4YNBA

Crystal structure of helicobacter pylori 5'-methylthioadenosine/s-adenosyl homocysteine nucleosidase (mtan) complexed with pyrazinylthio-dadme-immucillin-a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
230
structure length
230
Chain Sequence
b'VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Aminodeoxyfutalosine nucleosidase
publication title New Antibiotic Candidates against Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/inhibitor
total genus 86
structure length 230
sequence length 230
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ynbA00
3KUKA 1ULAA 4YNBA 4TXHA 3MB8A 4D8XA 1T8RA 4WKNA 1U1CA 1YBFA 3U40A 3OZBA 2IQ5A 4JP5A 4E1VA 3E9RA 4K6OA 2OC9A 2XRFA 2H8GA 1B8OA 1A9OA 4WKCA 3KVYA 1RYZA 1YR3A 1YQUA 1SJ9A 1V48A 4GLFA 3BSFA 3INYA 3UAZA 3EMVA 5B7GA 2AI2A 4QAQA 5I3CA 4DA6A 1V41E 4LDNA 5FAKA 3P0FA 1A69A 4M1EA 1JP7A 5CXSA 3PHBE 3NM5A 4DA0A 4L5YA 3DF9A 3K8QA 4G89A 4I2VA 1K27A 2ISCA 1LX7A 5B7PA 4TS9A 3KVRA 3QPBA 4TYMA 1JE1A 4U2KA 3BGSA 4M7WA 4GMHA 1PR2A 1PR5A 4D8VA 3ONVA 1CB0A 4MCIA 4YJKA 2HRDA 1U1DA 1LVUA 4LNAA 1V45E 4L5AA 4F2WA 4G8JA 1OTYA 1TD1A 4TTAA 4TXLA 4DANA 1NW4A 4OF4A 1PKEA 1VHWA 1A9SA 1PWYE 1Z37A 1WTAA 3UAVA 1PF7E 2QPLA 3D1VA 1N3IA 1QE5A 4MCHA 1V4NA 1B8NA 4OJTA 4NSNA 2BSXA 1Y1TA 5EUBA 5B7NA 3IOMA 4YO8A 4BN0A 3O4VA 3MMSA 2GUWA 1OU4A 3UAYA 4EB8A 1T0UA 4X24A 5F7XA 3DP9A 4QFBA 1V3QE 4DARA 1OVGA 4JWTA 5CXQA 5IFKA 5F73A 1Y6RA 4JOSA 3F8WA 3TL6A 1TGYA 3LGSA 5ETJA 4QARA 4DABA 4BMYA 3KVVA 1Q1GA 1SD2A 1VMKA 3O6VA 1NC3A 3LA8A 4QEZA 4L0MA 1U1EA 4D98A 4G41A 4QATA 2AI1A 3OCCA 2OXFA 1NC1A 3EEIA 3KHSA 5C80A 1K3FA 1PBNA 4WKBA 3FNQA 3OF3A 1T8YA 1Z36A 4M3NA 4TTJA 5F7JA 5CYFA 2HN9A 1OTXA 3OZCA 1RT9A 1JE0A 2QTTA 2A0YA 1RXCA 4YMLA 3FUCA 2A0XA 1VFNA 1ZL2A 1CG6A 2AC7A 3ODGA 4FFSA 4OY3A 1JPVA 1Y1QA 4L6IA 5F7OA 5CYGA 3GB9A 1ODIA 3IEXA 4OGKA 4MARA 3OZDA 3E0QA 3E9ZA 1Y6QA 1A9PA 1RFGE 3NBQA 1A9RA 1A9TA 2OC4A 1RXUA 1RCTE 3EUFA 1PR6A 4IP0A 4KN5A 3OZEA 5CCEA 1A9QA 1TCUA 3P0EA 3DJFA 5CCDA 1LV8A 1YQQA 3FB1A 1OUMA 1ODKA 1JDZA 1OV6A 1PR0A 3SCZA 1SD1A 1Z5PA 4TXMA 4R2WA 3K8OE 5EFOA 2QDKA 5F78A 1JDVA 3BJEA 1JDSA 3OPVA 4F2PA 5JPCA 2RJ3A 4WKPA 2Q7OE 1YRYE 3FOWA 2PGAA 4R2XA 1I80A 4F1WA 1PR1A 1ZOSA 5EPUA 4DA7A 1JDTA 3EUEA 1ULBA 3NM4A 1PK7A 3PNPA 4TTIA 4D9HA 1TCVA 4BMZA 3DDOA 1RXSA 1Z5OA 3PHCA 2QSUA 1M73E 4PR3A 4LZWA 1Z34A 4H1TA 4NY1A 4RJ2A 4EARA 4TS3A 4QASA 5K1ZA 5KB3A 3UAWA 1SQ6A 5F77A 1T8WA 3C74A 4LKRA 4ECEA 3FWPA 1FXUA 4WKOA 2ON6A 2B94A 1XE3A 5F7ZA 1Z38A 2OECA 3BL6A 3OOHA 3PNSA 1RXYA 1Z5NA 1Z33A 2I8AA 1RR6A 4F3KA 4TXNA 1ODLA 4BMXA 5B7QA 4DA8A 1JDUA 4D8YA 4OGLA 2HSWA 4NS1A 1Z35A 1PK9A 2A0WA 5DK6A 4TXJA 4GLJA 1ODJA 1U1FA 1JYSA 1Y1SA 4GKAA 1ECPA 3GGSA 1V2HE 3FAZA 1T8SA 1RSZA 4OEHA 3UAXA 3OOEA 1Z39A 3T94A 4P54A 1K9SA 3KU4A 3NM6B 1PW7A 4R31A 2A8YA 1Y1RA 3LBAA 4UC0A 1C3XA 4DAOA 3ENZA 2HWUA 2I4TA 1U1GA 2QTGA 4DAEA 1VHJA 1G2OA 1PR4A 5IU6A 3UT6A 4L5CA 3DPSA 4F3CA 1TGVA 2P4SA 4LNHA 5F76A 2AI3A 4PNPA
chains in the Genus database with same CATH superfamily
3ZUGA 1U0BB 4MIOA 5J47A 2F64A 5EY5B 1IHXA 1U7PA 1ZR2A 1YBFA 5CA1A 4NCBA 2VCEA 2QD2A 3ROPA 4C4AA 3WL7A 1QZZA 3MGCA 4M22A 5EJ7A 3GF4A 1IVSA 1VP9A 3RS9A 2GF9A 2C7OA 3RUDA 2NNWB 2F43B 1YKSA 3UB3A 1M2VA 1NI4A 5LA6A 3RTAA 2BT4A 2OCAA 1DBRA 2R5NA 4MITA 5AKYA 2ADOA 5LMCA 2P9QA 4ZO8A 3LGXA 2JBAA 2AXEA 2DUMA 5DMHA 4E4RA 4RTLA 3U4MA 2O7QA 5G4KA 1WW2A 1HRKA 4HWGA 5JEEA 1TF5A 3H2JA 5B58C 2OCKA 4YJFA 1ISMA 1XPJA 2Q5EA 3L6BA 1JHAA 3TL3A 4DHEA 2P6UA 3IP6A 4RSGA 5CVCA 2ONZA 4JQCA 1ZG3A 1DKMA 2A1UA 2A88A 3CC8A 4OGGA 3U9SA 3OLZA 2G6TA 3JQFC 4QEKA 1SQFA 5SY9A 4AWAA 5DOZA 1TX4B 3PFBA 4IAOA 3KXDA 1TQ6A 3TTXA 1KFCB 2J48A 1O6FA 1SUCA 4M4SA 3TLMA 7ABPA 2FMHA 4YJ2A 3HKEB 1G7TA 2MR5A 3PGMA 1VPWA 2BD0A 2I54A 4FDVA 2NGRA 4CCYB 3KR0A 4DBLE 1SVKA 3HVJA 3F4LA 4ZANA 3U4AA 2QNIA 3DLTA 2JGNA 1UMBB 1ACMA 2OZLB 5BSTA 4U39A 2W6ID 4DA0A 5CAEB 1Q57A 5DKFA 2QMHA 2FG7C 1ZIXA 4AN0A 2BM1A 4IJUA 3T3HA 2QP4A 5AM1A 5KOHA 2VLBA 4L5JA 3CNBA 3O7WA 1F4PA 4TRRA 5E3JA 5AK0A 5EWMA 1X2BA 2H16A 3ANXA 3S4YA 4CHGA 3ELYA 1L4NA 2OV3A 2ESRA 4P4NA 2OAEA 1L7XA 5BSVA 1B8PA 3JRNA 1N8NA 1VE6A 1Z18A 2O7NA 3M3HA 3QNMA 2I03A 4RA6B 4DVGA 4D3DA 3G2PA 5I4KA 1REQB 4Y2QA 4PO8A 3BX1A 2NO7A 1W88B 4W1RA 3RSGA 4ARIA 2HXGA 4B71A 1KFBB 4L22A 2G1KA 1GUBA 4X60A 3FROA 1GR1A 1LK5A 1VE1A 3K9CA 3L8GA 1KIMA 4MRNA 4NZZA 1FYXA 3C4QA 5JQGB 4RZXA 1JAZA 1X7YB 3BIFA 3AKYA 1AKYA 3LG2A 5JZBA 2VJAA 1BVYF 1X19A 4MA4A 4OHFA 4BCDA 5IJ0B 3WDMA 3L4EA 1QS0B 4IIJA 3W78A 4TM7A 5EKSA 1EK5A 5CA1F 1G59A 2A94A 3CSSA 5KMGB 2ZRQA 1EH5A 1TJYA 5CPFA 3FWYA 1RJGA 2CMFA 2Q1SA 4OAQA 1ZUIA 4TXLA 1N5OX 2XYGA 5LA6F 1Y98A 4OF4A 2YXEA 4YIKA 3S44A 3EYWA 4TWBA 5FX2A 3BSWA 1Y7TA 3ZJYA 2L18A 5K8IA 1N2CB 3AUAA 4PZEA 2XLCA 2JIQA 1KWKA 1EFRA 4YJDA 1MAUA 2CUZA 2GPYA 1UK7A 2PLRA 3AM4A 1UBNA 3BGOS 1T6NA 3A9TA 3MTJA 4JHXA 4OJQA 4M1MA 3R7SA 4BKOA 3OE5A 1A71A 1WW3A 2HWYA 2VPQA 1QE5A 4DR4B 1J0XO 4WZBE 2OFPA 3BRQA 4KPFC 1Q44A 3QVJA 3D0OA 4G0PA 1BX0A 2IZ7A 4KXUA 2EVWX 4BLVA 4KI0A 5EUBA 2XCQA 3CUKA 1R6VA 4NMWA 4Y0VA 3GG9A 3TRJA 1PL8A 