4YN5A

Catalytic domain of bacillus sp. jamb-750 gh26 endo-beta-1,4-mannanase
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
391
structure length
391
Chain Sequence
IPKDSEGQSFKLVDSNASTLTKSLYAYLQDTSGRQILFGHQHAVDEGLTLTNSGDRVGSTQSEVKNAVGDYPAIFGWDTLSLDGYEKPGNEKNSQAQNRANVVQSMRTVHELGGIIALSMHPENFVTGNQYNDTSGDVVKNILPDGSHHEVFNAWLDNIAAFAHELTDQSTGELIPVIFRPFHEQNGGWFWWGAQTTTASEYKALYRYTVDYLRDVKGVNNFLYAFSPNAPFDGNLTQYLRTYPGDQYVDIFGLDQYDNKANAGQATFLNGLTQDLAMISKLADEKGKIAAFTEYGYSPQGFNETGNYLQWYTAVLEAIKKDPNASRIAYMQTWANFGYPTNMFVPYRDVNGNLGGDHELLPNFVEFYEDDYAAFLTEASGWNLYQDISTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus sp. JAMB-750 GH26 Endo-beta-1,4-mannanase
rcsb
molecule keywords Mannan endo-1,4-beta-mannosidase
molecule tags Hydrolase
source organism Bacillus sp. jamb750
total genus 146
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4yn5A00
1UD8A 4W7VA 2VVNA 1V3HA 3BSHA 3VUPA 1W2PA 1CEOA 3W0KA 1SYTA 1E4LA 2YBUA 3UR8A 5CPTA 2J7EA 3BH4A 4D1JA 4PTXA 3EMCA 3MV01 2YOCA 3F5JA 2YLLA 4E8DA 2D3NA 4MAZA 1TA3A 3GM8A 4V27A 1QBAA 1FA2A 2CHNA 3EBVA 3LPPA 3VVGA 2ZUWA 4HZ6A 4J3WA 1JIBA 1CENA 2YL8A 4UQEA 2VCAA 7TAAA 2WHJA 1WO2A 3T0BA 4UNIA 4WSKA 2UWFA 1B90A 3ZJKA 3ARZA 1ZBKA 3SCWA 3A6OA 2WWDA 2W63A 1UG6A 4WIWA 1E6ZA 1H0GA 2B31A 3CHCA 5LA0A 2WMHA 5CG0A 1EIBA 2VURA 1QNRA 2ZX9A 2VC9A 1V6YA 3W37A 3SURA 4B9ZA 4GZEA 4EKJA 2UY3A 2D24A 3WH9A 3WD1A 4FK9A 3WH8A 1M04A 2W5FA 3MKKA 4P7QA 4PMXA 5JBFA 1H41A 2QMJA 3AISA 2PC8A 2EEXA 3ARQA 3ZT7A 4UQBA 5D4YA 1GQLA 3AZRA 1R85A 4BQ5A 4W5ZA 1B2YA 2VNCA 3QOKA 4W7UA 4UQAA 2W66A 1RD6A 3W6MA 1MFVA 5HBFA 4JFSA 2DPEA 4AZ6A 3RILA 2WMIB 1IZJA 5E09A 4KGJA 4ACZA 2DH3A 3VU2A 1E9LA 2WBKA 5JIPA 1HKJA 1GCYA 3PTQA 2BFGA 4XZBA 3CTTA 5A8QA 5IFTA 1C90A 1XHGA 1C8XA 4U5IA 4AZ7A 4AZCB 4PMQA 1DWIM 4J3VA 1E5JA 3D3AA 1JZ6A 4IM4A 2OYKA 4UTFA 1FHDA 2WNWA 4F9DA 4AIEA 3VPLA 2VO5A 1FH8A 1J12A 4V2XA 2DSZA 3BC9A 4HP5A 5E0CA 3GBDA 3VGGA 1L0PA 3O9NA 2CBVA 3PBGA 3SCTA 1V0NA 2EJ1A 2WMJA 1K9DA 5TD4A 3M46A 3WMSA 1QHPA 1UH4A 4PSRA 4PMZA 1HJSA 2QHAA 2WMIA 3SCOA 3CO4A 2WC3A 1GHRA 2VX4A 4E8CA 2WSKA 4NZCA 1DEDA 3WEZA 1TE1A 2J4GA 1RP9A 4MTVA 3WD4A 4DUXA 3WN6A 5A6LA 2XVLA 3SUSA 3TTQA 1MFUA 3WD3A 1ODZA 4E4PA 3N1AA 7A3HA 3N15A 4MB5A 3TP4A 1VJZA 4F8XA 2XIIA 3FXYA 3IAQA 1UKSA 2DIJA 3CHEA 1CGUA 1GOMA 4YN5A 4GQRA 1C93A 1JAEA 1JYXA 4CCCA 4U3AA 1VFMA 4PMOA 1Y7VA 3IJ8A 1HX0A 1WPCA 1GVYA 3PN8A 1AVAA 1UD2A 2QLYA 1ISZA 2J7DA 1EDGA 2CITA 3WBEA 1WZAA 2BY0A 2ESCA 3ZT5A 1ZBVA 4ATWA 4S3KA 3CZ8A 5BROA 3RM4A 1WDSA 1VENA 2VX5A 5I6SA 2YA2A 2CHOA 3WF2A 1JFXA 2YL5A 2ZUUA 2CBIA 3WUFA 1YQ2A 1HL8A 1CGYA 2WVTA 4D6JA 1LG2A 2JIEA 5HPCA 1E43A 3AXIA 4YHGA 4W88A 5CQ1A 4D6EA 1JL8A 1E6XM 4QFUA 2AMGA 1XGZA 1J0JA 1LL4A 3T2PA 1M7XA 2OYLA 2E0PA 2XWDA 4H2CA 1ZS2A 1G1YA 3WMCA 3VD9A 3VGDA 3OLGA 2D3LA 2JE8A 2FH8A 3ZMRA 5JIWA 3ECQA 1ZJBA 1GOKA 2WW5A 1US3A 2V5DA 4AXNA 2WXDM 3CIVA 1CXIA 2NW0A 4P7RA 1DHKA 1A47A 4M29A 5CPQA 1H11A 5EFDA 2NT0A 3SUTA 2W67A 2Z1KA 3AI0A 3ARPA 3ZIZA 2CIPA 5A94A 2WSPA 4D6FA 1MXGA 1JXKA 1SMDA 4CD8A 4PSPA 3WMBA 4M81A 4QDMA 3L4YA 1BGGA 3VOCA 1E4MM 2V38A 4BQ4A 5A1AA 1E6RA 3B9AA 3CUGA 2WKLA 2W62A 4EAMA 1V02E 1KXVA 4AZGA 3W6LA 3TTOA 5C8BB 1CLXA 3WNMA 1FFQA 5A6BD 1W3JA 4PTVA 3CZEA 3M07A 5BWFA 4AD3A 2VOTA 4W8BA 4F79A 5ABHA 3DECA 4J3XA 1HJVA 1O7AA 3SCQA 3GTNA 3AIWA 3AMGA 1UD3A 3ZJ8A 3OLEA 3AQUA 1CBGA 4UQCA 1UZ4A 5HNNA 4C7GA 3ARXA 3GH5A 1PIFA 4JKKA 1J0YA 1VFUA 4B3KA 3L2MA 1VAHA 4W8AA 4XZWA 3T08A 2OSYA 2Q8XA 3OA5A 1IV8A 1G9HA 3HJEA 4U2YA 1GZJA 4TVUA 4QLKA 4RE3A 4GIAA 2WBGA 3ZR5A 1GQIA 4PN2A 1US2A 1PBGA 2J78A 1OD8A 1UWUA 2EPLX 1UD4A 1PEZA 1LWHA 1EOMA 3GNPA 3RIKA 3K4DA 2CXGA 2D0FA 1KQZA 1G0CA 4MB1A 5CPSA 1B3YA 3CUJA 1PX8A 1CGTA 3VIIA 4QP0A 4U33A 3FNDA 4W89A 4X0NA 2G3JA 3AXXA 2GK1B 1R87A 1EQCA 3VIGA 2JEPA 4AEEA 3BAKA 1B1YA 2E8ZA 2YDQA 3DC0A 3VIMA 2WVVA 4PEEA 1WZKA 2VR4A 3GXIA 4GINA 1KXQA 2WHLA 4MNKA 5I2UA 4TTUA 1PX3A 3SEPA 1E56A 2J8FA 3GNRA 5ABFB 4P8XA 2VRJA 3WELA 5HPOA 2EPNA 3U5UA 2XVKA 3NYDA 2CERA 2J7GA 3KL0A 3KEHA 3MU7A 2XWEA 3WQ5A 4NSBA 1X6NA 1D2KA 1Q6DA 4P8UA 5IHSA 3VDBA 1BGAA 5LA2A 1VF8A 1U2YA 3K1DA 3GH4A 1KGWA 1PIGA 3BAJA 1WP6A 3APGA 3N11A 1OT2A 1BSIA 2GUYA 3AOFA 4UFLA 5DF0A 3RMEA 1UR1A 2WANA 3MSDA 2XVGA 1JZ4A 4F66A 3WDHA 1QHOA 3AIUA 5AY7A 2G3IA 4DWSD 5GNXA 1W1VA 4XV0A 5HOSA 3PZTA 4M80A 4PMDA 1GOQA 1E4NA 1OCQA 3DYMA 3WUBA 1HT6A 1JDCA 2FHCA 1H1NA 1ISYA 5M03A 4ZE5A 2X2YA 3NDZA 1NP2A 1VBRA 3K8LA 3BGAA 4KRTA 3ARSA 3U57A 1VEMA 2X09A 1PX4A 3WDJA 2VX7A 3UG5A 3AIVA 1KXTA 3G6LA 4MADA 1J0IA 4P7NA 2VZUA 1JNEA 1V0KA 2ZOXA 4B3LA 5BXRA 4AC1X 2FDMA 4JFVA 1VBUA 1E15A 3UG4A 2BY2A 1ESWA 5D9NA 1MW1A 2BNJA 1E70M 5CZKA 1V3JA 3UCQA 3OGSA 4U5KA 3VD7A 2XSAA 2A3CA 1JF6A 3U5YA 3ZT6A 1JI1A 3VIJA 3LPFA 2GFTA 2J7HA 2YA1A 1R8LA 3WEMA 4CN1A 4GZJA 4ZXLA 1JXJA 2EPMX 5E9AA 3VM7A 4KGLA 2YL9A 4J3UA 1CZ1A 1WNOA 1XH2A 1CNVA 2QPSA 2WZEA 2YL6A 3CLWA 5HXMA 1LG1A 4H7VA 3BAIA 4HTYA 3T2OA 1ZBCA 1WDPA 1LLOA 3EDKA 1QI5A 5I24A 3WFLA 1GNXA 1G94A 1B30A 4U31A 1W1TA 1V3MA 1V0MA 1HJWA 4PYSA 1UWIA 4IUGA 3KWXA 2PWFA 4D6GA 4W5UA 1DWGM 3RCNA 1JYNA 1E6PA 1WB0A 3NDYA 2CPUA 1NP0A 4AZIA 