;  5F9L A;  5EWF A;  3G6V A;  4I2E A;  3G6X A;  9ICO A;  3AQK A;  4YD2 A;  2R8J A;  3WFQ E;  1XSP A;  4J9N A;  1QSY A;  4E80 A;  2JEJ A;  9ICV A;  2RFF A;  3RBD A;  4FBT A;  4ED8 A;  2R8I A;  4QZC A;  4JV0 A;  1ZQB A;  2BCU A;  4GXK A;  3TAP A;  4DSI A;  1R89 A;  3M8R A;  4QWD A;  3UXP A;  4BXO B;  2ASL A;  2C28 A;  2Q66 A;  2ID1 A;  3GFK B;  4RPY A;  2XGP A;  2W9C B;  4WC0 A;  3ZD9 A;  5HRE A;  1NK5 A;  1BVS A;  5DQI A;  7ICV A;  4LT6 A;  7ICM A;  3EPI A;  3PV8 A;  4F2S A;  2JZB A;  2JEI A;  1TVA A;  3JPS A;  4F4Z A;  1NK9 A;  1N48 A;  1ZQM A;  3V72 A;  4P4M A;  3SI8 A;  5KFC A;  5J0O A;  4DQQ A;  4RU9 A;  2C2R A;  3OV7 A;  2XO7 A;  4LZD A;  2A1J B;  1ZQA A;  3ZDB A;  4FHW A;  1NJZ A;  1Z00 A;  4UD4 A;  9ICP A;  2HHV A;  1NJW A;  2HW3 A;  4QWE A;  4EBJ A;  2ZHA A;  4BXO A;  5HRI A;  4KLS A;  2R8K A;  2PBE A;  2W9B B;  4RUA A;  5DQH A;  3GII A;  5KTQ A;  2W9C A;  4EBC A;  2AQ0 A;  2H5X A;  2V9W A;  4KTQ A;  4KLL A;  7ICI A;  3UXN A;  9ICF A;  4DL6 A;  3MAB A;  3NTU A;  4YN4 A;  1RXV A;  4UB1 A;  7ICG A;  4GXJ A;  8ICS A;  3LK9 A;  1JXE A;  1JXL A;  4M2Y A;  4X4Q A;  8ICZ A;  1U49 A;  9ICM A;  3JPO A;  7ICP A;  4AT7 A;  1A76 A;  4QW9 A;  1X9M A;  1S77 D;  9ICQ A;  1C7Y A;  2XCP A;  4DOA A;  4IRK A;  5KFA A;  1QSL A;  3H37 A;  4KLO A;  3M8S A;  4DLE A;  3LDA A;  5HMM A;  2Q0Z X;  2W9B A;  3KHH A;  3TFS A;  1SL2 A;  5J2I A;  4PPX A;  5HRK A;  2ZH4 A;  5J2A A;  4RPZ A;  1NJX A;  3C5G A;  1BNO A;  1JQR A;  2IHN A;  4KLI A;  2M2W A;  4I2D A;  2W8L A;  5L1J A;  1ZQE A;  1WOT A;  1KDH A;  1ZQU A;  4WCW A;  4RQ7 A;  1KFS A;  4PHD A;  3MBY A;  1U48 A;  4O3O A;  5IIM A;  4QWA A;  4R66 A;  2ZH7 A;  1MC8 A;  4I2H A;  5BOM A;  2KN7 A;  8ICE A;  9ICJ A;  3AUO A;  2DR8 A;  4UB3 A;  4DL5 A;  1T3N A;  2ZH8 A;  1UT5 A;  8ICT A;  4BWM A;  3T5J A;  5J0S A;  3OUY A;  4RQ6 A;  3E2E A;  4XUS A;  3H38 A;  3T5K A;  2M2T A;  8ICC A;  1D9F A;  2AQ4 A;  4RWO A;  1VJ7 A;  8ICB A;  4F50 A;  4RNO A;  2R8G A;  8ICJ A;  1BGX T;  3PW7 A;  4IRC A;  5J0R A;  4EBE A;  7ICL A;  2J6S A;  5KFG A;  2ATL A;  1S9F A;  3RB3 A;  4ECW A;  5III A;  3QZ8 A;  4KLJ A;  4YR2 A;  4QZ8 A;  8ICO A;  4EYH B;  2O5A A;  5IIL A;  2J6T A;  5KFN A;  4I27 A;  3RB0 A;  4MFF A;  1NO5 A;  3V7J A;  2BHN A;  2BQU A;  1KFD A;  3BQT A;  3H39 A;  4DFK A;  1PX5 A;  9ICN A;  4WC6 A;  3M9O B;  4M9N A;  2ALZ A;  1S0M A;  4KLF A;  8ICX A;  2O1P A;  9ICR A;  2LYH A;  5KFK A;  3TI0 A;  1NKC A;  7ICE A;  4EBK A;  4FHX A;  4X4T A;  1K1Q A;  5HHI A;  1ZQL A;  5DBC A;  3JZ0 A;  4X4V A;  5CJ7 A;  4ECU A;  1Z3E B;  4UB5 A;  4PGX A;  4DQS A;  4AT8 A;  3WFS C;  5KG2 A;  1UA0 A;  3RH4 A;  1NK8 A;  1COO A;  3OJU A;  1V4A A;  3Q8S B;  4F93 B;  4TQS A;  4FS1 A;  4RUC A;  2HHT A;  4RNM A;  3MDA A;  4KLT A;  3QEA Z;  5DG7 A;  3GIM A;  4J9K A;  5HNK A;  3HW8 A;  1U9L A;  5F9N A;  1NK0 A;  4F3O A;  3BQ0 A;  4F4W A;  3UPQ A;  1FA0 A;  4PGQ A;  2ISO A;  4S3N A;  4B9V A;  2VA2 A;  5EWG A;  1L5U A;  3RAQ A;  4GC6 A;  4K4H A;  1HUZ A;  5DLG A;  2NRT A;  4G3I A;  2GWS A;  5L1L A;  2OWO A;  2P6R A;  4O5E A;  4NLK A;  4PHP A;  4TUP A;  3ISD A;  2M2U A;  3PX6 A;  3WFR E;  2RDI A;  2IBK A;  1ZQT A;  2IMW P;  3ORY A;  1DK3 A;  5KT7 A;  4QZD A;  3T3F A;  4P4P A;  4JV1 A;  3H3A A;  3GIK A;  2ZH3 A;  2I1Q A;  5IIN A;  4YQW A;  1ZQY A;  2VA3 A;  4J9L A;  5KFY A;  4B9M A;  8ICH A;  9ICC A;  4GLX A;  4DQR A;  1L3T A;  2IHM A;  1VFG A;  4MEX A;  2DVI A;  1BPB A;  3PR5 B;  9ICU A;  1KLN A;  3AQM A;  2XY5 A;  1UEV A;  4I2B A;  1ZQD A;  4B9L A;  8ICF A;  3MR6 A;  3PR4 A;  2W8K A;  4RQ3 A;  3LWM A;  7ICQ A;  2VA8 A;  1L3U A;  8ICP A;  4AT9 B;  3RJE A;  4YCX A;  4LZG A;  4FH5 A;  1NK4 A;  4PGY A;  2FMQ A;  9ICA A;  4ZH4 A;  5DB9 A;  5KT6 A;  1Z00 B;  9ICT A;  1R8B A;  3C2M A;  1S76 D;  3RJH A;  1ZQJ A;  5J29 A;  5DB7 A;  1ZJM A;  1S0V A;  4RT2 A;  3HJ4 A;  2HHP A;  2ZHB A;  1ZQS A;  1JMS A;  4YVZ A;  1S97 A;  4WC1 A;  4X4U A;  4F2R A;  8ICQ A;  5KFZ A;  3RB4 A;  1V9P A;  7ICO A;  2IA6 A;  5KT2 A;  4YXJ A;  4P4O A;  4QZF A;  1RXW A;  4KLH A;  8ICM A;  4AT9 A;  1JX4 A;  2HVH A;  3C23 A;  4JWM A;  1F5A A;  4AT7 B;  2KZM A;  5J2G A;  4WBY A;  3JPQ A;  4JK1 A;  4GC7 A;  1ZQP A;  4MF2 A;  3Q8Q B;  4NY8 A;  4RQ8 A;  7ICR A;  1UT8 A;  4HYK A;  4X4S A;  4KMU A;  4JUZ A;  3ZDC A;  5F2V O;  4QZE A;  4F4X A;  4WC2 A;  1L3S A;  2PFO A;  3H8W A;  4WC3 A;  4KN4 A;  3PW5 A;  1K1S A;  5EOZ A;  9ICE A;  3RH5 A;  4M9G A;  4Q43 A;  3PX0 A;  3K75 D;  1IXR A;  5DG9 A;  5KG4 A;  4QZ9 A;  3GV5 B;  4ECZ A;  5KG7 A;  4B9T A;  2ZTC A;  4WBZ A;  3BJY A;  1PZN A;  1ZQX A;  4ECS A;  2ZJA A;  4DOC A;  4DS4 A;  4DLG A;  4DL2 A;  