4YNBA

Crystal structure of helicobacter pylori 5'-methylthioadenosine/s-adenosyl homocysteine nucleosidase (mtan) complexed with pyrazinylthio-dadme-immucillin-a
Total Genus 86
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
86
sequence length
230
structure length
230
Chain Sequence
VQKIGILGAMREEITPILELFGVDFEEIPLGGNVFHKGVYHNKEIIVAYSKIGKVHSTLTTTSMILAFGVQKVLFSGVAGSLVKDLKINDLLVATQLVQHDVDLSAFDHPLGFIPESAIFIETSGSLNALAKKIANEQHIALKEGVIASGDQFVHSKERKEFLVSEFKASAVEMEGASVAFVCQKFGVPCCVLRSISDNADEKAGMSFDEFLEKSAHTSAKFLKSMVDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title New Antibiotic Candidates against Helicobacter pylori.
pubmed doi rcsb
source organism Helicobacter pylori
molecule tags Hydrolase/inhibitor
molecule keywords Aminodeoxyfutalosine nucleosidase
total genus 86
structure length 230
sequence length 230
ec nomenclature ec 3.2.2.30: Aminodeoxyfutalosine nucleosidase.
pdb deposition date 2015-03-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01048 PNP_UDP_1 Phosphorylase superfamily
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.1580 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4ynbA00
2QPLA 3E0QA 3O6VA 1FXUA 4EB8A 4DARA 3PHCA 3FB1A 5EFOA 3OCCA 1Y6QA 3LA8A 1PR5A 4L0MA 1RFGE 4GLFA 4ECEA 1TCVA 3KVVA 4GLJA 1PR4A 4QEZA 3TL6A 5CXQA 1VHJA 4UC0A 2A8YA 2P4SA 3PNPA 3FAZA 1PBNA 1Z39A 1N3IA 5DK6A 3OZBA 4F2WA 4OF4A 3E9ZA 4WKNA 1XE3A 1Z33A 5KB3A 1A9SA 1JDVA 3KHSA 1RSZA 2A0YA 4MARA 3UAXA 1OTYA 3IOMA 1T8WA 1SJ9A 3EUFA 4L5YA 4TXNA 1Z5OA 2I8AA 5CYGA 1JDTA 4TTJA 4R31A 3E9RA 4L5AA 1G2OA 1NW4A 3MB8A 3OZCA 4JOSA 1V4NA 4WKCA 1LV8A 4DA8A 4TXHA 4LNAA 4TXLA 2ON6A 1V48A 3FWPA 1A9RA 4F1WA 1U1FA 4GKAA 4YMLA 3QPBA 4JP5A 4G89A 1U1GA 4QASA 5I3CA 1PF7E 4U2KA 4QAQA 5EUBA 4DA7A 5B7PA 4L6IA 1U1DA 2A0WA 1LVUA 4OEHA 3NM4A 4TTIA 4TXJA 1B8NA 2A0XA 3UT6A 1PK9A 3FUCA 3FNQA 1PR2A 1Y1TA 5F73A 4JWTA 1YRYE 3UAZA 4PR3A 3ODGA 3ONVA 4G41A 4R2WA 1JDUA 1RXUA 2HRDA 2H8GA 5F7ZA 4QFBA 5CCDA 1T8RA 3K8OE 2QTGA 2OECA 1K27A 1RR6A 3OF3A 4MCHA 1Z38A 3KUKA 4F3CA 4K6OA 1RXCA 1RXYA 4LKRA 1V3QE 1JE1A 3NM5A 4M3NA 1JYSA 2RJ3A 4TS3A 1T8YA 1Y1QA 3MMSA 4YO8A 5CYFA 5IFKA 1JE0A 1Z5PA 4H1TA 1SD2A 1OTXA 4P54A 1JPVA 1OV6A 1VFNA 3OPVA 1TGVA 1PK7A 4RJ2A 3DDOA 4DA0A 1PKEA 1A9TA 1TGYA 1VMKA 1SD1A 2HSWA 1LX7A 1TCUA 1VHWA 1ODLA 2QTTA 2AC7A 3IEXA 4WKBA 1WTAA 4R2XA 4D8YA 3KVRA 5F7OA 4D9HA 4EARA 3BGSA 1RCTE 4QARA 5F78A 2AI1A 4DAEA 1RXSA 4BMYA 1ULAA 2OXFA 4YNBA 3LGSA 2AI3A 4WKPA 3UAVA 2B94A 1JDZA 1T0UA 1V2HE 4LNHA 4OY3A 4PNPA 1ULBA 2XRFA 1PR1A 3DPSA 3DJFA 5ETJA 4GMHA 5C80A 5F76A 4G8JA 3C74A 3UAWA 4E1VA 1ZOSA 2AI2A 1I80A 1NC1A 4KN5A 1ZL2A 2QSUA 1U1EA 5B7GA 3DF9A 3FOWA 1C3XA 2QDKA 5F7XA 4F3KA 1OU4A 4WKOA 1PWYE 3KU4A 3T94A 1ECPA 1PR6A 2OC4A 1NC3A 1PR0A 1Y1RA 4D8XA 1ODJA 1K3FA 5K1ZA 1Z35A 3U40A 1OUMA 4LDNA 1YQQA 4OJTA 4DANA 3KVYA 4MCIA 5B7QA 2OC9A 3K8QA 1OVGA 1A9OA 1QE5A 3GGSA 1ODKA 1T8SA 4D98A 5FAKA 4F2PA 1TD1A 3NM6B 4IP0A 1YR3A 1PW7A 2PGAA 3OZDA 1Y1SA 3P0FA 1CG6A 3EUEA 3BJEA 3OOHA 4FFSA 4NSNA 5IU6A 3P0EA 3SCZA 4X24A 1YBFA 4TS9A 5CXSA 1JDSA 1A9PA 4DAOA 4TXMA 4BMXA 3EMVA 3ENZA 3PHBE 4BMZA 2ISCA 4L5CA 1RYZA 2HN9A 3BSFA 1Z5NA 5EPUA 4QATA 2BSXA 3O4VA 3UAYA 1SQ6A 3BL6A 4TYMA 1CB0A 1ODIA 1V41E 1Z37A 2I4TA 5B7NA 3EEIA 3D1VA 4M7WA 2HWUA 4NS1A 5F77A 3NBQA 1A69A 2Q7OE 1Z36A 1B8OA 1V45E 1RT9A 3DP9A 3OZEA 5JPCA 4DA6A 4OGKA 4OGLA 1Y6RA 4D8VA 3PNSA 1Q1GA 4LZWA 3GB9A 4BN0A 5CCEA 1M73E 5F7JA 1A9QA 4NY1A 1JP7A 2IQ5A 1Z34A 4TTAA 3INYA 1U1CA 1YQUA 3F8WA 3LBAA 1K9SA 4DABA 3OOEA 2GUWA 4YJKA 4M1EA 4I2VA
chains in the Genus database with same CATH superfamily
2VDLB 3ONWA 3O73A 4DV1B 1MAHA 1R6TA 2X1HA 5F5LA 1YJCA 3Q7QA 5LQNA 4YK7A 1OXTA 1Y3DE 5H82A 2QN9A 3V4OA 2P7IA 3EF1A 4EB8A 3KYBA 1OFUA 1KAMA 4GGMX 3DKKA 1G1MA 4RHCA 3QX7A 1FFAA 3DV9A 5AVSA 2PVSA 4D9CA 2P3QA 1IM5A 1Q19A 3GT0A 2VJMB 1K7XB 1BH2A 4CDRA 1FXWA 2AHOA 4OP3A 4X62B 3A6EA 3E1KA 1EFKA 2HWKA 4ZT4A 2X3FA 1LGYA 4NPAA 1IHXA 3M33A 2R6JA 2W0SA 1QHGA 1A5AB 4GM1A 2CHEA 2CMFA 4JY7A 2CL0X 3BF8A 4F7DA 1TE2A 1V3UA 5E7MA 5IDQA 1U1IA 4EEXA 1G5FA 3L6UA 1AQIA 3ZNPA 4OHYA 2YZGA 5KYNA 4YMVA 4UC0A 4F38A 3O38A 2J45A 1KRXA 3WHPA 4DLZA 3EOBI 4Y18A 3UWSA 2WAAA 1A76A 1SIUA 2IGTA 1U3FA 4E51A 2VDUE 4N6OA 1IN5A 3AONB 2VDRB 1EG2A 2GEUA 2AZMA 1NR7A 4FBLA 4RTSA 2RK4A 3A6GA 5EIBD 3RNLA 3BRQA 2XMPA 1H4TA 1TLFA 2N9UA 3OZBA 3TMAA 1HL3A 3TQCA 4F92B 2GTPA 4FMBB 3QNWA 2ZSUA 2B8JA 2VAVA 1UMCA 2YL2A 4K9OA 3STXA 2O2ZA 3CUWA 4KXXA 5TMDA 1TCBA 3T52A 3T9DA 2RH5A 4IZ6A 1I01A 1HRKA 1RPJA 3IAM6 1ZVQA 1B6SA 1XZFA 4FM9A 3EQZA 1FDSA 1RSZA 4ND4A 1UZLA 2HV9A 5JCXA 1KU6A 3BSWA 1KYTA 1DIBA 1QS0B 4N7BA 4CKZA 3SN6A 2UUCB 4EI9A 4ZAGA 2ZS9A 3O03A 3ZE6A 4C4SA 4NZPA 1CTQA 4MV8A 1WXDA 1SXJD 2YV5A 4OQZA 4HDNA 1Z5OA 4MQFA 4J2TA 4TTJA 3G2QA 2Q3JA 3GFRA 3GFQA 5KTNA 4WOJA 3UJHA 1P1JA 3Q9LA 3BJZA 1E3MA 3WSTA 3OE7D 4X7BA 3W4KA 5C4IA 4ZEOA 4HVAA 2IXGA 4YLYA 5LP6C 4JOSA 5HTKA 4CIVA 4KO3S 2XWJI 4FMPA 5HWSA 5IM4F 1AS0A 1AKEA 1VYHA 2NSJA 2DUWA 2VWGA 2QSYA 2WZBA 3BCUA 3LHIA 3OOWA 1AKWA 4LCEA 4RPIA 3W4JA 2WP8J 4L0CA 4ER6A 1M2JA 4NX2A 1X1CA 3IUMA 4OAOA 2V9PA 3LBYA 4LZLA 3FDJA 5BNZA 1CUIA 3O91A 