4YN5A

Catalytic domain of bacillus sp. jamb-750 gh26 endo-beta-1,4-mannanase
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
391
structure length
391
Chain Sequence
IPKDSEGQSFKLVDSNASTLTKSLYAYLQDTSGRQILFGHQHAVDEGLTLTNSGDRVGSTQSEVKNAVGDYPAIFGWDTLSLDGYEKPGNEKNSQAQNRANVVQSMRTVHELGGIIALSMHPENFVTGNQYNDTSGDVVKNILPDGSHHEVFNAWLDNIAAFAHELTDQSTGELIPVIFRPFHEQNGGWFWWGAQTTTASEYKALYRYTVDYLRDVKGVNNFLYAFSPNAPFDGNLTQYLRTYPGDQYVDIFGLDQYDNKANAGQATFLNGLTQDLAMISKLADEKGKIAAFTEYGYSPQGFNETGNYLQWYTAVLEAIKKDPNASRIAYMQTWANFGYPTNMFVPYRDVNGNLGGDHELLPNFVEFYEDDYAAFLTEASGWNLYQDISTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus sp. JAMB-750 GH26 Endo-beta-1,4-mannanase
rcsb
source organism Bacillus sp. jamb750
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase
total genus 146
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4yn5A00
4UFKA 5BXPA 1OSEA 5F7UA 3CTTA 2EPLX 3IJ7A 3OGVA 3SCOA 2D20A 3PHAA 4WJXA 1XSIA 4P7QA 1IV8A 4N42A 3LMYA 2IXVA 1ODZA 4D6FA 3GBEA 1XH0A 3CBWA 5HNNA 1HKKA 4WKHA 4Z2JA 2WXDM 2E8YA 3L2LA 2E3ZA 1ESWA 2GJPA 2Z1SA 1RD6A 1SR0A 5GNYA 1LG1A 2X0HA 1NWRA 1CGVA 4H41A 4Y7EA 5ECUA 4FLSA 3RM4A 1BF2A 3GXMA 3WH6A 4LYQA 5IHRA 4PMRA 5FD0A 3M46A 1I1XA 2J4GA 1W9UA 1VFUA 4P8VA 2BV9A 2VR4A 2VQTA 4W5ZA 5D8ZA 2BY2A 1BHGA 1KXVA 2W67A 4URIA 1AQHA 1FA2A 2W4XA 4OOZA 3T09A 5E9AA 1WZAA 5EMYA 1JZ5A 1K9DA 4MJ2A 2B31A 2FH8A 2GVYA 3LPOA 3DECA 1RPKA 1GQIA 2Y8VA 1VEOA 1V6VA 1UH2A 1PZ2A 4GI8A 3SCQA 1CXHA 3VGBA 3VIJA 3AOFA 4JKKA 4BF7A 1SYTA 1AVAA 3BMVA 3OG2A 4UFJA 3ZSTA 1OB0A 1XGZA 4R27A 1KBKA 3I3EA 2Y8KA 5EFFA 1GJUA 3AQUA 4JFTA 1VAHA 4Q7NA 5E0FA 3ZIZA 3W38A 3FHAA 1TG7A 3AS3A 3WEOA 4H04A 5TD4A 1CGUA 3VGDA 1JYVA 1CGWA 1WDSA 3KL3A 3O9NA 2PI6A 2EO7A 5C8BB 1O6IA 2QPSA 3B9DA 1L8NA 2CESA 5A69A 2W5FA 5EBAA 1E6XM 3SUVA 4W7VA 4DM2A 3UG5A 1HVXA 2QV4A 1C7TA 4V2XA 3W4RA 1B3VA 1QI3A 4CU6A 4HOWA 1JZ2A 2WBKA 1PIGA 1R8LA 3TTOA 3AXIA 4PMVA 4KGJA 4F79A 1QI4A 4U2ZA 2QMKA 2ZWYA 4IUGA 2C0HA 3DYMA 3VM5A 3EDFA 3SUSA 4UQAA 1WZMA 1NWSA 3VVGA 3BAWA 1VF8A 2EBNA 1DEDA 3O2LA 3VM7A 1YHTA 1TCMA 3WH7A 5E09A 1GNXA 2UY3A 3IK2A 4U5IA 2V3EA 5CSUA 1GORA 1UA3A 2D23A 1CXKA 8A3HA 1DWHM 1VEMA 5D9PA 2BHYA 1AMYA 3VD5A 1E6ZA 3W82A 1OIFA 5LA1A 4C7DA 1TFVA 1HJUA 1S46A 3VTRA 3VU2A 1GHRA 1BYDA 1CLXA 1JDDA 3WY1A 1NWTA 1W91A 1E6QM 5A95A 1GOQA 1V3KA 5A94A 3VDHA 2YJQA 4HP5A 3GDBA 2J7HA 1KGUA 1R87A 4IPNB 1B1YA 3A4WA 1ITXA 4OOUA 1W9BM 5FCZA 4JFUA 2XG9A 1QBBA 1WNOA 4AZCA 4JCLA 2VZVA 3WQ8A 1QVBA 4QLJA 2D1ZA 2UY5A 3PZMA 4GI9A 1N82A 4UQDA 3AI0A 4D6EA 4CD8A 3ARTA 3WNPA 1B9ZA 1E43A 2DDXA 4M56A 2GJXA 5CPQA 4H8UA 1B0IA 3CZ8A 4NZCA 3WUBA 4F66A 1HNYA 1C3FA 1ZBCA 2PWHA 4DUVA 2XFYA 3KEHA 3ZJKA 2XHYA 2ZX7A 2WZIA 1UWRA 1DWAM 2ZUMA 3ZSSA 2WCGA 3IJ8A 4FLRA 4PSPA 3HMCA 2ESCA 1KXHA 5ABHA 4BCEA 3VD7A 2XFRA 2QHAA 3WH8A 1KQYA 3CHCA 3SUTA 1ZL1A 3B8SA 3BC9A 2G4FA 4HMEA 3THDA 3EBVA 1NWUA 3T2PA 2Q8XA 1XHGA 2XGIA 4AD0A 3WDJA 3SCNA 3WFLA 2AOSA 3PZIA 4BQ4A 3D3AA 4UCFA 3L4WA 1G94A 4MB5A 3RIKA 3NUKA 3IJ9A 4UOZA 5A6MA 1FH9A 3CPUA 2QF8A 1BAGA 5HPOA 4ACZB 2VCCA 4MB3A 3N17A 3VIFA 1PJ9A 4LXFA 1E4NA 2GUYA 2YL9A 2CXGA 2J25A 3QGVA 4KRUA 2WKLA 2J7FA 1V6WA 2WMGA 3KL5A 4Z2GA 2YBTA 3WDQA 3T0DA 3CMGA 1W32A 1O7AA 1QNPA 2A3AA 3FW6A 1VB9A 4UFHA 2XVLA 1KGWA 1FFQA 2YOCA 2WMJA 3PTKA 3WQ6A 2FDMA 3AIBA 2ZUWA 4ZEPA 1JDCA 2WSKA 1GOWA 2CERA 1K9EA 3AIEA 3W6LA 3PZNA 3NDZA 5BXTA 2OWCA 4HOZA 1OGGA 3OGRA 1B3ZA 4YHGA 3GXFA 1UR8A 4X0NA 4UFIA 1R85A 5GPRA 4RE3A 3VD9A 1XD1A 2GDVA 1W1YA 3II1A 1CTNA 3CO4A 5CPSA 4J28A 1W3HA 3EMZA 3BH4A 4C7GA 4F9DA 3CUIA 1TUXA 2JALA 4TVUA 1EQPA 1XV8A 5IHSA 4QLLA 1QI0A 2BY3A 5FKYA 4JHOA 4PBGA 3AFBA 4CD4A 4EE9A 4PCTA 1V3JA 2OYMA 2VX4A 1SMDA 1XD0A 1UR1A 1K6AA 3ZM8A 1LQ0A 3BMWA 5BROA 1GW1A 1TMQA 4JKLA 4F8XA 3N15A 3RJYA 2ZX9A 5CGMA 3K4AA 1U30A 4E8DA 4AZGA 1I1WA 1DWFM 4L4PA 1E9LA 2J75A 4P8XA 1M04A 1E40A 3PZUA 1UQZA 2ZUVA 5D4YA 3ZO9A 3CZEA 3AMGA 3AYSA 3WUEA 5ABEA 1RP9A 2DH3A 2XWEA 4XUYA 5E70A 1CPUA 2YDSA 1B31A 1JDAA 2GJXB 3WMBA 5A8QA 3VINA 3I3BA 2IXUA 4HMCA 4P7RA 2VR5A 1UD4A 2VCBA 1JYWA 3QHMA 1LJYA 2YL5A 4KH2A 1QHOA 1R7OA 1LF1A 2JEQA 3DHUA 4WKFA 3TONA 1B90A 3W25A 1CXIA 4GINA 4J3SA 2ZXQA 2YDRA 1JI1A 3T2OA 1HJQA 1UOKA 5HDRA 4OJYA 3WNLA 5I23A 1OGSA 3ARZA 2VRKA 3PZVA 1HXJA 1V02A 4JHZA 3BAYA 5A1AA 2YDQA 1UYQA 3LPPA 4P8WA 3HN3A 4AZHA 4W85A 5CQ1A 5GNZA 2BNJA 2VMFA 2XVKA 1JZ3A 1GHSA 5AC5A 1H3GA 4AW7A 5HBFA 3AXHA 1IZJA 1CENA 4D1IA 2F61A 4DM1A 1BPLB 2FGLA 1UH4A 4HZ7A 4MNLA 1HP5A 3GBDA 1OM0A 1Q6DA 3ARRA 1JAEA 3GTNA 1XCXA 5HPCA 2PBOA 5JIWA 2E9MA 7A3HA 1PZ3A 2V5CA 1PIFA 3ARSA 1GVYA 1EGZA 1LL4A 1KWGA 4N0RA 1H11A 2E9BA 5KZ6A 3QOMA 5AY7A 1CGXA 1YQ2A 4GIAA 4Z2IA 2DSKA 1D7FA 2OYLA 1G01A 2V3DA 1GZJA 1MXGA 2WVVB 3ARWA 3GNPA 4MTVA 3VILA 3M07A 3AZTA 4HZ8A 4FMVA 5DEZA 3WDHA 4UZSA 4WIWA 1M53A 1E5NA 1ZU8A 1G1YA 1Q6FA 1UG6A 1MVYA 4YN5A 2D3NA 2XIIA 4AIUA 1ISXA 3ALFA 1DWIM 3WUFA 4JKMA 3AHVA 2JIEA 3EMQA 2VZTA 2WCSA 2WZHA 2ZWZA 3WIJA 3ZMRA 2VX7A 2VNCA 3VX1A 3FAWA 1PX8A 4GZJA 4NRRA 4GPNA 4JFVA 1Z32X 3UEQA 1BGAA 2YA0A 4PMZA 2D22A 2JF7A 4UR9A 4FLQA 4PRWA 4P7LA 4QDMA 1UWSA 3EDJA 2CITA 1ZBKA 1MXDA 1C8XA 3ARXA 1QOXA 