4YN5A

Catalytic domain of bacillus sp. jamb-750 gh26 endo-beta-1,4-mannanase
Total Genus 146
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
146
sequence length
391
structure length
391
Chain Sequence
IPKDSEGQSFKLVDSNASTLTKSLYAYLQDTSGRQILFGHQHAVDEGLTLTNSGDRVGSTQSEVKNAVGDYPAIFGWDTLSLDGYEKPGNEKNSQAQNRANVVQSMRTVHELGGIIALSMHPENFVTGNQYNDTSGDVVKNILPDGSHHEVFNAWLDNIAAFAHELTDQSTGELIPVIFRPFHEQNGGWFWWGAQTTTASEYKALYRYTVDYLRDVKGVNNFLYAFSPNAPFDGNLTQYLRTYPGDQYVDIFGLDQYDNKANAGQATFLNGLTQDLAMISKLADEKGKIAAFTEYGYSPQGFNETGNYLQWYTAVLEAIKKDPNASRIAYMQTWANFGYPTNMFVPYRDVNGNLGGDHELLPNFVEFYEDDYAAFLTEASGWNLYQDISTI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of Bacillus sp. JAMB-750 GH26 Endo-beta-1,4-mannanase
rcsb
source organism Bacillus sp. jamb750
molecule tags Hydrolase
molecule keywords Mannan endo-1,4-beta-mannosidase
total genus 146
structure length 391
sequence length 391
ec nomenclature
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02156 Glyco_hydro_26 Glycosyl hydrolase family 26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.20.20.80 Alpha Beta Alpha-Beta Barrel TIM Barrel Glycosidases 4yn5A00
4QFUA 2OLHA 3QOMA 4AY1A 2VCAA 2PBOA 2CBVA 1JZ3A 4AXNA 5DMYA 4PTMA 4PSPA 5JBDA 3ARWA 3W29A 1VFOA 1WZKA 3AS1A 1AQMA 1EA9C 1K9DA 2CHNA 1OWQA 1GHRA 3CHEA 4TUFA 1NWSA 2QMKA 2IUZA 4W5ZA 1CZ1A 1K9EA 4GQRA 1KGUA 3WUGA 1KXQA 2G3JA 1CENA 3PZUA 1V3LA 2ZWYA 4CKQA 2GDVA 3UEQA 2DIJA 4J3VA 4ML4A 2WLZA 5CLTA 5C71A 1UD6A 3BAJA 4WKAA 3PZ9A 1TR1A 1F4HA 1V3IA 1KGWA 3A6OA 1WDRA 4W7WA 4UQ9A 2W66A 1J11A 3W6LA 1PJ9A 1GQIA 1HNYA 3T2PA 1PIFA 2WM0A 5E6ZA 3M7SA 2Y8VA 3SUSA 5I78A 1HX0A 5ABEA 2CITA 1W3JA 4MJ4A 2XYLA 1J9YA 1W32A 3A4XA 1OD0A 2A3HA 4D1JA 1SMDA 1HKMA 4UCFA 4OIFA 3ZJKA 1M03A 4X0VA 3ZT7A 3WBAA 3IAPA 2VR5A 2GSJA 1Q6DA 3AZSA 3G6MA 3WMBA 4UOQA 4L4OA 4LXFA 1E72M 4U2YA 1HP5A 2XVGA 4LX4A 1UWUA 1Z32X 4DWSC 4JCLA 3AMCA 2D0FA 4CU7A 4EANA 2VZSA 3PTQA 4U33A 1JGIA 3I3BA 4MDOA 2HVMA 2PC8A 4P7NA 2XVKA 2VX5A 4AD0A 4UFKA 1KR0A 1XYFA 2J77A 3AFBA 4XV0A 5A6BA 2WXDM 2WVSA 4UFHA 3VGBA 4D6DA 3RIKA 3VGHA 3FAXA 3WBEA 2W91A 4BS0A 1F4AA 4HZ8A 2WZHA 2G3IA 1Q6FA 3WEMA 4CCCA 1UKSA 3CO4A 4PMYA 5FOOA 4OJYA 1ITXA 4NZCA 5CXPA 3WL0A 1V0LA 2ZX6A 1CGVA 1ISYA 2VVSA 3WH6A 3ALFA 4B3LA 1IV8A 4QCFA 4BQ4A 3D5HA 1V3JA 1R7AA 2WVVB 1QI3A 1V3KA 4N42A 3EMCA 3DYMA 2F8QA 1R85A 2XSBA 1QNOA 5M3WA 4QDMA 4AZCA 4AWEA 2J7DA 1FH7A 2YDSA 2W5FA 2BNJA 2GVYA 3ZT5A 3W53A 1W3LA 5FD0A 2PF0A 1DWFM 4B15A 3AHZA 1ZBCA 3FAWA 2DEPA 1QW8A 2E9BA 3PBGA 4M1RA 4CUCA 1UKPA 5BXTA 2OWWA 4TVCA 4HOZA 2YA2A 1PIGA 1KXVA 1CXIA 3AOFA 1JZ8A 1EDQA 3WQ8A 4Z2LA 3CZLA 5HPOA 3WDIA 4WIWA 3WMCA 5GNXA 1G01A 4WSJA 4JFUA 1W9PA 3CZEA 4HMDA 1VB9A 1LL6A 3M07A 2X1IA 2FHFA 4WKHA 4CD4A 1OB0A 2Z1SA 5D8ZA 4UFIA 1KBKA 4P8VA 5FL0A 3AMLA 3OIHA 3NYDA 1HJXA 5A6MA 4AW7A 4CVUA 2YL8A 4PYSA 1DWIM 2UY3A 4YHEA 2RGLA 7TAAA 2YJQA 1E4NA 1R87A 1D2KA 2CHOA 2X0HA 2V3DA 1ISZA 3VIFA 2WVTA 1E3XA 1GHSA 2OSXA 3ARTA 4EKJA 2WHKA 3AMGA 3K4AA 1E6NA 4BCEA 2PWFA 1OINA 4U5IA 1E0WA 1XSJA 4FLQA 2BHZA 1CGWA 4D6CA 4F8XA 4KMQA 5HPCA 2VMFA 4JFTA 4PMRA 1ISXA 5CZKA 3NUKA 1I1WA 4B16A 2JIWA 3K8LA 4P7OA 1E6ZA 4R27A 3A47A 3AS3A 3SUUA 3T08A 4J3SA 3L4TA 2WB5A 1NH6A 4XB3A 1BYBA 3ARXA 4UQCA 2FGZA 2WWCA 4OUEA 5I3DA 1C8QA 3VIKA 4ATWA 2VX6A 2GUYA 4LPCA 2PWDA 1XCWA 1QVBA 3ZOAA 1ESWA 3J7HA 2GK1A 3AHTA 1C3FA 2WK2A 1HVQA 4PCTA 4AZIA 3BAWA 4C7FA 3WNLA 1E70M 4GZJA 1E43A 2BY0A 3VNZA 2QLYA 3SCWA 3WNOA 4OBSA 1GOKA 4EE9A 1G0CA 1HJUA 2QF8A 3OA5A 3WD3A 1WDPA 2OSYA 1BAGA 5ECUA 3F4VA 4JL1A 2ZUUA 1A47A 5DT5A 1BGGA 1GCYA 5HXMA 3AXHA 3KL5A 5HOSA 1B3ZA 1CECA 3MV01 1EO7A 2J47A 4W85A 1LLOA 2D0HA 4D72A 3SUTA 1X6LA 1A3HA 3O2LA 4L4PA 1EIBA 1VIWA 3N12A 4D6HA 4CN1A 3GTNA 2XGIA 4KRUA 2CIPA 4H04A 4RL3A 4PCSA 3UG3A 2XJ7A 1P6WA 4OKDA 4JKKA 3VIJA 3CIVA 2TAAA 3ARPA 4AISA 3U5YA 1KCLA 3VGGA 3NJ3A 5EMYA 3N15A 3UCQA 3L4ZA 2ZXDA 2BHUA 3NCOA 2XG9A 2XPKA 1JDDA 3PZOA 1QNQA 4DWSA 2DSZA 1V6UA 2EPOA 1GJUA 1VBUA 1J10A 3AJ7A 5I5RA 4BQ5A 1VFUA 5AYIA 5ABFB 5JIWA 1HT6A 3CLWA 1CGTA 2WSKA 3NSXA 3L4VA 3LPOA 3ZJ7A 3BCDA 3AIQA 3QOKA 1CLVA 2DQXA 1JZ7A 1E6PA 1OGBA 5AC5A 4HZ6A 4BZYA 1UYQA 2ZUWA 1QPKA 1BYCA 4IPNB 4URIA 4W84A 3WENA 2RGMA 5I2UA 2EBNA 3II1A 1EO5A 3T0DA 5FIPA 1Q6EA 4QAWA 5E9AA 2VI0A 5ABGA 1KFWA 2Y8KA 1E4IA 2DT0A 1E3ZA 1KXTA 2EXOA 3NDYA 4AD4A 2V3GA 2EPLX 3W38A 3VDBA 1H41A 4J3UA 1CLXA 3WEOA 2Y2WA 5A8MA 5E0FA 4YPJA 1C8YA 1QHPA 3S2CA 4AEEA 1C8XA 3WSUA 1C90A 3BC9A 3RILA 4MTVA 3EYPA 4UQDA 4MNLA 5A8NA 4JIEA 2XSAA 1OD8A 5I0DA 2EO7A 4CCDA 5EFFA 1W2PA 3OBAA 3VIIA 2YOCA 4GI9A 3OGVA 3BMWA 3DC0A 3SCOA 4W93A 4W8LA 3VINA 2G3NA 5A2BA 1IZKA 4PTWA 2ZX9A 3B9AA 2WKGA 4GXPA 3VIHA 1MQQA 3AIEA 3WQ4A 2EPMX 4H7VA 4U3AA 3GXMA 1G9HA 3CGTA 2GJXA 3TTSA 5LA2A 2AOSA 1XHGA 3AZRA 1B31A 4YHGA 4ZXLA 1VAHA 3BAKA 3WNKA 3FNDA 4AZ7A 1J0ZA 3U57A 3WNNA 2J8GA 1FHDA 2XM1A 2PB1A 4BQ3A 4M81A 2X05A 3RM8A 1BG4A 4Z2JA 5LA1A 1R7OA 1LWJA 1UKQA 1J0KA 5TD4A 4ACZB 1W1PA 7CGTA 1ZBKA 1XH2A 2CYGA 3NSNA 2CBIA 3M6DA 3CUGA 1B9ZA 1E71M 1W9BM 4CN6A 4JFSA 5IFPA 4Q7NA 2VUYA 3WY1A 1ODZA 4WLCA 1AVAA 1ZJBA 5I79A 3AIVA 5HDRA 2WMHA 1QI0A 3AZTA 1NARA 1GVYA 4QP0A 2ZOXA 4ZEPA 3MUZ1 