1ZQG A;  3FDS A;  1Y88 A;  1CUK A;  3GIJ A;  8ICK A;  3C66 A;  4FS2 A;  3B0X A;  4F5P A;  1SL0 A;  3OUY B;  2AU0 A;  3V6H A;  4EBD A;  3RJI A;  3NGD A;  1BPX A;  3KHR A;  5DKW A;  5J2C A;  2UVW A;  4ELT A;  2KTQ A;  2ZH5 A;  4R63 A;  4DQP A;  7ICH A;  9ICI A;  3OVS A;  4GXI A;  4DS5 A;  1ZQV A;  2BQR A;  1EXN A;  3H7I A;  4KLD A;  2XY7 A;  1KFT A;  4I2A A;  3EZ5 A;  2BCV A;  1D8L A;  2M9N A;  5KFF A;  2BGW A;  4X0B A;  1NK6 A;  5KFD A;  4BWJ A;  4MFC A;  4RWN A;  3GQC A;  3QEB Z;  4X4O A;  2XY6 A;  1SZP A;  2C2D A;  2J6U A;  2PFN A;  3RBE A;  5KT5 A;  4MFA A;  4DSE A;  1UET A;  4F4Y A;  4F5O A;  3UPS A;  4NLG A;  2BR0 A;  2P6U A;  1SKW A;  2JEF A;  9ICB A;  4UAZ A;  4ELV A;  3RR8 A;  4R64 A;  4ED6 A;  4RNN A;  4O3P A;  4QZH A;  2AGP A;  5HRF A;  1TK8 A;  4C8O A;  3LWL A;  2BKE A;  5KFM A;  1S10 A;  4Z6E A;  3HX0 A;  1SKS A;  3Q8P B;  1ZYQ A;  4BDP A;  8ICV A;  2HHU A;  4RPX A;  4F92 B;  5DBB A;  4AT8 B;  3THV A;  5J0X A;  1QLN A;  3JYY A;  4B9N A;  5KG6 A;  1MIW A;  7ICF A;  4QWC A;  3HP6 A;  4KLU A;  1YLQ A;  3AQL A;  4DF8 A;  1KEJ A;  1RYS A;  2B21 A;  5DLF A;  3Q8R B;  3TAR A;  2FPM A;  1B43 A;  3HPO A;  4UQG A;  3ETL A;  4I2F A;  1R8C A;  4O3Q A;  3MR5 A;  4B9U A;  4RZR A;  5D49 A;  4NM2 A;  4BGD A;  4RQ1 A;  4F5R A;  3UXO A;  2FMS A;  2KP7 A;  1XSL A;  2W9M A;  3TAN A;  3RAX A;  4Q45 A;  4UB2 A;  3BDP A;  5DGB A;  4O5K A;  1LB2 B;  4NLZ A;  5HC9 A;  5DEC A;  1ZQF A;  1BPY A;  3AU2 A;  1QTM A;  9ICG A;  2NRV A;  1WCL A;  4RQ2 A;  4XQ8 A;  1HJP A;  2ZUB A;  2FPK A;  5J2F A;  2KZ3 A;  1MQ2 A;  2BCR A;  3SZ2 A;  1TK0 A;  4UAY A;  3PY8 A;  1ZJN A;  2BCQ A;  1HUO A;  4C8M A;  2UVU A;  4F8R A;  1DOQ A;  1NZP A;  4DEZ A;  5KFI A;  1IM4 A;  4DSJ A;  5HML A;  2C22 A;  3WFO A;  4NKU A;  4X4N A;  1N56 A;  1XU4 A;  5KFU A;  2NRW A;  3H40 A;  5CA7 A;  2BPC A;  5DQG A;  4DSF A;  3T5L A;  2ZH9 A;  5IIK A;  5TZV A;  5C5J A;  3GV7 B;  3OSP A;  2PFQ A;  3HT3 A;  4DFM A;  2ZUD A;  4DL7 A;  4IQV A;  2W9A A;  2ZJ5 A;  2R8H A;  2F1H A;  3RTV A; 
#chains in the Genus database with same CATH topology
 3QUB A;  4ELU A;  4RT3 A;  1SWV A;  5AIB A;  2H3V A;  4YXM A;  1CEZ A;  2BPF A;  3M9N B;  4UW9 A;  2Y9U A;  3OHB A;  3JPT A;  3RJK A;  2Y0S F;  3ZDD A;  3WFP A;  3HJE A;  2BDU A;  5KT3 A;  3EF2 A;  4I2C A;  5ALL A;  2KZZ A;  1TAQ A;  4ED0 A;  2F2A B;  1V38 A;  3KTQ A;  2NRX A;  3TAC B;  5KFQ A;  2ASJ A;  4BUG A;  2AJQ A;  5AKY A;  2YN4 A;  3NWI A;  1DRG A;  3EYZ A;  2EAO A;  4LVS A;  3VC8 A;  3ED5 A;  5AI4 A;  8ICU A;  1T94 A;  4M5D A;  1DGS A;  9ICL A;  4WC5 A;  4I29 A;  1NKE A;  4NXV A;  5D46 A;  3C1Z A;  4ED2 A;  3ICX A;  3HWT A;  4EP7 A;  2HHW A;  4XJE A;  1A77 A;  4YP3 A;  2FDR A;  3C28 A;  2Y1J A;  3DV9 A;  2I9G A;  3KZX A;  5DDM A;  1T4G A;  3U26 A;  1SWW A;  2BQ3 A;  4ECX A;  4Q44 A;  2FLP A;  3L9D A;  1T8E A;  4EX7 A;  3NYB A;  4XRH A;  3NVW A;  3SD7 A;  2A1J A;  3PHZ A;  4KB6 A;  4J9M A;  4O68 A;  4PHE A;  4EED A;  4MEY A;  1RYR A;  4ED3 A;  2Q4T A;  2A19 A;  3E58 A;  1ZRN A;  5AHX A;  3WKA A;  5ALE A;  2KFN A;  1QQ6 A;  1ZQH A;  4J9S A;  2FCL A;  5AM4 A;  3M9M B;  3NVO A;  2H3F A;  1U45 A;  5DG8 A;  3MC1 A;  3K4G A;  1BPZ A;  2ZTD A;  4LEZ A;  2W11 A;  2AGO A;  1T3Q A;  4XA5 A;  4O9M A;  4TUQ A;  4RWQ A;  4RQ5 A;  2N1R A;  1ZQZ A;  4ECY A;  1NZB A;  4WQK A;  5ALQ A;  2HBK A;  2CRX A;  5J2E A;  1TV9 A;  3C2L A;  4IR9 A;  4ATB A;  5KFT A;  3RH6 A;  3RRG A;  1TK5 A;  1UEU A;  4X4P A;  1QSS A;  1BNP A;  5L1K A;  1ZQI A;  3BQ2 A;  5AI9 A;  3HKZ C;  1DK2 A;  2YY6 A;  5HR9 A;  1FFU A;  4J9P A;  1U47 A;  2DFL A;  4DF4 A;  4CRX A;  1OXJ A;  2R18 A;  2ZIX A;  9ICK A;  2QB0 A;  4ED1 A;  3KHL A;  4NXT A;  1L3V A;  3RB6 A;  1SV4 A;  5BPC A;  1YZ7 A;  4DO9 A;  5HRB A;  4I0U A;  1ZD5 A;  5JTI A;  1RPL A;  4O67 A;  4EX6 A;  4WC7 A;  3NRW A;  4NXZ A;  4PH5 A;  5HRG A;  3I76 A;  3WKC A;  4JV2 A;  3C18 A;  4GIB A;  3OTQ A;  9ICX A;  4FH3 A;  4F5Q A;  4IQU A;  4TUR A;  2DRA A;  5DB8 A;  1A6S A;  2D6F C;  2JZB B;  5F9L A;  3G6X A;  1RQN A;  4FBT A;  4GXK A;  2JHD A;  4K9A A;  4JLX A;  2Q66 A;  2OXO A;  4WC0 A;  4WOY A;  4NV0 A;  1BVS A;  3UMC A;  3SR6 A;  3JPS A;  5JRT A;  4F4Z A;  4UD5 A;  4P4M A;  2RLT A;  1ZQA A;  4UD4 A;  2HHV A;  1NJW A;  4Y2U A;  2QLT A;  4BXO A;  2KEY A;  4KLS A;  2ZHA A;  4EBC A;  4KTQ A;  4LJX A;  2V9W A;  2AQ0 A;  9ICF A;  3MAB A;  1RG6 A;  4C7Y A;  4GXJ A;  1O03 A;  7ICP A;  2IUB A;  4AT7 A;  4Y2T A;  4F71 A;  2XCP A;  4DOA A;  4IRK A;  1QSL A;  5AM3 A;  5J8Y C;  3JCF A;  3K1R B;  5J2A A;  4RPZ A;  1NJX A;  3C5G A;  5AKG A;  5D63 A;  2M2W A;  4I2D A;  1WOT A;  1KDH A;  1N5X A;  3H0M B;  