1CXHA 3WEOA 3WDQA 1M03A 1TVNA 2JEQA 3EDJA 3MSGA 3U7VA 5AYBA 3AS1A 4R5EA 2BHYA 2ZE0A 4B9YA 4AD5A 2O9RA 3ZSSA 4UQDA 4D71A 5FCZA 4Z2JA 1M01A 3WH7A 3AZTA 4AIUA 5A8OA 2XTKA 1JF5A 1NWSA 3VILA 1NWTA 3AHVA 3FHQA 4OUEA 4BS0A 3AS2A 3WF4A 1UQYA 3GXFA 3AROA 1HKIA 1JG9A 1NARA 1GUVA 1P6WA 4WKAA 1ZB5A 2OWXA 4TVDA 3IAPA 3RM9A 3U7BA 4MDPA 4QCEA 1LL7A 2OYMA 3EDEA 4TUFA 5CGMA 3CBWA 2YJQA 1UOKA 3BMVA 1OWQA 2AAAA 4A3YA 1D3CA 3ZJ6A 3FW6A 4CD4A 1W9BM 4OJYA 1W3LA 2VJXA 2CYGA 3QHOA 3UERA 3TTYA 2W91A 4K68A 3AICA 3WQ8A 2Z1SA 2EBNA 1V6UA 3VMOA 2J75A 5A8NA 1OGBA 1WDQA 4LQ1A 1OM0A 2RGMA 3CHDA 3BLPX 1E0XA 2Y4SA 3BXWA 2FGZA 2JALA 2VUYA 2J25A 5KEZA 1MW2A 1NOWA 2ZX7A 1NOFA 2ZWZA 4P8VA 2WC7A 4XUYA 1H2JA 4H04A 1CGWA 4QLJA 1EDQA 5AC5A 3RJXA 4RL3A 3II1A 5I78A 4UR9A 5DT7A 5A6MA 1OSEA 1YHTA 1JYWA 4MB3A 5FD0A 1JNDA 3CH9A 3F4VA 4UFHA 5BXSA 1BYDA 2VR5A 4HOXA 2WCAA 4HOWA 1KCLA 3GH7A 1GJWA 3L4XA 2QPUA 1W1YA 1NWRA 1XCWA 1HJQA 3AHXA 1XD0A 3W38A 4UOZA 3B9EA 1CIUA 4LGXA 1E1EA 4CCDA 3J7HA 1HXJA 3ZO9A 2O9PA 3MMUA 3A4XA 2GDVA 1BYAA 4R27A 4CD6A 1MQQA 3SCNA 2D23A 1TMQA 1Q6FA 1Q6GA 3VX0A 3GBEA 4B16A 3AMLA 3RO8A 3W26A 1WE5A 2C7FA 4AZCA 3ALGA 4V28A 4PCTA 4UFJA 1VEOA 3G6MA 4IPLA 4D6IA 4TTGA 1UWTA 4TOQA 2WZIA 4LYPA 2WVUA 5A8MA 4UZUA 2GSJA 4P8WA 4MJ2A 3VX1A 3VKKA 3SUVA 4L4PA 2E8YA 2WLZA 5E6ZA 2E9BA 4MNMA 4HZ7A 2FHBA 4BA0A 1KFWA 1XSIA 2DSVA 2CCRA 2AOSA 1XH0A 1QI3A 1UKTA 3NSMA 1WCGA 1J01A 6TAAA 2GJPA 2J7FA 1SMAA 2O9OA 2VZVA 1BG4A 2O9TA 2ZXDA 3VNYA 1EH9A 4CGTA 1PZ2A 3CZGA 1ISWA 3VIKA 2ZXQA 4TX6A 1S46A 2UY4A 5M5DA 3UG3A 5DMYA 1RP8A 2YLAA 2XFFA 1IT0A 3FN9A 3UR7A 4IPNB 3CUFA 1K9EA 3AZSA 1V03A 5BRPA 5M17A 3N18A 4JFUA 1KQYA 4OOZA 5C70A 2JF7A 1VJSA 1H3GA 1OBAA 1JFHA 3N04A 1E71M 2CEQA 1UWRA 1GONA 4Q22A 3IK2A 5BRQA 1Q4NX 1UR9A 3W25A 1W3HA 2F2HA 3AMKA 4PMUA 4LXFA 5CLTA 1HJXA 4H8HA 3BAXA 2EPKX 2DSKA 3O2LA 1ZL1A 4A3HA 5IHRA 2BVYA 4JHZA 3MMWA 2G3MA 4PUDA 3RJYA 6CGTA 4DWSB 1UKPA 3HMCA 2OLHA 1NOUA 2YIHA 2V3FA 5FKYA 3L2LA 2YA0A 1WZMA 1XSKA 1EQPA 2PB1A 3RM8A 2PWGA 4JIEA 1WZLA 3WDPP 5A8PA 1UA3A 2G4FA 3VIOA 1ISXA 2CNCA 5DT5A 3L4UA 1UKQA 4FMVA 2CESA 4HPGA 4AW7A 2ZUNA 3N13A 3VO0A 1AMYA 2DGAA 1FP8A 3BLKA 1QVBA 1GOWA 1H4PA 1CXEA 3AS0A 2DIEA 3D5HA 2WCSA 3VMNA 1E40A 4UZSA 1I1XA 1V3KA 3T2QA 5I5RA 4JL1A 1GOIA 3VM5A 3ALFA 3CZKA 5ABGA 3VGHA 4DWSA 3A3HA 2E9MA 5A2AA 3L4TA 1J0KA 1I1WA 2ZUMA 4X9YA 3OIHA 1OIMA 2D22A 3O6AA 4FLSA 4NRRA 1W9PA 2PWHA 2YDRA 4UOQA 3ZR6A 2HVMA 2X1IA 2XFYA 2VRQA 2XYLA 1MQRA 1VRXA 3PZQA 1L8NA 3ZQ9A 2J77A 4B15A 5AC4A 1QPKA 3W4RA 4KH2A 1JI2A 1E3XA 1B31A 2WHKA 2CKSA 2WYSA 1HKKA 2XM1A 4FF5A 4W85A 5DFAA 1AQMA 3WUGA 5F7UA 1SFSA 3AFBA 4HMCA 4M82A 4JAWA 4LX4A 3CMJA 3BAYA 1G01A 1M53A 2BS9A 2VX6A 4HZ8A 4KRUA 4UOJA 3AIRA 4M24A 5FIPA 2G41A 4H41A 1JZ5A 2BHUA 4AMCA 4QAWA 2GJRA 3CMGA 1JZ8A 2D0GA 2PBOA 4W8LA 1C91A 2RGLA 1X6LA 3T09A 1R7OA 2MANA 2W92A 3WNLA 3FAXA 1W1PA 3K4AA 4OKDA 4Z2GA 5A95A 2VTFA 3VD4A 1J18A 2IXUA 4JCLA 4KWUA 4ZENA 1J0ZA 3K46A 2GK1A 1QNQA 3KL3A 4U2ZA 3T0DA 3CUHA 3ARVA 3KZSA 4W93A 1HL9A 3PZUA 2BXZA 1OD0A 4JKMA 3WQVA 3WENA 4M8UA 4E2OA 5D8ZA 1AQ0A 4Z2HA 4EK7A 1OGSA 3ARRA 5LA1A 4DWSC 1TUXA 2BV9A 1V3LA 2XM2A 1PAMA 4TXEA 2XVNA 1IZKA 1W91A 1KWGA 3K8KA 2EXOA 1ECEA 5CJ5A 5ABFA 1KB3A 1GW1A 4N0RA 5ECUA 3I3EA 4MAVA 3SCUA 4YHEA 1NM9A 1B3WA 1ITXA 1CWYA 4HU0A 1QNSA 1BQCA 4J3TA 3VD5A 4URIA 1QNPA 1KBBA 1U33A 1KCKA 1DTUA 3ARWA 1R7AA 4Q7NA 3EDFA 2QF8A 4GI8A 2A3AA 2OSXA 1TZ7A 5BXPA 4FLQA 2VQUA 1VIWA 3ARYA 2X05A 5HDRA 4WKFA 2J62A 1JAKA 4OBSA 1GQJA 3M7SA 3VTRA 2VZSA 3SCRA 3QOMA 3NCOA 3WNNA 2CBUA 1BYBA 1HP4A 1KGXA 1ZBWA 4GI6A 2UY5A 4LPCA 3E1F1 4AYSA 3WDIA 3OB8A 2YBTA 3WH5A 2IUZA 5GQBA 3W24A 1QW8A 4MPKA 3SCSA 1TCMA 1HIZA 2DDXA 1C7SA 2BVTA 3OLIA 5A6AA 1F4HA 3WNOA 2VZOA 4GPNA 2A3EA 3VD3A 4HOZA 3B8SA 1FOBA 2PF0A 4WK9A 2XIBA 1JGIA 4J28A 1E55A 2TAAA 3CZLA 5CXPA 4D6HA 3PZ9A 1TR1A 4CD7A 1E0VA 3BMWA 5KZ6A 3WY1A 1W2VA 2DH2A 4PMVA 1E4IA 1UKOA 4ZE4A 1A3HA 5E70A 4DUVA 1MQPA 1UWSA 3MV11 3OGRA 3SCVA 1CPUA 1UD5A 3NUKA 4DM1A 3HU7A 2WMFA 3NJ3A 5D9PA 5LYRA 3NSNA 1EO7A 2V3DA 2XJ7A 2XGIA 3WDRA 3DHUA 4ATDA 3THDA 4HA1A 1VEPA 3VDCA 4OZOA 2WC4A 4D6CA 4D72A 4M1RA 2JFEX 1E73M 2G3NA 2ZUVA 3SUWA 4WSJA 3UEQA 1QNOA 5E0FA 2E3ZA 1UYQA 4AD0A 5IDIA 1CXLA 5FL1A 3S6TA 4CU8A 1PJ9A 5M3WA 1NH6A 4PBGA 1SR0A 3I3BA 3POCA 1MYRA 3UESA 1BYCA 4ZXOA 2CETA 1HN1A 5A6JA 5I3DA 4Z2LA 2EO7A 3ZM8A 3W53A 3JUGA 4MNJA 4ACZB 5I79A 3WD0A 5EBAA 3CHFA 1W9UA 5FL0A 1CXKA 4Y7EA 4NRSA 4P7LA 4FLOA 4H8UA 1TVPA 2ZICA 3BAWA 3PZIA 4GQQA 4HA4A 3VINA 4CN6A 4CN4A 4HMDA 4HPHA 5DEZA 2W61A 3BSGA 3DYOA 3RPMA 5A3HA 2XUCA 3L4WA 2BVDA 4AZHA 1J10A 1UUQA 1E6SM 3ZOAA 2OWWA 2PWDA 2C0HA 1V0LA 2BXYA 3BCDA 2FHFA 3WUEA 2ZIDA 2V3EA 1E72M 4BQ3A 1QOXA 4BQ2A 1FH7A 3WF3A 4QLLA 2ZWYA 4ML4A 1K9FA 3I3DA 3F5KA 4A4AA 2V5CA 5D9MA 1W3KA 4EE9A 1B3VA 4CD5A 1JYVA 1XRVA 8CGTA 5D9OA 1GVIA 1W9DM 3VIHA 1UR4A 2ZXBA 4XB3A 4KMQA 4AD4A 1AQHA 1XV8A 4RE4A 4CU7A 1RH9A 1JZ3A 3OLDA 1OINA 1XYFA 2WZHA 1ODUA 1HNYA 1JZ7A 1V08A 2YKKA 2QMKA 2Y8VA 4UFMA 3PTKA 1DP0A 2WPGA 3A4WA 1EDTA 2WLYA 1I75A 1K6AA 4GKLA 4AZ5A 1HKMA 3QHMA 1RPKA 1CYGA 1UR2A 2BY1A 1H49A 3OZPA 4UFKA 2PI6A 1LL6A 3AIBA 