4H8HA 3DHUA 4D1IA 3VGEA 3WQ5A 2VCCA 1VEOA 5JBEA 3IJ7A 1TUXA 1BPLB 3RJXA 2JFEX 2O9OA 3MO4A 1JZ4A 1RH9A 2DSWA 3W4RA 5E0CA 2WMJA 4HPHA 2CNCA 2YDQA 3VPLA 1MXGA 2J79A 5ABFA 4UZUA 4P8XA 1N82A 2ZUMA 5F7UA 4KRTA 5CSYA 5GQBA 3W28A 2IXUA 4V27A 1B3VA 4GO8A 5A6KA 1JL8A 4HA1A 2BY1A 1DTUA 4LYRA 1H1NA 2WBKA 3AI0A 4FLSA 4MADA 1EQCA 3WN6A 3PZNA 3EMQA 5D9NA 5A6LA 1E6QM 3OGSA 3EMZA 3EDEA 4Q22A 1BTCA 2E9MA 5BWFA 4MB4A 5AY7A 3WQ6A 2G41A 3BAIA 3PZIA 1CGUA 1W9VA 3AXIA 1NM9A 2C7FA 3K46A 3AYSA 1XRVA 2A3EA 2NSXA 3RM4A 3VGFA 4JHOA 1CEOA 1FP9A 4PMOA 1WP6A 3APGA 1U2YA 1W9DM 5DEZA 1SMAA 3WNMA 4IISA 4QLKA 5E6YA 5BROA 4XZBA 2YDRA 1B3WA 1UWSA 3CHDA 4F79A 3MS8A 5CG0A 2ZE0A 3SCNA 3ARYA 3ARSA 3VD3A 3MU7A 4GO9A 3SCRA 3ALGA 3BLPX 5A8OA 1ISVA 4BQ2A 2WZEA 4J28A 1HKJA 2WCGA 1OGSA 1E5JA 2GK1B 4QCEA 2WAGA 3GM8A 4HP5A 2W62A 1JFXA 1W3HA 4TX8A 4AIUA 4P7LA 2E8YA 1ZBVA 1UR4A 1OIMA 2CKRA 2QPUA 4B9YA 4IM4A 1CXEA 1BF2A 4LYQA 1UH2A 3CZJA 2DT3A 2BVTA 2J78A 3DHPA 1VJZA 3SCQA 4DUVA 1DHKA 5IFTA 1JF6A 2CCRA 3WUFA 2ZUSA 1JIBA 1EHAA 1B0IA 1VJSA 4WSKA 2GJPA 1LQ0A 4TX6A 2OSWA 1CNVA 1JYWA 3RJYA 5M03A 3EDDA 3WL1A 5A6AA 1UWRA 1W1TA 1EDTA 1GOOA 2J74A 4UQEA 3WDPP 2FGLA 2V3FA 3T0BA 1GUVA 1WZAA 4W8BA 2WWDA 3K4DA 1SFSA 4UQBA 1UR2A 1EGZA 1OT2A 1G5AA 4TVDA 3BAXA 5A8QA 1RPKA 3T2OA 1BVZA 4TVUA 3AS0A 1QI5A 4KGJA 5FKYA 1VRXA 4MPKA 1V03A 3W6MA 1NWUA 3W37A 3VDHA 3ZO9A 3KL0A 4XZWA 1OIFA 5M5DA 4MAVA 3T0AA 4ZE4A 5A6SA 1M7XA 1VFFA 1JG9A 4CD5A 1KBBA 4CU8A 5D9MA 1UKOA 1VBRA 1J0HA 1DWJM 5A69A 1J18A 1TZ7A 2WLYA 2ZIDA 1ODUA 2PWHA 3MUY1 4PMNA 5DT7A 3OZPA 2D22A 3L4WA 2WHMA 1UKTA 5D9OA 3VNYA 4E2OA 2O9PA 3MMDA 1LL4A 2J7FA 3TA9A 3UETA 1H11A 2XUCA 3QGVA 1ZJAA 2VZOA 3WF0A 3WIJA 2DT1A 4PTVA 3SCSA 1Q6GA 3VDCA 1OCQA 3QHNA 5C8BB 2WANA 4ACYA 2QHAA 1HF6A 1WZMA 3OLIA 5E70A 4MNKA 3OB8A 1B3YA 2VZTA 5BXSA 3K1DA 1UZ1A 3AHVA 3T2QA 1MW1A 2JEQA 4E4PA 3CPUA 3CH9A 1J0YA 4UQAA 4AMCA 2WNWA 4XUYA 3AISA 1GPFA 1WDQA 4PBGA 2W4XA 3B8SA 2VZUA 4MJ2A 4BA0A 3W24A 1UR0A 4A3HA 4CD7A 2J7CA 1HJSA 1KCKA 5BYWA 1LJYA 2W61A 3UG4A 1JD7A 1AQ0A 2XGBA 2UWFA 1GOIA 1CYGA 1UH3A 5GNZA 1CXKA 2VCBA 5BRQA 2UY4A 2D3LA 1E55A 3ZJ6A 4NSBA 1BYDA 1V6WA 3MUIA 1GVIA 5CSUA 2VL4A 4D6EA 1MFUA 3A4WA 1JNEA 2XVPA 3S6TA 3VVGA 4W7UA 5IDIA 1UR8A 1C91A 1K6AA 1H49A 5CQ1A 2JEPA 4UR9A 1CDGA 2O9RA 1TMQA 3SCUA 1LF1A 1BVNP 3GBEA 1US3A 5EBAA 1QI4A 2ZXAA 4M56A 1XD1A 3OLGA 6TAAA 3AYRA 1W1VA 3TONA 1X6NA 2QV4A 5FCZA 1UR1A 4P7QA 3D3AA 3KEHA 2J7GA 1UD4A 5GNYA 3TTQA 4V2XA 4ACZA 4S3KA 1JXKA 2XFFA 4HA4A 3VOCA 3SCVA 1HJVA 3WFZA 1GQJA 2ZX5A 5A3HA 1AQHA 1R8LA 2O9TA 2YKKA 1CGXA 2BVYA 1PEZA 3ARVA 3WDJA 3UR7A 1W2VA 5CGTA 3B9DA 4NI3A 4RE2A 4CU6A 2XWDA 2ZUNA 3VD7A 1FFRA 2CESA 1WCGA 3WH8A 4U31A 4M82A 4PTXA 3VM5A 2C8NA 1V0NA 3N11A 3UESA 4PMUA 2X0YA 4D6GA 1WAWA 1PX8A 3CUFA 3SCTA 2J4GA 2ZUVA 4AZ5A 2J25A 1J0IA 3TTYA 1ECEA 2EJ1A 4Z2IA 3GDBA 1GOQA 4M8UA 2BV9A 3F5LA 3VMPA 5DF0A 3WD1A 1H3GA 3WH5A 1Y7VA 3WELA 2VC9A 3BXWA 1V6XA 1JDAA 4W88A 1B2YA 4AZHA 3N17A 3CUJA 2ZUTA 4Z2GA 3SUWA 2YA1A 4AZ6A 1HKKA 4J3TA 1E1EA 4U5KA 1UUQA 5M17A 1H5VA 3N18A 1GORA 4TXEA 1V3HA 2W92A 1GJWA 1AMYA 1E6XM 3GYCA 1KQZA 1GQKA 3AROA 2WC3A 3RM9A 2WC4A 2WCSA 4ZFMA 1J12A 1O7AA 2UY2A 2JE8A 3GNOA 4EK7A 2VRJA 3BSGA 3L2MA 1JDCA 4LQ1A 1DP0A 2FDMA 4FLOA 4UOZA 2DDXA 2D2OA 4HU0A 1B3XA 1ISWA 2JF6A 2X09A 3QHOA 1C7TA 1OT1A 3BSHA 1KGXA 4YN5A 3AMKA 2OWXA 1QI2A 3N9KA 4FMVA 4UZSA 2WSPA 3VDAA 3VX0A 1ZBWA 2G3MA 3WD0A 1O6IA 4PMDA 3RCNA 1LL7A 1CIUA 2WMFA 3THDA 3ECQA 3GZAA 3HU7A 2D23A 2YL6A 1E73M 2X8RA 4K68A 4N0RA 4EAMA 2PWGA 1D3CA 1JAKA 2BS9A 1B1YA 2VTFA 1PAMA 3THCA 1DEDA 4HTYA 3L4YA 1UH4A 3KWXA 5I77A 1MW3A 1WZLA 1BG9A 4H8UA 4ZXOA 4S3JA 3VM7A 4Z2KA 1B90A 3RO8A 5JUVA 1H0GA 2DSUA 2CPUA 2E4TA 2QPSA 2XHYA 3RDKA 3ZR5A 1LG2A 3CZ8A 3UR8A 2VX4A 4PEEA 3AMDA 3F5JA 3WEZA 4PUDA 5CJ5A 1G1YA 2DH3A 1ZS2A 2E40A 1IT0A 2VQTA 4FLRA 4IUGA 2PWEA 3AXXA 4W5UA 1K9TA 4UFMA 4KWUA 3KZSA 1BLIA 1UOKA 1OGGA 1NP2A 3EDKA 1E0XA 4H2CA 3VKKA 4D71A 2WMIB 3WKZA 3DYOA 4DWSB 5CPTA 1JI1A 1CXFA 1PX3A 2YLLA 4WJXA 2OYKA 1OM0A 2J62A 4PN2A 2Y24A 1OBAA 1JF5A 1NP0A 3VU2A 1MXDA 3ARZA 3I3EA 4MB5A 1CXHA 4GQQA 4QLJA 5JIPA 4JL2A 3VIMA 1W1YA 2VX7A 1RD6A 3POCA 2WHJA 2VOTA 2YIHA 3MV11 2V5CA 2E9LA 5BCAA 4AZBA 2WMKA 3W27A 3A3HA 2CBJA 3AHYA 3VUPA 2F2HA 1HVXA 2YL5A 1C7SA 1M01A 1PX4A 3OGRA 4JHZA 3WF2A 1QBAA 3FHQA 2VNCA 3CUIA 2B31A 1JFHA 2BXZA 1MW2A 3WFLA 2VJXA 2OYMA 3VD9A 1HP4A 3ARRA 3AIBA 1GQLA 1BGAA 2D20A 3GNRA 5A6BD 2ZXQA 2NT1A 1EHNA 3N1AA 3ARUA 5A95A 3GNPA 3U7VA 6CGTA 2ESCA 4PMZA 2BHYA 1SR0A 2VT0A 4HA3A 2ZICA 2WMIA 4TOQA 2V38A 4J27A 1IZJA 1UWTA 2Q8XA 3AICA 1MFVA 3PTKA 2XIIA 1V02E 3W0KA 2Y4SA 1OSEA 2EQDA 3E1F1 4H41A 2PI6A 3MUAA 2JF7A 1PPIA 3L2LA 3T09A 4J3WA 4DUXA 4JKMA 3LPGA 5LYRA 4AD5A 2V5DA 4TTUA 2DPEA 4ZENA 4XX6A 7A3HA 2GJRA 3MMUA 3FN9A 1FP8A 4JAWA 1JAEA 2OWCA 3KL3A 3ARQA 5KZ6A 4NF7A 1RP9A 4GZIA 2BY3A 2DT2A 4DM1A 4IPLA 1CTNA 2BFGA 4W8AA 4WKFA 4ZE5A 4GI8A 4GIAA 1FH9A 4UFLA 1M53A 4JZ5A 2O92A 4MNMA 1V6YA 2WW5A 3MSDA 1NOUA 5A2AA 4HPGA 5EFDA 1JXJA 4AZGA 4CN4A 3I3DA 3WH7A 3PZQA 3WF4A 1D7FA 4E8DA 5A6JA 3WUBA 2W67A 5AYBA 4HMCA 4MNJA 1LWHA 1BFNA 2D1ZA 4HOWA 1X1NA 1V0MA 1TVNA 2E8ZA 2G8ZA 1VFMA 1C92A 