3NWPA 5C8YA 3ZDRA 1N2IA 2WPNA 1M34B 1OBFO 1QC5B 4HDRB 1Q84A 4UUAA 1AMUA 1KYYA 1ZCAA 4EB8A 1JLMA 5DE3A 1YDMA 1NZJA 3VO1A 5AOBA 3NC0C 3FPGA 2IOFA 3MUFA 5CJJA 1ODSA 4AX4A 5EZ6B 1MJHA 3TEJA 5FOXA 3ZWKA 1XDWA 2Q6KA 3WMFA 3UMMA 3NTRA 4I4IA 1OR8A 2GHRA 4JLOA 1ZAYA 1WJGA 4M88A 1S3GA 1E5DA 2OQVA 4CKYA 1APBA 2ZI5A 2GD2A 3W5HA 1J9EA 1HKHA 3EVGA 4FYYA 3I83A 3AIOA 1P0MA 1Z2EA 1DXOA 1JG3A 2J4DA 2WT8A 1TT5A 2F2TA 3H17A 3W1EA 5A4JA 2Z8ZA 4XDGA 5JTUA 3QEMB 5IRCD 4FGLA 3H6GA 3AL2A 2IP1A 3PUHA 3DAOA 3P1JA 3RLFA 3AEXA 4DABA 1SVLA 1QYCA 1XDBA 4NBNA 3GMTA 3NORA 3NG1A 2IELA 4RIEA 1Z45A 2CV1A 4I1SA 2W37A 2YYAA 4GOND 2XHZA 4I7EA 4BVEA 3C7TA 1JFFA 2QG4A 3JZIA 3P9NA 4LJAA 4N9WA 3FPSA 4TYNA 3K9WA 3VSCA 3FCXA 1ZI9A 3PLAE 4FYXA 1TKRA 2OT3B 4IIJF 1G21B 5DVZA 3RVQA 1EP2B 2GBIA 2DP4E 2W6NA 4ZO7A 3R76A 4D2IA 2GYVA 2EF0A 1ONOA 4D9EA 4CTOA 3WMWA 4F5ZA 5KWIA 1H8ED 1K5PA 1S4MA 1YOBA 2O06A 2ZYUX 4XUCA 1C1YA 2CE2X 1T2CA 2W6OA 3JQ6A 2YOFA 4EJ0A 3P9IA 1GHTA 3LHFA 1QZ3A 5BURA 3GPLA 1XZNA 1P44A 1DHTA 4WVLA 4CIVA 1M8FA 2FPWA 3TLGB 2BR3A 5CB8A 5CFLA 4QHTA 1Z2AA 1W0KA 1Z73A 4IL5A 3M6XA 4IJMA 5EXEA 3PRKE 4F3YA 5IT4A 5IT9A 4TL6A 1TJPB 2CZGA 3UJCA 3ZD8A 2DTDA 4JV5B 2FMXA 3JXEA 2I6UA 3AWDA 1KH1A 5U9CA 2MSDB 2HK7A 3ICCA 3ADCA 1XZCA 1IK4A 4X6YA 2GS9A 4U2BA 4Z1MA 5TMBA 4CV2A 4N0EA 4GZ5A 1CUAA 1BA2A 3NEYA 3AUUA 4GQBA 3VZRA 3AKZA 1EVZA 1UM9B 2Z4RA 1RYMA 1RWKA 3ZK9A 3CVXA 3JYPA 1CFZA 3QBEA 4AS3A 2DLCX 4DM7A 1GQFA 3N5KA 1NN3A 2ISSD 1FY2A 4QDUA 3CX4A 4HQKA 4XXHA 2EFCB 4PG8A 1M2NA 2QTLA 4BTLA 3U4HA 4KQJA 1DAOA 2GO1A 2XWSA 3DBIA 1G9TA 3FNHA 3LBYA 4FZJA 5TQ0B 3UEOA 2SKCA 1FU4A 4NBUA 3UGJA 1EDOA 4FN4A 4R9SA 4XA8A 4L4RA 1NBMA 1BWRA 2ZDQA 3WSWA 3V6MA 3UWDA 3EDOA 2NUAB 2C5AA 4CL0A 5IYZB 4MK4A 2PN1A 4CF4A 3DXZA 3UKDA 3L1IA 3R9WA 4HQNA 4OGKA 5A4KA 3H7AA 1Z4PX 2OKCA 3Q85A 1CUJA 3L6EA 4JUDX 4IICA 1YAJA 5DP1A 3GLHA 4B6RA 4ETWA 1ABFA 4IW3B 5FUBA 1MB2A 1P6QA 1QFZA 2PPLA 3MOGA 4HX5A 2XWQA 3EIEA 2GZDA 2PMWB 3HXLA 2OP0A 3EQ6A 1EFKA 4L4XA 5GTDA 2PZLA 3GA0A 1IN7A 2JA2A 2IPMA 1AKNA 1SUFA 2VHEA 3I30X 1XJCA 2WDPA 4KVGA 4QYMA 1UFVA 4GHWA 4NDZA 1GNRA 3HWSA 1OOEA 1DKNA 3OJCA 2XZLA 4XVHA 3ITKA 3BF7A 3MG9A 4IP0A 1KJZA 2I99A 1RXEA 1E3DA 1HTTA 3MGKA 3VNRA 1IZZA 3AEQA 2F9LA 2PSEA 2QQFA 2H0AA 5JMTA 4ZYWA 4FFVA 1SVUA 3Q2KA 1JJIA 4I5DA 3B38A 4MHSA 1YQQA 2GXSA 4XGIA 3A3YA 3WR5A 1XD2A 3ROZA 5J4HA 2KWIA 1HMPA 3AERB 2Z0MA 4EY7A 4XWYA 2WKQA 4FXOA 2RH8A 1EWRA 1RKXA 2FG5A 2GHIA 3SCZA 3VUFA 5KYGA 2QSJA 3SZRA 1BDIA 3B85A 3HPQA 1UJ4A 1RI2A 1Z5PA 3AI2A 4X84A 3DWFA 1EA7A 1FPQA 1GARA 4HZUB 3K05A 4PYRA 5E7JA 3EBLA 2A35A 4KFSA 1FDSA 4LQ4A 1LQTA 3GG2A 4IHJA 5FBKA 4G0OA 2RHCA 4F2PA 3KTAA 5ICMA 2QTZA 4XIJA 1YRAA 1FW6A 1CERA 1EVIA 1ORWA 1R1DA 2JATA 1MNQA 5BN4A 2IZ0A 2FZKA 2I3BA 3V4FA 3AR3A 2B6NA 3KEGA 3R20A 3TD6A 2PGAA 1XKTA 2AFRA 4OP1A 1ZOSA 4MQ6A 2FNAA 3P9CA 3SM3A 4JB8A 1GNVA 4DC0A 1LGYA 1MENA 2Q1UA 4KUEA 2O8CB 4F5YA 1OX4B 5DWDA 4WCFB 2IEZA 5TLSA 5BRNA 4F04A 2PMCA 2GZSA 2P9GA 3NKFA 3OKAA 1T36B 3W2GA 3C97A 5CM2Z 3AHEA 4EUKA 3DW3X 1N5RA 1EXMA 4IV0A 1RAIA 3A4LA 3G5LA 4JSTA 4JT8A 1AJEA 2Z5VA 3CX7A 3P9SA 3AVUA 5FA5A 3UMBA 3PKIA 4BMZA 3MTIA 3E53A 3VOAA 2RE8A 3OETA 1T3HA 1Y4AE 3LNCA 1EJ2A 4RFLA 3LUBA 1U9IA 1PLKA 2D1TA 3I6YA 3OE7D 2C9DA 3GCGA 4GPIB 2Q1XA 4NY1A 1O0CA 1G2IA 5JYCA 3IHLA 4URFA 1L1RA 2GCEA 3HUDA 3SGLA 3TE7A 4AZWA 3OLQA 4A92A 1KK1A 4F11A 5JYDA 1C7JA 2PBZA 4YY3B 2CLOB 2GEFA 2QX9A 4BEVA 2FMFA 5HBRA 4EOGA 3ZBTA 4REQA 1EGVB 2JFVA 2WAYA 3GZJA 4EUEA 1QVZA 4F2DA 2R6GA 1GU1A 4PQGA 4C4YA 4KV9A 2EFEB 3W1VA 4ATNA 4MKFA 5ALPA 4RK6A 1PFUA 3JQAA 1LBIA 4XGRA 1UMDB 4AP6A 2CLSA 5AXCA 1AGYA 2H2DA 3G8AA 1ADYA 5AK5A 3D6TB 5HA5A 1DKUA 2C0QA 2EZ9A 1EFCA 4A03A 4GPD1 3FCAA 1KKUA 1E9CA 13PKA 1C8KA 1V7PC 2BKVA 3NOQA 4G1FA 5A3VA 2WY2D 3URKA 2P3QA 2HEGA 2PJDA 5BWOA 2IYZA 3WAJA 2C2HA 2XX3A 4LHYA 2OHOA 4N82A 3EVNA 5JW6A 1UC5B 3OVMA 1OWNA 1KNXA 1KOJA 3Q1LA 3RJZA 1KYWA 4GI7A 2OB1A 3OOHA 4YV0A 1GNQA 3X1WA 3O4IA 3DLCA 2AT1A 3TXYA 1RWBA 1AKEA 1L4HA 2Y1KA 5L53A 3GUHA 3VYRB 4JGBA 3EWNA 3QMPA 4N12A 4EQ6A 1SIBE 1BDBA 1E3QA 5CX1B 1TVCA 4QZVA 3I3SR 3IP9A 4P8RA 1RYHA 3O4JA 2ETVA 4F9EA 5BUQA 5FI0B 5DB4A 2QJWA 3EH1A 4TVBA 2Q0QA 5DNAA 5TRTA 4KQ9A 3TE6A 3BBPA 4R71A 2AG8A 2AOUA 1QPBA 3ROMA 3TM4A 3SS8A 3KKEA 2A33A 1XDZA 3PPIA 3NDJA 4MTLA 1DQRA 5K8CA 3OZIA 1GDDA 1OX6A 3JAWB 4GLJA 4HD8A 4U5XA 4YGYA 4M1ZA 1W36D 1BGVA 4YALA 4X7RA 4JY7A 3A7EA 1E6UA 3A25A 4F4IA 1WVMA 1YVPA 3V4LA 4GKAA 3FCCA 1ECPA 5DPMA 3VDXA 4BJ3A 5UKDA 1IJFA 1ZH4A 4KGXA 10MHA 3I73A 5IHPA 1VJDA 4RH3A 1FSFA 2GT1A 4IGKA 4PZZA 5E38A 1O9HA 3SJZA 3Q9LA 3SLGA 4AWXA 4YECA 5I8PA 3OJWA 3TXAA 3MAJA 3OQNA 3FKQA 2ZM5A 3VV3A 4DIDA 3HZOA 2VO1A 2JIZD 3REQB 1Z0AA 3CURA 4ZP1A 1RZRD 3TZLA 4JXZA 1V4VA 4S0XA 4BNJA 3Q9UA 3NBMA 5KAMA 1FYDA 4HLNA 3LF1A 1FRFS 1DJOA 1JTEA 1VMDA 2WWIA 3CN7A 1MC5A 4IYRA 4M8IA 3OP1A 4NKRA 4EW6A 5IC4A 5L4SA 4BXOA 5GOZA 5ESXA 4W4TA 1QHIA 1JQ5A 1TJ4A 1ZNWA 1PDVA 3GRYA 4MV1A 3ZWVA 3OUZA 3R3SA 1G5TA 5LMUB 5FLEX 5K3FB 5K01A 3IT1A 1TUGA 1SBTA 2VRCD 1G7CA 2IK8A 2JHAA 3JATA 3NONA 3OJLA 2ZXUA 1L3IA 3O94A 4ZYLA 1L8AA 2QLFA 2R66A 