3CZJA 4MB4A 4CVWA 3AIQA 4PUEA 4ZEPA 1EA9C 4PMYA 1GQKA 3BCFA 3WF1A 2UY2A 4PMNA 3PZVA 4W86A 3GXDA 4AIOA 1WAWA 3WD2A 1BVNP 1B9ZA 2J74A 2W4XA 1E0WA 5CGTA 4AWEA 4JL2A 2WMKA 5GNZA 4L4OA 4HMEA 2NSXA 4GO8A 2WMGA 3AYSA 3NIYA 4NI3A 5A2BA 1J0HA 4EANA 4GXPA 1Q6CA 1J11A 2DEPA 4W87A 1OT1A 5JBEA 5IXEA 1CGXA 1UR8A 4WLCA 3CPUA 3TOPA 1KR0A 4DUWA 2GJXB 4PRWA 3WKZA 5I23A 2DT3A 1KXHA 3VDHA 2E9LA 2X0YA 3RDKA 3ARUA 1KBKA 3TONA 4XX6A 1BLIA 5A6SA 2NT1A 1NQ6A 2ZX8A 1EO5A 4BCEA 3VIPA 3DHPA 1PPIA 2VZTA 3PZNA 2VMFA 2IXVA 4N42A 1V3IA 5E6YA 3VGBA 4BZYA 4C7FA 2O92A 3GXMA 5A6BA 4AEFA 6A3HA 4J3SA 4BF7A 3MANA 4D1IA 1HF6A 3AYRA 3MUIA 4JCMA 4UFIA 4TVCA 1CDGA 5EMYA 3W28A 3LMYA 2EPOA 3MS8A 4OIFA 1CECA 2Y5EA 2GJXA 1V6VA 1V02A 4JKLA 3GNOA 4C7DA 1XC6A 3OG2A 4UQ9A 1XYZA 2XSBA 2VCBA 3L4ZA 3IJ9A 5A2CA 2A3HA 1B3XA 3WL0A 1UHVA 1B3ZA 3IJ7A 3EDDA 4PTMA 4P7OA 1H5VA 2J7BA 2DT2A 3VGEA 2DSWA 4OOUA 4J27A 1NWUA 4Z2IA 4RE2A 3PTMA 5I77A 3THCA 2VCCA 4S3JA 3MUAA 1N82A 2CBJA 3W27A 3EMZA 4D6DA 3ZSTA 1WDRA 3GDBA 3VGFA 3KL5A 1ZJAA 1EHAA 1JD9A 2WB5A 1MW0A 8A3HA 4FLRA 1JDDA 3SUUA 3DYPA 3WQ4A 1MXDA 4WJXA 2BHZA 4WF7A 1UH2A 3W81A 5JUVA 1MWOA 3QR3A 3T0AA 1LF1A 3QGVA 3AMCA 2VT0A 1DWAM 3OZOA 3PZMA 3WQ6A 2WHMA 2D20A 5IFPA 4LYRA 2WK2A 1VFFA 1MVYA 2DSUA 3FY1A 1O6IA 1JZ2A 3WBAA 2ZUTA 3PZOA 4CKQA 2JIWA 1UH3A 1GHSA 1QI4A 3EYPA 3WFZA 4DM2A 2EQDA 1E5NA 1H0IA 4AZBA 1E6QM 5GNYA 4CVUA 1UA7A 1BPLB 2J7CA 4AY1A 1C3FA 2ZUSA 2Y24A 3F5LA 2A3BA 3VMPA 5AYIA 5I0DA 1KWKA 4HU8A 1BAGA 3AJ7A 3ZJ7A 3N9KA 3WSUA 4W7WA 5A69A 2WVVB 1FP9A 3AHTA 1E6NA 1QBBA 1CTNA 5FOOA 2WKGA 2OSWA 3PZGA 3VDAA 4AISA 2ZX5A 3GYCA 4GI9A 4HA3A 1F4AA 2V3GA 7CGTA 3QHNA 4JHOA 1CXFA 4PCSA 2XVPA 4AD1A 5EFFA 4F9JA 1JDAA 1FHLA 1XCXA 1W32A 3WH6A 2D0HA 5EB8A 9CGTA 1EHNA 3FHAA 2XPKA 1W9VA 3M6DA 1QW9A 3AS3A 4IISA 4H8VA 3SCPA 2WVSA 5DO8A 1ITCA 3WNKA 5BYWA 4U3CA 1QI0A 3KE0A 1V6XA 3EMQA 1BFNA 1V6WA 1DWHM 5CSYA 2OWCA 2DT1A 1BHGA 1PZ3A 1X1NA 1D7FA 2XG9A 4W84A 1BF2A 1C7TA 2D1ZA 5A6KA 1UD6A 1G5AA 1C8QA 1XSJA 3WNPA 4OBRA 2VQTA 1LJYA 2Y2WA 2XFRA 4JFTA 2YDSA 3N17A 3K8MA 1HP5A 4X0VA 1WKYA 2F8QA 3PHAA 1GORA 1C8YA 2VRKA 2PWEA 3ARTA 2CKRA 3N12A 3WF0A 1QI2A 3A47A 1BG9A 3W82A 1KGUA 2XGBA 3B9DA 3WL1A 2GVYA 2BY3A 3VIFA 2HISA 1FFRA 2J79A 3HN3A 4MJ4A 1GJUA 3NSXA 1EOKA 1FH9A 1Q6EA 1UWQA 1R86A 4ZFMA 1C92A 3OGVA 2ZX6A 1EGZA 2E40A 3W29A 3WIJA 1XD1A 4AD2A 1E3ZA 5BXTA 4UCFA 4LYQA 1JD7A 2VVSA 3IANA 1KR1A 5D8WA 1W9XA 3SIMA 4JFWA 2VI0A 3L4VA 1OIFA 1B0IA 3AHZA 4J7RA 3LPOA 1LWJA 2J8GA 2E4TA 1UZ1A 1TFVA 1CGVA 2F61A 1BVZA 1DWJM 2C8NA 1U30A 4JZ5A 4MNLA 1ZU8A 5CSUA 1HVQA 3A4AA 3WQWA 2XHYA 4GO9A 5C71A 1OGGA 2X8RA 4GZIA 2Y8KA 1HJUA 2D2OA 2QV4A 2WWCA 1OB0A 5CLWA 2G8ZA 1BTCA 3MMDA 3OBAA 3VNZA 2X0HA 2WCGA 4YPJA 1GPFA 4CUCA 1DWFM 3CUIA 1TA3B 4ACYA 1K9TA 1VFOA 2FGLA 2GDUA 1UQZA 1CLVA 5BCAA 2WM0A 3POHA 3AXHA 4TX8A 2FH6A 3S2CA 5JBDA 2VL4A 1HVXA 1MW3A 3TA9A 1TG7A 4CCEA 1UR0A 4QCFA 3MUY1 2WAGA 4NF7A 3MO4A 1VB9A 1Z32X 2DQXA 4M56A 1QHZA 4ATLA 3AIEA 1H09A 1E1FA 2PBGA 3AHYA 1LQ0A 1ISVA 4MDOA 1EXPA 1XH1A 3UETA 3TTSA 3GZAA 5GPRA 3MUZ1 2ZXAA 2DT0A 4PMRA 2JF6A 1J9YA 4WKHA 4CU6A 3LPGA 3AMDA 3CGTA 2J47A 1GOOA 4PTWA 3FAWA 5ABEA 4Z2KA
chains in the Genus database with same CATH superfamily
3B8VA 2BGSA 2JBMA 2VVNA 4A21A 3BSHA 1XRSA 4DXKA 1MXSA 4EOUA 2XZ9A 4C6EA 1E4LA 2YBUA 3UR8A 2BGQA 2VEPA 2PCQA 1Q65A 1U1HA 3BH4A 3TQKA 3P2VA 4D1JA 3MV01 2YLLA 2AQVA 4R85A 1TA3A 1ONXA 1XIHA 1FA2A 3VVGA 1YDNA 1CENA 3I6RA 3WQEA 4UQEA 3E0FA 1OC5A 5DY3A 6PTDA 4DPPA 5HMEA 1WO2A 4JD4A 3T8LA 1VPQA 4U4MA 3T0BA 4WSKA 1B90A 4WRHA 3ZJKA 5CJNA 3CWNA 3N25A 3ARZA 1YYAA 2J66A 3LCGA 2Y7FA 5K2ZA 3RAOA 4Q7IA 5BNKA 4GXWA 5LA0A 1AW1A 2VURA 5HWMA 1QNRA 1V6YA 4O4WA 3W37A 1O1HA 3P82A 3SURA 3TYBA 1SJAA 4QROA 2D24A 3UXAA 3WH8A 1EZ2A 1M04A 2W5FA 3LTPA 3BOXA 4PMXA 1RA0A 3CC1A 3SQLA 4MUPA 5JBFA 2FZ9A 1V77A 4JTIA 3AISA 4EPBC 4IQJA 4NZFA 3W1NA 3ZT7A 4UQBA 5D4YA 4QE1A 3L0KA 2DUXA 3BLFA 4W7UA 3UJ2A 1E0TA 4UQAA 2W66A 1UP2A 1K4HA 3M5YA 1LOQA 4NZ4A 2WMIB 4KGJA 3TLQA 3NPXA 3VU2A 1E9LA 1T5AA 4XZNX 2BLEA 3PTQA 4ZOAA 2BFGA 4XZBA 3FV9A 3H2MA 1XHGA 1FX6A 1W3TA 4AZCB 3W2JA 4AWTA 1IWAA 2WJDA 4IM4A 2OYKA 3WJXA 2OQHA 1T8QA 4JTLA 1I9CB 1HGWA 3TZNA 4HP5A 1HL2A 3GBDA 5LIYX 4ZO8A 3OA3A 2DJLA 3DX5A 3O9NA 2CBVA 3UWVA 3PBGA 4A8RA 4UMAA 3SCTA 5CBJA 2EJ1A 5HJLA 1HZYA 5TD4A 3M46A 4B5XA 2QHAA 1T6MA 4GYPA 1KM4A 2GQ8A 1TV4A 3SCOA 3DIPA 3PPHA 1GHRA 5DLCA 2WSKA 5JH2A 3PG9A 3TYEA 4GOAA 4O14A 4AC7C 3WEZA 2ABAA 3M0VA 4UTWA 1RP9A 3DH7A 3LYEA 5IOBA 5A6LA 4KEUA 2PD5A 3TTQA 1KFCA 4XVEA 7A3HA 4ZTXA 3OTRA 3WLJA 1VJZA 2PDXA 1VBHA 1MDLA 4YCPA 2XIIA 1Q7MA 4QHRA 3IAQA 1FWWA 1CGUA 3BICA 3BJSA 3LUTA 4DIAA 3REQA 4GQRA 1C93A 1JAEA 3LM7A 4DJDA 3H8AA 1Y7VA 3GG0A 3EB3A 2HWGA 1AVAA 1Q6LA 3IEBA 1IR2A 2TODA 2BOFX 1G6CA 2BY0A 2ESCA 1ZBVA 1H7PA 1WDSA 1VENA 3G77A 2WQDA 2PGFA 3G8RA 2YL5A 2ZUUA 3WUFA 3UJEA 1YQ2A 3GG1A 1PSCA 1QJWA 3S9IA 2Q71A 2WVTA 4LFYA 5RUBA 4NJJA 4O53A 1E43A 4C6MA 1JCLA 2OEJA 2YYTA 3AU2A 1JL8A 2AMGA 3PPFA 1XGZA 4GD0A 5C9WA 4A2SA 2ZDRA 3N9RA 5L6UA 2OYLA 2XWDA 4H2CA 4S3EA 3VD9A 3VGDA 3RUBL 4BY3A 4NNBA 2JE8A 1MUMA 3T1GA 5JIWA 4QDPA 5CPLA 2VGIA 5EL1A 