4YN5A

Catalytic domain of bacillus sp. jamb-750 gh26 endo-beta-1,4-mannanase
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
391
structure length
391
Chain Sequence
IPKDSEGQSFKLVDSNASTLTKSLYAYLQDTSGRQILFGHQHAVDEGLTLTNSGDRVGSTQSEVKNAVGDYPAIFGWDTLSLDGYEKPGNEKNSQAQNRANVVQSMRTVHELGGIIALSMHPENFVTGNQYNDTSGDVVKNILPDGSHHEVFNAWLDNIAAFAHELTDQSTGELIPVIFRPFHEQNGGWFWWGAQTTTASEYKALYRYTVDYLRDVKGVNNFLYAFSPNAPFDGNLTQYLRTYPGDQYVDIFGLDQYDNKANAGQATFLNGLTQDLAMISKLADEKGKIAAFTEYGYSPQGFNETGNYLQWYTAVLEAIKKDPNASRIAYMQTWANFGYPTNMFVPYRDVNGNLGGDHELLPNFVEFYEDDYAAFLTEASGWNLYQDISTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus sp. JAMB-750 GH26 Endo-beta-1,4-mannanase
rcsb
source organism Bacillus sp. jamb750
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase
total genus 146
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4yn5A00
2WWCA 1V6YA 2DSKA 1GUVA 1XSIA 4Y7EA 4PYSA 2X8RA 3CH9A 4CCDA 5CLWA 3UR8A 4AZIA 1US2A 1HJQA 5EB8A 3CMGA 3ZJ6A 3E1F1 4PSPA 1ZBVA 3I3DA 1CZ1A 2J75A 5A6KA 1VJZA 3EMQA 3AMGA 3ZJKA 1XYFA 1UOKA 2C0HA 2F2HA 2GJXB 1WZKA 2DT0A 2J25A 4W5UA 4UFHA 5FL1A 3EDJA 5FD0A 3VUPA 1OIFA 1K9EA 4D6EA 4JFTA 2A3EA 2HISA 4AEFA 2A3AA 3UETA 2CPUA 1M53A 1RP8A 2FGZA 4MJ4A 1EIBA 3CLWA 3KEHA 5JBFA 1C3FA 3FW6A 1OCQA 1V02E 4GQQA 1XHGA 1XH2A 2CKRA 2VMFA 2VZVA 4AZHA 3GBEA 2CCRA 1HKJA 2VO5A 3MUIA 4PMYA 3WD3A 1KBBA 4WK9A 2OYLA 4PMDA 1UWUA 3L4UA 5D4YA 2WNWA 3A47A 3GXMA 1CTNA 4AY1A 5BXSA 3BSHA 2EPLX 3BCDA 3AIVA 2JIWA 5E6YA 1LG1A 3SCWA 2D22A 1K9DA 5CQ1A 3VGGA 3PHAA 1R86A 1H1NA 1NWRA 3WQVA 5C70A 3LMYA 2DSWA 4NSBA 5CG0A 4AIOA 3UG3A 2JIEA 4CU6A 4R5EA 3K4DA 4QLLA 4UZSA 2OLHA 4W7UA 5BCAA 1DTUA 3QHMA 1OT2A 4MPKA 1NH6A 2NT1A 4K68A 3VD3A 3B9AA 3CUHA 1DWHM 1E56A 3W81A 4PMQA 1MW2A 1TVNA 1NP0A 2VRKA 4J28A 3EDFA 1ZJAA 1EHNA 2GDVA 3WMBA 1JDCA 2BVDA 2X2YA 1E72M 1UWRA 1FA2A 2G4FA 1V0NA 2WVVB 4F79A 1H0IA 1QPKA 3N17A 4TTUA 2VL4A 4HA4A 4B9YA 3RIKA 2ZWYA 4D6JA 1JZ5A 3S2CA 2Q8XA 2WWDA 3KWXA 3WY1A 3K1DA 3AISA 3QGVA 4MNJA 3ALFA 2DGAA 2XWEA 3FHQA 1W9DM 5BROA 3TTYA 4AW7A 2XUCA 1ISVA 2G3NA 4FLRA 1E4MM 1JI2A 4A3HA 1XD1A 1KFWA 2A3HA 4W89A 3GXDA 3II1A 1GJWA 5F7UA 4EK7A 4TUFA 3WD1A 3WDHA 1BGAA 3WELA 5A69A 3RMEA 2WVTA 1VEOA 4W88A 5GNXA 2BVYA 3MSDA 1MW1A 1V6UA 2D0FA 3W4RA 3PZGA 1E0VA 2VZSA 1KCKA 3BLPX 1GORA 4BA0A 4D1JA 4LYQA 2ZWZA 3AIBA 1MQPA 4M82A 3U5UA 1OSEA 5A6JA 1JIBA 4LPCA 3WEOA 3W53A 2WMIA 1E0WA 4AD0A 4E8DA 3RM8A 5LA0A 3VD7A 3T0BA 4F8XA 1V3HA 1BPLB 4DM2A 1CYGA 1H5VA 3GXIA 2DDXA 1TCMA 1W3JA 2XFFA 3VM7A 4U5IA 3WENA 1OB0A 4UQ9A 1EO7A 2CBIA 2PF0A 4AEEA 4WSJA 4D72A 5D9OA 1WO2A 3WL0A 1LJYA 3FHAA 5FL0A 1O6IA 1W1YA 5JIWA 1CGYA 1WDRA 2WMKA 1DEDA 3GTNA 2ZXBA 2BY3A 3GBDA 3EDEA 2XVGA 5HNNA 4ZXOA 4QDMA 4C7DA 3W82A 1B3VA 2ZX8A 1UWSA 1UZ4A 4OKDA 3TTQA 4Z2LA 3W0KA 2EO7A 3QOMA 1HL9A 2PWEA 5A2CA 1VFFA 3T08A 1UKOA 1GW1A 1G1YA 1VRXA 2VZOA 3ARVA 4PUEA 5DMYA 3VIJA 4DUXA 3VOCA 2AOSA 1KQZA 3WF4A 2CHOA 3VIKA 3VDBA 2O9OA 3ZSSA 2NSXA 4AXNA 2XFYA 1JL8A 2EBNA 5FOOA 4P8VA 4J7RA 5M17A 1OM0A 4C7FA 2G3JA 4P7QA 4D6GA 3SUTA 3VDHA 4TVCA 3L4TA 3DYPA 1NOUA 1XRVA 1DP0A 1RP9A 3THCA 1W9PA 3AOFA 1CXEA 1E5NA 3OA5A 2WZEA 4HZ7A 5ABGA 3WD2A 1BLIA 5IXEA 3N12A 1S46A 2ZE0A 2VX4A 4S3JA 1HJSA 3KZSA 1JF5A 1BQCA 4IM4A 1WZLA 4DUWA 3WBEA 1KXTA 1H41A 2DT2A 1MYRA 1JZ8A 4PUDA 1J0YA 2DH3A 4B16A 1KWGA 1BYDA 2GK1A 3U7BA 1GQLA 1H2JA 1EDGA 1R87A 3VDAA 2YKKA 1ODUA 4JZ5A 4UQBA 1UA7A 2WCGA 2V38A 1KBKA 3AFBA 4LGXA 3ECQA 3VD4A 3SCQA 5CLTA 1C90A 2VT0A 2YDRA 2YLAA 1V3KA 4HP5A 4HOXA 4HOZA 8A3HA 2X1IA 4GO8A 3WQ4A 3POHA 1IT0A 2PC8A 3VGFA 3JUGA 5GQBA 4UZUA 2NT0A 4XZBA 3ZO9A 3FN9A 3AS2A 1BGGA 1UD3A 3ARRA 4H7VA 2O9PA 6CGTA 3VIMA 2V3FA 1PBGA 4QFUA 1C91A 2VRJA 3WDPP 5CPQA 4QCFA 4UFMA 3ZSTA 2XWDA 5LA1A 4MB3A 1BG4A 4J27A 3GH4A 4UOQA 3VO0A 2YJQA 1HJUA 5FIPA 2BY1A 2J7HA 3DHUA 4GXPA 3OLGA 3F4VA 1TE1A 4LQ1A 4PTMA 2WHLA 1MVYA 2FH6A 5DO8A 4P7NA 4HOWA 3SUWA 4ATLA 3IAQA 4W7VA 2NW0A 3VGDA 3ARUA 2DSUA 4RE3A 2D0HA 4E8CA 1DWGM 1J12A 1BYCA 1LLOA 1WE5A 3WH8A 2WHKA 5A6LA 2PBOA 5DFAA 1WZMA 2WZHA 1XYZA 1PX3A 3MO4A 4EANA 3O2LA 4UFLA 1EO5A 4UQDA 4BZYA 2Y8KA 3IJ9A 2G3MA 2AMGA 1QI4A 1G01A 3RCNA 4ACZB 1MXGA 2Y24A 4CU7A 1E15A 2YA1A 4ATWA 1B90A 1CDGA 1E4IA 3F5LA 1JF6A 1HP4A 2J47A 1OD8A 2VC9A 3A4WA 4LXFA 1OGBA 2YDSA 1E1FA 4B15A 4JKKA 4TX6A 1VEPA 4P7OA 1DWFM 4GZEA 4KH2A 5JBEA 1JGIA 3S6TA 2YL9A 4D1IA 1HX0A 2VQTA 5AYIA 4CVUA 2ZXAA 2VR5A 4F9DA 2PI6A 1K9FA 1IV8A 1CLXA 4CKQA 1PIGA 4CD8A 5KEZA 3PTMA 5A6BA 3THDA 3OIHA 2GDUA 1TUXA 2PB1A 3RPMA 2FHBA 1NQ6A 3AS0A 1LQ0A 4XUYA 5E9AA 3SCRA 1I1WA 1ECEA 2C7FA 1QHZA 3AYRA 1JZ7A 1NOWA 2E4TA 2ZIDA 1GQJA 4HMDA 1GOIA 2GSJA 2WMHA 5M3WA 3SCTA 4PMZA 2VURA 2EPKX 1VIWA 4PTXA 4F66A 3U7VA 1UD5A 3SCSA 3OLIA 2W91A 1UD2A 2VCAA 5LA2A 1ZBCA 4D6FA 1H3GA 2CITA 4CD5A 3W6MA 3D3AA 1M7XA 2D20A 4W8AA 2VR4A 4X0NA 1US3A 3N15A 4OOZA 1H4PA 1GQKA 2XG9A 1X6NA 5ECUA 3MMDA 2J7GA 3W6LA 1E3ZA 2W63A 2OSWA 2EPMX 2XTKA 2G41A 2WSKA 3VIGA 4BS0A 1CEOA 1UD8A 1M01A 3VDCA 3GYCA 7A3HA 5HPCA 1CGTA 4OUEA 4H04A 3NCOA 2WXDM 1B3XA 1EOMA 1BSIA 4PCSA 3N04A 1UKPA 2UWFA 1UYQA 4MADA 4WLCA 2ZX9A 1GOQA 5CXPA 2WCAA 4OZOA 4YN5A 2VI0A 3LPGA 