3LMYA 2QMJA 4OZOA 4AIOA 5A8PA 4AZCB 2J8FA 2ZWZA 4FK9A 3QHMA 4R5EA 5E09A 1JI2A 2BY2A 3OZOA 1QW9A 3VILA 3HMCA 4M24A 3VMOA 1FFQA 5A94A 3PZTA 5AC4A 5IHRA 1UA7A 1US2A 2VQUA 3BAYA 2ZX8A 2DH2A 4W7VA 1KB3A 1U33A 1JZ5A 1HL8A 1XSKA 2XFYA 5EB8A 1XD0A 1TVPA 1E56A 1UWIA 4ATDA 3M46A 1WO2A 3GH5A 1ZU8A 2EEXA 3ZIZA 1QNPA 1V02A 3ZT6A 1DWHM 5HBFA 2YA0A 3UERA 4CD6A 1E4LA 4AD1A 1QBBA 1E0VA 4JKLA 4JFVA 3WDHA 4P8WA 2CBUA 3BH4A 4ATLA 3OLEA 3VD5A 1KQYA 5I23A 3ZM8A 3F5KA 1TFVA 2CKSA 3EDJA 1MW0A 1E6RA 4H8VA 4PSRA 1W3KA 3FW6A 1JZ2A 4KGLA 3U5UA 3POHA 3LPPA 1V3MA 3KE0A 1TE1A 1S46A 2G4FA 2NW0A 1G94A 2WMGA 1UA3A 3JUGA 3SIMA 1BQCA 3K8KA 4GINA 2CETA 4RE4A 3CTTA 5FL1A 2FH6A 3ZQ9A 3IK2A 3K8MA 2JIEA 3EBVA 1QNSA 1W91A 3VIGA 1RP8A 3G6LA 2OYLA 4GZEA 2J7HA 2XWEA 3EDFA 5I6SA 1UQZA 5BXRA 1QNRA 2CXGA 3WD2A 3TTOA 1PBGA 3CMGA 3WMSA 1HIZA 1CGYA 3B9EA 4X0NA 3SURA 4TTGA 2WPGA 1HJQA 4AC1X 1CPUA 4KH2A 3WDRA 1WNOA 4GKLA 4AIEA 1TG7A 1KWKA 1WPCA 1CXLA 2VRQA 3L4UA 1PZ2A 1TA3A 2FHBA 1C93A 2HISA 3AIWA 2D3NA 2XTKA 4RE3A 1V6VA 4P7RA 4HMEA 1UD3A 3SEPA 1PZ3A 1E15A 1CBGA 2EPKX 3IJ9A 1E40A 4HOXA 1QHOA 5BXPA 4W86A 4D6JA 2WC7A 1E6SM 3UG5A 1R86A 2A3CA 1XC6A 4F9DA 3PZVA 3WH9A 1UWQA 1QHZA 3LPFA 4AD3A 1VEPA 3BMVA 2WYSA 3HN3A 3RMEA 4QLLA 2NT0A 3ZSSA 1EXPA 2WVUA 3AQUA 3HJEA 3FXYA 4Y7EA 4PMVA 4WK9A 2D24A 4LYPA 1EH9A 5IXEA 2YBTA 3N13A 3CZGA 3GXIA 4M80A 1KWGA 3WF3A 5DO8A 3AIRA 2WCAA 2V3EA 2E0PA 5D8WA 4UOJA 2XFRA 4W87A 2UY5A 1VF8A 2WVVA 1HXJA 2VO5A 4NRSA 1NQ6A 2C0HA 3BGAA 4JFWA 3OLDA 4M29A 1J01A 4A3YA 3AIUA 2YLAA 2DSVA 3ZR6A 5BRPA 1W9XA 2A3AA 4J7RA 1HKIA 3RPMA 3AHXA 5DFAA 3SCPA 3SUVA 3NDZA 3ZSTA 5LA0A 1BSIA 1VENA 4C7GA 2YL9A 1GONA 4J3XA 4HU8A 4DUWA 3O6AA 4FF5A 8A3HA 4X9YA 2Z1KA 3MANA 1GOMA 2D0GA 3FHAA 4MB3A 3W25A 8CGTA 3WF1A 1H2JA 4BF7A 1MQPA 1UD5A 1L8NA 1E5NA 3WQVA 3CHCA 1UHVA 3WDQA 3QR3A 1GZJA 1TA3B 2AAAA 1GW1A 1MYRA 3IANA 4AYSA 3PHAA 1DWAM 4C7DA 4P8UA 1I75A 4CGTA 4Z2HA 4PRWA 3VGDA 2PBGA 4F66A 3WUEA 1JYVA 2J7BA 1EOMA 2BVDA 2FHCA 4W89A 1HJWA 3CBWA 3MKKA 3VO0A 3VX1A 4A4AA 1WB0A 1JZ6A 1WKYA 2DIEA 1XSIA 4U3CA 1NWTA 1EDGA 2VURA 2VRKA 5D9PA 3MMWA 1LG1A 4PMXA 2E3ZA 5IHSA 1I1XA 1J0JA 1GOWA 2WZIA 4E8CA 4JCMA 4AD2A 4MB1A 4HZ7A 4LGXA 1ITCA 2VZVA 1XCXA 4U2ZA 1M04A 2J75A 4D6FA 2CERA 1ZB5A 3OG2A 2XIBA 5I24A 3W26A 3VTRA 4NRRA 1Q6CA 3TP4A 1MWOA 4UFJA 2XVLA 1YHTA 3CMJA 3BLKA 1JD9A 2AMGA 2WKLA 3PN8A 1XYZA 5A2CA 1Q4NX 2XVNA 2WHLA 3WQWA 3NIYA 4GI6A 3ZJ8A 5CPSA 1U30A 3U7BA 1XH1A 5A1AA 1WE5A 1V0KA 2DGAA 3VD4A 5GPRA 2WBGA 2IXVA 3DECA 5JBFA 1UQYA 4GPNA 1JYXA 4CVWA 3IAQA 2DSKA 3PTMA 2F61A 2GDUA 2Y5EA 2GJXB 5D4YA 3VIPA 4OOUA 3VIOA 5HNNA 1FH8A 1VEMA 1HN1A 4MAZA 2X2YA 1FOBA 3FY1A 1EOKA 3BCFA 3WNPA 2BXYA 4DM2A 1DWGM 1ZL1A 3TOPA 4CCEA 1H0IA 2ZX7A 2ZXBA 6A3HA 1MVYA 1YQ2A 1SYTA 3L4XA 4AEFA 4PMQA 5CGMA 1JYNA 2JALA 3N04A 1E9LA 4OBRA 2A3BA 5ABHA 3MSGA 1XH0A 5C70A 1XV8A 3WD4A 4OOZA 2CEQA 1UR9A 1W9UA 1K9FA 4WF7A 3CHFA 1E1FA 1HL9A 1WDSA 3CUHA 1FA2A 1E4MM 1MQRA 4B3KA 3GXFA 1BYAA 5KEZA 3W82A 3DYPA 4DWSD 1TCMA 2J7EA 4UTFA 1KXHA 1CWYA 1QOXA 1KR1A 3PZMA 2EPNA 3O9NA 1UD8A 1UZ4A 2YBUA 4D6IA 2MANA 1GNXA 4PUEA 1B30A 1JNDA 1EQPA 1V08A 3GXDA 3A4AA 3CZKA 4UNIA 3PZGA 2VVNA 1NWRA 3GH4A 1NOFA 2VR4A 1L0PA 3GH7A 1UG6A 1NOWA 5CLWA 1BHGA 2GFTA 3IJ8A 1FHLA 2FH8A 3VMNA 5CPQA 4CD8A 3AS2A 4B9ZA 3W81A 2W63A 3GBDA 3NSMA 1XGZA 4MDPA 3ZMRA 1H4PA 1H09A 4V28A 4F9JA 9CGTA 1UD2A 2XM2A
chains in the Genus database with same CATH superfamily
4DZAA 2OLHA 3PULA 3MPGA 2CBVA 3NZRA 5HMEA 5HQMA 5D2VA 3DC8A 3UXIA 4LVGA 3AS1A 5FF0A 4HSHA 1GHRA 4ZQRA 3CHEA 2QMKA 3T6CA 1TPC1 1KGUA 4IWWA 1MZRA 3PZUA 2PDKA 3WBXA 2ZWYA 1KFJA 4JTHA 5E93A 2DIJA 3U4AA 2EGZA 4ML4A 1P1XA 4R53A 2OO6A 1U1JA 2I56A 1VIZA 4P5UA 3VI2A 2HQAA 3BDKA 1WA3A 1YTDA 4ENLA 3A6OA 3S9ZA 4UQ9A 2W66A 5DX7A 3TDFA 3W6LA 1PVNA 3RHGA 4RKAA 3T2PA 3VDGA 2IKJA 4ZOEA 2Y8VA 5I78A 1HX0A 1ZP3A 5ABEA 2PDLA 2Q02A 2I5IA 3S4TA 1J9YA 1X38A 4EF9A 3NQ6A 1ME8A 1SMDA 4UTHA 1HKMA 3ZJKA 3ZT7A 1WQ5A 2VR5A 5KZDA 1Q6DA 2A5HA 1XDJA 3RITA 4V33A 1Z32X 4DWSC 3SN0A 2VFGA 3AMCA 3HPSA 4IGMA 2VZSA 1XJBA 1KKRA 4MDOA 1KFKA 4FOJA 5F2GA 4HHMA 1NJJA 4P7NA 2XVKA 3D47A 1F3EA 1OY0A 1SJDA 4GVGA 1PHWA 3C56A 1H7WA 3VGHA 3Q94A 4ICMA 2YCKX 2WSQA 2P53A 4JDYA 3INPA 2XISA 3SRKA 3CO4A 4EAYA 1RD5A 4RXFA 4MWAD 1XRTA 4OJYA 3UFYA 3YPIA 3LGEA 4Y2WA 4IMFA 1KV8A 2X1SA 3STEA 1IV8A 1V3JA 3VNIA 3T44A 3ATYA 1RPXA 1QNOA 5C7HA 3LU2A 2YDSA 3ABSA 2W5FA 1OCNA 2BNJA 3NPXA 1W3LA 2EJAA 4XG1A 4FEZA 2PF0A 5FD0A 2PTDA 3M0VA 1ZBCA 3PBGA 1IF2A 2OWWA 2ZDSA 4IQJA 1KXVA 1P0NA 4ONVA 4J2PA 3FOKA 1JZ8A 3CHVA 3SN1A 4Z2LA 3KOZA 1W8SA 3BICA 4M0XA 4XZ9A 3WDIA 4WIWA 1G01A 4JFUA 1LBFA 1LL6A 4JYEA 3VZYA 4EF8A 2HDJA 4FI4A 1FBAA 3UXLA 1XICA 1WX0A 3NYDA 4GZ7A 4GACA 3PJWA 3R11A 4HCDA 4CVUA 5LNSA 1VJIA 2FFCA 7TAAA 1H60A 3NZQA 3PNZA 1D2KA 1YBQA 3WLMA 3VIFA 3BV4A 4JGDA 3VFLA 3UGRA 1QRQA 2OSXA 3PC0A 3PF3A 3UZZA 2PD5A 2WHKA 1JCYA 2G0WA 4UIOA 2PWFA 3T78A 1OINA 4HNUA 3S8HA 4U5IA 5HPCA 5E0KA 3W7RA 3V5FA 3IEBA 3ICJA 3QLDA 1PB0A 4OWGA 4RPPA 3PPHA 1YDVA 4GXWA 2AGTA 4L64A 3THAA 2A21A 1OVDA 4UQCA 2FGZA 4NX5A 3IUIA 4J3ZA 3VIKA 2ALDA 1K4GA 1QVBA 4UXDA 1ESWA 1C3FA 2WK2A 1HVQA 3OZMA 3WNLA 1FCUA 1PSCA 1VBHA 