4AYSA 1NOUA 4FF5A 2WVUA 3RMEA 2ZOXA 3MMDA 5CG0A 2X1IA 1JAKA 3OGSA 4ACYA 3NYDA 1DHKA 1VRXA 2WVVA 4UFMA 3WH9A 1C8YA 1JG9A 3VIHA 6CGTA 3SCWA 5A2AA 1VBUA 1JFXA 5IFPA 3VIPA 3OLDA 3AIRA 4AZ6A 1J0JA 2VCAA 3PZOA 2GJRA 1AQ0A 2ZXDA 3VIGA 1G5AA 1UD8A 1OCQA 3FNDA 1GOOA 3OA5A 1E0WA 1QHZA 4B3LA 1VFFA 3IANA 3APGA 4GZEA 2OSXA 4S3KA 1WE5A 2V5DA 2XYLA 4D6HA 4CVUA 2WLYA 2WMKA 4NRSA 2ZX6A 3CLWA 4H8VA 2DSVA 1E4IA 2EPNA 4PYSA 3SCRA 1HJSA 4AZCB 1V02E 5I24A 2WK2A 4JAWA 3F5JA 4HU0A 3AXXA 1EDQA 2WHMA 1QPKA 3GZAA 1CGYA 1BG9A 4M29A 1E5JA 4CCDA 3VDBA 4BQ3A 1E56A 3BSGA 1V3HA 3RILA 3WMSA 2GFTA 3GH5A 2CKRA 2DT1A 1MQQA 2WHKA 3BLPX 1JD9A 2WHLA 4CVWA 1IT0A 4RL3A 4CCCA 4MAZA 5LA2A 3AIWA 4D6DA 4MNJA 3SCPA 5HXMA 4ZE4A 5BRQA 2W92A 1UA7A 4M82A 4PN2A 3K8KA 4JZ5A 1VIWA 3VKKA 1IZKA 2OLHA 3A47A 2OSWA 1LL7A 3CZGA 1H2JA 4OIFA 3N04A 1I75A 1BVNP 2EPMX 2XWDA 5M5DA 1W2PA 1PPIA 4AD4A 1B3YA 1J0HA 2DT0A 1V03A 1SMAA 1ZS2A 5A8OA 2D24A 4B3KA 4J27A 3GH7A 2VZOA 4J3WA 4HA1A 1FFRA 2HISA 3IAQA 4MB4A 5LYRA 1HJVA 3VGGA 1XYZA 1PAMA 2BHZA 2NSXA 3AMCA 1KXTA 3NSXA 2WSPA 3W24A 3MV11 4D72A 3U57A 4A3YA 1BSIA 2J7CA 1GONA 3E1F1 4ACZA 4TOQA 3NJ3A 1BTCA 2F2HA 3WEZA 1CECA 2XGBA 1G0CA 1NARA 3KE0A 4W87A 5BWFA 1MFVA 4V27A 3HJEA 1CGTA 1JXKA 1QNQA 2YL8A 2EXOA 1JYNA 3AHZA 5CXPA 2VRQA 4J3VA 3VNZA 1OBAA 5DO8A 1A3HA 2ZIDA 2DSZA 3RO8A 3PBGA 1VFMA 4UQ9A 3MUIA 5BYWA 1H0GA 2BVDA 4XX6A 1QNSA 3CHDA 4L4OA 4HOXA 2W66A 1QI5A 5C70A 4WF7A 1XCWA 1BFNA 4Z2LA 5IDIA 3AJ7A 2EJ1A 1EQCA 2VOTA 2CYGA 2W63A 2EQDA 2J7BA 2GK1B 4H8HA 3AZRA 5A2BA 3BAXA 3QHOA 2FHBA 2WYSA 2FGZA 3FN9A 4MAVA 3WNKA 2EPOA 4AC1X 4DWSA 1VEPA 2VX6A 4NF7A 5JBDA 2J79A 1V08A 4F9JA 4PMYA 1EOKA 3MUY1 3VIKA 7TAAA 1H1NA 1JZ4A 2DIEA 3W27A 3K46A 3OLGA 2VURA 1UHVA 4AISA 1J11A 2WC4A 1TA3A 5CPTA 5DT5A 3W53A 5BCAA 4OKDA 2JF6A 1MYRA 2J74A 3L4UA 4W8LA 1V0KA 2XTKA 5CLWA 1LL6A 1W1PA 4MB1A 2X0YA 2E9LA 4M80A 1B3XA 1MQPA 2VRJA 3SCVA 2A3HA 1E4MM 4WKAA 1FHDA 3UCQA 3WQWA 1CXEA 3EYPA 4H2CA 1GQKA 3EDDA 1TR1A 3MSGA 5A6AA 5AYBA 3L4ZA 2Z1KA 4J7RA 4UFLA 4CN6A 1D3CA 4UQCA 4UTFA 3A3HA 2GDUA 5I6SA 3FY1A 3WDRA 2X09A 2WW5A 2FHCA 1J18A 2ZUUA 1KWKA 1UWUA 4P7NA 1F4HA 2J8FA 1XSKA 3GYCA 2YLAA 1B3WA 3AYRA 2J7DA 3UERA 5E0CA 1V3IA 3CUGA 3ZR6A 3K8LA 1JGIA 1U2YA 1UR4A 1ZJBA 6TAAA 5A6BD 3GNRA 3NSNA 1J0ZA 3WQ4A 4CU7A 1QNRA 3WD3A 3MMUA 4W88A 5IFTA 3RM9A 3S2CA 3M6DA 3VUPA 2V38A 3BLKA 2W61A 1C92A 1DP0A 3BAJA 4X0VA 4MJ4A 3WF3A 5I2UA 5JIPA 1EDGA 5A8NA 3SUUA 1HKJA 3AROA 2G3IA 1W1VA 1US3A 4EAMA 1HF6A 3CZLA 2CBJA 3DC0A 2X2YA 3ARPA 5FIPA 1UR0A 4U33A 3W0KA 2XSAA 2W62A 1HVQA 2BY1A 2IUZA 2DT2A 2NT0A 1H4PA 4TTUA 1X6NA 4PTXA 3OZOA 1CXLA 5A2CA 4TVDA 1LWJA 4AD3A 4YPJA 4QCEA 1FP9A 9CGTA 4MPKA 1X6LA 1E6RA 1E6NA 2YKKA 3AMLA 1VENA 3SCTA 3CHFA 3W6MA 5M17A 5M3WA 3SUWA 1OIMA 4HTYA 1BLIA 5KEZA 2DSWA 2V3GA 2JE8A 3OBAA 2YIHA 4CUCA 3POHA 5I5RA 4CN1A 1KGXA 1XC6A 5AC4A 3U5UA 5E6ZA 4W7UA 3AIUA 1W9PA 3MU7A 3WNMA 4D6CA 4EANA 3WENA 5D9OA 1ISYA 5A6BA 4EKJA 3AS0A 4H7VA 3A4AA 1J12A 2J77A 1WAWA 3B9EA 5FL1A 2VX5A 1JF5A 4AZIA 1X1NA 2WANA 4JL2A 1LG2A 1DWGM 2BVTA 3MO4A 3ARUA 2D0HA 1C91A 3PZTA 1KQZA 3A6OA 2J7GA 1BVZA 4MNKA 4IM4A 3FXYA 2RGMA 3ZQ9A 2QLYA 3AZSA 1WZLA 5BXSA 3W26A 4XZBA 4ZXOA 2VO5A 1UR2A 4FLOA 1NP0A 1EXPA 2O92A 5JBEA 3L4YA 3SCUA 2DH2A 4MDPA 3PZGA 1CXFA 3WF0A 4PTWA 2EPKX 4KGLA 1HJXA 4FK9A 4M1RA 4TTGA 4AIOA 1JL8A 1FP8A 3TOPA 5M03A 5D9MA 4X9YA 2WCAA 1UWQA 4PMXA 4B16A 3KZSA 1HIZA 1UKOA 3SIMA 1ITCA 4TUFA 3SCSA 2DT3A 5A8PA 4PSRA 2XUCA 3VX0A 5FOOA 1JNEA 2J7EA 4QAWA 4BQ5A 3WD0A 2UY2A 1GCYA 3AICA 5DT7A 2O9TA 1V3LA 4LQ1A 2ZE0A 1EHNA 5E6YA 5DFAA 2ZICA 1DWJM 4B9YA 2VT0A 1KCKA 4W84A 3G6MA 3T2QA 5D8WA 3VIIA 1Q6GA 1R7AA 2PB1A 1OWQA 3WMCA 2PC8A 2Y2WA 3VPLA 3HU7A 1Y7VA 2XIBA 4C7FA 2OWXA 3WBEA 5CZKA 1TA3B 2XM1A 1XYFA 3N12A 2VC9A 1CYGA 2D0FA 1BYAA 1XH1A 3OZPA 4DWSC 2E4TA 5LA0A 4PUEA 3BGAA 4W89A 1CLVA 3WF4A 1CEOA 2VVSA 2D3LA 3KL0A 5ABFB 1UUQA 3NIYA 4AD1A 4KMQA 4J3UA 4XV0A 3D5HA 3ALGA 4K68A 3ARYA 2J62A 1EO5A 3WUGA 1VFOA 3UR8A 4GXPA 4AEFA 3OIHA 1ISVA 5I77A 3K1DA 1KFWA 3N1AA 4D71A 2A3EA 2GSJA 3T0BA 2FHFA 3PN8A 3VMPA 1F4AA 1MW0A 2CNCA 5ABFA 1Q4NX 3DYPA 3CZJA 3GM8A 2XVGA 1MW1A 5I0DA 3WH5A 1NH6A 3RM8A 4UOQA 1W9DM 1AQMA 4OZOA 4JFSA 1HJWA 1BYCA 1QW9A 4Z2KA 3NCOA 3MUAA 4U31A 4M81A 5C71A 4E4PA 3QR3A 4DWSD 3EDEA 1QI2A 1CDGA 5GQBA 3TA9A 4AZ5A 5CSYA 3AIQA 2XVPA 1CNVA 1PX4A 2G3NA 4GKLA 4GI6A 3AHYA 1ZBWA 1DTUA 1Q6EA 4DWSB 5A6JA 1C8QA 2G3JA 3NDYA 2VZUA 1H5VA 4QFUA 1EO7A 1E72M 3WNNA 3MV01 2BXZA 3GXIA 3AMKA 1B30A 1UKSA 1E71M 3FHQA 4CCEA 4Z2HA 2XJ7A 2PWGA 1VJSA 1FOBA 1UZ1A 3VGFA 2MANA 1JZ8A 1C7SA 3U5YA 4TVCA 3CGTA 1GJWA 4HMDA 1MQRA 4HA3A 4OBSA 1K9FA 2ZUNA 1Q6CA 3A4XA 1H41A 4U3CA 2ZX8A 4AD2A 4LX4A 2RGLA 1OT2A 2X8RA 4IPLA 5I3DA 4W93A 2CBIA 4D6GA 4JFWA 1PEZA 3WN6A 2WNWA 1UZ4A 1K9TA 2WAGA 4S3JA 1WCGA 3AS2A 1JI2A 1ECEA 1HP4A 1JNDA 1ZB5A 4UNIA 3U7VA 1TE1A 3CMJA 4HZ6A 4W8AA 4DUXA 1E6SM 2Y4SA 1E0XA 2JEPA 3NSMA 3VGHA 5A6LA 3BXWA 2WVTA 3WF2A 1WP6A 3WD1A 2TAAA 3J7HA 4RE4A 2YL6A 5BXRA 1J0IA 1E73M 3ZJ7A 1GVIA 3BAIA 4P8UA 4U5KA 2XVNA 2WLZA 3IAPA 4AIEA 4PMDA 3N11A 1KBBA 1BYBA 1HX0A 1E55A 1UD6A 4PCSA 1NM9A 2DSUA 3K4DA 5ABGA 1V3MA 