3WLOA 1LYXA 3T0TA 3CIVA 3KBSA 5BOFA 2F6UA 2NW0A 1V93A 4QAIA 2EAWA 3H4WA 3VFCA 1F7BA 4M29A 5CPQA 4PUUA 3N73A 7XIMA 3F2BA 2E5DA 1H7XA 2Z1KA 1I0BA 4AX7A 5A94A 3U2ZA 4D2JA 3B0YA 4AUBA 4PSPA 4FIRA 1Y5WA 4QDMA 4CCZA 2FMNA 4V1YA 2QAFA 3R2GA 3W7IA 1M7PA 1E4MM 5FAGA 1A49A 1L6GA 4LAKA 1V02E 4NASA 1KXVA 4AZGA 3R79A 2ASHA 1CLXA 3TLLA 4W8BA 3B8DA 1F9CA 3DECA 4J3XA 4ZQCA 1HJVA 3AIWA 4FOJA 3LSCA 1A5BA 3CJPA 4HHMA 3GVWA 1CBGA 4UQCA 3ORWA 2DZAA 3GH5A 1PIFA 2O56A 3L2MA 1VAHA 1RK5A 3R89A 2OSYA 2Q8XA 1IV8A 1G9HA 3HJEA 3TNBA 4TVUA 3GXNA 3ZR5A 3ABQA 4RNIA 2NVCA 1VLIA 1IEIA 3ITTA 1UD4A 4JX5A 3GNPA 1LBMA 1DJHA 4GY7A 3VOJA 3FA4A 3P93A 4ZB2A 5G1TA 4LB4A 1CGTA 4YTTA 4W89A 4X0NA 1K70A 2GK1B 1R2RA 1B54A 3QR0A 1EQCA 4PUWA 2YDQA 3VIMA 1H5YA 4PEEA 1WZKA 4B4FA 3R0DA 2ZZ2A 3QGAC 1KXQA 2V5LA 1RCQA 2X42A 3HB9A 1OZMA 4MNKA 5D2YA 3SEPA 1C9WA 4NIRA 1E56A 2OLAA 3NYDA 2CERA 3KL0A 3KEHA 3MU7A 1AZ1A 2XWEA 4ZL1A 3WQ5A 1X6NA 1BGAA 1VF8A 4ZMGA 3BV4A 3TN5A 4AEOA 1JPMA 4I7WA 4M1BA 3BAJA 2XN1A 9RUBA 4CQDA 3N11A 6ENLA 3FDGA 5KMYA 3RMEA 1M6JA 3BLLA 1IEVA 1TPDA 3C2RA 4M3PA 2WANA 4JNMA 3W70A 2FFCA 1JZ4A 4IX2A 2XIMA 1QHOA 4LUTA 2C16A 4EAYA 2G3IA 4BKNA 5CBBA 3C0LA 4M80A 2NLIA 4DXXA 1HT6A 1JDCA 4ZQOA 5I03A 2E1WA 3TJLA 4ZE5A 1LT7A 5EMLA 5DBTA 5G4EA 4MWAE 4QIUA 3AU6A 1FWAC 5XIMA 4BR1A 3G6LA 1JNEA 4GABA 4QX4A 4M5PA 4AC1X 3FGCB 3S83A 3HF3A 4FEZA 1E15A 3UG4A 4GWEA 1IT7A 1ESWA 4M6VA 4GKTA 3HGJA 5D9NA 1MW1A 2ZYFA 4PUJA 1HTIA 3UCQA 3VD7A 4QRNA 3ZZ1A 3T44A 4C6JA 3ZT6A 5HA7A 2J7HA 1EBGA 4HN8A 1KM0A 4GZJA 2OFJA 1P7TB 2YL9A 1XH2A 3DGRA 1CNVA 2OKOA 3OP2A 4GCXA 2OCZA 1EYEA 4K39A 1S5NA 2ODOA 5I24A 4NT0A 1CB7B 3S2NA 1GNXA 4LEQA 1W1TA 1V3MA 1HJWA 3CU2A 2PWFA 3RCNA 2HEJA 1E6PA 1G7VA 1WB0A 2CPUA 2NWRA 3NDYA 4Z0JA 5BRBA 3L68A 1YTEA 2YB1A 2F6KA 1J2BA 2BTMA 4WVXA 4IMGA 3MSGA 3U7VA 5EKYA 4XBKA 2ZE0A 1DJWA 3SN0A 2PDPA 1A5KC 3WH7A 4QXIA 1OC6A 5DCEA 2ZRWA 1NWSA 3OG3A 2J9ZA 3EXSA 1O4UA 3A22A 3GXFA 2HXTA 3SGZA 3W1PA 4BF9A 1HKIA 2NUYA 1GUVA 5BU6A 3JS3A 1H63A 5DQPA 4GUFA 4FS9A 3R8HA 3RM9A 4MDPA 3BOFA 5XIAA 4WXZA 4US5A 1FCBA 4KBXA 2ZCGA 3CBWA 4AWSA 1P0DA 1S38A 1OWQA 1AW5A 2AAAA 2X1TA 3ZJ6A 4CD4A 4OJYA 1W3LA 2OZ8A 2VGFA 3UERA 4IMEA 4ZOCA 2Z1SA 3IGSA 2J75A 5G2HA 4ADUA 4X61A 1WDQA 4LQ1A 4Q4PA 4WR3A 5C9UA 2XN0A 1O5QA 3G1XA 2VUYA 1O5XA 2PLKA 1UIOA 2V63A 2J25A 5KEZA 3M7WA 1NOWA 3G1DA 4A3RA 3B03A 2CLOA 3OHIA 1VCGA 4IMCA 1ENUA 4QLJA 5AOUA 5AC5A 4PH6A 4HJFA 4ERAA 2C1HA 1UZDA 4WUIA 2PFHA 3VE9A 1GYNA 4MKNA 4Q8UA 4GYKA 1K7EA 3HTWA 1C29A 1IYXA 1BYDA 3O1NA 3S42A 1F05A 1GJWA 3IJQA 2BX7A 1VD6A 4J2MA 1XCWA 4JHMA 3W38A 1CIUA 1RLDA 4ZO6A 4CCDA 1PKLA 2E5CA 3J7HA 3V7PA 3A4XA 2GDVA 4LV9A 3SCNA 1L9WA 4C6DA 2D23A 1FCVA 1VH7A 3AMLA 2ISWA 3C2FA 1SW7A 1SJCA 2ISVA 4UC5A 5LXXA 1UPPA 3LHWA 5D03A 1VEOA 3CAKA 2ZZ3A 4D6IA 4ASTA 4DO5A 3CQHA 1GPWA 3N14A 1Q6OA 2GSJA 4MJ2A 3VX1A 1UJPA 3BTNA 4AB4A 5GJPA 3T6CA 1A5SA 1X38A 4MNMA 4O8AA 4PTNA 4BA0A 4GNKB 3LHUA 2CCRA 5DMNA 4AFYA 3BOLA 4IIHA 2AOSA 1K02A 1QWGA 3GZ3A 3O05A 2O9OA 1SMAA 2VZVA 4IGSA 5FF0A 1EXBA 2EPHA 2QXWA 4I5RA 1EH9A 4CGTA 3CZGA 4B2DA 3UWEA 1QR7A 4YTSA 5SWUA 1XYCA 4LSBA 3CIWA 1S46A 1H1ZA 3UF9A 3LXCA 5AECA 3A3WA 3PUGA 3UT0A 3WYZA 1IT0A 1QMLA 4IPNB 5LSMA 3TEVA 1M5WA 1K9EA 4L65A 3N18A 4JFUA 1KQYA 2PC4A 3KTSA 3CV6A 3W1LA 5C70A 3HJZA 3QPZA 4HPJA 2GPTA 4RZ6A 4OTKA 1JFHA 4HNCA 3N04A 5HJYA 4LCQA 1ZTVA 1GONA 4Q22A 1Q4NX 1Q66A 3KS6A 3TSBA 1X8CA 2F2HA 5D2XA 1AMKA 1KV8A 2PP3A 3VZYA 5CLTA 4H8HA 3RFAA 3K13A 1XDJA 3MBDA 1PTGA 3C0JA 3OVGA 2G3MA 4DWSB 3EWBX 4DPQA 4JYDA 1THFD 1UCWA 4DO4A 4NAFB 3WBYA 4ENLA 1LBFA 2YIHA 1ONWA 2V3FA 3BJTA 5HQLA 1EQPA 2PB1A 2YXXA 4AY7A 2GQ9A 2A7NA 2IMRA 3U48A 4JIHA 2EG8A 2CNCA 2B0MA 3UWYA 4AW7A 3LQLA 2DGAA 3IJ6A 3N6HA 4JTSA 1P0BA 3IIPA 3KOYA 1NFGA 1YTKA 4N9CA 3N2TA 1IT8A 4UZSA 3RXZA 4I6KA 4ECLA 2WZTA 3T2QA 1XLCA 3B40A 2V2CA 1FUYA 3VM5A 2VKZG 5ABGA 2NXIA 3WBXA 2R1NA 3G0XA 2AKMA 2PZNA 2R1LA 3W83A 4TV6A 4NRRA 1W9PA 4C6FA 3I6TA 2YDRA 3V5OA 4QNEA 2X1IA 2XFYA 3GTIA 2XYLA 1PXGA 2VEKA 1XWYA 4OFCA 4KCUA 1E3XA 4WEVX 3LCXA 1M68A 3SY5A 3VNKA 2XM1A 2GGIA 4FF5A 3W2KA 3HG2A 1EJSC 2Q8LA 3QW3A 2QDHA 5ABTA 4L6HA 1Z48A 3UNDA 4LX4A 4IGNA 1G01A 1M53A 4HZ8A 4KRUA 3O6YX 2ATMA 2CU0A 2ONEA 4L6DA 5T9CE 5FIPA 3NQ7A 1LORA 3M5XA 1JZ5A 4QAWA 3TW6A 3ONCA 3T09A 1R7OA 2W92A 4JS3A 2QUMA 1PTDA 3UZ5A 4Z2GA 2VTFA 4HYRA 1J0ZA 1QNQA 1QXLA 3CUHA 3ARVA 5CPOA 5G1YA 3NL3A 5DY2A 3P6LA 3WQVA 4GUIA 3A13A 3GDLA 1MSSA 4Z2HA 3EXRA 1ZRQA 4DWSC 1PAMA 3UGVA 3L23A 4P5UA 4FNUA 2ZZ5A 1KB3A 3SCUA 4C1NB 1B3WA 3EX3A 3W1UA 2DZBA 1Z41A 1R5YA 1KBBA 1UPMB 1R7AA 3NZ1A 3W23A 3KCOA 1NDVA 2OSXA 4FLQA 4O11A 4M19A 5HDRA 3MHGA 2YPIA 3PANA 1H50A 3AUJA 2OR2A 3QOMA 3WNNA 3N3TA 2OJPA 1KTNA 3SSZA 3H7RA 4HYVA 3TTEA 3EWYA 5AYXA 3U4FA 1F3EA 1TCMA 1GVSA 2CLHA 3GTHA 3ICJA 1F4HA 2Y0FA 3T42A 1SR9A 4HNLA 4GPNA 2OTDA 4HOZA 1FOBA 2PDJA 1IIGA 1JGIA 4J28A 1XG4A 3FX4A 2INFA 1BQGA 1TR1A 5FA5A 3H2EA 1OYAA 1Z9AA 4CD7A 5KZ6A 4DBWA 1EF2A 1DIKA 3AAMA 5KETA 3S5ZA 3LCWA 1E4IA 1XLLA 4LJ3A 5E70A 2VHLA 4ZBCA 3C2VA 3UU0A 1UD5A 1TPH1 4HHHA 2H8XA 2PTYA 5D9PA 1EO7A 2I16A 2XJ7A 3E12A 4PB4A 1WOAA 3U2OA 3WDRA 4EACA 3R0UA 4R7JA 