4ZT6A 4AIIA 3GLUA 4DSOA 1N4AA 1U2TA 2C97A 3QVTA 5JZMA 1C81A 3FSJX 2WD8A 3NHAA 3OJEA 4NJOA 3SX2A 3H8SA 1TM1E 4QJ3A 1PE0A 4Y2HA 1BTOA 3C41J 1GL6A 4FDUA 4FYJA 4MWSA 3VKGA 2IDZA 2K4MA 1OXXK 3CH7A 4X20A 1X1DA 3HCPA 5FL3A 2JLAA 4FBLA 4LNHA 5F76A 4YRPA 3HCCA 9LDBA 4IIEA 1JL3A 1IPFA 4ZKEA 1XAHA 4ALMA 5BWLA 3IBCA 3L07A 1QH1A 4ADSG 4ESEA 3H2GA 4CUKA 4WKNA 5EHGA 5AW0A 1I1QB 1LFDB 1YS2X 2Y2UA 3Q8XB 3FLAA 3Q3CA 4GBED 1JW9B 1XTSA 3WLKX 5A0TA 4H7FA 3A36A 1XQ1A 4GNRA 2HQRA 1FLVA 2HV9A 3MK31 1RHQA 2KW5A 3QYPA 1QHFA 4BO5A 2ZTMA 4J16C 4DL9A 4HRXA 3CN9A 1ZD1A 2K6GA 1ADBA 2WSSA 4RA9B 3W4IA 1IXKA 2D1QA 1JEDA 4EF6A 1SIOA 2P78A 2JW5A 2GYWA 3N1UA 3HN6A 4LJLA 2FQXA 2HLHA 1UL1X 3UJNA 2Q0SA 2H1LA 1CRLA 3O9MA 3OLXA 3L0ZA 4HWOA 4MIKA 3W34A 2WAOA 1Z88A 3L8HA 5EIBD 1XROA 2P4EA 3H16A 5D5QA 3V8MA 3C70A 4LX8A 4PVDA 3BMNB 4U2FA 4HFRA 4PTLA 2BV3A 4TRJA 3SIWA 2VQFB 1JQAA 2BISA 5BQ5A 1N2XA 1H2EA 1F0NA 4EQZA 2L82A 4R1QA 4B76A 3M34A 1PV1A 4BQQA 1L5KA 5KSZA 3A1TA 9ABPA 2GEJA 1XCPA 1LSOA 4ZGGA 1RJEA 4ZVQA 4HMOA 1HG1A 4UFPA 1QYRA 4C0LA 4EITA 5EEGA 2JCXA 1EBFA 1JHRA 2BMJA 5DF1A 1QGYA 1RCUA 2ZVJA 2JZCA 3EBPA 2AE2A 3JARA 5IT5A 4A15A 4ZVUA 4R8VA 3LZDA 1JSRA 2FOXA 4QYIA 3GX1A 2OV6A 2EIHA 4LV5B 4ARZB 2A84A 1W2HA 1B4DA 1GZVA 1H5NA 1NRIA 2PBFA 3MT9A 5DLEA 5F21A 4BP1A 1GO2A 1FRQA 5FP0A 1QIJA 1S02A 1W96A 2PU7A 2VA9A 1CEQA 3C15C 4NU5A 4ZZ2A 3V4RA 1GSAA 2FFJA 4KPEC 1KSJA 1KO4A 1GTL1 4C08A 3M70A 4K28A 1FVFA 4M8SA 2YJNA 2ABWA 1LPAB 4TLDA 1F5NA 2VSOA 1QR2A 3AU9A 3D8RA 2X0KA 1PNRA 1W5BA 1HLGA 3U09A 5E9JA 4XQGA 2AZDA 1VPLA 1T5IA 3I2GA 1IFXA 2VHWA 4XSGA 5ALKA 1KERA 1SZPA 3QVOA 4NPAA 4TRNA 1MC1A 1DG9A 1MFPA 1GTJ1 3Q11A 1Q7EA 2H48A 3NGXA 5DHUA 3ZWOA 3SWWA 1W4LA 1UPAA 4MHTA 4G0QA 4Y1RB 5GY7A 2VHYA 4MV8A 4ZO4A 1L5YA 4NYJQ 1RPNA 4RMJA 2GPJA 4AJPA 4QXRA 2H1VA 2FEMA 1RBYA 4KODA 3VYVA 3K2IA 2GJ4A 2Z3VA 2X8JA 2XDQA 1A9SA 4ZQCB 5CFMA 5TSDA 2DWCA 3T52A 2D00A 8AT1A 5C7IO 3R0QA 4KQGA 4BWFB 3UAVA 5LP1A 1H2FA 2ZBQA 4L0DA 1XTBA 1YCFA 5KAPA 4EYGA 3K9FC 4MUYA 3ZYZA 4M0MA 3UFXA 3DMYA 2YDYA 1M1XB 4RQTA 1GAXA 5IZCC 2TMDA 1YZUA 5AI8A 1PFWA 1JTFA 2ZU6A 3DO5A 4XYBA 3H5AA 2H3EA 3MJDA 5DIFA 3IPCA 4YO8A 4FNOA 1XALA 4RIHA 1UBGA 1H1DA 1XXHE 2HIMA 4RDXA 3U19A 2IYSA 3PQ3A 5SY4A 4EUHA 1JBQA 1ZP6A 2L19A 2CD9A 4RQBA 3T0IA 1MDBA 2CSUA 3D3WA 4YCDA 4YROA 4ZAFA 3ZCPA 5ARDA 3WGHA 5HZHA 3KQKA 1NVUQ 1UODA 4NIMA 4BRSA 5LP6B 3BKWA 4R9RA 4FEGA 3H0CA 2G4CA 1SXIA 3FVQA 1FXWA 1V3QE 4DBLC 1RM3A 4MX8A 3KOXA 3AW8A 2EEZA 3CR3C 4X41A 1RPTA 1PJZA 2OD2A 2UVPB 5AW5A 1K66A 1X6VA 3I28A 3JSAA 3B9QA 4HVTA 1CV2A 4MIEA 4QU9A 4C0SA 4DT1A 3F8WA 3P5BA 4HBGA 1OWMA 4YP5A 3DTNA 3DE3X 1MZPA 4FZVA 4Q1BA 1TGYA 4X44A 5LD2B 5K0TA 1D1QA 4Y2JA 2RK4A 1KL7A 1YIAA 2E55A 5T4FA 4AVYA 2WP8J 1TUBA 1UXJA 3AI7A 3KQWA 3KB8A 3IMEA 2FHPA 1PNTA 1PS0A 1TUIA 2IZ1A 4JEUA 2FWBA 2BL4A 4PPYA 4C1BA 1NF3A 4QXPA 4AP5A 1P4RA 3PYLA 4LUCA 4NJMA 2OORC 5BOSB 2WTUA 3KWLA 3SIXA 4A6DA 1Q0RA 2RARA 5HMMA 3WP0A 2YUIA 4CF6A 4AQ7A 3WWZA 4EYOA 1XYVA 1BVRA 1GA4A 4ASUA 4U63A 4MVCA 1CUWA 3GGOA 4R1LA 5DASA 1Y3BE 1C9MA 1VGQA 4ON9A 1QFJA 3MJHA 5LJIA 3ZHYA 1W36B 4US2R 2N75A 2BE9A 2O6HA 2VYND 4K86A 4H08A 1P39A 1ZK0A 2ZUUA 1J0BA 4OFXA 4NF2A 5C34B 2OK8A 5CA0A 4DR3B 3KT3A 3HM2A 3EAFA 1QH8B 3IMKA 3NBXX 4KLAA 2PX5A 4KWEA 4RYLA 3ZWAA 3T7SA 1MJFA 3T7CA 2E6KA 1WCWA 1XVUA 1HO3A 2CXSA 2DCUA 3GEBA 3N28A 3OF3A 4IJQA 4WLFA 1UFRA 3UK0A 4F1KA 4UREA 2OGSA 3UKOA 4FWTA 1J25A 4NEHB 1XDGA 2BFBA 4YI5A 2OL4A 2OWEA 2YWFA 3TOXA 4LMRA 1ECGA 5JDIA 4PG5A 5A04A 3KYIB 1DEOA 2Z9CA 1PQPA 4BGIA 1PP4A 3K8ZA 4LS3A 4P7FA 1B16A 4UM5A 1W6UA 1YBMA 3UMGA 3I3OA 2KI5A 5JNUA 2B0JA 2I7DA 3QLVC 3UBTA 4X90A 4TL9A 3QKUA 3FUTA 4TL7A 5IBPA 4ASUD 3A9RA 1YRBA 5H9WA 2R25B 2IT1A 3DD1A 3V7UA 1UIRA 3DZFA 1QQ7A 1RXCA 2OXRA 1P5FA 2SKDA 3KKNA 5G1PA 3OD1A 3RWOA 3VISA 2D1FA 3VR2A 3WK7A 1CUGA 3ZU5A 4WVFA 5E0KB 1MABB 1VLQA 5DRYA 1NULA 1XNHA 5KVCA 5FFFA 3JQBC 1T9HA 3FFTA 3ILVA 1K6IA 2VPWA 4MR8A 4EHFA 3V42A 3KPWA 4O3FA 2ZS8A 1U65A 3F3KA 3H18A 4NK4A 2PH5A 4PSKA 2O3UA 1Z4QA 5JY6A 3RG8A 2HNAA 3KJQA 5DM60 4ZMSA 3QH4A 1GJRA 3O8QB 1HE2A 3G7UA 1JIUA 1QYVA 3H05A 2ZRHA 3JQGA 5FI1B 2ZT8A 4LRUA 3VC1A 1JI3A 1LVGA 3MQ2A 3H5LA 1VG9B 2IHVA 4II2A 1YIOA 1V8FA 3O93A 1UKAA 2WWTA 1DDIA 4L7VA 1PL6A 1AU9A 4BN5A 3WL4A 3ZWWA 1A9PA 3BJIC 3E70C 5A7HA 3KYBA 3T3GA 1QIFA 3D7MA 3DHNA 1NIJA 2OC4A 1NSFA 2R7KA 3N2KB 4I4NA 5EJFA 1C3OA 5SYAA 4EA9A 4CIBA 2OHFA 2YN2A 1GGVA 4GICA 3SOPA 1ZN8A 3EGCA 4H0NA 3VMMA 1WMSA 5ALSA 3T0GA 3X1KA 2FSVC 5CEFA 3C5WP 2J41A 4KDRA 1JLSA 1WCIB 1E2EA 1YZYA 2ZT6A 4IH1A 4ZPJA 2Q27A 2EF1A 4GXRA 3SJUA 5K2OA 1D2AA 2BFEB 3ESQA 1IHPA 1UXIA 1JR4A 3M4JA 3VPGA 4KDEA 1X42A 2YH2A 4O08A 1EA5A 2OHIA 3PU6A 4JT9A 4O4JA 4QDJA 1NONA 4LDQA 5FPQA 4TKUA 2J09A 4RAOA 4A0FA 4ZEMA 3HB1A 1P2VA 2JH9A 4I55A 1NXXA 4RM3A 1HYHA 5ALZA 2IU3A 3PI7A 3WB0A 1JDPA 3NP9A 1JNXX 3QJ5A 4EYSA 1E8NA 1THZA 2CFTA 2CVPA 3JVUA 2BHLA 5PNTA 1DX4A 3C87A 3P7MA 4D3YA 4EW2A 5KU1A 3LY5A 4F38A 3ZGLA 5CD1A 3GLGB 3NGLA 3VYWA 1G5QA 3IIEA 4H3VA 3D0RA 4TV8A 1RWQA 1QNFA 2XYVA 5EE3A 1QBKC 1FDWA 2JFYA 3WLMA 4P4UA 4K88A 1ESCA 3IP5A 3BJEA 