2QHAA 5A6AA 1R85A 1ZU8A 1FOBA 2QF8A 2BHUA 2VTFA 2GJRA 4PEEA 1V3IA 3VD5A 2WMFA 4DWSB 4CD4A 1CGUA 1K6AA 1V02A 1JDAA 5E09A 1PZ3A 3L2MA 1PZ2A 1UHVA 4Z2GA 3AZRA 3AMKA 1CENA 2QPUA 3WF1A 1PJ9A 3GNPA 3I3EA 3SUSA 1QNPA 2AAAA 2EPNA 1E71M 1HN1A 3UR7A 3W28A 4E4PA 2J7FA 4UFJA 3OZOA 3BAIA 1E43A 1D2KA 1UQZA 3O6AA 3ZT7A 4CUCA 4N0RA 3WF2A 1BTCA 4YHEA 4ZFMA 2EEXA 3N9KA 5HBFA 3M46A 3IJ8A 1XV8A 1TFVA 1MQQA 4M29A 2GK1B 1JAEA 1QVBA 5I0DA 5JBDA 1JG9A 3RO8A 5AYBA 1FFQA 3ZMRA 1JNDA 4MTVA 2E40A 5A2BA 1UG6A 5BWFA 3SCOA 1VBUA 3CZEA 1H09A 5DT7A 2YDQA 4FLQA 4AD1A 3VILA 2VX7A 1CGVA 3WIJA 2VOTA 1HKKA 1GNXA 3VMPA 3ZT5A 3VMNA 2XVLA 4GO9A 1HVQA 5HOSA 3VNYA 5C8BB 1NWUA 5KZ6A 1BF2A 4JFVA 1EOKA 3WNLA 1B3WA 3PTKA 1JZ3A 3CHEA 1IZJA 3A6OA 4IUGA 4UTFA 3FXYA 2GUYA 4GINA 1LWJA 1B31A 3WQWA 3I3BA 2D23A 1AMYA 1NWTA 4AWEA 2D0GA 4MNMA 4BF7A 1J9YA 4RE2A 3CPUA 4HA1A 1HVXA 1YHTA 5E6ZA 4CN6A 1DHKA 1MW3A 3RM9A 3SCVA 4FLOA 1QW8A 1UR8A 2OYMA 4PMXA 1KCLA 2WW5A 3SIMA 1F4AA 2WLYA 2F8QA 1KXQA 4FMVA 4UQEA 3PZIA 3K46A 1VFMA 4UQAA 3FY1A 5CSUA 1HKIA 3PZUA 2UY5A 3U5YA 1QI3A 4JCMA 4H8HA 4WKHA 1KQYA 2J62A 3EMZA 1BYBA 4H8VA 4UFIA 4OJYA 3WMSA 4B9ZA 4Q22A 1UKQA 5BRQA 4X9YA 2YA0A 1ISXA 3AJ7A 3WNPA 3OGSA 1WDPA 4MDPA 4QP0A 3BMWA 1G94A 1DWIM 1E6NA 2CERA 3MV01 2VZUA 4HPGA 3WNNA 1JFXA 3L4YA 1QNSA 3KE0A 1W9UA 3T2PA 1WZAA 2WMGA 4W84A 3TOPA 3ARSA 3K4AA 4NF7A 3W37A 2OWXA 4NRSA 7CGTA 2Y5EA 5A8OA 4MB1A 1JZ6A 2E8YA 2FGLA 3PZTA 3UEQA 2J77A 3LPPA 3GH7A 2OWCA 2BNJA 2WC7A 5A6BD 4DWSD 4W5ZA 1UR2A 1JD9A 1W9XA 1E4NA 4NRRA 1JXKA 4FK9A 3VM5A 3KL0A 3IJ7A 1EH9A 5FKYA 4MAZA 1W3KA 4HMCA 2PWFA 1R7AA 3CTTA 3MS8A 3QR3A 3CUJA 5CGMA 3GDBA 5CPSA 4DUVA 1ITXA 1CPUA 2VZTA 2ZICA 5DEZA 3WH5A 3ZQ9A 1XGZA 6TAAA 1CIUA 1HJWA 3VGEA 1B2YA 3WDQA 4AZCA 3PZNA 2OSYA 3SCNA 3OGVA 1JXJA 3CBWA 5I78A 4W93A 2IUZA 3BMVA 1ISZA 1MFVA 4ZENA 4WKFA 2XJ7A 4Z2IA 2JFEX 1QHPA 5I24A 3DC0A 2MANA 2QPSA 4RL3A 3WUFA 2PBGA 1UWQA 4AYSA 1JFHA 1QBAA 3MU7A 1C8YA 3WEZA 3WL1A 1EQPA 1UR0A 1GOOA 3HMCA 2J74A 1MFUA 2XIIA 3OBAA 5HDRA 2YL5A 3GM8A 5C71A 4J3XA 4P7RA 1SMDA 2HVMA 3PZQA 3VGHA 3AROA 1TA3B 2D1ZA 4AZCB 1KR0A 1E73M 3L4XA 4D71A 2XVKA 1JZ2A 2D2OA 4BQ3A 4ZXLA 3PZVA 2ZXDA 2VX6A 1W1TA 1XCXA 4JIEA 3N1AA 1W32A 1MWOA 1ISWA 5A95A 3M07A 3WKZA 5EMYA 1CXIA 1UH3A 2J78A 3DYOA 1GHRA 5DF0A 3B8SA 1G9HA 3WNKA 2FDMA 2YL6A 1LG2A 4PBGA 1R8LA 4LX4A 2BY2A 2XHYA 2A3CA 2D3NA 1QW9A 2DIJA 4MJ2A 1XD0A 3AIWA 4J3TA 1ZS2A 4R27A 5BRPA 3AS3A 3HN3A 3FAWA 4A3YA 3AHXA 4YHGA 3CO4A 1PIFA 4IPNB 3K8KA 1BVZA 1BVNP 5IFTA 1HJXA 2JALA 2YOCA 3AIQA 1E6XM 1NARA 5M5DA 5IHRA 1G5AA 4MB5A 1FFRA 1KXHA 4WKAA 3NJ3A 4AZBA 5CJ5A 3IK2A 1J10A 3VKKA 4UNIA 2O92A 4U3CA 2ZUSA 1W1PA 1XH0A 1UWIA 1VFOA 3CUGA 1QI5A 1QHOA 3N18A 2CNCA 4DM1A 5A8PA 3GH5A 1RH9A 2VVNA 2J8GA 3WDIA 2ZUUA 1V0LA 1QNQA 2G8ZA 3CUFA 1OGGA 2FH8A 4N42A 4ACZA 1GOMA 1WCGA 4TVDA 3BAJA 1QNOA 2PWDA 3TTSA 2J7DA 1VFUA 5A3HA 3NDYA 3CZKA 1H0GA 4KGJA 1FP9A 2B31A 1PX8A 4HA3A 1C7TA 4XZWA 4WJXA 5EFFA 4EE9A 5CZKA 3GZAA 4JL2A 4LYRA 2BXYA 3OGRA 3WH7A 1V0KA 3KL3A 1CGXA 3MSGA 4ML4A 3RJYA 1WNOA 2BS9A 3L4ZA 3T0AA 3QHOA 1A3HA 1SR0A 3WNOA 2XM2A 4BQ5A 1BFNA 3QHNA 4XB3A 4CVWA 3ARQA 4TTGA 1FH9A 1ZBWA 4W8BA 3AMLA 2CBJA 4TX8A 5DT5A 4U2YA 3CMJA 1E4LA 3BLKA 3VIFA 1OINA 3AICA 2V5DA 5BXRA 3W38A 3WD4A 4PTWA 2JF6A 1V08A 4W87A 1KXVA 2VJXA 4KMQA 1Q6EA 1BYAA 3SEPA 2BV9A 4OOUA 1J01A 2V5CA 4Z2HA 3AI0A 1UR9A 2GFTA 1TZ7A 1CGWA 1J0KA 1GVYA 2CXGA 2XPKA 1WAWA 5A6MA 2XSBA 1KGXA 1W2PA 4M8UA 2WVUA 3BAXA 4NZCA 2WBKA 1GHSA 4WIWA 2VNCA 1O7AA 4F9JA 3EYPA 3AMCA 1OBAA 1B9ZA 3DYMA 4NI3A 1VBRA 5E0FA 4HU8A 2X0YA 5D8WA 2VUYA 5A6SA 1H11A 2Y8VA 4JFUA 3VVGA 3A4XA 1ODZA 2XFRA 1KB3A 3HJEA 3VNZA 1LL7A 3OG2A 6A3HA 1EDQA 1V6WA 2XVPA 4M81A 4QLKA 2CYGA 3VIHA 1CECA 1WDSA 4MNLA 3BXWA 3AHVA 1XCWA 3PZMA 1EGZA 1J18A 2QMKA 3WUBA 2CBVA 4FLSA 4GZJA 3CHFA 3A3HA 3K8MA 1M03A 2OWWA 3WUEA 1K9TA 1GOWA 2V3GA 4DWSA 1J0IA 3IAPA 4OIFA 4Z2JA 1C93A 1HJVA 1LL6A 4CCEA 1HKMA 3NSXA 2ZX7A 3ALGA 2DQXA 4GKLA 4W8LA 2QLYA 4AD5A 1KWKA 1TVPA 4D6IA 4CU8A 1E6QM 2XIBA 5E0CA 1L0PA 3MANA 2Z1SA 1PX4A 2QV4A 2J7EA 4HU0A 4B3KA 1ZBKA 2VCCA 2G3IA 1UD4A 2WAGA 4AD3A 2TAAA 1NWSA 3N11A 2WZIA 2YA2A 3DHPA 4QLJA 2WMJA 1N82A 3AQUA 4AMCA 4GZIA 1SFSA 2F61A 3PZ9A 3VIIA 3WSUA 4JKLA 3OB8A 3RILA 3WH9A 4PMUA 1TA3A 4GQRA 4OBSA 3WD0A 3BGAA 4AZ6A 4HMEA 1UH4A 2J4GA 4IISA 3KL5A 4Q7NA 3UESA 4H8UA 2CEQA 1UQYA 5CSYA 1QI0A 1QI2A 2BY0A 2ZUWA 5JUVA 2Z1KA 3J7HA 2DSVA 3VGBA 5BYWA 3EDDA 2X0HA 3ARXA 3CIVA 2WVVA 4A4AA 2W62A 5HXMA 4GI8A 1TR1A 1CNVA 2W67A 1W2VA 5I77A 1RD6A 2WLZA 5CPTA 3ZIZA 4MB4A 3BC9A 3AXXA 3PBGA 4UR9A 4CD7A 1HL8A 2J7CA 4ACYA 1CXFA 1U2YA 1GCYA 1V3LA 2WBGA 1M04A 1KGWA 4PN2A 1JNEA 2VQUA 1EXPA 2IXUA 2W5FA 3ZT6A 2EPOA 4L4PA 3SURA 3L4VA 5CGTA 4HZ6A 1G0CA 2W66A 2A3BA 3CZGA 1KGUA 4AIUA 1CXLA 5A8NA 1VEMA 2J79A 3GXFA 1B0IA 1XSJA 2D3LA 3WN6A 3T09A 3QOKA 3CHCA 1PEZA 1UUQA 1HIZA 5I3DA 4FF5A 4TVUA 2GJXA 4JKMA 2WK2A 1SYTA 4PCTA 1I75A 1W1VA 3TONA 1UH2A 3AIRA 3MUAA 4AIEA 3AIUA 3VX0A 4U33A 4KGLA 5JIPA 3AS1A 2DH2A 2JE8A 3O9NA 2YBTA 3WMCA 2VX5A 1OWQA 1W9VA 1LWHA 4PSRA 3VTRA 3W29A 3RM4A 1CBGA 2RGMA 1PAMA 3WDRA 3VU2A 2JEQA 1E9LA 1W3HA 1VJSA 2OSXA 