5BMXA 1VFTA 2CLIA 3VDCA 4QJ1A 3RLGA 2WC4A 2F38A 4M1RA 1ADOA 3TU9A 1PYMA 3VNJA 3DEQA 5LNWA 5ENLA 1QNOA 4ZO9A 3IPWA 1R38A 5AHFA 2A5HA 4AD0A 3ABRA 2I9UA 3QY7A 1CXLA 2PDIA 3MSRA 5FL1A 3QYSA 3VC5A 1PJ9A 5M3WA 5C55A 3I3BA 1MYRA 3UESA 2QJGA 3S9ZA 3LM3A 3HPZA 4ZXOA 2OX1A 5A6JA 3GTXA 4LVFA 4Z2LA 1RBLA 4O50A 1PS9A 3LHYA 4HK6A 5EBAA 3HZ3A 3D0CA 4G5DA 5FL0A 4Y7EA 2DW6A 3EKGA 3H55A 3CWHA 4BI6A 4H8UA 1TVPA 3PZIA 3TJ4A 4Y8FA 1TCDA 1D9EA 2QEZA 4HA4A 2FTYA 4HMDA 4HPHA 4IL0A 2W61A 3BSGA 3IJDA 2HRWA 4UB9A 2BVDA 2P3ZA 4JIRA 1RHCA 1BEUA 2QAPA 3VAVA 5LIKX 1VFHA 2PWDA 2C0HA 2ACUA 3UG8A 3ZLGA 4PMJA 2Y8UA 3WF3A 2PTZA 4A4AA 3F5KA 4K1GA 3VIHA 2QJNA 1YPIA 4Z1DA 4KMQA 1NF0A 1SO5A 4UWMA 2HQAA 4RE4A 4CU7A 4PE8A 3OLDA 1OINA 4LNCA 2X30A 2YKKA 3FA5A 2Y8VA 2O0TA 1DP0A 3AYTA 1EDTA 1TZ9A 3NL6A 1W31A 4GVFA 1HKMA 1RPKA 1UR2A 2BY1A 3KHDA 2XISA 4JYFA 3CZJA 4CVWA 3AIQA 3ZVIA 3DERA 4ZEPA 4LTSA 1NDZA 2E25A 3BCFA 4EIVA 4Q6XA 3REQB 3PZVA 4W86A 1ZENA 4OU1A 1B9ZA 1OABA 1ICPA 1DKWA 1TQXA 2WMKA 1TPC1 1MMFA 4IMDA 3KCLA 2DZVA 4JTKA 4LVDA 3NIYA 4NI3A 1J11A 4W87A 1OT1A 5JBEA 1CGXA 3B8TA 3DFSA 4WLCA 5DXYA 3JR2A 2C71A 3WKZA 1EWEA 3HV9A 4HKPA 3C4UA 2E9LA 3BQ6A 2I9EA 4YWIA 2ZX8A 3GR8A 1KFLA 1EO5A 3VIPA 1D7KA 3WFAA 3TW9A 2CLLA 1A5NC 1V7YA 1VLWA 1OYBA 2VMFA 3VGBA 2PDYA 1T0OA 3TSMA 5AC8A 5A6BA 4GVIA 3FJ6A 3S5SA 6A3HA 3EEGA 3KRSA 3G1RA 5D2TA 4S3AA 3MANA 2DORA 3V0TA 4D1IA 3EPOA 2Y1HA 3UA4A 3MUIA 3I6EA 4PCFA 3MKCA 5HULA 4TVCA 4O52A 4RR4A 5D09A 2ZVIA 3LMYA 3NQMA 2QIIA 1W1ZA 2Y5EA 4IP7A 4AF0A 3VXGA 5IBXC 4C7DA 1FCUA 4AWUA 3GFZA 2FDSA 2O7QA 2XSBA 2VCBA 2YR1A 3SGUA 1B3XA 3MO7A 3OZMA 5I07A 1B3ZA 2QCLA 3FXGA 3S47A 4P7OA 3L9CA 2J7BA 9XIMA 1GVEA 4LS1A 5HNRA 4S3DA 4OOUA 3BW3A 4RE2A 2J6XA 4GYPC 1S3HA 5I77A 1A0EA 4GUHA 1N8WA 3C61A 4O18A 4D6DA 3ZSTA 4UTWC 3KL5A 4JQ3A 1EHAA 1Z7AA 1MW0A 8A3HA 4XISA 1R6WA 1JDDA 3MMTA 2QVHA 4H2HA 1OFBA 1MXDA 2NX3A 5AYZA 4WJXA 2VFFA 3DESA 3QR3A 3VCNA 3MYPA 1EJXC 1EEXA 4ORIA 4LNYA 2NV1A 2DUZA 5D32A 2R6OA 5IFPA 4J4KA 3K4WA 2WV8A 2Z25A 2VEGA 3P3BA 2A7PA 1O6IA 2H3BA 3WBAA 3CNYA 1PUDA 3PZOA 2ZUTA 4DJDC 4M7TA 4CKQA 4IIFA 4YYCA 3ZR4A 1GKQA 1UH3A 1WKFA 2YXGA 2EQDA 3DFYA 1E5NA 1H0IA 1E6QM 5GNYA 4CVUA 3MJYA 1OFDA 1R30A 3PFMA 4AY1A 1OK4A 1VC4A 1R3YA 3F5LA 2HZGA 4PGLA 1S5TA 4HU8A 4RDYA 3NVDA 5C2GA 2HVOA 1QBBA 3GU9A 2O4QA 2OSWA 4IIDA 3W01A 1O5RA 4AISA 1VS1A 1XI3A 2V3GA 2QDGA 4PCSA 4MKSA 3HBLA 2V5BA 5CH9A 3QR1A 1HKWA 2FQIA 1W32A 3WH6A 5EB8A 9CGTA 3NQ2A 2OQYA 3B8WA 4HSHA 2XPKA 1QW9A 3AS3A 3WLQA 1K8YA 2KZHA 3CMFA 3H7VA 3VZZA 1ITCA 2VDHA 1PVNA 3KE0A 1XP3A 4MY1A 2G3FA 4O1DA 7PTDA 3NGFA 1TELA 1BFNA 3EMQA 1DWHM 1AL7A 1BHGA 1PZ3A 5F1UA 1KFJA 2XG9A 1BF2A 4LUTB 3WQOA 2QVNA 5A6KA 1G5AA 3W7HA 3WNPA 1LJYA 1FWDC 1N55A 3M16A 3F4CA 3UVAA 4ROPA 1JQXA 2HSAA 1GEQA 5GVJA 3ARTA 3WF0A 3FJNA 4FA3A 3HFYA 3LNMA 3VCRA 1WDDA 3RLVA 3UWUA 4FNSA 3B0XA 2GLKA 1EJVC 1P5BA 5FJTA 1R0MA 2RDUA 3EGJA 1Q13A 3QV7A 1LRTA 3RCMA 1BKSA 3UJSA 1JPIA 2VVSA 1TQJA 5D8WA 3CLMA 3PB2A 1W1A1 1SZFA 4JFWA 1J6OA 1B0IA 4J1OA 4EXAA 4QBXA 4LBUA 3AHZA 4B5WA 3GNXA 2J8GA 2E4TA 1CGVA 1HW6A 1DWJM 2C8NA 1H7WA 4RJEA 1Z8AA 5CSUA 4C6BA 3BZJA 1HVQA 3VK5A 4E3TA 3WQWA 4GO9A 2QUVA 2ISSA 1DYSA 4CLMA 4PCPA 3WLPA 4FOKA 4RUBA 5E0KA 1FHVA 1BTCA 4NAEA 3DFOA 2X0HA 4PB3A 4CUCA 2WSQA 4ACYA 2Q02A 1VFOA 2D73A 3AXHA 4FXRA 1V8EA 2VL4A 1DTNA 3TA9A 1TG7A 5F4SA 4EWND 4NF7A 3QY6A 1E1CA 5AZ0A 3AIEA 3QQ1A 2PBGA 3AHYA 4DQWA 3NL2A 1EXPA 3UETA 4IL2A 1LWIA 4WKHA 4JNZA 3H12A 3PG8A 1DQXA 1KA9F 2B4GA 1UD8A 4JNYA 1W2PA 4FALA 1SYTA 4U10A 4FO4A 3U6WA 2J7EA 3MP5A 4HBKA 4PA8A 1FDJA 3LEPA 3QBUA 2CZ5A 4NVTA 3W3OA 3IJIA 1SFLA 4MAZA 4OV4A 4E8DA 2A79A 1A5LC 1ME9A 3EBVA 3LPPA 2ZUWA 2PGRA 3NXLA 4DHGA 3Q67A 5K4XA 1TSIA 3M44A 4XZIA 1EP2A 1ZGDA 3URQA 6XIAA 2ADAA 3SIZA 5H8MA 4UNIA 2ZZ7A 1ZBKA 2VENA 3A6OA 3V35A 2GUUA 4DLFA 1UG6A 4L9YA 1G67A 2R1KA 1ZSXA 3QH2A 1E6ZA 1H0GA 3V0UA 1EP3A 1YX1A 1Z3NA 1AZ2A 3OYXA 2ZX9A 5CC6A 3G0UA 1WX0A 2OEMA 4EKJA 2GQ3A 4IPIA 4P7QA 3MKKA 4NKCA 2QMJA 1IXNA 8XIAA 3V1HA 1YPFA 3LHVA 4QS6A 4IFKA 2FB3A 2GVEA 2GDQA 2IPWA 3EWUA 4BQ5A 1IE7C 2VNCA 3QOKA 2YFOA 3M6YA 3BARA 3QTPA 1VBJA 3RILA 1RV8A 1IZJA 5E09A 5D30A 1MNSA 2PP0A 2DZUA 4AHOA 1HKJA 2BXVA 3HPSA 1C8XA 4JOMA 1O68A 1B4KA 4Q8TA 4ROQA 2PD9A 3DHDA 3D3AA 3EWXA 2IW0A 2ZZ6A 1FHDA 3RLHA 4XD3A 3JRKA 4K36A 4O12A 4F9DA 4MM1A 1GT8A 3UZWA 5HANA 4DO7A 3VGGA 3UXDA 2PTWA 3GS6A 1F6PA 1L0PA 1ZALA 4HNOA 4L4LA 1SPQA 1Y8BA 2C79A 4B5VA 1V0NA 2WMJA 1D3GA 1RQHA 1W0MA 1AW2A 5I06A 1QHPA 2P53A 3OBEA 1M1BA 2WMIA 3CO4A 4E8CA 4NZCA 3QEZA 3EB4A 4V15A 4WY0F 1GG1A 4M7SA 4MTVA 4DUXA 2XVLA 5HNUA 1UOZA 1MFUA 2DZTA 2Q8ZA 4E4PA 3G22A 3BURA 3N1AA 4I9JA 4IPPA 3N15A 2QS8A 3FYYA 4MB5A 4S2BA 3TP4A 3QV8A 3O6CA 3FXYA 2VFGA 1UKSA 1W5OA 4YN5A 3GC4A 3U0HA 3E49A 3PBYA 1JYXA 4CCCA 4U3AA 1T96A 3S2LA 2J9XA 5FJRA 1YE6A 4JTTA 1OY0A 1WPCA 3HOJA 1GVYA 3LENA 3BDKA 1C8VA 3CK5A 2WJFA 1ISZA 2J7DA 3AWNA 1EDGA 3CM4A 3WBEA 1WZAA 3ZT5A 3TC3A 5C2CA 4S3KA 1XRFA 3USBA 5BROA 5EMMA 3SJ3A 3KCJA 2OT0A 5I6SA 2YA2A 2VFEA 2VC6A 4OQVA 2CBIA 1BWLA 4X9SA 4IP4A 4D6JA 3U2CA 4F2TA 1LG2A 5HPCA 3WK2A 5CQ1A 3DENA 4QFUA 3LI1A 1ZZMA 2Y62A 3P5ZA 2PGEA 