3THCA 1KR0A 1UKTA 2FH6A 2QMJA 2WMIB 1G9HA 1XH2A 2V3FA 2DPEA 4LPCA 3CUFA 1UD5A 2VJXA 2O9PA 4BS0A 1WDRA 3OLEA 5GNXA 7CGTA 2CBUA 2Y5EA 4AMCA 1VJZA 1UH3A 3VIOA 2X05A 2WBGA 1J0YA 4E8CA 1GOMA 4TX8A 2XPKA 2VQUA 1LWHA 2CBVA 4JL1A 3QOKA 1W3JA 1UD2A 5A3HA 2WVSA 1M01A 3EDKA 1OINA 3CH9A 3CZKA 3DYOA 3PTMA 1E70M 2CETA 1MWOA 1V0NA 1V6UA 4R5EA 1M7XA 3MANA 3RDKA 2DEPA 2PWEA 2OWWA 2O9OA 1XRVA 5IXEA 3MS8A 4W5UA 1GPFA 3SURA 1UKPA 5DF0A 2WZEA 4W8BA 1E4LA 4GQQA 4CD5A 4GQRA 2C8NA 2UY4A 2E8ZA 1E1FA 1HL9A 2VL4A 4AXNA 3UG4A 2VZSA 1EA9C 1W3LA 3WL0A 2WKGA 2JFEX 4CD6A 1H0IA 3BCFA 3WD4A 2OSYA 2YLLA 2EEXA 3MUZ1 2W91A 3CIVA 4LYPA 3MMWA 3W28A 1E6PA 2PBGA 1NP2A 4HA4A 1CBGA 3ZJ6A 1KB3A 1OGBA 4CN4A 1HKIA 3ZJ8A 4GO9A 1BGGA 2BXYA 1TZ7A 3MKKA 1EDTA 1QNOA 1C90A 4D6IA 4CGTA 4UZUA 4EK7A 1MW3A 1PX3A 1JXJA 3T08A 2CPUA 2BFGA 2YA2A 2BVYA 2WB5A 4JIEA 1RH9A 5JBFA 2NW0A 1ZJAA 1JZ6A 2ZXAA 1U33A 3VDCA 4E2OA 4UQBA 1FH7A 2AMGA 1W9VA 2D0GA 3WQ5A 5AYIA 5HOSA 3ZT5A 1TVNA 3BCDA 4NSBA 1E15A 4PMOA 3U7BA 3UR7A 4BA0A 1KXQA 1W2VA 2UWFA 1E3ZA 4HPHA 6A3HA 3WD2A 1V0MA 2ZXBA 4B15A 1OD0A 2YA1A 1C93A 4QP0A 1H49A 4LGXA 2O9RA 4M8UA 3RCNA 1ISWA 3ARVA 1MFUA 2GK1A 2VI0A 3AHXA 3AS1A 3CHEA 5EFDA 3VD4A 3F5LA 1UD3A 2JIWA 1WB0A 3BAKA 4TX6A 2WC3A 3MSDA 4UOJA 2WWDA 3L4VA 1W1TA 3N18A 3KWXA 4U2YA 3B9AA 1MW2A 3TP4A 4UQEA 2DQXA 4IISA 2D2OA 2WPGA 3POCA 4MDOA 2PWDA 4A3HA 4AWEA 4OUEA 5I79A 3FAXA 3WL1A 4B9ZA 3ZT7A 2VTFA 4ZFMA 3WQVA 2CIPA 3VO0A 3RJXA 2F8QA 1JD7A 1QW8A 2J78A 4BZYA 1V6YA 2G3MA 4YHEA 3WF1A 4AZ7A 1J9YA 3AISA 3SEPA 1EIBA 2AAAA 2NT1A 1J01A 4XZWA 3L4XA 1WKYA 1W9XA 1GOKA 3OLIA 1TVPA 3UG3A 1E3XA 3TTSA 4MNMA 4JCMA 3PZQA 1J0KA 4J3XA 1ZBVA 4KWUA 1ODUA 8CGTA 1NOWA 4ML4A 1CIUA 1JFHA 1OT1A 1UQYA 4AY1A 2WMIA 2XFFA 3WSUA 1CWYA 2HVMA 1XSJA 4AZBA 1GQLA 1QBAA 3O6AA 1LLOA 2CHNA 5DMYA 4QCFA 4P7OA 2J8GA 1GUVA 3VMOA 3WNOA 1UKQA 4CKQA 1E1EA 4GZIA 2E0PA 3S6TA 3UESA 3VNYA 2PWFA 4PUDA 4RE2A 3ECQA 4GO8A 3TTYA 2XSBA 3AMDA 3ZR5A 1BG4A 2G8ZA 2DGAA 4PMQA 1UWTA 3PTQA 2C7FA 5JUVA 3M7SA 1FH8A 3I3DA 3ARQA 4AEEA 3G6LA 3K8MA 4TXEA 4M24A 1WDQA 2DIJA 1W3KA 2J47A 1D2KA 1WO2A 4AD5A 4PMUA 4LYRA 1PBGA 2WMFA 5CGTA 4ZENA 3W37A 3DHPA 3JUGA 2WM0A 4CD7A 4WSKA 1JIBA 1JF6A 2ZUSA 1BQCA 4PTVA 2CKSA 4ZE5A 4WK9A 2ZX5A 1E0VA 1KCLA 3T0AA 4ATLA 3RPMA 4V28A 1B2YA 1KR1A 4W7WA 4A4AA 2OYKA 4ATDA 3WEMA 3CUJA 2VVNA 3VDAA 4HU8A 1GQJA 2CHOA 1OD8A 3EMCA 1R86A 1WDPA 4CU8A 1HT6A 4U3AA 4DUWA 3GXDA 5A8MA 2WHJA 3VMNA 1GOIA 3WKZA 2A3BA 1A47A 3F4VA 1UWIA 5BRPA 3W81A 3ZOAA 3N13A 5D9NA 2VUYA 1L0PA 4QLKA 1HKMA 3WELA 2ZUTA 5FL0A 3WFZA 4ZXLA 4J3TA 1M03A 3VIMA 3GNOA 3L4TA 2CEQA 1US2A 1SFSA 3TTQA 4Q22A 4NI3A 1FHLA 5CJ5A 5A6SA 3BSHA 1P6WA 1EHAA 1WZKA 2BS9A 2G41A 1J10A 3GH4A 3LPGA 1QHPA 4XB3A 4WSJA 1HL8A 3N9KA 2BY0A 2CCRA 4D1JA 1EOMA 1HN1A 3WDPP 2A3CA 2WWCA 4PMNA 3F5KA 2WMHA 3WBAA 1WPCA 4WLCA 2E40A 1NQ6A 1V6XA 4PEEA 4MADA 5CLTA 3PZ9A 1V0LA 1RP8A 2WC7A 4KRTA 2Y24A 2PF0A 1JYXA 3AHTA 1JZ7A 3W29A 4PTMA 4W86A 1EH9A 2XM2A 3VOCA 4D6JA 3AIVA 5A6KA 5EB8A 1CZ1A 1NOFA 3L2MA 1UR9A 4HPGA 3OB8A 1H09A 2YBUA 4OBRA 1VBRA 1ISZA 3CUHA 3LPFA 3VGEA 4ATWA 3QHNA 3WDIA 4BQ2A 3ZT6A 3VD3A 2QPUA 3UETA 2BHUA 5I78A
chains in the Genus database with same CATH superfamily
4UFKA 4AWUA 2PU0A 1IEWA 5HJLA 3OGVA 4XKMA 2Z2AA 1XXXA 3PHAA 4HNNA 3T55A 1X98A 2UV8G 1XSIA 3LTSA 1TYGA 3M44A 1SO5A 3N3MA 1NEYA 4KWVA 4C6LA 4JQAA 2HS8A 3CBWA 3T0TA 6XIAA 1HKKA 2QUUA 3E0FA 3RN6A 2E3ZA 2YR1A 4GXWA 4RXGA 1RD6A 3HV9A 5GNYA 2X0HA 4WY0B 3RM4A 5ECUA 4FLSA 3GXMA 2E6AA 2NQJA 4JX6A 4LYQA 4Q4OA 1I1XA 4GACA 3IJIA 2I56A 4H9ZA 1Z41A 2VQTA 5D8ZA 4HNUA 2HV5A 1KXVA 5C2GA 2YB1A 2J6VA 5AKQA 1UW9A 3TR2A 4GYJA 4GMEA 1K9DA 4MJ2A 1YDNA 2B31A 3W3OA 2BZNA 5FEZA 5FJRA 3TC7A 1RPKA 1UC4A 1MEWA 4WDWA 1Q6LA 3VIJA 1T8QA 3N9RA 3WMLA 1O5RA 1XGZA 2C19A 2OGYA 3I3EA 1YNQA 3W38A 1UPPA 2XN1A 3PUGA 4U28A 2XU2A 4JQ1A 2Q8LA 4L80A 4A8IA 5TD4A 1CGUA 3VGDA 3KL3A 1ZFJA 2EO7A 3A24A 3DGBA 1AW2A 3IRDA 1L8NA 1W5OA 1RQBA 5EBAA 3RU6A 2H9AA 1U5HA 3CYVA 3W4RA 2ZA1A 1B3VA 1QI3A 5KINA 3I4KA 1R8LA 2F6UA 4O14A 1M41A 4KGJA 1XRFA 3TC6A 1T8XA 4FSAA 2ZWYA 4IUGA 4YMZA 2WJEA 3SUSA 3H2CA 3NOYA 2BLEA 3FGCA 4HVXA 3VVGA 5CEWA 1DEDA 2YYTA 3VM7A 1BQGA 2ZZ7A 3DBPA 1TCMA 3WBXA 4KERA 3HF3A 5CAHA 2QUTA 5CSUA 1UA3A 1CXKA 1GTHA 1SJCA 4GNVA 1OIFA 2B0MA 1J4EA 3VU2A 1JDDA 1XLIA 5HQLA 3WY1A 4TO8A 1AMKA 1W91A 1IIHA 5A94A 2YJQA 4HP5A 4Y2WA 1PZ1A 4L1GA 4S3AA 1W3IA 2OOGA 4OOUA 1W9BM 3OVQA 3LCIA 5FCZA 3UR5A 2QULA 3W87A 3WCZA 1WDWA 2ISVA 4H9UA 2NXHA 4E0CA 4UQDA 1PCKA 3PWGA 3EKGA 4DXKA 4C6PA 2CWNA 4CD8A 1FBAA 2PLMA 3UWVA 4M56A 2QCFA 1PCWA 2OPJA 3WUBA 4HCDA 1HNYA 3V5CA 3P5ZA 4F66A 1C3FA 2DUAA 1ZBCA 2VGIA 3ZJKA 4LF1A 3NQDA 2HEJA 4PGLA 1UWRA 4MY8A 4S3EA 4XTIA 3C56A 1KXHA 5ABHA 3NZPA 3NQVA 1HGYA 4A3RA 5F2LA 1XHGA 5LNUA 4ICMA 4C6DA 3WDJA 3D3AA 1P7TA 1UC5A 3L4WA 2INZA 4XAZA 1G94A 1F76A 3IJ9A 4KEMA 4UOZA 3CK5A 4YTTA 3ITLA 2QF8A 3FKKA 5H8PA 3GXPA 3F2CA 1E4NA 3QQ1A 2CXGA 4QROA 1B4EA 1R2RA 2C18A 3CMGA 3VI2A 2QCNA 2XVLA 2A85A 4NAFA 2ACRA 2YCEA 5MKGA 2Z7GA 4ZEPA 4I9MA 2XFWA 2CERA 3AIEA 1H5YA 2J24A 3W6LA 1H1ZA 4QJ3B 4LOCA 4A35A 3NDZA 1MO0A 4HN8A 4HOZA 4FX6M 1ZENA 