3DYBA 3BJMA 4HYQA 4QBIA 1NBHA 5T4BA 1C7QA 4B74A 3I64A 4O6VA 4DJ5X 1J0CA 4PN3A 2IOFK 5F52A 1CW2B 1ECJA 2LUOA 2VHQA 5T8KC 3U80A 4FC7A 4U4AA 3E9DA 4IGFA 1IAVA 2C99A 3ONNA 3PWZA 4FINA 3HS3A 3RBAA 4KC0A 1JB1A 2UZ1A 1ZJ4A 4XCXA 3NS7A 4UW9A 2BZ0A 2J3LA 3E9MA 5LMNB 1FSPA 4JN6B 3ZVMA 2FW1A 2EL9A 2JZOA 1T0PA 3HACA 4OQPA 4POAA 4PZCA 4YLEA 3HCDA 4A8JB 2C2OA 3VO8A 3UF0A 4B3JA 4JJKA 2EIXA 1Y5NA 4ZT5A 5EGSA 2V1UA 3MTDA 3W3AD 3IB3A 1YASA 4D3ZA 1B2RA 3AJDA 1L5RA 4YP7A 3BA6A 1HH4A 3ND5A 4ZTUB 1U11A 1Q15A 1X7XB 4WN9A 5LQDA 4ZT7A 2BDTA 1Z5OA 3CH4B 5DW3A 2Y1LA 2QBYB 1TZKA 2GD1O 1Y1LA 4DXAA 3MLAA 1P0PA 4TMXA 3MRSA 1ZD5A 1GG5A 4Y0NA 1VQ1A 3HEAA 2P0YA 3CRW1 3EZXA 3G2IA 4G1EB 1RTTA 4LZWA 3RTGA 1XZFA 1PNVA 2YHBA 1R4AA 4JGGA 4UM9D 5FOVA 1AHIA 5JD4A 4U7GA 4HDNB 4R8MA 1SUEA 1ZGZA 2R6AA 2W6CX 1W5FA 4QQ8A 4RDHA 1GRRA 2KHZA 2QMOA 1VDMA 4GPBA 2R44A 3KE9A 1VP3A 3OI7A 1QKJA 1CY6A 4WX2B 3SHTA 3TNFA 3UB4A 4EAAA 5KB3A 1U6IA 1CR1A 3VH2A 1RQGA 1XLTA 4LN1A 4LHWA 4B6OA 3L46A 2IEYA 3Q7PA 3NYQA 3MTEA 3IBYA 4X6XA 2IU4A 2E48A 2QQEA 2A9JA 1I2AA 3G6WA 4Y1GA 4G5SA 2QU8A 4HK4A 5AXBA 2XB8A 1XLVA 3TB4A 2ON6A 3DDNA 5JT1A 1PJTA 2RGCA 5D3ZA 1ZUNB 1XE3A 4NFLA 4AQDA 3NTLA 3E03A 1MRSA 3HPRA 4LDRA 3TRIA 3ZZ0A 4X1KA 1UFOA 3WGJA 3C6QA 3AY3A 3VBCA 2FQ1A 1ST2A 4HQ6A 3T5MA 2NO4A 3RSHA 3ZDCA 2WTNA 3K6SB 5JADA 2WWRA 2H1RA 3BTSA 5LQSA 4PAWA 4BVLA 2ZBRA 1L5LA 2GILA 2JLUA 1NXPA 2JEYA 4MW1A 4NH4A 3CWQA 1AO0A 4EWLA 1B14A 1G3UA 1P5JA 4Z9AA 3ESRA 4GRDA 3O0DA 1N6KA 4NU8X 1ZI8A 2CFRA 1ZJYA 3PE3A 5DYWA 4DILA 4ZDKA 5K45A 3GJ3A 1GTVA 2FEWB 2ODWA 4WBSA 1LBTA 2R8EA 4GPEA 4AY4A 4QGAA 3WI7A 3OEED 4MW4A 1OBVA 2YWBA 2H51A 3TEFA 3L9XA 5JNRA 4I1UA 1P2GA 2D5AA 4K87A 4A8HA 3CINA 5BNTA 1NF8A 2R4QA 1FJHA 3ZZNA 1WMFA 5EJ5A 5A2QA 2Q2VA 1ZD3A 1JX6A 4GZ3A 2B99A 4G86A 4KWHA 3QOXA 2EG9A 3A1CA 3N87A 3E7PA 3TXXA 1KH3A 1ODJA 1SOVA 1XRMA 4UBNA 2PVSA 1UOPA 1HZJA 3L8ZA 2WILA 2FPLA 1CE8A 4RW0A 3AIMA 5JO0A 2HRZA 1BCSB 3GO4A 4L8YA 5BSGA 1RM5A 1ZNYA 1VA5A 4P31A 1XZMA 4JZYA 4PBTA 3QQ5A 1NG1A 2DBVO 3ZHZA 3MGBA 3AT1A 1CQIA 3K8YA 3QP9A 3SVZA 4B48A 3QWBA 4MP8A 3NU1A 1GGFA 1USWA 2VPYA 3ON5A 4AZ0A 5FFNA 3MJTA 3R74A 5B3LA 1I7DA 1R7RA 3C3BA 3GN1A 3HWX1 3LC2O 1PT8A 3OCXA 4P54A 1W44A 2I1WA 4LY9A 4WKGA 2R7NA 3LM8A 3RRYA 3WLRA 4MS3B 4OFWA 1ISJA 4L50A 3RYIA 1XJ5A 3AF0A 4XE5A 3VTKA 3H5WA 3HBFA 5JOQA 1OYWA 2HLDD 3KKPA 5I9TA 4CW7A 2PFKA 1G3MA 2QE7A 4WUTA 5B6IA 4UQOA 1FMFA 3QOWA 4D3SA 3WNBA 2QVBA 3SG0A 4CKCB 1GUYA 1PEYA 1MTZA 4DAOA 1QORA 3HXKA 5FLXA 4GS5A 4DQLA 3A14A 2A4KA 4B0PA 3QVUA 4G2TA 3IO3A 3PA6A 4RHUA 2LDBA 2H2WA 3E84A 1P2SA 4J03A 1T2EA 4WACA 3QXHA 4JLPA 5JS1A 1VHJA 2NT3A 2PG3A 1LPOA 3GVCA 5DX0A 3TZBA 3ZXIA 1B7GO 3GBSA 5F1OA 2Q07A 1QTIA 4L5CA 1XPRA 1PV2A 3DUFB 3BTVA 3D4OA 5IF9A 1O03A 1LRLA 1HDYA 1I4DD 4U7JA 5KCMA 2IBSA 2SCUA 3OJFA 3LZ6A 3U0BA 2HH9A 5AW9A 4A0QA 3AQIA 5KDLA 3FRHA 4FB4A 3EIOA 1C1DB 4PE5B 2PH1A 5CT9A 2ZEJA 3FA2A 3E2IA 4TTPA 4F3TA 3V4OA 2IUUA 1MX9A 3NBAA 4M0LA 3ADOA 1X1RA 3IL2A 5EERA 3HY4A 2R84A 2ERCA 2VDNB 4YRIA 1AKVA 2PKQO 4YMIA 4F91B 5DP2A 2QENA 1JR6A 2FFRA 4L8VA 1LI7A 2XRFA 5T64A 2XOKA 4X1IA 3M6VA 3PXGA 3ZX4A 1JG1A 3VKFA 2I0FA 3RS8A 1TF2A 2BCJQ 3R0JA 1NT4A 1G3IA 2PX2A 3C1TA 3JYOA 4CLDA 2JHCA 5AUOB 4KPYA 3D2CA 1E3MA 1CUHA 1I33A 1TU4A 3SI7A 3CH5A 4BJHB 3IP1A 4CU2A 2ZSFA 5I5GA 5KJ1A 2DFNA 1KAMA 3LCJA 3O1HB 2EBFX 2F3RA 3R3XA 4OSEA 2X8BA 3GQBB 3LBIA 3GUCA 3ZCVA 3QF4B 2H63A 4EJ6A 4ABYA 1QO9A 2ZQZA 1GGMA 2O2SA 2W93A 4ETIA 3KAJA 2DR0A 4LYDA 2UUPA 1SUBA 1NNSA 1ZIPA 3E9YA 4G0NA 2OO5A 4X54A 4EGQA 1OVMA 2HK6A 3Q8KA 2XUGA 4P34A 4EF5A 3MBIA 3E3NA 1P31A 2F43A 3RI3A 3O8BA 3RU9A 3TQHA 4ZZ0A 1Q12A 1EAYA 1LX6A 1MDFA 1H6BA 3EB9A 2P5YA 4RK7A 1QFMA 3BK1A 1NSTA 4ZODA 4I81A 3RRMA 3HEBA 4ALIA 1MEEA 3ABQB 3TINA 3ZEIA 3FJ1A 4P84A 5DNEA 3FTFA 1T9GR 3IUSA 3HK2A 1UZAA 2N3ZA 4KQMA 3VFDA 3K71B 1LBHA 1JZTA 2QR2A 1YKGA 3JD3A 3U1VA 3FVTA 2CVFA 4TS9A 1I01A 2GAJA 1GZDA 2GKOA 3D43A 2WPDD 3C3MA 4U2KA 1IWOA 2C2GA 5CYPA 2HIGA 5ITWA 1NJ8A 2O2HA 3C5EA 1GG9A 1YC5A 2BZGA 2H2GA 2YXDA 3HFRA 3E81A 4LPSA 5FFMA 1JEQB 1DC8A 1IMOA 4HDCA 4UDNA 2Z1DA 1YUNA 5U4XA 1LLDA 1DRUA 4IS3A 1X92A 2J1LA 2JPDA 2HRDA 3HKEA 1FUKA 2AXQA 1KC3A 2A9QA 2H2HA 2YRWA 4IXDA 4WEQA 5BO5A 4FYMA 2ATIA 2QTAA 2P4HX 4CCYA 2ID9A 1OB5A 2VDVE 4DJJA 3BWYA 1RXWA 3OFNA 3ORYA 1UZMA 1Q50A 1WLSA 1UMBA 2OZLA 4C6RA 3O8CA 3R7BA 5CAEA 1LPMA 3OKPA 4IEFB 1O6CA 1VL2A 5FUWA 2Q3EA 1CR4A 4LVNA 5GONF 1QG6A 4TQGA 3I37X 5HVNA 4LJ9A 3U56A 2VDLB 3IAFA 3MBKA 3ACDA 16PKA 1Y80A 2FPGB 1A95A 3FXAA 3RQIA 1W34A 2A4MA 2FVYA 1RE1A 4G9GA 4ZVSA 1GADO 1A5AB 3H1EA 2VTVA 5T6MA 5I7UA 1D4FA 3MCZA 4RA6A 2XRYA 3KBOA 4J9VA 1UPXA 1T9CA 4LK3A 1G19A 4RJKA 1YK0A 4OREX 1I4EB 3RFXA 2ZJAA 4Q9DA 2BKLA 1W88A 1N6NA 3ZIDA 5LPNA 4R4JA 1B74A 2NO1A 3HDYA 1GOTA 3KXKA 4NWIA 4UM9B 4OJTA 4NSNA 2GSDA 1IUOA 2I6GA 1PD0A 3C8MA 3SBDA 2C2BA 5CLHA 3A1UA 3PDWA 2G0AA 4C1NA 1E18A 1SPBS 1MMFB 5JQGA 1X7YA 3O8OB 2B4RO 6AT1A 2EFYA 3KLNA 2AOWA 2J0EA 4JODA 4YP9A 1JJVA 2IEBA 1PYGA 2G70A 2QRKA 2W2QA 4XASA 1D4ZA 1QS0A 2GM9A 3A06A 4WE3A 1ZKDA 4RTMA 1D2GA 3AJEA 4Q39A 4X45A 3S3TA 5KMGA 1T13A 3FSGD 