4EE9A 1RBLA 1HJUA 2QF8A 3WD3A 2YFOA 1VFSA 4I9TA 2PLMA 4M7TA 1BGGA 2C19A 4G5DA 3CH0A 1TIWA 5HOSA 1P5BA 2V63A 1B3ZA 4R33A 2BOFX 4W85A 3GFYA 2QS8A 3O2LA 4L4PA 3WK0A 3VAVA 3U48A 3U2CA 4CN1A 2XGIA 1GGOA 1LQ2A 1W5OA 3W7EA 3FS2A 4OKDA 1G4SA 1UPMB 4JHMA 1UIOA 2AMXA 3W70A 5L9FA 3ARPA 2PCEA 3U5YA 2Y5JA 3VGGA 1RQHA 5EMYA 3N15A 3L4ZA 3M16A 5EPDA 2P8BA 4JTSA 4Q4RA 3KDNA 3PAJA 2DSZA 3LXBA 4ZQNA 1RVKA 3U4FA 2PWVA 1QMLA 3DBNA 4ZO6A 5AYIA 4ERGA 5ABFB 5JIWA 3TYDA 1ONRA 1XCFA 5A6TC 3L4VA 3LPOA 1JPMA 3ZJ7A 2JBMA 1XLGA 1S3HA 2YYTA 4I8YA 3OODA 2ZZ4A 5I07A 2A7PA 2OOGA 3MW7A 1BYCA 4ORMA 3BWWA 4URIA 2EBNA 4DLFA 5FIPA 1XRSA 5LIUX 1H63A 4QAWA 2RH9A 5RUBA 2GGIA 4QBXA 2GVLA 5KETA 4LUSB 2Y8KA 1NFPA 4N4QA 1VPXA 5HANA 4O8RA 1XC4A 4ZQMA 2B7PA 1X39A 4ZSUA 1UJQA 1AL7A 4R9OA 3NVTA 4WDWA 4MWAA 1TPB1 4PUNA 1US0A 3N2TA 1Q7QA 4J3UA 2XGZA 4S3CA 1CLXA 1X98A 2Y2WA 5A8MA 3WEOA 2QYGA 4QROA 2YXOA 3WSUA 1KFLA 4L5ZA 5CPLA 1A53A 3RILA 4UQDA 1FWFC 4MUPA 3EPNA 3S3GA 4GABA 3W75A 5GJPA 1R30A 2FB2A 5EFFA 5AC8A 1TTQA 3GVGA 3UZXA 3TC6A 3EB2A 3SCOA 4W93A 5FEPA 2G3NA 5A2BA 3M5VA 2ZX9A 1S5WA 2HXTA 1YPIA 2WKGA 4JR5A 1MQQA 1WOBA 3CQKA 3AIEA 1G9HA 2GJXA 1OABA 3S5SA 3TTSA 4C6NA 3IIPA 1GYMA 1XLFA 5LA2A 1L2QA 3AZRA 1IT7A 4L80A 3JR2A 3AUJA 3A3WA 3EA1A 4XTIA 1IIGA 1AQFA 2I7GA 4AZ7A 3WNNA 5MKGB 3N25A 1FHDA 4MJMA 4YIWA 3H21A 4Z17A 2PB1A 5L6UA 3F03K 2NQLA 4HNNA 4QIUA 3JZUA 5EL1A 2PDXA 1R7OA 4LRSA 3CL7A 1KRCC 1R3RA 1W1PA 1ZBKA 2QDGA 4IXXA 3NSNA 1K03A 2CBIA 3TYEA 3GFZA 3M6DA 2RJGA 3N2OA 1HQTA 1E71M 1W9BM 4CN6A 2ODOA 3NQGA 4YCOA 1NU5A 1ODZA 1VD6A 3G3MA 3S2JA 3T9PA 3S5YA 1ZJBA 3LCFA 1KM0A 1IXPA 5HDRA 1TTJA 3TU9A 1QI0A 1EPVA 2RKXA 1TTIA 3WO8A 4QP0A 3UA4A 1C9DA 1XBXA 1PTAA 4A05A 2CWXA 3IJ7A 3C2OA 3MZNA 2JFEX 1S5TA 3BZGA 1SJAA 3NQFA 2P88A 1W1A1 1JULA 1AUSL 2GJLA 2R1PA 3G0XA 2PDGA 3W87A 1MXGA 4HQVA 3NM1A 3B9NA 3M6YA 2BXVA 4UZUA 1IQ8A 4JPGA 1QWKA 3QV6A 4EPEC 5T91A 2IXUA 3GHUA 2ADAA 3L0NA 4V27A 5A6KA 1JL8A 1AH3A 1AMKA 4NNBA 4EPBC 4LYRA 3QPEA 1H1NA 1DV7A 3G8EA 3WN6A 1ZY9A 1B54A 1JPIA 5D2YA 5D9NA 3P5YA 1XGEA 3C61A 5DRCA 3KS5A 2YZRA 2E9MA 4MB4A 3WQ6A 1TWDA 1NY1A 3PZIA 3NZGA 1NM9A 1ZAIA 3LCHA 5CJNA 8TIMA 4LVAA 3VGFA 4PMOA 2QDEA 5F4WA 3FDKA 4NASA 4HNOA 3L12A 1XLLA 2LLEA 3U6WA 3W73A 1TVLA 2YDRA 1B3WA 2VEPA 5FEWA 4F79A 3N9RA 1KA9F 5CG0A 5BWAA 1W54A 5H1WA 4KFOA 5A8OA 3UNTA 2Y7FA 4J28A 1A5MC 2E09A 4CEXC 4PB4A 1HKJA 1YTEA 5FA5A 2F38A 2C1IA 2R91A 1JFXA 4FNSA 4P7LA 1ZBVA 1UR4A 1XP3A 3OOQA 2QPUA 3LYEA 1JDEA 3SB0A 1A5OC 1EJRC 4LYQA 1VGAA 3VABA 2BVTA 3DHPA 4Q8PA 4DI9A 1JIBA 1EHAA 5I7GA 2GJPA 1LQ0A 1ICSA 2OSWA 3QGKC 3N3MA 1EA0A 3O6DA 3L23A 4DO5A 1X97A 1YBQB 2AAMA 2NLYA 3KS6A 1JRBA 2QIWA 2PDCA 2NX9A 1GOOA 4EPDC 1XIMA 4GUGA 3W1AA 1GUVA 2PAJA 5A8GA 2WZTA 1SZFA 3OTRA 1UBPC 5C9WA 4TVDA 1G5AA 3R0KA 4JNMA 3R58A 1ONWA 3B03A 4GYFA 1I6NA 2DVXA 3UY8A 4KGJA 3IJIA 2QUTA 3DI0A 1KTBA 3ZO9A 4NX0A 5E9XA 4XZWA 4ZE4A 5A6SA 1MNZA 2R1NA 1VFFA 1JG9A 4FNRA 5D9MA 1VBRA 1H7PA 1ADSA 3TSMA 1O66A 1J18A 1S5MA 4LANA 1LYXA 2GWNA 1ODUA 2NVAA 2PWHA 4DYEA 3MUY1 4PMNA 3OZPA 3LB0A 4E2OA 2O9PA 1M9HA 1XKJA 3QM3A 1DJYA 1GQNA 4CQBA 4B5UA 4HNCA 3ATZA 2XUCA 4XAZA 1Q6GA 5T26A 3VDCA 3UU0A 3ZLHA 2NQ5A 5C8BB 1XR2A 5CKSA 3LOTA 5E70A 2EF9A 4S3AA 5BXSA 1N2VA 3K1DA 4RDYA 2HVOA 2QPXA 1XWYA 2QT3A 5CC7A 4A2RA 1J0YA 4AMCA 4CNOA 2PDWA 3AISA 4H01A 4HPXA 2RDTA 5DMLA 2W4XA 3E0IA 2CZFA 1XKYA 4BA0A 5HJYA 4MLRA 1RK6A 2E6YA 3AO0A 3N73A 2PGRA 3WLSA 3HMJG 3H54A 2XN1A 3T4WA 4HB7A 1ITQA 3IJQA 1H61A 3UY7A 4X63A 3ZVIA 4UTLA 3MUIA 1GVIA 2QCDA 5CSUA 2GL5A 3BGGA 4PUMA 3A4WA 1JNEA 3GX9A 4BKNA 1PL9A 3AXKA 1UMLA 5KMYA 1D8WA 3GDLA 3U9IA 3PPFA 2OX1A 3FYOA 2I57A 1BWKA 4I5XA 1BVNP 2J66A 1UR3M 4PH6A 3DFPA 1K02A 1QI4A 2ZXAA 6TAAA 2ACQA 2V9DA 1XQLA 1JPHA 3VOGA 3LRKA 5FCZA 4GFSA 1UR1A 3KEHA 2CLMA 1KTCA 1XQKA 5J8LA 1SR9A 3KBJA 3SCVA 1HJVA 2ZX5A 4K7VA 1IWBA 1NF7A 4INFA 2W6RA 3B9DA 1U83A 1OFAA 4RE2A 4CU6A 3QY7A 3CWOX 2VHLA 3O0KA 1PKMA 3CJPA 4RZ4A 3TR9A 3GVQA 1NFGA 4PMUA 3ZLGA 4D6GA 1EUNA 4AEOA 3CUFA 1ML1A 4Y8EA 2J4GA 4FS9A 4AZ5A 1SVDA 2J25A 1VR6A 3KCJA 1D9EA 2NLIA 4H6QA 1J4EA 3OZYA 4U28A 3USBA 4Q8NA 3LSCA 3WD1A 3QKEA 3TSDA 4JTTA 1JCMP 3LEPA 4YJ5A 2QCEA 1Z44A 4BWLC 2C1HA 3BXWA 4ROPA 1TV5A 3MP4A 1Q7ZA 3RX2A 3KVJA 3BE7A 4JXCA 3V18A 4BEUA 4N9CA 5AN7A 3TCSA 2ZUTA 2POZA 2QCCA 5IBXC 3QFEA 3NQMA 3VOJA 5M17A 3N18A 2YXXA 5G2IA 4UTWA 1X1ZA 4W9TA 1HTIA 4M1BA 2E6DA 3GYCA 4LVFA 1F05A 3TXVA 1GQKA 3AROA 2WC3A 2G97A 3RM9A 4Q4OA 1VFLA 4YVVA 2UY2A 4JN8A 3S83A 1TYGA 1JDCA 1A5NC 3UR2A 2JF6A 1C7TA 2A7NA 3QGAC 3KBVA 3PBWA 4J4KA 3M0XA 4WUIA 3W2JA 3AMKA 2OWXA 1QCWA 1QI2A 2QUVA 2WSPA 3AJXA 4JTAA 2G3MA 2J6XA 4QISA 2WMFA 3GZAA 4E4UA 1THFD 1D3CA 3CQ0A 4PULA 1B1YA 3TW7A 3TYAA 3WQFA 1U5HA 3SQLA 3VK5A 1OEPA 1WZLA 3BSMA 4S3JA 5C5YA 5C2CA 3GW0A 4HYVA 1H0GA 1XM3A 3IVTA 2CPUA 2QPSA 3W83A 4YMZA 3AMDA 3L7RA 3RO6A 1Q7MA 4PUDA 3NGJA 3M0HA 3PWAA 3V1PA 4DNMA 3SRFA 3LS9A 4LF1A 2VFIA 4FHAA 2INEA 2OT0A 2GVJA 2PWEA 3AXXA 4W5UA 1K9TA 1LT7A 1EZWA 5HQLA 4KWUA 1BLIA 4O10A 1NP2A 2ZZ7A 4K1GA 2WMIB 4L61A 6ENLA 3GY1A 4NZJA 2YLLA 2OYKA 4FNUA 1NP0A 2YXGA 3I3EA 3U0HA 1XIJA 3CTLA 4GQQA 1EP3A 3A4JA 4QLJA 1XYMA 5HMSA 4Q7BA 2TPSA 1O1ZA 