1KCZA 1B4EA 2E0PA 3RRXA 3NWRA 4GQGA 4IGHA 2D3LA 1KM3A 3ZMRA 2D2JA 3ECQA 3PWGA 1VFSA 2DVUA 3G24A 1K7FA 4A8IA 5LHFA 2V5DA 2E09A 2WXDM 4KWSA 1S39A 2Z1XA 1RQBA 2P8CA 3VFLA 1VRDA 2NT0A 2W67A 3LXAA 2NQ5A 4C1LA 4MZYA 3ARPA 3P0XA 3M0XA 2CIPA 4DYEA 3FS2A 4DELA 1Q6QA 1MXGA 4CD8A 3CQIA 2PURA 3W75A 2PF8A 1KRMA 3C8FA 4CNUA 2Q6ZA 1PKYA 3A5FA 2Y6ZA 3W7CA 4O1CA 4BQ4A 3S5OA 1E6RA 3CUGA 4EAMA 2VEMA 4QQUA 1O66A 4QTGA 3E2VA 3KRZA 3W6LA 3WK0A 3TTOA 1R46A 3KP0A 5C8BB 1W3NA 2FZNA 1DJIA 5FJIA 1W17A 2D2HA 1O7AA 4QSFA 1XUZA 3DFHA 4GY1A 1EWDA 4EP8C 1UD3A 3V0SA 4UTLA 2C0AA 3RITA 4MYXA 2ZA1A 3EOUA 3P67A 5HNNA 4C7GA 4JKKA 2VFDA 4B3KA 3KM8A 4XZWA 4H7CA 4CQAA 1Q7QA 2D2GA 2WBGA 1OX4A 3M0JA 4PN2A 1RK6A 3MQTA 4MG4A 1US2A 1PBGA 2J78A 1OD8A 5BWAA 2EPLX 1J93A 3ELFA 4AMAA 4LUIA 4C65A 2X40A 3RIKA 2CXGA 4C6IA 1ZAJA 1G0CA 3CUJA 1PX8A 4DWDA 3VIIA 1KD0A 3NO5A 4QP0A 4U33A 1UC4A 4EVZA 3EOEA 3AXXA 3NQGA 1FQ0A 1XIGA 4V33A 2GZXA 2KAUC 3BAKA 3WX7A 4AEEA 3Q94A 2R1MA 3NYZA 3C0SA 4HPNA 1XIIA 2VEFA 4A2RA 4Q8QA 1M3UA 2YFNA 3GXIA 3DI0A 2FZMA 4I5XA 3VKBA 2WHLA 1XF0A 3F1QA 4HCLA 1EJUC 1EJRC 3V36A 2A6NA 4TTUA 1PX3A 3WJYA 1ONEA 2VRJA 2AAMA 1JCJA 2XVKA 3KDNA 3NZGA 5JXQA 2PLMA 3F03K 2P1FA 1X98A 3R11A 4FNQA 4REQA 3IGUA 3D47A 4NSBA 1O60A 3RYSA 5KINA 5LA2A 1WKDA 1JQVA 1KGWA 4LWWA 4NYUA 3ZFHA 3H2NA 3GB6A 2QGYA 2GGEA 1WP6A 4XQ6A 1BSIA 2GUYA 5DF0A 1D8CA 3W7LA 1DQUA 3MSDA 4OBTA 3PK7A 2XVGA 3XINA 2FPYA 4F66A 2IPGA 3AIUA 4Q4SA 4DWSD 1EP1A 3I4EA 2A85A 2MNRA 3WLLA 1OCQA 4INFA 3DYMA 4DYJA 2J6VA 4ICMA 4CQ9A 1K8CA 4BWLA 4HB7A 4XO7A 3GU2A 1ISYA 2Z1WA 3DU0A 1FWTA 3P7YA 3GNNA 4H01A 1GWJA 2ZZ4A 1NP2A 1YMYA 3BGAA 3FVDA 2F9RA 4MVAA 3ARSA 2UBPC 4XAYA 4O54A 1PX4A 3KBWA 4GJIA 3ZLHA 3UG5A 2W9MA 1J0IA 4P7NA 2QF7A 1YW1A 1V0KA 2X7WA 3GSMA 4B3LA 2OELA 4XAZA 5CC7A 4JFVA 1VBUA 3H2FA 5C54A 2BWGA 1QCWA 2BY2A 3GU1A 5E9XA 3S1WA 1E70M 5CZKA 1V3JA 4JGDA 3QKEA 3OGSA 2XSAA 4I8DA 1JF6A 3QKZA 4JTUA 1EKOA 1DE6A 3GFXA 3HGRA 3VIJA 3LPFA 2GFTA 1EYWA 2YA1A 1QPNA 4KGLA 4J3UA 4Z1CA 2QPSA 2WZEA 1X97A 3CLWA 1LG1A 4HTYA 1ZBCA 3KRUA 1LLOA 2WNZA 1G94A 1B30A 1UWIA 1WBHA 4DB7A 1DWGM 3FGCA 1NP0A 1CXHA 1IWPA 3CB8A 4R7WA 2JEQA 3BO9A 2PDBA 3H4XA 2GWNA 1FKWA 3KBJA 5AYBA 2MUCA 3MCNA 4R5EA 2BHYA 2O9RA 3CUZA 1NFPA 4NZJA 4UQDA 4D71A 2PLJA 4D9PA 2OO0A 5LXEA 4S3FA 3VILA 3RHGA 3AHVA 2CLMA 3INPA 4OUEA 5EA9A 1YNYA 1W56A 2VXNA 1PHWA 3WF4A 4YVPA 4YYFA 1JG9A 1NARA 2RHGA 4WKAA 4S38A 3IAPA 2CZVA 4NY2A 4QCEA 3TXVA 2IQDA 3EDEA 3MDUA 4TUFA 3N2MA 3TUUA 2HTMA 3BMVA 1NELA 1A4LA 1XQLA 3PR2A 1QPQA 1D3CA 4IP5A 1JR1A 2HDJA 3MP4A 2QJMA 3QHOA 3ITOA 3RG6A 2VUNA 2W91A 4F2UA 4K68A 4YTQA 4EPDC 3VMOA 5A8NA 1FKXA 3IIOA 3M0LA 3L21A 2RGMA 3MZNA 1TIWA 1W3IA 5H6HA 3CHDA 3WMLA 2YCLB 1E0XA 3BXWA 2FGZA 4F2BA 4LCRA 3UXKA 1VPXA 3NR0A 2NQ9A 4DO6A 2I17A 4D8LA 2PTDA 1UC5A 2ACSA 3WO8A 1WYIA 1NOFA 4QS5A 4P8VA 5D04C 2WC7A 1H2JA 4LV4A 4E8GA 3NM3A 4ZGYA 1OSEA 1YHTA 1EJ7L 1M9HA 4RLIA 1VHNA 1TMHA 3BG9A 2OZ0A 3C2OA 1XINA 5DXXA 3NQDA 5BXSA 1GYLA 3VCCA 1W8SA 1PTAA 2PDLA 1KCLA 3TOYA 2QPUA 2Y61A 1XCFA 3R7MA 1E1EA 4XD5A 3R43A 4PODA 1BYAA 4CD6A 1DXIA 3S1VA 1TMQA 4B92A 3DGBA 4B3ZA 3LHZA 3RO8A 3W26A 3TQ0A 2C7FA 2NQLA 4V28A 3GUWA 4PCTA 4O4VA 3VKCA 3NFUA 3G6MA 3V3WA 3P8JA 5HWNA 4IPLA 2NLYA 2WPBA 1UWTA 4PL1A 3W7NA 5A8MA 4DF2A 4WXYA 1OC7A 1XL9A 4AF0B 3MUXA 3SUVA 3N4FA 4C5ZA 4L4PA 2WLZA 4Z08A 5E6ZA 4RV8A 4HZ7A 3SO7A 4QG9A 2RDTA 1QI3A 1OK6A 1UKTA 3NSMA 3PY2A 3M1ZA 4WDXA 1J01A 4J40A 2GJPA 2J7FA 4LUYA 4Q7BA 3F4WA 1PZ2A 5HJXA 3VIKA 3LBCA 2ZXQA 3VOGA 2ANUA 2UY4A 1W5NA 5M5DA 3UG3A 1RP8A 1DPMA 3FN9A 3QJAA 3DC8A 3A24A 3IARA 3OYZA 1PDYA 1YNPA 4O19A 3DN5A 3TAOA 5BRPA 3IGHX 5M17A 1X7IA 3TSDA 1VJSA 2JGQA 2Y7EA 4DX3A 4NHVA 3H24A 1UUOA 4LBRA 3TKFA 3IK2A 4I9TA 5BRQA 3W25A 2NSOA 3UW6A 1P0KA 3AMKA 4JEQA 4LXFA 4DBDA 4UNLA 1QFEA 3O2LA 1XBXA 1ZL1A 4A3HA 4Y9AA 3QZ6A 4PUDA 3RJYA 4NZ5A 2CWXA 4TO8A 4GJJA 3VYLA 3UYIA 2QJJA 4AY8A 3R10A 4M0XA 2FVKA 1XXXA 3RM8A 1Y5VA 4QISA 1MEIA 3WDPP 3DZ1A 5A8PA 2G4FA 1AH3A 1ISXA 4BI7A 4NZ3A 3URAA 2DQWA 4DJDD 1UKQA 2NXHA 2YW3A 2P5NA 4WD0A 1XYAA 1SUXA 2H6RA 1FP8A 4CQBA 3BLKA 4DXVA 2EF9A 2QV5A 1TJPA 1CXEA 3WCZA 3VMNA 4WGXA 3TV8A 1I1XA 3FFSA 3SQSA 4WGHA 4JL1A 3VGHA 4DWSA 4NI8A 3OBKA 4J5NA 2HK0A 3VNMA 1J0KA 4NAFA 5AFDA 2ZUMA 3GD6A 3OIHA 1XJBA 2D22A 4LALA 4FLSA 1LQ2A 3ZR6A 4PUMA 3VABA 5AC4A 2QCNA 1DE5A 4XBSA 3CB3A 3W4RA 4KH2A 3N19B 2EG6A 2CKSA 3OPSA 2WYSA 3ES7A 3MHUA 5DMLA 3WUGA 3GHUA 3PBUA 1SFSA 4XG1A 3QPYA 2HE8A 4JAWA 2BS9A 4UOJA 3OU8A 1KCXA 2PMQA 3PB0A 3NTYA 1PL9A 3Q4DA 1IEQA 1SO6A 2BHUA 1S5WA 2HROA 2I14A 3W7QA 1X6LA 1QO2A 2ZBTA 4HT3A 5LNVA 4DI9A 3WLMA 1MO0A 4JQ2A 1I2PA 4Z1YA 4J2PA 1OFPA 1RPXA 1K7XA 3B4YA 3PAOA 4OKDA 4GH1A 3DKLA 3S1GA 2NQZA 4JCLA 4HSOA 4GK8A 4O13A 3T0DA 1PYFA 1HL9A 3F2DA 1ADSA 4M8UA 5LGXA 4E2OA 5D8ZA 4KESA 1VBGA 1EX1A 1OGSA 2FKPA 3L66A 4BFAA 4C91A 4XBJA 1TUXA 3UR5A 3AO0A 4NAEB 1V3LA 1OFOA 2XM2A 4TXEA 1W91A 4LC8A 3AWOA 1L6YA 8XIMA 3K8KA 4ICCX 4IGMA 5ABFA 1K4GA 5LIWX 1ITXA 1R3RA 4JN8A 2PA6A 4HU0A 1QNSA 3NAVA 4YIWA 4J3TA 1SU5A 3EWCA 3VD5A 2CLFA 2ZFAA 3UFYA 1E1CB 1U33A 1KCKA 3CS2A 2NQJA 1POKA 4Q7NA 5BZAA 1A50A 2QF8A 1IF2A 3PP7A 4GI8A 