4QWA A;  1MC8 A;  5BOM A;  3AUO A;  1T3N A;  1N5W A;  5J0S A;  3E2E A;  3N28 A;  2F8L A;  2AQ4 A;  1VJ7 A;  4F50 A;  8ICJ A;  5D62 A;  3PW7 A;  1ZXI A;  4EBE A;  7ICL A;  1KKX A;  1TE2 A;  2KKP A;  1S9F A;  4ECW A;  5ALO A;  2G08 A;  3F2B A;  4KLJ A;  8ICO A;  4MFF A;  1L7M A;  4FZN A;  3V7J A;  2BHN A;  2BQU A;  4Y2J A;  4AP9 A;  3MGV A;  9ICR A;  5ALY A;  1NKC A;  3ALR A;  1K1Q A;  4X4V A;  5ALD A;  1Z3E B;  4UB5 A;  2QAR A;  5KG2 A;  1V4A A;  1X6I A;  4FFD A;  2KIW A;  3NKU A;  3QEA Z;  5HNK A;  2DKX A;  3PSF A;  4F3O A;  4F4W A;  4PGQ A;  2VA2 A;  3RAQ A;  1HUZ A;  3QU7 A;  2AHO B;  4O5E A;  2DBY A;  2EDU A;  1ZQT A;  3IP4 B;  5KT7 A;  4P0P B;  4JV1 A;  3H3A A;  4OCZ A;  2I1Q A;  5IIN A;  4YQW A;  1ZQY A;  4FZL A;  4J9L A;  5CFS A;  2OCE A;  2RP5 A;  1VFG A;  2IHM A;  5KAF U;  9ICU A;  3NVY A;  1ZQD A;  2BBH A;  2W8K A;  2NYV A;  2KIC A;  2W55 A;  3AN1 A;  3RJE A;  1IIP A;  4Y2Q A;  1NK4 A;  2FMQ A;  9ICT A;  2W03 A;  1O08 A;  5J29 A;  4WH5 A;  1S0V A;  2ZHB A;  1JMS A;  4YVZ A;  4NLB A;  4F2R A;  3RB4 A;  1V9P A;  5KT2 A;  1RXW A;  4AT9 A;  3C23 A;  4NXW A;  2HDO A;  4JUZ A;  1Z4N A;  4WC2 A;  3CYM A;  5AI0 A;  3KBB A;  4JMU A;  3H8W A;  4KN4 A;  2GOL A;  5EOZ A;  9ICE A;  3RH5 A;  1MA7 A;  3K75 D;  3GV5 B;  1PZN A;  4DOC A;  3SEN A;  2FI1 A;  1ZQG A;  3C66 A;  1Y88 A;  1CUK A;  3GIJ A;  4FS2 A;  4C80 A;  3V6H A;  4EBD A;  3KHR A;  1Q3V A;  2WB1 F;  1N63 A;  5AI5 A;  2ZH5 A;  3OVS A;  3WK4 A;  1J2M A;  5AIA A;  3EZ5 A;  4OAI Z;  1D8L A;  4K96 A;  5KFF A;  2HMX A;  4MFC A;  4RWN A;  3GQC A;  3QEB Z;  1SZP A;  2J6U A;  2K8A A;  3RBE A;  4F4Y A;  2BR0 A;  2B0C A;  4N7R A;  4ED6 A;  2YTU A;  4QZH A;  4FZM A;  3KKA A;  3LWL A;  2YMQ A;  4Y2Y A;  1S10 A;  1SKS A;  4RPX A;  3O0F A;  5J0X A;  3QX7 A;  4KMO B;  4CF4 A;  5KG6 A;  7ICF A;  4QWC A;  3AQL A;  3TAR A;  2FPM A;  5T14 A;  1B4F A;  1SXE A;  2H3I A;  4WJ3 B;  3M1Y A;  4O3Q A;  4EGW A;  4NM2 A;  4BGD A;  4RQ1 A;  3UXO A;  1XSL A;  2KOB A;  4Q45 A;  4NLZ A;  4O5K A;  1LB2 B;  5HC9 A;  3F5E A;  1QTM A;  9ICG A;  2VIX A;  4XQ8 A;  4I2A A;  3PY8 A;  4UAY A;  2ZXH A;  1DOQ A;  1IM4 A;  4X4N A;  4NKU A;  2ZH9 A;  4DSF A;  5IIK A;  4F72 A;  3HT3 A;  4DL7 A;  2W9A A;  4TQS A;  2ZJ5 A;  2W54 A;  5J0Q A;  2ZIV A;  4MF8 A;  1OU5 A;  4I2J A;  2Z7J A;  4ECV A;  1JRO A;  3V6K A;  1LV5 A;  5J2D A;  5L9X A;  5KFL A;  4USA A;  2PI4 A;  2MRL A;  3Q8L A;  4E7X A;  5ALR A;  3H4B A;  1MIY A;  2XGQ A;  3TQ1 A;  3OHA A;  3C2K A;  5KT4 A;  9ICS A;  1XWL A;  4U6P A;  1JAJ A;  5CHG A;  1BPD A;  2YMP A;  4QZG A;  4R65 A;  3I28 A;  2WHE A;  2V4R A;  2UVR A;  3OSN A;  3H4D A;  7ICJ A;  5DBA A;  4Q8E A;  3C5F A;  3TFR A;  3L3F X;  4YMN A;  5J0P A;  2GH1 A;  3HIL A;  1FIQ A;  3FYH A;  4F5N A;  7ICK A;  5IIO A;  2PXI A;  2W3R A;  1R8A A;  1VJ5 A;  2MUT A;  4AYB F;  2IOH A;  5CP2 A;  5J0U A;  3LQC B;  3PML A;  3SEI A;  1X42 A;  2ZIW B;  2MAX A;  2C2E A;  3TAQ A;  1TAU A;  4LEV A;  5B3Q A;  1SL1 A;  1KTQ A;  4CNQ A;  5AM0 A;  2ODG A;  1JIH A;  2I5H A;  4YMO A;  4FBU A;  4DL3 A;  4C8K A;  4P0Q B;  1ZQN A;  5B66 U;  5KFE A;  5GTH U;  4E0D A;  2FMP A;  2M2V A;  4NLN A;  5KFH A;  5J0T A;  4DL4 A;  1B0X A;  4KN7 A;  5EWE A;  4YR0 A;  4KLM A;  1C20 A;  3PZP A;  1L7P A;  2NRZ A;  3AM9 A;  2KFZ A;  3WK7 A;  4KX5 A;  5KFP A;  5HHH A;  1KRP A;  3Q8K A;  4WC4 A;  1AQ6 A;  3IRU A;  2BCS A;  3T5H A;  2UVV A;  3ZD8 A;  1RZT A;  4EZ9 A;  2EZZ A;  3IG8 A;  3PVX A;  3QU5 A;  3ZDA A;  1ARO P;  2RDJ A;  4YD1 A;  1ZET A;  2E8O A;  2WF5 A;  4M6W A;  5KG1 A;  1H38 A;  3PW0 A;  2JEG A;  2VAN A;  3WU2 U;  4CCH A;  1X40 A;  3B0Y A;  2WAQ C;  1KL9 A;  4IG8 A;  5ALH A;  5HRD A;  1MQ3 A;  2K4E A;  3V7K A;  1FO4 A;  1Z19 A;  1XC9 A;  2AXT U;  2M0N A;  1CRX A;  5DED A;  1NOM A;  2HOF A;  4NL9 A;  3SV3 A;  5JU5 A;  3LVW A;  1ZQO A;  2G06 A;  4FO6 A;  1XS9 D;  2RRD A;  2GA9 D;  2P35 A;  3UMB A;  2WF8 A;  1NK7 A;  1XSN A;  1Q79 A;  1QCK A;  1PK1 B;  5KFX A;  1SKR A;  3LVV A;  2YML A;  2YMM A;  4OD0 A;  2ZJ8 A;  4R8U B;  4YR3 A;  5JTG A;  1ZQK A;  3JPR A;  1D8B A;  4OAF A;  4DFJ A;  3AQK A;  2OHF A;  4J9N A;  2JEJ A;  4P0P A;  2RFF A;  4DSI A;  4QWD A;  3UXP A;  3GFK B;  2W9C B;  4K99 A;  4PZN A;  1WUD A;  4CDG A;  2K4H A;  2JEI A;  1N48 A;  5ALU A;  3OV7 A;  5J0O A;  2XO7 A;  4FHW A;  2W43 A;  3NVZ A;  5HRI A;  2PBE A;  2W9B B;  4RUA A;  3QU4 A;  5KTQ A;  4KLL A;  4GFJ A;  1SV0 A;  4OJL A;  1JXL A;  4M2Y A;  3QXG A;  4NXX A;  8ICZ A;  4X4Q A;  4QW9 A;  9ICQ A;  1C7Y A;  1N2X A;  3GZF A;  3H37 A;  5ALK A;  3M8S A;  3LDA A;  5HMM A;  2Q0Z X;  3KHH A;  5HRK A;  5J2I A;  5ALJ A;  2ZH4 A;  1BNO A;  