1HFJA 1XRRA 3GL9A 2Q7DA 3ROXA 1DC4A 3S99A 1B6TA 5K0SA 3OPYI 3N2NA 3JARA 2XBMA 1P1KA 5T41A 2P6PA 4MQUA 3AJ9A 3UYKA 3QPBA 4EVIA 4M54A 4A6PA 3PC8A 2BGWA 4TX1A 1SZDA 5PGMA 4RTMA 2PL9A 2YWHA 3VZPA 4FN4A 3H42B 4DIDA 1M2VB 4QG7A 5BWLA 4JUCA 3P4YA 4P4LA 3VYUB 1RMTA 2JIQA 3C4QA 1F4PA 1P61B 1KVSA 3GLGA 3ONNA 3KV3O 1P7WA 3SQDA 1M2HA 4WD3A 1YZNA 1QHIA 4QT0A 3BREA 1HX7A 2F4NA 4TUYA 4EGQA 3E7FA 5CM2Z 4TTIA 1SIWA 5EMNA 5CT5A 1XMVA 1WEKA 2ODWA 3S28A 3JWIA 2VPZA 3PC6A 3W5HA 4AZ0A 2HMTA 2FKNA 3A6KA 2AQIA 3OFVA 5E3HA 3WB0A 3MD0A 4WTOA 1QP8A 3SS9X 4IDHA 4IWXA 3WMEA 1R0RE 3N2GA 5A6SA 4EKGA 1WMEA 3ODGA 1TO1E 1FQOA 4L4ZA 3BCHA 2HA2A 1OCEA 4M1KA 5DGHA 3RHZA 4D1YA 4DBLC 1G6HA 1O3YA 5IC4A 3DT8A 1E1NA 3QVXA 2B98A 4MW9A 5FHRA 3E5MA 3IAS6 5IMBA 4A03A 3TW6A 5DK4A 4H3SA 4BQIA 2ZSFA 1EX6A 1DX4A 5CCDA 2J46A 4DLWA 2J6CA 4LHSA 3RRNA 1T2CA 1T8PA 2P8SA 1KO1A 2HMSA 1IB6A 1VJDA 3NOQA 4PG4A 1KGSA 3IBCA 2BM1A 4MGZR 3OM0A 1PTJA 4IXMA 2C5FA 4BNXA 3NTOA 4CEJB 2FW1A 2XD9A 3VISA 3AKYA 3E1SA 4LHWA 1OASA 1Z22A 3WDKA 1EM6A 4PE5B 1R12A 3VFDA 1EM8A 1AXEA 1KEUA 1YDHA 3AQIA 3K7EA 3KC2A 3M9LA 3R6GA 4U7TB 4X0EA 4X7MA 5DN6D 1CETA 1E0KA 1DJMA 1QG0A 2GHIA 2P9GA 1JEQB 3EIWA 3KD3A 2WFLA 1QJ4A 3KTAA 1XXHA 1W0KA 1AV7A 1CVLA 1RZVA 2NYVA 3QPUA 4QUDA 4EPVA 5A3QA 4ZOCA 6PFKA 3BRWA 3BMNB 3B6MA 3O4JA 3OTGA 2O07A 4NECA 3B78A 1T8YA 3LXRA 4H0FA 4OYHA 1VSQA 3OKAA 4OBEA 4C04A 1YB7A 4L4SA 3CLTC 2C7VA 3WSVA 4FYMA 1PO7A 3CBGA 4RX1A 3G13A 5CLGA 3TJZA 2J4CA 2Y6VA 5J4YA 4RULA 4EUHA 3ZWDA 2Q8NA 4I0WB 1KZYC 3T3EA 5I51A 4AMYA 3DL2A 5A4IS 2AYYA 2ECQA 2FV8A 2EGGA 1PYGA 4BLOA 3UJNA 3U31A 5IDXA 2W83A 2WT4A 1NVVQ 2VHCA 1V9CA 4Y0AA 1KPIA 1Q1NA 3OZSA 4BBPA 1DRJA 1VFNA 3IB3A 4Y2RA 3BWBA 3KEGA 4HTAA 1RDFA 3W7VA 4IQFA 3WIDA 1DG3A 1FXWF 1LEHA 4WUVA 1YK0A 3RYHA 5GADl 3N58A 1M1YE 1C7EA 1U3CA 2DUUA 1PNVA 3BXGA 2I76A 3EWIA 3IMGA 3NX4A 3OJLA 4LKOA 4M21A 4Q1AA 4Q1EA 3LW7A 4QPZA 3U2QA 1Y1PA 3L5KA 2H9YA 4MWDA 4L78A 5BUCA 5IKOA 3FE2A 1VP9A 2HCRA 3SQLA 1X9HA 2R5FA 1GAWA 4GICA 1IZZA 4WFIA 4DDWA 3JPWA 3N0XA 3PNBA 4Q02A 3RREA 1T9GS 4OTZA 5IABA 1DEHA 2ERCA 4LXGA 2BI7A 2Y93A 2FEWB 3EZ2A 4E1AA 4Y6LA 2RHRA 3COVA 5JD5A 1Z13A 3Q7PA 3WQQA 6LDHA 4DT1A 5CK5A 4LDAA 3EODA 1FBNA 2IYTA 4UUOA 2K87A 4JC8A 1EI9A 1REQA 3TR0A 4BNUA 1FLDA 4QDZA 2J4FA 2I62A 3GCXA 4X00A 2VQFB 1QK3A 2I91A 2JZNA 4M37A 5DLEA 3H5WA 3KBOA 1Z4JA 2YS6A 3LLUA 1E1LA 1M0WA 1VPTA 2AFIA 2B9EA 4BWFB 3BIJA 1UXGA 1XQ1A 3ETHA 1F8FA 1H8EA 2BRUC 2J0UA 3OSZA 2FE4A 3PZBA 5C1OA 5IZ4A 5KYUB 2ZJ2A 4B3GA 1XQVA 3HV2A 4J49A 5HX7A 3GMTA 1M2OB 4G25A 5IJ0A 1G3QA 3F4LA 2BI4A 2NUTA 3KDPA 3H2SA 5F2EA 2AFVA 2WWHA 4EFLA 4EJSA 1DXHA 3MB5A 2P9JA 1MIOB 1CLUA 4Q19A 1PL0A 2EVWX 3DJFA 4B87A 3M4JA 2RSLA 2C5EA 5JXHA 4K6MA 1PYDA 2EWMA 1PV2A 3HYRA 4BPRA 5GIOE 4LOHA 3AETA 2FZ5A 5J5AA 1AUVA 1NF2A 1T0PA 1XN1A 4B2LA 4C29A 4CTOA 4NNJA 2JAOA 3ZD7A 1VPLA 1E9CA 2MJLA 2V59A 3KM0A 1XNRB 2BFDA 1N6HA 1N1MA 3T3GA 1WB6A 2EEZA 1Z4NA 2XUJA 4A8JC 1RQLA 2PJDA 3INRA 3LP6A 5A71A 1GDDA 4NTZA 1SKQA 2QL5A 2QGZA 3EN0A 3HYCA 4DNFA 2ZPTX 4EFMA 2NUPA 3TW4A 2SECE 1QR2A 3E8XA 3H3XA 4EPWA 4B3RB 3THXA 5L3SA 2V3WA 2NO6A 3WX0A 3IUQA 1MPTA 1WXXA 1NC3A 4QQ8A 3ZHOA 3AFMA 5C8YB 1NW8A 4D8XA 1VLZA 2OFFA 2OORC 3E61A 3WK8A 1ESDA 1ECGA 3EGXB 4DY6A 5I7HA 5LU8A 3U3RA 3VSBA 4GOOD 2C0QA 2OD9A 5JSZB 4A8HA 4EKIA 3FOAA 3AVQA 2A1TS 1ZJZA 4JIMA 3DFIA 5ALDA 2J09A 3BXXA 2AFIE 4RJKA 4U9UA 4LDNA 1OGYA 3H5IA 3INTA 1YJXA 2WJ3A 4CM5A 2WVHA 3DOFA 1PR9A 3RR2A 3UV3A 5JNLA 1RWQA 2HMUA 3NHYA 3DGEC 1NLFA 5FPHA 2EHDA 3BD7A 1MX9A 4RXUA 2HMVA 5B7QA 5LOVB 1WMDA 1WV1A 1CDDA 1Z06A 2JCXA 5CH8A 3CLUC 1DE0A 4O2AB 3SC2A 1ID8A 4Z9BA 3GUHA 1YRWA 2H0RA 3IQIX 4P92A 3DT9A 4CNQA 1XRMA 4DBZA 4JVNA 2ATIA 3M0EA 2DLCX 4BEWA 3TLCA 4DLXA 3LLSA 1JLKA 2OORA 4L22A 3TD2A 4B3SB 1UOOA 3MTQA 3KL4A 1Z7YA 1MVNA 1TFUA 3K9HA 2I2DA 4M1SA 1COZA 1BVYF 1Q91A 1ENOA 3TFQA 3FHTA 3BL5A 1PTJC 1ID1A 1XYGA 2NQ8A 4IH9A 4RWZA 1O77A 4EWLA 3U7JA 2J7PA 1NKTA 2XMZA 1VMDA 3L4BC 4FYPA 4MZXA 4WJZA 4CIWA 5LQRA 2LP4Y 3RSLA 4LXQA 3RG8A 4EJFA 1ZQ1A 4Z4EA 3PEYA 5BSMA 1HEIA 2CNWD 4BKMA 2G1JA 1O0BA 3IT1A 5JNSA 1O2DA 3DUFA 3PDJA 4NMHA 4U2FA 4DRYA 4F46A 1M74A 1KDOA 3ESRA 4ZYZA 4FGKA 4EUSA 3G9TA 5ARBA 1E9RA 1UKBA 4F96A 1NASA 4UXJA 5FWYB 5LZ5A 3RIHA 3LOPA 3V42A 5E0KB 2G77B 3R0ZA 3LGAA 3OP4A 4XA8A 4DAOA 2I54A 2LV8A 1MO3A 3GDOA 1S01A 3ZQJA 2JGJA 1JR6A 3HL4A 5G0UA 4ZU6X 1C5KA 3MTBA 3MZ0A 1KP9A 4YJHA 5FUWA 3JYLA 2DY1A 2P2ZA 5FD8A 2VT7A 3K73O 3RVOA 3GRCA 3H0EA 3AV0B 5FEUA 4CGZA 2C3PA 1IXYA 5ESXA 4ERXA 3SQNA 2O0LA 1EIWA 4RO0A 1R0KA 2KBFA 2GFHA 4ALLA 2Z4RA 5CH3A 1JKXA 4GSYA 1W19A 1N2CE 2O8FB 2NAPA 5EWMA 1GP2A 2PRZA 1TXGA 3VKWA 4QWWA 2IXAA 3NH9A 3SSMA 3ZR4B 4LF8B 1NJ8A 1NN0A 2IP2A 2Y3IA 2QVZX 2GCOA 2AYXA 2O3QA 2XCQA 3Q85A 3DHWC 4IW3B 2B2XA 1YL5A 3JQQA 2FCRA 4IL5A 3QELB 2ZEJA 3G1TA 4ANFA 1WXEA 2D0IA 1M2KA 1U7DA 3FYUB 4K8RB 4LY9A 3GLFE 3K71B 1RC8A 2FDRA 1BDIA 1AMUA 1B8OA 2C4UA 2GBIA 1NQAO 2O7RA 3BZWA 3NDRA 2W58A 5SZIA 5TEVA 3W2HA 4C6SA 1E89A 2HIGA 3VJKA 2E5FA 4XI9A 5EVJA 4MW7A 2WBLC 3MEQA 1AIPA 3CGWA 5LP6B 3VJRA 1IPEA 4PF1A 4XYBA 1NUTA 5KJEA 3T7RA 3ETJA 5AJYA 4RFVA 5KJCA 3BJMA 4C7OA 1LSUA 3DHVA 3AOEA 5EHXA 2R6AA 4A0QA 