4YN5A

Catalytic domain of bacillus sp. jamb-750 gh26 endo-beta-1,4-mannanase
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
391
structure length
391
Chain Sequence
b'IPKDSEGQSFKLVDSNASTLTKSLYAYLQDTSGRQILFGHQHAVDEGLTLTNSGDRVGSTQSEVKNAVGDYPAIFGWDTLSLDGYEKPGNEKNSQAQNRANVVQSMRTVHELGGIIALSMHPENFVTGNQYNDTSGDVVKNILPDGSHHEVFNAWLDNIAAFAHELTDQSTGELIPVIFRPFHEQNGGWFWWGAQTTTASEYKALYRYTVDYLRDVKGVNNFLYAFSPNAPFDGNLTQYLRTYPGDQYVDIFGLDQYDNKANAGQATFLNGLTQDLAMISKLADEKGKIAAFTEYGYSPQGFNETGNYLQWYTAVLEAIKKDPNASRIAYMQTWANFGYPTNMFVPYRDVNGNLGGDHELLPNFVEFYEDDYAAFLTEASGWNLYQDISTI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mannan endo-1,4-beta-mannosidase
publication title Crystal structure of Bacillus sp. JAMB-750 GH26 Endo-beta-1,4-mannanase
rcsb
source organism Bacillus sp. jamb750
molecule tags Hydrolase
total genus 146
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4yn5A00
2CYGA 4OBSA 2ZWZA 3MO4A 3GDBA 4E4PA 3VINA 3BAWA 3L4VA 1TVNA 2ZUSA 3IAQA 2VZVA 4UZUA 1HNYA 4ZENA 4DWSD 4ACZB 2CIPA 1UKOA 4GINA 2CBIA 4JFSA 1B3WA 1BGAA 1NP2A 1G01A 2XYLA 4CCCA 4DUXA 4EAMA 4JFUA 1JFHA 5A3HA 4GI8A 5E6YA 2WMIB 5A69A 4H7VA 2WYSA 3M6DA 1ZBWA 1R7AA 3QR3A 4AZGA 3VDAA 2EBNA 1TA3A 1CXKA 4P7NA 1MVYA 2J62A 2VCAA 3RPMA 4OUEA 1I1WA 2WLZA 1F4AA 1FFQA 5CG0A 1VFFA 4IM4A 5DF0A 1RD6A 1E5JA 4AWEA 2OWWA 2G8ZA 3DYPA 1UR2A 1PAMA 1HJUA 4JAWA 5HOSA 2XFYA 3W26A 4MAZA 1EOMA 1NM9A 4QLKA 1U30A 1NOUA 4TX8A 3I3EA 4HMEA 4M80A 5IHSA 2CBVA 1FH9A 1GZJA 1D2KA 4LXFA 1R7OA 1DWJM 2X0HA 1W9UA 4H2CA 3MMWA 1W9PA 1FHLA 3SCSA 3FHAA 3VIIA 2RGLA 5IDIA 3KL5A 2E8ZA 2VQTA 4L4PA 3EDDA 2WSKA 1JNDA 1UD6A 4PMYA 2PWDA 2DPEA 3WNPA 1KXVA 4Q22A 2V3FA 3AIEA 3OIHA 1KBBA 4P8UA 1MW1A 3BAYA 4NSBA 4XV0A 3SCPA 3AI0A 3ZJKA 3WN6A 2QF8A 1JAEA 4TVCA 4RL3A 4F9DA 1QPKA 1Q4NX 2DEPA 1CGUA 2YA0A 1XCXA 1UA3A 4D6GA 1CGXA 3RM8A 3I3DA 4PTVA 3BAJA 3T08A 2ZUTA 4DM1A 1A47A 2ZX8A 3WUBA 1R87A 1MW2A 1EH9A 1JGIA 4UOJA 1J11A 1UKQA 1VFUA 1DWHM 2ZXAA 1HN1A 1SFSA 1HKJA 1V6VA 4W87A 5EFDA 4AZIA 1XH2A 4QDMA 5LYRA 2WZHA 2WHMA 3CLWA 4P8XA 4LQ1A 1BLIA 4V2XA 3BAKA 4U5KA 1E15A 1VBRA 4JCMA 4HU8A 3AFBA 3AIRA 3U57A 3CUHA 4JKMA 1C8YA 1JF5A 2WWCA 3CZGA 1QVBA 2WB5A 1CLVA 1H09A 2BFGA 3D3AA 4W5UA 4BA0A 1EHAA 1EXPA 3HN3A 1EQCA 4E2OA 1SMDA 1CECA 5A6JA 4URIA 8A3HA 2VQUA 2BVTA 5KZ6A 3GH7A 2W63A 1OGSA 4H04A 4HPGA 1MFUA 3FAWA 5FOOA 2EO7A 1QI2A 4J3SA 2CCRA 3SIMA 2OSYA 4EKJA 2YKKA 3WF1A 1TMQA 1P6WA 1UHVA 2VO5A 2ZUUA 4OOUA 1JZ6A 3W38A 3VD3A 4F66A 2DSUA 4P7OA 2EJ1A 1TG7A 3EDKA 4W8BA 1MXDA 3I3BA 4AC1X 1UR0A 2OSXA 4AZCB 1GJWA 4PTXA 5DT5A 3ZT6A 3NYDA 5GPRA 4KH2A 9CGTA 4IPNB 3K8KA 4AZBA 2CXGA 4CD5A 4J7RA 5AC5A 3AS2A 1ZL1A 2CEQA 1WNOA 2MANA 4U5IA 1GORA 3W6LA 1MWOA 2WMGA 3WFLA 1NH6A 1J9YA 3MUAA 4QCEA 2DT3A 1JF6A 4GO8A 1QNPA 2X8RA 1B0IA 2O9TA 2WC3A 3BXWA 1CGTA 3T0BA 1MQRA 3F5JA 3PTQA 3WDHA 1VFMA 4CCEA 3L4UA 2EPNA 4CKQA 2ZX7A 3VILA 1V02A 1FP9A 2VURA 2D1ZA 4AIEA 5FD0A 1EIBA 4U33A 1PEZA 2D2OA 1FOBA 2WXDM 5EMYA 2V38A 4HA3A 1VJSA 3PZNA 3UETA 3L4ZA 1GOQA 2WAGA 5GQBA 2WCAA 1E71M 1WP6A 4HMDA 1UH3A 2VVSA 3N11A 5I0DA 1M04A 4QFUA 1RP9A 2BY2A 2V3EA 1UD4A 2AOSA 1BYBA 3NIYA 3MV11 2VL4A 4DUWA 4WK9A 2O9OA 4H41A 4PYSA 4AEEA 2DDXA 4HOWA 2OSWA 3VNYA 2YJQA 1V0MA 5CQ1A 4P7RA 5JBEA 2F8QA 1KCLA 1EO5A 3CZJA 1V03A 1J0YA 2X2YA 4Z2KA 4UOQA 3A47A 3VGEA 3WL0A 4EK7A 6CGTA 5HDRA 3ARQA 4W5ZA 3GBDA 1ZJAA 4LYQA 4J3XA 2DIEA 4BF7A 2JF6A 1SR0A 1BPLB 5ABGA 1LG2A 4RE4A 3KZSA 2GUYA 3QHNA 4MDOA 3WMCA 5A2CA 1CEOA 3GH5A 1W2VA 2WKGA 3S2CA 3VMOA 1E4NA 3GTNA 2PB1A 2E9LA 4NF7A 3NJ3A 5A1AA 4W84A 5E0CA 1TUXA 4C7GA 4BQ4A 4PSPA 4AD4A 5D9PA 3OZPA 3W27A 2VR5A 4AYSA 5I24A 1OT1A 4B16A 1W9VA 1LQ0A 3AHYA 2NT0A 1OGGA 3OBAA 1Z32X 1PBGA 4M81A 1ZBCA 1JZ5A 3VD4A 3UR8A 1RPKA 2W92A 3QHMA 5CLTA 4AD0A 5I78A 3WF2A 1CLXA 4MTVA 3BSGA 5HBFA 4PMQA 1XSKA 2G3IA 3UESA 3AXIA 2XWDA 5I23A 3VD5A 1BVZA 2J74A 5A8NA 2DH3A 4FK9A 4FF5A 7TAAA 4UZSA 3AMCA 2A3AA 1QOXA 3PZIA 1LWJA 3QOKA 3CGTA 4PMOA 3TTSA 2X09A 2JALA 4S3KA 2VRJA 4D6FA 2HVMA 1VEPA 3VGFA 1CGWA 3PHAA 2XVNA 2DSZA 3TTQA 5EBAA 1GOWA 4J3UA 1QW8A 5I77A 3CHFA 3IJ7A 4IISA 2J75A 1UD2A 1ISWA 4BS0A 1V3MA 4JCLA 1GOIA 4QAWA 3UG4A 3AJ7A 1R86A 5D8ZA 1ZBVA 1H1NA 3ZSTA 3BGAA 1EO7A 4PTMA 1CIUA 3AZSA 4YHGA 3AISA 5CXPA 1GHSA 2QPUA 1B3ZA 4X0VA 4FLSA 4V27A 1PPIA 1J0JA 2GDUA 2D3LA 2PWGA 3B8SA 2CNCA 2J47A 1OINA 2W4XA 4NRRA 3F4VA 2FHFA 1QI5A 1ZU8A 1US3A 3WNKA 1OSEA 3CMGA 3HJEA 2OYMA 4CVWA 1JDCA 8CGTA 5CGTA 3PTKA 1DHKA 3OZOA 5A6KA 4M82A 2WVUA 3GNPA 3CMJA 4U31A 3MMDA 5AC4A 4M56A 1EOKA 1NWTA 2TAAA 2WMHA 1LL7A 2FGLA 4A3YA 2ZUMA 1HX0A 3ARSA 2CHOA 3SCWA 2UY4A 4CN4A 1HP4A 4Y7EA 4XZBA 3ZT7A 3ZM8A 1WZAA 2GJXA 2D20A 1JI2A 3AHVA 5M17A 3WMBA 3VUPA 1KR1A 1UWIA 4AD5A 1TFVA 2GDVA 4BZYA 1JG9A 2CITA 1XD0A 4YN5A 1F4HA 4MNKA 4M8UA 1ZBKA 3MKKA 1UYQA 1UUQA 3AXXA 1CGYA 1A3HA 7CGTA 3ARXA 5JIWA 1KQYA 4DWSB 4J3TA 3VKKA 1VJZA 1HJXA 1OWQA 1EDGA 2W91A 3OGRA 5BROA 2BHUA 1UA7A 2JIEA 3MUY1 4TXEA 4D72A 1W3JA 3A6OA 1H41A 1UD8A 1W3KA 1L0PA 6TAAA 3WDIA 2EPKX 5EFFA 5JIPA 1H0GA 3EMCA 3WDQA 3VIFA 4F79A 4D6CA 1HIZA 1V0KA 3FHQA 1H49A 2J7DA 1W2PA 1V6UA 2XPKA 1AQHA 4WLCA 3OLEA 1B30A 3AMLA 2CERA 