4X3ZA 1TZ7A 4XD4A 3T81A 5BXPA 1UZHA 3GDRA 1BWKA 1CCWB 1VIWA 2X05A 1Q2SA 4WKFA 3NGJA 1DQWA 1QW7A 4OBSA 1GQJA 1WQ5A 4WSHA 2B7NA 3LCFA 4RXFA 3LRKA 3SN1A 2OGYA 3NCOA 3R0KA 4IT1A 2CBUA 1HP4A 1KGXA 4I3GA 3E1F1 3L0GA 4R3UA 3WDIA 3PNZA 2YBTA 1QATA 3L12A 4L7ZA 3P61A 3GFYA 4JEJA 1C7SA 2Q01A 1FBAA 2A3EA 3ISIX 4UTUA 4IQDA 1F2JA 3CZLA 4CEXC 4D6HA 3TH6A 2HE5A 1X8FA 1MQPA 3SCVA 3GXPA 2GGGA 2OX4A 4K2SA 3E96A 2OB3A 3NSNA 4O15A 1PWMA 4IJCA 3L5MA 4HA1A 3H7UA 3NPWA 4K8GA 2WSYA 2Z0IA 4L80A 4D6CA 3TC6A 2JFEX 3PJUA 3UEQA 1XYBA 3TNOA 5E0FA 2E3ZA 1DORA 3CUXA 3SM0A 1EB3A 3N3MA 1LQAA 3NPVA 4IFKB 3S6TA 4PBGA 1I6NA 4XKYA 4NYYA 2QQ6A 4Q8OA 5KZDA 1HN1A 4MPQA 3LS9A 3K5XA 4V1XA 4UR7A 2PRLA 3B9NA 4DJEC 3UJRA 6TIMA 4J9JA 3W53A 3JUGA 4KWOA 3L67A 3WQPA 4BF5A 4HHPA 1XGDA 3WD0A 4AG0A 1MEHA 1H51A 4P7LA 4ADTA 1JCNA 2QNEA 3BAWA 3LN3A 4CN6A 1XLAA 4PFMA 4BK9A 3GC5A 1TPUA 2XUCA 3EZ4A 3L4WA 5F2IA 1J10A 5C0QA 1E6SM 3Q65A 3TYZA 4YL2A 1KTCA 1V0LA 3BCDA 3CIXA 3WUEA 4LUSA 3W1XA 4L5ZA 1QOXA 4FIQA 4BQ2A 2ZWYA 1K9FA 2V5CA 4GG9A 2Y5SA 4LYKA 3DCPA 1W3KA 3HA1A 1B3VA 3R1ZA 4KCTA 5D9MA 4EE9A 4Q8VA 1W9DM 4QDWA 3HQOA 4GC3A 3O15A 1I2OA 4BJHA 4LAOA 1XV8A 2TPSA 1XLDA 1RH9A 1JZ3A 1XIDA 3MI6A 2WZHA 3HQNA 5KZEA 1HNYA 1BSLA 2QMKA 5MHBA 5IM51 3O3RA 2V8ZA 3PTKA 4YLWA 1XG3A 1REQA 1K6AA 2NX9A 4GKLA 1HO4A 3QHMA 4UFKA 3S6OA 3A5VA 3NQ6A 4MF4A 5IBXA 4MB4A 4PUEA 3COTA 1EA9C 1S1RA 1GQKA 5LIUX 3UZYA 2UY2A 4PMNA 1IEXA 3GXDA 2G50A 3V4BA 2W4XA 1E0WA 4JL2A 2DIKA 4L4MA 1EUNA 1XLKA 1W8GA 3BZGA 4US5D 4FXFA 4ES4A 1KBLA 3AYSA 3KWSA 5BOEA 3IVTA 4WDUA 1Q6CA 4NJGA 1KR0A 4DUWA 4DEFA 4PRWA 1ECQA 4G1NA 3TXZA 2DT3A 2AQWA 2X0YA 3VDGA 4NX5A 4CNNA 1KBKA 4XX6A 1BLIA 4Q4OA 5A6SA 1NQ6A 3DHPA 1PPIA 1Q3NA 4XZMX 3PZNA 1FWJC 1YXDA 2NWSA 4AEFA 5EPDA 2RDWA 3LU2A 2CW6A 3N4EA 1D8WA 3FYOA 3H2CA 1F3WA 3WQGA 2BODX 4BF7A 3GYEA 3PUOA 3VKAA 4C6CA 3MVTA 3TIMA 3AYRA 3TMQA 1JCYA 1TRDA 3KVLA 3W2UA 3R8GA 3PWIA 4GBUA 2WNNA 1AH0A 4PRTA 2I1OA 2EPOA 3G1VA 3QPEA 3W28A 2HBVA 1VHCA 2V6AA 1CECA 5I3HA 5CZJA 1V6VA 1V02A 2QT3A 4JKLA 3GNOA 2PDQA 1XC6A 3OG2A 1XYZA 3L4ZA 3IJ9A 1PCWA 3CHVA 5A2CA 2A3HA 5JQ9A 1UHVA 3SAZA 5EBUA 2BVWA 4PTMA 3IJLA 1H5VA 4PL2A 5GJNA 3O07A 2GGJA 4R7OA 3VGEA 2DSWA 1QU4A 3UY7A 4Z2IA 3P81A 1BTMA 4DJFA 3PTMA 3THCA 2VCCA 3LSBA 4DBSA 1JUKA 2CBJA 4Z1BA 5BOOA 5J5DA 3EMZA 4HVXA 1U22A 4JY8A 3GDBA 1JD9A 4MMWA 3GVGA 3FCPA 5H8PA 4GJ1A 3DYPA 1TO3A 2VGBA 1ZAIA 1XKYA 1SSGA 4WF7A 3W81A 1YXCA 1PDZA 3ITGA 1DWAM 1KFKA 1OX4B 3WQ6A 2WHMA 3B8UA 4FX7A 4LYRA 2DSUA 1JZ2A 2C14A 4D8AA 1RCXB 2QKFA 4PCNA 4GX9A 3XISA 3GC2A 2FFIA 5DCBA 1QT1A 1QI4A 1LRQA 1TJRA 3GTFA 4E4FA 1BPLB 2J7CA 2DJXA 1N8FA 3BVJA 2ZUSA 4MGGA 4HN4A 4IPJA 4B2DD 4ZFCA 1GKPA 1BAGA 4G56A 1QUMA 1E6NA 3TA6A 1CTNA 1ONRA 5FOOA 2WKGA 3T40A 3LLFA 4GI9A 2IKGA 4GIEA 4JHOA 1Y65A 5DCDA 1F07A 4TR9A 1K8XA 4REQB 1PZ0A 2D0HA 5AVHA 3UZXA 1NEYA 3SQMA 3FHAA 1ZP4A 1W9VA 5FJOA 3M6DA 4IISA 3TN3A 1DJQA 4TX9A 4P2VA 2WVSA 4O17A 3WNKA 5BYWA 5HQMA 1QI0A 2YDAA 2Q3OA 4A6GA 1V6WA 1R3QA 5CSYA 2OWCA 1SJDA 2DT1A 1D7FA 1AA1B 4W84A 4KFOA 2J13A 1XSJA 3UR2A 2Y2WA 5FAJA 4JFTA 4MWAA 2YDSA 3K8MA 3GAYA 3IGXA 2FJUB 4H9TA 1FWGC 3LDVA 2F8QA 3TW7A 1C8YA 3BG3A 4EWJA 3PTDA 1P6CA 1VP5A 2XH7A 4Q4MA 1EC7A 3A9IA 3B9DA 4JICA 3VIFA 2HISA 1SFTA 4PTDA 1FFRA 2V5KA 1LOLA 1UWQA 4GFIA 1MI3A 4DY1A 1R86A 4CEUC 3U9IA 1C92A 2ZX6A 1EGZA 3NOYA 3W29A 1B3OA 1G4SA 4WCJA 1TIMA 2LLEA 1HKVA 5BXTA 3TYCA 1XRTA 1MRQA 6XIMA 3C3UA 2C18A 1W1IE 4WDTA 3VI2A 5HMFA 3ERPA 3IANA 4Q4RA 1KR1A 1CI1A 2NQHA 4B5UA 1B5TA 4Q4KA 1FHUA 1BKHA 2VI0A 4ZSTA 7REQA 4FOUA 4LC6A 3LPOA 1A3WA 4Y9OA 1UZ1A 2F61A 1BVZA 1XIMA 3KVKA 4QEEA 4F0SA 1TR9A 2XHYA 5AC7A 5C7VA 2DFAA 3DBPA 1OGGA 1UBPC 4LY8A 4GZIA 2D2OA 5CLWA 2WWCA 1OB0A 2CZEA 3D46A 2WCGA 3TFCA 1K9TA 2FGLA 2GDUA 4IXHA 5BCAA 2WM0A 3POHA 4WDWA 3S2CA 1MW3A 1VR6A 4KEVA 3B0UX 3HGOA 4L1XA 2HNEA 3MO4A 3SRHA 2DQXA 2PAJA 4M56A 1QHZA 4ATLA 1H09A 3LNPA 2DVXA 4IJRA 1PE1A 3O0KA 1KV5A 2UZ9A 5EMUA 2XIQA 5EYWA 3QZEA 1KBIA 1WAUA 3CTLA 3TTSA 3GZAA 2Q3RA 5GPRA 3GX9A 2C13A 4GI4A 2GL5A 4K8EA 1WBJA 2JF6A 2PDUA 2POZA 3LPGA 5I3IA 1RCOB 2J47A 5TF0A 3FAWA 2CZFA 4W7VA 4YJ5A 2X7VA 4N6FA 1V3HA 1S2WA 4PZVA 1CEOA 3W0KA 3N29A 5CPTA 4PTXA 3W2MA 3EMCA 3IRDA 2VC7A 2YOCA 5TNVA 2D3NA 4NQ1A 4YVVA 4V27A 2CHNA 3PM6A 3M0YA 4BWLC 1EBHA 4GUJA 3PNUA 1DIOA 4HZ6A 4J3WA 2VP8A 3IRSA 4H6KA 3ME3A 3ONBA 3MB9A 2VCAA 2VC5A 1H7NA 3RPDA 3TQVA 1OG6A 2TSYA 2GJLA 3LZ3A 4QJ3B 4X2PA 1XBYA 1ZLPA 3SCWA 2WWDA 2W63A 3N2BA 5AHMA 4WIWA 2H9AA 2NZLA 2Z27A 3CHCA 5CG0A 3ZYZA 1I45A 2VYOA 5CCZA 2VC9A 3GXTA 3T07A 5BMWA 4B9ZA 4C5YA 3NPUA 4GZEA 3C52A 4ILSA 2X1UA 5AHLA 3TJIA 1T41A 4CQCA 1A5UA 3EX6A 5AN7A 3ZWSA 2XIOA 3P8IA 2PC8A 4G9PA 1ZJHA 3NDOA 3ARQA 3M0ZA 4ZB0A 2REQB 3QMRA 3AYVA 1GQLA 3MCMA 3N6QA 3AZRA 1F5ZA 1OG0A 1R85A 4W5ZA 1YE4A 1B2YA 4AQLA 4L9ZA 3PBMA 2OOFA 2W0UA 2Z2AA 4UTKA 3KP1A 1MFVA 5HUOA 5HBFA 4JFSA 2DPEA 5JH1A 4UUIA 3CAQA 2QULA 4ACZA 5JIPA 4XZHA 4B5NA 3RGTA 4ALDA 2INEA 1GCYA 3CTTA 5A8QA 4U5IA 5U7SA 4WJ8A 3FK4A 4AZ7A 3FJ4A 5TBOA 2QCDA 4PMQA 3G8EA 4J3VA 4Y90A 3MPGA 3SW6A 1XLGA 4AIEA 1FH8A 3MVIA 4TQTA 2YSWA 5K9XA 1U5JA 4GMEA 7ODCA 5LKYA 2ZC8A 3W07A 2DU2A 