4NNAA 1UR8A 2IPGA 4UFIA 4X3ZA 2HPIA 4RE3A 3VD9A 2V67A 3II1A 3T40A 2O55A 3CO4A 1W3HA 4C7GA 4NYYA 1VFSA 3LGGA 1A0CA 4QDPA 4TVUA 3VNJA 3O7UA 2IQ0A 3Q65A 2A6NA 1KBJA 4JHOA 3W73A 4MLJA 1QOQA 2OYMA 1VKFA 3URAA 3ZS4A 1K6AA 3ZM8A 1DJIA 1YRRA 1GW1A 3KLKA 3MDWA 4F8XA 3N15A 1VQTA 5CGMA 1U30A 1IGSA 4E8DA 3ABQA 1EXBA 3IS4A 1E9LA 2J75A 4MMWA 4D8LA 3M5VA 4FNRA 5FEWA 4UC5A 5SWUA 3ZO9A 1UZDA 3CZEA 1QUMA 3WUEA 1T40A 5ABEA 1RP9A 4HU4A 4JR5A 3NR0A 2YDSA 1JDAA 4A29A 4JYDA 3RO6A 2IXUA 1TPH1 4J40A 1UD4A 3DHFA 5HWMA 4PRRA 3VNKA 1VZWA 1QHOA 1LF1A 3TONA 4WKFA 4Z42C 1GYLA 5TBOA 3DCPA 1CXIA 4XSLA 4CQ8A 2YDRA 3ZYZA 2CLMA 3V35A 4LVDA 4ZGYA 4O0ZA 1LBMA 3NZ1A 2TMDA 2PDJA 3BAYA 2DUXA 3B0YA 4KCUA 1TPWA 3EWWA 2YDQA 1UYQA 4W85A 1D3GA 2E5DA 2XVKA 1JZ3A 2R1KA 5HBFA 2F61A 1BPLB 3QZAA 1WYIA 2HS6A 1I9CB 5AOUA 2ZTKA 4HZ7A 4IIEA 1HG3A 1HP5A 3HQOA 5FJPA 2FGBA 3UXLA 3WQFA 3BLEA 2DZAA 3ARRA 2VWSA 1D8CA 2BVWA 2C15A 3A9BA 2F9RA 4G7EB 4LVGA 7A3HA 4GHRA 1LL4A 4HSNA 1H11A 5KZ6A 4YTUA 4K8HA 5AY7A 3VC5A 2PDKA 4J9JA 1IXNA 1YQ2A 2VGGA 1MXGA 3H2EA 2WVVB 9RUBA 3S5NA 3VKCA 4PE8A 1BKHA 4FMVA 4UZSA 3T78A 1ZU8A 1Z7AA 1L2QA 4IMEA 3PFRA 2D3NA 2ANUA 4AIUA 3ALFA 4LVFA 1W5NA 3AHVA 3E96A 2RKXA 2VZTA 1W1ZA 3ZMRA 2VX7A 3VX1A 1B9BA 3FAWA 4GZJA 3LM3A 2PWUA 4GPNA 1Z32X 1H7OA 5G2WA 1AG1O 3TFXA 4PMZA 4IX2A 3Q67A 4C1KA 4QDMA 2YB4A 3C0JA 2YCJA 4K8GA 1E9YB 3EDJA 2R14A 2PZ0A 2NV2A 3ARXA 3BOFA 1W5MA 1NOUA 1I4NA 2WVUA 3SW6A 2B4GA 2W6RA 3MMDA 2GGGA 1XIFA 1OFPA 2WVVA 2FFIA 4UFMA 4ZOEA 1LQ2A 4S2CA 4B5UA 3SCWA 5A2AA 1VFTA 4RR4A 3IV3A 3OBKA 5K9XA 1JPHA 1EWEA 2X30A 5BZAA 4GYPA 4LVBA 4LNCA 1OFQA 3AIRA 1J0JA 1GK8A 4M6UA 1OHLA 2E28A 1OCQA 4X63A 3SJNA 2OZ0A 3OA5A 3LHTA 4B5SA 3WJSA 2ACUA 3KBSA 4A2SA 1TV7A 5DRIA 3M0IA 1YE4A 2XYLA 1I2NA 5DMNA 3BV7A 5M1TA 4C6NA 2DSVA 1E4IA 3LTYA 2EPNA 3QLDA 1SZRA 3CYJA 3ONCA 4JAWA 3F5JA 3PBWA 3KOFA 9XIAA 3E3HA 1CGYA 1Y0EA 1BG9A 1LOQA 3BANA 4M29A 1E5JA 4Y8FA 3H12A 3BSGA 1KRMA 1T5AA 3WMSA 1AZ1A 4CVWA 3H4WA 4L5ZA 4FHAA 1FWGC 3GE7A 4DJFD 3BPWA 3M5ZA 3AIWA 4HCLA 3A5FA 4ZE4A 4M82A 1SU5A 3MP4A 4JZ5A 1EUNA 2OLHA 4DY1A 3UZWA 4RNIA 4L6OA 1SZFA 2ZBTA 1ZS2A 3F1QA 1TQJA 1WAUA 4B3KA 1RVKA 2I1OA 4ZO9A 4J27A 2VZOA 4F0LA 5CSRA 4WSHA 2FLIA 1GEHA 3NPXA 2HISA 2NVAA 3IAQA 4FOKA 4IIGA 4MB4A 5LYRA 1XYZA 1F3EA 2C1HA 2XH2A 3AMCA 5DY2A 1KXTA 4KS0A 1GYNA 5BU9A 4NZ4A 3MV11 2PD9A 3WFAA 2POZA 1TMLA 3WEZA 1CECA 1G0CA 2F6KA 4RNJA 3P6LA 3KE0A 5L9FA 2NXGA 3VZZA 4DJFA 2EXOA 2FVKA 3W74A 3WQDA 1JYNA 4K1GA 2JGYA 3H70A 2BASA 4J3VA 3VNZA 2C0AA 1GKPA 2ZIDA 2DSZA 3STPA 4UQ9A 3OHIA 4DO5A 3U48A 2W0UA 3W7RA 3WLJA 3T7VA 4L4OA 5C7VA 1I2QA 3HPXA 3B8TA 3HGJA 2DQWA 3SO7A 2J7BA 5D2YA 4HNOA 5DBTA 3LYEA 1EX5A 4C6QA 3QHOA 2WYSA 1X7IA 3FN9A 1XBVA 4XVEA 4NNBA 4CNPA 4Z1CA 1QPRA 3O06A 4GIEA 4M51A 1WKFA 1GJPA 4DWSA 5T9CE 4Q8NA 1N8FA 1V08A 4DZHA 1XFBA 2HXUA 3W27A 4ZZ9A 3W7PA 3KVJA 2VFFA 4ICNA 1HO1A 1J11A 3E0WA 2WC4A 2NLYA 5BOFA 1TA3A 3W53A 1PWMA 2WQPA 3FGCB 3TR9A 3UP8A 4ZR8A 5C9UA 1F74A 3NQCA 1R2TA 1RCXB 5CLWA 1LL6A 2Z24A 4M80A 3W72A 1NDWA 3WK1A 1W54A 1MQPA 3CIXA 3S5SA 2QCMA 3R6IA 3DFSA 1O4UA 3EYPA 2R1MA 3SIZA 3F7JA 1O68A 2DVXA 5AYBA 4EXAA 3L4ZA 1G7UA 3NQAA 3WDRA 2VC5A 2X09A 1KV5A 1A5CA 3GG8A 1EEPA 3B8WA 3GTFA 3P7YA 1TREA 2FHCA 4YYCA 3BZGA 2ZUUA 1R6WA 4P7NA 4RDYA 4YS1A 4XD3A 3UERA 5E0CA 2DP3A 1O5QA 3K8LA 1TTIA 1EGMA 4ZQCA 3VCRA 4DF0A 4QQUA 3KCJA 1SO3A 6TAAA 3B8IA 3H2AA 5DMMA 4MZYA 1J0ZA 2V6AA 1QNRA 1BVWA 3QR1A 3MMUA 1Q7ZA 2O7SA 4IICA 4W88A 4JTGA 3S2CA 1NFGA 3M6DA 4GIYA 1XIBA 5C2CA 4ADTA 1FHUA 1C92A 3NWRA 4WZHA 4I7WA 1YTDA 3WF3A 2BTMA 1HKJA 3GSMA 4O19A 1W1VA 2YXOA 1ICSA 1US3A 2Y63A 4B2DA 5G2IA 2X2YA 3ARPA 4H9VA 1O1HA 2W62A 1HVQA 2BY1A 2IUZA 2NT0A 3UCCA 4XBJA 4PTXA 1EP1A 4K7YA 1RAKA 3GC4A 4TVDA 3VNIA 3T8QA 2QEZA 4GQ0A 4QE5A 1CB7B 4GY0A 3P5YA 1Y5XA 2CLKA 1WXJA 1XC6A 2XDFA 3U5UA 3STGA 5E6ZA 3AIUA 3L23A 2B81A 2B7OA 1ISYA 3AS0A 1DJQA 4GLEA 3M0LA 3CMFA 3GU2A 1JF5A 1OC6A 1W17A 3PY2A 1ELSA 3VABA 5C9ZA 2JKPA 3MCMA 3WG6A 1BVZA 4ERAA 3M0ZA 1SFTA 1WZLA 5BXSA 1P48A 4XZBA 4MM1A 1NU5A 3TVAA 4E8GA 2TRSA 3GUWA 3WQCA 3WZ0E 2POTA 2VO5A 1NP0A 3TZNA 2REQB 2CLEA 1F9CA 3W86A 2NVCA 3LXCA 3KS6A 3DOPA 4GY1A 3PZGA 3UZYA 2FZ8A 2YFOA 2CZDA 3C2FA 3NQ7A 4QAIA 2GSHA 3SDOA 2FJUB 1OABA 4N2YA 4MWAD 3GAYA 4JTSA 4G7EA 3GK0A 2RHGA 3H26A 3Q58A 3HPSA 3KZSA 1ITCA 4FOUA 5A8PA 5FF0A 5FOOA 1PTAA 4NQ1A 5DCEA 3JZEA 2EG6A 4CQDA 4HNTA 5DT7A 3AICA 1W0MA 1W31A 4ADUA 4QS6A 1TPDA 1EHNA 3EB4A 2E09A 5DFAA 4OBTA 4QBXA 3G0SA 3ID7A 5REQA 4B9YA 3G6MA 3T2QA 3VIIA 4KFNA 3WMCA 2PC8A 3VZYA 3W1AA 4GC3A 1Y7VA 2XIBA 2OWXA 3G1DA 2G96A 4PA8A 2WZTA 4K1WA 2PDMA 3TN6A 3I6EA 1CYGA 2B7NA 3EPNA 1VPXA 1PKLA 2E4TA 1TSIA 1IYXA 3EWBX 2MNRA 4I3GA 3G18A 3WF4A 4N6FA 3ABZA 4R33A 4Z1BA 3FJ4A 2VVSA 2PMQA 3NIYA 3M0HA 3GAKA 4KMQA 4A6GA 3LCWA 3A21A 1L6WA 3N73A 4JTFA 3ARYA 2J62A 1X39A 3QW3A 4GXPA 4HK5A 2VDGA 4A8NA 4KIRA 1TRIA 1ISVA 2EG8A 3M0VA 3QQ0A 2FHFA 3L66A 1ITQA 1XF0A 3STCA 1MW1A 3NQ6A 3SY1A 3N34A 4IQJA 3RM8A 2ZZ3A 1F6YA 4JFSA 1HJWA 4Z2KA 3BW4A 3NCOA 1AZ2A 3THUA 1MSSA 1TIWA 1S1PA 3QR3A 2E1DA 3L21A 4DWSD 1QI2A 1GVEA 5HUOA 4L1XA 5CSYA 1KM1A 3CB3A 4R85A 3R7MA 3LM7A 1Q6EA 