1Q6CA 4XX6A 4YHEA 3VDHA 2D0HA 4CUCA 3AXHA 1HKKA 2VR4A 1JXKA 3ARTA 3AOFA 1E6SM 1LF1A 2J7CA 4J28A 2CBJA 1V08A 3CZLA 4PMVA 4R27A 3WL1A 1M53A 4NZCA 1H2JA 3EBVA 4P7QA 3UG5A 2FHBA 1LWHA 1OD0A 1AQMA 1WZKA 3VIPA 2WVTA 2FH8A 3RM4A 1MYRA 2XUCA 4ATWA 4N0RA 4AW7A 1E6RA 3N15A 4AXNA 3W4RA 2G4FA 1H11A 1I1XA 3WUFA 1X6LA 2ZIDA 4W93A 2Y2WA 4WKAA 1UG6A 1VF8A 4U3CA 2BNJA 1J0KA 4CN6A 3AIUA 4UFIA 4DWSC 1UR1A 4PEEA 3WD4A 3ZO9A 1ZB5A 3ARZA 4MNMA 2QLYA 3SURA 2GK1B 4X9YA 1LL6A 5DEZA 5A6BD 1JFXA 5FL0A 2WC4A 3VM5A 1MW3A 2ZUNA 4UFMA 3OG2A 1CPUA 3F5LA 1HJSA 4J27A 1C8QA 3T2QA 3VPLA 1G94A 3W37A 2GVYA 1J0IA 2G41A 1NOWA 4K68A 5CPSA 3LMYA 3BCDA 2WMJA 3ZSSA 3K4AA 2QPSA 2YOCA 3L2MA 3ZT5A 2J7HA 3LPGA 5A94A 1JYWA 3WQWA 2BHZA 1CYGA 3OGVA 4KMQA 1US2A 5C71A 1E0XA 2VZTA 3L4XA 1PIFA 1VRXA 4TTGA 4YPJA 1B9ZA 3L2LA 3WIJA 3WMSA 3VGHA 1R85A 4JKKA 1UWUA 2EXOA 4TVDA 2D0FA 3CZEA 1QNRA 3PBGA 1HXJA 2BXZA 1PJ9A 2DT2A 2XFFA 4FLQA 5BWFA 1G1YA 1OB0A 1UH4A 4DM2A 4AISA 2Q8XA 3QHOA 5JBFA 1HVXA 3SCTA 1BGGA 3WBEA 3POCA 4W86A 4W7UA 4LYPA 4UQBA 1L8NA 7A3HA 1JXJA 4HOXA 1D7FA 1K6AA 2CETA 2V3DA 4GI6A 3SCQA 5M5DA 3WNMA 2PI6A 3BLKA 4MPKA 2OWCA 1FFRA 4HPHA 4R5EA 2V5DA 3GZAA 1FA2A 4V28A 4LYRA 2A3BA 4PTWA 4UQAA 3RDKA 1WDPA 1CENA 5E9AA 2Z1KA 4OKDA 1JYVA 1TCMA 3N13A 3ARVA 3HMCA 4AIUA 3TONA 1G0CA 2A3CA 4KWUA 1E4LA 2VX7A 4CD6A 1KCKA 1BYCA 3NSXA 1B3XA 2XM1A 4UFJA 2PWHA 2DSVA 2JE8A 3U5UA 1NWSA 1WPCA 5C8BB 4PMXA 1OIFA 4JL1A 4KGJA 4AMCA 3GYCA 1UWRA 3CUJA 3CUGA 1EGZA 1JIBA 2XVPA 1UKPA 4HA4A 4HTYA 2O92A 3T0AA 1QNOA 3E1F1 3PZ9A 1KB3A 4OJYA 3VOCA 3MANA 4CD7A 1JZ4A 4CD8A 5A6SA 3VDCA 4BQ2A 3FY1A 5D9OA 2AAAA 2X0YA 4PMDA 2WANA 1O6IA 3D5HA 1XD1A 5I5RA 3VMPA 4JFVA 1UWTA 3NDZA 4UFKA 1JL8A 2YL6A 1GHRA 5ABFA 1JD9A 5BYWA 1E43A 4LGXA 4N42A 3SUTA 2JFEX 1B2YA 2FGZA 5A6BA 3M07A 3NDYA 3W0KA 1E3ZA 5DO8A 2DSWA 1GNXA 3MS8A 1ISVA 3ARRA 3OLGA 3UCQA 1QNQA 2NSXA 3AS0A 4J3WA 3II1A 3K1DA 3AZRA 2O9PA 3UERA 1TVPA 3AIQA 1BFNA 3KL0A 4ACZA 3AS3A 4JZ5A 3KL3A 3W29A 3W82A 1XYFA 1JZ2A 3T0DA 2WMIA 1W32A 2ZX9A 4RE3A 2G3JA 4D6HA 1ECEA 1JDDA 2WKLA 3WH7A 1MQQA 1S46A 3MU7A 1BTCA 5A8QA 3CUIA 2D22A 3TOPA 4HZ7A 2W66A 1TZ7A 3N12A 4OZOA 2IXUA 3TA9A 3WSUA 4U2YA 1BSIA 5E09A 4DUVA 4X0NA 5BRPA 1V3HA 3G6LA 3BC9A 3DYMA 2BVDA 3OLIA 5M03A 2BY0A 1TE1A 1HVQA 1V3KA 4W85A 3GXFA 3WF0A 1AMYA 1UWSA 4MADA 4MB5A 4TUFA 3WELA 2YL8A 1E56A 1K9EA 3VX0A 3IJ8A 1CWYA 1IV8A 1LJYA 2WVVB 2BY3A 1C7SA 1K9FA 1JZ7A 2GJRA 1G5AA 1H3GA 3MSDA 4QLLA 4WKHA 3IK2A 2XTKA 4WJXA 4JFTA 1WDSA 3GH4A 4HA1A 5CPTA 4UCFA 2VZSA 4BCEA 1UR8A 4PN2A 1DTUA 4PMNA 1FP8A 3W25A 3VIHA 3WEOA 1UQZA 2X1IA 4UQ9A 3ZQ9A 4W8AA 3N18A 3THCA 1HL9A 4JKLA 3K4DA 4ZXOA 4S3JA 3DYOA 3ZJ7A 3WNNA 3VGDA 4AD2A 2V3GA 2J77A 3T2PA 3BH4A 1WB0A 2EQDA 4W7VA 1BHGA 2YLLA 3WENA 4WKFA 1UD5A 4JHOA 3DC0A 1C90A 1KBKA 2BHYA 3M46A 4CU6A 4A3HA 3ALFA 1TA3B 2WBKA 1HJWA 2DGAA 1I75A 1JDAA 4OOZA 2PF0A 3K46A 5BXSA 3NSNA 1YHTA 4UFLA 1QNSA 2IXVA 1DP0A 1ISZA 2E0PA 4U3AA 4XUYA 2VZUA 5HNNA 2OYKA 1E40A 4AZHA 3L4TA 1EDQA 1G9HA 3WFZA 5I3DA 1HP5A 1GQJA 4MNJA 4ZFMA 3S6TA 2PWEA 3RCNA 1V6XA 2AMGA 1NWRA 3WH5A 4MAVA 1XCWA 3WDPP 1Y7VA 1H0IA 3WD3A 1M7XA 4KRUA 4NRSA 5GNZA 2F2HA 5DFAA 2VRQA 1W1YA 1CZ1A 1B3YA 4CD4A 1J10A 3CTTA 3PZUA 3J7HA 5FKYA 1J0HA 1C93A 5BCAA 2YA1A 1UZ4A 3O9NA 1E72M 5I6SA 1X1NA 3WF4A 2Y5EA 5GNYA 3SUWA 1H4PA 2XM2A 3CZ8A 3W6MA 5CSUA 5FIPA 2WPGA 1EHNA 4M24A 2XIBA 2E8YA 1KGXA 3PZVA 4P8VA 2YL5A 1CXFA 3GNOA 4UFHA 1DWGM 4F9JA 2BXYA 1E1EA 1ODUA 3BAIA 3N17A 2XFRA 1E5NA 3CHCA 1GQLA 3N9KA 2XHYA 3AZTA 2WC7A 2WLYA 4GO9A 2VUYA 3VU2A 2ZE0A 4AZCA 2RGMA 2VX5A 4W89A 3ZR6A 1VEMA 1VEOA 2J79A 4H8HA 2IUZA 1BF2A 3WQ8A 5CGMA 5CSYA 4PMZA 3W28A 5KEZA 1E9LA 2GSJA 1HF6A 4GZIA 1BYDA 4Q7NA 1E70M 2WHJA 4Z2HA 3FAXA 4WF7A 2WZIA 3VGGA 1SMAA 1IZKA 1BG9A 3DHUA 2WNWA 4ZXLA 1KR0A 3SUSA 1B1YA 1LG1A 4CU8A 5AYBA 3ZMRA 1ISYA 2G3MA 2FHCA 4FLRA 4Z2JA 3RILA 3VD7A 5A6LA 1VIWA 3L4YA 2E9MA 3PTMA 2JIWA 2VX6A 3DHPA 4F8XA 3NCOA 4D71A 1PZ3A 1UZ1A 4MNLA 1HL8A 3CPUA 1LL4A 2JF7A 1VB9A 2W67A 2WSPA 1V3JA 3WNOA 4P7LA 2DIJA 4AD3A 4D6JA 1C3FA 1GOOA 1K9DA 1QI3A 3T09A 4UOZA 4UR9A 3A4XA 2ZXQA 1XRVA 4PMRA 2QMJA 4GIAA 1DWFM 1V3LA 4B3KA 2VCCA 4ML4A 3CIVA 4NI3A 3AROA 4MB1A 1KQZA 3BMVA 3POHA 1WE5A 1QBAA 3AHXA 3KE0A 5IXEA 4B9YA 3AIBA 4FMVA 3WKZA 5DT7A 4B9ZA 1QBBA 5E6ZA 3U5YA 4CN1A 2Y8VA 2NT1A 1M01A 3WEZA 4C7FA 1E6NA 5M3WA 1EQPA 3W24A 3VIKA 1XSIA 1M03A 3EDEA 3FN9A 5LA1A 2J25A 1V6WA 3U7VA 2EPLX 3QGVA 3RJXA 3NSMA 2ZICA 3WH6A 3QOMA 3CBWA 5I2UA 1GQKA 1W9XA 1GJUA 2VMFA 1ZJBA 3AMKA 3B9EA 3ZJ8A 1E4MM 4M29A 2VT0A 5HXMA 1E55A 2J7BA 1W9DM 1KXHA 2Z1SA 1JAKA 1XYZA 3ZIZA 1CXLA 1UD3A 4XB3A 4WSKA 3FNDA 4W88A 3GXDA 4A4AA 3HU7A 4QLJA 2XGIA 3AHTA 4GZJA 2VVNA 2CESA 2EEXA 1WZMA 3BLPX 1WZLA 5ABEA 1CXHA 1QI0A 3EYPA 4D6EA 3WD0A 4IUGA 3WNLA 4PUEA 2QHAA 4ATDA 3LPPA 3OLDA 5D8WA 2B31A 2XIIA 1IT0A 1R8LA 1J18A 1V3IA 4J3VA 1C7TA 2BV9A 1Q6EA 4AY1A 3WQ6A 3WUEA 4UQEA 5IHRA 3ECQA 2WMFA 1EA9C 4JIEA 1JZ8A 3PZOA 4TOQA 4ZE5A 3VNZA 4PSRA 1KWKA 1E0WA 5FCZA 2D23A 2XG9A 2EPOA 4PUDA 1GONA 2J8FA 3VMNA 2CPUA 3ALGA 3WQ4A 5JUVA 2ZXBA 4CVUA 3TTYA 2C7FA 3RJYA 2J4GA 2WZEA 3T2OA 3ARPA 3A3HA 5F7UA 2CKSA 1XV8A 4GZEA 1WCGA 