4UAS A;  1JQR A;  1FFV A;  5L1J A;  2W8L A;  1ZQE A;  1ZQU A;  4RQ7 A;  4PHD A;  4O3O A;  5IIM A;  2HI0 A;  1J97 A;  2W7P A;  2ZH7 A;  1PVP A;  2KN7 A;  2ZH8 A;  8ICT A;  4IC9 A;  1PVR A;  2M2T A;  4C4S A;  1D9F A;  5CFU A;  5F3X B;  8ICB A;  3TAD C;  2W3S A;  2Y9T A;  2R8G A;  4K9B A;  1BGX T;  4CE6 A;  4OJ5 A;  2J6S A;  5KFG A;  2F8K A;  4YR2 A;  5C0Y A;  4EYH B;  1XO0 A;  5IIL A;  2J6T A;  5KFN A;  4PZO A;  1GPJ A;  1KFD A;  3H39 A;  3M9O B;  4EEN A;  2ALZ A;  3A0B U;  8ICX A;  4G9B A;  1ZD2 P;  2DF4 B;  3I1Y A;  5CJ7 A;  4ECU A;  3WFS C;  1UA0 A;  3RH4 A;  1NK8 A;  4RQM A;  4FS1 A;  4RUC A;  3HW8 A;  5F9N A;  1NK0 A;  4O6A A;  4FO1 A;  1YT3 A;  1FA0 A;  2ISO A;  3BS5 B;  5EWG A;  4O69 A;  4K4H A;  2GWS A;  4NLK A;  1PUZ A;  3M6K A;  3WFR E;  4QIW C;  1UHU A;  3ORY A;  2KSO B;  4QZD A;  2HOI A;  3GIK A;  2ZH3 A;  3R9K A;  2D8C A;  5KFY A;  8ICH A;  4GLX A;  2DVI A;  1KLN A;  1VLB A;  2XY5 A;  4B9L A;  8ICF A;  3N7R C;  3MR6 A;  4YCX A;  1RQL A;  9ICA A;  3RJH A;  5DB7 A;  2PMZ C;  4RT2 A;  2HHP A;  4JLZ A;  1S97 A;  1TAM A;  4X4U A;  1ZD3 A;  5KFZ A;  7ICO A;  4KLH A;  8ICM A;  2HVH A;  4US8 A;  1F5A A;  5J2G A;  4JK1 A;  2EH9 A;  4FE3 A;  5F2V O;  4QZE A;  4F4X A;  1L3S A;  1OUQ A;  4WC3 A;  1JI7 A;  3PW5 A;  4Q43 A;  4ECZ A;  4B9T A;  4HX0 A;  3BJY A;  5G5G A;  4OAG A;  2ZJA A;  2D3D A;  4DLG A;  8ICK A;  2IOF K;  1BPX A;  5DKW A;  1WYG A;  2KTQ A;  2H3Z A;  4R63 A;  2LM1 A;  9ICI A;  4GXI A;  2EAM A;  1ZQV A;  2BQR A;  4KLD A;  2XY7 A;  2ZIW A;  2BCV A;  2KKV A;  4X0B A;  5AK6 A;  5KFD A;  4A8E A;  3F2C A;  2LBO A;  2ZXI A;  4ICA A;  2FE9 A;  2LKY A;  2EAN A;  2KK0 A;  5AKJ A;  4MFA A;  4DSE A;  1UET A;  5AKH A;  4F5O A;  3WK8 A;  2YQE A;  1SKW A;  5CRX A;  4UAZ A;  3RR8 A;  4R64 A;  5HR7 A;  2AGP A;  2BKE A;  5KFM A;  1ZYQ A;  4OJ6 A;  4F92 B;  5DBB A;  4AT8 B;  5AK3 A;  4OJO A;  1PVQ A;  3HP6 A;  4KLU A;  4DF8 A;  1RYS A;  4K8V A;  1B43 A;  3HPO A;  2HN2 A;  2LYA A;  2W9M A;  3RAX A;  2HBJ A;  2KZ3 A;  2BCR A;  3SZ2 A;  1TK0 A;  3CK6 A;  2JR5 A;  4F8R A;  3QYP A;  3QUT A;  3WFO A;  3WK9 A;  2WFA A;  1XU4 A;  2E5S A;  4CF3 A;  3H40 A;  5CA7 A;  5DQG A;  5TZV A;  3GV7 B;  4DFM A;  2OEH A;  4IQV A;  2W7O A;  2F1H A;  4UAT A;  3B9J A;  3OJS A;  4O5C A;  1SIJ A;  1UA1 A;  1RYU A;  4Y2V A;  4DFP A;  3ONN A;  5AM5 A;  3ZI4 A;  3HJ1 A;  3KD3 A;  5AKK A;  3BZK A;  3MGH A;  3PW4 A;  2DR7 A;  4TUS A;  2EQY A;  3WKB A;  2HHQ A;  3V7L A;  3OGU A;  2W04 A;  1MN8 A;  5E79 U;  5KFV A;  3H8J A;  5CB1 A;  2DPI A;  5D4B A;  2GAF D;  1WCN A;  2OH2 A;  2F1J A;  8ICA A;  2K8C B;  3Q8M A;  3EW9 A;  2ISP A;  5KG3 A;  7ICU A;  4KLG A;  1D8Y A;  3OVB A;  4Z6F A;  4MHV A;  5KFO A;  3GU3 A;  1MSW D;  2EZX A;  2DGZ A;  1JN3 A;  5CEH A;  1ZQW A;  3OWG A;  5J2H A;  4UB4 A;  1L8L A;  5CR0 A;  4M0A A;  4M9L A;  2JH1 A;  5ALV A;  2DPJ A;  4R8U A;  4F4K A;  3UQ0 A;  4Z6C A;  3GIL A;  5DDY A;  4KM5 A;  2IOF A;  5J2J A;  2V4Q A;  2F44 A;  2JRZ A;  4M04 A;  2FLL A;  1PK3 A;  4EZ6 A;  2LHT A;  3C1Y A;  5IIJ A;  1QQ7 A;  4QZI A;  4FHV A;  1URJ A;  5ALX A;  4XQ7 A;  3MFH A;  1X2I A;  4NKT A;  1X6J A;  4U7C A;  5KG5 A;  1L8O A;  3AEV A;  3PSP A;  3GV8 B;  2OYY A;  2HOQ A;  2XIC A;  1P7D A;  3RJG A;  1S0N A;  3H0L B;  1S0O A;  1TFY A;  2ZTE A;  3N4M B;  1V85 A;  3RFA A;  4B9S A;  5L1I A;  1LKY B;  3PNC A;  2P66 A;  5J8Y A;  5AKE A;  3PO5 A;  4DSL A;  4DSK A;  2XCA A;  4K4I A;  3AMZ A;  2WTF A;  3IHQ B;  5KFS A;  5H2F U;  2ZUC A;  5ALW A;  4ATB B;  1ZQQ A;  4JWN A;  3F5A A;  4K4G A;  4ED7 A;  1F44 A;  4M9J A;  1TFW A;  1TFR A;  1ZQC A;  4ECR A;  4E8F A;  1ZQ1 C;  3KHG A;  4P2H A;  4YFK A;  4M47 A;  4KX3 A;  5CHE A;  4IR1 A;  4FHP A;  1ECW A;  4QZB A;  5D61 A;  2KHV A;  4UBC A;  4QNL A;  5HP4 A;  5KFR A;  1D9D A;  4NL9 C;  2QB0 B;  2PFP A;  5ALN A;  4PHA A;  4K98 A;  3CNH A;  3D2S A;  2KNJ A;  2FPL A;  4M9H A;  5DGA A;  2BDP A;  1QH9 A;  3SV4 A;  4Q8F A;  1ZQR A;  4IRD A;  2B56 A;  4QWB A;  2ASD A;  2LM4 A;  2VJ5 A;  1FEZ A;  1WWU A;  4MKP A;  2JV3 A;  2F76 X;  2JGA A;  2DKZ A;  3ISB A;  2K8B B;  3V6J A;  3RR7 A;  2XC9 A;  2HVI A;  4DQI A;  5KG0 A;  4YG2 A;  3N97 B;  4B6J A;  1Z1V A;  3M6Z A;  4KLE A;  2ZG6 A;  3L5K A;  5BOL A;  3NUQ A;  4EEY A;  2MSN A;  5J2K A;  1T7P A;  4C8N A;  3G6V A;  9ICO A;  1ZOL A;  4YD2 A;  2R8J A;  3WFQ E;  3VCB A;  1XSP A;  1QSY A;  2E8P A;  2KSO A;  9ICV A;  2PKE A;  4BXO B;  2ASL A;  2C28 A;  5FP0 A;  4RPY A;  2LPE A;  3ZD9 A;  1NNL A;  2BZF A;  5HRE A;  3K7D A;  4LT6 A;  3K1Z A;  1UPH A;  4F2S A;  2JZB A;  2I6X A;  1TVA A;  1NK9 A;  1ZQM A;  5KFC A;  4DQQ A;  4LZD A;  3ZDB A;  4CGZ A;  