2ZXUA 3R3VA 1X6VA 3LFHA 1YI1A 1Y4UA 3KFLA 2O9JA 3N2YA 4L2IB 5AO9A 3S44A 2VBGA 4EJMA 1E0JA 1ISSA 1EP3B 1KA9H 4PNHA 1XGKA 5HKKA 1PLLA 3I5YA 1GEGA 2CL5A 3IKLA 1S2NA 1B93A 3MQ2A 5CVTA 2YJZA 2XA2A 2ENWA 2WUEA 3KFXA 1SK9A 2ZI5A 3PD7A 3RRXA 3TOXA 1IBCA 2Z6UA 1OFTA 3QV1A 4QODA 3PA8A 4GOJA 2AN4A 4O29A 5FT9A 2IH5A 2FW8A 3A10A 3HSSA 3O3OB 3AOEC 5CDYA 3J81A 1A0OA 1ZN7A 2ANBA 4ND3A 5CA1F 1CDEA 4XQEA 5I4KA 3ER8A 3HDQA 3OU2A 4AO8A 1HLGA 2FYTA 3EVBA 4GWGA 4Q3CA 5JYBA 1XB2A 1RWXA 3G7UA 1TUBA 3DZIA 4ID9A 4P84A 4TOIA 4RD6A 4CQLB 1JU9A 3GJYA 2CJXA 1OPRA 1CRQA 2IQ5A 2NT3A 2PR2A 5EMHA 3PJRA 1NY6A 5KC8A 4X61A 5JCJD 2CL7X 3VDQA 4NYIQ 3IA2A 2G5CA 4V3BA 5AJZA 5BT9A 1BSVA 2PU5A 2ETXA 2JEZA 3V4VB 2H5JA 4JXJA 5I8WA 3F8WA 1KZ9A 1PUXA 3L1VA 3GGOA 5BVHA 1RYHA 2PLWA 1P5RA 4RESA 1OSNA 3C3KA 1XJ5A 4IXNA 3CG0A 1HOXA 4OMDA 3MHTA 4RKFA 3BEOA 4TN5A 2QGNA 3K6SB 2R6HA 2OZEA 1A4UA 4H35A 3M5PA 4NS4A 5CYPA 4I66A 2FSVA 3LQ1A 3RS8A 5KU1A 5CXUA 3A9WA 5A9SB 5JBIA 4LXXA 4RXTA 4IQ8A 3ZLBA 2YRXA 5B3AA 1JVBA 1O6CA 1QORA 1SG9A 2PX2A 2Q6OA 3D3EA 4X8HA 2OV6A 4X7PA 3R7SA 4BP1A 1FXUA 4GYJA 3ODPA 2ZCVA 2RHGB 3WR5A 5FX2A 3LT4A 5GGXA 3WTBA 4PIPA 3TINA 2FX3A 2PGIA 5COAA 2ONYA 2RB5A 3P9RA 2DYKA 1PR5A 5DKFA 4BCDA 1PP4A 4Q7EA 1UFRA 3SEFA 3FHCB 1UJ6A 1EHIA 2BFMA 4QE3A 1Z15A 3KEFA 1KAGA 2C7GA 2BMJA 3KVVA 1N2BA 4X9XA 5JO9A 4P4SB 4F85A 5EOVA 1TYDE 5GONB 1T2AA 1JG2A 1Z18A 4ITVA 3TL6A 3PEWA 5JUWA 4L16A 1IOVA 2OYRA 1KFJB 3IH5A 1R0XA 1XXLA 4D92A 4UPEA 3UJPA 3UKJA 2VDVE 3EWAA 1U0TA 2D5BA 1G3UA 3I09A 1QFJA 4XX0B 2F1JA 3TWOA 1YO6A 3QW2A 2A14A 2P9EA 1JDBB 5THKA 2IYOA 3FAZA 5IJXA 1LTKA 2W2QA 1KI4A 3IL2A 4JVLA 1IY0A 2BFWA 7ADHA 4KE8A 5DK6A 3KQQA 1VKOA 1XLWA 2VSQA 4E88A 2VZ0A 3JWEA 4WBSA 1HBJA 1I1OA 4IVNA 1WVGA 1Q83A 3E9ZA 3MPUA 1OOEA 2IU6A 3FLBA 3BB3A 1HE3A 1OIVA 1DBIA 1PTKA 2GJ8A 2WTXA 2CLDX 4IXDA 4KFRA 2QV7A 4XJSA 1ORDA 1FNMA 1A77A 3L7YA 3EX7C 4DR1B 1ZJYA 2FP4A 3IOMA 1YBMA 2VC2B 2W9XA 3VM6A 2W42A 3OHSX 2AJBA 2LXNA 1QOQB 1ZU4A 3PQ7A 3GLIA 3AM1A 5JECA 4QFMA 3LPMA 2GARA 5CNIA 4MR9B 4LBYA 1OBVA 1Z4QA 2YR0A 3ELWA 5M04A 5JARA 4P35A 2ZRNA 4XJTA 1CWUA 1GCOA 1H0KA 1ZM7A 4O4IA 2VHWA 2FZLA 1SQ5A 3VC2A 1YZGA 5TGTA 4NOJA 4INJA 4JB8A 1RRPA 3UNXA 1BCRB 1UJ5A 2IYUA 2QD1A 1V48A 4RKEA 5J47A 3HADA 3OKCA 4AY4A 3I01M 2X0RA 1W76A 2WABA 3PIRA 4EHJA 3GHHA 3S7TA 1A9RA 1XA0A 1OKKA 2C94A 4DR3B 1JG6A 3LP8A 3WK6A 5DNAA 2CUKA 3AGPA 5BNWA 1MX5A 3FTDA 1WY5A 2CLKB 3H2HA 5GQSA 1M2EA 4OGGA 4JDUA 4LJ6A 1ZSVA 1OIWA 3BHIA 3SX2A 4C4PA 3DCJA 3DFFA 3PHJA 3L8GA 5BQXA 5GJVC 1JDBC 4LNUA 5C4MA 3HZZA 1ZMXA 2VRCA 3F8TA 4MJXA 4DA7A 1VSBA 1U0OC 4JJGA 5KTRA 1W75A 4QVGA 3BZUA 2EERA 2XUDA 3WWOA 2FI1A 1U7WA 4DPMA 5C2JB 1JHZA 4IJVA 1N8KA 3NNNA 4KQWA 2A0WA 4A6EA 1D9ZA 1R9MA 3PC8C 3U4QA 3OEEA 2CSUA 3NM4A 4NYMR 1FU4A 3GQBB 4U7FA 4WY2A 2I6GA 1NJSA 1U7UA 2MHCA 3L6BA 3WNQA 1FNNA 3TLEA 1I7DA 4Z3OA 1N8NA 5TGDA 3MOGA 1FVFA 3KLPX 3HB9A 4RJLA 3G17A 1PT9A 2YJTD 3HCCA 4BDTA 1U11A 5FPSA 2JD1A 5FUYA 4BQQA 4WOBA 1DXQA 2VLBA 3O8QB 4NAVA 4OK5A 1N92A 4HT3B 1D09A 5CVCA 4NCBA 1DAFA 2VDKB 2X3UA 4UPDA 1QKKA 4Q3AA 2EIXA 2PBZA 4R84A 1G55A 4IQ0A 4XSGA 3HNPA 3W2IA 3IHLA 1AF7A 3OLZA 3OZWA 2C7QA 3EGDB 3K8OE 2QTGA 3PDIB 1QFYA 4PO1A 4C22A 5JNWA 4HZUA 1XHEA 3H7IA 1AGYA 3WGGA 1RZRA 2I2FA 3BIFA 1X1RA 4LUCA 3D0KA 1F14A 1GLGA 3JATA 3P0IA 4HWPA 4PW0A 4IRMA 1R6XA 4WV3A 3E8SA 5B37A 1QH1B 3VKHA 3D6VA 4MIEA 3UCXA 4PZAA 2QRJA 3MMPA 3ZZTA 1MAUA 1I4WA 2H17A 5FORA 1PS8A 1EA5A 2GRUA 2H57A 4GMDA 2H06A 4MCJA 4PCLA 4H31A 4BGDA 4ER7A 1THZA 3C6YA 1FL9A 4ZRDA 1M7GA 2WHXA 3DLPX 4C2UA 5K4GA 4QWMA 3UHOA 4DIOA 3PJDA 1V4VA 2XNSA 3GAFA 1V3VA 4TS3A 4QTYA 4F4DA 3IR5A 3ZXYA 3CSSA 5E7JA 3CKYA 3MMSA 1UODA 3PUKA 2E0IA 1OX4A 3GI1A 1U3TA 3MPOA 1JA9A 3DPUA 5A4MS 2QMUA 2GZ1A 2RAVA 5KCMA 1OLOA 4D3ZA 1MG5A 1C1DB 2O1EA 4CUZA 1SD2A 2PA3A 1Q0RA 2W6JD 1OLXA 2VOEA 1POXA 3FI0A 2H2DA 2O8EB 3GIWA 3MWYW 1WZ2A 2WMDA 4N3NA 5AVUA 2KE5A 2Q9AA 2GM3A 1DVRA 4YCBA 3AT1A 4GUDA 1Y8AA 1TF2A 3RU9A 1NZFA 3CZRA 3G2OA 2Q45A 2VBCA 3A0UA 3WZMA 1CVIA 1E9VA 4G24A 1SVLA 3DDOA 4YAEA 4ZEVA 3A1WA 4AUEA 4EHNA 2HIMA 2DVMA 3FROA 2JANA 5BW4A 1G4AE 1YZQA 3LNTA 1RRCA 4DR6B 3MD9A 4D8TA 2GBCA 1ND5A 3FSGA 1WNTA 4MEJA 1FP1D 2O20A 3OQIA 5CDGA 2DERA 2YOHA 5IDVA 1F1BA 2RAUA 1SXJE 2PKQP 5U9CA 1E8MA 1WB9A 3BTOA 5TX7A 4FMDB 4X41A 1JI0A 2NPIA 1XELA 2C96A 3SS7X 5GV8A 4JN6B 1XTPA 2QTWB 1EAMA 1WTAA 4R2XA 4OI1A 4IG9A 4O59O 4UFPA 5IKXA 4J16C 1NSFA 4EA6A 1PEYA 2B36A 4ZRNA 4AS3A 3PJGA 1AZLA 4D9HA 4AYXA 3E3MA 4REQB 5JEEA 1QV7A 1UL1X 1GQ2A 2C3YA 1DZ3A 2QHXA 4DV7B 2PAAA 5IARA 1W8IA 5K0JA 1CUWA 3PHLA 4XKJA 3T7DA 4DNOA 2HT1A 1CQJB 2PKQO 3DBOB 1Z7GA 4E12A 1ZK3A 1GN9A 2HRBA 2VYVA 3OZIA 2O7SA 4PLGA 3TKYA 2ODAA 1M7HA 3CXRA 3E7PA 1V5GA 1EJ0A 4N7MA 2OYCA 2TMGA 4IY1A 4YCSA 3D4PA 2P90A 3JZDA 2V7QD 5JXIA 3C45A 3EXHA 4BAZA 4W5HA 3V48A 4DLKA 3GP3A 4R1MA 2YZNA 4ES6A 4J0QA 3MERA 3EBPA 3BB1A 3PIIA 2YRWA 4GFDA 4NG5A 2G08A 4KAAA 2ZTSA 4U9IS 2GO7A 4BNKA 2PLNA 2RI1A 4O63O 5KYWB 3F96A 3CEHA 1N6LA 3AR5A 3CLHA 3NTUA 4GMHA 3PA6A 4BLQA 5MN5A 1U28A 3BWYA 5LR6A 3NLLA 4KWIA 1X19A 3THWB 3TAUA 1ESEA 4H7KA 1RWMA 3WIVA 2VJYA 3HGMA 2GPYA 1NC1A 2FMKA 1GUZA 1KY3A 3G2PA 4KN5A 1QUFA 2FEKA 4Z7JA 