2XJ7A 2ZUWA 1H5VA 2XGBA 2XWEA 4GQQA 4ACYA 3K8LA 3CH9A 1OT2A 3BAXA 2VOTA 3AHZA 3AMGA 2E3ZA 4EANA 3WD2A 2W61A 2J7EA 4OBRA 1ITXA 4D1IA 5A2AA 4H8UA 1BVNP 1E6PA 4JHZA 4LX4A 3A4AA 4JFWA 2OYLA 3VDBA 2A3EA 1MW0A 2E40A 2VX4A 1FH7A 1HJVA 2YIHA 1JYXA 3BCFA 4HOZA 1HT6A 5AY7A 3MUIA 1V0NA 2WCSA 2WBGA 1BG4A 3EDFA 3DECA 1ESWA 4TX6A 1U2YA 5A8PA 3EDJA 2QV4A 5ECUA 2UY3A 1BQCA 1ITCA 5D9MA 3B9DA 3IANA 5E70A 4ATLA 2ZOXA 3LPFA 1ZS2A 2DSKA 3MMUA 4ZE4A 1LLOA 1FHDA 4LPCA 4Z2GA 5C70A 3GXMA 1MXGA 3WUGA 5A95A 5I79A 4HU0A 3CO4A 1JNEA 1C91A 3AIWA 1RH9A 4BQ5A 3EMQA 1QHPA 1XSJA 3OB8A 3AIVA 1OGBA 2CBUA 3FXYA 2Y8KA 3VTRA 4MJ2A 1QHZA 4DWSA 2Y4SA 1UH2A 1E1FA 5ABHA 1W9BM 5CJ5A 4D6IA 1KXTA 1W1VA 4PCSA 2YL9A 1VAHA 1GPFA 4XZWA 4KRTA 3PZGA 2PWFA 1GOMA 4TTUA 4HZ8A 4FLOA 2E4TA 3PZQA 3THDA 1AVAA 2GFTA 3N1AA 1JD7A 5CLWA 1W91A 1HKMA 3GM8A 4PMUA 2D3NA 3CHEA 3ZOAA 1CNVA 2XVLA 2BY1A 2QMKA 2A3HA 1PZ2A 3PN8A 3L4WA 1XH0A 3TP4A 5LA0A 4GXPA 1RP8A 2YLAA 3SCOA 3EMZA 1GVIA 1XHGA 1UWQA 2V5CA 2XVGA 2DT0A 3KWXA 2GJXB 2W5FA 2C8NA 2EPMX 2YDSA 4AEFA 1V6YA 1PX4A 1VENA 3IJ9A 4MB4A 2YBUA 1VFOA 3BSHA 1GOKA 4C7DA 1NQ6A 4MJ4A 2D24A 1UKSA 1WO2A 3TTOA 1Q6DA 1Q6FA 2J7GA 2X05A 3UR7A 1OBAA 1W1TA 2W62A 3CHDA 1HKIA 2BS9A 4Z2LA 3G6MA 5FL1A 1GVYA 2GK1A 1UKTA 4PBGA 3KEHA 3SCVA 3MV01 1JYNA 2JEPA 2GJPA 1NARA 1K9TA 1CDGA 1UR9A 3ARYA 3SCUA 3SUVA 2OWXA 5BXRA 5BXTA 4EE9A 4CU7A 1ODZA 1OM0A 1CBGA 4WSJA 1HJQA 5D4YA 1QHOA 5GNXA 1J0ZA 5TD4A 3OGSA 2WVSA 3FW6A 4UTFA 3WH8A 2VTFA 4IPLA 1J12A 3VIOA 3A4WA 5EB8A 1QW9A 5DMYA 5AYIA 2VZOA 2NW0A 4RE2A 4AZ6A 2WHLA 2ESCA 1E6QM 2WM0A 4B15A 4L4OA 1U33A 5A8MA 5A8OA 1E6ZA 1C92A 1XC6A 1DWAM 2VNCA 3VVGA 1IZJA 1Q6GA 3O2LA 1E6XM 1X6NA 1DEDA 3ARUA 4U2ZA 1O7AA 2YDQA 4OIFA 1PIGA 4CGTA 3AQUA 4ZEPA 3VIMA 3GBEA 3ZR5A 2ZXDA 3WF3A 1W1PA 2YDRA 3K8MA 5D9NA 3W53A 2WHKA 1KFWA 3LPOA 1TR1A 2WW5A 5A2BA 5CPQA 4HZ6A 2VJXA 1J01A 4HP5A 3VGBA 5BRQA 4W7WA 4MDPA 1E4IA 1XH1A 1UQYA 2VC9A 1MQPA 3RO8A 3JUGA 1OCQA 4GKLA 1CXEA 1OD8A 2YBTA 3VX1A 1YQ2A 3AICA 1GCYA 3W81A 2J78A 4D1JA 2ZWYA 3UG3A 5E0FA 5CZKA 6A3HA 3AMDA 3B9AA 3APGA 3RIKA 2FH6A 1CGVA 2WCGA 3VO0A 4GPNA 4QP0A 3SUUA 3ARWA 4JL2A 1GUVA 2E9BA 2PC8A 1W3HA 3SEPA 4UQDA 1GQIA 2ZUVA 3O6AA 4MB3A 2PBGA 4D6DA 5LA2A 1EDTA 3SCRA 3AYRA 3VIJA 1JZ3A 2UY5A 1CXIA 5IFTA 4W8LA 5JBDA 1V02E 2PBOA 3WY1A 1N82A 2CKRA 2YA2A 1AQ0A 3WQVA 2CHNA 2XSAA 1JI1A 1NWUA 1DWIM 2ZX5A 1PX3A 3U7BA 1UOKA 1VBUA 1MFVA 4AIOA 4GQRA 3IAPA 3OA5A 3MUZ1 4UQCA 3UEQA 1E73M 3CUFA 4HMCA 4BQ3A 2FDMA 3WEMA 2DQXA 4WIWA 5HPOA 4PRWA 1KXQA 1C8XA 2HISA 5A6AA 4QCFA 3RMEA 1V0LA 5IFPA 2DH2A 4UNIA 4KGLA 3WDJA 4AD1A 4B3LA 2VCBA 2G3NA 1KWGA 2Y24A 4AZ7A 1SYTA 4M1RA 2XSBA 3M7SA 4E8CA 3WDRA 3VIGA 1PX8A 1B90A 3WH9A 1WDRA 1WDQA 1WKYA 3CZKA 1NP0A 4TVUA 1D3CA 1BYAA 4AZ5A 3AS1A 4P8WA 2JEQA 3PZMA 3ZJ6A 2F61A 1ISXA 2BVYA 1GW1A 5A6MA 4H8VA 3VD9A 1FH8A 5BXPA 1BAGA 2J8GA 2ZX6A 3RM9A 1NOFA 2D0GA 3F5KA 2UY2A 1W3LA 5HPCA 1CTNA 1E3XA 1B31A 2VRKA 3NUKA 3SCNA 2XVKA 3WQ5A 2WMKA 2J7FA 3WBAA 2C0HA 3WD1A 3GXIA 3VM7A 1QI4A 3AYSA 2VI0A 4CCDA 4PCTA 2UWFA 4E8DA 1B3VA 1KGWA 2WK2A 1OIMA 5ABFB 2WVVA 2O9RA 4GI9A 2WWDA 1UR4A 3GNRA 3BMWA 1XGZA 2DT1A 3PZTA 2OLHA 3N04A 1KGUA 1WAWA 4Z2IA 3MSGA 1E0VA
chains in the Genus database with same CATH superfamily
1EFZA 2ZWZA 3MO4A 3AU2A 3ZVHB 3MA8A 1TVNA 5LIKX 3P5ZA 3E5PA 2VZVA 1T8QA 3WQGA 1DQUA 2PDQA 4ZENA 3M0XA 2V2HA 4ACZB 1UROA 1RSCA 5H2ZA 2ZZ5A 2AMXA 2CLKA 4CCCA 4NJKA 3OZMA 3B4UA 2GVEA 2WYSA 4MWAB 1Q85A 3BDKA 1SFTA 1MDRA 4UC5A 4P2VA 4ZQMA 3FSUA 4C6CA 4A6GA 3W23A 4HNLA 3UVAA 3R5EA 1TA3A 2B7QA 1MVYA 3VE9A 5AVHA 1ZGDA 1FWEC 1I1WA 1P6CA 2BTMA 1EJRC 4JAWA 2FPVA 1XI3A 2XFYA 4B5TA 4DO7A 4MAZA 1ME7A 2D2GA 4QLKA 2ANUA 1U30A 1F3WA 3EX3A 3S46A 4HMEA 3GHUA 4M80A 3T55A 5IHSA 2CBVA 1P0KA 3W1QA 1GZJA 4Q8OA 1DWJM 4QTGA 1FHLA 3G18A 4GI4A 5KITA 3FHAA 1NY1A 4LAUA 4GQBA 4IUOA 4PCPA 4I5UA 2VQTA 2NXGA 4KBXA 5CEWA 2HZGA 4Z0JA 1P43A 2FZDA 3TLLA 1O5RA 3WNPA 1GTEA 4MWAC 2V3FA 1WDDA 2PGEA 3UWUA 4QROA 1KBBA 2VP8A 2Z6JA 4XV0A 3MY9A 1UBPC 3WN6A 2QF8A 1B4KA 3NPWA 5IBXC 1QPKA 2AQWA 1CGUA 2YA0A 1UA3A 1JRCA 3RM8A 4KS0A 3H4WA 3FJ6A 5EPDA 1EWEA 3WUBA 3JZEA 4A2RA 1EH9A 1S5TA 4RJEA 1J11A 4H2HA 1UKQA 4OWGA 1HN1A 4LB3A 2GQ9A 4W87A 3TMLA 5LNUA 1J5TA 3OQEA 4GJ1A 4RK8A 5DCBA 1XLJA 3AIRA 1PYFA 3CEUA 1SGJA 1EWDA 1V4YA 1H09A 1TPUA 2Y88A 1EF2A 3CIXA 3D3AA 1FHVA 3TVAA 3LRKA 4NZJA 5G4EA 2WSQA 2AL2B 2W63A 4H04A 5FESA 3FAWA 5FOOA 1H7WA 2O56A 3W22A 1UPPA 2CCRA 3SIMA 2F6XA 2YKKA 3E38A 4K3ZA 4M6QA 1TMQA 4KF1A 1XDMA 3W38A 1OHLA 1XICA 4XKMA 4AXKA 1ONEA 2DSUA 4E6MA 3EDKA 4W8BA 1MXDA 5AZ1A 2Q09A 3MZ2A 1TV7A 1QO2A 1SW7A 1Y5XA 1W3NA 4PTXA 2VR2A 3QPEA 3LG3A 5DT5A 3MBDA 2YBVA 4CCZA 5GPRA 4UXDA 4KH2A 3WJWA 3NR0A 3ERPA 3K8KA 4J7RA 3G1FA 2R1LA 5CAHA 3KUMA 3NL5A 3ONBA 4HVXA 5DN1A 1TPFA 4U5IA 1MWOA 2WMGA 2BB0A 4QCEA 3MB9A 1PIIA 2DT3A 3UWWA 1JF6A 2QCMA 1QNPA 2X8RA 1FQ0A 4PMJA 1EBHA 4NG3A 2HE5A 3CLMA 3PTQA 3WLMA 1V02A 3LZ3A 5FD0A 3FIGA 3LNPA 4QJ4B 1WXZA 3SGGA 2D2OA 1FOBA 2WXDM 3MWAA 5XINA 1H5YA 1GG0A 1E0UA 3H2AA 3PZNA 3UETA 4LW7A 1GOQA 2O4QA 2WAGA 2PUZA 4PZVA 4ZR8A 1JPKA 2F38A 4HMDA 1EC9A 3WLJA 2H9AB 4HMNA 2BY2A 3DFPA 2O0TA 