2JVJA 3LQYA 4E46A 1X8LA 1JLLB 1QGZA 5IARA 1AKUA 3SYKA 1OXTA 5AVTA 1I6LA 1AG9A 3NC1C 5E9WA 2BW0A 2ET6A 3UA3A 4CDNA 3SM9A 4KBFA 4P3PA 5BR4A 4UEKA 1GGNA 4EI2A 3N8GA 2VEOA 1F1BA 1N2CA 3PQ2A 4NCNA 1Z5WA 2ZUSA 3OCWA 5HUJA 2YVQA 1XQYA 4IMJB 4LYFA 2H06A 3NTOA 3BCRA 1B93A 1P72A 2H1WA 3ROQA 2DWOA 2HREA 4JU9A 4IIGA 3GGDA 2RK3A 4US0R 3GLRA 1JPNA 2DRIA 1FDOA 5D7NA 5B2EA 2VZ0A 4Y2UA 1S0UA 1C30B 3OT1B 1V47A 2H9IA 2ZP1A 1T4CB 1NLYA 4FDTA 3OOSA 4PCUA 2H1OA 1EZ1A 3PIDA 3N7TA 1Q1GA 3A0RB 3R3ZA 4GMDA 4UNQA 2YFHA 3DV0A 3AFHA 1XC7A 1BWPA 2P30A 3IQXA 4NFSA 4EKEA 1M34A 1NQVA 1DHRA 1K98A 1LFAA 1VKOA 1RYDA 4HDRA 1ZN2A 2IEIA 2PZAA 2HEIA 4OB7A 4A9AA 3ZDDA 1SGWA 1R0KA 2PX8A 3ZDYB 1HEUA 2J31A 3I1YA 1XWWA 4HGRA 4FP9A 2OILA 5E1OA 3DDUA 4J7UA 5AOVA 3LA8A 4ED9A 5FEUA 3LH5A 4L0MA 3FNBA 1EFLA 4CM9D 2ZZNA 1ONNA 4XDZA 2ORYA 3FDXA 4YV7A 3AOEA 4IKOA 5C0OE 2N47A 4DZRA 1DBPA 5CURA 4UPEA 2REOA 1CEYA 3BB3A 2WJYA 2QTHA 3ZW8A 2YNMC 3A31A 4ZQHA 3AP3A 3UG7A 3RTEA 1GPMA 4ZI2A 3WGOA 2LZ0A 4WH0A 3KZ1E 2BEWB 3CW9A 1NDUA 2YRFA 3AHCA 3K3PA 3QEMA 5DM0A 1TA0A 1I10A 2SICE 4R2JA 1J8VA 1EDBA 1NU6A 2CJPA 2HU8A 2NN3C 3AWIA 3F2VA 1YVDA 1CIJA 2QUBA 2ZTSA 2HN9A 5JQGF 4AFNA 4H77A 1PG0A 1OAOC 3DXFA 5CYOA 2BZSA 2I76A 4J0FA 4ZCTA 2PEZA 1G21A 4FJ1A 5HZGA 1T8PA 2A59A 2C0CA 2Q21A 4OL0A 5E4TA 2QVLA 4OXNA 4PCLA 3DNPA 4FI3C 2B1GA 4AY3A 3ZHTA 2YY6A 1EXDA 4ZVRA 4BUJA 1L5SA 3KEOA 1CP2A 3BH0A 5KKCA 3C85A 5AI4A 3R0ZA 5LQJA 1MA0A 2FLKA 2Q0XA 3FHLA 5FPPA 3TLGA 2WJ4A 1Y1QA 3C4JA 4A82A 2RI0A 1JA0A 2IYQA 4B73A 3EGVA 4ONEA 3UK1A 3UNXA 3PEYA 2JL1A 1PFYA 1CNFA 3FWNA 3STUA 4BTVA 2V3CC 3G59A 4F2WA 4ZU3A 2CLCX 1RWXA 1LV7A 2X3YA 3GZ4A 4KIGA 2CUNA 3QMVA 3V33A 4Z3DA 4MPTA 1RBZA 3JWGA 4L9SA 1ZK1A 3PC8A 5HF9A 1DIBA 3E0QA 3EDRA 2WR8A 4PONA 2IOQA 3DC2A 4UULA 2NU8B 3T35A 1N3LA 1Z4IA 1W1UA 1WX1A 2GTPA 1ISSA 2J5KA 1V43A 3ODPA 2WB2A 2IYVA 4S04A 3WFIA 1LRKA 2PZEA 3DD5A 2QIPA 3OCZA 4DW8A 4I1VA 5REQB 5BV0A 1UM9A 4V0QA 1ZIOA 1T35A 2JAOA 4LHSA 1KIAA 5BSMA 3U62A 2WWVD 5KJFA 1ABEA 4M7RA 1FUUA 4G5GA 1WXQA 4OHWA 1QR6A 3CGWA 4Q48A 3LUKA 3GUZA 4ZALA 2ZRIA 2RGYA 3LXXA 5TQ0A 2D54A 4RWZA 5JI3E 1E2NA 2MJLA 1OHHA 1OWLA 3OZEA 4P80A 2JFHA 1RLIA 2IODA 3LWZA 4UAJA 1PJ2A 3S2GA 3RU3A 4C04A 3PUKA 5B30A 1XP5A 4M0PA 5JYBA 1CUYA 1J5PA 5H83A 2NUAA 3UH0A 5IYZA 2H0QA 3G1TA 4U2DA 3LLUA 2WYVA 3P9YA 1OUMA 3UM9A 1Z5GA 3FYSA 1OV6A 3LO5A 4DF3A 2X0FA 4FW8A 2NWQA 2Q99A 3GLGE 4LKOA 1SD1A 5K05A 3DMTA 1RAGA 1YB5A 4MVYA 1KETA 3ZJVA 3Q12A 1NP3A 3I0ZA 1K68A 1Y8AA 4DGSA 4MDEA 1XZDA 3Q2IA 2AGVA 4R16A 4Q9HA 5EFOA 2PUGA 2WJAA 2MSKA 1JAYA 3JQDA 5IDXA 4JBLA 3O38A 5CVUA 1E0JA 2VP4A 5IEJA 4LWQA 1QV6A 4PFJA 1VL5A 3N6VA 3WBJA 3L8EA 2Y67A 1PQWA 2EERA 3HRKA 4Q21A 2P6NA 3LBHA 4P86A 2BR5A 2OBLA 3ZOKA 2PTGA 1PG5A 2LDXA 4RKFA 5DCLA 3TF5A 5DCWA 4RTNA 2E5LB 2Q5HA 3IVAA 3FRIA 3OX3A 3E0XA 4N7RA 4AZ3B 1EINA 5C4IA 5J2UF 4GPZA 3ZCRA 2YMLA 4IIFA 1XHLA 2BYTA 2WF8A 3P71T 3ZS8A 1HI9A 3F9RA 1OGYA 2D2EA 1Z4OA 2GHTA 2X9VA 3E58A 4UCQA 1DAKA 3BRWA 2IUYA 4IKEA 3W77A 1JPUA 7REQB 4J3NA 1Q3HA 4DQXA 3IALA 5IH3A 3ZY5A 4HZUA 4RY9A 1GFIA 1ZK3A 3AF6A 2Z5LA 5IPFA 4HT3B 3EZ9A 1UINA 2W6IA 3EX7C 3X2SA 1FBNA 2HPHA 1WQ1R 3N70A 1KSHA 3KR2A 4O8CA 3KZXA 2D62A 4ZXFA 5EIXA 1LI4A 1OWOA 3C5CA 4AO7A 2C3UA 2YWJA 6PFKA 3LQRA 1R6TA 2ZYSA 1ITZA 4MO9A 1Z82A 4DLRA 5K0FA 1U8YA 2HQBA 1ZEJA 1ZMRA 2FH5B 2GJSA 3HB5X 3A27A 3KUDA 3W6PA 5CB4B 3BC1A 3WWEA 4GVLA 4ERNA 4LG1A 2O8CA 2HQSA 1HYQA 1KMNA 3C98A 1OX4A 4WCFA 5B64A 1W49A 1DL5A 1XVVA 1BH2A 4DC1A 4B79A 1L5NA 3R40A 1BE0A 4ZZIA 3C74A 3EASA 3PDIB 3OZTA 1T36A 4KYTA 3RRXA 2YZKA 1YRHA 3SYMA 1QUEA 2IHYA 2ZRCA 4RHCA 4H4EA 4PZ0A 4EL5A 3Q8WA 5F7ZA 2Y27A 5TT1A 5B37A 2VJNA 2V7QA 1WUHS 3EWAA 5TGDA 3VNSA 1CQZA 2Q6TA 1JT9A 1AA6A 2L0XA 2CJXA 2XUQA 3OH8A 4HGQA 3BFXA 3PGA1 5ALFA 4F4CA 4CKBA 2YVKA 1QM5A 1R3DA 1MGOA 3WGKA 2IEGA 1VL6A 2KE5A 4UTXA 1ZS9A 5KDDA 3WAGA 1P4GA 4EHLA 4NULA 4UQLA 1GTSA 2OCDA 2QAGA 2FOIA 2YCBA 2PDAA 1CQWA 3AM3A 4RESA 3VDRA 4D0LB 1SURA 1UK9A 4KX3A 2IKSA 3MGGA 3OF5A 3MUOA 1R0XA 3S5JA 3WIEA 4IJ5A 3KQYA 1AD2A 3EOZA 3HWWA 1L7DA 5D1NA 1EFDN 4WSOA 1Z62A 3L4BC 1TVEA 4N5LA 5FWYB 4P7JA 5EE5B 4FI3F 5B7QA 2FP4B 1GRVA 2QMEA 3JQ9C 3KJZA 5BPFA 1UMDA 3CPJB 2TS1A 4OHYA 3UGQA 2Y92A 1WP4A 2AZ4A 2EW8A 2DX7A 2YZMA 4OXIA 2OLJA 4W5WA 4MUGA 2E49A 3GWZA 1EQAA 1YOVB 1CUZA 3IV7A 4FS3A 5H5JA 2CDAA 2PD4A 3N2NA 4I19A 1BMFA 3L4KA 3JZFA 3C3CA 4J94A 4H59A 4HRVA 5DNDA 4DBZA 3GJYA 4RGBA 5DIZA 5FEMA 1L7AA 1N7HA 2HA2A 4FE4A 1WD7A 1IB6A 3F4KA 2B5VA 4CKWA 1XMQB 1YQTA 1MR3F 2FMTA 1T24A 5FR2A 1XZEA 2R8PA 3HSYA 1KA9H 1Z08A 1IEXA 1IL0A 1RSZA 2C9ZA 2FWMX 3D3NA 2R1TB 3CEMA 4HGNA 3WK8A 1JEYB 4KSYA 1EIWA 3B1ZA 3L8DA 2CBZA 2IBMA 2W2KB 5ITSA 1QOPB 4WOBA 1GITA 5CX1A 3A1VA 4GOKA 2Y6UA 5FADA 1HORA 4B17A 2P3LA 3HZRA 4Q3EA 1FDTA 3DYIA 2I66A 2XIQA 1NL3A 1EVQA 1WR8A 2C58A 4DPLA 2PE5A 2JI6A 1YACA 1XNJA 2G25A 2IDMA 2QUIA 2DFDA 2RHWA 1IM5A 3FFXA 1MQAA 4RVOA 5MF6A 1DTWB 1QK4A 2VP6A 2W43A 4Z86A 5J9FA 1E2PA 3PC2A 4DMRA 3EMKA 3JAWA 2QTGA 1RHJA 1XK7A 3I32A 1OPXA 4XKJA 3VAZA 1OB2A 4M0UA 4BASA 1NDQA 2OYSA 4GP7A 4URWR 3TLJA 3VYTB 1JMKC 3L1KA 4CDGA 2NP6A 