4YNMA

Ash1l wild-type set domain in complex with s-adenosyl methionine (sam)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
215
Chain Sequence
AGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ASH1L
total genus 49
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ynmA00
3RAYA 1ML9A 3OPEA 3VUZA 5CPRB 2R3AA 4J7FA 2RFIA 3M57A 4QEPA 5T0MA 2O8JA 1MVHA 4IJDA 1N6AA 3M58A 4NJ5A 3S8PA 4H12A 5CCLA 3K5KA 3RQ4A 3SW9A 4QEOA 3OXFA 5KJKA 5TTFA 3TG4A 5F6LA 3F9WA 4LDGA 4IJ8A 3OXLA 3M5AA 4YNMA 3RJWA 3TG5A 3MO0A 3QWVA 3M55A 3MO5A 5JHNA 1ZKKA 3OS5A 3KMTA 2BQZA 1MUFA 1N6CA 3M54A 3MO2A 3RIBA 3F9YA 3PDNA 5KJLA 3SWCA 5JINA 1MVXA 3QWWA 4I51A 4YNPA 2W5ZA 3BO5A 1MT6A 4FMUA 4WUYA 4YPUA 5EX3A 3DALA 3FPDA 2JV0A 3QWPA 4RZ0A 5HQ8A 3CBPA 5EG2A 3EP0A 5EX0A 2W5YA 4YPAA 2QPWA 3F9ZA 4JLGA 4MI0A 3KMAA 4BUPA 3KMJA 3OOIA 3CBMA 5T5GA 2F69A 4O30A 5F5EA 5ARGA 3S7DA 3F9XA 3IHXA 1O9SA 5F6KC 5JIYA 5KJMA 4J7IA 1XQHA 3VV0A 4YPEA 4NVQA 4QENA 3N71A 3RU0A 5AYFA 5TEGA 5ARFA 4J8OA 1N3JA 5F59A 4JDSA 4C1QA 5JJ0A 2IGQA 4YNDA 2G46A 3HNAA 5LSZA 4O6FA 3M59A 3MEKA 3M53A 4MI5A 5HI7A 5T0KA 3S7BA 5CCMA 3M56A 3S7FA 4AU7A 1PEGA 4Z4PA 3CBOA 4J83A 3S7JA 1H3IA 5TH7A 5LSXA 4E47A 5KJNA 3OXGA 3DB5A
chains in the Genus database with same CATH superfamily
3RAYA 1ML9A 3OPEA 3VUZA 5CPRB 2R3AA 4J7FA 2RFIA 3M57A 4QEPA 5T0MA 2O8JA 1MVHA 4IJDA 1N6AA 3M58A 4NJ5A 3S8PA 4H12A 5CCLA 3K5KA 3RQ4A 3SW9A 4QEOA 3OXFA 5KJKA 5TTFA 3TG4A 5F6LA 3F9WA 4LDGA 4IJ8A 3OXLA 3M5AA 4YNMA 3RJWA 3TG5A 3MO0A 3QWVA 3M55A 3MO5A 5JHNA 1ZKKA 3OS5A 3KMTA 2BQZA 1MUFA 1N6CA 3M54A 3MO2A 3RIBA 3F9YA 3PDNA 5KJLA 3SWCA 5JINA 1MVXA 3QWWA 4I51A 4YNPA 2W5ZA 3BO5A 1MT6A 4FMUA 4WUYA 4YPUA 5EX3A 3DALA 3FPDA 2JV0A 3QWPA 4RZ0A 5HQ8A 3CBPA 5EG2A 3EP0A 5EX0A 2W5YA 4YPAA 2QPWA 3F9ZA 4JLGA 4MI0A 3KMAA 4BUPA 3KMJA 3OOIA 3CBMA 5T5GA 2F69A 4O30A 5F5EA 5ARGA 3S7DA 3F9XA 3IHXA 1O9SA 5F6KC 5JIYA 5KJMA 4J7IA 1XQHA 3VV0A 4YPEA 4NVQA 4QENA 3N71A 3RU0A 5AYFA 5TEGA 5ARFA 4J8OA 1N3JA 5F59A 4JDSA 4C1QA 5JJ0A 2IGQA 4YNDA 2G46A 3HNAA 5LSZA 4O6FA 3M59A 3MEKA 3M53A 4MI5A 5HI7A 5T0KA 3S7BA 5CCMA 3M56A 3S7FA 4AU7A 1PEGA 4Z4PA 3CBOA 4J83A 3S7JA 1H3IA 5TH7A 5LSXA 4E47A 5KJNA 3OXGA 3DB5A
chains in the Genus database with same CATH topology