2R4UA 5KNBH 2TMKA 4UBNA 1JX6A 2XGMA 3VTKA 2OV2A 1XEAA 4FR5A 1JPUA 3CO5A 1P39A 1E2LA 5ALLA 4IMIB 4AJ9A 1WXFA 3AK4A 3SKVA 4HQFA 3IP6A 1RWNA 1FPQA 2WVJA 3FVTA 4NNPA 5LDGA 2G4LA 4IWYA 1XNGA 4LTMA 2AF4C 2NZ2A 1AZTA 5B6IA 1FSPA 1OH8A 4B1FA 1YR6A 2QD5A 4IO0A 3IUJA 1O94A 5TLSA 4PZLA 5F64A 1HYHA 2QM0A 1HZZA 4UUPA 5HQJA 5ITZB 2IYLD 2ZYDA 1CDZA 1XDUA 4MVJF 4X8MA 4CKBB 2NW6A 4URUR 4LZAA 2J33A 2NG1A 4KSYA 2AMYA 1OXSC 2DY0A 4MPTA 4X20A 1TJ4A 1P81A 3F4KA 5IKPA 4BN4A 1DQYA 3B5EA 4MMZB 3W5CA 3ABSB 1ZH8A 2B21A 1HQKA 2BFEB 3JWPA 2I4NA 5D84A 4K86A 4NIMA 4Q1VA 1YWGO 1U7ZA 4C0LA 4FGSA 4YPFA 2IY9A 3A6DA 4LFAB 3TSWA 3FWKA 1WV0A 1MO2A 4M0DA 5T6BA 5JAZA 2AKAB 3WRVA 1EHYA 1X7XB 1PDOA 3X1XA 3LNCA 1JB9A 1HKHA 5D6NA 5JANA 2E4VA 4OGWA 2IPXA 2W5UA 1ODFA 2XX3A 2XB8A 5KWVA 1CP2A 4OHZA 2CDAA 4KQGA 1DZIA 3V6MA 2QAGB 3DONA 1LJ8A 1U02A 4N5DA 1UIMA 5LBIA 5KDOA 1CY0A 4KV9A 3HO1A 1JRLA 1G17A 1WMSA 3P0HA 5ELXA 3ES9A 5WRFA 3R0XA 4UASA 2O2YA 1GG5A 4AG3A 4QUGA 2IYXA 1OZ0A 1L7PA 1N5MA 2EBFX 1G5HA 1N57A 2TMYA 4IIGA 1QCCA 1ZEMA 1QO7A 2C07A 3H2YA 4H7HA 3TZ6A 5CD9A 3B6JA 1NBEA 3SEQA 2R2GA 2QRZA 3IULA 3HP4A 3BE4A 1T5BA 2DQKA 1H4VB 8ATCA 2VAPA 3M6LA 4URWR 4HQNA 5FO0A 2EF1A 1N78A 4WVFA 1LDGA 2XVYA 3VZBA 2K5UA 4NRDA 1CQIA 4HVLA 3BE6A 5BW8A 1R3DA 1VSTA 2P2YA 1FQWA 1LC3A 1QK5A 2XIJA 1SZCA 3FYDA 4RF3A 1NBAA 2JK1A 4G5XA 5DTMA 5IDWA 4ZPXA 1NFFA 1FDIA 1RC0A 3QPAA 4DSUA 5EIOA 2HF8A 1M10A 1I8TA 3NNSA 5CVDA 3GWGA 4UJ5A 3S2SA 3U4AA 1V2GA 2BI8A 5A02A 2ID8A 2QAGC 5JIBA 1CUEA 3RM3A 4TN1A 5ECWA 1FLNA 1P44A 3KHUA 3OJCA 1AGPA 1IBRA 2FZVA 3CH4B 3B6IA 4P0QB 1IXRC 1MRSA 3EVCA 2WPDD 3IERA 2DFNA 4AMGA 1O57A 2DF8A 5KQLA 2G6TA 2QQFA 3COSA 3HDYA 1XO1A 2YWJA 3CKMA 4XD2A 4G56A 3UV7A 5B7NA 1G2QA 2HA6A 2C00A 2XR1A 2ZITA 4M7WA 1T3HA 4JDPA 2GN6A 3L84A 4BBJA 5LLTA 3MA0A 3SMQA 1VL0A 5C18A 4G9GA 1XEFA 1AGRA 2I1WA 3OWHA 2VWPA 2MCFA 1YUMA 2XZDA 3N8HA 4V1CI 3GJ3A 3OIFA 4X6UA 4OVKA 3KVOA 3L05A 4QC2A 3MGBA 4Q7JB 4YJFA 3IAEA 1ULHA 1XAHA 4KREA 1B42A 2QN3A 2OHOA 4YTEA 1W30A 3RC8A 4Y1EA 1S3IA 1VE7A 3RTEA 5CTAA 1GRQA 1JW9B 4O25A 3HBNA 1BMDA 3GJ4A 3DVQX 1ZC3A 3HY3A 4ZGGA 2H65A 4B2PA 3T1OA 3A25A 3T0FA 3PTZA 2VPXA 4DUYB 4ZZ0A 1KWKA 4EG5A 4HFJA 4G0OA 4E09A 3GLGE 1BFDA 3RRYA 4C78A 5E38A 1K98A 4ME6A 5LQAA 4DDVA 1P2VA 3FPAA 3O26A 2UVQA 1AS2A 4RZ3A 3WAGA 4ZQBA 1PR3A 1QYCA 2QJRA 2Z04A 3T5PA 1WPRA 3OZXA 1F6DA 5CDFE 1JNYA 3FKSA 3REFA 4AY6A 2LBPA 3T5DA 2R8RA 2BAGA 5M29A 3EQ2A 1E2KA 1PT8A 3S2GA 3L3BA 5IDYA 4D56A 1RHKA 3A1NA 4C21A 4MW0A 1KI7A 5CDSA 1N5JA 1RLTA 2Q6KA 3FYCA 3NV7A 1DFGA 1XZJA 1NLYA 4YJDA 2O2GA 3FMFA 3QA9A 3WKDA 1GPMA 2DLNA 1NVKA 1OC4A 5HE8A 1HFEL 5CNKA 4MLPA 1TYAE 4IJQA 1YS2X 1OI4A 1WPQA 2MWMA 3G8CA 2W22A 2VF8A 3K32A 3QYJA 1AKNA 1GZVA 4K88A 5CU7A 1NWHA 4HNSA 2NQTA 2AN5A 4NC9A 2CJFA 3ZWMA 4EO7A 1QQ6A 5DP2A 3GJRA 1P6QA 4G23A 4UVDA 5JXWA 1N5DA 2WIFA 3JS5A 3NVKI 4Q5IA 3TTYA 2VQ6A 2Q99A 1K75A 1O0SA 2BFFA 3BFPA 2X1LA 3K2IA 3QA3E 5LYYA 2GUWA 3UOWA 3WNVA 1EE1A 1U8YA 3LVQE 2AQ8A 3IHKA 3Q3HA 1TJ3A 1BG6A 5EINA 4FC6A 1QZTA 1XHFA 4L95C 4XYMA 4PHHA 1BW9B 4FQ8A 4E7PA 2RBGA 2D2VA 4ALIA 3CV3A 2HKIA 1ZRMA 1U0LA 3H05A 4OXNA 4C30A 4R2MA 4J1TC 2VPPA 4KQ6A 2CFCA 1M76A 3O2SB 1H2AS 5DX1A 2FX5A 5JRDS 1SXJB 4EZEA 3CCCA 3R44A 4KODA 2PFSA 4MPRA 3ROPA 1IHYA 1T25A 1WLYA 1D04A 4PGFA 3GH3A 1TQ6A 1W9MA 2FN8A 2AUNA 1QIHA 3EZLA 5CHYA 3EFBA 4YQFA 3EEBA 1L2TA 3E15A 3UPTA 3T1VA 2JB9A 1WOMA 4B8WA 1IJBA 3DHYA 1QWOA 3QLUA 4QTXA 3MCZA 2EFYA 3H99A 3CF4G 1SCKA 2GVZC 2FPKA 1J9GA 2P9BA 2OO7A 4B09A 2QD3A 5CXQA 1I7PA 2O5RA 3UQYS 4TMXA 2DR0A 3EAGA 3F6PA 4NPHA 5HBRA 3PEFA 1GSIA 3B1FA 4FYHA 2F90A 4OHOA 4Q00A 5JAIA 2P2SA 1RKVA 2LTAA 3QBDA 4D4HA 3HU3A 3KJQA 2WFAA 3AJEA 3MOIA 4R3UC 2O57A 2VJBA 5E2BA 4PZEA 1X1BA 2PPVA 4ITUA 4LWZA 4BVGA 1LLCA 2ETVA 2JCBA 2XAUA 4FZVA 4U1RA 3TRJA 2BR4A 1JGTA 1ZPDA 2OXIA 1G42A 2FN3A 1C8VB 1ADCA 1QGDA 2Z2KA 1KYWA 1FSSA 4YUYA 6NULA 1M3SA 4R1TA 3FR8A 1QIMA 1IHUA 4GVXA 5TF4A 4MARA 1T35A 1ULUA 4A1OA 1K86A 2YRFA 4CIBA 4B73A 4JEHA 3ESDA 4LGMA 3FPKA 1GKYA 4H77A 4DC9A 3AKCA 2LRHA 3W6ZA 2JAQA 2QT9A 3A11A 3WLLA 1JDTA 1U2ZA 4MQ5A 4RGBA 2A5YB 1XFDA 1UBNA 2OLJA 3VOSA 2PQ2A 3FJ1A 3HCWA 3ZHVA 1RAGA 2IDJA 3ZTYA 5C7LO 5KYUA 4EVSA 1O87A 2PO5A 1NURA 2QN6A 3O47A 3WFJA 1UKVY 2I6TA 1HMPA 3I9LA 2NUTB 2ZBPA 4RK0A 5DNVA 4I1PA 3U16A 1GRNA 2JK0A 1K2WA 1MRZA 2PGNA 1WJGA 3SZGA 4CKEA 2ON6A 4JOQA 2PKXA 3IDOA 2YVUA 3GRFA 4JJ6A 4RK1A 4HFMA 4TMWA 5ALGA 3VMMA 4RPGA 3LD9A 2CZGA 4YQYA 3LF2A 3GLFA 1JDPA 3Q3VA 2X5OA 4G0PA 5C7IO 4N5IX 5HRAA 1F2DA 4UFOA 2QW1A 4Z4FA 1WETA 5D3MA 2H63A 3N7TA 3TTUA 4M1WA 4WMLA 3LU1A 1L5LA 4RTQA 2Z8YM 2I4RA 4EFNA 1YR2A 2XGJA 5JU6A 3UT5A 2F3PA 3HJNA 4YCJA 5AW1A 3NTXA 5EIXA 3P2JA 5A06A 1XAJA 2VF4X 3PC2A 1HORA 1XCBA 4P3YA 4B7AA 3N9IA 5AKKA 1CW2B 3CUUA 5I3CA 1QBGA 4URZR 4YRGA 3DZ8A 3O94A 2IYWA 2QUAA 5K0NA 3IMEA 4UTPA 3CVOA 4I5IA 3VVCA 3M2TA 5B7PA 1EMDA 3T9FA 1X7WA 1ECLA 5D5HA 5C35A 2O4CA 5G3YA 4V1CB 4AW9A 4ZYWA 3QK7A 2ADMA 4O4JB 2HAEA 3A2LA 4YMIA 3Q8LA 1G60A 2EFHB 4HXYA 4UATA 5IAOA 1MQAA 3FLMA 5FOTA 1JXQA 4TKMA 1P2FA 3O9MA 4EPRA 5CA0A 4IHQA 2CLFB 2B7LA 3C4JA 1EQ2A 1R2QA 3WLTA 3F3KA 5ICEA 4YAIA 2YFYA 5FA5A 1FJHA 3L0YA 1BKSB 3DMTC 3MFQA 