4RTPA 3QU4A 1KRHA 3INTA 4IMRA 4WBNF 2AS0A 4IKPA 5FL7D 1EE9A 1J00A 2P7IA 4KH0A 4AJ4A 1HKUA 1NR1A 5B1EA 2QF7A 5AQEA 1QVRA 5LOVA 4Z4QA 3MYYA 1QQBA 1E3EA 4ER7A 3REQA 4S2EA 4B3DA 1U0HC 2CHVA 1D1SA 3CUYA 3OQIA 5EPEA 1QKIA 3ZNNA 5JHGB 3PJDA 1SCBA 2AIRA 4E7OA 5EHZA 5K8JB 3IPLA 4KOAA 1YKFA 2IQ5A 2VUHB 4HCJA 4BX2A 1UBEA 1KK0A 1Z4KA 3ZLUA 1T4MA 3QPVA 1Z0UA 2VRNA 3KT6A 3IT2A 3JWJA 1GFSA 1P2FA 3M6MD 3RYCB 1Z2NX 5CLIA 2WICA 1TUEA 3CIFA 5K3FA 3PX2A 1A82A 4JUBA 3MIIA 4WKCA 2J3EA 2IX9A 2XMBA 3GELA 4RXUA 3AXSA 2WWFA 1YR3A 4C01A 5D7BA 4E1BA 3HCWA 3JQQA 1E1YA 5TNXA 1IQRA 3PQDA 2X5JO 2Q4BA 5BYKA 2SECE 1CSEE 3VX4A 5C1OA 4HGPA 4LEIA 4C43A 1EUCA 2FKNA 1SUWA 2ZBUA 2VEDA 5FPHA 3NOVA 1XUOA 4MRMB 1IU9A 5A4AA 2Q41A 2VWHA 4A36A 3QX8A 1U98A 1HDGO 2XTAA 1T1JA 1ATZA 1FNCA 3B5JA 3VZCA 4OTZA 4FPXA 3MMPA 4Y9RA 5HOEA 1NP6A 3HZHA 3FJOA 4UU0A 1TO2E 1E8DA 2RFLA 1SBYA 4L3WA 4NBKA 5G1NA 3ZE8A 4WESB 4OMCA 3TVDA 3KKMA 2H4WA 2W90A 1ZCFA 2GZRA 1CS4C 3WYNA 2Y1FA 3OPNA 5DI3B 1GQRA 2DC1A 3S2EA 3VU0A 1DBIA 4DJDC 4AUNA 3LPCA 4Q4HB 3M4YA 3HHEA 3RC3A 5K0SA 4RPJA 5AW2A 3DF9A 5KNDA 4MQMA 1LPPA 1ZM7A 4N48A 3L0PA 4W8OA 2ISCA 3IDSA 4RA9A 3LGAA 1COWD 3ZCXA 2LWIA 4KLZA 1NR7A 3GUYA 4ILKA 2VYCA 2I2BA 2IZ5A 2ZIAA 1SQ0A 1JEJA 3ORSA 3F2IA 2J3KA 1BOOA 2ZUWA 4K2AA 4QECA 2WKRA 4QUEA 4P36A 3VVBA 1NQXA 3RRZA 4QGFA 1P0QA 3IAEA 1H9AA 4DDUA 5TF4A 1S2GA 4EUFA 1O95A 3ZCQA 2F9MA 3INNA 1W93A 5EPOA 4MVJA 1O9BA 2O9JA 5MN4A 1F3LA 4FHDA 3BMNA 1E2LA 3FSRA 2LVBA 4HVAA 1QG2A 4GXTA 4AIRA 3GAFA 3W4KA 2JGMA 4DNQA 2H1HA 5AWFC 1E4OA 4H3HB 1W35A 2QQ0A 1HDXA 1TD1A 1Q19A 3BIXA 1M0TA 1AUOA 3CQ9A 4COOA 2VXYA 4JQYA 5JAIA 1X7HA 3D5TA 4LDAA 2X1MA 3O3CA 1XU7A 3HH8A 4IO1A 1EWTA 1Y48E 3IV6A 4FCTA 4YXWA 4DCGA 3KQPA 4C0XA 3H3XA 5H82A 4S35A 4UTNA 1CD5A 4WDQA 4HG2A 1V8DA 4DRXB 5CG2A 3ZWMA 3MXTA 1ZOIA 2XMGA 3AFGA 3I1IA 5ALEA 4ARZA 3GP8A 4BFSA 1N2HA 2GA8A 3U3MA 2ONKA 1A76A 2FEOA 4O2BB 3U49A 2G8LA 5LUAA 4AO6A 2C42A 2BEJA 1D6SA 2ZRNA 2PWPA 4EMUA 3QUTA 5IHXA 4JJAA 1WHTB 3MEQA 4V2UA 1BDMA 1AHPA 1E6CA 4XVQA 1ULUA 3JZMA 3K5IA 5I7OA 4FNGA 6ADHA 1C9EA 1ESNA 1RYYA 1Q1BA 2ZJ6A 4RSRA 1DAPA 5FOUA 1U5BB 5B7NA 5C5IA 1ZSVA 3N3BC 4DIBA 4MV9A 1DRWA 1TYEB 4C4OA 2Q3BA 1NM5A 2IIQA 1HT0A 3BZUA 5ARCA 4BIIA 2YWDA 4YPFA 3PE4A 4XD7D 1X74A 2ZRLA 1CBUA 4Y1RA 2QLLA 1XTIA 1M83A 5A6SB 5C1IA 1EXVA 4EMBA 3CVYA 4Q3BA 1J1UA 1TAUA 3IGFA 4O4HB 4NE2A 4WK6A 3NHZA 4EM6A 1ZR4A 4E4TA 4J90A 4IQ8A 5T4EA 4JZKA 1GAEO 2B83A 2GVDC 3DHVA 4KK3A 3RKRA 3VR6A 4Q4LA 2FUG1 1B6RA 1AN0A 2HFJA 4WQMA 3UVEA 4A6PA 4JWTA 1A50B 1T10A 5JSKA 1J6UA 1AQ6A 1A5TA 3G68A 4WLOA 2JRLA 3VRHA 3F1LA 3S1AB 2HADA 2C98A 5FH9A 1IQUA 3QVLA 2A1TR 1JRLA 4P83A 2P2LA 4RK1A 5A9SB 4WOCA 4V02A 2AG1A 2IHNA 3PA8A 3JYHA 4PBRA 5COAA 4D57A 4NAHA 3RFTA 1EP1B 2OCGA 2UV8A 2QLBA 4MOWA 3NGMA 2AMLA 4LJ4A 5LMZA 2DPHA 1JV2B 2X4LA 1KAEA 5HJ5A 1RXIA 4ETNA 2AKAB 1J8QA 2JF0A 1KOFA 3VC3A 5LP6A 4P4SB 4KKVA 2Q8PA 3RNLA 1KH2A 1UJBA 3BA1A 3LSTA 1FBTA 1H93A 3BFVA 4X6LA 3RR2A 3S2FA 2EWVA 2IGBA 3DFKA 5HUQA 5K0CA 3H3JA 3DZKA 3G3EA 3KHSA 2UVPA 1K6JA 2WIBA 4B6SA 4Q7QA 2NVOA 4FDMA 3RKSA 5KIAA 1Z29A 4Q1CA 3SNHA 4EPWA 3LUDA 1C0KA 3H42B 1NX9A 2Q4TA 2XZPA 3AGPA 1T9DA 4EVIA 4RZ3A 2WYUA 3I2FA 1O97D 2WE7A 1GAWA 2ZBFA 3ELDA 4HH0A 5DWQA 3RT7A 4MQBA 3URMA 4ZCPA 1MU0A 4G07A 1JVSA 2NYUA 2QWXA 3JR3A 3OC6A 8LDHA 3MN1A 1FRZA 1RNLA 5EP2A 2JEZA 4JLBA 4B4UA 3A1NA 1FC0A 5BOSA 1UKVY 1SK8A 1EDDA 3OIVA 2A0YA 1SBCA 4D4HA 2WJ6A 1EJ6A 1PWZA 4P3XA 3FUCA 4RKRA 1TM3E 2ZJOA 3OECA 4X71A 4F1JA 2DFTA 2Q6VA 5AVRA 1CG6A 2AC7A 1L9XA 1UOOA 1G55A 1KP9A 2NTEA 4W6QA 4OQLA 5KYUB 3UCXA 1G8HA 1IXSB 4JXJA 3STXA 4B4OA 1E4EB 3N74A 4KN8A 4L6IA 4M9XA 1Q0LA 2Z2JA 4E70A 2IFTA 1QH8A 3KV3O 5ALQA 3SC2B 5HW0A 1L4EA 1DX6A 4J1TC 3VOTA 1JXQA 3NHKA 3WWCA 4JMPA 4OLHA 1YRWA 3ISVA 1NMZA 3NXKA 4JI4B 2BGNA 3CLRD 5JLAA 2IF2A 2Z2KA 3DM5A 3FY4A 3O8LA 4QHYA 5ESWA 2F7SA 1YJXA 4W99A 2WTXA 4HEA6 1Q0ZA 1PVOA 1HRDA 1RFGE 1UPFA 1RPZA 5KOIA 2FQQA 4LBVA 1MXHA 1YZQA 1GZSA 1VHQA 4JU8A 1TYAE 5H0IA 4N6NA 3MFYA 3WYBA 1SXJD 3KX2A 2DFVA 1DPFA 1QHYA 2QW8A 2ZT7A 4L4ZA 4V0ME 5G02A 4Q1FA 3EZFA 2JFZA 2VJDA 2PS1A 4FT4A 2R8ZA 1JXOA 1PQUA 3NYRA 5DN6A 2AX3A 2PL9A 1QG4A 3RG2A 1XHFA 2X1HA 3W9YA 4YUYA 1L1FA 2XNCA 1RIIA 2NUBA 3KYJB 2JJ2A 3CNLA 3NLLA 4CBVA 1MABA 5AJYA 5LP6F 1U99A 3ZY4A 3IUQA 1Y7PA 3SOZA 1Z7BA 1GGJA 3K31A 5M34A 1JAHA 3SR4A 5FUYA 5KDOA 2NV6A 1G66A 1CZLA 4FU0A 2BHTA 1QWOA 3BERA 5EUQB 5G4LA 4D9MA 3ZN2A 4G1CA 1DWUA 1KJ8A 3LKBA 3O8QA 3OQJA 4K9KA 4LJSA 5EIEA 1QHHB 2GQ0A 5JZVA 1BE8A 1O8CA 3T7IA 3JD0A 4IOMA 1N6HA 3R0IA 3GLIA 3HV0A 1J1IA 1NIPA 1XP8A 2IC5A 4PAMA 1R0WA 3UA4A 3ABOB 4PX2A 2BHSA 1ORDA 2JFBA 3CZ5A 2KPOA 4NBVA 4ZN6A 2O8FB 3Q6IA 4P0TA 4UEOA 1ENZA 3DKRA 1DARA 3N2KA 2CNLA 4XVRA 2NAPA 2K2QB 1KI7A 4EPTA 3G8CA 3PC3A 2Z8YA 2QDKA 3O4FA 4BQNA 3WC4A 3W7VA 4D6YA 3HXMA 1MIOB 2RC5A 1OKKD 4KMRA 3RVDA 1DOAA 3FPBA 1WCIA 1M7BA 4EX7A 2ZFUA 3OOWA 3OESA 2BFEA 5LB4A 1Z0SA 1ZD8A 4R2XA 1I94B 5IBRA 1HFWA 5CTAA 1UJ2A 3ZNQA 1K3UB 2LKCA 2Z57A 2YZ7A 3ZZ1A 4DZTA 1ZJ5A 4FOSA 1UUFA 3ZDBA 4HDMB 4MVJP 3HSSA 3ELUA 4Z4GA 4R83A 3WKDA 3KP1A 4ES6A 3DL0A 4EHBA 