1SV0 C;  4EBJ A;  2NO4 A;  3ER9 B;  2R8K A;  3GII A;  2H5X A;  3UXN A;  4DL6 A;  4YN4 A;  1RXV A;  4UB1 A;  8ICS A;  3LK9 A;  1JXE A;  1U49 A;  9ICM A;  3JPO A;  3RF9 A;  4DCC A;  1S77 D;  2K4P A;  3E0F A;  3TFS A;  4DLE A;  4EEK A;  4PPX A;  2H3Q A;  2QB1 A;  2EWR A;  2KHQ A;  4C4R A;  4WCW A;  1KFS A;  4OAH A;  2E8M A;  9ICJ A;  2GLE A;  3LYS A;  4UAR A;  4UB3 A;  4BWM A;  3T5J A;  2KIV A;  4RQ6 A;  3IN5 A;  4XUS A;  2A1A A;  3OPX A;  3T5K A;  4RWO A;  3BZC A;  4OJP A;  3N7S C;  3QZ8 A;  2O5A A;  4DFD A;  2KG5 A;  4I27 A;  1NO5 A;  3L4P A;  4ACO A;  2K60 A;  5G5H A;  3BQT A;  4WC6 A;  4M9N A;  5K4L A;  4KLF A;  1S0M A;  2O1P A;  3BS7 A;  1YZ6 A;  2LYH A;  5KFK A;  7ICE A;  4EBK A;  4X4T A;  1WWV A;  5DBC A;  3JZ0 A;  3PSI A;  4DQS A;  1DXS A;  2WF9 A;  1COO A;  3OJU A;  4F93 B;  2Y0S C;  4KLT A;  4J9K A;  3BQ0 A;  4B9V A;  1Q3U A;  4IL6 U;  4GC6 A;  5DLG A;  2G09 A;  2A3V A;  4G3I A;  2B4V A;  2OWO A;  3S6J A;  5L1L A;  1S5L U;  5CFT A;  3D2Q A;  5AKZ A;  3PX6 A;  3FM9 A;  2IMW P;  2MA1 A;  2FJ6 A;  3J81 j;  2WAQ F;  3T3F A;  4UAU A;  2VA3 A;  2JMG A;  4B9M A;  9ICC A;  2WF7 A;  4Y2P A;  4DQR A;  4MEX A;  3AQM A;  1UEV A;  2CN1 A;  4I2B A;  5KNI A;  3PR4 A;  4RQ3 A;  2VA8 A;  1L3U A;  4AT9 B;  5AI8 A;  4LZG A;  4FH5 A;  4PGY A;  4ZH4 A;  5DB9 A;  5KT6 A;  1Z00 B;  1R8B A;  3C2M A;  1S76 D;  1J2N A;  1ZJM A;  2E3T A;  3SQI A;  8ICQ A;  2IA6 A;  2KJ9 A;  4QZF A;  5ALG A;  1JX4 A;  4WBY A;  3JPQ A;  4NY8 A;  4RQ8 A;  1UT8 A;  4KMU A;  5ALM A;  2PFO A;  3ER8 C;  1K1S A;  2KV2 A;  4M9G A;  4WQL A;  3PX0 A;  3KFU F;  3NS1 A;  2ZTC A;  3AQE A;  4UB6 U;  5EE9 A;  1ZQX A;  2KVS A;  4DS4 A;  1SL0 A;  3OUY B;  2ZIU B;  2AU0 A;  4HAI A;  3RJI A;  1HEK A;  1F0M A;  2UVW A;  4DQP A;  7ICH A;  1Q8K A;  4DS5 A;  1EXN A;  1A0P A;  2B51 A;  2BGW A;  4C4T A;  1SZH A;  1NK6 A;  4BWJ A;  4X4O A;  2VKQ A;  2XVT A;  5AM2 A;  5ALF A;  2PFN A;  3FC4 A;  3QU9 A;  1KBU A;  2P6U A;  9ICB A;  4RNN A;  5HRF A;  3NVV A;  2L5Y A;  2XI9 A;  4Z6E A;  2HHU A;  3THV A;  5AKX A;  1QLN A;  3JYY A;  4B9N A;  1MIW A;  2MU2 A;  2LI6 A;  2HSZ A;  1YLQ A;  2KE7 A;  2IHO A;  3FAH A;  2B21 A;  3Q8R B;  3H0R B;  1LKY A;  3ETL A;  4I2F A;  3MR5 A;  1XNS A;  4RZR A;  5D49 A;  4F5R A;  2FMS A;  3NRZ A;  3TAN A;  4UB2 A;  2YX8 A;  1F5S A;  2NRV A;  2ZIV B;  1WCL A;  4RQ2 A;  5J2F A;  2FPK A;  1KW4 A;  2O6K A;  1IG6 A;  4QJF B;  1UCV A;  1ZJN A;  3ERC C;  5HML A;  3WKD A;  2NRW A;  3T5L A;  2KMD A;  5C5J A;  3OSP A;  2PFQ A;  2OM6 A;  2R8H A;  8ICG A;  4NWI A;  3RTV A;  3CP8 A;  8ICR A;  2NRK A;  2QKQ A;  4KIT B;  3KOO A;  7ICS A;  3H8S A;  3RJJ A;  4IQT A;  3MR3 A;  1MIV A;  4LEW A;  3HKZ F;  1U4B A;  3GDX A;  2EZY A;  3C21 A;  4IS7 A;  1XO1 A;  1B22 A;  4X4R A;  8ICY A;  5KL1 B;  1KNY A;  3QNM A;  3PW2 A;  2PI5 A;  4NJ8 A;  2FLN A;  5J2B A;  1COK A;  2MUT B;  4PL2 A;  4QIW F;  1NKB A;  2F77 X;  3BQ1 A;  4QW8 A;  4DOB A;  5AM1 A;  3PO4 A;  2Y1I A;  1TKD A;  5TIS U;  2F1I A;  4TQR A;  3JPP A;  1RDF A;  3DEE A;  7ICT A;  1OW5 A;  2ZH2 A;  5AI6 A;  5AK5 A;  3SAG A;  2DWQ A;  3AQN A;  4EEB A;  1ZD4 A;  1NI3 A;  4NM1 A;  3F53 A;  8ICL A;  4EYI B;  3A0H U;  2EAP A;  7ICN A;  2ZH1 A;  1CI4 A;  2PMZ F;  2RHF A;  8ICN A;  2G5H B;  8ICI A;  3QU2 A;  4UAW A;  4IQW A;  8ICW A;  5B5E U;  4FHY A;  4QZA A;  4RWP A;  4BX9 C;  5KFB A;  4O3S A;  1N61 A;  3ISC A;  3EWA A;  3JPN A;  4KLQ A;  2YB4 A;  4O3R A;  3UQ2 A;  2DR5 A;  4RQ4 A;  4O3N A;  1IV8 A;  4ZOH C;  1NJY A;  4Y2X A;  4C8L A;  3AQF A;  5J0Y A;  3KKA C;  4UBB A;  1BPE A;  4UAV A;  2HHS A;  1Q78 A;  1N62 A;  4P0Q A;  5AIC A;  3IM1 A;  4RQN A;  3QE9 Y;  3IG5 A;  4J9R A;  1X9S A;  4EEL A;  4Y2S A;  3T79 A;  2DRB A;  5ALT A;  2YB1 A;  2HHX A;  4M6W B;  5EE0 A;  5JUM A;  2DR9 A;  2G07 A;  1X9W A;  9ICP A;  4J9O A;  1DGJ A;  3ETR A;  2LYB A;  2DL0 A;  4ECQ A;  9ICH A;  3EPG A;  5KFJ A;  1SXD A;  4RQ0 A;  4I2I A;  5KFW A;  3SYZ A;  3TAD A;  4PJ0 U;  9ICW A;  3AU6 A;  3D6J A;  3MFI A;  4X0A A;  5KAI U;  3ZDE A;  2KVC A;  5AKL A;  5EE1 A;  3G6Y A;  5J0W A;  1RM6 C;  3RJF A;  3PMN A;  4K97 A;  4DWI A;  2WF6 A;  3QZ7 A;  4J9Q A;  2AGQ A;  2BPG A;  3MDC A;  1SB3 C;  3MCR A;  5DB6 A;  2ZH6 A;  2BBJ A;  4ECT A;  4I2G A;  4NLC A;  4PL1 A;  3MGI A;  5CWR A;  4Z6D A;  1X9X A;  5ALS A;  1N60 A;  5HRH A;  4X5V A;  3AL0 B;  3HIY A;  3PX4 A;  3MR2 A;  2KJ8 A;  2BE3 A;  5HRL A;  5ALZ A;  5GTI U;  4CF5 A;  3RRH A;  3HRD D;  3KZI U;  4O0I A;  3QUC A;  3OVA A;  4F91 B;  2AH5 A;  4YMM A;  1KSP A;  4LEY A;  4I28 A;  5EWF A;  4I2E A;  1WG8 A;  1PK1 A;  1L7O A;  5AK4 A;  2DQN B;  4E80 A;  3RBD A;  4ED8 A;  2R8I A;  4QZC