5ABEA 1X6LA 5LYRA 1JYXA 4EKJA 2DIEA 4PMNA 3ARYA 3POCA 1WPCA 3T2QA 3AHZA 1JAKA 3G6MA 1R7OA 3MUZ1 1ZB5A 1FH8A 2YIHA 1C92A 2J7BA 1V0MA 3ARZA 1F4HA 3BCFA 3UG5A 1HF6A 1Z32X 1AQMA 4J3WA 3UCQA 4CD6A 4W7WA 2E9LA 2ESCA 1U33A 1XH1A 1UA3A 2UY3A 1HNYA 5I79A 4YPJA 4KWUA 4OBRA 3OZPA 1OT1A 1U30A 1LL4A 1E5JA 2CETA 2XM1A 3SCPA 1W9BM 3CZ8A 4L4OA 4PRWA 1Q6CA 2VVSA 4AC1X 1CLVA 4M24A 3VIPA 3VD9A 1JYWA 3VMOA 3RDKA 1OGSA 4LYPA 4H41A 4IPLA 3DECA 3AZTA 1HT6A 1PPIA 2XGBA 4KRTA 4C7GA 2WVSA 2BVTA 1DWAM 3F5JA 3BAYA 1C7SA 1OIMA 3MMUA 3OLEA 4S3KA 2O9RA 4UQCA 1UR1A 3WQ6A 1GZJA 3WEMA 3W24A 3FAXA 3APGA 3EDKA 3MKKA 2BHZA 4JFSA 3AYSA 5GPRA 1JZ4A 2CHNA 1Q4NX 2PWHA 5AY7A 5I23A 1SMAA 3AHTA 2D24A 1FHDA 5A1AA 2JF7A 1Q6GA 1JI1A 4TXEA 3CZLA 2VRQA 2Y4SA 4WF7A 1MXDA 1UKTA 2CBUA 5D8ZA 1TMQA 1JYVA 2DT3A 4KRUA 3TA9A 1E40A 1XSKA 1FP8A 1WKYA 3L4WA 2DPEA 1GOKA 1D3CA 3LPFA 1EA9C 2Y2WA 1QBBA 4PMVA 4H2CA 3UERA 4BCEA 2DT1A 4JHOA 3NDZA 3OLDA 2C8NA 1IZKA 2WPGA 2CIPA 3K8LA 5IDIA 2QMJA 3BAWA 3IANA 3WNMA 3CZJA 2ZX6A 1BG9A 4GI6A 2E9MA 2WANA 4X0VA 1AVAA 2E9BA 1E6PA 1AQ0A 3WFLA 5BXPA 3ARWA 4P7LA 1V6XA 5I6SA 2GVYA 1HP5A 1BHGA 3TTOA 2WC3A 1GPFA 3MV11 1UR4A 4JHZA 2CKSA 1D7FA 2WKGA 3T0DA 1V6VA 1WDQA 4GIAA 9CGTA 3WFZA 2W4XA 4ZE5A 2WB5A 1JYNA 1Q6DA 3CGTA 3W27A 4ZE4A 2YL8A 1OD0A 4AZ7A 4E2OA 2UY4A 4M1RA 1E70M 3CUIA 4P8UA 2WMIB 5TD4A 4D6HA 3AXIA 2DSZA 3NSMA 3GNRA 3MMWA 3F5KA 1JD7A 1E0XA 2V3EA 2XSAA 4W86A 1P6WA 1TG7A 2ZX5A 4EAMA 2XGIA 2FHFA 4MNKA 1YQ2A 1QNRA 4MDOA 4U3AA 2X05A 1CXKA 3HU7A 3NSNA 2FHCA 3WH6A 5GNZA 1B3YA 1NOFA 3AHYA 1HXJA 2E0PA 1UWTA 1H49A 1GJUA 1VF8A 3WDJA 5IFPA 5BXTA 1V03A 2W92A 1NM9A 3AIEA 3PN8A 1UD6A 1A47A 4B3LA 1V3JA 2EJ1A 4V28A 5EFDA 3RJXA 3TP4A 2WC4A 4U31A 3BH4A 3BAKA 4V2XA 4J3VA 4J3SA 2ZUNA 2W61A 2WM0A 4GPNA 3D5HA 1CWYA 1ITCA 3NYDA 1E6SM 3VIOA 1UZ1A 3WUGA 5D9NA 1Q6FA 2OYKA 3ZM8A 3VPLA 4PTVA 1FHLA 1C8XA 3AZSA 3WF3A 1WP6A 3MUY1 1DWJM 2ZUMA 5A8MA 3CHDA 4D6CA 1GONA 1FH7A 3N13A 3W26A 3BSGA 4QAWA 3W25A 4DWSC 3B9EA 2IXVA 3T2OA 1J11A 2RGLA 4XV0A 1Y7VA 4MAVA 1EHAA 1VAHA 2YLLA 1L8NA 5M03A 5D9MA 2X09A 4HZ8A 2E3ZA 1XC6A 5GNYA 3G6LA 2WHMA 2J8FA 1X1NA 1AQHA 4ATDA 1ESWA 5AC5A 2DEPA 1J0HA 3LPOA 4RE4A 4UFKA 1NP2A 2YBUA 4BQ4A 5AC4A 1W3LA 2ZUVA 3M7SA 2WCSA 1E1EA 3L2LA 3ZOAA 4AISA 3PTQA 1ISYA 1EQCA 2WKLA 2EQDA 4AZ5A 3A4AA 4U5KA 1E55A 3B9DA 2BHYA 5ABHA 4AD2A 3WQ8A 4JFWA 3UG4A 1I1XA 2WYSA 4Z2KA 2PWGA 2UY2A 3ZJ8A 5IHSA 5A2AA 5ABFA 4CCCA 1UKSA 3VX1A 4CN4A 1V3MA 4BQ2A 5I5RA 1JDDA 3SUVA 1VENA 2ZOXA 3GNOA 5I2UA 2ZXQA 4D6DA 4PMOA 3ARTA 4TOQA 3SCUA 4M56A 1E6RA 1J0JA 1ZJBA 3U57A 3ZR5A 1KR1A 7TAAA 1E6ZA 4QCEA 4GI9A 3VINA 1RPKA 1B30A 3AMDA 3M6DA 4JL1A 4UCFA 3ZR6A 3NIYA 4HPHA 1J0ZA 2BFGA 4UOZA 5HPOA 2ZUTA 2E8ZA 4P8XA 2XVNA 8CGTA 1MW0A 5ABFB 5A8QA 4CN1A 4U2ZA 1LF1A 5A94A 4HTYA 4W85A 1E3XA 1WB0A 3FNDA 2JEPA 3WF0A 1W91A 2WHJA 4XX6A 1MQRA 4J3UA 3NUKA 2EXOA 1GQIA 4CGTA 2VCBA 2V3DA 3SUUA 1GVIA 4AZGA 4ZEPA 4URIA 3ZJ7A 3WBAA 5E70A 4PMRA 4JCLA 1EDTA 2GJPA 4JAWA 3WQ5A 5EBAA 4V27A 1QOXA 2WSPA 1C8QA 1ZL1A 4P8WA 5D9PA 1VB9A 3AXHA 2BXZA 1B3ZA 3EBVA 5FCZA 4UOJA 1CXHA 1B1YA 2XYLA 3PZOA 3EMCA 4AD4A 4WSKA 1BAGA 3ARPA 2CESA 4M80A 2O9TA
chains in the Genus database with same CATH superfamily
5G4HC 5AC8A 1X7FA 4Y7EA 4PYSA 3B40A 3CH9A 1DE5A 4L9YA 2P8BA 2OX4A 5CLWA 4AZIA 1HFBA 4JQ3A 2PF8A 1GZGA 1ZBVA 5JVLA 4O18A 3BG3A 1CZ1A 4FPSA 5DX7A 1VJZA 1FWFC 1G7UA 3EMQA 1XYFA 3U0HA 3T78A 3WLSA 2GJXB 5MKGB 1WZKA 3C4UA 3GR8A 2J25A 2G97A 3UPWA 3EDJA 5LNUA 5FD0A 2X1UA 5KTLA 3B8TA 2I14A 1VLIA 1OIFA 3IJQA 1WUEA 4D6EA 3S9ZA 2GSEA 2HS8A 3W01A 1GG0A 3UETA 3M0JA 2IKJA 1ICQA 2CU0A 3QPZA 4AF0A 1DIKA 1EX5A 1YTEA 1Y8BA 2GSHA 3N73A 4HQVA 4K7YA 3FW6A 1OCQA 1PIIA 3L65A 4AH7A 1QW7A 1XHGA 2ISDA 3SGZA 2ISWA 1NDVA 4L6HA 1DHPA 3LHWA 3THUA 1ITQA 2PPGA 1JUEA 1X96A 2XH0A 3NPVA 1V51A 2QXWA 4TU1A 2Z2BA 2VO5A 4IFOA 2JKPA 3MUIA 2Q02A 1UIOA 4WK9A 1OFOA 1K3UA 1I0BA 1SZNA 3BSMA 1UWUA 3GXMA 3NZPA 1HW6A 3ZWSA 4ILSA 1FUYA 3NZQA 3BCDA 1TRDA 4C91A 4NYUA 4KFPA 3GE7A 2D22A 2VM8A 3TCSA 1K9DA 5CQ1A 2TSYA 3V5OA 1KNWA 3WQVA 1IYXA 4W9TA 5MKGA 1JPIA 3NQDA 4CU6A 5C54A 4R5EA 3K4DA 1XYAA 4NAEB 5CSSA 2HZGA 1QK0A 3MMTA 3MKCA 3NL2A 3SR7A 1R9YA 1YDYA 2VHLA 1PYFA 4PMQA 2CWNA 5KZMA 5EMLA 1NP0A 2O4QA 2F38A 1T40A 4AF0B 1O1ZA 2EGZA 5FJJA 1GW9A 3WMBA 5DBTA 1KD0A 2X2YA 4NXSA 3G8RA 2P5NA 3RRXA 2Y0FA 4F79A 1H0IA 4TTUA 4B9YA 2E6YA 2PE4A 1JZ5A 1AK5A 3KWXA 3T0TA 3WY1A 4YYCA 4PUKA 4PR4A 3STCA 5FEWA 2QGHA 4MNJA 3NVTA 5BROA 2X1TA 4QXIA 2BOEX 1UBSA 3VCCA 2VD8A 3IGSA 1B54A 1GT8A 4A3HA 2BZNA 1XD1A 2A3HA 1GVSA 2WQPA 3GXDA 3II1A 2Z1XA 3WBYA 3WDHA 5K4XA 4ERAA 4O4VA 4N4PA 4B3ZA 1PL9A 2OXNA 2GQ3A 4Y9AA 1U83A 2BVYA 3MSDA 5T9BG 1OX4B 5AZ0A 2VZSA 1KCKA 2GUUA 4D1JA 4LYQA 4AUBA 1MQPA 3CEUA 3DUGA 2Z6JA 1POKA 1W5QA 2WMIA 4BI7A 2Y70A 3BCJA 4AD0A 3O16A 3EAUA 5LA0A 3T0BA 4F8XA 4JTIA 3FKKA 3ATZA 4DM2A 3V16A 1W3JA 2XFFA 2FKPA 3G1RA 3WENA 1BWLA 4UQ9A 3W7MA 2PGEA 5D9OA 3M0XA 5FJTA 3DI0A 5HINA 4Y9MA 4FP1A 5FL0A 2ZADA 3L0GA 3LLXA 4PCNA 1CGYA 1WDRA 2WMKA 2BY3A 3GBDA 1YTKA 4B2DA 4LVDA 2H6RA 1GZ1A 3VC5A 4GBDA 3W82A 1B3VA 4INFA 1YX1A 5FESA 2Z1VA 2Z27A 3TTQA 4OV9A 1FWGC 1EP1A 