1J8FA 1MJFA 3MN1A 5CEEA 2VNJA 1F4LA 3DKRA 2XQGA 4PPFA 1QKIA 2VWQA 2YXNA 3FPJA 4L8VA 4NOKA 5IMSA 5EJEA 1PNQA 3H9JA 4UMFA 4QLBA 1HV8A 1RJWA 1FNDA 4WK4B 4B6JA 3L4BA 3CB2A 4MV4A 3A2KA 1BDMA 3SS8A 5INTA 1DTEA 4QDTA 4I50A 3IUYA 1KDYA 4B4WA 2H5IA 3D7MA 3EZNA 3DR5A 1EDEA 3GVPA 3ISJA 3L6DA 4QFBA 3ZZNA 1SHKA 2W48A 1LK0A 3PLRA 3KUDA 3Q10A 5CPBA 1YRHA 1GTMA 4O4HB 3GGDA 2P91A 1W47A 4XGRA 3K9WA 2VXYA 1K27A 2WF9A 5ALRA 1RR6A 4L7QA 3OIYA 4FYYA 3UOGA 2CMKA 1MPXA 2C78A 3BCRA 3I0ZA 3RTDA 3SZMA 4BKUA 4WZ6A 3VBCA 3RAGA 4RV4A 3U4DA 4PLPA 3AGQA 1ONPA 3T15A 2GM4A 1BMTA 3RJZA 1KF0A 1SIBE 4YP5A 1AV6A 4IYJA 1DUVG 2ZR7A 3OP1A 3LT5A 4HEJA 4MR8B 5AHWA 3ZHSA 1QH8B 4MP3A 3F7NA 2OYSA 1E6LA 2D7CA 1MAAA 2NZUG 1IXZA 3VH4A 4HSEA 1Y7TA 5KDDA 1POWA 3EGWA 1VDZA 1Z4IA 4JUBA 1DCFA 4E4YA 4CF6A 3EWSA 1FMTA 2HA4A 3G5TA 4HLQB 4ZVKA 4D82A 5LDDC 1IN6A 3HL0A 2EAUA 3WQBA 4BOYA 1NMQA 2W2PA 2PRKA 1KZ4A 1TM2A 2G17A 2WNHA 2AOUA 4I55F 3QOFA 4M60A 2W6JA 1FTNA 5FBQB 3W34A 2CLOB 2AK2A 1U0GA 1N2SA 1WQ1R 2CL6X 2I4IA 2YCLA 3DL0A 4CG1A 1FVXA 1L3CA 1XTSA 2R5NA 4G84A 4YRTA 3CBQA 2P9TA 5ADUS 1BWSA 1NOKA 4KJXA 5E9QA 2H2AA 4JQSA 4R98A 5CA1A 4PSKA 3DMGA 4NCKA 3REOA 1BAPA 2O2IA 4K9RA 4X54A 3EF3A 4GGOA 1PWHA 1S2OA 3ZCVA 4NDAA 1F0NA 3HJUA 3LIPA 2PUTA 5KQRA 4N76A 1F3OA 4G07A 2BZGA 3FETA 2PUCA 1WDWB 1B00A 2Y1XA 4FR2A 4MW6A 4PRKA 1HDCA 4N0EA 1ZK0A 4EGCB 4I8IA 1ETHA 4DJFC 2X4IA 3MUEA 1C80A 3KQNA 2ZI4A 3RRJA 1BWQA 1RWKA 3CKKA 3OLYA 1PJZA 4D9NA 1R8XA 2HCFA 4TKUB 1R3UA 3QX3A 1EGAA 2LDXA 2QTBA 1ZQ9A 3IEXA 2D0OB 2O1WA 4L9RA 5FRDA 3QIAA 3WGJA 3HLTA 3HN6A 4FWIB 5SZJA 2G8LA 1U2GA 4UHFA 3ZHUA 4J0CA 2Q0XA 3EFHA 4HQRA 4RABA 4YJ2A 3TJRA 2FG6C 2BRUA 4D26A 1W4AA 3AFIA 1KJZA 3QUAA 1NUAA 4PYMA 1MA3A 3QF4A 3KS9A 3CNEA 3NWJA 4MKIA 4DIBA 2O8CB 3KPWA 3WLHA 2PQ0A 2ICAA 4KPGA 1Z17A 2P0YA 2BGNA 3K9NA 4HDRA 2R84A 1CUBA 1M75A 4DAEA 4DWJA 1S1CA 2JGDB 5IAEA 1Y6ZA 2PH5A 5EKSA 2Q2VA 3VVLA 1J8QA 2QIPA 2AMLA 3A36A 4RH3A 4V03A 4BGEA 5LD2B 2ZR9A 4FONA 5A3VA 1GPNA 2LWIA 1SCUA 3V33A 1C7RA 3JTEA 4HHEA 4PG8A 3KTFA 4PQRA 3EW9A 5T57A 4KMMA 4F5WA 2XDQB 3E22A 3M6UA 3VU3A 5C7YA 5KNLA 4Y9SA 5DHUA 5LJIA 3AL0C 1UBMS 1H9BA 4QLAA 2KI5A 4QUKA 1M6VB 4H16A 2NU6A 4DSNA 1QO0D 3SIRA 5IFLA 4Q01A 1PFQA 2M6KA 3TIVA 3W2EA 3VH2A 1JQ3A 3H0CA 1JFFB 3CLRC 1TAHA 1N5LA 4XVRA 4QHSA 4A2CA 3JTMA 4DS3A 4GKVA 4DW8A 3NBZC 4CLDA 3S6JA 4QXPA 4ZYYA 1NZJA 2RB4A 1ZL2A 1IYZA 4WNAA 3W8RA 4KPEC 1XDBA 4JI0B 4N5HX 1SBHA 3A2NA 4RMNA 2V1UA 1H8HD 4RYDA 3LAWA 1UOPA 2OAQ1 4OKIA 3RBVA 5HZHA 3AC0A 2FEXA 5BVHB 1UWVA 4P3KA 5IH7A 2UZ3A 2NU8B 3SJAA 2ABWA 1JA1A 2PXCA 5AIAA 2F8TA 3KXDA 3IILA 4KN6A 2WYOA 4XFJA 5H02A 4NMWA 2V7VA 1Y1RA 4G5SA 3IQHX 2AG5A 2AXNA 4QT4A 2I34A 5BVGB 2X42A 4NDZA 3DMPA 2DWOA 1KL7A 3FBTA 3GJZA 3GZ4A 4IF6A 3WA6A 4O1IA 4OHFA 3WLKX 1QPGA 1H2XA 3FTNA 5ABPA 3WWPA 3RWBA 4JXZA 4CE6A 3RRFA 4EHBA 1GEEA 1YJ5A 2A30A 4OLJA 1TK3A 2ZYIA 4RTNA 1S6YA 2Q07A 2RGNC 2CFOA 1Z0AA 4ZEXA 5B4VA 1Q3KA 3RYIA 2C99A 4O4IF 4YX9A 4UJ3A 3UWOA 2EC5A 3ZWYA 3U4HA 1I9CA 2E21A 2OQRA 3C6QA 1LDYA 2EP5A 1X1AA 4OQNA 1ZKMA 4XWAA 2IUUA 4ENSA 1DG9A 2IYEA 1SZJG 2IZ1A 3PGJA 4D7AA 4H1VA 4AF8A 2IT1A 3L7NA 3HVJA 2RJNA 2XVAA 3ZGVA 1TVCA 4BATA 5IBQA 4IPTA 4FFOA 4RZUA 3FUWA 3QUBA 5A9RA 2FF5A 4AI6A 3K2BA 1P9LA 4MV1A 2XMSA 5DJ5A 1DIOB 2G0AA 1TD1A 1QHXA 1Y81A 1JWBB 1P0QA 2PGAA 3CC8A 3U3OA 3IE0A 1KMNA 3UZUA 4Q15A 4YP0A 3EXIB 4LVNA 4X6XA 3HXQA 4Y1FA 2IU3A 3BORA 5FP0A 1CG6A 2HSJA 2YIMA 1XXHB 3EUEA 3OT4A 4FIDA 5TPZD 5EQJB 4KR3A 4E94A 1E9BA 2GO1A 3ZCRA 3RTBA 3FCUB 4CV3A 4YUZA 3GP8A 1IK4A 1PN3A 1G20B 1S9DA 1N5OX 2VSFA 3E3OA 3GVHA 4LZNA 3MSXA 1COWA 1JDSA 3HFGA 4FOSA 1OH6A 1FNCA 1H1LA 3BMCA 4D4JA 2YIJA 1D4AA 2OCXA 3OQBA 3ICQB 3EZ7A 4RADA 5JAHA 4GZ6A 3KWLA 4HJXA 5F9MA 2IOQA 1UZNA 3TBKA 2AFHE 3VTFA 3W8DA 3R5KA 3G0DA 1C9MA 2IZ6A 5I7WA 5I9NA 1TK9A 10MHA 3E3AA 1KVTA 2VP4A 3B2QA 4ZDJA 2D5AA 2GJKA 3K5PA 1P9NA 4R1PA 1JH9A 3PXCX 4MWBA 5TT1A 4BGUA 2DR2A 1WSWA 2B35A 4M9ZA 4N5NA 5KINB 4AJ2A 4G5RA 5KSPA 3RH0A 1Y3IA 1VXOA 1Q84A 5DBGA 4QLOA 1BE1A 1QKJA 5FPQA 2ZE6A 3WNZA 4DCPA 2OG1A 4RD2A 4E5KA 4ENUA 4RJJA 3WKBA 1N2XA 5JZSA 5LB4A 1RM0A 1O9BA 2QNBA 4L0QA 3TJMA 2HWUA 5I5GA 1AURA 2EKBA 4YACA 4W5QA 3DD5A 2V7EA 1CF2O 2NPOA 3WOHA 2V0NA 3D6FA 3HLYA 5C8VA 1SUDA 1ZXXA 2Y0PA 3LWZA 3I64A 1ELOA 2YFKA 1OXVA 3C6MA 3GGPA 3LW8A 4JSTA 4NNOA 5E7QA 4MQEA 4ZT2A 1KOLA 3T9BA 4CHGA 4MUNA 5HM8A 1GT91 2VHXA 2WSBA 1QJCA 2B5VA 1Q12A 5A5GA 3HZOA 2PZKA 1A8SA 1IAQA 3CF0A 1BYUA 4LNUB 1X87A 1FLVA 2GAIA 4TTPA 3DAYA 4G4SP 2EQ5A 4D3SA 4DEYA 1UQRA 4DT1B 3S8MA 4R69A 1FXSA 4BS9A 3UWDA 4IAOA 2ECFA 3F2IA 3AU8A 2R8EA 1Z75A 1YVUA 1X9GA 4I3HA 3LQ2A 4S04A 2ZVJA 1DRUA 2BGRA 2QA5A 2I3ZA 4E15A 1UJ4A 4C4TA 1PL8A 1C9DB 4I1VA 3VU8A 1T5LA 1HE1C 1M54A 3IUSA 1QF6A 4H3HB 5JFTA 3JQBA 2YTZA 5BYBA 3DAPA 4BFLA 2JCVA 1Z0FA 4OL0A 2DE0X 1PD0A 2JJYA 1T2FA 3ROTA 4AYTA 5JMWA 4RA6B 4IILA 3DF7A 4NZ9A 1P9OA 1RRVA 2JVIA 4FC7A 2ZPUA 4X1IB 3PV0A 1FEZA 2XNDD 3QKRB 5I47A 3IIKA 3E27A 4QOHA 1O89A 3UMGA 3CIOA 1HNWB 3WLSA 4OQFA 3FNFA 3CX4A 3AFHA 4MA5A 4WQMA 4LY0A 3RD5A 3MBIA 2J3HA 2HLDD 1L7VC 2LDBA 3I0MA 3JWGA 2Q29A 4P34A 5E4FA 3R7DA 5A2QA 1X15A 2CUNA 5DLPA 5BYKA 2GWRA 3QG5A 2L82A 1U7HA 3INYA 3JQ7A 