3RAYA 1ML9A 3OPEA 3VUZA 5CPRB 2R3AA 4J7FA 2RFIA 3M57A 4QEPA 5T0MA 2O8JA 1MVHA 4IJDA 1N6AA 3M58A 4NJ5A 3S8PA 4H12A 5CCLA 3K5KA 3RQ4A 3SW9A 4QEOA 3OXFA 5KJKA 5TTFA 3TG4A 5F6LA 3F9WA 4LDGA 4IJ8A 3OXLA 3M5AA 4YNMA 3RJWA 3TG5A 3MO0A 3QWVA 3M55A 3MO5A 5JHNA 1ZKKA 3OS5A 3KMTA 2BQZA 1MUFA 1N6CA 3M54A 3MO2A 3RIBA 3F9YA 3PDNA 5KJLA 3SWCA 5JINA 1MVXA 3QWWA 4I51A 4YNPA 2W5ZA 3BO5A 1MT6A 4FMUA 4WUYA 4YPUA 5EX3A 3DALA 3FPDA 2JV0A 3QWPA 4RZ0A 5HQ8A 3CBPA 5EG2A 3EP0A 5EX0A 2W5YA 4YPAA 2QPWA 3F9ZA 4JLGA 4MI0A 3KMAA 4BUPA 3KMJA 3OOIA 3CBMA 5T5GA 2F69A 4O30A 5F5EA 5ARGA 3S7DA 3F9XA 3IHXA 1O9SA 5F6KC 5JIYA 5KJMA 4J7IA 1XQHA 3VV0A 4YPEA 4NVQA 4QENA 3N71A 3RU0A 5AYFA 5TEGA 5ARFA 4J8OA 1N3JA 5F59A 4JDSA 4C1QA 5JJ0A 2IGQA 4YNDA 2G46A 3HNAA 5LSZA 4O6FA 3M59A 3MEKA 3M53A 4MI5A 5HI7A 5T0KA 3S7BA 5CCMA 3M56A 3S7FA 4AU7A 1PEGA 4Z4PA 3CBOA 4J83A 3S7JA 1H3IA 5TH7A 5LSXA 4E47A 5KJNA 3OXGA 3DB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RAY A;  1ML9 A;  3OPE A;  3VUZ A;  5CPR B;  2R3A A;  4J7F A;  2RFI A;  3M57 A;  4QEP A;  5T0M A;  2O8J A;  1MVH A;  4IJD A;  1N6A A;  3M58 A;  4NJ5 A;  3S8P A;  4H12 A;  5CCL A;  3K5K A;  3RQ4 A;  3SW9 A;  4QEO A;  3OXF A;  5KJK A;  5TTF A;  3TG4 A;  5F6L A;  3F9W A;  4LDG A;  4IJ8 A;  3OXL A;  3M5A A;  4YNM A;  3RJW A;  3TG5 A;  3MO0 A;  3QWV A;  3M55 A;  3MO5 A;  5JHN A;  1ZKK A;  3OS5 A;  3KMT A;  2BQZ A;  1MUF A;  1N6C A;  3M54 A;  3MO2 A;  3RIB A;  3F9Y A;  3PDN A;  5KJL A;  3SWC A;  5JIN A;  1MVX A;  3QWW A;  4I51 A;  4YNP A;  2W5Z A;  3BO5 A;  1MT6 A;  4FMU A;  4WUY A;  4YPU A;  5EX3 A;  3DAL A;  3FPD A;  2JV0 A;  3QWP A;  4RZ0 A;  5HQ8 A;  3CBP A;  5EG2 A;  3EP0 A;  5EX0 A;  2W5Y A;  4YPA A;  2QPW A;  3F9Z A;  4JLG A;  4MI0 A;  3KMA A;  4BUP A;  3KMJ A;  3OOI A;  3CBM A;  5T5G A;  2F69 A;  4O30 A;  5F5E A;  5ARG A;  3S7D A;  3F9X A;  3IHX A;  1O9S A;  5F6K C;  5JIY A;  5KJM A;  4J7I A;  1XQH A;  3VV0 A;  4YPE A;  4NVQ A;  4QEN A;  3N71 A;  3RU0 A;  5AYF A;  5TEG A;  5ARF A;  4J8O A;  1N3J A;  5F59 A;  4JDS A;  4C1Q A;  5JJ0 A;  2IGQ A;  4YND A;  2G46 A;  3HNA A;  5LSZ A;  4O6F A;  3M59 A;  3MEK A;  3M53 A;  4MI5 A;  5HI7 A;  5T0K A;  3S7B A;  5CCM A;  3M56 A;  3S7F A;  4AU7 A;  1PEG A;  4Z4P A;  3CBO A;  4J83 A;  3S7J A;  1H3I A;  5TH7 A;  5LSX A;  4E47 A;  5KJN A;  3OXG A;  3DB5 A; 
#chains in the Genus database with same CATH topology