1PV8A 3WLQA 3NIYA 2VL4A 4CNTA 1XQLA 1WKFA 1SJCA 4DYJA 3L68A 4PYSA 2DDXA 3WJXA 1IXQA 1CX9A 3QY7A 3TYDA 2OSWA 3VNYA 1V0MA 5CQ1A 5JBEA 1KCLA 1V03A 1LQAA 3P0WA 4Z2KA 1QWKA 3VNIA 3MYPA 4JN7A 1R3RA 4HHHA 3RF9A 3C2RA 1XS2A 1SZRA 2A7NA 3LCIA 1QJWA 3KZSA 3QHNA 4RDWA 5CH9A 4YTSA 5A2CA 1E4NA 1H1ZA 4R85A 3L65A 1DJGA 3AXMA 3OZPA 3QC3A 1BQGA 3W27A 1OT1A 4MJZA 1EKOA 3GDMA 3GUGA 3W3OA 4XO6A 1LQ0A 3QLDA 3TJXA 2OT1A 2NT0A 1OGGA 3N73A 3MJMA 1NAL1 5E5CA 1PHQA 3G24A 1TPC1 3BQ5A 3QV9A 4AD0A 3CAQA 2BGQA 1KTNA 1W3TA 3NEVA 5C9WA 3HZ3A 3TWBA 3NGJA 4FAMA 3FEQA 4PMQA 3GIPA 4E2DA 5U7SA 5IM51 3TV8A 2FPTA 3CIWA 2XWDA 5I23A 1NU5A 3PBMA 4AF0A 5M1TA 3VD5A 4Q6JA 4DEFA 2PTDA 4FF5A 3LCGA 4AFYA 3Q4DA 3PZIA 1LWJA 1UJPA 2X09A 4JICA 2X2GA 1MMFA 3GFYA 2OOFA 3VNKA 1VEPA 1XKJA 3C3NA 4JTQA 3PHAA 4RLIA 4LWWA 3VFLA 3VGFA 3CEPA 3TTQA 5EBAA 1LWIA 4J3UA 3IJ7A 1Q2SA 2CWXA 2VEKA 3H2MA 3SRFA 1V3MA 2ZKMX 4FNTA 1GOIA 3AJ7A 5D38A 1A3XA 4OGZA 5HR7A 1JPMA 3URBA 1ZBVA 3ZSTA 3BGAA 3PUOA 2Z1WA 2XIOA 1EO7A 2QPUA 1B3ZA 5FA5A 3ZWTA 3N29A 4QDPA 1M7OA 2GDUA 4QQ3A 1A50A 1KLYA 1K4GA 4UR7A 2CNCA 3GVQA 1OINA 3VABA 1BWLA 3FA4A 1ZU8A 2VC7A 2OYMA 2YR1A 4NZ5A 1LM1A 4X22A 5CPMA 5CGTA 3O6YX 3OZOA 2WVUA 3DGRA 5JH2A 3LSCA 3EWXA 1T7LA 1EBGA 5AC4A 4M56A 3QGKC 1FKWA 1XLAA 4GXMA 1HX0A 1LRNA 3ARSA 4ORMA 2E5DA 3SCWA 1GVSA 3Q65A 1HP4A 1IXOA 4F0SA 3ZT7A 3ZM8A 3TFXA 3URNA 4JTKA 4K1GA 3P74A 2D20A 1JI2A 1T5AA 4EPBC 3WMBA 4FXFA 4BHYA 1UWIA 2PLCA 4BZYA 3TK7A 2CITA 1Q63A 2ZTJA 1SJBA 2I5QA 4YN5A 2GPTA 4MNKA 4HNUA 1KTCA 4WGXA 4GY1A 4UTWA 2FJUB 4YCOA 3T8QA 3QN3A 1EDGA 2W91A 4CNPA 1M9HA 3VZZA 5F1VA 3KCLA 5BROA 4MMWA 5HWJA 4YVXA 4C5YA 4TXEA 2XZ7A 4A3UA 5I02A 4FOJA 1L0PA 4R7WA 4XBJA 1L6FA 4NZ1A 2RAGA 6REQA 3WCZA 4F79A 4D6CA 1V0KA 3SAZA 3A3WA 5HATA 3FVMA 2ISSA 4FALA 1RY8A 4WLCA 3THQA 2PDNA 3OLEA 2CLIA 1Q6CA 1PCWA 3F4DA 4RZ4A 3G1HA 5FF7A 4DJDC 3CL8A 4JTEA 4WDTA 1M53A 5C2GA 4NZCA 1H2JA 2VOMA 3PUDA 1Y5WA 1AQMA 3PBUA 5FJUA 1P5BA 3TZNA 2I5GA 4RW3A 2OTDA 4O12A 1P0BA 1X97A 4YL2A 3WUFA 1WAUA 2Y2WA 1X8FA 4Q6XA 4R53A 1RLDA 1MZRA 1L8PA 4O19A 5G2IA 1UR1A 4IMAA 4ZQNA 4PB4A 3GG0A 1ZB5A 1SZNA 3R0DA 3M5YA 1TWWA 2GK1B 2GUUA 5ENLA 3OHMB 5FL0A 7REQB 4RXGA 3VM5A 4EOUA 3GDRA 4W4QA 1C8QA 3T2QA 3UY8A 3W37A 2QIIA 3N34A 1J0IA 5B7ZA 3BE7A 1N8IA 4LSBA 3JRKA 4K68A 3KTXA 3K4AA 2QPSA 4Z1DA 3DFOA 2YOCA 4I9MA 4N9DA 2NUYA 2ZDSA 3UR5A 1V6TA 2BHZA 4OUIA 1US2A 4B5SA 3GU1A 3L4XA 1VRXA 1J4EA 3EWWA 3L2LA 1QPQA 1XKYA 3WMSA 4HB7A 3IACA 4K1WA 4TVDA 2D0FA 4IFKA 4A2SA 1OZQA 1M5WA 3KS6A 5BWFA 4BWLC 3QYQA 4EWND 3WLTA 3QHOA 2AQVA 2I57A 2XISA 2Q02A 4W86A 4W7UA 1TRIA 2I1OA 4HYVA 2CETA 1BVWA 3BLKA 4MPKA 2OWCA 1FFRA 1QOPA 4R5EA 1BRLB 4DBDA 1XL9A 3GZ3A 2NQ5A 1DORA 4PTWA 1CENA 4UNLA 3F4NA 2Z1KA 4OKDA 4EP8C 1VLIA 1TCMA 3CB3A 2YCLA 3HMCA 1Q6LA 3BICA 1E4LA 3T40A 1IF2A 2NV1A 3CWHA 3SRHA 1VFLA 4LRTA 2DSVA 1NWSA 1WA3A 1WPCA 4PMXA 3MVTA 1OIFA 4KGJA 3N4FA 4AMCA 2QJNA 4ZB2A 3TE9A 3H24A 2XVPA 4HA4A 5HNRA 1MZHA 4MY9A 2O92A 2YB4A 4LBSA 4IGMA 1ITUA 1XUZA 1KB3A 2Y63A 3DERA 1VFHA 4CD7A 4A3QA 3H4GA 3VDCA 4BQ2A 1LYXA 5A5WA 3TW9A 4E2BA 1O6IA 4JXCA 4MSSA 4DF1A 4KIEA 4YIWA 4C6IA 2YFOA 1DJQA 4GXWA 1HTIA 4JTRA 5BYWA 1FWRA 3LBCA 3STPA 2JFEX 1B2YA 1JPDX 2FGZA 3HPZA 5CBIA 2QT3A 1TVLA 5DO8A 2DSWA 3MS8A 3ARRA 3OLGA 5DMMA 3OZYA 3RRXA 2EAWA 4J3WA 3EB3A 3K1DA 1VPXA 4FX7A 2D69A 4MGGA 3AIQA 3BV7A 3VA8A 1KKOA 4NHVA 3UA3A 1NDZA 1O4UA 5CJNA 3V1PA 1OX6A 4GYPC 4BR1A 4RE3A 2ACRA 1EJTC 3UJFA 4AVNA 1GK8A 1BXBA 4ZO7A 3WH7A 1MQQA 1S46A 4H6RA 4Q4RA 1TV8A 2CZ5A 4ZZ9A 3TOPA 2YYUA 3COTA 3N12A 1W1IE 4U2YA 4HU3A 3UXAA 3I7QA 1RAKA 1G67A 3GKAA 3RFAA 5HNUA 1HVQA 1AMYA 3OP2A 2YCIX 3QM3A 1E56A 3PPFA 4JHMA 3W7JA 2IKIA 3NQ6A 2BVWA 1NVMA 2CLHA 3P5YA 3BLFA 4KWVA 4LVBA 1H3GA 4WJEA 3KRBA 1NF0A 4WKHA 3IK2A 2XTKA 4H4IA 3ES7A 4WJXA 3GH4A 5CPTA 3TXZA 1IZCA 1AL7A 1KM6A 3NQFA 4PN2A 1IEWA 4YYCA 3TSDA 4IMGA 4JKLA 4QR6A 3K4DA 3VI2A 3DYOA 3ZJ7A 3WNNA 1GVEA 4DB7A 3PBYA 3A22A 1JCMP 2X1UA 3AJXA 1TA3B 1HJWA 1JDAA 1BKSA 4JNMA 2WQPA 3B06A 2CFFA 3GC4A 1ISZA 2FFCA 4LEFA 3BUVA 4G56A 1JCTA 1NQKA 4JTDA 4IP4A 3W2LA 2Y5SA 1E40A 3K30A 2CLLA 3WFZA 1GQJA 1H7OA 4I5RA 4IIGA 3C86A 3RMJA 2FTWA 3ZLGA 4XIAA 2GQ3A 2NLIA 1VGAA 3EX2A 1Y7VA 3MJYA 4KRUA 2EF9A 1I2OA 4CLMA 4QE4A 5GNZA 2MUCA 5DFAA 3QPZA 1J10A 4RDVA 1C93A 2YA1A 4LNYA 1UZ4A 2PRMA 3WF4A 2Y5EA 1SO6A 2BLEA 1EGMA 1VP5A 1H4PA 2C79A 3CZ8A 1TTPA 5CSUA 4O4WA 1EHNA 1I6NA 2XFWA 2XIBA 2E8YA 2R9RA 5FAJA 2RFGA 4S3GA 3GNOA 5ABTA 1DWGM 2BXYA 1E1EA 3BAIA 3PR2A 2NSOA 1FWTA 2YFNA 3AZTA 2TYSA 3VU2A 4IICA 1QU4A 1D8WA 2RGMA 2VX5A 4W89A 4AWUA 3W2JA 2ACSA 3MHUA 1K7EA 4Z17A 3WQ8A 4AAJA 5D2YA 8TIMA 1E9LA 4RPPA 4YMZA 1BYDA 4HHPA 2WHJA 3LBOA 3FAXA 1V5XA 4US5D 1SMAA 1BG9A 4ZXLA 3E12A 3IVSA 1B1YA 1LG1A 3ES8A 5AYBA 3ZMRA 3C3UA 3WG6A 4FLRA 3QBUA 2BMBA 1VIWA 1R9XA 1TMLA 4HKPA 4LVDA 2E9MA 4ZGYA 3E6EA 3DHPA 1EEXA 4D71A 1PZ3A 1HL8A 3CPUA 4L56A 1H51A 2Y5JA 2W67A 3PVFA 1V3JA 3WNOA 2RH9A 1L6WA 1ZCOA 2ZRVA 4Q4MA 1F3TA 4V1YA 2ZXQA 1XRVA 4PMRA 4M7SA 3UZWA 2I16A 3LDVA 3EKGA 1XR2A 1MXSA 3HFTA 3DAQA 3PY2A 3ZXWA 1KM0A 1KFKA 4MB1A 1LTDA 3HM7A 1VC4A 3POHA 3AHXA 5FI8A 3B05A 5IXEA 3MP3A 1KM3A 5FJOA 3WKZA 