3W1RA 5C55A 2EO7A 1UP2A 2Z0IA 2PRMA 3ONCA 3T08A 1PTGA 3NR0A 4PCFA 2VZOA 3FKRA 4RK8A 3ARVA 3CEPA 1VD6A 3VOCA 2AOSA 4KRZA 1KQZA 2CHOA 2O9OA 3ZSSA 3R11A 5TNVA 5LIXX 3A24A 4R34A 1F07A 1XP3A 4D6GA 3DC8A 1NF7A 4TVCA 3NM3A 2FFCA 4K38A 1ZY9A 1RP9A 2GJNA 2VEGA 3CV2A 1XGDA 1E5NA 1OYCA 3OA5A 5HULA 1S2TA 3S6DA 2ZBTA 3WD2A 3SQLA 5CPOA 2R82A 3WQEA 5CH9A 3KM8A 4S3JA 3HM7A 4DUWA 2WOQA 1KXTA 3QEZA 4P2VA 2XU2A 1MYRA 1XDMA 1GVQA 1KWGA 2GK1A 1GQLA 4NZ1A 3QTPA 4JZ5A 1UA7A 3P14A 1R38A 3CS2A 1J5TA 3VD4A 4N7QA 1FRBA 4JTFA 2X1IA 3CL6A 3HGJA 3H2OA 2PRHA 2VC7A 4O28A 5CZSA 3MYOA 4Q4PA 1BGGA 1F7BA 1VPXA 1H63A 1PBGA 3WDPP 4UFMA 3TW6A 4J27A 1YE4A 3GH4A 4QGCA 4X3ZA 3KHDA 3S8HA 2Y6ZA 3DHUA 3HG5A 3OLGA 3F4VA 4L7ZA 4NJKA 3H7VA 1QOPA 5DANA 4HOWA 1KCXA 3E96A 3GIYA 4ATLA 4Q8UA 2W3ZA 1XKJA 3UD6A 1XLDA 2Y8UA 1EBHA 4YNGA 1A50A 4Q8WA 3HPSA 3CASA 5ENLA 1WE5A 4MFEA 4ZMGA 3WH8A 3TA6A 4FSAA 2WQDA 3MO4A 1KFLA 3PPCA 1L6SA 4Z42C 4UWMA 4IF2A 4F2BA 2QCDA 1UPPA 4UQDA 1OVDA 4JEQA 2G3MA 2F84A 3BLLA 2AMGA 5IM51 4EXAA 1VQTA 3EOOA 3C0LA 2ZC8A 4HKPA 2QF7A 4KIEA 4PTDA 2PDCA 1AJ2A 2GVLA 1JCTA 5I3GA 3A4WA 3IJIA 4LXFA 1ZHAA 4NKCA 4G9PA 4BKNA 4C6FA 1LRNA 1E9IA 1W31A 1DWFM 4GZEA 3ES8A 4JNMA 4KH2A 4UTJA 2C91A 4RDVA 3NQ2A 3CU2A 4CVUA 3C0QA 3LTYA 1ZGDA 4CKQA 4MWAA 1PIGA 2GGGA 3OIHA 1TUXA 4H7ZA 2P88A 3JZUA 4XUYA 5E9AA 5J04A 1I6NA 4F48A 4LBSA 1I1WA 3LM3A 2C7FA 1F5ZA 2ZIDA 2X30A 5MHBA 3NA8A 1WOBA 2I9EA 1U22A 4JN7A 2A6NA 1KTBA 4PMZA 4XD6A 2DY3A 4PTXA 3N2CA 2KZHA 3UVIA 4F66A 3JRKA 1UD5A 2W91A 1UD2A 5E0KA 2CHRA 3C2VA 1ZBCA 3FSUA 4C5YA 3IIZA 4YLWA 3ZZ1A 4W8AA 3LSCA 1US3A 4OOZA 2ZRVA 2CLPA 1AJZA 2R1NA 2J7GA 2EPMX 1M7JA 2G41A 2ZRZA 4RE0A 4RLIA 4C1NA 2FZ9A 1P5BA 4UMCA 4IGMA 2F6XA 4BS0A 3QFEA 1M01A 3GYCA 5AHIA 4OWGA 7A3HA 3PBYA 3H2MA 5HPCA 4R85A 1CGTA 4B2DD 3GFXA 3ONBA 1B3XA 4QG6A 1GKQA 4WLCA 1A0CA 2ZX9A 1GOQA 4H6QA 2P3ZA 1VIZA 2CLIA 4YN5A 3TQVA 1GQNA 3FSTA 5A6AA 2QUTA 4GVHA 2R6OA 4ZODA 2XIOA 4DJDA 4PEEA 4Q8OA 4M6PA 3VD5A 3QMTA 1CGUA 1K6AA 1SQ7A 1KM1A 4JGDA 4GISA 3TNOA 4CEXC 1PZ3A 4GVGA 1MRQA 3W1UA 1PZ2A 1VS1A 1UHVA 1OZQA 4NZ4A 4UMAA 4N9EA 3G1HA 3LCLA 4K8GA 4Q32A 1R3SA 3BW4A 3TN4A 3GNPA 4LAMA 3SUSA 2AAAA 3VZZA 4IHCA 3Q67A 1W37A 3UGVA 2J7FA 3IK4A 3QM3A 1XISA 1E43A 1UQZA 3O6AA 3ZT7A 3OYZA 1BTCA 2EEXA 3N9KA 5HBFA 4HT3A 1MQQA 2YSWA 2J9XA 5AFDA 1IHIA 2XZ7A 2RHGA 3G1FA 1JNDA 3FIGA 2E40A 1UG6A 1QK2A 3E0VA 1VCFA 1ZUAX 1H09A 2QJNA 1TQJA 2YDQA 2DVUA 4GX8A 3P2VA 3Q65A 4GI4A 2FMOA 3VZXA 1UUOA 4R53A 4JIRA 1HKKA 3L5MA 2XVLA 3CO8A 2H3BA 3L12A 4Q8PA 4EPBC 3S6OA 1B3WA 4Q33A 3UZYA 1OQFA 4UTKA 1IZJA 4C6KA 4BF5A 5FF2A 3SO7A 3FXYA 2GUYA 5C7HA 3WQWA 1TE6A 5LIWX 3P81A 2PSNA 4BF7A 1J9YA 4EOUA 2J9YA 3UJFA 4IQDA 1HVXA 1DPMA 4ZOBA 2YCKX 2OU4A 1SU5A 1YHTA 3TYZA 1I9CB 2Q01A 2BVWA 3UJRA 1QW8A 3UCDA 1UR8A 3M64A 1KCLA 1F4AA 2F8QA 1KXQA 4UQEA 3R94A 1MEHA 1VFMA 3FY1A 4GVIA 3WLPA 4DJED 5BW6A 2ZFAA 4JNYA 4JTHA 2J62A 1YRRA 2PDGA 4H8VA 4O1EA 1XG4A 4X22A 4DWDA 4Q22A 1XLJA 4LB4A 3LV5A 4NNBA 3NWRA 4X9YA 3CWHA 3OGSA 1AD4A 2ZTKA 1MUCA 4MDPA 3M5YA 1TWWA 2X42A 1G94A 4JTAA 1KO0A 1N8FA 2VZUA 3B0YA 1UJPA 5E1QA 3T2PA 3BL3A 3I7RA 1WZAA 3QJAA 4W84A 4NX5A 4ZA0A 3TOPA 3ARSA 3K4AA 4NF7A 2OWXA 4A05A 4E6MA 1MI3A 4IH3A 2O56A 4MB1A 2FGBA 3LTSA 5C0QA 2ABAA 4JDBA 1RY0A 4H6EA 3UEQA 4CQDA 4E0CA 5J5DA 1SSGA 5HJYA 2GQ9A 3L7RA 1PUDA 1R47A 3KTXA 4BR1A 1Q5MA 1W9XA 3KL0A 4GGBA 4S3GA 4LS2A 1W3KA 3MS8A 3TC3A 1ITXA 3DFPA 4GUGA 1XGEA 4C5ZA 3CQJA 3OZMA 1XGZA 3WH5A 2PDKA 4AZCA 3PZNA 3SCNA 2JK2A 3HJZA 3OGVA 3XIMA 5I78A 3SRHA 1RK5A 3BMVA 5FI8A 2ATMA 5BOOA 4WKFA 1JULA 3QV6A 4Z2IA 4RL3A 3WUFA 4LALA 3WEZA 3VA8A 3H4XA 2QAPA 5LIKX 5CPMA 3KCLA 5HDRA 6PTDA 3N2TA 4GQGA 2YL5A 3GM8A 1SMDA 3FEMA 3UF9A 1LWIA 3IS4A 1TA3B 2D1ZA 5DELA 3W86A 2CZVA 4YS1A 3L4XA 4DJEA 3MJMA 2OELA 2XVKA 1XIJA 4BQ3A 1R5YA 3W71A 4JY9A 1CLKA 4M7SA 2WSQA 3V1HA 1XW8A 1ISWA 4IFKA 3M07A 4Y9NA 3WKZA 4F0KA 4H9XA 1GHRA 1NFPA 4I7VA 4WX2A 1XKYA 1G9HA 4PBGA 4UMBA 1R8LA 4LX4A 4LS0A 1OFBA 2D3NA 3RLVA 4MJ2A 1XD0A 4J3TA 3KOZA 2VP8A 4GJJA 3AS3A 7PTDA 1YXDA 4LVBA 4HSNA 4A3YA 1AODA 1HZYA 2QNEA 4YCOA 1HJXA 3HPFA 4DJDD 2YOCA 4MYXA 4LEFA 5M5DA 3BLIA 5H91A 1G5AA 2QT3A 4EF9A 3NJ3A 5EY5A 1L9WA 2OLAA 4KESA 3C6CA 3NQGA 3A3XA 3GTFA 1XH0A 3SI9A 1VFOA 2JGYA 1QI5A 1QHOA 1O95A 2CNCA 4I3GA 4GY7A 3EX1A 1PO9A 1S2VA 2TMDA 3GH5A 1RH9A 2VVNA 3WDIA 1V0LA 1QNQA 4GFSA 1OGGA 1F61A 1KFBA 4MG4A 1GOMA 1WCGA 3BAJA 4L4LA 3VOIA 2RKXA 3DN5A 4WEVX 3W7NA 1VFUA 3NDYA 3NO3A 4KGJA 4PTNA 1NFBA 1UB3A 4EE9A 1XXXA 1EYEA 2BGNE 3OGRA 4KEMA 1OF6A 5B7ZA 1E51A 3SECA 1IGWA 3RJYA 3T0AA 1KM4A 1QASA 4GBUA 3M6YA 3R8HA 4BQ5A 4V1YA 4TTGA 4GG9A 3AMLA 2CBJA 2PDJA 4D8LA 3CMJA 1E4LA 3D6NA 4AWTA 4ORMA 4HZMA 3W2LA 1MXSA 4O50A 5BXRA 3JZEA 3B8DA 1EWDA 2PGWA 3A64A 1Q66A 1T96A 2YYTA 1Q6EA 1B57A 4ES4A 4FS9A 4JIQA 4XIMA 4FXJA 2V5CA 2R94A 2XPKA 1GVYA 3SBFA 3RHGA 1KGXA 4M8UA 2WVUA 1ZPTA 4NZCA 2WBKA 2VNCA 3PS7A 3XISA 4F9JA 1HO4A 4XBJA 5DRCA 4Z1DA 3AMCA 1B9ZA 5DRIA 1O68A 2VUYA 1U1HA 4QISA 5E9XA 2JGQA 2FTPA 3OG2A 3MCNA 4US5D 4QLKA 2O7QA 4QE4A 3HMJG 1CECA 4DO5A 1DXEA 4MNLA 2RJGA 2VFDA 3PZMA 3WJWA 3WUBA 3CQIA 5DMMA 4FLSA 4UNKA 3OO2A 4PFMA 3A3HA 