3DA8A 4O1MA 4OV6B 1N1MA 4TSFA 1HGXA 1ULBA 1U02A 2Y9PB 1W4RA 1SZCA 2NZUG 1DKRA 4XYEA 1YQDA 5EJEA 1EAMA 4WW0A 3S6JA 5IM4A 1QYIA 1YZNA 1NQUA 4FE7A 3ADDA 4CMKA 5AOAA 3YASA 2I3AA 4E14A 4C30A 5JROA 1TA4A 3DR5A 1B3BA 1EB8A 3GCXA 4X93A 2BFFB 4L5BA 2CLFB 4N0QA 2WWGA 4PSCA 4NMXB 4R5MA 3STHA 5C1DA 2ZXEA 4H7PA 4RPKA 2ADMA 1KXZA 5DXFA 3P4UA 1KTIA 4EI8A 4RJ2A 1Y3HA 4M9ZA 4N18A 3THWB 1N78A 2O54A 4U6NA 1DGQA 3UY4A 4XUEA 4Z3KA 1QP7A 4FIDA 4OKNA 4PYQA 1QTQA 2Y3IA 1JHOA 4TTRA 1BOFA 1E92A 3DMFA 2PGIA 5IJ9B 5F3WB 4WK0B 4XIYA 4EJSA 2IRWA 1Z6GA 2QTBA 2EV9A 1MV5A 3WMEA 2ZBPA 5HKLA 3ADBA 3PDUA 1WY5A 3HYLA 5TJHA 4R8KA 1M8GA 2GCOB 4QFMA 2CXNA 4A8JA 4HATA 4ECEA 1M1NB 2HQOA 3A3OA 4WLUA 4WPGA 4WV3A 2YZ2A 1Y34E 2AFVA 3K09C 5IM5A 3KSRA 5CD9A 1IZ7A 4NCKA 1E1QD 1A2BA 1E7YA 1AHNA 3F49S 3AVYA 1Z38A 2JRCA 1YE3A 2XQFA 4N03A 4EUNA 4ZDWA 4RZQA 3I76A 4KVFA 5KNBH 1QNLA 2X1VA 3DEYX 2FZCA 3HBNA 1OBOA 2QBYA 3JQ8B 2NSYA 3IQIX 2O2ZA 3ONDA 3TMYA 4DKJA 1AUXA 1QKKA 2QG9A 4AJ9A 4J8PA 4GIBA 3PNSA 1QHEA 3C8HA 3BWEA 5DM70 3EIWA 1IULA 4UQPA 2D2IA 2GCPA 2AR7A 1V0JA 3HTXA 2GJKA 3EZGA 4QBKA 3SFTA 4HDNA 5BWMA 1JJAA 2GERA 4P5DA 3NYWA 5A5DA 3WAKA 4FR5A 3FJYA 1H4VB 3IODA 3QLUC 4HTAA 4KQCA 4BQOA 3V1LA 5EXPA 1V8OA 1U5CA 2A5LA 5ILGA 5LCXA 3SNKA 3JD1A 3IVGA 3IVCA 2QW1A 2INGX 3WWPA 3D4PA 1HT1E 1P77A 3BF8A 3SEZA 3OQOA 1EUDB 3ZHOA 4D8YA 4JB2A 4EG7A 1DC7A 1K75A 2AZMA 2HHCA 3A2NA 2HSWA 4NS1A 5F3RA 4HLCA 1LDNA 3MA0A 1U81A 2CZCA 2PUAA 3IBGA 4F12A 1P1KA 2QX4A 3LUJA 3C8ZA 1ZIDA 4KO4S 1P7VA 3ECCA 1AGNA 2R6CA 1T0HB 5JS6A 1ZQ1A 4HZIA 4DV5B 4NYMQ 2RGNC 3MC1A 3NEAA 5CIQA 2VP3A 2VATA 2B69A 3TLAA 3KJIA 1A0OA 3PEUA 5JAOA 1JA1A 2YY5A 2VHJA 1ENPA 3M1IA 4K0RA 3M49A 4M60A 4F8EA 3MWDB 3B12A 3MCWA 3ZBPA 2ZRDA 3S2YA 3QKTA 3M9LA 1T8SA 1V95A 3PNYA 3IPXA 1BVHA 1Z3IX 1P7CA 2FU5C 3ZJ5A 3EDMA 1H22A 3L2OB 5ALLA 3NX4A 1N75A 1JLKA 4B6QA 2X0DA 4HAZA 3WLJA 2JAQA 1R0YA 2JJ8A 3BWMA 2BM0A 1NTOA 1SC4A 3OZUA 3Q3EA 4NYJR 3T99A 3EPPA 4Z49A 2DH6A 3B1YA 3G0HA 2BDUA 4M98A 2Z2XA 3HADA 2VXOA 4BNZA 2D13A 4XOIA 2GSWA 1H2AS 3DP7A 1NMEA 5HRUA 2O6LA 1WY7A 1M5UA 2WF7A 4FZ5A 4K3VA 5LBUA 3PQ7A 1PSWA 3JVDA 5NULA 2WD9A 5KSOA 5KWSA 2HA6A 3I1FA 1Z0JA 3ESDA 5FJIA 3G7SA 4NOKA 2I4TA 3TSZA 1JR3D 3C7KA 3Q3JB 3PL1A 2QY6A 4S1OA 2GN6A 3BZWA 5FD8A 2GM3A 2VNHA 2IXTA 2VP9A 1BCSA 3TUIC 3I6MA 3H97A 4OAOA 3UHJA 2JLYA 2WAXA 5HM6A 2JJYA 5H7XA 2ZR8A 1X13A 2D3WA 1AE1A 2VHXA 4LE2A 3DYVA 2GB4A 2FEAA 2R86A 2WYHA 1MC8A 1T3GA 3RVOA 4L3OA 4OAPA 4D9KA 3W8EA 2CK3A 2G9UA 3LF2A 1A04A 1EBBA 2NSHA 2PZBA 1F4VA 3A4IA 3IUYA 1A5BB 3DOFA 4MS3A 2QT1A 2VT2A 5EXTA 3R0VA 4JVSB 4MYUA 4IZIA 3P97A 3WBKA 5DBOA 1D4OA 1DIHA 1IHDA 3C3EA 2FV8A 3CSDA 1G6HA 4BE4A 3OBBA 3F9CA 4RHTA 4CKCA 5FV4A 2ZVPX 4OB6A 1YS6A 1FQWA 4K6OA 2ZTLA 4LVUA 4U7WA 2CL6X 2B3DA 2QE6A 3EA5A 1SHZA 5TT0A 3R7WB 1RAEA 2O48X 2Z3WA 2Q3CA 1V71A 3THYB 1GXSB 5BV2P 3RC9A 4NFYA 1HSOA 1YRLA 2CYCA 2PBRA 3A4NA 2W2NA 4DXDA 3JVEA 3O1LA 2IYXA 2PKWA 5F12A 1NSYA 1HEIA 1POWA 1L5WA 1KJJA 3NB0A 1OYOA 3VBEA 4B80A 4PX9A 1C50A 2JNWA 2RG1A 1VIVA 4NBRA 5A03A 1SXJB 3DUFA 1LPNA 1FDIA 1KOGA 2HF7A 3AYZB 2BLNA 4AF8A 1CRPA 1XTKA 4L16A 1R5BA 1A7KA 3ZJUA 4QAQA 1J56A 1ZMXA 3DOIA 2OP1A 1LK0A 3SLKA 4JLVA 1SVOA 2MINB 4UNNA 1PEDA 3I9LA 1HDZA 2LRHA 221PA 3D1JA 5FAKA 3GRKA 2WRZA 3IAS6 3KEQA 3RYFA 3EZ2A 1C1XB 3ZWXA 3PLNA 1WZEA 3CPSA 3JQ7B 3ZXXA 5ICSA 2C5BA 5CRIA 3LXRA 1ZN7A 4G84A 2ASEA 4TKVB 4WWHA 3VKWA 4I8IA 3QITA 4A1FA 1BE1A 5E7QA 5BPHA 3AKEA 3UK2A 1R4MB 1OBCA 5DHRA 5GM1A 4JLUA 4ENUA 5CDFE 3HY6A 5F35A 3TCKA 3B89A 3E1KA 1IM2A 3HEMA 4G8BA 3COZA 3HNPA 3FYHA 3O2JA 4CJXA 1ZFNA 2NT4A 2JZNA 1ZH0A 1WQ3A 2OBXA 4OLJA 1KVUA 1JE1A 3GDOA 3GQBA 1B41A 2RHLA 4KIUA 3QF4A 4RORA 4UU8A 5CU7A 4G9BA 4O29A 3MELA 5IWCA 1NJGA 4UHFA 3OTGA 4S1TA 2QGZA 1ZU5A 1E7MA 3IXQA 2HY7A 3QVKA 3KT8A 2XEXA 1KK3A 4INOA 4IYJA 4EHKA 4QVGA 1V45E 4I4CA 1XVLA 4G8JA 1R10A 4RVHA 1YZTA 2BH9A 3JAKB 3QELB 3W6ZA 4X1YB 2AG6A 5AYVA 3REOA 1NJ2A 5BN5B 3RYHB 4BWYA 2PYDA 4KRFA 3Q5EA 2VSQA 3KL2A 2BI8A 2G7ZA 3K5PA 4J07A 1TIPA 3VPBA 4E3WA 4QOFA 1P9OA 3SPXA 2QJTA 1C2TA 1NW4A 1U4SA 2KLHA 2QUZA 2JIDA 3IUMA 4F84A 4XWTA 4Z0HO 3ICOA 3T1YB 4HN2A 1N25A 5DU2A 1H2ZA 4HRYA 2ZB7A 5EIOA 3VTZA 1J7JA 1HOTA 1RE0A 3QUCA 4UMDA 4IVQA 5C1PA 5JQWA 2UZ4A 2IV3A 1UXGA 5D2CA 2E18A 2QAJA 2VDMB 1E7SA 2J5BA 5IBCA 4H1HA 5K6TA 1C4WA 2ZAMA 2EX4A 4RJIA 1KRWA 1WNFA 3W6UA 2PU5A 4I4TB 3ZV3A 3L7KA 4L15A 2O0HA 2Q2WA 4MKIA 4DCNA 3E35A 3FKSA 4WY5A 4FZ3A 2HAEA 3HRHA 3IUEA 1TRHA 4J4HA 1JEQA 4R3NA 1BKYA 4DEVA 3DZCA 2H52A 2X7HA 3DO8A 1JH9A 1E2JA 2X5NA 1C4XA 1TIBA 2ORWA 3H1AA 1JQDA 1CUSA 3NHWA 1M8PA 1TMGE 2R2GA 1FPMA 1SXGA 4O5AA 1E89A 3CUTA 2GZAA 2H3HA 3QIAA 2G67A 3QYJA 4MZXA 4M86A 1A8QA 1UPTA 2FW9A 3OF2A 1J21A 3NNDA 3PL5A 4NZYA 3O4VA 3T3EA 3W3ZB 5KX5A 2XA1A 4GBMA 2BFDA 3KOUA 3QVGB 2UXDB 3EVDA 4WZBA 2AWOA 3FB4A 1UZLA 1PKXA 4JASB 2CJFA 3STYA 3IC5A 2J5QA 3V8RA 4RGVA 4MYRA 1EFRD 1A72A 1HXHA 2JAWA 2VDRB 1YI0A 5JZOA 4YRBA 2XNHA 4HNVA 1XNQB 2H11A 1WCV1 4HAIA 3R3YA 3AF3A 3FUUA 4FNAA 1V11B 1ISGA 4XD2A 3HDGA 3KLBA 4JJGA 4I6EA 4KMMA 2A14A 3R4VA 3LC1O 5LQNA 4JOSA 5JDCC 1RM4A 3LDAA 4MPPA 