5DT7A 1EC7A 1QBBA 3N6JA 2Y8VA 2NT1A 1ZCCA 4C6LA 3MDUA 3W2NA 1E6NA 5M3WA 1U5VA 3FN9A 2J25A 4CEUC 2PMQA 3QGVA 5FEPA 3RJXA 3WH6A 3QOMA 7ODCA 3MWCA 2TMDA 4DJEA 1GQKA 4J2PA 1GJUA 1YYAA 2VMFA 4O4VA 4JTJA 1H7NA 4M29A 1W56A 2O7SA 2DUZA 1KXHA 4H9ZA 4PB5A 3QV6A 3RITA 3C0SA 1UD3A 4QITA 4XB3A 4WSKA 3FNDA 2ZZ4A 3GXDA 4A4AA 1ICPA 1XIHA 2XGIA 1W31A 3CO8A 3UZZA 4GZJA 3PTDA 3BOXA 3DFSA 1WZLA 1IXPA 3QZEA 1CXHA 3SQMA 3EYPA 1PYMA 3ABQA 1HGWA 3EXRA 3R4IA 1XBVA 3VNJA 2QHAA 3W1XA 3C5QA 2B31A 1S2UA 3WQDA 1LBMA 4AY1A 3B8VA 1YDOA 4Q7IA 4UQEA 1BEUA 4F40A 4QEEA 4L6HA 3WQEA 2P10A 3TQPA 3H12A 4TOQA 3SQSA 4A8NA 1GGOA 2XH7A 4QBXA 3VNZA 3UFYA 1Q7MA 4QJ3B 3CQ0A 3OBEA 2J8FA 3CJPA 1FXQA 1FY6A 5BOFA 3VMNA 2D2HA 2Z27A 2KX9A 1LT8A 3WQ4A 3SDOA 3GDLA 4D9PA 5JUVA 2ZXBA 2P53A 4CVUA 3TTYA 2VGBA 2BG5A 3R10A 2FZ9A 4JDYA 5AHEA 3UYIA 4GZEA 2I14A 1D8CA 4DAIA 1WCGA 2XJ7A 4QAIA 1A4MA 1H5VA 3C2OA 5HWNA 4BI7A 4Q4QA 1W5OA 1YIXA 4GQQA 2AKMA 3CH9A 2PTZA 3BAXA 3AHZA 2W61A 1I9CB 1ITXA 5A2AA 4H8UA 1BVNP 1E6PA 3LBMA 4LX4A 4R9OA 4O1BA 4RZ6A 2E40A 4JTGA 2YIHA 4NJGA 4HOZA 2Z24A 3MUIA 1TQJA 2WCSA 1YPFA 2WBGA 3EDFA 4AF0B 4RDZA 5GJPA 1ESWA 5D09A 5A8PA 4E3TA 5ECUA 5K9CA 5E70A 4EPKA 3QQ1A 1XISA 4NAFA 5GJNA 1XGEA 4ZSUA 1LP6A 1J79A 4GVFA 1B57A 4Z2GA 5C70A 3GXMA 4ORIA 3B0XA 1BD0A 3WUGA 1E1CA 2SFPA 4KCWA 5A95A 3N19B 4GY0A 1S3TC 4HK6A 3D6NA 1C9WA 1U1HA 4ZODA 1SO4A 2EKGA 3SJ3A 3F2CA 5EMKA 1RH9A 1EX1A 3EMQA 1XSJA 3NZGA 1JJKA 3GTIA 3E3HA 4GGHA 3MP4A 1Y0EA 4GNJA 5G2HA 4DWSA 5IOBA 1E1FA 3HMJG 1UUMA 2YL9A 2CU0A 3ZVIA 2OR2A 3PZGA 3U2CA 3MPGA 2BOFX 2PWFA 4TTUA 1LRQA 4LAMA 3N2CA 1J5SA 3G8EA 3GG7A 4IL0A 4M3PA 2ZZ7A 3EXTA 2GFTA 1W91A 1DVJA 3NZRA 3N6HA 2GVGA 4KT2A 4LV4A 4PMUA 3CHEA 3ZOAA 2PU0A 1Q8JA 4YWSA 5I3GA 2ZDRA 1TJRA 2A3HA 4LCSA 1XH0A 4RDYA 5LA0A 2E5CA 2YLAA 3WJYA 3YPIA 1ELSA 1UWQA 2V5CA 4NAEA 2PRLA 4IPIA 2B81A 2NQJA 4D8LA 1E9IA 1SJAA 2GGIA 2YDSA 3M5ZA 3KOWA 4C6DA 3FDGA 3UYCA 4LJ3A 3PFMA 1R5YA 1TO3A 2D24A 3R1ZA 1Q6DA 1Q6FA 2X05A 1OBAA 1W1TA 1W54A 5DRCA 3S9IA 1HKIA 2BS9A 4C65A 1PKMA 3G6MA 3C61A 4PBGA 3KEHA 1XRTA 3IS4A 1RALA 4IP7A 1LLWA 1D7KA 2INEA 2Y7DA 4DPQA 3LERA 3VKBA 4G6CA 3W7RA 2GJPA 1NARA 2P88A 1K9TA 2CZDA 3L9CA 2JGQA 6REQB 3FSTA 3SCUA 2DJLA 5SWUA 5BXRA 4QDWA 4G7FA 4ICNA 4XZ9A 3WLSA 5DXYA 1CBGA 1YPIA 3PM6A 1I8JA 2Z2BA 3UJRA 2C13A 5GNXA 1K8YA 1Z3NA 3TSBA 4FPSA 3WH8A 4IPLA 1VBJA 3NQCA 3VIOA 3KP0A 1QW9A 2GZXA 1FHUA 5AYIA 1E6QM 4LEQA 1P0EA 4B15A 1U33A 2QZRA 3GXPA 4ZA0A 1YADA 4XBKA 2VNCA 2NX9A 3JW7A 4JX6A 3EA2A 3B8WA 3O2LA 1RJRA 2PDFA 4UTWC 3ARUA 3HPXA 4U2ZA 4OIFA 1PIGA 4CGTA 3AQUA 4TQTA 1K4HA 3WF3A 1A5AA 3DENA 1EX5A 2OX1A 3WLNA 4X2PA 2ZRXA 4DBEA 2BWGA 1DJZA 1ZLPA 1TIWA 1XUUA 2RDXA 3GHSA 1RA0A 2DVUA 2IS7A 3RO8A 1Q13A 1OC6A 3V0UA 4FP1A 3GY1A 1O68A 1YQ2A 2QGHA 5E0FA 6A3HA 4IH3A 1XLFA 1CGVA 5BOOA 4C60A 2DVXA 3VO0A 1M41A 4JL2A 3BGJA 3E2QA 4Q8TA 3DI1A 1S1PA 3CV6A 5FSDC 1KCZA 3W7KA 4AVOA 2ZUVA 3W73A 3O6AA 3I68A 4D2JA 2PBGA 1PXGA 3TXVA 4ZVJA 5LA2A 4IFKB 2OZTA 4UTUA 3NG3A 1A0CA 3SCRA 2QUTA 1O94A 2DUAA 4NILA 5JBDA 2PBOA 1VYRA 5BU9A 1N82A 1AQ0A 2XSAA 2ZC8A 1SW3A 3UPBA 2ZX5A 3U7BA 1JR1A 2OPJA 2YZRA 4XAYA 1VBUA 3FYOA 2QVHA 1Z9AA 3LGEA 3OA5A 2PDBA 4HIBA 3OYZA 3NO1A 5DBTA 4JGDA 5KZEA 3WEMA 4WIWA 1T41A 5A6AA 1DE5A 2CLEA 3CXOA 5IFPA 4Y9MA 2P3EA 3BW2A 2G3NA 1G7VA 1KWGA 3LNMA 3HG4A 1BWKA 4M1RA 4JQ1A 3WDRA 1JQVA 1WKYA 3BZGA 3LY0A 1BYAA 1F3EA 3MUCA 3M9YA 4P8WA 2JEQA 3PZMA 1F7BA 4KESA 5A6MA 1FX6A 4H8VA 1FH8A 1YXCA 1BAGA 3SFWA 1JCNA 3PFRA 3RM9A 1NOFA 2D0GA 1HQTA 4GG9A 1W3LA 3NPVA 4ZQPA 1E3XA 1MNSA 2VRKA 3NUKA 4Y8FA 2FVMA 2PF8A 2C0HA 3GXIA 2VI0A 2DZTA 3O3RA 3G0XA 1YTEA 2PDJA 3T42A 3R0KA 4Q32A 3GNRA 3W2KA 3PZTA 2OLHA 4E38A 1DJHA 1XYAA 4Z2IA 3FK4A 1TTJA 4LALA 5T8GA 3BAWA 3QR0A 4H6QA 4CNSA 3IAQA 3B0PA 4PGLA 5JU6A 2J6VA 4UZUA 1HNYA 2AKZA 4KIRA 4PODA 4GINA 3QY8A 1BGAA 3KAOA 4EAMA 4JFUA 4GI8A 2ZZ3A 1H1YA 1OEPA 1GKPA 1R7AA 4LVAA 1DIEA 4AZGA 1CXKA 4P7NA 3RPMA 1TREA 1JEZA 4OUEA 2WLZA 1M7JA 4MLJA 4NIRA 5DMLA 3H8AA 4J35A 5AYZA 2G8ZA 1RCXB 5D32A 1PAMA 3VKCA 3V0SA 3QPYA 3W26A 1EOMA 4OQVA 4DX3A 1NOUA 3EX6A 1MUWA 3I3EA 2YXOA 4AMAA 3LOTA 3TH6A 2RUSA 1W9UA 4H2CA 3MMWA 3SCSA 3VIIA 5FEZA 2ONEA 4L4PA 3P60A 2WSKA 3NQGA 1O1HA 3L7RA 3UJ2A 4ZOCA 1KXVA 1SU5A 3OIHA 4F2TA 1BKHA 3BAYA 3SCPA 3VOIA 5HAOA 2Z29A 4PH6A 1FWHC 2DEPA 3H55A 3VNMA 4D6GA 3CAVA 1TV4A 2ZX8A 3NDOA 1R87A 1MW2A 2Q3OA 2H8ZA 1DWHM 2PDUA 1SW0A 1SFSA 1HKJA 3IIXA 3MVIA 1V6VA 5EFDA 4AZIA 4FR1A 3EX1A 4P8XA 1IEXA 4BKNA 1JCJA 1BLIA 5GVJA 4LTSA 1Q6OA 4FEZA 4U5KA 1VBRA 4JCMA 3AFBA 4IIBA 4IPJA 2WPBA 1J6PA 1C8YA 2QKFA 2W3ZA 1JF5A 4OVXA 4PUWA 3CZGA 1QVBA 4I6VA 2WB5A 1CLVA 2PTYA 4RKAA 2BFGA 2QCLA 3IJ6A 2Z1XA 5LGXA 1EQCA 3VXGA 3P7YA 4C6JA 5A6JA 4URIA 3PBVA 2VQUA 4TMCA 3GH7A 1LBFA 3E0LA 3V75A 4F0RA 3S2NA 4JS3A 1SSGA 2XH0A 3PJWA 2ZUUA 4JQ2A 4OOUA 1JZ6A 1VCVA 4EXBA 4UIOA 2EJ1A 5DELA 2TRSA 2IQDA 4KERA 3ZT6A 2V5LA 2PE4A 9CGTA 4QG8A 4AZBA 1XWYA 3EB4A 5AC5A 2EG8A 4KPLA 1UWAA 2MANA 2NQLA 2JKPA 5D03A 3CHVA 1XBXA 3A4JA 4QXIA 1FWFC 1NH6A 3W7HA 3MUAA 5D2WA 1H62A 4OHQA 4FXSA 5G4WA 2O9TA 4KCUA 3BXWA 5KZMA 3S2JA 1MQRA 4JOMA 1VFMA 3PG9A 2EPNA 2ZX7A 3VILA 1FP9A 3F03K 