1G6CA 1LROA 5LZLA 2FPTA 4R3UA 1PYFA 3VNLA 1ZGDA 2EF9A 3GXIA 1UKSA 1E71M 1P4CA 4LTSA 1PWLA 3QSRA 2H90A 2PWGA 4HPXA 4XKYB 1ADDA 2Z29A 2MANA 4FXSA 1JZ8A 3MQTA 2ODOA 4QG8A 4Q33A 4P61A 4HMDA 1MQRA 1XGEA 2Z1XA 4OBSA 2QJIA 3OVRA 4KW2A 4LX4A 1MUMA 3M1ZA 3AO0A 1TZZA 3B4YA 4D6GA 3F2BA 1PEZA 5XINA 3TJIA 5HA7A 1PXGA 1LTDA 2WAGA 3DERA 4OQVA 1UP3A 3S5YA 3W1UA 2CWXA 1JEZA 1JI2A 1ECEA 5EMJA 3NXLA 3BV4A 1ZB5A 3WO8A 1E6SM 1WKEA 1F7BA 2Y4SA 3RFAA 3VGHA 3W2NA 4AH7A 3BXWA 4S3DA 3WF2A 3FJNA 1EBGA 4RCXA 4JQ3A 1FWHC 1VGAA 3GUGA 3ZJ7A 1H61A 4NIRA 3BAIA 4U5KA 3IAPA 4AIEA 1W8SA 2QDDA 1JJKA 4JTIA 4YVPA 4OUIA 2V5BA 3K4DA 1RJRA 2IPFA 5CGQA 3BJSA 1L6YA 4N4QA 2GSEA 3MJMA 2HNEA 4GUIA 1XYLA 3N2MA 3W1XA 3CQ0A 4H9YA 3CT2A 3WLQA 3TLLA 1WDRA 3GD6A 7CGTA 3MHFA 4CNUA 4HMNA 1EYEA 1FWBC 3VIOA 2X05A 1J0YA 1XUZA 1GOMA 3IPWA 2VWTA 1LBLA 4LS0A 2Z2UA 4H9TA 2VQUA 4PTNA 3GW3A 4WUIA 4AFYA 3ITVA 4JL1A 1UD2A 4Q4RA 2WVSA 5A3HA 2ZZ4A 5KETA 4R9XA 3EDKA 3UXKA 4ZOAA 2P8BA 1E70M 5CPNA 4QJ1A 3BLOA 1V6UA 4R5EA 1M7XA 3RDKA 3VFCA 2DEPA 2OLSA 2O9OA 5IXEA 2NWSA 2YXGA 5BMXA 3N14A 2OLAA 3U0HA 1IWPA 3PUOA 5FJIA 2WZEA 2SFPA 1C8VA 2J66A 1E9ZB 4NVTA 4AXNA 3UG4A 2VZSA 1XS2A 1EA9C 3A3XA 2WKGA 3QVQA 2QJNA 4CD6A 3AUOA 3P84A 2OSYA 3EWXA 5G2HA 1G4TA 4YU1A 5IBXC 5MF5A 1GWJA 4C6IA 1QU4A 3VOFA 3QH2A 3W28A 2YXXA 3BDKA 3EOLA 5ECVA 4HA4A 3MP5A 4XUGA 3WBWA 4CN4A 1HKIA 3EPMA 1S2AA 1J6PA 1A5SA 1TZ7A 3MKKA 3S42A 3CUXA 3QPZA 4GJ1A 4UZUA 5KTLA 1PX3A 1IEVA 3GR4A 4ONVA 3KP1A 5EMKA 3INPA 4FNUA 2XZ9A 4JIEA 2BVYA 2WB5A 4O10A 1ADSA 2J9XA 1OX4A 1TR9A 3QRHA 1U33A 4M6VA 5F2MA 2AMGA 1W9VA 3WQ5A 1XI3A 5D04C 3C0SA 5D37A 5H6HA 3KOWA 6A3HA 4HA0A 4B15A 1OD0A 2FTPA 2YA1A 3NQGA 3MWAA 4RX0A 4CQBA 4LGXA 3VE9A 3FOKA 2Y88A 1MFUA 4Y9NA 4F48A 3AHXA 1V79A 5EFDA 4LUYA 1O5XA 3KBVA 2GQ8A 3PUDA 1WB0A 3BAKA 2C91A 3DZ1A 4QG6A 4X2PA 5HWNA 4F0HA 5CJMA 2O4QA 3H8AA 3TP4A 4UQEA 3L0KA 3CXOA 2PWDA 3LHYA 4OUEA 4PCPA 3FAXA 4RDVA 4NJKA 4P2VA 1F3WA 5E93A 3M7WA 4ZFMA 4DJFC 4FXRA 1PKNA 4MFDA 4QDWA 2ISWA 3WQPA 2QZRA 5I00A 1QTWA 4LBSA 4UTTA 3N6HA 1W1IE 4BZYA 2QCEA 6XIMA 4AZ7A 4PUKA 4IL0A 1G7VA 4A21A 1EIBA 3ZLHA 4OU1A 5FJJA 3H7VA 3R89A 1GKQA 3LY0A 2RDUA 3OLIA 2I16A 2A1YA 1EJXC 1TVPA 3G1AA 4NL1A 3HA1A 4C1NA 3QGAC 4MNMA 2ZE3A 4JCMA 3PZQA 3GKFA 4J3XA 1YXDA 2FZNA 8CGTA 1NOWA 7PTDA 1DXFA 5DXYA 1UWAA 3VC6A 3WYZA 1OT1A 5F2IA 3N29A 2WMIA 2GWGA 2XFFA 1CWYA 2HVMA 5DRCA 1LLOA 3LI0A 5AHFA 2CHNA 3W7KA 4AVNA 3NXFA 2J8GA 3R0DA 4RKAA 4GZIA 4YNGA 1Q8JA 1QRQA 3QZEA 4ERIA 4RE2A 1AD4A 4NNCA 1QDSA 2XSBA 2G8ZA 4JBRA 2DGAA 1UWTA 3RITA 3PTQA 5FF4A 3G1XA 5JUVA 3FKRA 3TYCA 1DL3A 3I3DA 1H50A 3GDMA 3LG3A 3HGSA 1W5QA 2VFDA 1WDQA 2OQLA 1X8FA 1YW1A 4KFPA 3MO7A 3W37A 5AC8A 3S6OA 3BE7A 3B0UX 1FUYA 2Y7EA 3GNXA 4B90A 3T0AA 2PUZA 4N7QA 4O17A 5EGRA 3WEMA 1GQJA 1OD8A 3WLHA 3V7PA 3S4TA 4DUWA 3G22A 3LXAA 3MA8A 3GXDA 4OHQA 1F3TA 1XDMA 3R79A 4LSBA 4GVHA 2WHJA 4L7ZA 1GOIA 2V5LA 1OADA 3RUBL 3W81A 3RLGA 3C0LA 1XLKA 5D9NA 4EVZA 3OJGA 5AVNA 1XJBA 2CW6A 4QLKA 1VBJA 1SZNA 4YVVA 3Q4DA 5FL0A 3BLIA 1XC4A 1MMFA 1IE7C 3MZ2A 4JD4A 3ZWTA 1P6WA 2G41A 3PULA 1F73A 1HL8A 3N9KA 2BY0A 2CCRA 1HN1A 3WDPP 4PMNA 3WQOA 3L65A 4WLCA 4EXQA 4MADA 5CLTA 1V0LA 1N8IA 3W1LA 3RCMA 1EA0A 2QJGA 3W7OA 3GFZA 2JKEA 1LQAA 4ICCX 1XLAA 2PLCA 3AIVA 1FKXA 5J04A 4MOZA 4HPGA 1HUVA 1VHCA 1WDDA 3RR4A 3NYZA 2YCKX 3DFPA 4G56A 4BQ2A 1JULA 4BK9A 4YCOA 3LBCA 4ZA0A 3UETA 3G8RA 2XSXA 2V5KA 3B0PA 3UWQA 2BHUA 3BOXA 4AXKA 3AU6A 5BXPA 1OSEA 3W7DA 1IXQA 2Q01A 4LNYA 4UTLA 1DE6A 1EPVA 4GNKB 2PSNA 4UTUA 4I9JA 4N42A 1SM9A 4REQA 4MG4A 2IXVA 3KFTA 4F2TA 3U8GA 4LRSA 4WKHA 4Z2JA 3URNA 2WXDM 3L2LA 1ESWA 3N2CA 3DG6A 2Z1SA 2CLLA 5GVJA 4AEOA 1CGVA 3WLPA 4H41A 1IT7A 1R9XA 4FNPA 4JTQA 2VEPA 1J79A 1YDOA 4DLMA 5IHRA 4LUTA 4PMRA 3M46A 2J4GA 1W9UA 4AB4A 2FZBA 1Q6QA 1RSCA 4P8VA 1JCJA 3DN5A 5U4NA 3UCDA 2BY2A 1BHGA 3PPHA 1OJXA 1W5PA 1M7OA 1ZP4A 5LIXX 2DUZA 4PCNA 4NZFA 3V36A 4YTRA 1WZAA 4OTKA 1JZ5A 6TIMA 2FH8A 2GVYA 3S2MA 3LPOA 3DXIA 3P82A 3L9CA 1GQIA 1V6VA 1UH2A 1XR2A 1PZ2A 2QXWA 4C6EA 1SO6A 1CXHA 2PTXA 3HGRA 3BW3A 3AOFA 3EEGA 4BF7A 3MKCA 5CAKA 3QQWA 2Y7DA 1A50A 4R27A 4JFTA 1VAHA 5E0FA 3ZIZA 1TV5A 3HOJA 3FHAA 3AS3A 3BOLA 2Y89A 3WEOA 3WK0A 3QPEA 4UR8A 1WDSA 4JTRA 3O9NA 1KTBA 2PI6A 1O6IA 4O0KA 2J88A 5FA5A 5LIUX 1X97A 4A8RA 1M65A 2OQHA 3ZR4A 3E49A 2W5FA 3CT7A 5G4EA 8XIMA 1E6XM 3UG5A 1AW5A 3FVDA 1HVXA 2IQTA 2VEGA 4HOWA 1JZ2A 4MVAA 4PMVA 1YNYA 2C0HA 1P6BA 3DYMA 3W7NA 3EDFA 1IQ8A 5K4XA 1FQ0A 4ML9A 3NL5A 1NWSA 3BAWA 1VF8A 5J5RA 3LRKA 3O2LA 1CW2A 1G69A 5E09A 1GNXA 2UY3A 3IK2A 3E12A 2GQAA 3F4DA 1VEMA 2BHYA 1AMYA 3W82A 4E3TA 3LB0A 2ZKMX 2ZQ0A 3PS7A 2UBPC 5D38A 4C7DA 1S46A 4GOAA 3VTRA 1BYDA 5ABTA 2A0NA 3WLLA 5A95A 4MYAA 4E5TA 1V3KA 4IQLA 3VDHA 2WNQA 4AX7A 1BKSA 2J7HA 3ITOA 1R87A 1YIXA 3S2NA 1ITXA 3LXBA 4JPGA 1JQVA 4UUIA 4J1OA 1QBBA 4NASA 2VZVA 3WQ8A 2UY5A 3EPOA 1AJZA 3ABSA 3SAZA 3AI0A 5KZEA 4E4FA 3QF0A 3LSBA 1S5NA 3ARTA 3WNPA 1B9ZA 2DDXA 2GJXA 5CPQA 1B0IA 1UASA 3TJXA 5TF0A 3TNBA 3DENA 1DJXA 4DUVA 2G37A 3KEHA 1VD6A 1AJ2A 3G1YA 5C0QA 1DWAM 2ZUMA 2ZA2A 3HMCA 1LLZA 2PAJA 2XFRA 4B91A 2QHAA 3TX9A 4FI4A 3CHCA 3S1GA 3SUTA 4Y9PA 1DOSA 5ENLA 