3E18A 4OU5A 1KEWA 4RL4A 4BQPA 1H5QA 2OVBA 5C81A 3T4EA 3VVMA 1LLQA 3F7NA 1KVTA 1U2DC 1BD3A 4JROA 4C22A 3BXXA 1YBAA 1EK0A 3ETCA 3AI1A 4NESA 3WA6A 3ZDZB 4RE5A 4NAUA 2RJOA 3LA6A 2XB6A 3O8OA 3T61A 1H6AA 4LYJA 1VCNA 1NYQA 4QPNA 3VJLA 2DQKA 2XA2A 4HR7A 1Z12A 3VR4H 4KTTE 2OG1A 3WNZA 1NZDA 1OX5A 2FRDC 2I2FA 2Z58A 5FIUA 2WU0A 1XQVA 2QK4A 1NLMA 2J87A 2VPXA 2P9HA 3GPBA 3IA2A 3IT0A 1KR2A 1JLLA 1RWVA 3MD9A 3VPCA 2OV8A 1NE2A 1ZHHA 3DF7A 4EDHA 1YL7A 5AW7A 1KXJA 3DEZA 4GZ6A 1NJFA 1XRJA 1J1ZA 3ND6A 1P3JA 3NVDA 4LGMA 4N3BA 3L5OA 5L3RA 1N8TA 3K96A 2R87A 3DL4A 1K3FA 4H0CA 2O2IA 4I50F 4TZKA 3AVQA 3BMOB 1SBNE 3FVVA 1PGPA 3KFLA 2WE8A 5B4UA 3EXHB 3FNQA 3BWVA 4HDQB 1MPXA 1C30A 3EA4A 3OT1A 4EF4A 5IUJC 4LOAA 4ZRDA 5C4GB 3VNUA 1G20E 1T4CA 2WKPA 3NAQA 1MORA 1H2RS 5HMLA 2JD0A 1VLZA 1XMIA 2WBLC 1ZISA 4B3XA 3QE2A 1TLTA 3RU7A 4EBFA 2PO7A 3FNEA 2R6HA 3HB4X 4MCAA 1CDZA 1RJDA 3DGFC 3JTMA 3T5GA 3ZHQA 4F9FA 2ZUTA 1FLDA 5D86A 1EHCA 1H65A 4IR7A 3AILA 1IBSA 4HB3A 3ROFA 1SVSA 3EXFB 2FSGA 1CPYA 2HD4A 3ZY6A 1QG0A 4MGIR 1G8SA 4O4LF 4TZ0A 5BYBA 4Z2YA 1MB3A 1SPXA 3HA5A 4NNPA 5CVJA 2XB9A 3NWOA 4XFKA 3L6DA 4FFSA 4XCQA 4MDFA 3ZV5A 4G0UA 2OUKA 1W0KD 1Z3CA 4YHBA 1JPVA 3O2SB 2B8NA 3F3YA 2XMZA 2V5UA 4KXNA 1LW6E 5AW3A 4I5IA 3H0KA 3GB9A 4JMLA 4L7QA 4P7BA 3T4UA 4C87A 1FB5A 1PGOA 5TGZA 3GP3A 1PR9A 4W8HA 4MARA 1VIAA 1HFEL 2P2CA 3WRVA 1ZWLA 3ENKA 2IDJA 2A3NA 2NQ2C 4GLBA 1M6VB 3L92A 4TMVA 5D6OA 4I6GA 4C7OB 5JCPA 4Z7OB 4Z1MD 1H2BA 3WHKA 4RZIA 2C00A 4QREA 2CL7X 3IEPA 5CLJA 1BE6A 1V9SA 2GJAA 3NO4A 4TV9A 4WCDA 4FYWA 3N86A 3ETNA 2AKYA 3QI7A 1DUSA 1J06A 1Q6ZA 2DT8A 3I9V1 5KQGA 3JX9A 4B4DA 3IURA 2P2GA 4ITRC 4CEJA 2RHRA 3VC2A 3K1ZA 4UJ3A 1WSAA 1Z8DA 3SLRA 4OYRA 4FFNA 1XA0A 3QJYA 1KO7A 5THQA 1XMXA 2EFJA 3OICA 4W5QA 4REOA 3ENNA 3V1KA 2Q7DA 1NBMD 1XTVA 5AP9A 4YP6A 5HPYB 3QXXA 2FR1A 1NMYA 2JAUA 5BNIA 4G5HA 1EB9A 2JI7A 4A1OA 3W8FA 8OHMA 4LWPA 4OBBA 1TMKA 4NPHA 2I29A 4PAQA 5JV5A 1WDLA 1Z0IA 3D6UA 4NI5A 4B46A 4UOEA 3FB1A 5JH7B 1NUHA 1SOUA 1QOQB 1ZEMA 3LT4A 4QPPA 5JI2E 2PGDA 4PCVA 2OLKA 3CNQS 3PUZA 1DAFA 3ZY2A 4U7FA 4DBVO 2LP4Y 1TXGA 3L6UA 1GG8A 3LY9A 3GFOA 4M1WA 5C7YA 3LQKA 3MWJA 3PS9A 5JXWA 3FYTA 3VUEA 3WNVA 1EI9A 2NU8A 4UVEA 3T7JA 1JFRA 4CEIB 1J9ZA 1UDAA 2GD6A 5BR1A 1EM6A 1KMQA 4R2WA 4UATA 4NJEB 4MTCA 4AECA 4ABTA 1UKYA 4OFBA 3RJ9A 4YAGA 3A3KA 2H17A 2I1QA 1ZJJA 4A91A 1Q92A 5REQA 3PITA 2A58A 4TUYB 1R12A 3EXIB 1QF7A 2B2NA 2Z2IA 2WTBA 3IA7A 1PS8A 5ERXA 3RS2A 3ZEAA 4DLWA 4BLTA 2X86A 2H7YA 4OHZA 3D64A 1L5ZA 1QF9A 3V8PA 2Q29A 4GGOA 1BN6A 3L3BA 5FLYA 2O52A 3WHLA 1D07A 3UW3A 3UJ3X 121PA 5EPUA 1V3UA 3OZRA 1I4LD 3IEKA 1GPDG 3FAKA 4IEEA 1LS1A 3SF8B 3N75A 1H5UA 2XRMA 1GPNA 3UICA 3WGYA 4EVQA 2DHDA 1CJSA 2IEDA 3A6DA 4DYHA 3SE0A 4L4SA 621PA 1U9ZA 2PO5A 2GCGA 2M9MA 1SQ5A 2C2WA 1TDJA 2ZB3A 3AFMA 3KDPA 3LUAA 2GAFA 3SDSA 3PC6A 1TTQB 3NDRA 2D7DA 1J07A 3CWZA 3OCYA 4BPBA 3ZD6A 1Z6XA 2CZQA 3I01A 4JUCA 3TMAA 3IMGA 1I1NA 2HA3A 4PX3A 2FTKE 3LUFA 1BYUA 5K3BA 3NBZC 1UZUA 2FJ0A 5LYJB 5JAQA 4U5QA 4JBIA 4C0QC 1P1IA 2OBMA 4CG3A 1I4WA 1Z13A 2R60A 4HV4A 4LGVA 2KX7A 4R01A 1U7DA 1O8BA 3I4FA 1VBMA 5CTJA 3NTUA 5HDQA 3HKBB 2V8OA 2ZSHA 5IAEA 5EWLB 4AXXA 3T1HB 3PYMA 1RVV1 3AF4A 3WV4A 4B4WA 4UDOA 1ORRA 3NPMA 3U48A 2OHXA 3HWRA 1GPBA 3CZCA 1TMYA 4JR1A 1XVTA 1VMEA 5KQSA 2ZCJA 2VP5A 1GQ2A 4KBGA 4DG8A 2FMUA 2P91A 1GT6A 3DVQX 4KEAA 4AZ3A 4EAQA 4H7DA 2DZDA 2C4HA 1EX6A 1T8WA 3B5EA 1X3SA 1ZGGA 4XCVA 1KZ4A 1V7QA 2GPBA 2XQJA 2JLCA 2HX1A 2GO7A 4RY8A 2E21A 5IDYA 1Z5ZA 4ZIRB 1Q83A 3D5EA 4YB8A 2CXXA 1HM5A 3DE6X 7REQA 3BE4A 1XPUA 2LW7A 2OECA 3I8SA 3K0KA 3BL6A 5D84A 4UE2A 2B2XA 2OYCA 1MHTA 2XADA 2D0OB 4JQSA 3EY9A 4ER0A 4BO1A 4LRSB 4BVBA 4YAUA 1DCKA 4M53A 1C8VB 1ORVA 1XF9A 5I7EA 4YQFA 2YDXA 3BHMA 2PKXA 3M1YA 5DYNA 4CI0B 2MT9A 2QYHA 3JPWA 3T9AA 1Q6YA 4H7IA 3JRWA 1ZA1A 2O3TA 4W1SA 1VMAA 2HUPA 2I8AA 1NVKA 2OOSA 3SBEA 2O57A 1C4KA 1FNNA 3ZOZA 4BGVA 3PXEA 3JQAD 4BBPA 5CB4A 5JVDA 3BWXA 1EWVA 1R6XA 3D6JA 5BSHA 1EG2A 4RV4A 2PGXA 3LJKA 2HSEA 2XKKA 4CG1A 4DJEC 1JMVA 4UXHA 3J80A 2KB0A 2HJHA 3PDIA 4NU6A 4BNGA 3TM5A 2ZI4A 1PX0A 5ABPA 3K20A 4C6TB 3BHNA 1V2GA 3RVMA 1PZXA 2CFCA 1JI0A 4ND3A 1S1MA 4W5RA 1JYSA 3IVMA 3N76A 8GPBA 2OO3A 2ZSUA 1PNOA 3LC7O 1UMCB 3LKZA 3ORQA 5IUKC 3W2EA 4E22A 5AQ1A 5JCXA 2BTOA 3F1KA 1ODFA 3FLMA 4G01B 3JAMA 1GTRA 3V7YA 2FF7A 4UHKA 3TMKA 2QU7A 3D3JA 3PHIA 2R8YA 1KI1A 1TYDE 2VRBA 1X39A 5E3IA 4PZLA 1CY1A 3FAZA 4KN9S 5LWQA 4P5PA 3I53A 4D81A 1ODCA 4Q24A 4YCAA 2C5LA 3DAGA 3T94A 3WB2A 3ETLA 3TECE 1NT2A 3T7TA 3V3TA 4AUKA 1A97A 1MC4A 2WIJA 2XD9A 1H6CA 1MAAA 4AO8A 2WMDA 2R0QC 2O5RA 1RJ9B 3N39C 1AOXA 5FWYA 5JR3A 2QVGA 2ASVA 2FP4A 3SYTA 3DKKA 2BKUA 3HVHA 1WBDA 2HMVA 1HQDA 1Q2UA 2J59A 2P1RA 3HI4A 3SVTA 2WF9A 1GPKA 5ADUS 4GMFA 3S40A 4LFAB 2QN9A 3ENZA 2HWUA 1XCGB 4Q7JB 5KYYB 1ONPA 1N77A 5EN4A 3RHZA 2WQ6A 1U1GA 1U90A 3L77A 4Q3NA 4C7BA 2Q1TA 1FOEB 3GFTA 4LGCA 1E1DA 4XYLA 4YRCA 3K1AB 5JE8A 5TVGA 1NRXA 3WMRA 3L8FA 4DIUA 1E9BA 1YR1A 1VL8A 3GVXA 3LUGA 1JFTA 1YCGA 4BGEA 5MGNA 1I9CA 1N9ZA 4QXMA 2QT9A 3H1BA 1EGAA 3Q5GA 3SJCA 3GPCA 1XFDA 5C8VA 2IHKA 1MOQA 4XEUA 5H1YA 4F3CA 1KBOA 4X8OA