4L7VA 4FT2A 2BFDB 1U1CA 2F00A 2VJAA 5ULLA 1PV1A 5LU9A 1VL2A 5LIPA 2AOWA 1Q7EA 2KPOA 3B36A 4X63A 3LX6A 3I2FA 1MO6A 4R2HA 3H2JA 5AVJA 5L40A 4E6EA 3WBFA 4A8PA 3MVEA 2PUBA 2GN2A 1XSEA 2QPOA 2ZU6A 4FI3C 1IB0A 2OAEA 2W70A 3MYRA 4QM7A 5AVOA 4Z4CA 1DO8A 5EKUA 1ADYA 1LS1A 5ALNA 3DMFA 1TVKB 2O6LA 3KQSA 5KKNB 3IKMB 3OETA 1FDRA 2GBPA 4IDFA 5T5QA 3ZH9B 2CFSA 4C0KA 4DCOA 3UB3A 4DDTA 2ZUCA 2WWYA 3SYMA 1YDGA 1C0EA 1ESZA 5L7TA 5DXJA 4QDXA 3N2KB 4QXOA 4AKHA 1FW8A 2Y71A 4OH7A 3VBEA 5L95A 4LRTB 3V7FA 1QDLB 4AY5A 3AZQA 2O5EA 4D9FA 2RI0A 3QY0A 2WM2A 3SR3A 1Z3IX 5JXJA 4MNTA 3QBTA 1WY7A 2AH5A 4G5FA 3OIWA 1A9XB 1MIHA 3HKCB 1JIXA 1PL7A 1NOIA 4WFQA 1NV8A 2GA8A 1KJNA 3ZJUA 2WJGA 1QH0A 1EVQA 1PR4A 2VEDA 3V97A 3UYLA 2QQ0A 2Z2JA 2NU7A 3GQVA 2QLLA 4WCFC 4W9RA 4JCCA 4HR7A 2XGOA 4EW1A 4QZVA 4CI9A 3CWQA 3RODA 4KWTA 1EJBA 1PJLA 2G70A 1U2QA 1WB4A 2EJUA 4YV1A 3JWHA 1MJGM 1GGFA 5GOZA 2HQSA 3ZLJA 4HO1X 3IDZA 2LIVA 3EQ8A 4LK2A 2ZGVA 2HUNA 1EA7A 1ZI9A 4CKXA 1TL7C 3C97A 4JJIA 2OVBA 1ARZA 4PFSA 4V38A 1LF0A 5D3KA 5KSOA 3QXSA 4B76A 5I7UA 1S8OA 1KO5A 4FEEA 4HQKA 4UDNA 3RS3A 5SYNA 4MWTA 3ZE8A 4LX8A 3TLBA 2H2HA 1XE3A 3ED5A 3OX2A 4DLNA 2E2WA 3CW8X 3QU2A 5HUHA 3K5HA 3ZWNA 1R18A 3VV2A 2ZSIA 4A92A 2CHQA 5TARA 1H8ED 1MC4A 2XW6A 4MI3A 4Q4CA 3D3NA 2H4HA 4FJ2A 5B57C 4QYIB 1OREA 1CP3A 1CQJA 4OL9A 4P4NA 1SVNA 4OQMA 4LY3A 3SQWA 1YAHA 1E1CB 1RJ9A 1GKUB 4C4ZA 1Z7EA 1VHTA 2PWAA 1UH5A 4QQRA 3OIDA 1CZOA 1UJCA 1DRKA 3FYSA 4H3VA 4JB2A 3PQ4A 3JAWA 4AZVA 4DJJA 1O94C 3I9V6 2J59A 2ZUFA 4ZVPA 4B47A 2BIFA 2ZUVA 1HRDA 4LNAA 2PZMA 3CUSA 4TXLA 2O8FA 4BJ5A 1V8ZA 4RD4A 4OU4A 3FWPA 4DKJA 3K2EA 4GP6A 4YPVA 2E6UX 2ARKA 2R85A 3KQLA 1BD4A 1Y7IA 3E9YA 4AS2A 1NVAA 2HLPA 3LL7A 5IXYA 2IPLA 4QGAA 5TGZA 4XYGA 2QV0A 1VJRA 2WUWE 3QOWA 2P3OA 1X92A 4WADA 2A67A 3QF7A 4YMSA 2RHBA 4Q4DA 2D62A 2UUOA 3LDGA 3QOYA 3R3YA 1CHNA 2C9ZA 4QASA 1YQEA 4BJ6A 5IRCD 1RZRD 3RK1A 2VG8A 3SZUA 1TW2A 2Z6QA 1TZCA 4UU8A 5ERGB 3DH0A 4PGAA 1QFMA 1J21A 2AX4A 2IDZA 4QAQA 5K6RA 3JWJA 3TDMA 1N0UA 1JYFA 1S5PA 3D6JA 3OWOA 4QBFA 3IQEA 4JBLA 2IL1A 4GI1A 2WTMA 4QRIA 4Z9XA 5ITZA 4BO2A 4YY3B 4P7GA 4UMDA 3TX2A 2BMFA 4QGSA 4KE7A 2BKVA 3H1FA 3P9KA 4N18A 2YWXA 3LRTA 2XF2A 3B51X 4RVUA 1GV0A 4BMNA 4CTJA 3ADBA 3ZGNA 1XCPA 2GILA 5BW6B 3KTDA 3OT5A 1SURA 5I45A 1C1XA 2VYFA 4N65A 3MELA 3D7KA 1GO2A 5AK6A 4C0AC 2I4OA 2DPMA 2R97A 1ZH0A 3A0RB 4YV2A 1OD6A 1NVVR 2QYOA 3O93A 3JALB 1JTEA 1C9JA 5TE9A 5TJ9A 3R3SA 1J6UA 1JHVA 5F3WB 1U0BB 1VBMA 3A1SA 1V11B 1UPTA 1LBQA 1B0PA 4R9RA 1CF9A 2AQKA 1T8RA 2R6GA 2J67A 3DV0B 1AQNA 5K45A 4N8SA 2HJGA 1JFLA 1WWKA 3NFRA 4H17A 5AW0A 5HSGA 2BT4A 4MHOA 2QAGA 3V8QA 4EG7A 1YGPA 4BTEA 3HSYA 4ESHA 4PO8A 3TLAA 4BZWA 5AUOB 4XGNA 3MT7A 4E5MA 4DDUA 2CLEB 1Q21A 1OXMA 2ZRLA 3W5SA 3HKDA 1XU7A 4KQCA 2CWWA 1SHLA 4R8KA 3JU3A 4CWAA 3VX4A 3R5TA 4MCHA 3FCOA 2PRSA 2JGFA 2Q0QA 4S3MA 1RXYA 1BXGA 1DBSA 1NG1A 2GN9A 4ZJPA 2DWUA 3W7AA 5A2GA 2FW7A 3UICA 2R8ZA 3IR6A 4DV2B 2VA9A 2QQEA 3GMDA 1C1HA 2NPFA 4AJEA 2P4QA 2ZWOA 2VI5A 4R7GA 3QEOA 2QT1A 2D6FA 2EX4A 3RHSA 5K3EA 3LUBA 4C7XA 4XSVA 3A06A 4KZKA 1E9EA 4OHXA 4UHDA 2DSNA 3N0TA 3Q8XB 3UANA 1M83A 2HY7A 2JFZA 4Y2VA 4ZREA 3USZA 1RLIA 1ZS9A 3CLRD 5U4XA 3LXUX 4FSDA 5I9SA 3IAAA 1GYPA 2CB9A 2BMAA 3H2GA 3JQCA 1WR8A 2ZJBA 3Q87B 4OHBA 4ZIRB 2M1XA 5JADA 4P4SA 3FIUA 4AZ3B 4QYXA 2CD9A 2JGRA 4RJ2A 2BP7A 1ZOLA 5IVHA 4GNRA 5CBPB 4DA0A 3JSAA 2XE6A 1EGMB 1OV4A 3A2MA 3UH0A 1TAQA 2BONA 2DM6A 3AUTA 3VRHA 4U7HA 2RI6A 3M49A 4AIIA 4XX0A 2ZIVB 2OENG 2A0UA 1TFRA 4FGZA 2BTQB 2LGJA 3U19A 2ZR8A 3O8CA 2H7CA 2JFBA 3B7WA 1N2HA 3CLSD 3ZWXA 5SY9A 2ZAOA 1U81A 3WBBA 4EYOA 1YULA 2G9QA 3GBVA 5IULC 4WOPA 3EFOB 5BR8B 3AR7A 3PBKA 3R3ZA 4HWOA 2XSZD 4TV9A 4BUCA 5B1EA 3BILA 3RVSA 3GDHA 1N3LA 1R5JA 1Z5VA 1EFRA 1PFVA 4HNRA 3K0BA 1BD3A 4JBNA 3F78A 3GCZA 5H16A 1E9AA 3ZZ1A 2ZATA 3QXHA 5A4AA 1NOJA 3IPCA 3PUHA 1HTWA 4PTYA 1QNFA 4QUBA 3LLMA 4TWBA 4CPDA 5E9AA 1RJDA 1M8KA 3TIGA 1RCTE 3VR2D 5G0VA 5BR1A 3IT3A 3SX0A 4P80A 5EJ7A 4B33A 1WS6A 4EDHA 5DGDA 1U9YA 1OH7A 3R3XA 5FNZA 3UK6A 3CVUA 1UBOS 4BMPB 3TCNA 3WMRA 3AHHA 3HJAA 4XWTA 2HMAA 121PA 3DP7A 2H1OA 1WHSA 4Q48A 4YNBA 4NULA 3F7MA 2NSLA 4RVDA 1SXJC 2J5BA 2R1UA 3MCTA 2VT3A 1AHHA 2GAJA 4ZOEA 4DM7A 4C4YA 4PLHA 2BLNA 3MW8A 1XWWA 3OPNA 3HB4X 3UGJA 3FB4A 2GPSA 1E1YA 2QTLA 1BCRA 2Y4OA 3ROMA 4B3JA 5AT1A 4G0XA 4BLUA 2DFVA 1WUIS 2POQX 4KLCA 1PQPA 1M0EA 4ZTBA 5F76A 3LUGA 221PA 4BV9A 4XGKA 1ZCBA 2NNLD 3W5DA 4HAXA 2C77A 4BFUA 2O54A 1L7AA 4A8JB 1UDXA 5A5VA 4AS1A 4IVRA 2IYRA 3HNOA 5KVAA 3EGEA 2V6MA 1V0JA 2W37A 2XYHA 2ZZKA 4XLZA 3DF9A 5KI6A 3RT9A 2DBZA 2E5WA 3W5BA 2OP0A 3H75A 1AQYA 4QJBA 4XWYA 5IASA 3RADC 2ZOSA 3F6BX 1XAIA 4D3DA 4FBGA 4I1SA 1ICEA 2R87A 4EQZA 1Y33E 3FGOA 2GZHA 3IRUA 1KAQA 2PSSA 1JWAB 1MB9A 3Q9NA 4G0MA 4LV5B 4X8LA 1MD9A 2AJDA 2QTCA 5CJ2A 4U6NA 4YWJA 3U1TA 4Y2GA 1D7OA 2P69A 4AICA 1JXAA 5LP6F 3PP8A 3ZIAD 4AQ7A 2XYGA 3WWDA 5BSEA 1RQGA 1DHRA 3N75A 3WV5A 4ZMRA 3UK2A 3U7GA 2IOFA 1ENYA 2DWPA 2YJ4A 3KZVA 1PLJA 4QELA 4EZBA 1H2RS 3IAM1 1Z2DA 1B8UA 2QD2A 1M0SA 4P31A 5H4GA 3ENNA 4UM8B 1JWLA 1BDHA 1YB5A 1WRBA 3H6GA 4NBVA 4B6EA 2OB1A 2JFYA 2E49A 2OXTA 2HYIC 1ISFA 2B69A 3JRNA 4I3GA 1ZA2A 3WYEA 2V0CA 4NBRA 1NAHA 1M1UA 