 3RAY A;  1ML9 A;  3OPE A;  3VUZ A;  5CPR B;  2R3A A;  4J7F A;  2RFI A;  3M57 A;  4QEP A;  5T0M A;  2O8J A;  1MVH A;  4IJD A;  1N6A A;  3M58 A;  4NJ5 A;  3S8P A;  4H12 A;  5CCL A;  3K5K A;  3RQ4 A;  3SW9 A;  4QEO A;  3OXF A;  5KJK A;  5TTF A;  3TG4 A;  5F6L A;  3F9W A;  4LDG A;  4IJ8 A;  3OXL A;  3M5A A;  4YNM A;  3RJW A;  3TG5 A;  3MO0 A;  3QWV A;  3M55 A;  3MO5 A;  5JHN A;  1ZKK A;  3OS5 A;  3KMT A;  2BQZ A;  1MUF A;  1N6C A;  3M54 A;  3MO2 A;  3RIB A;  3F9Y A;  3PDN A;  5KJL A;  3SWC A;  5JIN A;  1MVX A;  3QWW A;  4I51 A;  4YNP A;  2W5Z A;  3BO5 A;  1MT6 A;  4FMU A;  4WUY A;  4YPU A;  5EX3 A;  3DAL A;  3FPD A;  2JV0 A;  3QWP A;  4RZ0 A;  5HQ8 A;  3CBP A;  5EG2 A;  3EP0 A;  5EX0 A;  2W5Y A;  4YPA A;  2QPW A;  3F9Z A;  4JLG A;  4MI0 A;  3KMA A;  4BUP A;  3KMJ A;  3OOI A;  3CBM A;  5T5G A;  2F69 A;  4O30 A;  5F5E A;  5ARG A;  3S7D A;  3F9X A;  3IHX A;  1O9S A;  5F6K C;  5JIY A;  5KJM A;  4J7I A;  1XQH A;  3VV0 A;  4YPE A;  4NVQ A;  4QEN A;  3N71 A;  3RU0 A;  5AYF A;  5TEG A;  5ARF A;  4J8O A;  1N3J A;  5F59 A;  4JDS A;  4C1Q A;  5JJ0 A;  2IGQ A;  4YND A;  2G46 A;  3HNA A;  5LSZ A;  4O6F A;  3M59 A;  3MEK A;  3M53 A;  4MI5 A;  5HI7 A;  5T0K A;  3S7B A;  5CCM A;  3M56 A;  3S7F A;  4AU7 A;  1PEG A;  4Z4P A;  3CBO A;  4J83 A;  3S7J A;  1H3I A;  5TH7 A;  5LSX A;  4E47 A;  5KJN A;  3OXG A;  3DB5 A; 
#chains in the Genus database with same CATH homology
 3RAY A;  1ML9 A;  3OPE A;  3VUZ A;  5CPR B;  2R3A A;  4J7F A;  2RFI A;  3M57 A;  4QEP A;  5T0M A;  2O8J A;  1MVH A;  4IJD A;  1N6A A;  3M58 A;  4NJ5 A;  3S8P A;  4H12 A;  5CCL A;  3K5K A;  3RQ4 A;  3SW9 A;  4QEO A;  3OXF A;  5KJK A;  5TTF A;  3TG4 A;  5F6L A;  3F9W A;  4LDG A;  4IJ8 A;  3OXL A;  3M5A A;  4YNM A;  3RJW A;  3TG5 A;  3MO0 A;  3QWV A;  3M55 A;  3MO5 A;  5JHN A;  1ZKK A;  3OS5 A;  3KMT A;  2BQZ A;  1MUF A;  1N6C A;  3M54 A;  3MO2 A;  3RIB A;  3F9Y A;  3PDN A;  5KJL A;  3SWC A;  5JIN A;  1MVX A;  3QWW A;  4I51 A;  4YNP A;  2W5Z A;  3BO5 A;  1MT6 A;  4FMU A;  4WUY A;  4YPU A;  5EX3 A;  3DAL A;  3FPD A;  2JV0 A;  3QWP A;  4RZ0 A;  5HQ8 A;  3CBP A;  5EG2 A;  3EP0 A;  5EX0 A;  2W5Y A;  4YPA A;  2QPW A;  3F9Z A;  4JLG A;  4MI0 A;  3KMA A;  4BUP A;  3KMJ A;  3OOI A;  3CBM A;  5T5G A;  2F69 A;  4O30 A;  5F5E A;  5ARG A;  3S7D A;  3F9X A;  3IHX A;  1O9S A;  5F6K C;  5JIY A;  5KJM A;  4J7I A;  1XQH A;  3VV0 A;  4YPE A;  4NVQ A;  4QEN A;  3N71 A;  3RU0 A;  5AYF A;  5TEG A;  5ARF A;  4J8O A;  1N3J A;  5F59 A;  4JDS A;  4C1Q A;  5JJ0 A;  2IGQ A;  4YND A;  2G46 A;  3HNA A;  5LSZ A;  4O6F A;  3M59 A;  3MEK A;  3M53 A;  4MI5 A;  5HI7 A;  5T0K A;  3S7B A;  5CCM A;  3M56 A;  3S7F A;  4AU7 A;  1PEG A;  4Z4P A;  3CBO A;  4J83 A;  3S7J A;  1H3I A;  5TH7 A;  5LSX A;  4E47 A;  5KJN A;  3OXG A;  3DB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...