3PG9A 2GDQA 2ISFA 4ZBCA 3DOPA 4ZZ9A 1J0IA 3IAPA 1POJA 1C93A 4FHAA 4DI9A 2ZX7A 3NSXA 3ALGA 4GKLA 4MMWA 2D2HA 1Q8JA 3ATYA 3DKLA 5AHFA 4IQEA 1LDCA 2XIBA 3GWQA 4DB7A 3MANA 3LNPA 1FWNA 3GU1A 2QV4A 2J7EA 4B3KA 1ZBKA 1M3UA 3STPA 3EWBX 3RYSA 1K8XA 4XAZA 2ZRYA 3AQUA 1C9WA 3B05A 4GZIA 1R46A 3GNDA 1H7RA 1YLVA 3QGAC 4JKLA 1T8XA 5CEWA 4F0LA 4GQRA 4L64A 5AHMA 2GGIA 5CAKA 3BGAA 4HMEA 2J4GA 3H6OA 4RV8A 1QI0A 2ON3A 3HTWA 2QS8A 3AUOA 1VYRA 1V4YA 1XLEA 3GU2A 2BY0A 2ZUWA 4C1KA 3LS9A 4NHVA 4Q8MA 3OHIA 2J8TA 1T41A 1Z69A 4LYKA 4EPDC 3EDDA 3B4YA 6ALDA 2WVVA 3QQWA 2HDJA 5HXMA 4GI8A 4GOAA 1Z41A 3SRFA 1J93A 5I77A 1RD6A 3GK0A 5I3HA 3SRDA 5CPTA 1HL8A 4MIMA 2YCIX 1LUCB 3TEVA 1TELA 2WBGA 1M04A 1KGWA 3E0LA 4PN2A 5BNKA 1YYAA 4DJEC 3LXAA 2W5FA 2IXUA 3TX9A 5M2FX 3PBWA 2FDSA 5G1YA 1YADA 3CAVA 1A5MC 3FS2A 3QC0A 1G0CA 3EEZA 4LF2A 2A3BA 2QCMA 4ZSTA 3K5XA 5G5IA 2YW3A 1PHQA 1VEMA 2J79A 2QCNA 2D3LA 3GLCA 3QOKA 3F4CA 1PEZA 1HIZA 5I3DA 4GACA 1IXQA 3TONA 1UH2A 3AIRA 5EMUA 3BGJA 4AIEA 1ZCOA 2E6FA 1Q6RA 3AS1A 4GQBA 2FB3A 3O9NA 2Z2AA 1KV8A 5EKYA 2VX5A 4DXVA 1W9VA 4PSRA 3H55A 3RM4A 1PCKA 4IG2A 4NZ3A 2DP3A 1TTPA 4A35A 1W3HA 5LYRA 1P1XA 4EKJA 4ALDA 3POCA 5HMSA 2Y7EA 4R9OA 3E2SA 1R7OA 5CCZA 3MUZ1 1OFAA 1FH8A 5C7VA 3N9RA 2F7FA 3H8AA 3ARZA 5LNRA 1NY1A 2Z1WA 3HZ3A 3BCFA 3UG5A 3TW9A 1HF6A 1Z32X 4IL2A 3GTXA 1H7PA 4OHQA 3MWAA 1K4HA 4IPJA 1U33A 3AAMA 3P3BA 4KWUA 1G4PA 3OZPA 3HG2A 2CETA 3SCPA 4UNLA 3S42A 4I7WA 1DKWA 1Q6CA 1IT8A 4A6GA 4HPJA 4AC1X 1RZMA 3GU9A 4M24A 4RXFA 2QCDB 3O0FA 3VMOA 4IPLA 1LBLA 3HPAA 2BVTA 4FB7A 3V1PA 4GXWA 1C7SA 4FXSA 1R3WA 2O9RA 2PDQA 3ITGA 3NQFA 4ROQA 1AZ2A 2H9AB 3FAXA 3EDKA 3QPYA 5HWMA 1MRAA 4IP4A 1JZ4A 3DG6A 3VXGA 3NVDA 4XUGA 1TPH1 3IVUA 5A1AA 1Q6GA 1F6KA 4UBPC 4LCQA 4FALA 4AMAA 4FNUA 3LTPA 4HHLA 4WF7A 1M7PA 3RX3A 3AALA 1UWAA 2Y89A 1FWSA 4LNYA 1PS9A 3RK8A 1WKYA 3L4WA 3BLEA 3KOFA 4PODA 2WJEA 3LPFA 4QNWA 3DH7A 2Y2WA 1I60A 1QFEA 4H00A 2H3DA 4CNNA 3NDZA 1D8CA 1V77A 2CIPA 2P10A 5IDIA 3URQA 3WNMA 1JEZA 2WANA 2E9BA 3PPGA 1AQ0A 1UW9A 5C2CA 1A5CA 2AKZA 2B7NA 3OQ8A 1V6XA 1XBXA 3TTOA 3QQ0A 4JHZA 3EXSA 3WQPA 3T0DA 1JGMA 1WDQA 9CGTA 3ABZA 4DAFA 3KS5A 4WJEA 4HPXA 5LGZA 2FLIA 3PG8A 3W27A 1CB7B 2YL8A 1A53A 1OD0A 9XIMA 5D02A 4P8UA 4D6HA 4HJFA 1E0XA 1KM0A 1RJQA 3LBOA 4W86A 3JS3A 2ZDRA 1RLDA 2NQ9A 2PDUA 2XGIA 5EU9A 4MVAA 3TSDA 1QNRA 4IQJA 1TPUA 4AFYA 3FGCB 2AL2A 2ZDSA 5GNZA 1EF2A 3AHYA 4I6KA 3IGXA 2FPYA 1Q4WA 3GC2A 4MY1A 1VCGA 1V03A 2W92A 4B5UA 5I07A 1GGOA 3AIEA 2E5DA 5CGQA 1UD6A 1A47A 5LXEA 4B3LA 2LLEA 3SIZA 2HV5A 3BAKA 3BH4A 4J3ZA 1AQFA 2ZUNA 3NL5A 4GPNA 2FTWA 1H1ZA 5D09A 4CCZA 3GG7A 1Q6FA 2FVLA 2OYKA 2OMAA 4GC4A 1FHLA 3A9IA 1P48A 3UYCA 3AZSA 3QQ1A 5FJUA 5A8MA 1U1JA 2OJPA 1GYNA 3QSTA 1FWEC 4Q7IA 4DWSC 3RCMA 1Y7VA 1PKMA 1VAHA 3L2IA 4Q4SA 2X09A 2E3ZA 4O0QA 1ENUA 3DIPA 1AQHA 5BU9A 4ATDA 3GZ3A 1ESWA 4O52A 5AVNA 3RU6A 4BQ4A 3CL7A 5B80A 3WLTA 1DQWA 1TUFA 2OO6A 4K1GA 1RJPA 3L2LA 4AISA 1EQCA 2EQDA 3C8NA 1G69A 3ABSA 2V2HA 4U5KA 1E55A 3FV9A 2AQOA 5CC3A 2ZZ7A 3NQ6A 4Z2KA 2V5LA 1XUZA 3BG9A 4CCCA 3PK7A 3W74A 3Q37A 3S4TA 4ZL1A 3IACA 3K13A 3VX1A 4BQ2A 4PUNA 1JDDA 1B3OA 4S3EA 2DZVA 3GKAA 2ZXQA 4IPIA 3AYTA 3ARTA 1ML1A 3GW3A 2PTWA 1CCWB 3QKEA 3O0KA 2ZC1A 3U57A 3W7DA 2OKOA 4JIHA 4QCEA 4XAPA 3VINA 4GYPA 3M16A 1X1ZA 4OBTA 2G4JA 3NIYA 4HPHA 1JPDX 1ELSA 4P8XA 4WCJA 2XVNA 2GGHA 1W17A 2XH4A 3MCMA 4Z1YA 4J2PA 5IBXA 3LHUA 4GD0A 4HTYA 4W85A 4M3PA 1WB0A 2JEPA 2C19A 1KRAC 4J3UA 4REQA 3OA3A 1WQ5A 4L6OA 3BMXA 4NZFA 2CLLA 4KCWA 1S3TC 2WO5A 3ZJ7A 3WBAA 3W7GA 4WGHA 4NNCA 4PMRA 2XFWA 4JCLA 4ZCWA 4V27A 4O13A 1EJRC 1V5XA 4Z0SA 1ZL1A 2C0AA 3AXHA 2BXZA 3EBVA 3ZVHB 2QQ6A 5FJRA 1B1YA 4FOJA 3MBFA 3EMCA 2G0WA 2CZDA 5KZ6A 3UJEA 2O9TA 4H9ZA 2DSKA 4A21A 4R7WA 3TLLA 1XSIA 4WSHA 3U6WA 2X8RA 1RCOB 1D9EA 5U4NA 3OHMB 4MZ1A 1YEYA 1X39A 1Z8AA 3CMGA 3E1F1 2C15A 4PSPA 3V36A 3LZ3A 1G4SA 3W87A 3ZJKA 3B0UX 4YWIA 2C0HA 4LNCA 2F2HA 1FWHC 4UFHA 3D0CA 3RLUA 1R3TA 5G2HA 2HNHA 3I6RA 2DZWA 4MLRA 3URBA 3MCOA 2EAWA 3RR4A 4JTKA 3UFYA 2PCQA 1XINA 2GJLA 2HISA 1OY0A 3PUEA 2A3AA 4F0MA 5LHFA 4H7CA 1M53A 2FGZA 3CLWA 2Y7GA 3KEHA 2E7FA 3D3FA 4MF4A 1F9CA 2D2JA 4IMEA 3C52A 4GUIA 4GQQA 2OCZA 1XH2A 2CKRA 4LUTA 3SY8A 1Q6OA 3WX7A 2VMFA 2BWGA 4AZHA 5KZDA 1TTJA 2P1FA 3WYZA 4YIWA 3TN5A 3QV9A 4UTTC 2DIKA 4PMDA 2PD9A 3YPIA 2CLHA 4G1KA 5D4YA 3U8GA 3CWNA 1CTNA 1AW1A 3B06A 4HVXA 1TB3A 1EGMA 1TV5A 5E6YA 4O57A 1RBOB 2ZRUA 1Z7AA 4GZ7A 4TQTA 4RDYA 3NXLA 3VGGA 3PHAA 1H1NA 2ZKMX 1NWRA 5C70A 2O7SA 3V0SA 5HMDA 3LMYA 2DSWA 5I00A 3P0WA 4GUJA 3GIQA 1KCZA 3REQB 3UW6A 1FCQA 4MLJA 4UZSA 1EJUC 4R33A 3QY8A 2NUWA 4W7UA 3QHMA 1CB2A 1OT2A 4MPKA 5AYYA 4JTGA 3E5PA 3GW0A 1DWHM 1TWZA 2OVLA 3PJTA 1MW2A 3C5QA 4O15A 3QY7A 1LLWA 4J28A 3GS6A 4DJFC 1X6UA 2Q8ZA 4DBUA 3O63A 3KOWA 3I10A 2IKGA 1KM3A 1KM6A 3QV8A 3LDVA 3OVPA 4JOMA 4K2SA 3OQEA 2VL4A 4HA4A 3RIKA 1JUKA 3M41A 2ICSA 2Q8XA 2WWDA 4Q8VA 3AISA 4MOZA 3QGVA 4HCDA 1RBAA 4Y8FA 5BWAA 3BICA 3ALFA 2QCHA 5H8MA 1W9DM 3V18A 1VHNA 3GVWA 3WCZA 3NNTA 1ISVA 3R8RA 2G3NA 4FLRA 4D8AA 1EGVA 3O6CA 5K3VA 4W89A 2QIIA 1GJWA 4KEVA 1R30A 1BGAA 4D9PA 5A69A 1VEOA 4DO4A 4W88A 2WNZA 4YU1A 2EKGA 3W4RA 2G37A 4DO6A 