1NTOA 1FF9A 2UKDA 4N3AA 2OCKA 3GPBA 1PFKA 1A95A 4OMFG 1VJ1A 4DIFA 1A88A 3EGDA 3PDIA 1GAQA 2A1TR 4RFSB 2IDMA 3C1OA 4MUJA 3HVHA 4NYJR 3S1LA 3TNDA 2GETA 2O1XA 2M98A 3JATB 5AVVA 5JD3A 2RC5A 1KEEB 3A7DA 3BHMA 1GWNA 1ZISA 2FR8A 4I8DA 4HAOA 2OHIA 4F2PA 2IJGX 2MYUA 1F2TA 1XRNA 4KR7A 3KCNA 1VGRA 2WWGA 2IKQA 5FADA 3O84A 3KHTA 3THRA 4DMFA 1IEVA 2PUDA 2A94A 3ZV6A 3OZDA 2CLHB 1R74A 3F9RA 5BN5B 2ZCJA 2PKEA 3TSOA 3Q2KA 1HYGA 3A6PC 1GPH1 3W6OA 4CCSA 3AP2A 3OOHA 4FGWA 3FZNA 1NTRA 3ZS8A 1TQ2A 4B3XA 4IGEA 1XNQB 2HRQA 5JJ5A 2ZSEA 3W7BA 4B81A 4R1QA 2D7DA 3GDWA 1QONA 2JI7A 5ILQA 4ZCRA 5KNDA 4I4TA 1K8XB 1H69A 4IUYA 1UK6A 4JD5A 4PQEA 3PHBE 2WJPA 1C1DA 1VIYA 1K7FB 2QYTA 2ISCA 2P41A 3IDAA 4BMZA 3KBBA 3A9VA 1KERA 2ZI7A 1OLXB 3PDWA 5D01A 2FMHA 2XDYA 4QBHA 4N9WA 4OOFA 2GB4A 5FH9A 4C01A 2OCPA 4ZCIA 2EFEB 3GAAA 5JPIA 1I2CA 3VGJA 4CKEB 5C1BA 1KH2A 1JBQA 4JQCA 1CB0A 1X3LA 2BISA 3NT4A 1E32A 3P1JA 1AVTA 4LDRA 4CN8A 5G3ZA 2W98A 3ZJ4A 4AJIA 5MFZA 4Y0VA 4MDHA 1IQPA 1D5CA 1G2IA 4WERA 5TS3A 1GZ4A 4I6JA 2XCSB 1E6EA 2QMOA 1Q57A 2O48X 3I53A 4EHIA 1YS9A 4RIFA 3OQOA 3QE2A 3FGZA 3B2NA 3LFUA 4LBVA 2DHDA 4WA7A 2RAPA 7MDHA 5JATA 4B7ZA 3L77A 4GEKA 3EGIA 5IKMA 3I6IA 1YAJA 1IZYA 1ZZGA 3IAXA 3L18A 3M6VA 4M1OA 1B6GA 4L73A 3IIJA 4BY9E 4PX9A 1XUOA 4JYZA 1NU8A 1L7XA 4HN2A 1H1TA 4ZVVA 3SYTA 4CMGA 4EHHA 5JYDA 4M0PA 5K6TA 1CUJA 2CJPA 4Z5XA 5IVPA 3G02A 4UHEA 1SQGA 1XKXA 3MJCA 4MOWA 1B26A 1CZKA 2X7JA 5D7BA 3WKAA 1XTUA 2EZ8A 1SCQA 1Y6RA 1LBHA 3AI2A 3BXHA 3ESBA 1NXPA 1OZAA 3FOFC 1E0DA 2QN1A 3HJCA 3QU7A 3GA5A 1C4XA 3HJBA 3NU1A 3NGXA 3BBPA 1YRQA 3ZQ4A 5A0VA 4RDCA 1CR4A 4IRUB 1E79D 4Y2QA 3PNSA 3QQ5A 4AF7A 5FXMA 1XDGA 3EGOA 2J5KA 1TECE 3BQ9A 3U1VA 3IFSA 3UQZA 1PFYA 1C7FA 2G76A 2SKEA 4HAIA 621PA 1L3BA 3PCXA 1L5VA 4PPGA 1L5GB 2YMLA 3P9NA 5EA2A 1ZOOA 4I50B 5KNCD 1IDN1 1X38A 3ZKAA 2DT5A 1UT5A 3OTHA 4LI0A 4KDEA 4MRMA 3Q40A 4B9AA 4UOQA 4KGZA 2AL7A 3VPGA 3C8ZA 1G6Q1 1ST3A 4G5OA 4KN9S 4BHTA 1OGIA 1T9AA 3B9RA 3IODA 2YIDA 3N07A 3F98A 1NIPA 4X3OA 4LJ9A 1HG1A 2C82A 4M2LA 1JAHA 3B1JA 1SVSA 3MK31 4NBTA 5JNTA 1MVLA 3OY7A 3IT2A 3ZEIA 1YQUA 4HLNA 4L9AA 5GZ1A 2OXEA 2W6ID 1K9SA 1Y42X 3DCNA 3OOEA 5E4TA 2EGHA 1P4SA 2OFWA 4X90A 2GTIA 1PWZA 4MYTA 3Q3CA 3WBKA 1M33A 2JA1A 2ZT7A 5CFZA 4TYNA 3FA2A 4AC9A 1CEQA 3PG5A 1WSBA 2ZDGA 1XEXA 3DE6X 3GLRA 4AG6A 4EW3A 1GSHA 4FLEA 4YT8A 5JJLA 5FF9A 2R65A 3MAAC 4OXYA 3UCEA 5C46F 1KJWA 2CUZA 2Z8YA 4RW0A 3BJIC 3KKZA 4MUFA 3FSRA 3KO8A 5K9ZA 1SKMA 1SOWA 3PWSA 2VZ9A 1EQUA 1G21A 1W1IA 1BQEA 1YTLA 2GF2A 2WLSA 3AI3A 2VZ8A 4RE5A 5CT9A 4ETIA 4JCOA 2V4ZA 3QXJA 5HA5A 4ZI7F 4DNXA 3LA8A 3G0CA 5DGIA 4R9UC 4NFYA 5DM2A 3V4RA 1FU8A 2FFQA 1T1IA 4PR0A 1D2NA 4JP8A 5B1DA 1HKUA 3RIMA 2EJVA 2FAXA 1W35A 5BW5A 3DO5A 3ANMA 5CLFA 4GOLD 1OYYA 1JAXA 2B83A 4L8YA 3RVNA 2OWEA 3GPDG 2DTEA 4OHVA 4HADA 3I4CA 2PRYA 1EINA 3M5CA 4YRSA 3PGXA 1U2SA 3H4MA 4D5GA 1Z56C 3BX1A 2C4MA 1K89A 1ZO8A 2EJTA 3RO7A 4HQ0A 2MSCB 4R2IA 4BQSA 5BY2A 1FSFA 3GEDA 2X8AA 4B31A 1Z39A 2P2GA 2LZ0A 1EFHA 1GA6A 2ASVA 3Q6NA 1AKRA 1GKIA 1LUAA 4PYRA 3W78A 3V9AA 1XDDA 3NC0C 4F2WA 1KBZA 4I19A 1T5IA 4ZO6A 4WBNF 4LRYA 5FOVA 2COKA 4IDOA 4W8OA 2ZS8A 2FSVC 3FSJX 2A92A 4Q7KA 2Q8PA 3RRZA 3EARA 3MXOA 5CW1A 3U4MA 1QYVA 1KFCB 4KFTA 4MVJD 5REQA 5EERA 3R7BA 3X1DA 4CKYA 1VG9B 3DOJA 5JZBA 3OUZA 3EGVA 1F7UA 1ULTA 3F5MA 3TQHA 4DUGD 4IICA 1HDXA 3RS9A 5ECDA 5FBKA 3UWMA 4LOKA 4F8YA 3TLJA 1NJFA 5KOYA 3MMNA 4BYGA 4L8GA 1JQBA 4IMPA 1TW3A 3EK2A 3RS0A 4WVLA 4XLTA 2XTNA 2VHUA 5KTTA 5JTUA 3OAAD 5G0SA 3ZI0A 1DAGA 4INAA 3H2IA 2FOIA 4IDDA 3SE0A 3A4TA 4GUAA 4X93A 2FRDC 1ZAKA 2QP4A 4BFCA 2HNKA 2JJQA 2X2PA 1G20E 1FX1A 3PVZA 2XDQA 3E22B 1TMYA 1X8KA 3WIUA 2IXTA 4GKJB 2IY8A 1CUVA 2R00C 3JAMA 2ZSDA 5BMOA 5KNBD 3V2GA 3M6FA 5EMKA 3PFCA 2NU6B 3FOZA 3X2EA 3LY7A 1AMOA 2PWPA 1DUSA 3OJEA 1WZCA 3HA7A 3R0IA 4KPUA 1N0HA 3HUUA 3NTLA 2R44A 1FTSA 5KYVA 4A2WA 2X2EA 4W1PA 3VNRA 2PGLA 4RMHA 5HIJA 3MSCA 4DVGA 4DTCA 2PL5A 1D0IA 1DBWA 4QVKA 4XEHA 1O94D 4JI2B 3OQ1A 4YYEA 2BWJA 3FSEA 4BZPA 3C0KA 2AQHA 3AIOA 3M5WA 1TNDA 4Q66C 3WL6A 5KPDA 1EVZA 3ORHA 3EEQA 5LLSA 1KI2A 1LDBA 2GYVA 2ZYHA 3K4HA 1T36A 4TTRA 4JQOA 2MINB 1CIVA 1M1YA 3EVTA 1D07A 4PTZA 3PR1A 1I1HA 2GN8A 4KN8A 4O5OA 4DYHA 4YUAA 4QIHA 5AJVB 2V5VA 1H66A 1P0PA 5F5NA 3TLMA 3CNHA 3W1EA 2Z6VA 3EXHC 3SQOA 4BRZA 2XOKD 4MVJG 4KH1A 4NL4H 5E6RA 4H7PA 2B7BA 4B2IA 1TUIA 2J9FB 4MZDA 4C5BA 4IXWA 3E2MA 1CR1A 1K8RA 5H9WA 1Y1TA 4HDMA 3K5IA 2NXCA 2M32A 3KAKA 4WL0A 3CMMA 1Y6GA 2Q41A 3ZWCA 4U02A 3SHFA 3DE0X 3K30A 2CNNA 1MUUA 1T9GR 3ONVA 1Q6ZA 1SUPA 1KXJA 2QX8A 4FFBA 4HQLA 2P1ZA 2OILA 1Z5WA 4O4LF 3A1EA 1TIKA 1EGHA 3BWVA 4GBJA 2H59A 2BLLA 2OZVA 2FFBA 2YIVX 3I01A 3P2EA 3ZNNA 2H8GA 3H9GA 1TUEA 2ZQYA 4KSCA 1OAOC 4XR9A 3PX2A 3Q2IA 4B0PA 3K0FB 1E3WA 1XPJA 1Z9BA 1MQ9A 1N6IA 4X1KA 2YY7A 4MSUA 4WJLA 1W0CA 2P79A 4JLJA 1H3NA 1XLTA 4UAGA 2OB2A 1U94A 3DMNA 1UBRS 4L9WA 5DHQA 5AUPB 1E1DA 3TW0A 3PL1A 5H81A 5JAOA 1UFVA 2V1XA 3N2LA 1Q0UA 4LSMA 1OWLA 2H4JA 2VDWB 2YJ6A 2O3UA 3CY6A 3SOZA 3OF3A 3TAXA 2IH4A 3WDSA 1SUAA 4P6VF 2I7DA 3I4LA 2MSKA 4POOA 4ER5A 1RXVA 1SOAA 2N46A 1G4UR 4GZ3A 3LHDA 1DRWA 5HJ7A 1J0DA 3GLHA 3OCYA 1BCSA 1HDZA 1T4BA 3JW8A 2APJA 3CUTA 3TTSA 1MG0A 1YZLA 