4AY8A 1YX1A 2V2HA 2XGIA 3UT0A 5GJMA 3TEVA 3LD5A 4RPPA 4JEQA 4UCFA 4MB5A 4RXFA 5CH9A 5F1VA 4Z08A 5DN1A 4ZQNA 3FLUA 3CPUA 4AYGA 1R3RA 1JCLA 4NXKA 5TAOA 1YADA 3O6DA 4KRUA 2WKLA 3W88A 3LRMA 2WMGA 4AMAA 3GVVA 5AN7A 3T0DA 3WDQA 4INFA 5K9CA 7TIMA 1O7AA 3E5BA 1QNPA 1UUOA 1VB9A 3AYVA 1DQUA 3H2FA 3RGTA 1KGWA 1LRQA 2YOCA 1WKDA 4UTHA 4H1ZA 3AIBA 4K2SA 1GOWA 2R6OA 3EWCA 3ANUA 2GLKA 1TPFA 3CV6A 5BXTA 5RUBA 1OGGA 5A5WA 2A7PA 3F4CA 3NL3A 1XIEA 1Z42A 5AZ0A 4DO6A 4FA3A 4GUFA 4JTAA 3AWOA 1CTNA 4J28A 1GPWA 3EMZA 2F6XA 1A5NC 4KQNA 4J2MA 3S9ZA 1P0EA 3M5YA 5IHSA 4QLLA 4RZ5A 3T9PA 4EE9A 4Q4KA 1V3JA 4L9ZA 3B03A 2Q3OA 5IOBA 2NUXA 3PVFA 3BMWA 3HIJA 5BROA 3V0TA 2A5HA 4MWAC 3RJYA 4GRSA 5LGXA 2CLHA 3NOEA 2W27A 4L4PA 3LOTA 4P8XA 1ZNNA 3RX3A 1T6MA 4UR7A 3SSZA 3T8LA 2ZUVA 3TYUA 3T1GA 2XWEA 4XUYA 3RPTA 4RK8A 1B31A 2GJXB 5A8QA 3UXDA 3VINA 3I3BA 1KNWA 4FIQA 4YJ5A 4B4HA 5CC3A 4P7RA 2VCBA 2HCVA 2JEQA 2GOUA 4O15A 1B90A 3TYAA 3LQGA 4J3SA 2XH7A 4PH6A 1RJQA 4ZQPA 4S3GA 2R8WA 3MHUA 4US5D 3WNLA 4ZSUA 2V5JA 4JY9A 2VRKA 4Q8UA 4LF2A 3PZVA 4Y96A 4NZJA 5A1AA 1XGDA 3W1QA 5GNZA 2J9ZA 4AW7A 3AXHA 1MEHA 2VFEA 3G24A 2CLOA 4UMAA 1UH4A 1XIIA 1B57A 1TJRA 2DU2A 3GBDA 3RLUA 2A21A 2QVNA 4OE7A 1JAEA 1XCXA 1EB3A 5HPCA 5JIWA 4HBKA 5AC6A 3ARSA 3CAWA 1EGZA 3RLHA 3W23A 1Z48A 1CGXA 4Y90A 1D7FA 1OZQA 1J2WA 3SGUA 1G01A 1A5KC 2Z1VA 2NX9A 3ARWA 4MTVA 3M07A 3WJZA 3O1NA 3CEUA 5DEZA 1Z89A 1M53A 2QCDA 5JH1A 1G1YA 3IVSA 1UG6A 1MVYA 1JDFA 4YN5A 3GWQA 3D0CA 5AYYA 3WIJA 2RJHA 4ZQOA 1PX8A 4NJHA 4JIHA 1ONXA 3R8HA 5CZSA 5FF2A 5CBJA 2YA0A 3NVDA 4FLQA 1A5LC 4P7LA 4IP4A 1E51A 2CITA 2RUSA 4QTGA 1V93A 5K2ZA 1RALA 2ZOXA 2YBVA 4M19A 5DELA 5CG0A 3OGSA 4HYWA 4C6JA 1GVFA 2V69A 2QAPA 1C8YA 5LHEA 4HZMA 1F8IA 2CZEA 1TJ2A 1FWTA 1JFXA 2XINA 5JQ9A 3QYQA 3VIPA 3OLDA 4O1DA 3O16A 2GJRA 4PFMA 3UJ2A 4Y9MA 3P80A 1KA9F 2X7VA 4DPQA 2OSXA 4YCPA 1ICQA 4LEFA 4S3KA 1RY8A 3VNDA 2WLYA 4NRSA 3CLWA 3A4JA 4RUBA 4PYSA 1HJSA 2PCEA 3GDRA 1V02E 3AXXA 2WHMA 1QPKA 4QSFA 3GZAA 2Z27A 3QV8A 3BQ6A 4NI8A 4CCDA 2ZRVA 2E6DA 4DO4A 3VYLA 5I06A 3W2LA 3MSRA 4ZB0A 2CKRA 2DT1A 4MZ1A 2WHKA 5HAOA 4Y8EA 3D47A 1JD9A 4LS1A 3UWYA 1IT0A 4CCCA 5LNRA 4MAZA 5LA2A 4BEQA 2R1NA 4D6DA 3PC0A 2QPXA 2PDWA 5HXMA 2W92A 2FIQA 5T9BG 1VIWA 3WQGA 4AU0A 1LL7A 1Q13A 4FNSA 1H2JA 4OIFA 2ATSA 3N04A 3F2DA 1BVNP 4FZIA 1N7KA 3R58A 5AHNA 4KWSA 1SMAA 4RDZA 4FIRA 4CNOA 5FJUA 1ZAHA 3HJZA 3REQA 4EF8A 4FOJA 1FFRA 4NAFB 5IDZA 3VGGA 3W84A 4IP5A 1XFCA 4R7OA 2WSPA 4D72A 4C6FA 4A3YA 2J7CA 3EA3A 1M6JA 4I8YA 3NL2A 5E1QA 2F2HA 2YW3A 4F2UA 1NARA 1M7PA 4FR1A 1R3TA 1AA1B 4W87A 5BWFA 3HJEA 1FRBA 1QNQA 1E1CB 4C6OA 5C2XA 2GVLA 3CWHA 3EA2A 1XG3A 1TELA 3TUUA 1ME8A 1XRSA 1XLFA 3BJTA 3PBGA 5L6UA 3MUIA 1H0GA 2BVDA 1XIJA 4XX6A 5LHFA 1QNSA 3PAOA 3CV7A 4DB7A 3L12A 4LEQA 1XIHA 2W66A 1YNPA 4WF7A 1XCWA 1BFNA 5IDIA 3AJ7A 1W1B1 3RNDA 1S5WA 1EQCA 2C14A 2W63A 3JR2A 4IF2A 3ANVA 4F0SA 1RD5A 4PTDA 4XD5A 1A4LA 3OG3A 3M41A 2YX0A 2J79A 3VIKA 3MUY1 4AC7C 3NVTA 1ONWA 2VURA 2X1TA 4OWGA 1UHVA 1IHIA 1BTMA 3W71A 4HNVA 2PDIA 4XIAA 5CG7A 5CPTA 5BCAA 4OKDA 5AZ1A 5BMWA 3L4UA 2ACSA 1V0KA 3B4UA 2XTKA 4HNLA 2AQVA 2X0YA 2E9LA 3SM0A 1XLLA 1B3XA 5I3GA 2VRJA 1E4MM 4WKAA 2PTDA 1TR1A 5H1WA 1LZOA 4UFLA 1VC4A 4UTFA 1SZEA 2GDUA 5I6SA 4ERGA 3I68A 3QR0A 4AUBA 2PGEA 2RDXA 1KWKA 1F4HA 3MBDA 1POJA 3GYCA 1XLCA 2YLAA 3IUHA 3CWNA 3PSVA 4H6RA 3VKJA 1V3IA 2E68A 3CUGA 3ZR6A 1I60A 4PR4A 1U2YA 1UR4A 2WSYA 4F40A 5A6BD 4J2PA 3WQ4A 4CU7A 3NA8A 1KM5A 3PK7A 3RM9A 3CASA 2OXNA 4DN1A 2VC6A 2W61A 5K7JA 1KCXA 3U6WA 2DVUA 5JIPA 3BW2A 3T42A 3Q94A 3KTCA 4R53A 4E4UA 3QV7A 1T7LA 4EAMA 4CEUC 3SQMA 4DI9A 3SBFA 7XIMA 1UR0A 5F4WA 2XSAA 2BOGX 1GQNA 1H4PA 4LAMA 3M4HA 2F38A 4N9CA 3T05A 1CXLA 3KRBA 3Q45A 4YTSA 4R7WA 5KSWA 1OYAA 4XAFA 4YPJA 4QCEA 4MPKA 1X6LA 1E6NA 2YKKA 1VENA 2Z1WA 3KRZA 3S1UA 5B80A 3CHFA 3MPGA 3SUWA 3MI2A 3OBAA 3U2ZA 1KGXA 2ISDA 4BKNA 4A3QA 3I65A 1W9PA 4EANA 3T0CA 3WENA 5A6BA 4EKJA 1TPUA 3A4AA 1WAWA 1C29A 4ZO6A 3SADA 3SQLA 3TE9A 2VX5A 1NIUA 3C3NA 2BVTA 3ARUA 3VZXA 1C91A 4ZBCA 5C9WA 2Z25A 3PANA 3O07A 5G4WA 3GR7A 4XG1A 5H2ZA 2WJZA 1VBGA 3W26A 2HBVA 5LGZA 1EGVA 3EOEA 3VCNA 3TA6A 1UR2A 3CV2A 3GIPA 3PAJA 3QY7A 2KZHA 3L4YA 1GEQA 3WK3A 1EUAA 4IXXA 1EC7A 4KGLA 4AIBA 4MSSA 4M1RA 1RA0A 1WOBA 2QW5A 5EA9A 1DORA 2QCHA 3KTSA 3LRLA 4KF1A 5M03A 1O95A 5D9MA 4X9YA 2V81A 4WHBA 1UWQA 2YZRA 3QTPA 3MCOA 1SSGA 2OMAA 3ME3A 4B16A 2OEJA 2W9MA 2DJLA 4PUWA 3SIMA 4H9XA 4LCSA 4UNLA 4BQ5A 1U1JA 1OCNA 3M43A 2UY2A 1GCYA 1V3LA 3UPMA 2ZE0A 1XQLA 4NJIA 5E6YA 1S3HA 1O1ZA 2ZICA 3WLMA 1KCKA 4GZ7A 1OWQA 2YCLA 3U2CA 2Y2WA 3VPLA 1I0DA 5GJPA 1NELA 4K6AA 1YDVA 4WJEA 1XYFA 3COTA 2D0FA 4GXMA 1OFAA 3CEPA 4DVOA 4X60A 4DWSC 5T91A 4L1WA 3B3DA 4PUEA 1P43A 1Y8BA 1Q2RA 3TQVA 2D3LA 3AXMA 3KL0A 5ABFB 3KVKA 2PGWA 4J3UA 1TWZA 3ALGA 4K68A 3WUGA 5HR7A 1VFOA 4H3DA 5AHIA 2VDIA 3NZGA 4IJCA 1KFLA 3IV8A 3K1DA 2HROA 3OBEA 1K70A 2O0TA 4EACA 4LAKA 1GVRA 2FVMA 2A3EA 1HL2A 2FMOA 3VMPA 1F4AA 1KM6A 3QV6A 2CNCA 3S3GA 5CBIA 4XZNX 3GM8A 1IR1A 3NO1A 1P5BA 5I0DA 3E2RA 3KVLA 1NH6A 2G97A 3DH7A 2PRLA 4AHOA 3UWUA 2JBMA 1BYCA 4RNHA 3MUAA 1TJ1A 5AHLA 4M81A 3SN4A 4GJJA 5LIYX 4YIWA 2DJXA 