5KSWA 1E0VA 4ZQNA 3BLPX 1GORA 1ZJIA 4BA0A 4QJ1A 3AIBA 5XINA 1A5NC 1Q65A 1OSEA 3O7UA 3WEOA 2VR2A 3M43A 1E0WA 3EGJA 5CJNA 3VD7A 1CYGA 1H5VA 1KBLA 3CTLA 1TCMA 1N8WA 4WZHA 1DJGA 4DBEA 4TV6A 2PF0A 4D72A 2XINA 3EPMA 3ES7A 2PS2A 1E1CA 4JTCA 3W22A 1O6IA 2VDGA 5JIWA 4M5PA 1JPHA 3P5YA 2ZXBA 2HVNA 3V0UA 4ZXOA 3GFZA 1U5HA 2PDLA 2ZX8A 5CBBA 4OKDA 4WDTA 3W0KA 3TDFA 5KETA 1DQUA 2PWEA 3SFKA 2OZ0A 5K4ZA 1P6BA 3G5EA 1EFZA 1VFFA 1GW1A 2WM1A 1TPB1 1DIOA 1Y0EA 2CZ5A 4PUEA 3U2EA 3S5SA 3VIKA 2QVHA 5HQEA 2PDPA 4NIRA 3LERA 4JS3A 1XM3A 5F4SA 4OQVA 1FCBA 1JL8A 5FOOA 4GWEA 4C7FA 4P7QA 3VDHA 1YPIA 1P0DA 3DYPA 3N29A 1QTWA 1XRVA 4AHOA 4H1ZA 4KFOA 3G1XA 1TIMA 1DJIA 2XN0A 4MHBA 4HZ7A 1XBZA 3G3MA 1BLIA 2PTYA 3N12A 4N6EA 2RUSA 2ZE0A 4FNSA 4H83A 1Q7ZA 4RNFA 3SQSA 1JF5A 3GVVA 3R0DA 3WBEA 3NZ1A 4FNQA 2DT2A 4QSFA 4O14A 1YDVA 3LBCA 4G56A 3GG0A 3H7UA 4G1NA 2DH3A 3KVLA 4WRHA 3L0KA 4XG1A 3QMRA 4B16A 2Z24A 3T07A 1IEQA 1EDGA 4KBXA 2YKKA 1NTHA 4IXXA 3VKBA 5C2GA 1KBKA 4H4IA 4LGXA 3M47A 2FZBA 5DXYA 3ECQA 3WQFA 5CLTA 3E0FA 4B4FA 2YDRA 4HP5A 4HOZA 4HOXA 3ANVA 1R3YA 5I03A 3PANA 3M0VA 3VGFA 1JQXA 3F4WA 4XZBA 4IJRA 3P67A 1FDZA 1SO6A 5M1TA 4H7VA 2O9PA 4IIBA 3VIMA 2MUCA 3GC5A 3BOXA 1WDWA 3UZWA 1C91A 5CPQA 3ZSTA 4HYVA 4MB3A 1JCYA 1T6MA 5KITA 3PSVA 4DZHA 2DJXA 4UOQA 2YJQA 3JU2A 2GZXA 3P84A 1HJUA 4X2PA 3LLFA 3NG3A 5FF4A 2V0TA 2J7HA 4N2YA 1GYMA 1S2AA 3VOHA 3BOLA 2ZZ1A 4JX4A 4IPPA 2C71A 2FH6A 5I06A 4BFAA 4KWWA 4DX3A 3CUXA 4GKTA 2D0HA 1WOAA 3KUMA 4E8CA 3E9AA 1DWGM 4KWOA 5JMUA 1OZMA 3FVDA 4KEUA 3NQCA 2OGYA 2WHKA 2PBOA 5DFAA 1VH7A 1MSSA 1WZMA 2NV9A 4D8ZA 4EANA 3O2LA 1EO5A 1O12A 2AMXA 4FNTA 4BZYA 5HQMA 1L2QA 3Q4DA 1SGJA 3IJ9A 1L2UA 4EP8C 1WXJA 5AB3A 2Y24A 3DG3A 4M7TA 4HHPA 3TQKA 1E15A 2YA1A 5TIMA 1CDGA 1JF6A 1HP4A 1HUVA 4B5XA 5AC7A 3VKDA 1OD8A 2VC9A 1KRCC 1E1FA 3INPA 3EKLA 4TX6A 1MNZA 4P7OA 1ZSXA 5T26A 5JBEA 2YL9A 4ZFCA 4DVOA 2ZXAA 3R13A 2VR5A 3O07A 4I90A 3SW6A 2PI6A 1K9FA 3CIWA 3TVAA 4WVXA 1H62A 4EXQA 3I6EA 2QCGA 3THDA 1LOQA 2GDUA 3URNA 2PB1A 3RPMA 3AUJA 1OX4A 3AS0A 1LQ0A 3IEBA 5CPNA 3SCRA 1ECEA 2NZLA 1QHZA 1NOWA 4R7JA 1THFD 3LRKA 3TYEA 4HMDA 4XKYA 1KTNA 1J2WA 1GOIA 3PBVA 3M44A 1M7OA 2WMHA 5D2WA 3SCTA 2EPKX 5EMJA 3SCSA 3OLIA 2VCAA 3L9CA 1Y5WA 1SUXA 1H3GA 2CITA 3W6MA 3KBWA 1M7XA 2D20A 2VR4A 3GG1A 1H4PA 3W6LA 2NLIA 2B7OA 3EWCA 5I3KA 1NJJA 1H51A 2WSKA 4DN1A 3VIGA 3VDCA 3DHFA 2QAFA 3W73A 1L6FA 3UR2A 3LGDA 2BTMA 1P4CA 4H04A 2RDXA 5GJMA 1OEPA 2WXDM 2X41A 3KXQA 4PCSA 4OV4A 3LI0A 4CNSA 1K7FA 2DU2A 4CLMA 4IGHA 3R7MA 3TH6A 2QHAA 1K02A 4KKXA 3EB2A 4I9MA 2BHUA 3M0ZA 4WXYA 4DPQA 4Y8EA 4CD4A 1YBQB 1NDWA 1LRQA 1KKOA 1NDYA 1YNPA 3ICJA 1XI3A 3LSBA 5E09A 1FXPA 3NFUA 1LQAA 1SJCA 1DJQA 4I5UA 4Z2GA 1Q2RA 3GDRA 4DELA 4JYDA 4O10A 1CENA 1MDLA 3K30A 3TFCA 4LUSA 4HU3A 2QJJA 2EPNA 1E71M 4LTSA 4I5XA 2WJZA 1HN1A 3G0UA 1YPXA 2GWGA 1T8QA 1SJAA 3BAIA 4JYFA 2OB3A 4I9JA 1D2KA 1I4NA 2FQIA 4CUCA 4N0RA 2QJMA 4MWAD 4YHEA 3G8EA 1DV7A 4PC8A 1TFVA 2GK1B 1EZ2A 5I0DA 1JG9A 2EG8A 1XIMA 4MTVA 1SO4A 5A2BA 5HMFA 4O8RA 1P0EA 3UXIA 1SZFA 1F3EA 5FJPA 5LGXA 2NXIA 3U2OA 3VILA 3GX9A 3M7WA 5LNVA 4O16A 3VMNA 5U7SA 1OX5A 1LOSA 1VZWA 5HOSA 3PBMA 1NWUA 1BF2A 3NQVA 4S3CA 3VCNA 2C3ZA 1JZ3A 2J13A 1ZP3A 2GQ8A 3O06A 2CLMA 2OT1A 4IUGA 4UTFA 1R0MA 2BOFX 3BK0A 1XIBA 1LWJA 4OT7A 4HA0A 3BV7A 4PULA 2HBXA 1Z89A 3PUDA 3MYPA 3LCFA 1FWTA 1RCQA 5E6ZA 1K8YA 4NU7A 1BXBA 1PTDA 4FLOA 1L6YA 4FX8A 4XVEA 5AYXA 3R5EA 4PMXA 3M0MA 5JH2A 2WLYA 1SFJA 1GTEA 4FMVA 4B90A 4WXZA 3K46A 1TV8A 4WGXA 1A5UA 4KT2A 2YFNA 2UY5A 3W83A 1QI3A 1ZCCA 1C8VA 4H8HA 1KQYA 3CHVA 3EMZA 2OEJA 3LOTA 1F73A 5G1TA 1UBPC 4UFIA 3A22A 2B7PA 4OJYA 3L23A 3H2EA 4GH3A 3AJ7A 3MHUA 4O1CA 3WBWA 2OODA 3F2CA 1MDRA 4QP0A 1PSCA 3EKZA 3UZJA 2ACRA 3S47A 3MTWA 3B04A 3LEPA 2CERA 4HCHA 2CC0A 3DDMA 1W9UA 3ZVIA 1WXYA 3MP5A 4NRSA 3MPGA 1TKKA 4GRSA 2OLSA 1BKSA 3LPPA 3GH7A 3U3HA 1SW3A 2BNJA 3IRDA 4QIUA 4N9BA 4Z1CA 1YNYA 3N14A 3F2DA 3CC1A 1JXKA 3P82A 4NRRA 3VM5A 4QEEA 5FKYA 1AW2A 4MAZA 2DFAA 1R7AA 2Y63A 3CTTA 1RD5A 3CUJA 4F2UA 2YW4A 1D3GA 1JRCA 3C2OA 2VZTA 1VFTA 2E6DA 1XLKA 4CNOA 3MP3A 3AWOA 4XQ6A 6TAAA 1HJWA 3VGEA 1XF0A 3WDQA 4HNLA 5FF7A 1JXJA 3ERPA 4ZQPA 5ABTA 2QCFA 4W93A 3STGA 3B9NA 3K4WA 2HPIA 5F2MA 2XJ7A 4HGXA 1M1BA 2QEZA 4QBXA 2MANA 2PBGA 4WY0A 4QSHA 4AYSA 1JFHA 1C8YA 1UR0A 2YB4A 5C71A 2HVMA 3PZQA 2Y1HA 3ENLA 1YKWA 3LHVA 4AZCB 3RLHA 1PDZA 3U4FA 2YCEA 1DL3A 4GYFA 2B7QA 3BDKA 2D2OA 3SZ8A 4ZXLA 3EOSA 3PZVA 3R1ZA 1M41A 4MJMA 2ZQ0A 1FVPA 1QWKA 3JW7A 1VRDA 1W32A 5HAOA 3P8JA 2V67A 5EMYA 1PZ1A 1LOLA 5L9FA 3LY0A 3HFTA 2FDMA 3UR5A 3QBUA 9XIAA 1I2QA 4NX0A 1XFBA 5EPDA 4S3AA 1P6CA 1HKWA 2QUUA 2IMRA 3AIWA 4EIVA 1IXNA 4R27A 2IKHA 1XLFA 1R2TA 3M1ZA 3CO4A 1PIFA 3UBPC 4IPNB 1D8WA 3K8KA 1ZAJA 1LP6A 3AIQA 4HTBA 1E6XM 1NARA 1EUNA 3VNLA 4MB5A 4DF0A 4C90A 3RCYA 1FFRA 1KXHA 3KCOA 2CXEA 1XRSA 1ME7A 1J10A 3VKKA 1UWIA 4BEQA 4WR3A 3UY8A 3N18A 4JDYA 1NAL1 3MI6A 3AXMA 2J8GA 1H7XA 2G8ZA 3CUFA 3QY6A 4N42A 4ACZA 4QHRA 4LCRA 4PB3A 3CAQA 2PWDA 3B8WA 1K6WA 3TTSA 4MUZA 4WDWA 4B4HA 5AHEA 2FZDA 3CZKA 2O4MA 2B31A 2OTDA 4HA3A 3UJSA 3HFYA 3RO6A 1K77A 3ANUA 5EFFA 4BHYA 4XISA 3TAOA 5CZKA 3GZAA 2BXYA 