2VOTA 2XIQA 2QCFA 2HPIA 3P3BA 3W27A 4PL2A 3A3HA 2CBJA 3R8GA 2PMQA 1HVXA 3IS4A 2G3FA 3WZ0E 2Y62A 3R13A 4JHZA 2ALRA 3H2NA 1BGAA 4G7FA 2RAGA 2BOEX 4YTQA 4H9TA 3ARUA 5AHFA 1I45A 1MRQA 2VT0A 1I2RA 1IZJA 1UWTA 2F6KA 2Q8XA 2H90A 3WMLA 3FK4A 4ZVJA 4XD6A 3E1F1 4GHRA 3UW6A 4NG3A 3TK7A 3EKGA 3T09A 1R6WA 2QJHA 3LPGA 5LNUA 4AD5A 3S6DA 2ZZ3A 3R12A 3TJXA 1EJUC 3P82A 4H83A 1FP8A 1Y65A 4JAWA 4M3PA 5HWNA 2QVHA 1AD1A 1ONEA 3HQPA 5KZ6A 1ZSXA 1RP9A 4IMCA 2X1UA 4CQCA 4YNGA 4DM1A 3LHZA 4IPLA 1CTNA 2BFGA 1FWWA 3TC7A 5AYYA 4UBPC 1M53A 4JZ5A 2QCDB 1P0EA 2GGGA 1W5QA 4GVFA 1NOUA 3BCJA 5EFDA 4AZGA 4HSNA 2F7FA 5SWUA 5A6JA 1D7FA 2W67A 4HZMA 4TMCA 3TWBA 3GIYA 2YBVA 1LWHA 3CAQA 1TVNA 2E8ZA 1VFMA 3COTA 1F2JA 3GDKA 5A8PA 1VYSX 4AZCB 1S2TA 5I09A 3S0CA 1JQXA 5F4XA 5A94A 5CZ0A 3DI1A 2NWRA 2Z1WA 5FF3A 3V4BA 2EKGA 5AC4A 2VQUA 2PTYA 5BOOA 2DH2A 5U7SA 4H9VA 2IQTA 3TN6A 1M68A 1TX2A 2J27A 4R7WA 1GYNA 4ATDA 3TN5A 4GGHA 3M46A 3NEVA 3OVQA 1ZU8A 4ZMGA 2EEXA 5MHBA 1S2UA 5HBFA 1R3QA 3OHMB 1IHIA 1QBBA 4GIYA 4LAZA 3BH4A 3OLEA 1KFEA 3VD5A 2HPMA 5BMWA 1BKHA 1EUAA 5I23A 3IV3A 4PSRA 3S1WA 3MQTA 3BMXA 1JZ2A 4GYKA 3KE0A 3I7SA 4LF2A 4ECLA 4Q8QA 4ZODA 4G7EB 3SIMA 4GINA 4WCJA 1IGWA 3PY2A 2G37A 3N6HA 4DWDA 4GCXA 4XUGA 4YTUA 1DJWA 3O07A 1TPWA 2JIEA 4GOAA 1QNSA 2G50A 2PLKA 3QBUA 4CQ8A 4WHBA 1FUYA 2OYLA 4GZEA 2J7HA 4JYDA 4LAUA 3NA8A 4NZ3A 1UQZA 4IG2A 1JUEA 2XU2A 1PBGA 2ZZ1A 4JICA 1BF6A 2WPGA 1HJQA 3HIJA 1CPUA 4KH2A 3VCRA 2EPHA 3BJTA 4L7ZA 4ZOBA 3S5NA 1KWKA 2VRQA 4QITA 1PZ2A 1TA3A 2FHBA 2IPJA 5TIMA 3OQ8A 1V6VA 2FZDA 1PZ3A 1E15A 1PCKA 1E40A 4HOXA 1QHOA 5BXPA 4XKYB 2FGBA 4IQDA 1TWWA 1GOXA 5CH9A 4UMBA 3N2CA 4D6JA 2WC7A 3GG7A 4O12A 1R86A 3M0MA 4C60A 3WH9A 3UWUA 1VEPA 1MRAA 1W17A 2WYSA 4RNHA 1P0BA 4IFKA 3LLFA 2TMDA 2Q8ZA 3ZSSA 2RDUA 2X42A 2UV8G 1NF0A 3AAMA 4GYJA 4Y7EA 2YBTA 1DE5A 3CZGA 3E0VA 4YVPA 5DO8A 3IUHA 3AIRA 4XD4A 5FJOA 2XN2A 2E0PA 4Q4PA 1EPXA 2VO5A 3KP1A 5D33A 3BGAA 1XLBA 3MJMA 3EWWA 4A3YA 2YLAA 2Z4GA 1AFSA 3HV9A 1HKIA 1KCZA 3RPMA 1TIMA 1A49A 4LWWA 3NDZA 2YW3A 4C7GA 4XZHA 2A4AA 1YKWA 4LB4A 2ZYFA 3C8NA 4MVAA 5G5IA 3WQDA 2Z1KA 3MZ2A 9XIMA 2WOQA 5K3VA 1M7JA 3W25A 3BOFA 1OG0A 1BD0A 3LCXA 4NKCA 1I0BA 2TSYA 2UZ9A 1L8NA 3FA4A 4WD0A 3MA8A 3W02A 1XLIA 4JTLA 1CI1A 1QT1A 3QV7A 4IIEA 1GW1A 3IANA 3KX6A 3N6JA 3PAOA 3MDUA 1MI3A 3RLVA 2OQYA 4PB5A 4CGTA 2GVEA 4DY1A 4F66A 2PBGA 3EEZA 1JYVA 4ZZ9A 3MKKA 3MTWA 3VO0A 4DRSA 3CV1A 3UR5A 4IQEA 3WLTA 1PTGA 1JZ6A 1D8CA 4U3CA 1NWTA 1EDGA 2VURA 3T42A 5D9PA 3W1MA 1F6YA 1LG1A 5FESA 1ZLPA 2PFHA 2PDUA 4DBSA 4EPKA 2P5NA 4C6EA 3C2FA 3JW7A 2IW0A 1FHVA 4KCUA 1OFRA 1GG0A 2CERA 1ZB5A 1TE6A 3OG2A 4WQ6A 2R24A 2PP3A 1IEWA 2VFHA 3BOLA 3GYEA 3HBLA 4A8RA 1JD9A 1T8QA 3EOEA 2VDGA 3VE7A 1M7PA 2RJHA 3WQWA 4GI6A 2P8CA 4WJ8A 3V1HA 5A1AA 1IZCA 3DX5A 3KBMA 5T9CE 4AAJA 1V0KA 3VD4A 4HA0A 4F4RA 5JBFA 1UQYA 5FF7A 4FF7A 4CVWA 1S2VA 1ECQA 4HHHA 4DB7A 3BQ6A 4DN1A 5HUPA 5C2XA 2GJXB 2Z7KA 1FH8A 2ZA2A 1S2CA 1GVRA 8RUCA 4US5A 3FY1A 1XPYA 3WNPA 3DZ1A 2BXYA 2ISDA 4HPNA 2MNRA 5FJJA 3TOPA 4CCEA 5CZSA 2ZX7A 2ZTKA 3GXPA 6A3HA 4BF9A 4KFPA 3M0YA 1WUFA 2VFEA 4O0ZA 4AEFA 5CGMA 2EHHA 1E9LA 1EX1A 4OBRA 1PTDA 1X8CA 4GJIA 4XAYA 1F61A 1UR9A 3EWXA 5FJIA 3TWAA 4JNZA 1HL9A 2Z7GA 4L56A 4QQUA 1YE4A 3UZYA 2QCLA 2DFAA 3TQ0A 5FJRA 4DWSD 2J7EA 3KWSA 1QOXA 2V8ZA 3M0KA 3UG8A 4ERIA 1UD8A 3QC3A 2MANA 3EB3A 4G8TA 4PUEA 4KWOA 4MWAC 3H2AA 2OO0A 4UNIA 3PZGA 4O8AA 1NWRA 2R94A 3LCLA 1L0PA 1RHCA 3LQGA 1T8XA 3GH7A 2HS6A 5CLWA 1XF0A 3KTXA 4O53A 1GJPA 2GFTA 3LK6A 5DXXA 1Z9AA 4QAIA 2FH8A 3VMNA 5CPQA 4F0HA 6XIAA 3GBDA 2QZRA 5GJNA 4MDPA 4NZ5A 3UXAA 4GRSA 4PMXA 3UYIA 3QOMA 2PBOA 3KBWA 1JZ3A 4AXNA 4ZSTA 4M5PA 1YXYA 3W29A 1H51A 3B8VA 4KEMA 3B8WA 2CHNA 3REQB 1RUSA 3GU9A 4W5ZA 4GQRA 4JDBA 2GDQA 2Y61A 3EXTA 2H8ZA 4MM1A 3WUGA 4XVEA 4B91A 5CCZA 1CENA 4QR6A 1PKYA 2GDVA 3GKAA 1LRNA 3HQNA 4LVDA 4ZCWA 5CLTA 4NXSA 3Q45A 2WZMA 3BAJA 4XAGA 4O1DA 5XINA 1WDRA 3BOXA 4W7WA 2O4QA 1PZ1A 1GQIA 2PUZA 3CS2A 1UC5A 4LAOA 1A3WA 1LBMA 2QCNA 3H4WA 1OFDA 3WLIA 1FWNA 4Y9AA 1W3JA 1TKKA 2ATSA 3SZ8A 1EEXA 1OD0A 4D1JA 4QS6A 2PTXA 1M03A 5JH2A 2H9AA 3NPWA 3IAPA 4QDWA 1E72M 1HP5A 4LX4A 1XLAA 2IKHA 2D0FA 2V2DA 3EA2A 2Z29A 4EANA 1Q45A 4H4IA 1MUMA 1DTNA 4YWIA 5REQA 2HVMA 1IEIA 1M3UA 1QPRA 2PC8A 2VX5A 1KR0A 3WQOA 5I3KA 3AFBA 4XD3A 1IR1A 3P93A 4XV0A 4RW3A 2WXDM 4RW5A 1V93A 2NSOA 4UFHA 4D6DA 2OJPA 1FXPA 3GKFA 3RIKA 1G6CA 3FAXA 3WBEA 2W91A 5D30A 1RCOB 4FX7A 3LHUA 3TQKA 5BOFA 2GPTA 4O52A 4A21A 1UKSA 3H7VA 4XSMA 3KLLA 5FOOA 4ZB0A 3SGUA 3WL0A 4NZCA 5CXPA 2ZCGA 1V0LA 1R47A 2QV5A 2ZX6A 1CGVA 4Q8TA 1ISYA 3WH6A 2VWSA 3SJNA 1EJ7L 2FMNA 4QCFA 3D5HA 3FV9A 1R7AA 2WVVB 4N42A 1E0UA 3DYMA 3WG6A 1SJBA 3FFSA 3GUWA 4AZCA 4AWEA 1Q8JA 4S1FA 4S2CA 3W7QA 7ODCA 3HM7A 1DWFM 3SADA 2FZ8A 2CLHA 2GYIA 1QPQA 1QW8A 3FAWA 4IUOA 4CUCA 1PIGA 1RALA 4N4PA 1CXIA 3ENLA 3WQ8A 3H2OA 1LLWA 3PTDA 3WMCA 4WSJA 1VB9A 4LV4A 1VRDA 4YYCA 3MJYA 1S38A 1RR2A 1F7BA 5CPNA 2VXNA 4P8VA 4IGSA 4V1YA 3OIHA 3ZS4A 1HJXA 4B4FA 4TIMA 5A6MA 4PYSA 1DWIM 3TIMA 5J5DA 3RR4A 5J04A 3E0FA 5I03A 1E4NA 1R87A 4MSSA 3W1UA 1SQ7A 4G7EA 1W56A 3HGJA 2QUNA 3PFMA 1GHSA 2JKPA 3ARTA 1SZNA 4EKJA 3K4AA 1E6NA 4BCEA 4LBSA 4B5TA 1RA0A 1R9YA 3TLQA 