A;  4JV0 A;  1ZQB A;  2BCU A;  3TAP A;  1R89 A;  3M8R A;  3UM9 A;  2ID1 A;  2XGP A;  3EUB 2;  1NK5 A;  5DQI A;  3PST A;  7ICV A;  7ICM A;  3EPI A;  3PV8 A;  2WB1 C;  4NXU A;  3V72 A;  3SI8 A;  2C2R A;  4RU9 A;  2HN1 A;  3WK6 A;  2A1J B;  1NJZ A;  1Z00 A;  2CXY A;  2HW3 A;  4QWE A;  1JAL A;  1UQV A;  5DQH A;  5ALP A;  2W9C A;  7ICI A;  1LVH A;  3NTU A;  7ICG A;  2HBL A;  1SGG A;  2NV3 A;  2G0A A;  4Y2R A;  1JRP A;  1A76 A;  1X9M A;  5B3P A;  5KFA A;  4KLO A;  2W9B A;  1SL2 A;  4EV6 A;  3CW2 C;  2IHN A;  4KLI A;  5HR6 A;  3MBY A;  1U48 A;  4R66 A;  2KD1 A;  4I2H A;  2K89 A;  8ICE A;  2HCF A;  2DR8 A;  4DL5 A;  1UT5 A;  1L6N A;  3OUY A;  2ZIU A;  4O3M A;  3H38 A;  8ICC A;  4RNO A;  4IRC A;  2NO5 A;  5J0R A;  2ATL A;  3SAF A;  2ESE A;  3RB3 A;  5III A;  4QZ8 A;  3RB0 A;  4DFK A;  1PX5 A;  9ICN A;  3H8M A;  1V97 A;  3D2N A;  3TI0 A;  2ZIX B;  4FHX A;  5HHI A;  1ZQL A;  3NAS A;  2DUY A;  4PGX A;  4C0Z A;  3Q8S B;  2HHT A;  4RNM A;  2RQ5 A;  3MDA A;  5DG7 A;  3GIM A;  1U9L A;  2CPR A;  3UPQ A;  4S3N A;  1L5U A;  5A0L A;  2ES6 A;  2NRT A;  2LMR A;  2P6R A;  4PHP A;  4TUP A;  3ISD A;  2M2U A;  2RDI A;  2IBK A;  5EE3 A;  1DK3 A;  4P4P A;  1M6Y A;  3C29 A;  3BS5 A;  4UB8 U;  3BQ7 A;  1L3T A;  2VJ4 A;  1BPB A;  3PR5 B;  3TKA A;  4AYB C;  3IDW A;  3LWM A;  2JH7 A;  7ICQ A;  8ICP A;  2E1F A;  2B6G A;  4J03 A;  2F3N A;  1ZQJ A;  2HBM A;  1ZRM A;  3HJ4 A;  2GO7 A;  1ZQS A;  5AKI A;  4WC1 A;  4BJQ A;  1Q46 A;  4YXJ A;  4P4O A;  2G5I B;  3IV6 A;  4JWM A;  4AT7 B;  2KZM A;  1QQ5 A;  4GC7 A;  2E1E A;  1ZQP A;  3Q8Q B;  4MF2 A;  7ICR A;  2KJ5 A;  4HYK A;  4X4S A;  3ZDC A;  2XID A;  1IXR A;  5DG9 A;  5KG4 A;  4QZ9 A;  4WBZ A;  5KG7 A;  4ECS A;  4DL2 A;  3FDS A;  1S8O A;  4US9 A;  3B0X A;  4F5P A;  1KQQ A;  3F2D A;  3NGD A;  1X66 A;  5J2C A;  4ELT A;  5L1M A;  3H7I A;  5KL8 B;  1KFT A;  2M9N A;  1Z1B A;  2E8N A;  2XY6 A;  2C2D A;  3QUQ A;  5KT5 A;  3UPS A;  3WKE A;  4NLG A;  1JUD A;  3M7D A;  2JEF A;  4ELV A;  3SAH A;  3WK5 A;  4O3P A;  3SMV A;  1TK8 A;  4C8O A;  3N7P D;  2QAR B;  3HX0 A;  3Q8P B;  4BDP A;  8ICV A;  1VDV A;  1ED1 A;  1KEJ A;  1GO3 F;  5DLF A;  4C7Z A;  4UQG A;  1R8C A;  4B9U A;  4OO1 J;  2KP7 A;  4AT8 A;  3BDP A;  5DGB A;  5DEC A;  1ZQF A;  1BPY A;  3AU2 A;  2K4I A;  4JB3 A;  3DDH A;  1HJP A;  1HIW A;  2ZUB A;  1MQ2 A;  3CRX A;  3UMG A;  2BCQ A;  1HUO A;  4C8M A;  2UVU A;  1K5O A;  2JXJ A;  1NZP A;  1Z4O A;  5ALI A;  5KFI A;  4DEZ A;  2C22 A;  4DSJ A;  1N56 A;  5KFU A;  2BPC A;  1L7N A;  2ZUD A;  1KN5 A; 
#chains in the Genus database with same CATH homology
 5J0Q A;  8ICR A;  4MF8 A;  3OJS A;  4ELU A;  4RT3 A;  4O5C A;  2NRK A;  1OU5 A;  4I2J A;  1UA1 A;  4KIT B;  4DFP A;  4YXM A;  7ICS A;  3H8S A;  4ECV A;  3V6K A;  1LV5 A;  4IQT A;  5J2D A;  3MR3 A;  5L9X A;  3M9N B;  2BPF A;  3RJJ A;  1CEZ A;  1U4B A;  1MIV A;  5KFL A;  3HJ1 A;  3GDX A;  3C21 A;  3OHB A;  3JPT A;  3RJK A;  2PI4 A;  1XO1 A;  3Q8L A;  3ZDD A;  3MGH A;  3PW4 A;  1B22 A;  4TUS A;  4E7X A;  3WFP A;  4X4R A;  8ICY A;  2DR7 A;  5KT3 A;  2HHQ A;  3H4B A;  4I2C A;  3V7L A;  2KZZ A;  1TAQ A;  4ED0 A;  1KNY A;  3OGU A;  1MIY A;  2XGQ A;  3TQ1 A;  3PW2 A;  2PI5 A;  5KFV A;  3H8J A;  5CB1 A;  3KTQ A;  2NRX A;  5KFQ A;  3OHA A;  3C2K A;  2ASJ A;  2DPI A;  5D4B A;  1WCN A;  2F1J A;  5KT4 A;  8ICA A;  9ICS A;  3Q8M A;  2FLN A;  1XWL A;  1JAJ A;  5J2B A;  2AJQ A;  3EW9 A;  2ISP A;  5KG3 A;  7ICU A;  5CHG A;  2MUT B;  1NKB A;  1BPD A;  4KLG A;  4QZG A;  3EYZ A;  4R65 A;  3BQ1 A;  1D8Y A;  4QW8 A;  4LVS A;  4DOB A;  3OVB A;  2V4R A;  2UVR A;  3OSN A;  3H4D A;  3PO4 A;  7ICJ A;  4Z6F A;  5KFO A;  5DBA A;  4Q8E A;  3C5F A;  3TFR A;  2Y1I A;  1TKD A;  4YMN A;  1MSW D;  1JN3 A;  2F1I A;  5J0P A;  1ZQW A;  4TQR A;  5J2H A;  3FYH A;  8ICU A;  4UB4 A;  3JPP A;  4F5N A;  7ICK A;  4M5D A;  1DGS A;  5IIO A;  9ICL A;  7ICT A;  4WC5 A;  2PXI A;  5CR0 A;  4I29 A;  4M0A A;  1NKE A;  1R8A A;  4M9L A;  2ZH2 A;  2MUT A;  5D46 A;  3C1Z A;  5CP2 A;  2DPJ A;  4ED2 A;  4R8U A;  5J0U A;  4F4K A;  3LQC B;  3PML A;  3UQ0 A;  3AQN A;  4Z6C A;  3GIL A;  4NM1 A;  5DDY A;  3HWT A;  8ICL A;  2MAX A;  2C2E A;  4EYI B;  5J2J A;  3TAQ A;  4UD5 A;  2V4Q A;  4EP7 A;  2HHW A;  7ICN A;  2ZH1 A;  1A77 A;  4M04 A;  4YP3 A;  1TAU A;  8ICN A;  2FLL A;  8ICI A;  4EZ6 A;  3C1Y A;  5IIJ A;  4QZI A;  1SL1 A;  4FHV A;  4UAW A;  1KTQ A;  4IQW A;  2Y1J A;  8ICW A;  4XQ7 A;  2I9G A;  4FHY A;  4QZA A;  4RWP A;  5DDM A;  1T4G A;  3MFH A;  1JIH A;  5KFB A;  1X2I A;  4ECX A;  4Q44 A;  2BQ3 A;  4O3S A;  4YMO A;  2FLP A;  4FBU A;  4DL3 A;  4C8K A;  3L9D A;  4NKT A;  1T8E A;  1ZQN A;  5KFE