3P14A 1FTXA 3VKAA 4V33A 4Y96A 3N9SA 4DBUA 3TCSA 2WCAA 4ZB5A 2VVSA 5I0DA 2QF7A 3GTHA 1RP9A 5CJMA 4AX7A 2AOSA 5I03A 3V5FA 2C91A 4DUWA 4LAOA 2CWNA 2DJXA 4OTKA 2O9OA 3R8GA 3HIJA 5LGZA 3UZYA 4HOWA 3WLRA 1KRCC 4A29A 4ZO9A 3THAA 2V67A 1UBSA 4LBRA 3MT1A 1IWAA 3LCXA 4K2SA 2X2YA 5CC3A 2J9ZA 3UGRA 3VGEA 1I60A 2I5IA 1CB7B 6CGTA 4CNUA 5HDRA 3ARQA 4LC8A 1ZJAA 4J3XA 2OEKA 4BF7A 2QAPA 5ABGA 1BPLB 3WMCA 2R1PA 2YCKX 1W2VA 2WKGA 4Q8MA 3S2CA 3VMOA 4ZOAA 3REQA 2BSLA 2E9LA 3NJ3A 3FS2A 5E0CA 1TUXA 4BQ4A 3TR9A 4O53A 4PSPA 3SRDA 2OODA 5D9PA 2VR5A 2WSYA 2DIKA 4IGHA 1AG1O 5FAGA 2VGIA 3IEBA 4EXAA 3L5AA 3M5XA 4X61A 3T9PA 4M81A 1ZBCA 4XZHA 3C6CA 3QHMA 3CQHA 5CLTA 2NQHA 2DZPA 1MI3A 4GMEA 3WF2A 3BSGA 5HBFA 1MRAA 1XIMA 2G3IA 4PEKA 3G1SA 1F74A 1ME8A 3AXIA 1KBLA 5HQLA 2R1KA 3WQFA 4H9MA 3B8IA 1PTGA 2A3AA 4MKNA 5CZTA 3CGTA 3UJEA 5CZSA 3LQGA 4I90A 4Q8VA 1AMKA 1UC4A 5H8PA 4DJEC 1CGWA 3TJ4A 2XVNA 1F73A 1HG3A 3IGSA 1QW8A 1P6BA 3CHFA 1X98A 3ENLA 4JTIA 1UD2A 1P4CA 4IJCA 4BS0A 5LXXA 3W72A 1OCNA 3UG4A 4QAWA 3O63A 5D8ZA 1H1NA 2VDIA 4K36A 3M6YA 4AU0A 3BPWA 1CIUA 3L5MA 3AZSA 3AISA 3D3FA 1KRAC 2OEJA 2AL2A 3LI1A 5HUPA 1Z6KA 4FLSA 2RDUA 4LUTA 4QS5A 4H7ZA 1J0JA 1ICSA 3GG8A 3QQ0A 3B8SA 5BNKA 4HPXA 2J47A 3KVLA 3ABRA 5HANA 1H7PA 1WUEA 2NUXA 5CBJA 1OQFA 5E1QA 4LUIA 1JDCA 3GHTA 3L21A 4UMAA 1QK2A 1R30A 3W7LA 5A6KA 4M82A 4NKCA 4WOZA 3CMJA 3MMDA 3P84A 4JPGA 2FGLA 4A3YA 2ZUMA 1XJBA 1TWIA 2HTMA 1KV5A 4IT1A 2UY4A 4GUHA 3W07A 2P0OA 4JIHA 5B7YA 1M65A 1JRBA 2DZWA 1WZAA 4NAFB 1KRBC 1A3WA 3AO0A 4AG0A 3MSYA 1I4NA 3R43A 2A1YA 2PGFA 4XUGA 3QSRA 1S2CA 2BBFA 7ENLA 2EPHA 8XIMA 4O54A 2B7OA 3QKEA 1FWAC 3GW0A 4E4FA 1HO1A 2G97A 1Z41A 1MNZA 1H60A 5HA7A 3V18A 5C0QA 4NQ1A 3ARXA 3GDKA 1KQYA 4GIRA 4DWSB 1VJZA 1OWQA 3G1VA 1Z89A 3OGRA 3V35A 1ADDA 2BHUA 3P81A 2JIEA 3MUY1 4D72A 2QCEA 3LZ5A 1W3JA 3WDIA 5EFFA 1H0GA 3W1PA 3HGRA 1YXDA 3VIFA 4A8LA 1MO0A 1SO3A 3FHQA 2QCNA 1V6UA 3HG2A 1AQHA 5DBUA 1MSSA 3IVUA 3AMLA 4GOAA 3VDHA 4XX6A 2ADAA 1RQHA 4XK2A 3M64A 1HKKA 2VR4A 1E6SM 2J7CA 5F1UA 4A22A 1V08A 1YDVA 3N2XA 2DP3A 2FHBA 3IK4A 3QY6A 1OD0A 4LANA 2PC4A 4NAEB 3VIPA 1UMYA 5AOUA 3M43A 4LF1A 3RM4A 1MYRA 1Q6QA 4JTTA 4N0RA 4AW7A 3MCMA 4C6FA 2VM8A 4HCLA 5RUBA 4KQNA 1A5CA 3OVPA 4HK5A 1I1XA 2ZIDA 3OG3A 4QEHA 2CXEA 4C1LA 4DWSC 3BWWA 4HHLA 3RX2A 1NTHA 2QLYA 2PCQA 3CAKA 1LL6A 1LZOA 3VFCA 1Z44A 3RNDA 4DZHA 2ZUNA 3ME3A 4J27A 2ACUA 1B5TA 3OHIA 4F48A 3GB6A 4U10A 2OLSA 2FZ8A 4AY7A 3GR4A 1YE4A 3U2EA 3LPGA 2Z26A 5A94A 1JYWA 1CYGA 4GCAA 4KMQA 2CW6A 3APYA 4LY8A 1ZTVA 5C9RA 1PIFA 4FXRA 1MRQA 5I00A 1AQFA 1XIBA 1H63A 1IIGA 3CASA 1YKWA 3LTYA 3W85A 3APTA 1R85A 1QNRA 3PBGA 3G3DA 3SR7A 1G1YA 3IARA 4ZQRA 3H2EA 4QIUA 2GJLA 3CYJA 3LV6A 4DBWA 1HVXA 1MEIA 2C1HA 4HTBA 2V82A 4LYPA 4HOXA 1C8VA 4S3EA 3PJXA 4C1KA 1K6AA 1WQ5A 2V3DA 4GI6A 3PPGA 2WV8A 3GZAA 1Q66A 1FDJA 4FX8A 3BW3A 4LYRA 4AHQA 3RDKA 5E9AA 3DHFA 3T0TA 3N13A 3EKZA 3Q2DA 3CMFA 5A8GA 2HDJA 1UB3A 2OLAA 2H3BA 1GKRA 3PJTA 2F7FA 1AZ1A 3WBXA 1S38A 3VOGA 4UFJA 2PWHA 4S3FA 1XYBA 4PUKA 4LS1A 3CUGA 1JIBA 1SO5A 3UVIA 3T0AA 2OEMA 1RBLA 3E1F1 4NP7A 1FCUA 4GX9A 3U48A 5CC5A 3ITGA 2OFJA 4OJYA 1NDYA 1ZUAX 2QEZA 3N3MA 3FY1A 3OIXA 4JD4A 3T05A 5D9OA 1T96A 1HL2A 2DORA 1DJYA 1G4TA 1XD1A 1YDYA 2FVKA 4E4UA 4GYFA 2ASHA 5I5RA 3LCFA 3NDZA 4L9XA 5ABFA 1JD9A 4M0XA 3QV8A 3UXKA 3IJIA 4NZ3A 3C2VA 1BWVA 4LBUA 3THUA 3S83A 3M07A 1GNXA 2W79A 5AHIA 3KVKA 2NSXA 3AS0A 2YCJA 5EU9A 3II1A 4X63A 1PB0A 3AZRA 3GFXA 4O0KA 3VOHA 1A5MC 1ZSXA 2ODOA 3G2GA 3HGOA 4WHBA 1BFNA 4JZ5A 3KL3A 5H8MA 3W82A 1XYFA 4J1OA 4IHCA 2Y7EA 3TW7A 2F6UA 2BXVA 3SM0A 4I8DA 2WMIA 2QCGA 2ZX9A 4D6HA 4JTUA 1ECEA 1HGYA 5F2MA 2WKLA 2FVLA 4U28A 4PL1A 1H50A 3MU7A 3N3TA 3ELFA 2WM1A 4ERGA 2W66A 1OZMA 4OZOA 1F5ZA 4NASA 4GFSA 3WSUA 1UMLA 4DUVA 5BRPA 2G0WA 1POKA 4BWLA 2OKOA 1XIIA 4GNVA 4TV5A 1V3KA 4W85A 1CLKA 1KKRA 4TUFA 2PLKA 4PTNA 5FF4A 2RJHA 5CKSA 3IJ8A 1TJPA 4LUJA 1NFBA 4ZQOA 1K9FA 1S1RA 1JZ7A 1W5NA 4QLLA 1VPQA 3EOOA 2TSYA 3K2GA 4DO6A 2HPIA 4JFTA 4HA1A 5XIMA 1DTUA 3LU2A 4INFA 4KCTA 1A80A 2V0TA 3ZZ1A 4KEVA 1XDLA 3N18A 2Z7GA 3IIOA 2RDWA 3N2MA 4LAZA 3S5OA 4AD2A 2J77A 4LVGA 3DI0A 2YLLA 2ZZ6A 2J24A 5TBOA 4CU6A 3SY5A 3EOUA 4A3HA 1JDEA 3ALFA 2WBKA 2YW4A 1YHTA 1P48A 4DO5A 1EJVC 2YXXA 4POCA 1T6MA 4RXFA 3S9YA 4XUYA 5FEXA 1OF8A 2OYKA 4AZHA 3L4TA 1EDQA 2Q01A 1HP5A 3ITXA 1YTDA 4ZFMA 3BG3A 3S6TA 1BSLA 4GH3A 2AMGA 2Z7KA 3P93A 2BOEX 4MAVA 3WD3A 3PSWA 2DU2A 1A5KC 2EHHA 3MZNA 4KFOA 4H01A 4NRSA 2F2HA 1GYLA 1BXCA 3CTTA 3PZUA 1LORA 1I45A 2VC6A 1K03A 1UOZA 1E72M 2PU1A 3SADA 5GNYA 2XH2A 3GK0A 3MQTA 3W6MA 5FIPA 3HQNA 4GYPA 3KCJA 5T9BG 1XCFA 1XP3A 4NYYA 5CPLA 5HNTA 4UMCA 3W01A 2GQ8A 3BLOA 4F4RA 1ODUA 1EC8A 3N17A 3TN3A 3GNXA 5REQA 5LIWX 1GQLA 4GVIA 4LOCA 2WLYA 2ZE0A 4XZLX 4ZB0A 3HGJA 5CGMA 3FEMA 5CSYA 4X3ZA 4PMZA 5KEZA 3B97A 1HF6A 3S1XA 2D73A 4Q7NA 3TROA 4WF7A 2WZIA 2X7VA 1IZKA 4IG2A 2VEGA 3DHUA 3N25A 3VYLA 2Q6ZA 3H21A 1YNYA 1K02A 4DIAA 5A6LA 3VD7A 4L65A 3K4WA 3I10A 4MUZA 1XLEA 3WLKX 1JQXA 4O14A 4S23A 3NCOA 4B91A 1EF3A 4MNLA 1S2WA 2QNEA 1LL4A 3M0KA 4YCPA 3VUSA 1UIOA 4D6JA 4AD3A 3QW3A 1A0DA 4ICMA 3LEPA 3PF3A 3EB2A 4BEQA 3T09A 1O66A 4UR9A 4F2BA 3RX3A 