4UTJA 1XSJA 1AW2A 2BHZA 1CGWA 3ID7A 4F8XA 5AHEA 1A3XA 4YTRA 3EWBX 4B16A 3RCYA 1Q3NA 5I00A 4R27A 3A47A 3AS3A 1TUFA 3KLKA 2ZA1A 3SUUA 5D02A 2E7FA 3T08A 4J3SA 1FWCC 3DFTA 7XIMA 1A5CA 2BGSA 5I3DA 2FB3A 5CC6A 1AL8A 3MBDA 5CC5A 3KVKA 3VOFA 4C6OA 3EKZA 3IIZA 1XCWA 1YDYA 3ZOAA 3P60A 4JX6A 4PCTA 4AZIA 2PDQA 4C7FA 4MKSA 2GOKA 3GTIA 2BY0A 2QLYA 1K8YA 4XAFA 4FX6M 4CNTA 4UMAA 1Q85A 1WDPA 1ZALA 3O15A 4PC8A 5ECUA 3F4VA 4JL1A 3GHTA 3CL8A 2PRMA 3GVVA 5DT5A 1GCYA 4PUKA 5HXMA 3KL5A 3PS7A 4NAFA 1CECA 1NDZA 3MV01 2J8TA 2J47A 1LLOA 4K37A 3VC6A 3W2UA 4D72A 3BPWA 3SUTA 2TODA 5CSSA 2FPVA 4D6HA 4XKYA 3GTNA 3MHUA 1FKXA 4KRUA 5D37A 1XYCA 3UG3A 1P6WA 2PCQA 4QDPA 3UA3A 1DJIA 2CW6A 2VEFA 1LUCB 1TJ0A 5BU9A 2C14A 3E5BA 3LHYA 3W1LA 3NCOA 2XG9A 2Q3OA 1JDDA 1EC9A 2VWTA 4IFOA 1EWDA 2DQWA 1XLCA 3TX9A 2EPOA 1GJUA 1J10A 3WQCA 1LRQA 2WJEA 3SIZA 4DBDA 1CGTA 3Q65A 2CLIA 3QOKA 1JZ7A 4IX2A 3UCCA 4AHPA 5TQLA 3B9OA 4IPIA 3RU6A 4GY1A 2E28A 1SFJA 5AC5A 4HZ6A 4BZYA 4FXRA 2ZUWA 1UP2A 4IPNB 5TF0A 2RGMA 3CK5A 1XIDA 2A3LA 3T0DA 2A6LA 1Q6EA 3DU0A 3WFAA 2VI0A 5FAGA 1G4EA 1KFWA 2R1KA 4C6LA 4FIQA 1YDOA 1OK4A 2C13A 3NQ2A 1E4IA 1E9ZB 3VYLA 3NL3A 3CM4A 2EXOA 3KVLA 5DMNA 4H9MA 4Q4MA 1TRIA 3LBOA 1VHNA 4YPJA 4LY4A 5E0FA 3BW3A 1S39A 2OXNA 4OECA 4A8NA 1QHPA 2NZLA 2IKGA 3DENA 1C8XA 4CLMA 3BC9A 3F4NA 4UTTA 1V5XA 5F2LA 2C71A 3KTCA 3H2FA 3VZXA 2XSAA 3KCLA 4CCDA 1W2PA 3OBAA 2YOCA 2WO5A 3OGVA 3BMWA 1XYBA 4REQB 2VGIA 1UWAA 4W8LA 1KLZA 3W71A 4PTWA 2Z2AA 1KM2A 4ZQOA 1RZMA 4GXPA 3VIHA 4MMWA 3H70A 1OC5A 4U3AA 3GXMA 3CGTA 2DJXA 3OQEA 3RNDA 5M1TA 2NX1A 2ASHA 1P6CA 4FOKA 2GQ3A 3B40A 1LOSA 3IRSA 3FNDA 4Q3MA 3HURA 3QQ0A 2ZRUA 2X05A 4Z2JA 1YPFA 4UB9A 3DG3A 1J0KA 1XH2A 1EF2A 2E5BA 3CO8A 3TKFA 3UPWA 1ZUAX 3DIPA 4LW7A 2YZ5A 4I9JA 2ATMA 3UXDA 4Q7NA 3MCNA 7REQA 4WY0B 5AYZA 5I79A 3AIVA 4GH3A 5HWJA 2FPYA 3AZTA 4EIVA 2ZOXA 1PZ0A 3GVWA 4IMGA 2NXIA 4D1IA 3VGEA 5J5RA 1VEOA 1FX6A 4JIRA 4ZB5A 1TR9A 3RJXA 4GYPC 1C29A 2PSNA 3CQIA 2PRLA 2WQDA 1RH9A 2DSWA 4HPHA 1FCBA 3WLOA 2J79A 3ZR4A 3S5ZA 2P76A 3ONCA 4EOUA 3MMTA 2Q71A 3C86A 3RLUA 2VFDA 2Y5SA 5F7UA 3H2CA 5CSYA 2DW7A 1B3VA 4GO8A 4S38A 1XS2A 2BY1A 2X7VA 3OJGA 3NL6A 4S3GA 1Q6LA 2GGJA 2WBKA 3AI0A 4MADA 1GEQA 3SY1A 3T40A 1CB7B 2HK0A 4Q22A 2C16A 3SJ3A 2FZNA 3BANA 5BWFA 3TH6A 4GWEA 2DUZA 3BAIA 3ANUA 4IZGA 4Y8FA 3RG6A 3AXIA 2AGKA 3K46A 4PRRA 1XRVA 4XBSA 3QKZA 1CEOA 1R3SA 1QXLA 3I7RA 4L4LA 2XINA 3MVIA 1KRAC 2J88A 3F2BA 5BROA 1J79A 4GUJA 3W7OA 1UWSA 4UTUA 1UB3A 3EWZA 3MS8A 3Q37A 4WZHA 4X61A 4D8ZA 2ZE0A 3SCNA 3UWQA 3ARYA 3VD3A 3MU7A 4GO9A 3S1VA 3NGFA 3SCRA 3PJTA 3ALGA 1HZYA 1Z48A 4JTEA 1MDRA 4O0KA 1FWAC 2E5CA 4BQ2A 4IJCA 2WNNA 5IM51 1OGSA 2FDSA 2GK1B 2Q09A 3GM8A 4HP5A 4LS0A 5LIWX 2TYSA 4AIUA 4RX0A 2E8YA 1HO4A 3EAUA 4H6KA 3NQ7A 2CKRA 1CXEA 1FCVA 2B7OA 1MEHA 1ZQ5A 2AL1A 4O18A 4QEEA 4NZFA 3SCQA 4DUVA 1DHKA 3VKBA 2ANUA 2DZPA 2CCRA 3MSYA 1VJSA 1V79A 1D7KA 3RJYA 4MPQA 4GUFA 1UWRA 4XZLX 2CXEA 1W1TA 3E2VA 2J74A 3KOWA 4UQEA 2I17A 4KQNA 3WDPP 4XSLA 5G1TA 3T0BA 1KLYA 3LENA 1OZQA 2WWDA 5C9XA 4UQBA 1L6FA 3PVFA 3R0DA 3H8AA 5HMFA 1EGZA 1OT2A 4HGXA 3PUDA 3BAXA 1OYAA 2HZGA 1RPKA 3BARA 1YNYA 1BVZA 1M1BA 4TVUA 3G2GA 1QI5A 4MPKA 3W6MA 5K9CA 3W37A 3KL0A 7TIMA 3QMTA 5B80A 4KEVA 1KM5A 3Q67A 3GG0A 3LV5A 2Y88A 1J0HA 3HPXA 5A69A 1TZ7A 4AVOA 3VKJA 1S5NA 3GNXA 3MMDA 3EOLA 3TN3A 4BJHA 1RLDA 1OFEA 4JIIX 2D2HA 4E5TA 1H11A 1RY8A 3L65A 3DN5A 3H22A 1LOLA 3EXRA 2VZOA 3WF0A 3WIJA 4GFIA 4JD4A 1MXSA 4O1BA 5LHEA 2OQLA 1FQ0A 3NQEA 4X22A 1QOPA 3N2MA 1P48A 2QHAA 3NURA 2CFFA 3OLIA 1WDDA 1EGVA 1BEUA 4S23A 2QAPA 2UBPC 3OB8A 1B3YA 2VZTA 1IXNA 3AHVA 1JEZA 4Q8MA 2PU1A 1SW3A 1L6SA 3CH9A 4UQAA 1K7FA 1WKFA 2WNWA 2OZ0A 4IP4A 4X3ZA 1WDQA 1Y0EA 3LCIA 3QR1A 1UR0A 2ZBTA 4PA8A 4G6CA 5BYWA 3WJWA 3UG4A 2HROA 4WXZA 4PB3A 3QSTA 3QJAA 4TQTA 5DY3A 2RUSA 5BRQA 2JK2A 3CIXA 2D3LA 4QG9A 1QK0A 1SO4A 2ZC8A 1BYDA 1KNWA 3LZ3A 3EXSA 4D6EA 1OK6A 1MFUA 1QO5A 1HUVA 3S6TA 5LNWA 2I16A 4FNPA 1UR8A 1C91A 1H49A 5CQ1A 3P14A 2O9RA 1TMQA 4RE0A 1ZGDA 1J5SA 1DQWA 4RXGA 3W07A 3F2CA 3F4CA 3TOYA 2ICSA 5FSEC 4NJKA 1US3A 4HTBA 2Z26A 2QNEA 1OFPA 3TLLA 3TONA 1YIXA 2WJZA 2XH4A 2J7GA 3KFTA 2CLKA 1B5TA 3FLUA 2NV9A 2SFPA 4S3KA 1JXKA 3DH7A 2XFFA 4HA4A 3WFZA 1GQJA 3P81A 4O4VA 3E3HA 2BVYA 3FJ6A 1KM3A 1FWIC 1K3UA 3LLXA 1TX0A 5F2MA 2GGEA 2ZUNA 4NY2A 1FFRA 1WCGA 3GRIA 4M82A 3TQPA 3TE9A 4NAEA 4B4HA 1BSLA 4K8GA 2AQOA 2V69A 3UESA 1BQGA 4RV3A 1WAWA 1PX8A 1LZOA 4PFMA 3SCTA 2IMRA 1G69A 4GC3A 2EJ1A 4M8UA 3F5LA 1ITUA 3BLFA 1Y7VA 4X2PA 4Z1DA 4Y90A 3WELA 2VC9A 3MUXA 4O28A 1UP3A 1LUCA 1JDFA 1TWIA 4WOQA 1XINA 2E1DA 4W88A 3M0JA 1B2YA 4KIRA 3RU8X 4AZHA 4C6IA 2ZA3A 2P10A 1W31A 3CUJA 4LAMA 2R6OA 3SUWA 4HT3A 1HKKA 2HWGA 4M6UA 2INZA 1GORA 4TXEA 1AMYA 5EMLA 4ASTA 3URAA 1EC7A 2WCSA 3FGCB 4UTKA 4AVNA 3BK0A 4S3EA 2Z2BA 3LSBA 1MSSA 4GLEA 3BSGA 3H7UA 2FDMA 3HB9A 4HU0A 1ISWA 2X09A 3BSHA 4IG2B 1O95A 4XKMA 4B5WA 3RF9A 3W1RA 1WXYA 5AVNA 3N9KA 2PZ0A 3FKKA 3WD0A 4PMDA 3RCNA 4ADSA 1P0KA 4JQ2A 4YVXA 2V5KA 3PPCA 3P5ZA 3THDA 4MWAB 4I7VA 2YL6A 3CT7A 4FZIA 2V82A 2X8RA 4N0RA 3BG3A 4EAMA 2PWGA 2BS9A 1JAKA 2VTFA 4JNYA 1DEDA 1XBYA 1UH4A 3H2MA 1UW9A 2HE8A 5I77A 3SFWA 3GHRA 2FVKA 4ZXOA 3CPRA 4O15A 2EKCA 