A;  3ISC A;  3EWA A;  3JPN A;  4E0D A;  2FMP A;  4KLQ A;  4O3R A;  5KG5 A;  2M2V A;  3UQ2 A;  2DR5 A;  4RQ4 A;  4O3N A;  3NYB A;  4NLN A;  4XRH A;  1NJY A;  5KFH A;  3GV8 B;  5J0T A;  4DL4 A;  4C8L A;  2A1J A;  4KN7 A;  5EWE A;  4YR0 A;  4KLM A;  4J9M A;  5J0Y A;  4UBB A;  1BPE A;  2NRZ A;  3RJG A;  4PHE A;  1S0N A;  2HHS A;  2KFZ A;  4MEY A;  1Q78 A;  1S0O A;  1TFY A;  2ZTE A;  3IM1 A;  3N4M B;  1RYR A;  5KFP A;  5HHH A;  3QE9 Y;  1KRP A;  3Q8K A;  5L1I A;  4B9S A;  3PNC A;  4ED3 A;  4J9R A;  1X9S A;  2P66 A;  4WC4 A;  2DRB A;  2KFN A;  1ZQH A;  4J9S A;  3PO5 A;  2BCS A;  4DSL A;  4DSK A;  3M9M B;  2XCA A;  4M6W B;  3T5H A;  4K4I A;  2HHX A;  1U45 A;  5DG8 A;  5JUM A;  2WTF A;  2UVV A;  2DR9 A;  3ZD8 A;  1RZT A;  4EZ9 A;  3K4G A;  3IHQ B;  5KFS A;  2ZTD A;  1BPZ A;  2ZUC A;  2AGO A;  4ATB B;  3PVX A;  1X9W A;  1ZQQ A;  4XA5 A;  4J9O A;  4ED7 A;  4TUQ A;  3ZDA A;  4JWN A;  1ARO P;  1TFR A;  2RDJ A;  4M9J A;  4O9M A;  4RWQ A;  1TFW A;  4ECQ A;  1ZQC A;  4ECR A;  9ICH A;  3EPG A;  5KFJ A;  4YD1 A;  4RQ5 A;  4E8F A;  1ZET A;  1ZQZ A;  4RQ0 A;  4ECY A;  4I2I A;  5KFW A;  3SYZ A;  3KHG A;  4P2H A;  4M6W A;  5KG1 A;  4YFK A;  1H38 A;  4M47 A;  3PW0 A;  2JEG A;  2VAN A;  9ICW A;  4CCH A;  3AU6 A;  5J2E A;  3MFI A;  1TV9 A;  3B0Y A;  3C2L A;  4X0A A;  4IR9 A;  3ZDE A;  4IR1 A;  4ATB A;  5KFT A;  4FHP A;  4QZB A;  3RH6 A;  3RRG A;  1TK5 A;  3G6Y A;  1UEU A;  4X4P A;  5J0W A;  4UBC A;  5HP4 A;  3PMN A;  3RJF A;  5KFR A;  1QSS A;  4K4G A;  1D9D A;  4IG8 A;  1BNP A;  5L1K A;  1ZQI A;  4DWI A;  3BQ2 A;  2PFP A;  5HRD A;  1MQ3 A;  3QZ7 A;  4PHA A;  3V7K A;  4J9Q A;  2AGQ A;  1DK2 A;  2FPL A;  1XC9 A;  5DGA A;  3MDC A;  2BPG A;  3SV4 A;  2BDP A;  4M9H A;  4Q8F A;  5DED A;  5HR9 A;  1NOM A;  8ICG A;  3SV3 A;  4J9P A;  5DB6 A;  1ZQR A;  1U47 A;  2ZH6 A;  2DFL A;  4ECT A;  4DF4 A;  4I2G A;  1ZQO A;  4FO6 A;  4IRD A;  1XS9 D;  9ICK A;  4QWB A;  2ASD A;  3MGI A;  5CWR A;  4Z6D A;  5HRH A;  4ED1 A;  4X5V A;  3KHL A;  1L3V A;  3RB6 A;  3HIY A;  3PX4 A;  5BPC A;  1NK7 A;  4DO9 A;  1XSN A;  5HRB A;  1Q79 A;  3MR2 A;  3V6J A;  3ISB A;  5KFX A;  3RR7 A;  1RPL A;  2XC9 A;  2HVI A;  5HRL A;  2BE3 A;  4WC7 A;  4NXZ A;  1SKR A;  4PH5 A;  5HRG A;  4DQI A;  5KG0 A;  4YG2 A;  4JV2 A;  3C18 A;  3N97 B;  3RRH A;  9ICX A;  4FH3 A;  2ZJ8 A;  4F5Q A;  4KLE A;  4IQU A;  4O0I A;  4R8U B;  4TUR A;  4YR3 A;  2DRA A;  5BOL A;  4EEY A;  1ZQK A;  5DB8 A;  5J2K A;  3JPR A;  1T7P A;  4F91 B;  4YMM A;  1KSP A;  3OVA A;  4C8N A;  4DFJ A;  4I28 A;  2JZB B;  5F9L A;  5EWF A;  3G6V A;  4I2E A;  3G6X A;  9ICO A;  3AQK A;  4YD2 A;  2R8J A;  3WFQ E;  1XSP A;  4J9N A;  1QSY A;  4E80 A;  2JEJ A;  9ICV A;  2RFF A;  3RBD A;  4FBT A;  4ED8 A;  2R8I A;  4QZC A;  4JV0 A;  1ZQB A;  2BCU A;  4GXK A;  3TAP A;  4DSI A;  1R89 A;  3M8R A;  4QWD A;  3UXP A;  4BXO B;  2ASL A;  2C28 A;  2Q66 A;  2ID1 A;  3GFK B;  4RPY A;  2XGP A;  2W9C B;  4WC0 A;  3ZD9 A;  5HRE A;  1NK5 A;  1BVS A;  5DQI A;  7ICV A;  4LT6 A;  7ICM A;  3EPI A;  3PV8 A;  4F2S A;  2JZB A;  2JEI A;  1TVA A;  3JPS A;  4F4Z A;  1NK9 A;  1N48 A;  1ZQM A;  3V72 A;  4P4M A;  3SI8 A;  5KFC A;  5J0O A;  4DQQ A;  4RU9 A;  2C2R A;  3OV7 A;  2XO7 A;  4LZD A;  2A1J B;  1ZQA A;  3ZDB A;  4FHW A;  1NJZ A;  1Z00 A;  4UD4 A;  9ICP A;  2HHV A;  1NJW A;  2HW3 A;  4QWE A;  4EBJ A;  2ZHA A;  4BXO A;  5HRI A;  4KLS A;  2R8K A;  2PBE A;  2W9B B;  4RUA A;  5DQH A;  3GII A;  5KTQ A;  2W9C A;  4EBC A;  2AQ0 A;  2H5X A;  2V9W A;  4KTQ A;  4KLL A;  7ICI A;  3UXN A;  9ICF A;  4DL6 A;  3MAB A;  3NTU A;  4YN4 A;  1RXV A;  4UB1 A;  7ICG A;  4GXJ A;  8ICS A;  3LK9 A;  1JXE A;  1JXL A;  4M2Y A;  4X4Q A;  8ICZ A;  1U49 A;  9ICM A;  3JPO A;  7ICP A;  4AT7 A;  1A76 A;  4QW9 A;  1X9M A;  1S77 D;  9ICQ A;  1C7Y A;  2XCP A;  4DOA A;  4IRK A;  5KFA A;  1QSL A;  3H37 A;  4KLO A;  3M8S A;  4DLE A;  3LDA A;  5HMM A;  2Q0Z X;  2W9B A;  3KHH A;  3TFS A;  1SL2 A;  5J2I A;  4PPX A;  5HRK A;  2ZH4 A;  5J2A A;  4RPZ A;  1NJX A;  3C5G A;  1BNO A;  1JQR A;  2IHN A;  4KLI A;  2M2W A;  4I2D A;  2W8L A;  5L1J A;  1ZQE A;  1WOT A;  1KDH A;  1ZQU A;  4WCW A;  4RQ7 A;  1KFS A;  4PHD A;  3MBY A;  1U48 A;  4O3O A;  5IIM A;  4QWA A;  4R66 A;  2ZH7 A;  1MC8 A;  4I2H A;  5BOM A;  2KN7 A;  8ICE A;  9ICJ A;  3AUO A;  2DR8 A;  4UB3 A;  4DL5 A;  1T3N A;  2ZH8 A;  1UT5 A;  8ICT A;  4BWM A;  3T5J A;  5J0S A;  3OUY A;  4RQ6 A;  3E2E A;  4XUS A;  3H38 A;  3T5K A;  2M2T A;  8ICC A;  1D9F A;  2AQ4 A;  4RWO A;  1VJ7 A;  8ICB A;  4F50 A;  4RNO A;  2R8G A;  8ICJ A;  1BGX T;  3PW7 A;  4IRC A;  5J0R A;  4EBE A;  7ICL A;  2J6S A;  5KFG A;  2ATL A;  1S9F A;  3RB3 