1V0KA 3PVFA 2PP3A 1FXQA 3MSGA 1PTAA 3N4FA 1A3HA 1KM5A 3H12A 4JYEA 1SR0A 3WNOA 1IQ8A 1A5AA 4F2TA 4LAUA 3HG3A 5REQB 3ARQA 4A8RA 3FYYA 4W8BA 3MZNA 3KCJA 4U2YA 3VIFA 4ZB0A 2BOGX 4KWVA 3QZ6A 4H9UA 3MSYA 1OX6A 4PTWA 3VUSA 2RDUA 2C14A 4MWAE 4W87A 1RY8A 3PB0A 3G1SA 1U1UA 1BYAA 3SEPA 2BV9A 4OOUA 3L5LA 4Z2HA 3FA3A 1UR9A 4GFIA 3R12A 1TZ7A 1CGWA 1J0KA 1JRBA 3GHSA 2XSBA 1W2PA 4S23A 4XBKA 4JQ1A 5CC6A 3BAXA 1EF3A 3W85A 4A2RA 2FVMA 1EYWA 3HPXA 1O7AA 3WFAA 4S1FA 5AOUA 3PNUA 3RLGA 2PU0A 1F8IA 4RNHA 5E0FA 4HU8A 2B81A 2X0YA 1I2RA 3EXRA 4JFUA 3VVGA 3A4XA 2VWSA 1FHVA 4WJ8A 3GDTA 3R0UA 1DTNA 1ODZA 2XFRA 1KB3A 3EA1A 1O5RA 2ZRXA 4YL2A 1EDQA 3KP1A 3ABQA 1OYBA 5L6UA 3TIMA 4N02A 3ZFHA 1EGZA 2QMKA 3BE7A 4QAIA 4GMEA 2QCCA 1OFRA 2L5HA 1GVEA 3VNJA 3WUEA 1K9TA 2PD5A 4GLEA 1HJVA 1Z48A 3GQYA 4ZR8A 1KWKA 4D6IA 3UGRA 1R2SA 4RPQA 4QRNA 4CU8A 1E6QM 1XUUA 1PX4A 4XTDA 2PDBA 1RLCL 1TYGA 1RCXB 3W88A 4OE7A 4AD3A 2TAAA 4G7EA 1HL2A 2HJPA 3N11A 1TO3A 2YA2A 3JR2A 1QJWA 1GOXA 3KRUA 2F2KA 3GIPA 3VIIA 3IUIA 4O1AA 3L66A 1W5NA 4DUOA 1TA3A 2BGQA 1YXYA 2RH9A 4HSOA 2OOGA 4IISA 3KL5A 2DZUA 2Q3RA 1UQYA 3GXPA 3OVQA 2QIWA 3DGBA 4M19A 1XPYA 4I5RA 4KPLA 1QI2A 3WK1A 2I57A 4L1XA 3W7RA 4B92A 1YE6A 1PDYA 3LA4A 2EG6A 4EAYA 3KTCA 2Z1KA 1S2WA 1AA1B 1GYLA 4IFKB 3VNMA 3IRSA 4ERGA 1AH3A 1I2NA 2UV8G 2PLCA 1ICSA 3AJXA 4A4AA 2TPSA 3VKCA 3OYXA 3CL8A 4EX4A 3ZIZA 3BC9A 3PBGA 2I5QA 1V7AA 2I5GA 4PUWA 4ACYA 1CXFA 1GCYA 1VP5A 3GR4A 1YMYA 4A29A 5HUPA 3ZT6A 4B5VA 3IIPA 2EPOA 4PGLA 1BD0A 5CGTA 4D2JA 2W66A 4J40A 1TRIA 3NAVA 5T9CE 3LG3A 3VKAA 4MPQA 1UOZA 2NXGA 1XSJA 1O5QA 3WN6A 1EXBA 2X40A 1IWAA 3CHCA 4Z17A 3N2OA 4FF5A 4L65A 2WK2A 1SYTA 4IGSA 1W1A1 4KWSA 4Y90A 3NQ7A 1AL7A 1A0EA 4IX0A 3AIUA 4U33A 2AGTA 4C6JA 2JE8A 2PMQA 1EL3A 2YBTA 3WMCA 3PB2A 4HNTA 2A85A 3H22A 3RPDA 1OWQA 3VTRA 3ZLHA 4DF2A 1CBGA 1N55A 3WDRA 2WNQA 1Q63A 1VJSA 1GVOA 2V68A 2OQLA 3ARYA 3AHZA 1JAKA 4K8HA 4E3VA 2GGJA 1FWAC 3PTDA 2YIHA 2R9RA 4HNCA 4FIRA 1C92A 3M0IA 2J7BA 4HK5A 4WDXA 3WLKX 4J3WA 4CD6A 3VFLA 4JXCA 2QDGA 2ESCA 1XH1A 1HNYA 5I79A 2VEPA 1WBJA 1OT1A 1E5JA 2NQZA 3C3NA 2XM1A 1RA5A 5K9CA 1TJRA 3VE9A 1W9BM 4K1WA 4YJ5A 5EMKA 3E02A 1XC4A 4L4OA 4PRWA 5C9XA 3MHGA 1JYWA 4ZO6A 3FDKA 3TN6A 1RXOB 4S38A 3GKFA 4LY4A 3VCRA 2XGBA 2V63A 4KRTA 3EZ4A 5I3JA 4FI4A 2F6KA 4RCXA 4ORIA 1DWAM 5DY2A 1A3XA 3WLQA 1OIMA 2C6QA 1XL9A 1XLAA 3MMUA 3WQ6A 1GZJA 2E1DA 7REQA 3UXDA 3BLFA 2BHZA 1T0OA 3EA2A 4EPKA 5AKQA 5I23A 4K37A 3ITXA 3AHTA 3T8LA 1FHDA 2AQWA 3R4IA 1JI1A 3RGTA 2VRQA 2Y4SA 1A80A 1QWGA 3N34A 3PJWA 4P5UA 1MXDA 5D8ZA 4ADSA 5C5YA 6ENLA 4KF1A 1JYVA 2YXGA 3V75A 1FP8A 1JPMA 2VFHA 1K1DA 4S3DA 4YMZA 1GOKA 3ITTA 2CLKA 1YPFA 5FSEC 3QLDA 3F2BA 2PWVA 1XQLA 1PV8A 4BWLC 4C6BA 4BCEA 2OKTA 3BARA 3K8LA 5CZ0A 3IANA 4LV4A 3CZJA 1BG9A 2D69A 2C1HA 4X0VA 4HNOA 1E6PA 3GAYA 1ZNNA 5BXPA 4DI8A 4BJHA 5I6SA 4RNJA 3NDOA 2ZTJA 3MV11 1UR4A 2CKSA 1D7FA 2WKGA 2Y7FA 4C6NA 1JYNA 5AHLA 3FEQA 3CGTA 4ZE4A 3BTNA 2PZNA 1S38A 5J5RA 1JQVA 2HK1A 4CNUA 3S1GA 5TD4A 3GUGA 3MMWA 1P0BA 3PY2A 2V3EA 2DZBA 2XSAA 5HWJA 3LCGA 2ZX5A 4EAMA 1UPMB 4RKAA 3OOQA 1YQ2A 3WK0A 4MDOA 4U3AA 1QUMA 2BGSA 2G50A 1CXKA 3W6YA 1M65A 5GJPA 4QG8A 3NQ8A 1O1HA 2FHCA 1JUBA 4LUIA 3TJXA 1B3YA 1NOFA 1HXJA 1GJUA 3WDJA 2REQA 4J4KA 1XIDA 4U28A 1QU4A 4Q8TA 1LUCA 3TP4A 3N19B 4O4WA 4U31A 3N4AA 3D5HA 4XD5A 5HUOA 1P1MA 1EPVA 5HNUA 4LEQA 2DUZA 3EPNA 3VIOA 3VAVA 1JCLA 3ZM8A 3VPLA 5HWNA 3GHTA 4DZIA 4IJCA 5K7JA 2HVOA 3MUY1 4NJHA 2ACQA 2ZUMA 3CHDA 1GONA 4IIDA 3N13A 4IMDA 3O6YX 3T2OA 1J11A 4XV0A 2EKCA 2DW7A 2FYMA 3MQTA 3O8AA 5GNYA 3RMJA 4UTWC 2YBVA 1X1NA 3KBSA 4ROPA 5AC5A 4M51A 3LPOA 4IX2A 4UFKA 2YBUA 4HK6A 1EKOA 3L0NA 2VC6A 1IEVA 5CG7A 4IMGA 4O19A 2PDXA 4N9DA 2POZA 2Z28A 4DHGA 1UC5A 4QROA 3LYEA 4IMCA 3TKFA 4F3HA 1Z9AA 3WQ8A 4JTSA 3WLHA 4B91A 3UG4A 4CNTA 1SFLA 2WYSA 2PWGA 2UY2A 3CQ0A 3ZJ8A 1YW1A 5IHSA 2ZE3A 1RVKA 2Z1BA 2ZRWA 4IP5A 5I5RA 3SUVA 4JX5A 3GNOA 4QG9A 3HGSA 3W7QA 2ODOA 5D30A 3ZR5A 3T42A 1KR1A 7TAAA 3FDGA 3QZAA 2V6AA 1RPKA 3AMDA 1HGYA 3M6DA 4KEZA 4JL1A 4E4UA 4DY1A 1F74A 1M6JA 1J0ZA 4LH8A 5HPOA 2PUZA 3UWQA 3ITCA 1AZ1A 1PKNA 4AY8A 5A8QA 2NX9A 1LF1A 4U2ZA 1TV7A 1E3XA 3GXNA 1S5TA 3FNDA 5BOEA 1MQRA 4AC7C 2EXOA 3LHTA 3RX2A 4CGTA 4S3FA 3SUUA 1XLGA 1TPWA 2H8ZA 3P5ZA 4AZGA 4ZEPA 3BWWA 1TV4A 3FYPA 1FHUA 1TZ9A 2PTXA 3USZA 1K7EA 2GJPA 2HS6A 3E0IA 4CQ9A 5EBAA 3CIXA 2X2GA 1W56A 5D9PA 2VGBA 2GOKA 1NQKA 3EB4A 3BLOA 4AD4A 1UASA 1BAGA 3U2ZA 4QQUA 4L9ZA 4Q7BA 4US6A 3ARPA 2HXTA 3KZPA 3VNDA 1GUVA 3DFHA 4OU1A 1OC6A 4BY3A 4GGHA 3A5VA 4AAJA 4CCDA 1RALA 3UR8A 1QPOA 1HJQA 5EB8A 3O1NA 1QR7A 2NVAA 1UMYA 4O1BA 1OHLA 1IGSA 3I3DA 5A6KA 1VC4A 1JJKA 4GUHA 1EX1A 4AWSA 4A8IA 5DMLA 1UOKA 4PFHA 5AC6A 4LOCA 3WLIA 3UT0A 2I56A 1BRLA 3VUPA 1GVFA 1PZ0A 5LXXA 3EX3A 2ZCGA 2A3EA 1K8ZA 1KC7A 4RV3A 5CZTA 3G1AA 1AJ0A 2CPUA 3QW3A 1RP8A 4ZB5A 1KBJA 1EIBA 1NFGA 1W0MA 5G4WA 1C3FA 4GHRA 4MWAB 4K7VA 4ADTA 6REQB 4DJFA 4RZ4A 4LJ3A 4K39A 3COTA 1RQEA 1JR1A 2VGGA 2VZVA 1VBJA 3HQPA 2CCRA 1TR9A 4IMAA 1HKJA 3DGRA 1Q7MA 4O0KA 3KS6A 3BVJA 1KBBA 3LB0A 3WD3A 4A2SA 2FZ8A 5F2IA 1OC5A 3W1QA 3PAJA 4GCAA 2WNWA 3A47A 2FZNA 4AY1A 3LZ5A 2EPLX 4GX9A 3AIVA 1LG1A 3SCWA 