3MHGA 3A4XA 4O17A 4IMEA 4QG9A 4GIAA 2DW6A 4RV3A 2A6NA 4L64A 1PL9A 4G1KA 4ML4A 3AROA 4Z1AA 1KQZA 1XLGA 1XQKA 4DUOA 1WE5A 4DXXA 3DCPA 3AIBA 3H2OA 3KOXA 2CLOA 5E6ZA 3C0JA 3GRIA 1QFEA 3DGBA 4DI8A 3NGFA 3K1GA 2QUMA 4C7FA 3KBMA 5KINA 5LA1A 3WQPA 4OE7A 1PVNA 1V6WA 3U7VA 2YCEA 3H23A 4DNMA 3IUHA 3S6DA 3B8UA 3I7SA 4ECLA 3CBWA 4DZ5A 2JKAA 3R7MA 1E4MM 2VT0A 2PP0A 5HXMA 3C0QA 4DBSA 3SZ8A 1TB3A 5LNVA 2Z1SA 1XYZA 3A5FA 3ZIZA 4MKVA 4ML9A 3SW6A 3MO7A 1JULA 4W88A 1UZHA 3S2MA 3F2DA 3B9OA 3N2TA 3KWSA 2ALDA 4REQA 2DY3A 1OG0A 4XAFA 1WZMA 5EMUA 4CQCA 1RR2A 4HPJA 1TTQA 3UU0A 4DYEA 4IUGA 2XSXA 3UGVA 1ZY9A 4OBTA 3XINA 3U2OA 4Q7BA 1IT0A 1V3IA 1G69A 1C7TA 1Q6EA 3WQ6A 5KSWA 3AALA 5IHRA 1NJJA 3WJSA 1EA9C 4JIEA 2NQZA 4S39A 3RO6A 3ID7A 4GFIA 4M6PA 3PZOA 4ZE5A 2HSAA 2X42A 1E0WA 4K38A 2D23A 2XG9A 5LHEA 1FWIC 4Y90A 5AZ0A 3ALGA 2FFIA 4GC3A 2GGEA 1OC5A 3B04A 4C6EA 3REQB 3RJYA 2J4GA 1IR1A 3LTSA 3GR7A 3T2OA 3QYSA 3ARPA 4B2DD 1RJPA 4HN4A 1F76A 3E2SA 4Q8NA 1IEVA 1G6CA 4MZ8A 4ACYA 4A35A 3FYPA 1RQBA 3SIZA 5CZ0A 3TC6A 3UWEA 2E3ZA 1TX0A 3DC8A 4HU4A 4OBRA 3B0UX 4D1IA 1LCOA 4JHZA 3VDBA 1VBHA 4GUFA 3GLCA 1HJVA 3IRDA 1JYXA 5AY7A 4C90A 3PBWA 4Q8PA 3E49A 3ANUA 3C52A 1PZ1A 4TX6A 2QV4A 3ANYA 1ITQA 3W9ZA 2PDGA 3LPFA 5G1YA 4H3DA 2E68A 5D2XA 1Z7AA 4UTTC 4QM1A 1L6GA 1MXGA 2POTA 3PWGA 1KFBA 2HWGA 3TYZA 5I79A 6ENLA 4C6BA 5BWAA 2FPYA 3CM4A 4JQAA 3LHTA 3CO4A 4XAPA 1C91A 2POZA 1EPXA 1QHPA 1VCGA 4JTSA 3OB8A 1OGBA 1V8EA 1XG4A 5GJMA 3TUUA 1JUKA 3V5CA 4LUTB 1QHZA 1XLIA 2G50A 2Y4SA 3UT0A 2E09A 3QF0A 3G8RA 4WDWA 5FSEC 1LUCA 2C3ZA 3ABXA 4IMCA 4PCSA 3LRLA 1GPFA 4KRTA 1AUSL 3GR8A 2ZRUA 3BANA 3S5YA 4FLOA 3PZQA 2INFA 3THDA 1AVAA 4O0ZA 3N1AA 1R47A 1FWGC 1G7UA 2D3NA 2NVDA 2BY1A 2INZA 2QMKA 3W84A 3KX6A 3W76A 2V2DA 1CT5A 4ICCX 1V51A 3QKZA 3AC0A 3IJDA 4FNUA 3S1UA 3UNTA 3EMZA 2BX7A 1XHGA 3P82A 3KWXA 4GBDA 4ZTYA 2W5FA 3RPDA 2EPMX 3IJ9A 3W75A 5LKYA 3CPRA 3OO2A 4PBFA 3BSHA 1GOKA 4OECA 4C7DA 5DQPA 1NQ6A 1TV5A 2GVJA 1UKSA 1WO2A 4MJ4A 1M1BA 2J7GA 4Y9OA 2EGZA 2G3FA 5FL1A 1GVYA 1UKTA 3BW4A 5TF0A 3MV01 3HPFA 2ZRZA 1THFD 5JVLA 3TYEA 4AH7A 1F6PA 5TNVA 4HBKA 1QAPA 4CQ8A 3A64A 4JDBA 4HD5A 5HJLA 2OWXA 4EE9A 1D9EA 1LOLA 5C7VA 4AEOA 1ODZA 1OM0A 3R0UA 1DQXA 3KBNA 3DKJA 5D4YA 2E6AA 1AJZA 5TD4A 2WVSA 3FW6A 3F4WA 5F4SA 2DZXA 2OZ0A 3A4WA 5EB8A 4XIMA 5DMYA 4LY4A 4JYDA 3W7OA 2WHLA 3CYVA 2F2KA 2WM0A 2C6QA 4L4OA 3LGDA 5A8MA 2P50A 1C92A 5D2VA 3SGUA 2DUXA 1DWAM 2QPXA 4IQJA 3VVGA 3E0FA 3W02A 3ZLFA 1XPGA 4GQ0A 1X6NA 1DEDA 2VFFA 1O7AA 1NELA 1B9BA 1N7KA 4XZIA 3WO8A 5HMDA 1W1PA 3LCWA 3W7MA 3W53A 3LPOA 1DPMA 1TR1A 2WW5A 2XN2A 5A2BA 5HUOA 1TYGA 1W8SA 4W7WA 2OB3A 2F6KA 4QSFA 1MQPA 4JY9A 3JUGA 1TWSA 3Q37A 1WYIA 3EWYA 3VX1A 1SFLA 2QVNA 3AICA 3W6YA 2YXGA 1PUDA 1EP2A 2VEMA 5CZKA 1U5HA 3APGA 3RIKA 2FH6A 2BGSA 3RPTA 2HS6A 4GPNA 3ARWA 2QULA 3VOFA 1W3HA 4I6KA 3FJLA 3LN3A 4B5XA 1IEIA 4GIEA 1VR6A 3WK2A 1OCJA 3W83A 1GVRA 1GT8A 4D6DA 3N4EA 3CV7A 3VAVA 1HKVA 3R13A 1X38A 2OGJA 2UY5A 3NM1A 3NQMA 2FZBA 4W8LA 1V02E 1XYCA 2VEPA 3WY1A 3BURA 5EYWA 2WSRA 3BO9A 1XLKA 1JI1A 4MKSA 1DWIM 4KEMA 1PHWA 4WDUA 4JIPA 1DXFA 4ALDA 3W1MA 2G96A 2E67A 4GQRA 4HCDA 4NI8A 5G5IA 2YB1A 4G9PA 3UEQA 3CWOX 5HK4A 3JU2A 2EKCA 2FDMA 3SN4A 2DQXA 1J2BA 4K8GA 1YDNA 4QCFA 5BMXA 1IWPA 4IJBA 4UNIA 5JXQA 4MF4A 4AD1A 2VCBA 4S3DA 3BV4A 5D30A 1KBJA 4L9YA 3ITTA 1DJIA 3S4TA 4KRZA 4BF9A 4E8CA 1F05A 3VIGA 1I2QA 1Q65A 3WH9A 4I7VA 1WDQA 3CZKA 1NP0A 4TVUA 1D3CA 3QEZA 4PUUA 4OT7A 3ABZA 1KBIA 3AS1A 3PB0A 1O12A 4IWWA 3ZJ6A 2F61A 3FFSA 3PP7A 1KO0A 3VCNA 4IOTA 1XBYA 5BXPA 4NX5A 2J8GA 2QCFA 1ONXA 4M51A 3M0YA 3TIMA 2PA6A 1DL3A 3W2UA 1DXEA 5DMNA 3AUOA 3WQ5A 4U4MA 2WMKA 2J7FA 4QISA 3WBAA 1AFSA 3V36A 3WD1A 2OT0A 4WR3A 1QI4A 2YPIA 3AYSA 4UTIA 4PCTA 2UWFA 1R3SA 2WK2A 3MMTA 1OIMA 5ABFB 4MFDA 2GL5A 2PURA 1UR4A 3BJSA 2DQWA 2P3ZA 1EPVA 3N04A 4R7OA 3N6QA 1RK6A 3MSGA 1TWDA 1E0VA 3CS2A 2NVCA 1R3QA 2C1GA 2CYGA 4GX8A 4M6UA 3RLHA 4GUGA 2ZE3A 4YVPA 4O13A 4OBSA 3GDBA 3VINA 2MNRA 3L4VA 2ZUSA 2FDSA 4XKYB 3W7DA 1ZRQA 2IMRA 4DWSD 4WDXA 1OFPA 2CBIA 4QE1A 2E6DA 4JFSA 1JCYA 1NP2A 2QYGA 2WJDA 1Z42A 5A3HA 3SY1A 2WMIB 5A69A 5I3KA 3S5ZA 1KD0A 2J66A 2RHGA 3QR3A 4QRNA 3GG1A 2VCAA 4GISA 1VFFA 4IM4A 3URAA 5DF0A 1TR9A 1OYCA 1RD6A 4AWEA 1FWNA 4WD0A 2Y8UA 3ZLHA 1HJUA 4US6A 4DF0A 5HOSA 1RBOB 4I9JA 4ZBCA 3ITOA 4IGNA 1AH0A 1PKLA 4TX8A 3T4WA 5DY2A 4JIRA 1FH9A 1QASA 2XZ9A 2IW0A 2X0HA 1YLVA 3TJIA 1W9PA 4WY0F 2OQLA 3IV8A 3DG6A 2OVLA 1U83A 5IDIA 2QAFA 2V30A 3KL5A 2E8ZA 1V7AA 1UD6A 4LU0A 4N6EA 3KLKA 4PMYA 4HNTA 1X96A 1AA1B 4CNOA 2DPEA 5FF0A 1FWWA 2ISDA 4F3HA 1J96A 3HTWA 3AIEA 4NT0A 2D2JA 3EAUA 4RNFA 4P8UA 1MW1A 1S2TA 3B8DA 4XWUA 3AI0A 1JAEA 4TVCA 3L12A 3GQYA 4H6EA 1Q4NX 2OO0A 1XCXA 1CGXA 4QNEA 2ISVA 3I3DA 3NVTA 4FF7A 1RJQA 4PTVA 1XFCA 4DM1A 4HCHA 1AL8A 1UIPA 1XBZA 2E25A 5DANA 1WX0A 2AGTA 5C7HA 1WDWA 4LS0A 4QDMA 4PC8A 3WQOA 4NYUA 2WHMA 3CLWA 3VK5A 4LQ1A 3MI6A 3VKDA 4V2XA 3BAKA 3KDNA 1W1B1 4HU8A 2VWTA 3CUHA 3NZ1A 5I09A 4B5VA 4GCXA 1UP0A 2PDWA 1TV2A 4ZOEA 5CPNA 1EXPA 3MI3A 1LLZA 1K3UA 1SMDA 1X7IA 5KZ6A 4HPGA 3RU8X 1MFUA 2QJIA 1QI2A 4Z0SA 1HKWA 3DBPA 4EKJA 2YX0A 4PTDA 1ADSA 4PRRA 1DBTA 1P6WA 1UHVA 3A9IA 