A;  4ECW A;  5III A;  3QZ8 A;  4KLJ A;  4YR2 A;  4QZ8 A;  8ICO A;  4EYH B;  2O5A A;  5IIL A;  2J6T A;  5KFN A;  4I27 A;  3RB0 A;  4MFF A;  1NO5 A;  3V7J A;  2BHN A;  2BQU A;  1KFD A;  3BQT A;  3H39 A;  4DFK A;  1PX5 A;  9ICN A;  4WC6 A;  3M9O B;  4M9N A;  2ALZ A;  1S0M A;  4KLF A;  8ICX A;  2O1P A;  9ICR A;  2LYH A;  5KFK A;  3TI0 A;  1NKC A;  7ICE A;  4EBK A;  4FHX A;  4X4T A;  1K1Q A;  5HHI A;  1ZQL A;  5DBC A;  3JZ0 A;  4X4V A;  5CJ7 A;  4ECU A;  1Z3E B;  4UB5 A;  4PGX A;  4DQS A;  4AT8 A;  3WFS C;  5KG2 A;  1UA0 A;  3RH4 A;  1NK8 A;  1COO A;  3OJU A;  1V4A A;  3Q8S B;  4F93 B;  4TQS A;  4FS1 A;  4RUC A;  2HHT A;  4RNM A;  3MDA A;  4KLT A;  3QEA Z;  5DG7 A;  3GIM A;  4J9K A;  5HNK A;  3HW8 A;  1U9L A;  5F9N A;  1NK0 A;  4F3O A;  3BQ0 A;  4F4W A;  3UPQ A;  1FA0 A;  4PGQ A;  2ISO A;  4S3N A;  4B9V A;  2VA2 A;  5EWG A;  1L5U A;  3RAQ A;  4GC6 A;  4K4H A;  1HUZ A;  5DLG A;  2NRT A;  4G3I A;  2GWS A;  5L1L A;  2OWO A;  2P6R A;  4O5E A;  4NLK A;  4PHP A;  4TUP A;  3ISD A;  2M2U A;  3PX6 A;  3WFR E;  2RDI A;  2IBK A;  1ZQT A;  2IMW P;  3ORY A;  1DK3 A;  5KT7 A;  4QZD A;  3T3F A;  4P4P A;  4JV1 A;  3H3A A;  3GIK A;  2ZH3 A;  2I1Q A;  5IIN A;  4YQW A;  1ZQY A;  2VA3 A;  4J9L A;  5KFY A;  4B9M A;  8ICH A;  9ICC A;  4GLX A;  4DQR A;  1L3T A;  2IHM A;  1VFG A;  4MEX A;  2DVI A;  1BPB A;  3PR5 B;  9ICU A;  1KLN A;  3AQM A;  2XY5 A;  1UEV A;  4I2B A;  1ZQD A;  4B9L A;  8ICF A;  3MR6 A;  3PR4 A;  2W8K A;  4RQ3 A;  3LWM A;  7ICQ A;  2VA8 A;  1L3U A;  8ICP A;  4AT9 B;  3RJE A;  4YCX A;  4LZG A;  4FH5 A;  1NK4 A;  4PGY A;  2FMQ A;  9ICA A;  4ZH4 A;  5DB9 A;  5KT6 A;  1Z00 B;  9ICT A;  1R8B A;  3C2M A;  1S76 D;  3RJH A;  1ZQJ A;  5J29 A;  5DB7 A;  1ZJM A;  1S0V A;  4RT2 A;  3HJ4 A;  2HHP A;  2ZHB A;  1ZQS A;  1JMS A;  4YVZ A;  1S97 A;  4WC1 A;  4X4U A;  4F2R A;  8ICQ A;  5KFZ A;  3RB4 A;  1V9P A;  7ICO A;  2IA6 A;  5KT2 A;  4YXJ A;  4P4O A;  4QZF A;  1RXW A;  4KLH A;  8ICM A;  4AT9 A;  1JX4 A;  2HVH A;  3C23 A;  4JWM A;  1F5A A;  4AT7 B;  2KZM A;  5J2G A;  4WBY A;  3JPQ A;  4JK1 A;  4GC7 A;  1ZQP A;  4MF2 A;  3Q8Q B;  4NY8 A;  4RQ8 A;  7ICR A;  1UT8 A;  4HYK A;  4X4S A;  4KMU A;  4JUZ A;  3ZDC A;  5F2V O;  4QZE A;  4F4X A;  4WC2 A;  1L3S A;  2PFO A;  3H8W A;  4WC3 A;  4KN4 A;  3PW5 A;  1K1S A;  5EOZ A;  9ICE A;  3RH5 A;  4M9G A;  4Q43 A;  3PX0 A;  3K75 D;  1IXR A;  5DG9 A;  5KG4 A;  4QZ9 A;  3GV5 B;  4ECZ A;  5KG7 A;  4B9T A;  2ZTC A;  4WBZ A;  3BJY A;  1PZN A;  1ZQX A;  4ECS A;  2ZJA A;  4DOC A;  4DS4 A;  4DLG A;  4DL2 A;  1ZQG A;  3FDS A;  1Y88 A;  1CUK A;  3GIJ A;  8ICK A;  3C66 A;  4FS2 A;  3B0X A;  4F5P A;  1SL0 A;  3OUY B;  2AU0 A;  3V6H A;  4EBD A;  3RJI A;  3NGD A;  1BPX A;  3KHR A;  5DKW A;  5J2C A;  2UVW A;  4ELT A;  2KTQ A;  2ZH5 A;  4R63 A;  4DQP A;  7ICH A;  9ICI A;  3OVS A;  4GXI A;  4DS5 A;  1ZQV A;  2BQR A;  1EXN A;  3H7I A;  4KLD A;  2XY7 A;  1KFT A;  4I2A A;  3EZ5 A;  2BCV A;  1D8L A;  2M9N A;  5KFF A;  2BGW A;  4X0B A;  1NK6 A;  5KFD A;  4BWJ A;  4MFC A;  4RWN A;  3GQC A;  3QEB Z;  4X4O A;  2XY6 A;  1SZP A;  2C2D A;  2J6U A;  2PFN A;  3RBE A;  5KT5 A;  4MFA A;  4DSE A;  1UET A;  4F4Y A;  4F5O A;  3UPS A;  4NLG A;  2BR0 A;  2P6U A;  1SKW A;  2JEF A;  9ICB A;  4UAZ A;  4ELV A;  3RR8 A;  4R64 A;  4ED6 A;  4RNN A;  4O3P A;  4QZH A;  2AGP A;  5HRF A;  1TK8 A;  4C8O A;  3LWL A;  2BKE A;  5KFM A;  1S10 A;  4Z6E A;  3HX0 A;  1SKS A;  3Q8P B;  1ZYQ A;  4BDP A;  8ICV A;  2HHU A;  4RPX A;  4F92 B;  5DBB A;  4AT8 B;  3THV A;  5J0X A;  1QLN A;  3JYY A;  4B9N A;  5KG6 A;  1MIW A;  7ICF A;  4QWC A;  3HP6 A;  4KLU A;  1YLQ A;  3AQL A;  4DF8 A;  1KEJ A;  1RYS A;  2B21 A;  5DLF A;  3Q8R B;  3TAR A;  2FPM A;  1B43 A;  3HPO A;  4UQG A;  3ETL A;  4I2F A;  1R8C A;  4O3Q A;  3MR5 A;  4B9U A;  4RZR A;  5D49 A;  4NM2 A;  4BGD A;  4RQ1 A;  4F5R A;  3UXO A;  2FMS A;  2KP7 A;  1XSL A;  2W9M A;  3TAN A;  3RAX A;  4Q45 A;  4UB2 A;  3BDP A;  5DGB A;  4O5K A;  1LB2 B;  4NLZ A;  5HC9 A;  5DEC A;  1ZQF A;  1BPY A;  3AU2 A;  1QTM A;  9ICG A;  2NRV A;  1WCL A;  4RQ2 A;  4XQ8 A;  1HJP A;  2ZUB A;  2FPK A;  5J2F A;  2KZ3 A;  1MQ2 A;  2BCR A;  3SZ2 A;  1TK0 A;  4UAY A;  3PY8 A;  1ZJN A;  2BCQ A;  1HUO A;  4C8M A;  2UVU A;  4F8R A;  1DOQ A;  1NZP A;  4DEZ A;  5KFI A;  1IM4 A;  4DSJ A;  5HML A;  2C22 A;  3WFO A;  4NKU A;  4X4N A;  1N56 A;  1XU4 A;  5KFU A;  2NRW A;  3H40 A;  5CA7 A;  2BPC A;  5DQG A;  4DSF A;  3T5L A;  2ZH9 A;  5IIK A;  5TZV A;  5C5J A;  3GV7 B;  3OSP A;  2PFQ A;  3HT3 A;  4DFM A;  2ZUD A;  4DL7 A;  4IQV A;  2W9A A;  2ZJ5 A;  2R8H A;  2F1H A;  3RTV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...