1EFZA 4Z2KA 1B90A 3RO8A 4HJWA 1XLJA 5CAHA 4GQGA 3WLNA 2XZ7A 1LG2A 2GQAA 4EP8C 3AALA 1BKSA 1R3YA 1OF8A 2R14A 2YCLA 1G1YA 1TPFA 2DH3A 1EYWA 3G1YA 1TV8A 2OGYA 4AWSA 2E40A 1A5UA 1AW1A 2Q01A 4O4WA 3E5PA 3LMZA 1LROA 2DVTA 4O1FA 3KZSA 1UOKA 1OGGA 2X2GA 3WKZA 1CX9A 2DZTA 3QZAA 1JI1A 1GKPA 4O13A 1PX3A 4TO8A 3MYOA 1YYAA 4PFHA 1C8VA 4FP1A 2Y24A 3CWNA 1JF5A 4H19A 3VU2A 1QDSA 4CQ9A 2BGQA 1CXHA 4JL2A 3VIMA 8XIAA 3G1HA 2VX7A 2HJPA 3POCA 4AB4A 3WQPA 1A50A 1NIUA 2V5CA 2YDAA 4WDUA 1XBZA 1BTMA 3C2EA 1O94A 2YL5A 1C7SA 1Q65A 1PX4A 3WF2A 3GR8A 3CUIA 2B31A 3ITXA 3WFLA 2OYMA 3VD9A 3W7DA 3ARRA 4FPSA 2VDHA 2WNQA 1GQLA 2BG5A 2D20A 2V67A 3GNRA 2PTWA 4C6PA 4GVHA 1WXJA 2NT1A 1EHNA 3ABQA 3S1XA 2VC5A 3LD5A 5A95A 1XXXA 4QHRA 1Z7AA 3GO2A 4LALA 5D03A 1DXEA 3G77A 4HA3A 4H7CA 5C9RA 2ZICA 2WMIA 4TOQA 2V38A 1QFEA 1Y5XA 2A79A 2FTYA 1W37A 2DZVA 1W0MA 3GNDA 2EQDA 3CPGA 3A21A 1PV8A 2PI6A 3WLHA 4HYWA 1PPIA 1K70A 4J3WA 2NXGA 4WVXA 4IJBA 3NXLA 2V5DA 4TTUA 1GVFA 3PUOA 4UNKA 1JCXA 4DJDD 4DUOA 3SY8A 3FN9A 3TV8A 2ACRA 1NTHA 1U5JA 2OWCA 5FJTA 3ARQA 2YCJA 2P3ZA 1WUEA 1EF3A 4W8AA 3HPAA 4GIAA 5LIKX 3HQ1A 4DXVA 4F2TA 3QN3A 1QAPA 2PDMA 2GUUA 2WW5A 1TPH1 3T07A 1XW8A 1FVPA 4F3HA 3MSDA 4DZIA 3N9SA 1EBHA 2YB1A 3DFHA 3O3RA 4CN4A 5EMUA 2V2HA 5LNRA 4UTTC 2HV5A 4REQA 4BK9A 1QUMA 1V0MA 3WBWA 3E0LA 1C92A 2QMJA 2QQ6A 2WJDA 3PBVA 4AIOA 3GD6A 2J8FA 4QGCA 4Y6GA 4Q32A 4QRNA 6TIMA 2BY2A 2YX0A 4M24A 1FFQA 1HGYA 3R8RA 4LUJA 4C6MA 3T05A 5IHRA 1UA7A 4NL1A 3BAYA 5HUOA 5FF4A 1KB3A 3R10A 1JZ5A 2XFYA 5EB8A 1VYPX 1E56A 1XIFA 3PBMA 2PDBA 3KCOA 3WLJA 2Y89A 3GH5A 4XTDA 2ZTJA 2ZZ5A 2NV2A 1DWHM 2Y6ZA 2YA0A 3UERA 1X6UA 1X1OA 4AD1A 3B4UA 1E0VA 3WDHA 4P8WA 3NDOA 4ATLA 3DGBA 4KFNA 4WGXA 3F5KA 1TFVA 4C6BA 2CKSA 1MW0A 1E6RA 4H8VA 2PF8A 1Q4WA 3FW6A 5LHFA 1U22A 3NWRA 4FOUA 1BXCA 1VPYA 1P1MA 5EYWA 2WMGA 3SRHA 3DKLA 3K8KA 5EU9A 5DMMA 3CTTA 5GVJA 3CAKA 3ZQ9A 3VKCA 3PR2A 4LU0A 4AH7A 3K8MA 4PBFA 4AF0A 3VIGA 5U4NA 3W2KA 1EL3A 3EX3A 2VEKA 3H53A 1YW1A 3LUTA 2P0OA 4RR4A 1SO6A 1DIOA 3VNLA 5KZMA 3B9EA 1AODA 1IEVA 1PYFA 4ML9A 2BOGX 4GKLA 5G2HA 4B2DD 2NX3A 2Y63A 4YTSA 1WPCA 4XO7A 1CXLA 5G1MA 1G4PA 4X9SA 1SW7A 5C9UA 1F3TA 3DFYA 2OLAA 3SEPA 4JQAA 1YXDA 4HD5A 3C4UA 4O1AA 1XUUA 4A6GA 3TUUA 1XLMA 3QTGA 4L1XA 2DZAA 3UG5A 4A35A 4S2BA 4MWAE 2J6VA 3E2SA 4F9DA 3B8TA 1VFTA 3LGDA 3UNDA 3GIPA 1XISA 3BMVA 1SJCA 3CNYA 4YL2A 1S2AA 4DO6A 3WJSA 3L68A 3RMEA 4Q4KA 5BRBA 1EXPA 2WVUA 3AQUA 3NOYA 3S6OA 1Q66A 3FXYA 3W1QA 1EH9A 3O6CA 5JU6A 4HU3A 3GXIA 2OEKA 2Z1BA 3K2GA 4DYKA 3RAOA 1VCGA 2NUWA 3C0JA 5D8WA 2XFRA 4W87A 1VF8A 4MUZA 3SGGA 4FALA 3AXMA 4PZVA 2HNEA 4JFWA 1AH4A 2GJNA 3OLDA 3LQLA 1J01A 3W7MA 4PUUA 1FWTA 3ZR6A 3N4AA 1RSCA 3SCPA 1W5NA 3ZSTA 5LA0A 4LNYA 1GPWA 3E2RA 2YL9A 4FF5A 8A3HA 4X9YA 2OEJA 4QXIA 5AB3A 3EX6A 4HCHA 2X7WA 7ENLA 1K4HA 3NL2A 3FHAA 3O7UA 1DXIA 8CGTA 4IH3A 2I14A 3G18A 4BF7A 1MQPA 3W7HA 4J1OA 3CHCA 1UHVA 3WDQA 4JTKA 4FXSA 4DJDA 4E38A 4GBUA 4HCLA 3SI9A 1Z8AA 4O1CA 2HK1A 2PDFA 1O68A 5DCEA 3O8AA 1I75A 3ANVA 1E51A 4LC6A 3JS3A 4Z2HA 3TW6A 1EOMA 3ANYA 2FHCA 4W89A 3CBWA 3VX1A 4QSHA 4A4AA 1WB0A 2DIEA 4LVBA 3FXGA 3KW3A 4BI6A 4I90A 3W1NA 2OEMA 4JTDA 1FWHC 3MMWA 4E3VA 3W1PA 5PTDA 3BQ5A 2H9AB 4PCPA 5IHSA 4F0RA 2WZIA 4JCMA 2YPIA 1E1CB 1XCXA 4B3ZA 4Z42C 2J75A 3B8IA 2B81A 4RZ6A 1XIEA 3VC5A 2XIBA 3L67A 3W26A 3MP3A 1MWOA 4UFJA 3CL6A 5DBTA 2XVLA 1YHTA 3NPUA 2WKLA 1Q4NX 1BXBA 2WHLA 3CV6A 5EMMA 3HFYA 3DHFA 5CPSA 1F74A 1U30A 3U7BA 1QATA 4GNVA 4IGNA 1TV7A 4GISA 2J24A 5GPRA 4QX4A 3LX9A 4CQDA 2BVWA 4MLJA 2G4JA 4PMJA 4GPNA 3DERA 5D2XA 3PTMA 2GDUA 3QW3A 1UJPA 4H2HA 3K30A 1T99A 4PL1A 2X2YA 1U1UA 2X40A 1A4MA 2J13A 4ZTYA 3MBFA 1ZL1A 2QCHA 3A12A 4F48A 2ZXBA 3IIVA 1MVYA 2D73A 3LXCA 1SYTA 1EJXC 1TJ2A 2DZXA 2A3BA 5C70A 1TZZA 4IF2A 4IIHA 4OOZA 4QG8A 4D8AA 2CEQA 1K9FA 1TO3A 4WF7A 5KSWA 3H23A 1P43A 3W7GA 2F2KA 3QQWA 3QZEA 3SQSA 1OX5A 1WDSA 3NZ1A 3P74A 3CUHA 1FA2A 3V36A 4B3KA 3GXFA 5T8GA 1BYAA 4NZ1A 4AXKA 3D3FA 5KEZA 5C0QA 3DYPA 3CMFA 1KXHA 4D9PA 3M43A 1S5VA 4R7OA 3PSVA 2DUAA 1GNXA 2VEGA 1B30A 3HG3A 3OYZA 3GXDA 4NNAA 2W79A 4JQ1A 2VVNA 2H3DA 1KCXA 1UG6A 1NOWA 1BHGA 3M47A 1I0DA 3CC1A 3IJ8A 1K7XA 2AL2B 1P7TB 3CAVA 3S9IA 4CD8A 3PJXA 1NEYA 3HPFA 5AFDA 5JH1A 2W63A 3P2VA 4V28A 9CGTA 1FWDC 4K6AA 1TREA 4AY1A 2VCAA 4UTWC 4DZ5A 1O1HA 5FJUA 1V6TA 3T55A 3F2DA 5H8PA 5JBDA 3ARWA 4C6QA 1LTDA 1VFOA 1WZKA 1K9DA 1ZCCA 3S42A 3TA6A 4TUFA 1NWSA 3WK3A 1K9EA 1OHLA 1JJKA 3QH2A 1KXQA 1Q6OA 2G3JA 3I65A 2PEVA 3M5XA 4AY8A 3MVTA 3UEQA 4J3VA 2AKMA 2XIOA 4JTQA 4ZO8A 2WLZA 1TSIA 4BR1A 4LH8A 3PZ9A 1F4HA 1ME9A 1V3IA 1KGWA 5DXYA 1J11A 3HG4A 1PJ9A 4D8LA 6PTDA 4HHLA 2QJGA 1HNYA 1PIFA 2HS8A 2WM0A 3W7CA 1N7KA 3PWIA 2HBVA 3OVRA 3SUSA 3TC3A 3OIXA 4OV9A 2CITA 1H62A 2PA6A 3FA3A 4H7ZA 4MJ4A 4Y9MA 1FDJA 3DG7A 3W00A 1W32A 3G24A 5I3IA 4MHBA 6XIMA 2O0TA 1ZPTA 1V7AA 1WOAA 4OIFA 4X0VA 3MB9A 4JIQA 3WBAA 1YDNA 3W9ZA 2GSJA 1VCVA 4CEUC 3WMBA 4L4OA 4LXFA 3SW6A 1OX4B 4JTFA 1VFHA 1XDMA 2AQVA 4HHPA 3I3BA 2Q8LA 2XN0A 3FJLA 2FZ9A 4LSBA 2DV0A 4AD0A 4UFKA 1XYFA 2J77A 5A6BA 4IMEA 4ZOCA 1K8ZA 2WVSA 3CWHA 3ONBA 4R85A 5BMXA 3WLLA 4BS0A 4LFYA 1EB3A 3B97A 3PJUA 2BZNA 2IPWA 1Q6FA 3B0YA 3URQA 3WEMA 3REQA 5JXQA 1OADA 