2IEDA 1LPMA 5COBA 1UZAA 1IN4A 2Z5VA 3HCDA 2R79A 2UAGA 5KNDD 4X66B 1KKUA 4FOOA 4RELA 4MICA 5BV0A 3IE2A 3G9QA 1OI3A 4OSEA 3ZDBA 4MROA 1B3BA 2X7HA 2XD4A 4DKXA 2XB4A 1RC1A 3MT9A 4KLNA 2IHTA 1T3TA 2YXPX 4GXTA 2D4AA 5FQNA 3VH3A 1FS4A 4ISCA 4NFSA 1L1RA 3L0DA 1K06A 1WHTA 3HCOA 3NIFB 4HY3A 1GQFA 2HJRA 3D81A 3GU3A 3QE0A 1Y3CE 2WIGA 5JJKA 4YR9A 3B89A 3SBEA 1QVZA 3ZS9A 1PKEA 4YDQA 5A9TA 1PQWA 2JI6A 3RK4A 5CG1A 1N9GA 1Y9DA 3T61A 2CMDA 3EYAA 2HLDA 3HO6A 3QVOA 4R01A 2VOJA 2CCJA 1DBPA 1THTA 4TRNA 4Z9AA 2F64A 5FWAA 4G1BA 4DHEA 4C6TB 4YRKA 5F98A 1E60A 1GGVA 3W05A 1DLIA 1MA0A 2YH2A 3EOAI 3NOVA 3SEAA 4QBGB 8LDHA 5GV7A 3QVLA 4ND1A 2CVFA 2ZVDA 2JASA 4PZ0A 3WP0A 1EFPB 3GZNA 4C7MA 5LWQA 1SQFA 4NICA 1ADFA 2R6ZA 1BGVA 4A0FA 4ALMA 5ADVA 3TKLA 4MJ3A 3KVRA 1ZVMA 2X8BA 5LMNB 1HG0A 1P60A 3WTCA 1MEJA 1R00A 3HMQA 3I1YA 3K0EA 3NTRA 4PSVA 2XRMA 4RU1A 4K05A 4E03A 6REQA 4YRAA 1SG6A 5IEJA 5JS6A 2Q7XA 3CZ5A 3NWPA 3UOAB 1R10A 1YOVA 2FWPA 3TZCA 4BRUA 1QIDA 1GTRA 2AW3A 4BQNA 3AILA 5CFLA 2FN9A 4CMEC 1L8QA 1RXSA 3SJCA 3PXUA 4NEQA 4OP1A 2BZ0A 2QL7A 4JMLA 2WHEA 4FFMA 2PQMA 3LGSA 3QPDA 3W1VA 1PZEA 1DQZA 3FTCA 4ZQEA 5EHGA 1M1ZA 2ZKIA 2B1GA 3GXOA 2ZJ5A 4BB9A 2YZ7A 4IX1A 3QKRA 3ZI7A 5JZ9A 1NNLA 1Y7PA 3DPSA 3GWZA 2VYCA 3LKZA 4AU1A 5HKBA 4YBZA 1RYNA 1UXHA 4NLLA 1ENPA 1NW7A 3Q1LA 4WESB 1PNRA 4C7VA 3GLFB 5CLQA 1SXQA 2CV1A 1H3FA 3NASA 4IHJF 3R09A 1O5TA 1L7QA 1BQ3A 1Y98A 3Q12A 5ICSA 5D3MB 1XPRA 3K6RA 3D0OA 4JOCA 2IYNA 4JJKA 4MUEA 2YASA 3ZDCA 1Z2AA 3V1UA 3UT5B 4ERNA 5LLDA 1DWPA 4YRQA 3RANA 1T0JB 3A4YA 4XUCA 1OI2A 3NPAA 1SKBA 1C3XA 3IELA 4HYQA 3UENA 1AJEA 1ACMA 4LWOA 6Q21A 5D86A 3GAMA 4FE3A 3E23A 3HACA 3M1YA 4LX0A 4UEJA 1RRGA 5KUTA 1N7HA 2QMQA 1PFWA 1RVDA 1UBCA 3FLEA 4V1CA 1E7YA 3WLRA 4FHZA 4YRDA 3VUEA 5EN4A 4LCJA 2VXOA 1I33A 2JLRA 5AK3A 5FB3A 5LC1A 1WPXA 1KEVA 1Q6YA 4HUQB 3GLUA 5IAKA 5LXTB 1A7KA 4CVNA 1T24A 1XAGA 2ZXFA 1DCMA 4KE9A 4MEBA 2H0AA 4PXYA 4X5OA 1UINA 5E2AA 3HB7A 3TZQA 4LQCA 1QC5A 4CFZA 2FSPA 3P45A 3ZX5A 1Z6QA 4MUIA 5KKAA 3RC3A 4YUWA 3NUZA 1NRJB 1DB3A 1EXNA 1J0AA 3L7CA 1SY7A 1WF6A 4AP9A 1NNEA 4WWHA 1QLJA 1ORTA 4YCCA 1FTYA 1NXWA 2V8BA 3QTTA 5H0IA 4HI0E 3R23A 2QN8A 3JQ8A 3LWNA 3DAHA 4S0XA 5LKAA 4CM4A 2M6SA 3EHEA 1UAYA 1H2WA 3V55A 3OFKA 1SB9A 1BDJA 1BKYA 1K68A 1RHQA 3M6AA 3P9XA 4UHCA 4MW4A 1O9HA 1GA4A 3BXFA 3GGSA 1ODKA 4TROA 5CR9A 5MN6A 3H8VA 3UJCA 2WPNA 3DD1A 4BZZA 3TEJA 4LYEA 1ZN2A 5ALXA 1QGED 2VQSA 3RRBA 5JSQA 2HQRA 4L75A 5DLQC 4ZDKA 1D2MA 1P4JA 4XGIA 1H2BA 2HBQA 2V7PA 3OJ0A 4KVGA 1KI9A 3MTGA 3RS5A 1EJ6A 4INPA 2O2EA 1JA0A 2WRZA 1NRIA 1QB8A 5EWLB 2J9RA 2VSYA 4PC3A 1KR2A 1VLMA 2ZTUA 3LY9A 4G1FA 3RC2A 1TUGA 1U2RA 3RSCA 3S2ZA 3UXMA 1XKQA 2D13A 3I2YX 1GFIA 1K5HA 1JBKA 3R0QA 3ADPA 3MGAA 4UNSA 2WYWA 4IUBS 1YBFA 1ZY2A 4QQKA 4XDGA 2C4TA 3UH1A 4B17A 3VKGA 1BWPA 1QIJA 5EP4A 5TT0A 4CLEA 1U0RA 5FOQA 3FUUA 3THYA 1CY1A 4QNNA 3G8YA 3DBIA 4N40A 3A4IA 3JQ9A 4JELA 4KEAA 3Q11A 1D6SA 4IR7A 1T0HB 4R3WA 1ES9A 3BH7A 2Q27A 2Z6AA 4YDHB 3SR0A 3NC4A 3QFFA 4BCCA 2XVXA 2BSXA 3RKSA 1ORWA 3DZJA 2ECOA 3FFTA 3NOXA 4R2KA 1MTZA 1N6KA 1TJNA 4CV1A 3DDSA 3GRVA 4KDCA 4YJGA 1SQ6A 1B2RA 3BGOS 3OF5A 5CD1A 2WMNB 4FEAA 2ZKLA 1U5AA 3K9QO 3AUAA 4Q4HA 2Y1OA 2D1QA 4X7RA 1OGJA 4DN6A 3PF9A 2PUGA 3TQRA 2W8ZA 1R0YA 4ZU1X 4LV8B 2ZRMA 3HWRA 2Q62A 2HTEA 3GEMA 3LUFA 5HS6A 5A7HA 4YRIA 1KFKB 4NS1A 2AN3A 3V7NA 4LIPD 2AG1A 1K4YA 3IOCA 3GH1A 2XMGA 3GA0A 3FM9A 2HBYA 3QTBA 1NE2A 1OMOA 1RS0A 4TKUA 3O1JC 1IHDA 2G83A 3H13A 4H4DA 4PZUA 1RLUA 4TTVA 1P45A 2ISSD 4DWVA 5CB4B 2YMMA 4YREA 5JPDA 3TIIA 4BMDA 4MV3A 3KKMA 4Y1RA 4K6CA 4RDHA 1N33B 4YJ2B 4DLPA 4D0GA 5KX5B 2V58A 3P32A 1GLNA 2C8KA 1UEJA 1WTCA 1NMYA 3DHNA 3FRJA 3ZHZA 1SVKA 3ESZA 4WRRA 4N6NA 1P80A 1P0MA 3CIFA 1U7PA 1K4MA 3O4RA 4BP8A 1D4FA 1I4DD 1VIMA 1ZW1A 3CSDA 2G67A 3MM4A 5A3RA 5AW3A 3O21A 3AHCA 2N3ZA 5EEHA 3M82A 3B48A 1EUDB 4KQEA 3SIWA 5KX5A 3F47A 2A35A 3H1GA 3LKBA 1XVIA 1OLUA 5EZ5A 5P8WA 1PNTA 1DLJA 2FB9A 2H2FA 2IIQA 2QS9A 3L1KA 4GP7A 1KO7A 1KP2A 4YT4A 1VLQA 8GPBA 4GRAA 5ELMA 3STUA 4FCWA 3SM3A 3HKBA 5KQMA 3T9CA 3A6LA 3ILSA 3DOHA 4G65A 4OQQA 5BMVB 3R4VA 2XCLA 5DCWA 1WBDA 5FUQA 4C4OA 4NCAA 1DINA 4BKQA 3ZDAA 4UBMA 5G4KB 5KPJA 5KWIA 1G8PA 1L4BA 3M70A 1BTOA 2WDPA 2C0PA 4OOEA 4ZQHA 5HFNA 1KI3A 1GU7A 4IIFA 2ORED 4OHKA 1A72A 3T1YB 4FHDA 4ZVMA 4M0LA 4YLEA 4ER0A 1NKSA 3EPPA 3ONFA 2DB3A 4IHJA 2NXNA 4U39A 2CZCA 4OB8A 4LSGA 3NHJA 1KEPA 3DZDA 1NYQA 3TL2A 3ADDA 3FWZA 2NU8A 3F0TA 2AZDA 2GPAA 5IWAB 1J20A 1C41A 2ID7A 2J3KA 1KS2A 1PLKA 4GOXA 4TQGA 2JLUA 3IPRA 2ZUUA 3Q0TA 5D5PA 5EPEA 3G6WA 4UEOA 3TGWA 2DULA 2GCPA 3OX1A 1G8YA 3F1LA 4Y6GB 5BVGA 3BGIA 5EYPA 5ITWA 1QFXA 1T6BY 2WJYA 1YT5A 3CZAA 5CX1B 4NZZA 4W99A 1LVGA 1XTJA 2GESA 2GK7A 2QW0X 3AEQA 3EZ6A 3GFTA 4GE0A 4G6ZA 3BBLA 4R9VA 4F9GA 5DN9A 5AHOA 2LKDA 1JHYA 4UTOA 2A2ZA 2HDNB 4BC0A 2A86A 2BM0A 2GEKA 4NE9A 1RFGE 4MGEA 1DAIA 5I4IA 4LJ4A 3OCJA 3T99A 2FPUA 2HZBA 4WPGA 1DKNA 4EYSA 1UCFA 1BXRA 2JCSA 2EQAA 2J9XB 4JL5A 1U63A 2D2FA 3WGOA 1TO2E 3GNTA 1A8QA 2HEGA 5TF0A 4H6WA 5JLAA 4BC1A 3SYLA 2FWAA 1XIVA 2F3RA 4HTFB 2Z43A 1XRPA 3C6BA 3C5VA 1BHJA 5DHFA 2BJVA 2O19A 4QOFA 1FB5A 4AN4A 4JI1B 4XTRA 2HDWA 5KIAA 1JHDA 2H7VA 4DMRA 2YWBA 1MTOA 4JLWA 1V96A