3DFTA 4PB5A 5EMLA 1CDGA 5GQBA 3G8EA 1VYRA 4WXYA 4IQEA 1LUCA 1CNVA 1ME9A 2G3NA 4PBFA 2VEMA 5A6JA 4LRTA 3T07A 4MKNA 1EO7A 4IP7A 4ORIA 2C1IA 1S38A 2HE8A 4GE8A 3N4FA 3O8AA 4JX5A 3WNNA 1B30A 3LENA 3TYBA 2XJ7A 5GJNA 4Q7BA 2QS8A 1UZ1A 3VGFA 4AHQA 1UZHA 3QTGA 3SFKA 1C7SA 3TMLA 2HXTA 5I3HA 3EX4A 3LBMA 4HA3A 3BUVA 3FVMA 4L9YA 1K9FA 1HO4A 1K1DA 1OFRA 1C9WA 2Z26A 4AD2A 1JGMA 4ZTXA 1FDJA 1OT2A 2R1LA 4W93A 3UZ5A 4JFWA 4PEKA 3TQ0A 4MJZA 2ZVIA 3WN6A 2H9AB 2WNWA 1K9TA 2FZ9A 4S3JA 1Z69A 3MW7A 1WCGA 3AS2A 5IM51 5MHBA 4N9DA 1FCQA 2RFGA 2VGFA 3MUCA 2PDQA 1LM1A 2YPIA 4P5UA 2Z00A 3SJ3A 4IMAA 4A05A 3NDOA 2FZMA 3P0XA 2ZRZA 4HZ6A 1A5OC 2FKPA 1NJJA 4DUXA 2GUBA 1E0XA 1YXYA 2FTWA 3VUSA 3KP0A 4R7JA 1WP6A 2GQ3A 4D8AA 2PDLA 2YL6A 4PFHA 4QGCA 4Z0JA 3OU8A 5BXRA 4HGXA 1QWGA 2OCZA 2BBFA 2ISSA 1E73M 1GVIA 4P8UA 2WJDA 1PSCA 3T44A 3OVPA 4RZ4A 5HJYA 4PCSA 2DSUA 4AY7A 3TK7A 3FS2A 1EKOA 3S1WA 3QPYA 5ABGA 3THCA 2ZRYA 2C13A 4BWLC 1UKTA 3ZZ1A 4Q8VA 1QMLA 4HD5A 4O16A 1LOLA 1FWIC 2D2HA 4AX6A 3PPCA 4S1FA 1P1MA 3R12A 1XKYA 3MC5A 1TPVA 1XH2A 4WRHA 1VCVA 1V4YA 1WXYA 2CBUA 1TV4A 4GYFA 3VNMA 2IMRA 4E8CA 3N2BA 1K4HA 3RLVA 2D73A 4LUTB 4H6QA 3FCPA 5EU9A 1LWHA 3PPFA 5I3KA 2H8ZA 3QOKA 2PDPA 1W3JA 3AXKA 3DYOA 2WJFA 3PTMA 1ZP3A 4NZ5A 1MWOA 1V0NA 4JIQA 3MANA 4IFOA 2PWEA 3EKLA 1BXBA 3BG3A 4QE4A 4W5UA 5K9DA 2HBXA 4LCQA 1GPFA 3SURA 4GCAA 1UKPA 3EX6A 3FK4A 1E4LA 4GQQA 3GFXA 3CC1A 2H8XA 3ENLA 4O8RA 4FX8A 2E8ZA 1E1FA 4XBKA 2IPJA 3WL0A 1V77A 4LBRA 3MCNA 1AL8A 3MUZ1 1TTQA 3ZLGA 3VOJA 3MMWA 4M3PA 1K4GA 2EGZA 1JPKA 2V63A 1E6PA 2PBGA 3M6YA 3ZJ8A 4GO9A 4WGHA 1BGGA 3S47A 2BXYA 5EMMA 1EDTA 4Q6JA 4D6IA 1KBLA 3SRDA 4CGTA 3KDNA 3NURA 1MW3A 2CPUA 3FDGA 1BSLA 5T26A 2YA2A 1ADOA 1ML1A 4LYKA 2NW0A 3R25A 1ZJAA 1JZ6A 2ZXAA 2EPHA 1ZQ5A 3O3RA 5CPOA 3BG9A 4N9BA 3LX9A 5I07A 3TNOA 3ZT5A 4V1XA 3T4CA 3BCDA 2HVNA 4NSBA 4XKYA 2B7QA 3KCLA 3OEXA 2FPYA 4B4FA 4HKPA 4GY7A 4QP0A 5D2WA 3QSTA 3JRKA 3BQ5A 1ISWA 2GK1A 2PRHA 5HMFA 3FYPA 1PDYA 3MI6A 2GVJA 3CHEA 3VD4A 3F5LA 1UD3A 2PDNA 1TJ0A 4TX6A 2VFHA 2ON3A 2WWDA 2WO5A 1W1TA 4J4KA 4QEEA 4JOMA 3B9AA 3CIWA 4O8AA 2DQXA 4AWTA 3H4GA 2D2OA 3POCA 4MDOA 1YBQB 2AGKA 4A3HA 4RDWA 4JIRA 4IPIA 4BJHA 1ZRQA 3IIOA 1T99A 4HTBA 2VTFA 3WQVA 2P10A 1GG1A 3RJXA 2PTWA 4UNKA 4ROQA 4C1NB 1RK6A 1TPC1 3KWSA 3M0MA 2JK2A 3WF1A 1XCFA 3QZ6A 1J9YA 1YEYA 5FACA 1R3WA 3AISA 3WX7A 4W9TA 4TV5A 4PL1A 1JCTA 4Z17A 4O54A 3WJYA 4JTEA 1DQXA 3V16A 3L5MA 2NT1A 4NJJA 4GUGA 1YBQA 4BY3A 1SGJA 3VKDA 3L4XA 4RV3A 1GOKA 3O6YX 4LV9A 2VD9A 4HHMA 5C54A 1QASA 1KLZA 3UVIA 4DNHA 5D2VA 4GG9A 3TDFA 4BR1A 4DO7A 4DUOA 1IR2A 1NF7A 1JRBA 4AY1A 2VEKA 1XSJA 1FWCC 3O6AA 1UOZA 4QJ4B 4P7OA 3VMOA 1PTDA 3WNOA 1UKQA 4IGMA 3ZWSA 4JTLA 1E1EA 2E0PA 3UU0A 3UESA 4E38A 4HCHA 3VNYA 1PO9A 3HQPA 4PUDA 2OOFA 3ECQA 3TYZA 4GO8A 3TTYA 1YPIA 3AMDA 3KRSA 3ZR5A 3TU9A 4GX9A 1ZAIA 3GDTA 1FCVA 3ARQA 1MEIA 3R8RA 1N8WA 4M24A 1I6NA 2DIJA 1W56A 4TR9A 3E0VA 1D2KA 1JUBA 4GD0A 3K2GA 2WMFA 5CGTA 4ZENA 5K3VA 3IGUA 4UBPC 4D2JA 4EWND 3S8HA 3BL3A 1V7YA 4WSKA 3DGRA 1JF6A 3QGKC 4ZE5A 7ODCA 1E0VA 5HULA 3HFTA 4ATLA 3RPMA 1B2YA 4W7WA 3WBYA 1EZ2A 3GX9A 2FMNA 2OYKA 3N19B 2PWVA 1XICA 4DEFA 3CJPA 3CS2A 4CU8A 1EEXA 2GVGA 4I7VA 3VFLA 1XISA 4LUSB 4PB3A 5A8MA 2A3BA 3F4VA 1UWIA 3GVRA 2ISFA 3PSWA 5K4ZA 3NQ2A 4DAIA 3N13A 3RXZA 2WV8A 2PDBA 3A13A 4NUWA 3W01A 4QNWA 3KDOA 4ZXLA 1ENUA 3W7GA 2OJPA 4J3TA 2E6FA 3LCGA 4DJDA 3NG3A 2KAUC 1K3UA 1QOPA 4XZ9A 1PS9A 1UMYA 2DW6A 4C60A 3EX3A 3LCFA 3MBFA 1EJRC 4NU7A 3GFYA 1DE5A 1WZKA 2BS9A 1LDCA 4JS3A 1QHPA 1Q66A 1H7XA 4D1JA 1EOMA 2O7QA 2WWCA 1RK5A 4FEZA 1UBPC 3UYCA 3WBAA 1WPCA 1F5ZA 2L5HA 2EG7A 3PZ9A 3GO2A 2ZFAA 1NDVA 2WC7A 3QW4B 4DIAA 4KRTA 2PF0A 1JYXA 3H2MA 2GZXA 3AHTA 3C86A 1TJPA 4PTMA 1EH9A 3R94A 3TC3A 1FXQA 4D6JA 1CZ1A 5CBBA 1ICPA 1SPQA 1OK6A 2YBUA 4YTQA 1WBJA 2QCGA 3S6DA 1ISZA 1V51A 5B7ZA 3CUHA 1SUXA 3LPFA 3VCCA 3VGEA 5E0KA 4ATWA 2NUYA 1DJZA 2PEVA 2FQIA 3OTRA 3VD3A 2QPUA 2XN0A 1PV8A 2NQZA 3PB0A 4Z1DA 3FEQA 3W1PA 5B7YA 4IXHA 2E1WA 2EPLX 4R9OA 4G8TA 1H7WA 4WJXA 3A64A 3LMYA 1ODZA 4D6FA 3OPSA 5HNNA 1W8GA 1TX0A 4LUSA 2E8YA 1OX5A 4HNCA 1TWSA 2GJPA 3TKFA 1EZWA 1SR0A 4JN7A 4E6MA 1NWRA 4PBEA 3KBNA 3WH6A 1P7TB 4IMCA 3LBOA 1EF2A 2BMBA 3APYA 2BV9A 2Y8UA 1D3HA 4W5ZA 1VCFA 3RYSA 2P88A 4LY8A 3KXQA 3KAOA 4OOZA 1GKRA 1UJQA 5E9AA 3H2OA 3LSCA 4Q8WA 5EMYA 3ABXA 3FJ6A 4ZTYA 3G3DA 2DZPA 4JNMA 2V30A 1MDRA 3N25A 3B04A 2WM1A 2Y8VA 4HSOA 4AVFA 4GI8A 3SCQA 2OZ8A 2Z7KA 4O13A 1SW7A 3ZSTA 4XD6A 4RW5A 3PM6A 5EFFA 2Y8KA 1GJUA 3AQUA 3R0KA 4Q7NA 3PG8A 1H7PA 1MDLA 1L6SA 4X22A 1TG7A 4QE1A 4S3BA 3GTXA 2WNZA 7ENLA 4XVDA 4BHYA 2V2CA 1JYVA 1CGWA 4O53A 5BNKA 1X1ZA 4BFAA 1EJVC 2CESA 5A69A 4DX3A 4W7VA 1J8VA 3E02A 1SJDA 2R24A 1VR6A 1RBLA 4DBUA 5E5CA 4U4MA 1PIGA 1V7AA 3TTOA 3AXIA 3K1GA 4CCZA 2Z0IA 3AU2A 4UB9A 3KBMA 3VM5A 3U4FA 2YGYA 1WZMA 2OVLA 3P81A 2G3FA 4NY2A 4GI4A 3WLNA 3S9IA 4MKSA 3MKVA 1JCYA 3HFYA 5HUPA 2Q71A 4U5IA 2V3EA 3KCOA 3DX5A 2WZMA 3P67A 2P1FA 4QSHA 5CC5A 2D23A 3THAA 2QF7A 8A3HA 1DWHM 5D9PA 4I5UA 4YXGA 2QDEA 3VD5A 3QM3A 1TFVA 4UIOA 3MHGA 1CLXA 3TW6A 1J5TA 4QIUA 2Z6IA 1E6QM 1Z3NA 1D7KA 1GOQA 5H8MA 1BF6A 4JTDA 1WA3A 3U4AA 1H62A 3DKJA 