1MDLA 5LIYX 1JGMA 3GNDA 2L5HA 3NFUA 4F66A 4P7OA 3V16A 4L1WA 5BMWA 5REQB 4AC1X 1UR0A 2OSXA 1US0A 3A24A 1GW9A 3H70A 1DJXA 3S1GA 4B90A 1QTWA 3S47A 2X7WA 2CXGA 4F0HA 4S2BA 2Z1VA 2CEQA 5DX7A 4GACA 4IG2B 3NXFA 1GORA 2F9RA 2UZ9A 3W6LA 2IQTA 1ALDA 4RE0A 2FKPA 3ZYZA 5DLCA 4Y2WA 2QDHA 1IE7C 4GO8A 2NV9A 3SN0A 1KNWA 3UCCA 1CGTA 5J8LA 2G95A 3F5JA 3E74A 3WDHA 1RD5A 2RDTA 4CKQA 1ML1A 2VURA 2D1ZA 2A4AA 1EIBA 2V5BA 5EMYA 6ALDA 4HA3A 1VJSA 5CGQA 1SUXA 2QV5A 5GQBA 1E9YB 3KM8A 3GW3A 3OW1A 4JIQA 2HXUA 2REQB 1EZ2A 2ZFAA 4QFUA 3F7JA 3WK3A 4PCNA 2NV2A 2V3EA 2E6FA 4Q8UA 1VHNA 3HQPA 1QPNA 1F6KA 4WK9A 2J9XA 4H41A 2QXWA 4D8AA 3CWNA 3GX9A 4LB4A 1QXLA 2ZYFA 4P7RA 1TKKA 2F8QA 1EO5A 1R3VA 3CZJA 4YTRA 1J0YA 4JBRA 4UOQA 3HF3A 3A47A 4J2MA 4Y9AA 1ZHAA 3T4CA 3AU6A 3NZPA 3W7IA 4LYQA 2ACQA 3VNLA 2DIEA 2JF6A 1QW7A 1AD1A 4ILSA 4UBPC 3GTNA 5A1AA 4W84A 2OQYA 4JYEA 4C7GA 1SFJA 3JR2A 3QQWA 2YW3A 4AD4A 4B16A 3HQ1A 4IIFA 1GYMA 3AHYA 3OBAA 2BOGX 2YZ5A 3BK0A 3WLOA 4E8GA 4WZHA 3RK8A 2QDDA 4REQB 5D02A 3FV9A 3UP8A 1JZ5A 4R9XA 3VD4A 3UR8A 4KWSA 5DRIA 2B4GA 4DZAA 1CLXA 1PDZA 4MTVA 3WLHA 1XIDA 3EWDA 5FJRA 2X16A 3LS9A 1BVZA 2J74A 4A8RA 5A8NA 2DH3A 3TW6A 4UZSA 3A12A 2XN0A 1QOXA 4PMOA 2JALA 2VRJA 1L9WA 5T91A 2HVMA 4O50A 2DSZA 1GOWA 4FNSA 3LLDA 4IISA 4DPPA 4O1EA 2E1WA 1OYBA 1EXBA 5CG7A 4L5ZA 4HPNA 4PTMA 2J8TA 3GNNA 1EJXC 5CXPA 1GHSA 3S3GA 4GE8A 1QOQA 4X0VA 1LDCA 2ZA2A 4V27A 4X60A 5ECVA 4HNNA 4IIEA 3ZR4A 2D3LA 4O8RA 4ROQA 2PWGA 1L6SA 4FXJA 2ABAA 2VFIA 2CZEA 2V6AA 4NRRA 5AHFA 3L0KA 2FHFA 1TJ0A 1XLHA 2PZNA 1OSEA 3CMGA 3HJEA 4NNCA 6XIAA 4EACA 1HO4A 1ZAHA 8CGTA 1TPB1 4JIIX 3GNPA 3M0MA 4U31A 4NNAA 3NQVA 2ABBA 1ZJHA 5FF2A 2TAAA 2WMHA 1QPOA 3KRZA 4B5WA 2Y85A 4XTDA 1AJ2A 2QQ6A 3TEVA 4XZBA 2E6YA 4N4PA 4R88A 1DXIA 4YXGA 3BG9A 5I3IA 2H90A 5M17A 3VUPA 1PS9A 1NIUA 1KR1A 3PANA 2GDVA 3DFHA 1RQEA 5MHBA 3HA1A 1TWZA 1F4HA 1KA9F 1ZBKA 3FOKA 3W7EA 1EUNA 3MKKA 1UYQA 3SSZA 1UUQA 3AXXA 1CGYA 1R2TA 2ZZ1A 5JIWA 1GOXA 1RVGA 4J3TA 4FSAA 1UA7A 3NQ2A 4Y9PA 1LUCB 1J2WA 3LHYA 3O6DA 4B5UA 3A6OA 1JDFA 1UP3A 4C6QA 1UD8A 1W3KA 5FACA 3T1GA 2EPKX 1TIMA 3EMCA 3WDQA 2WNQA 3NQBA 5D33A 3LCHA 4GA8A 2J9YA 2QCDA 2HNHA 4MY8A 1Q4WA 4BI6A 2GVLA 3XISA 4PE8A 1K8ZA 1B30A 1T99A 2CERA 4UTJA 2QUVA 3CQJA 2D0HA 1IT7A 4FOUA 3ARTA 1JXKA 3QXBA 3C8NA 4J28A 2CBJA 3CZLA 1F8MA 3CQKA 4R27A 4DF2A 3EBVA 3E0WA 3VZXA 4LYKA 1X7FA 1WZKA 2Z25A 4WEVX 2WVTA 1PTDA 2FH8A 3LLXA 4JN8A 3WLPA 5HMSA 1XLMA 2HJPA 4AXNA 2C18A 1AH4A 3OYXA 1VZWA 3TFCA 1X6LA 1EGVA 4W93A 9XIAA 4GRSA 1J0KA 3AWOA 2QCHA 3EOLA 3LUTA 2E7FA 1EIXA 4PEEA 1OFOA 3WD4A 3ZO9A 4MNMA 3ARZA 3B9NA 4X9YA 1XLLA 4JTHA 4XZNX 3M0JA 5DEZA 3B4YA 5A6BD 2ALRA 4NU7A 4RX0A 4Q4SA 3EPOA 4UFMA 2J13A 1CPUA 3R79A 4OV4A 1OY0A 3K13A 2XIMA 3LA4A 1DE6A 2GVYA 3H7VA 4DLFA 5EBUA 3MDWA 2G41A 2HVNA 1NOWA 1DV7A 4HSOA 1NDVA 3BCDA 3ZSSA 3GU9A 2NUWA 3L2MA 2I9UA 1RUSA 2J7HA 3H6OA 4HQVA 4O10A 3G0UA 4MWAD 3CV2A 3WQWA 2GGJA 1QUMA 5C71A 2EJAA 3O05A 5T9CE 4Q3MA 4TTGA 3BLEA 3CUZA 3NURA 1B9ZA 4C1NA 3VGHA 3PJUA 4DQWA 4EAYA 3U2ZA 1SJDA 4C6KA 2EXOA 1U22A 2PDCA 4NX0A 2IQ0A 1HXJA 3I65A 1IR2A 3D47A 1OB0A 5HMEA 2ISFA 4QJ5B 2VYOA 3USZA 4AISA 3OQ8A 1QO5A 1VH7A 4C6MA 1XC4A 1IT8A 3SCTA 1BGGA 3WBEA 2GGHA 1UP2A 4KEUA 4NJIA 3POCA 1L8NA 1JXJA 3S5NA 3OODA 2ZC1A 3SCQA 5M5DA 1IXNA 4LNCA 2V5DA 3S6OA 4I5XA 4V28A 5K2ZA 2A3BA 3TN6A 4UQAA 1WDPA 1C9DA 3FVDA 1JYVA 3WZ0E 3ARVA 4AIUA 3TONA 6TIMA 4ADSA 4E3VA 1J6OA 4EVZA 2VX7A 5F2IA 2E77A 1BYCA 3RR1A 4MOZA 1K8XA 2XM1A 4ERAA 3KRUA 3U5UA 2JE8A 4HK7A 5C8BB 4FI4A 4JL1A 1RV8A 5I06A 3LQLA 4PFHA 1IHIA 1UWRA 3FLUA 1EGZA 4AB4A 3R2GA 5AB3A 1UKPA 2DZUA 3RAOA 3TYAA 2C16A 1QNOA 4GABA 5CPOA 2BP1A 3PZ9A 2PWUA 2PDHA 5I07A 1VS1A 3LB0A 3I6RA 4CD8A 3FKKA 1EUAA 4BF5A 3LHZA 2AAAA 2X0YA 1SZFA 2JBMA 3M41A 1XM3A 1A4LA 1DTNA 4JFVA 1UWTA 4UFKA 2YL6A 1GHRA 1EB3A 1N8FA 1EP1A 3IIVA 1E43A 1R3WA 4GY7A 4LGXA 3HV8A 2Z4GA 5BU6A 5AVNA 3NDYA 4AUBA 5CC7A 3W0KA 2EG6A 1XRSA 1CI1A 4ZCWA 1ISVA 1KFEA 1MUCA 4R7JA 5CC6A 4XAZA 3WJZA 1O1ZA 3GS6A 4DWDA 2VKZG 1EA0A 3BSMA 2VC5A 3LXBA 4EX4A 3EOSA 1TQXA 3C2FA 3KL0A 4I7UA 1S39A 1JUBA 3IUIA 3T6CA 1N8WA 1BXNA 4Q4OA 1JZ2A 3UG8A 4LVFA 1JDDA 3UW6A 4GLEA 3GVWA 3LX9A 1VQTA 1BTCA 5A8QA 3QZAA 4DJFA 3GKFA 4A8IA 4HZ7A 4S38A 2VGFA 1BSIA 3G5EA 5E09A 3BLLA 5F2GA 1L2QA 3G6LA 1FUYA 4FA3A 3BC9A 2BVDA 5M03A 2BY0A 1TE1A 1UWSA 4MB5A 4TIMA 3WELA 1Z69A 4IFOA 3UQNA 4Z08A 3EEZA 1K9EA 3VX0A 1S5MA 1CWYA 3DX5A 2NX1A 4MZ1A 2FTPA 5AC6A 4YYFA 5D04C 4NJHA 3PSVA 1XIEA 3SN1A 1W3IA 3MSDA 4N4QA 3N9RA 2GYIA 3ITVA 3W2MA 3QMTA 4BCEA 1UR8A 4LAKA 4PMNA 3VIHA 3QFEA 3WEOA 4LT9A 1UQZA 4BY3A 2X1IA 2Y7FA 4UQ9A 3ZQ9A 4W8AA 3PB2A 3KVJA 5AKQA 1LT7A 3P2VA 3THCA 4ZXOA 3B3DA 2PDMA 3VCRA 2FIQA 2AQOA 2ZZ2A 3BH4A 1WB0A 2EQDA 4W7VA 1BHGA 3M1ZA 2HBVA 1UC5A 1RVKA 1UD5A 3TMQA 1C90A 2BHYA 3W87A 3MC5A 2DGAA 4OOZA 2WZMA 1I75A 2PF0A 3NSNA 2VUNA 4UFLA 1GZGA 1I2PA 2YSWA 3LXCA 2IXVA 1K7XA 2VZUA 1ZFJA 5HNNA 3GSMA 4RCXA 1ADOA 3HV9A 2VDHA 4JEJA 4JN6A 3DEQA 4Q33A 1XLCA 1JCLA 4MNJA 2IPJA 4IMFA 4RZBA 3SSJA 3E5BA 1NWRA 3WH5A 3W1RA 4TO8A 1VJIA 4N2YA 1IGSA 1ZAJA 2OQHA 4K7VA 2Z00A 2VRQA 1W1YA 3B0VC 1B3YA 4CD4A 2Y62A 1R38A 2QGYA 1J0HA 5BCAA