3S2NA 1ITXA 4QNEA 2Z00A 2VVSA 2A0NA 4B3LA 1WAUA 4C1NB 1R9XA 2F8QA 1N8WA 3RN6A 2X0SA 4ADUA 4GG9A 4LUSA 1FH7A 2GVYA 4Z0JA 3G5EA 4RZBA 2FVLA 3AHZA 3CIWA 4JX5A 2W0UA 2DEPA 2E9BA 4HK7A 4TVCA 4HOZA 2YA2A 3AOFA 3GE7A 3QVQA 5CAKA 1P0DA 1RCQA 3M07A 1RAKA 3THQA 2X1IA 4WKHA 4CD4A 4JEJA 1IEQA 3A3XA 4UR7A 2Z1SA 1GKRA 5D8ZA 1FDYA 4UFIA 1WBJA 3GNNA 3STCA 1BWLA 5FL0A 3AMLA 1JGMA 1XIBA 2PP1A 2Y7GA 3A64A 3L66A 3EOOA 4YHEA 2RGLA 1R2RA 3IJLA 1QW7A 3KVMA 2HNHA 2P0IA 3HGSA 5LSMA 2ISVA 1E3XA 1WXZA 4F0MA 4PRTA 5ENLA 3AMGA 3ITCA 2VD8A 1E0WA 3O63A 2VMFA 2HEJA 4JFTA 4PMRA 4M6PA 2V2CA 4AFYA 3IIOA 4E6MA 3NUKA 1DJHA 2JGQA 2JIWA 4P7OA 3NO3A 1KRBC 1TV3A 3R0UA 3ZVHA 2OELA 5AVHA 1DHPA 4XIAA 3L4TA 4QJ3B 1NH6A 1BYBA 4QE5A 2WWCA 4YS1A 4OUEA 4HPJA 4O54A 2NVDA 4LEQA 4ATWA 4HIBA 2J9ZA 4FNTA 2E77A 2IQDA 2VX6A 2GUYA 1XRFA 3GC4A 1F8MA 4LPCA 2PWDA 4KF1A 3SY5A 2GK1A 1XUZA 1S2WA 1PIIA 3KOXA 3GWQA 5MKGA 3F4WA 4XK2A 4GZJA 1E43A 2E25A 1GOKA 1G0CA 5D38A 3OA5A 1FWSA 3M9YA 1BAGA 1A47A 2FIQA 3AXHA 4HJFA 2RHGA 3C2RA 1EO7A 4AWTA 1CT5A 1J5TA 2D0HA 4LS2A 1O5XA 2A85A 1A3HA 3W7JA 3N12A 3TMQA 4HK6A 4B5SA 2POTA 2EG8A 2XJ7A 3P80A 1N8IA 4JKKA 3LTPA 3VIJA 4JQ3A 3CIVA 1FHUA 2TAAA 3L5AA 3NJ3A 3G1FA 2QIIA 2ZXDA 1JPKA 1KFCA 2BHUA 1RCXB 4X2RA 3PZOA 3WLKX 1KKOA 1QNQA 5HNUA 4DWSA 4LB3A 3AJ7A 4QSFA 5B7ZA 5I5RA 3CEPA 3RXZA 4BQ5A 1VFUA 3RUBL 1AG1O 4GXMA 1G7VA 1J96A 2WSKA 3APTA 3NSXA 5HR6A 3BCDA 3AIQA 1FY6A 2DQXA 4L1GA 2A6NA 1R0MA 1E6PA 2IPFA 5FI8A 3H24A 4UMCA 1QPKA 5IBXA 3DG6A 4W84A 5I2UA 3II1A 1EO5A 2Q6ZA 1NQKA 2ISFA 1LRTA 5ABGA 3LGGA 5AHIA 3H4XA 4DJED 2CLOA 2E6FA 1XG3A 2DT0A 2VC6A 5KTLA 1E3ZA 1KXTA 3NDYA 4AD4A 2EPLX 4IIFA 3SECA 4GGBA 1CW2A 1H41A 1PO9A 3NEHA 1C8YA 3M44A 3PPGA 4XVDA 4AEEA 2ZVRA 5DCDA 3FEQA 3EYPA 3MP5A 4U4MA 1HW6A 1T41A 2DZBA 1RA5A 2R1LA 5A8NA 4ES4A 3ITGA 1OD8A 5I0DA 4WRHA 1HKVA 4S39A 3VIIA 2PGWA 1ALDA 4GI9A 1SM9A 4IXHA 3DC0A 2YGYA 4KW2A 3OW1A 3QR0A 1DIEA 2Z27A 3STPA 1KTNA 3FCPA 4PODA 4G56A 1OX6A 4LS1A 3B9AA 4RZ5A 1JCJA 3WQ4A 4H7VA 5CJMA 5JVLA 4WY0F 2AOSA 2BBFA 1XHGA 5DBUA 3N2XA 4OE7A 1TMHA 2D2JA 1JCNA 4Z1YA 1YRRA 1XI3A 3N14A 1JQVA 1VHCA 5H6HA 4DI8A 2PDIA 3VNJA 4A29A 1J0ZA 2XM1A 1K7EA 2CZEA 2PDJA 2ZRYA 2PD9A 4BQ3A 4M81A 3TTEA 3MI3A 3RM8A 1BG4A 4DPQA 3SAZA 3I4EA 3CB8A 1UKQA 5TD4A 1J6PA 4ACZB 5I3HA 7CGTA 3SFKA 5IRPA 2QGYA 2YCLB 4YYFA 4OFCA 3D46A 3Q4DA 4IL0A 1O5QA 4AX6A 5EGRA 1VYRA 3HG2A 1SFLA 4NAEB 4JFSA 4EXBA 4H9ZA 2VUYA 1S3TC 5CBJA 4WLCA 1AVAA 3N4EA 2FTWA 3TYZA 2INFA 2C91A 1FRBA 1PHQA 2ISWA 4PE8A 2R9RA 1NARA 3JRKA 1GVYA 3GS6A 4JY9A 5AZ0A 3P8JA 3CEUA 3QEZA 4JTGA 4ZEPA 4H8HA 1A0CA 3DHUA 1BXNA 5D2WA 3EGJA 3WQ5A 5JBEA 3APYA 1TUXA 1BPLB 2O9OA 3RMJA 2WV8A 2RDWA 4HMNA 4M19A 5F2IA 2YDQA 4NJIA 3VPLA 3G1DA 3UYCA 1EWEA 4P8XA 3XISA 1N82A 4KRTA 2FTPA 2PE4A 5GQBA 3W28A 2V0TA 1HG3A 3BV7A 1S1PA 2QKFA 1DTUA 4DJEA 2ZZ6A 2D2GA 2HSAA 4C1LA 5IDZA 5I3GA 3EMQA 5D2TA 5A6LA 1E6QM 3EMZA 4S3BA 4XQ6A 1OCBA 2CC0A 4A2SA 3T7VA 4I7WA 1E0TA 2G41A 3TZFA 4LCRA 1CGUA 1OG6A 1W9VA 4L6HA 2FZMA 3RM4A 4JHOA 3W7KA 4RNJA 2VEIA 1J93A 1WP6A 3APGA 5KINA 1U2YA 1JPDX 2C3ZA 1SMAA 4IISA 3GB6A 4QLKA 5E6YA 3PB2A 4DYJA 4XZBA 3QY8A 1KD0A 3CHDA 1RY0A 1X96A 3LNMA 4O14A 4PBEA 3GG8A 3ARSA 4LT9A 4F0KA 1ISVA 2BX7A 5FF2A 1E5JA 4QCEA 2WAGA 3Q2DA 2QUUA 3BG9A 1KV5A 1RQBA 3UPBA 1W3HA 1TZ9A 4TX8A 3WLRA 4HNTA 1PCWA 4DEFA 1OIMA 4GD0A 4BWLA 1GVQA 1DPMA 1OC7A 3KDOA 1UH2A 3CZJA 4RLIA 4PUJA 2Z25A 2DT3A 4NXKA 3W7NA 1A5KC 2XIJA 1UOZA 2J78A 1VJZA 1J6OA 2ZUSA 3GU2A 2PPGA 4WSKA 3QQ1A 4JS3A 2BODX 2RDXA 1CNVA 2O55A 2Z2UA 3NTYA 1XX1A 3P62A 3EDDA 3WL1A 5A6AA 3BG5A 1YMYA 3RRAA 1SO3A 1DKWA 2V6AA 2FGLA 3QSRA 1WZAA 2BLEA 3K4DA 3WYZA 1I2QA 3EZ4A 4NT0A 3MT1A 4HKPA 4FSAA 1A80A 4K39A 3VNKA 3CT2A 4NAFB 4TR9A 1W1IE 3M7WA 3T2OA 1H7NA 1E9IA 2PTZA 4MZYA 5EY5A 1A5SA 3E96A 5FKYA 1AZ2A 1RV8A 2PGEA 1NWUA 3QC0A 1TPVA 3VDHA 5F4SA 1GG1A 2VUNA 3FYPA 2FMOA 2GVGA 3NO5A 1M7XA 1DJXA 2AKZA 4J9JA 3G1RA 2C0AA 3ITOA 3R25A 1QPOA 1DWJM 4WOZA 3D0CA 2ZIDA 3MO7A 1SZGA 5DT7A 2H3BA 1UKTA 5D9OA 1LQAA 2C18A 5LXXA 8XIMA 1PXGA 3IJDA 3K4WA 3UETA 1KBIA 4L9ZA 1X8FA 3ZXWA 2DT1A 4XZNX 1EJSC 3AYTA 4US6A 4DVOA 2OTDA 3QHNA 4LUTB 4WDXA 3LBCA 3SSJA 1WZMA 4IIDA 1Z41A 5HA7A 1KBLA 4EWJA 4Z1AA 4MNKA 4ADTA 4ZO7A 3T2QA 3L0KA 3T0TA 1CLKA 1MW1A 3E9AA 4L9XA 5DY2A 2PDYA 1P7TA 4FR6A 3G1XA 4XO6A 2NV1A 3O0FA 3G1SA 1GPFA 4PBGA 4I6VA 2WM1A 4Z1BA 4QJ5B 3FVDA 4A3HA 1KCKA 3AU2A 1LJYA 5AYXA 4C6FA 2Q3RA 2FQIA 2XGBA 1GOIA 1CYGA 4ZOAA 1A0DA 1CXKA 2VCBA 4ZR8A 3S9YA 3ISIX 3TYUA 2UY4A 5LKYA 1GZ1A 3TW9A 3W2MA 4NSBA 1F3WA 4CNNA 3WJYA 5BNKA 4W7UA 3V16A 2JEPA 4UR9A 1CDGA 4QEHA 3WLPA 1M6JA 3TEVA 3ITLA 3EEGA 3VXGA 3W7LA 4AU0A 4C90A 1IT8A 4O17A 3R4IA 1PKNA 1R2SA 1BVWA 4M56A 4GIEA 1XD1A 2F84A 3UVAA 2QV4A 3D3AA 3WLQA 3TTQA 4V2XA 3VOCA 3KOYA 3PWGA 4KIEA 4BFAA 2O9TA 1PEZA 3ARVA 2VELA 2OT1A 3WDJA 3UR7A 4ZTXA 1W2VA 5CGTA 4CQAA 2XWDA 3VD7A 3R7MA 3MDWA 3WH8A 4U31A 4PTXA 2E1WA 1POKA 1H7RA 3VM5A 2C8NA 2XFWA 1OC6A 3N11A 3K1GA 3VNMA 2DU2A 4EVZA 4B5NA 3CUXA 2ZUVA 4FO4A 1SU5A 3QPYA 3AUOA 3TTYA 1ECEA 4LBRA 4Z2IA 3GDBA 1UUOA 2BV9A 3VMPA 2D69A 5DF0A 4N7QA 4QE4A 5TNVA 1H3GA 1Q2SA 3WH5A 4R34A 1F76A 2REQA 3HGRA 2C15A 2NVCA 2OKOA 3V75A 1V6XA