1KGUA 2PF8A 1K02A 3TXZA 1YLVA 2OEKA 3QXBA 4L64A 4YVXA 1VYSX 3ITCA 4JCLA 1HFBA 3N4EA 1OQFA 5KZMA 1UIPA 1QVBA 1SQ7A 4GI9A 3SR7A 4F0RA 1DVJA 4IFRA 5KZDA 1I0BA 3EAUA 1QNVA 3B0VC 2PLJA 1DPMA 4H8UA 1EP2A 4LAZA 3CZ8A 3P60A 1KKOA 4JTUA 5AHEA 1OF6A 1TV2A 4MUZA 2PCQA 5I02A 2XHYA 2VEFA 5HATA 4DNMA 2J27A 2WZIA 4UTKA 2F2KA 4DBSA 2WCGA 1R47A 1PHWA 4FLRA 2BGQA 4NX5A 3WK2A 3VA8A 4V33A 3CTLA 3UNDA 3WH8A 1KQYA 4YWIA 1DKWA 1ZL1A 3BC9A 1FWAC 5DX7A 3SN0A 2NLIA 3THDA 2Q8XA 3TSDA 1ZCCA 2ATMA 4YLWA 4GWEA 4ZCWA 4AF0B 2A7RA 4I7UA 2I5GA 1QXLA 3PZIA 4BQ4A 2AQOA 3GIYA 1A5AA 6REQA 1FKWA 4FR6A 1HGWA 1KM2A 3RIKA 3I6TA 4LAUA 1SJBA 1FH9A 3KOZA 1PHQA 3LCHA 5HMSA 5HMEA 3VIFA 1PJ9A 4LXFA 1EJUC 3QGVA 2J7FA 1V6WA 2EAWA 3LERA 4JIPA 1P1XA 4H7CA 4TV6A 3KL5A 2GJLA 4Z2GA 2Q02A 2YBTA 1W32A 3H7UA 3P74A 2A3AA 1EC8A 3FW6A 4UFHA 3KW3A 4O4VA 3KBJA 1FFQA 2X0SA 2WMJA 3KOYA 3PTKA 3WQ6A 3V1HA 2FDMA 3H6OA 4QM1A 1OF8A 5EYWA 3GS6A 1JDCA 1K9EA 2DZBA 3RPDA 2VYOA 4IIBA 2OWCA 2KX9A 3IGXA 2OB3A 2BX7A 3L67A 3OGRA 2DIKA 3GXFA 4KKXA 5GPRA 7REQA 1XD1A 4DZ5A 1BWKA 2GDVA 1W1YA 3PWIA 1WX0A 3B05A 4QS5A 1NF0A 2PDYA 5LKYA 3BH4A 5LXEA 1PKYA 2ZA3A 2BOEX 2JALA 3S46A 1PE1A 1YPFA 1XV8A 3FYYA 1QI0A 1XWYA 4PCFA 4GYKA 4LWWA 4O57A 1DIKA 3HGOA 4CD4A 3F4WA 2VX4A 5EY5A 1JCMP 2Y1HA 1MZRA 1RUSA 1LQ0A 4PL2A 4JKLA 2AAMA 3KHDA 1CT5A 3U2EA 2QIIA 3BCJA 1A0DA 3LHVA 1I1WA 1Q7QA 4HYVA 1DWFM 1XLHA 4I9AA 4UXDA 1M04A 1NSJA 3R13A 4B3ZA 1E40A 1FY6A 4MHBA 1UQZA 2GQ9A 3AYSA 3R11A 1IXPA 2DH3A 2OO6A 5HINA 1FWSA 1CPUA 1A53A 3SGGA 4HMCA 1GG0A 1YKWA 2VR5A 1SVDA 5LIKX 3ELFA 3M0YA 3QHMA 1LJYA 2YL5A 4KH2A 3G1HA 1Z9AA 3DHUA 2GOKA 4ZOBA 3DFNA 1ECQA 3W25A 1JI1A 3T2OA 3M0KA 3LHWA 1EL3A 1UOKA 5HDRA 1MZHA 3ORWA 3E2SA 5I23A 1OGSA 1QPOA 1HXJA 1V02A 4JHZA 5DMLA 4LBUA 3PTDA 3LPPA 3HN3A 3S5ZA 3WLRA 5CQ1A 4GX8A 4KPLA 1GHSA 1H3GA 2VGBA 4D1IA 4DM1A 4IWWA 1MNSA 4J35A 1OYBA 1VFHA 4IFKB 1Q6DA 1D8WA 3GTNA 1JQXA 3R5EA 2PBOA 3C2RA 2E9MA 3JU2A 2JKAA 4IMGA 4K3ZA 2HE5A 1PZ3A 1E0TA 1PIFA 3MMTA 4C90A 1F6KA 1ZHAA 4XQ6A 1KWGA 1JUKA 4ILSA 3DFQA 3QOMA 3V18A 4H2HA 4QISA 4GFSA 3C8FA 4GIAA 4Z2IA 2DSKA 2OKOA 3RHGA 2OYLA 1U1UA 5TNVA 4BF5A 3RF9A 2J6XA 2ZRXA 3AYTA 1TVLA 3AZTA 1EFZA 5E9XA 4KCVA 2LLEA 1VFLA 1E5NA 2XH0A 2VXNA 1Q6FA 2GUUA 5J5DA 2OEMA 2XIIA 4LALA 1W3TA 5FJTA 4JKMA 1S3TC 3EMQA 2CLPA 2WCSA 2WZHA 5JVLA 4DQWA 3C2YA 3P93A 1VH7A 3PPGA 4NRRA 2HVOA 4JFVA 1K8XA 1AUSL 1BGAA 2D22A 2JF7A 4PRWA 1PIIA 1J5SA 4BWLA 4ROPA 1RA5A 4AYSA 4FF5A 5FSEC 3RMEA 1S2VA 4ACYA 3NYDA 3USZA 5J8LA 1S2TA 1JG9A 3KUMA 4EAYA 1UMLA 3OODA 5EPDA 3VIHA 6CGTA 5H91A 1PB0A 1VBUA 1XBXA 5F4XA 5I09A 4IOTA 1L6GA 2VCAA 3PZOA 3VOHA 4YWSA 4FXJA 4WDXA 2ZXDA 1BRLA 1GOOA 1HKVA 2GVEA 1QHZA 2ZC1A 4B3LA 1VFFA 2X42A 3V75A 3A12A 4Q4PA 4GZEA 2IW0A 2TYSA 4A2RA 3IIPA 2OELA 4CVUA 1RJPA 2WMKA 3WJWA 2ZX6A 5HJXA 2VFGA 4CNTA 3SCRA 4RJEA 2QDGA 4AZCB 5D03A 5I24A 1REQA 4HU0A 2XN2A 3G2GA 4PODA 1VPYA 1S39A 2OQYA 4C91A 5XIAA 2W3ZA 5DY3A 3QN3A 5CZJA 4ZB5A 1MQQA 2WHLA 2AGTA 3MTWA 4RL3A 1R3VA 1ZZMA 1K8CA 3GG1A 2H3BA 2DY3A 3IIVA 2PRMA 2RDWA 1GZ1A 1PL9A 2E7FA 3SCPA 4GCXA 1OC7A 1GVSA 3TFCA 1W3NA 3VE7A 3A47A 2OSWA 1TTJA 1P6CA 2QUVA 1I75A 3TAOA 2CC0A 2EPMX 4AD4A 4K7VA 5A6TC 2DT0A 1V03A 1M7JA 5A8OA 4TX9A 2RAGA 1NFBA 4IPPA 4KCWA 2HSAA 3GH7A 4J3WA 2HMCA 3IEBA 1H60A 2BG5A 3R4IA 5CC6A 2NSXA 4O1BA 2RDTA 3PWAA 3FXGA 1XBYA 5D33A 4JTTA 3NAVA 3U57A 3NO3A 1GONA 3E1F1 4ACZA 4TOQA 3NJ3A 1BTCA 3ZVIA 2NV1A 2XGBA 5TQLA 2Y62A 2XZ7A 4FALA 1WUFA 4QG9A 3ZVHB 1A0EA 3AHZA 3L0NA 3ABRA 4L6DA 1OBAA 5DO8A 3RO8A 4MLRA 1VFMA 3AALA 4NX0A 2RJGA 5BYWA 3CHDA 3IIXA 4HOXA 1R3YA 2G50A 3GW0A 4MGGA 1EJSC 4Z2LA 4R88A 1LYXA 1CCWB 3EWDA 3DFHA 2X1SA 4MY1A 2GK1B 4H8HA 5A2BA 4LCRA 5F1UA 2QVHA 5G1TA 4MAVA 3WNKA 4AC1X 4HQVA 3B40A 3CM4A 4RV8A 1L6FA 3RU8X 2VX6A 4C6CA 2WKJA 5JBDA 4MPQA 1XM3A 2QCLA 4PMYA 1EOKA 3HM7A 2DIEA 1UR3M 3OLGA 4AISA 3JZUA 4G5DA 5KMYA 4O52A 5DT5A 4PZVA 2JF6A 2J74A 3HMJG 4W8LA 4HHLA 2VR2A 1IWBA 3SCVA 2A3HA 1TX2A 3RAOA 4IIHA 3UCQA 3WQWA 1PZ0A 3UD6A 1GQKA 2NX1A 4GYPC 5A6AA 1EWDA 3AWNA 2Z1KA 4J7RA 4CN6A 1D3CA 3KM8A 3QV9A 1OY0A 2QKFA 3FY1A 5KITA 2ZDRA 3B0XA 3B06A 3MY9A 4EXBA 1LRTA 2P0IA 1J18A 5LNWA 1TWDA 4C5ZA 3CAVA 1UWUA 4S3CA 3IACA 2ACQA 3GTHA 5C7HA 1GT8A 3PNZA 4IGNA 4IH3A 3AYRA 2J7DA 3MSYA 1ZCOA 2FPVA 4RLIA 2HWGA 2PLKA 1JGIA 4JQ4A 5BW6A 1K7FA 2PP0A 4J5NA 3GVWA 1K6WA 2HK0A 3QC0A 3FFSA 3SGZA 4O0QA 3S9YA 3NSNA 1SFJA 3TZFA 1BWLA 3O15A 3RMJA 3WD3A 4R34A 1DV7A 1QO5A 2QJMA 4O1FA 4LB4A 4C1LA 5AFDA 1OZMA 3BLKA 3GDKA 4GGHA 2HPMA 3GU9A 1UBSA 1EDGA 4LB3A 3NTYA 1JVNA 2NQHA 3T6CA 1WV2A 4LV4A 1ZY9A 3IIZA 2CBJA 3A5VA 2C1GA 5FIPA 3VDGA 3GRIA 3QYSA 5JH2A 4Q8QA 1X6NA 3CPGA 4XWUA 3F4NA 1DHPA 1LWJA 4QQ3A 1XYMA 3CWOX 9CGTA 3G0UA 2FB3A 1U5VA 3TWAA 1Q3NA 5D05A 1U5JA 5C6MA 5M17A 5M3WA 1OIMA 4HTYA 3EB3A 2Y7FA 1BLIA 1Q6OA 3NQMA 4NJGA 2V3GA 1OFBA 2YIHA 4CUCA 3POHA 5D09A 5I5RA 4JQ2A 3MU7A 3WNMA 4D6CA 1XYCA 3UZXA 5D9OA 5MKGB 2ZVRA 3O0KA 1TPB1 1IGWA 3PJXA 4PUUA 3BURA 2V82A 3EOSA 1RBAA 2I5IA 1X1NA 4JL2A 3IVUA 4IIDA 3CNYA 1LG2A 4XO7A 3MO4A 1GZGA 2D0HA 3PZTA 2J7GA 2CZFA 2V8ZA 4MNKA 4IM4A 1Q2SA 3W75A 3SN1A 4ZSTA 3ES8A 3OVGA 2QDHA 2QIWA 4HHHA