1IIHA 3I7SA 3LD5A 5LNUA 3STFA 4CNPA 1K9DA 2X2GA 1GVRA 3WMSA 1UMLA 4RNJA 3R12A 4S1FA 3QLLA 4PMZA 4OWGA 2VX4A 2Y7DA 1TWSA 1OX5A 3NVTA 4HK7A 1DEDA 1RAKA 2FIQA 2E1DA 3CO8A 1M7OA 2J4GA 4HCHA 5K7JA 3M0MA 1R3TA 3WN6A 2HCVA 1YLVA 3SUSA 4Q4QA 1UWAA 3WD3A 1ODZA 3W76A 3NNTA 2I5IA 5EMKA 1EJTC 4KCWA 1YDYA 3QSTA 4GQBA 1OFEA 3OODA 3ABXA 3UWQA 1JGMA 4IICA 1A0DA 2TYSA 4AXKA 4IXXA 2DIJA 3CHEA 1I2QA 1GOMA 2QGHA 4CQ8A 1SZRA 1OCNA 4HCDA 2BASA 3W1MA 3IJ8A 1HX0A 3GW3A 2JKEA 1UD2A 3M9YA 3LV6A 2CITA 3GAKA 4ATWA 3LV5A 4LB3A 3CZ8A 3NQAA 3RM4A 2VX5A 2GQAA 1DVJA 2J9YA 3M5ZA 4LVAA 2CHOA 3WF2A 1ZCCA 1HL8A 1CGYA 2J27A 3LLDA 4YHGA 4W88A 2ZE3A 2HXUA 4D6EA 4LUJA 1XKJA 1C9DA 2OPJA 3T2PA 1M7XA 5G2IA 3OQ8A 1ZS2A 1G1YA 3WMCA 3RN6A 3OLGA 4H1ZA 4G1KA 2V2DA 4HU4A 3ITCA 3QGKC 2WM1A 2WW5A 4AU0A 3E2RA 3KOFA 3ANUA 3KZPA 5KITA 5T9BG 4RPQA 3BLIA 1DHKA 1A47A 4M51A 1Z44A 2PODA 3S0CA 1SQ7A 3SUTA 3QVQA 3AI0A 3O7UA 2TMDA 4HMNA 4M6UA 2DP3A 1XYMA 1TX0A 4A05A 1JXKA 2FVMA 2R91A 2NVDA 3BUVA 5I3KA 3TWBA 3W88A 3L4YA 3QC0A 2I5GA 1BGGA 3VOCA 4O1FA 3CQJA 3AXKA 2V38A 2E6AA 3B9AA 1CB2A 3NL5A 4H6EA 3R58A 3WNMA 5A6BD 4PTVA 3M07A 2VOTA 2PDKA 5ABHA 2VGGA 4MFDA 3SCQA 2W27A 3AMGA 1NU5A 1EEPA 1JCXA 3D3FA 1YDVA 2QCMA 3ZJ8A 1TKKA 4MJZA 4KRZA 4AHQA 3MUCA 3AQUA 3ZVHA 1TE6A 1YNQA 1UZ4A 1KM2A 2ALRA 1Q7ZA 3E38A 3ARXA 3DHFA 1J0YA 1VFUA 4LAUA 3T08A 3I4KA 4U2YA 1GZJA 5HNTA 3EKLA 4RE3A 1YADA 4Q8PA 1GQIA 1TREA 1UWUA 1MDRA 3S5YA 2PDFA 1XBVA 1EOMA 3O0FA 1EC9A 2D0FA 3BLOA 4LY4A 4MB1A 3LK6A 1B3YA 3M43A 4Y9MA 3TAKA 1EC8A 3HGSA 3GDTA 1R87A 3QY8A 3VIGA 2JEPA 5E5CA 3BK0A 3DC0A 4I5UA 3VA8A 5F1VA 4GINA 3G1FA 3C0QA 2ZRUA 3KBVA 1CLKA 2XSXA 4HSNA 3RRAA 2J8FA 3GNRA 4GLEA 3IUHA 5ABFB 2RFGA 2P88A 3WELA 2EPNA 3U5UA 2ZRVA 3EPNA 5M1TA 1BXBA 2G95A 1KTBA 5EU9A 3LOTA 5K3VA 5L9FA 1D2KA 5IHSA 1KBJA 1RA5A 3H21A 4TU1A 3SB0A 4IUOA 5CG7A 1KLZA 3AOFA 2ISFA 2H8ZA 4NL1A 3CL8A 3GUGA 1XISA 2E28A 3QW4B 3WDHA 3E6EA 5U4NA 5AY7A 3UZZA 1A80A 1W1VA 5HOSA 3PZTA 2RDXA 3HG3A 4PMDA 3O8AA 1LRNA 3WUBA 5H8UA 1UUMA 5LHEA 3VZXA 2AL2A 2GYIA 1H1NA 2X2YA 3NDZA 1VBRA 3K8LA 4KRTA 1ELSA 3U57A 1VEMA 3ABOA 2G96A 4J35A 3WDJA 2A21A 2PDCA 3AIVA 2WKJA 1FWEC 4S3CA 5G2WA 4JPGA 2WSRA 4F4RA 1R9ZA 1WXZA 3DG6A 3C2EA 4PUNA 3GQYA 5M2FX 3LERA 1X96A 2BNJA 1AG1O 2CWNA 2DY3A 4NUWA 2JKPA 3U5YA 1TUFA 3NEVA 3WLNA 3LG3A 1I2RA 5FF4A 3WEMA 2ZADA 5E9AA 3JVAA 3VM7A 4XD6A 4FZIA 2BMBA 1WNOA 2YL6A 1LUCB 4JQ1A 2OXNA 4U28A 5AYYA 2Z7GA 1XBZA 5JMUA 5FEZA 4XKYB 1WDPA 4RPPA 1NSJA 3IS4A 4JTJA 3TYAA 2BZNA 1RALA 4PYSA 3AUOA 1TPWA 1J79A 3KWXA 4D6GA 2Y63A 4FF7A 3PSWA 1NDYA 4AZIA 3WEOA 2FPTA 3HMJG 3CH0A 3WDQA 1T40A 3ITXA 1P0EA 4Y6GA 4E6MA 1ZAHA 1VGAA 4Q8WA 4NILA 1TWIA 4B9YA 4AD5A 1QOQA 3ZSSA 3CQKA 4O1AA 1GZ1A 5FCZA 3AZTA 1EPXA 3WJSA 5A8OA 2XH4A 2XTKA 1JF5A 3FHQA 4L61A 4BS0A 1BVWA 4E2BA 1UQYA 3GVRA 4G6CA 3AROA 3Q2DA 1P6WA 4F0RA 1P0NA 1ALDA 4LUSB 1ZB5A 2OWXA 3N34A 1HUVA 2P76A 3K30A 4JTCA 3THAA 4DJED 5HINA 1LL7A 2YJQA 4UTIA 4Z1AA 4XKMA 4O28A 2BSLA 5KZMA 5FF2A 1X39A 2OOGA 4C6PA 4KF1A 3UGRA 4A3YA 3HG4A 3LBMA 1O5KA 4Y96A 4HNNA 1REQB 1WUEA 3WQ8A 2EBNA 1V6UA 1TWZA 1OGBA 2Y85A 4GNJA 2OMAA 1OM0A 4GNVA 3HPAA 1TMLA 4A3QA 1K8ZA 4JBRA 2V67A 2JALA 1OQFA 3GIQA 3E74A 1MW2A 2ZX7A 3AALA 2B81A 1UIPA 4OHQA 2ZWZA 4XUYA 1QDSA 2V69A 4NXKA 4YCOA 4H04A 1E0UA 1MRAA 3II1A 3MI3A 3LGGA 5DT7A 4O8RA 4JN6A 1JYWA 4YNGA 4MB3A 1S2CA 1JNDA 3CH9A 3B0VC 3CQ0A 1VCFA 1SO3A 4JQAA 2WCAA 4HOWA 3G5EA 4X60A 3M5VA 3RMJA 1NWRA 3NA8A 4JIIX 2IKJA 1IXPA 1HJQA 3AHXA 3B9EA 4O1BA 3T4WA 2YCLA 4PC8A 1O12A 1HXJA 3G18A 3MMUA 4EPEC 4R27A 4A29A 3NZRA 4I7UA 1ZHAA 2CLKA 1Q6FA 4EXBA 3GBEA 5FSEC 3QF0A 1XW8A 4C6KA 1WE5A 1XM3A 4H9MA 3F4DA 4GBDA 3KVJA 4UFJA 1ZQ5A 4TTGA 2VDGA 2AQOA 2C3ZA 2WZIA 4LYPA 4JTHA 4N4PA 2RJGA 2V0TA 4P8WA 3IUDA 3RCYA 2E9BA 3CV1A 2WO5A 3LTSA 2QIWA 4LRSA 3NZPA 1ZNNA 3UPBA 1TZZA 4JDYA 1KFWA 1XSIA 1MZHA 2DSVA 3MWAA 2H90A 1FWNA 2PU1A 1XH0A 3ABSA 4ERGA 4K3ZA 6TAAA 4WQ6A 1BG4A 1R47A 3VNYA 2ZA2A 1KKRA 3B8IA 4TX6A 3CWOX 5CEWA 5CGQA 1SZGA 1MUWA 3UPMA 2YLAA 2XFFA 4C90A 3TWAA 3LLXA 3PBWA 4QM1A 2POTA 2P50A 3TC7A 3S1XA 3E0LA 1V03A 1ML1A 2AMXA 3OQEA 1KRAC 3OJGA 1XPYA 4JTDA 3CV7A 3B4UA 2V30A 4OOZA 5F2GA 1H3GA 1JRCA 5H91A 3BLEA 2GGHA 2A2IA 4JN7A 3UJFA 1E71M 1SO4A 1UWRA 2V81A 4B4HA 3N2CA 4RZ5A 4GGBA 1W3HA 3QRHA 4PMUA 1FWBC 3PFRA 1S2TA 4YVXA 1HJXA 4JYEA 3CEPA 3FEQA 2AKZA 2Z2UA 1UP3A 2BVYA 3MMWA 3M47A 3SRKA 1Q5MA 6CGTA 1UKPA 2PDGA 2HNHA 2OLHA 3UYCA 1NOUA 5FKYA 3TCSA 2PRHA 1RUSA 3HPXA 4GVGA 2EG7A 1XSKA 2DZPA 5D2WA 2PWGA 1YPXA 3E02A 4JIEA 1WZLA 4KFNA 4B91A 3ZLFA 5DELA 3RR1A 4XZLX 3GK0A 1TWDA 2ZUNA 4QGCA 1QVBA 1WXJA 1TVLA 1ME7A 1H4PA 3S2JA 2DIEA 2XIJA 1H61A 2VWSA 4JIQA 4ZTYA 5AZ1A 2NVAA 2FMOA 2X0SA 3BSMA 3H26A 5I5RA 4UBPC 1GOIA 3ALFA 3W00A 2OZTA 3N9SA 3A3HA 2E9MA 4NXSA 5A2AA 4IOTA 2OT1A 4NNAA 1GVQA 1I1WA 4X9YA 4MWAB 3VC6A 4DAFA 3N6JA 4LF2A 1OIMA 3O6AA 2PWHA 4JTEA 2Z24A 4UOQA 2GSEA 2HVMA 3H70A 2VRQA 1MQRA 1VRXA 2FYMA 3ZQ9A 4LOCA 4DJFC 2V9DA 2F84A 1JI2A 3URBA 1B31A 1UASA 4ZR8A 2WHKA 3BW2A 1F6KA 4UTTC 3WLKX 1XGEA 4W85A 5DFAA 1AQMA 4HNTA 1R3VA 1T8XA 4GRSA 4HMCA 4M82A 4A35A 3CMJA 3BAYA 2HMCA 2L5HA 4C1KA 4X63A 5C9ZA