1RHCA 3W7LA 1FWBC 3CB8A 3I68A 4NSBA 5CG0A 4AIOA 3DAQA 3T81A 4JTUA 1SZGA 3UG3A 3RNDA 1A5LC 4QLLA 2Z25A 3CUZA 1FDYA 4W4QA 1RVGA 3LX9A 4JPGA 1NH6A 1XLBA 4K68A 3VD3A 3B9AA 1V6TA 1E56A 3W81A 3C2RA 4GH1A 2XN2A 1TMLA 3N2MA 2QVNA 3IWPA 3H2AA 1IXPA 3VYLA 1ZJAA 4JICA 4C60A 4O17A 3T55A 1R6WA 2QR6A 2XDFA 1E72M 5DMNA 1R3VA 2DZXA 2PDYA 1FA2A 4L9XA 5D32A 1V0NA 3T8QA 3VC6A 1EEPA 2ZWYA 1AH4A 4D6JA 1L6GA 2INEA 3PNZA 4V15A 2DGAA 2XWEA 3FHQA 4AW7A 2XUCA 5REQA 1SVDA 2FZMA 1PWMA 1KFWA 2BG5A 3NEVA 2UZ9A 2OR2A 4JD4A 4MJZA 5F7UA 4EK7A 3WD1A 4ADUA 2VENA 4C65A 2Y88A 4ONVA 5HR7A 1EJTC 5GNXA 2W79A 4DJFD 3OZYA 1MW1A 2D0FA 5G2IA 3PZGA 3TXZA 5CC7A 4XTIA 4YCPA 3M0YA 1S5NA 5F4XA 3KOYA 4H9MA 1BSLA 1EEXA 4KQNA 4K36A 4M82A 1XYCA 2VD9A 2XIJA 5A6JA 4LPCA 3W53A 3BJSA 3KDOA 4E8DA 1RAKA 4C6IA 3S0CA 3GYEA 6XIAA 1BPLB 4FXFA 1MO0A 2DDXA 3BV4A 3IARA 4EWJA 4U5IA 1EO7A 2CBIA 4AEEA 4WSJA 1DOSA 1XJBA 3VOGA 3WL0A 3UWZA 3B8IA 3S1VA 1SFTA 1O5KA 2AL2B 5FEXA 3F1QA 1DEDA 5D33A 3EDEA 3CYJA 1DBTA 2XVGA 5HNNA 7ENLA 1K03A 4KCVA 4C7DA 3DHDA 3TYAA 1ECQA 1UZ4A 1XRFA 4Z2LA 3RUBL 1HL9A 3C0JA 1L8PA 4KS0A 3GB6A 1JCMP 3UU0A 1G1YA 1VRXA 5HR6A 1GKPA 4XWUA 1RV8A 1TREA 3TW7A 4YYFA 5DMYA 3VIJA 4DUXA 3WF4A 2Y85A 3VDBA 1QPQA 3R79A 5FAJA 2OPJA 2EBNA 3MA8A 3QYSA 1PE1A 5M17A 1OM0A 2HTMA 3SUTA 3L4TA 4E3TA 3TTEA 4OGZA 2QUNA 2PURA 3TMLA 2YGYA 2QDHA 1CXEA 2WZEA 4L80A 5ABGA 5IXEA 2RDTA 4MSSA 1S46A 1F2JA 2VX4A 1HJSA 3KZSA 1BQCA 3B9OA 1WZLA 3OBEA 4GVFA 5H8UA 4Q4OA 1R9ZA 5IDZA 4H01A 1BYDA 1UIPA 3VDAA 1FBAA 3EB3A 3N6HA 2V38A 4QDWA 1JPKA 3LV6A 2INZA 1S5WA 5E5CA 1C90A 3EWZA 4UTLA 1TCDA 3MDWA 8A3HA 3GDKA 3HURA 4XBSA 4Z08A 4UCGA 4YTTA 2OT0A 2YCLB 3QW4B 2NT0A 2AKMA 3ZXWA 1V79A 4MGGA 5DY3A 2B4GA 3EWYA 2QYGA 1WYIA 1BTMA 3ARRA 1OC7A 3W7KA 2V3FA 4QFUA 2OZ8A 3TN3A 2XWDA 5LA1A 1BG4A 2GQAA 2WZMA 3VO0A 3QGKC 2BODX 4M0XA 5FIPA 2ISSA 3IGHX 2A5HA 3T7VA 3MSRA 5B7YA 3CH0A 4LQ1A 4PTMA 2WHLA 2E5BA 1MVYA 5DO8A 4UR8A 3SUWA 1LM1A 3IAQA 4W7VA 3VGDA 4M6UA 3M5VA 1SO3A 4RE3A 4XIAA 4GABA 1X98A 1FY6A 2Z6IA 1J12A 3LHZA 4XAGA 3BG5A 5J8LA 3URAA 1QATA 2C16A 3W7CA 4LS1A 3NO1A 3BW2A 2WZHA 1XYZA 1Q6LA 3A23A 2QV5A 4XD3A 3E2RA 3NYZA 2R1KA 1QI4A 4UTUA 3RCNA 4ACZB 3HO8A 1MXGA 4J1OA 4CU7A 3SB0A 3P62A 1B90A 4H6RA 3E0WA 1E4IA 4UB9A 3F5LA 1XIHA 2J47A 5H8PA 1TIWA 1OGBA 2YDSA 3KRBA 2E1WA 4JKKA 1BXNA 1YIXA 1OFEA 1VEPA 5GVJA 1JGIA 4JTLA 1WBHA 3HQNA 5AYIA 4ZQMA 4F9DA 3SRKA 4ERIA 1IV8A 4CD8A 4I7UA 4X9SA 2A7PA 2FHBA 3A9BA 2VFFA 2Y61A 3TYBA 1JDEA 1CI1A 5I02A 1JZ7A 3AYRA 1K70A 5AHNA 2PU1A 1RJRA 2EPHA 1EJ7L 1DORA 2GSJA 3TV8A 3WLJA 4J2MA 4HIBA 1VIWA 4AX7A 3EA3A 4IFRA 3TE9A 3U7VA 3FCPA 2V69A 5LA2A 3B8UA 3CV6A 5LHEA 2PDHA 3KAOA 3NM1A 4XO7A 4CD5A 1WXZA 3D3AA 3F4NA 7REQB 4DEFA 1GQKA 4GYKA 1BWKA 3MMDA 3D47A 3B0VC 1TWDA 2W63A 2XTKA 3M9YA 2W9MA 3KLLA 1DIDA 4QX4A 4FX7A 4E2DA 1M68A 3C2FA 4RXGA 1KKRA 2VEIA 1BSIA 3N04A 4IIGA 2W27A 4MADA 2J24A 3S9IA 3WJYA 3QRHA 1VLWA 2WCAA 2PDMA 2VI0A 3AYVA 1R85A 3S83A 1ZU8A 4Q4KA 3TR2A 2XN1A 2GJRA 2WMFA 1J6OA 4CQAA 3QPEA 3CWOX 3RFAA 1XX1A 3V0TA 3TFXA 3PWAA 3RU8X 3WF1A 1PJ9A 1QNPA 3FOKA 1MUWA 3UR7A 3W28A 3GXTA 4CNPA 3OZOA 3P7YA 3W2UA 4DYEA 5KMYA 2G95A 3WF2A 4ZFMA 1IE7C 4TV5A 3IJ8A 3MT1A 3QN3A 2YZ5A 5JBDA 3PAOA 3W7IA 1FFQA 5H6HA 1VR6A 3ZMRA 2NLYA 3L21A 3SCOA 3CZEA 3CT7A 2DV0A 5T8GA 4KCUA 5CKSA 3AWNA 3O3RA 4FLQA 1U5JA 4AD1A 4QQ3A 2Z2UA 4EF8A 2CLEA 2VOTA 3VMPA 1AUSL 1E0UA 3NQEA 4LFYA 3VNYA 4WUIA 3BURA 5C8BB 1N7KA 4RNIA 5EBUA 3HGRA 3UYIA 4YTRA 3W7EA 3CHEA 3SM0A 4LB3A 5FEZA 3SADA 5HANA 2C18A 4JN8A 4GINA 3CV7A 5D2XA 1O66A 2D23A 2HMCA 1AMYA 3WZ0E 2D0GA 4MNMA 2Q71A 4A8LA 3G2GA 2NQ5A 2X1SA 3CPUA 4HA1A 4NAFB 3W72A 2MNRA 5FACA 4M6VA 1MW3A 3RM9A 4GIRA 3N6JA 3IUDA 2ONEA 3K1GA 2V5KA 2WW5A 4AU0A 4JTQA 2R8WA 1VPQA 3PZIA 1C29A 1EJSC 4NYYA 4UQAA 5CSUA 2AQVA 1HKIA 1YXCA 3PZUA 5DCBA 1TZZA 3PSWA 2X1RA 3EWUA 3OP2A 1W5OA 4DZAA 4XSMA 5FSDC 4AY7A 3E3HA 1BYBA 2FFIA 4DBWA 2BASA 3S5ZA 2V5BA 3WMSA 2GVJA 3R25A 4C6QA 4B9ZA 4C1LA 1UKQA 1IEWA 5BRQA 3UWWA 3PWIA 4MKVA 1F6YA 3LN3A 2PP1A 3BMWA 3TYCA 4PBFA 1DWIM 1E6NA 2OZ3A 2NQJA 3MV01 2Z00A 1QPRA 1QNSA 1BWVA 1EC9A 1XIIA 1CT5A 1S1RA 1OK6A 3CB3A 2Y5EA 3ORWA 4GNJA 5A8OA 3EOEA 3VFCA 5LZLA 4LBRA 2J77A 3LMZA 3GHRA 4FA3A 2OWCA 1H7OA 1EC8A 5CJMA 3H2NA 4PCPA 3LRLA 4ZGYA 3F7JA 1UR2A 5BMWA 3RG6A 4FK9A 1FWWA 4QE1A 1IEIA 3WLMA 1ME9A 5CPSA 4DUVA 3JVAA 2QCLA 1CPUA 1UP0A 3C61A 4LVFA 4XAFA 3ZQ9A 1QT1A 3ISIX 1CIUA 2ZA1A 1B4EA 2OSYA 3CBWA 3UWVA 3MVIA 1SW7A 2HPMA 2C79A 1ISZA 1MFVA 4H9VA 1OYAA 3N2XA 4YTQA 3PF3A 4LT9A 2EJAA 3QZEA 1QHPA 5I24A 3DC0A 2QPSA 3LENA 2NQHA 3CMFA 5EYWA 2TYSA 2ZVIA 3MU7A 1RR2A 3WL1A 5K2ZA 3R6IA 1MFUA 2QDEA 3OBAA 4DLFA 3HB9A 1OCNA 4P7RA 1G7VA 1QNVA 1J5SA 3PPHA 1E73M 2PRLA 4BF9A 4IICA 2IKIA 3C3UA 2ZA2A 1H7NA 1JZ2A 3DZ1A 2NV2A 2ZXDA 1W1TA 3I6TA 4JIEA 4PE8A 1NVMA 1R2RA 4TX9A 3GTHA 3PPFA 3NO5A 4HPNA 4KERA 4Q4RA 1TQXA 3WLNA 1CXIA 1UH3A 5JU6A 2TRSA 2J78A 3DYOA 4ZO8A 5DF0A 1M5WA 1Y5VA 2V8ZA 4A3QA 2A21A 3WNKA 2YB1A 3SN4A 2R1LA 2XHYA 4MM1A 3TROA 3PUGA 2A1YA 3WG6A 1QW9A 2DIJA 4IZGA 2Z4GA 5BRPA 1ZS2A 4LCSA 5IRPA 2ANUA 3AHXA 4PUJA 4S2BA 5C9RA 4NILA 4DO7A 3MDUA 3W7HA 1MEWA 2E5CA 4RW3A