4YNMA

Ash1l wild-type set domain in complex with s-adenosyl methionine (sam)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
215
Chain Sequence
b'AGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Histone-lysine N-methyltransferase ASH1L
molecule tags Transferase
source organism Homo sapiens
publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
total genus 49
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ynmA00
3BO5A 1MVXA 3N71A 4NJ5A 3IHXA 3KMTA 4IJDA 3QWPA 5F5EA 5T5GA 1PEGA 3QWVA 3EP0A 3PDNA 3SW9A 2W5ZA 5EG2A 3CBPA 3RAYA 3MO5A 5KJNA 4J7IA 1MUFA 3S7JA 3S8PA 3CBOA 1O9SA 3F9YA 4NVQA 3SWCA 4C1QA 3OXFA 3MO0A 3OXLA 5F6KC 1MT6A 4JLGA 4MI0A 4YNDA 2QPWA 3QWWA 3F9WA 3CBMA 3RU0A 2W5YA 5JHNA 4H12A 3S7BA 4Z4PA 3DB5A 5KJLA 5AYFA 5JIYA 2G46A 3OOIA 5CCMA 5EX3A 5LSXA 4J8OA 1MVHA 5KJKA 4BUPA 2IGQA 2BQZA 3RIBA 3OS5A 3S7DA 4YNPA 2JV0A 2O8JA 2R3AA 4I51A 5ARGA 1N6AA 1ML9A 4YNMA 4IJ8A 4MI5A 3S7FA 5CPRB 3M5AA 5HI7A 1ZKKA 4J83A 4O6FA 1XQHA 3KMAA 3VUZA 4O30A 4LDGA 3M57A 5KJMA 3M58A 4QEPA 3M54A 1N3JA 4RZ0A 3OXGA 4QENA 5TH7A 5F59A 3F9ZA 4WUYA 3MO2A 5JJ0A 3RQ4A 3MEKA 5JINA 5EX0A 3TG5A 4FMUA 3DALA 3VV0A 3M59A 3RJWA 5T0KA 3OPEA 5F6LA 4YPEA 3F9XA 5ARFA 4AU7A 4QEOA 5TTFA 5TEGA 3M55A 1H3IA 3TG4A 4JDSA 5CCLA 3K5KA 5LSZA 4YPUA 5T0MA 5HQ8A 3M53A 3KMJA 3HNAA 4E47A 1N6CA 2RFIA 2F69A 4J7FA 3FPDA 3M56A 4YPAA
chains in the Genus database with same CATH superfamily
3BO5A 1MVXA 3N71A 4NJ5A 3IHXA 3KMTA 4IJDA 3QWPA 5F5EA 5T5GA 1PEGA 3QWVA 3EP0A 3PDNA 3SW9A 2W5ZA 5EG2A 3CBPA 3RAYA 3MO5A 5KJNA 4J7IA 1MUFA 3S7JA 3S8PA 3CBOA 1O9SA 3F9YA 4NVQA 3SWCA 4C1QA 3OXFA 3MO0A 3OXLA 5F6KC 1MT6A 4JLGA 4MI0A 4YNDA 2QPWA 3QWWA 3F9WA 3CBMA 3RU0A 2W5YA 5JHNA 4H12A 3S7BA 4Z4PA 3DB5A 5KJLA 5AYFA 5JIYA 2G46A 3OOIA 5CCMA 5EX3A 5LSXA 4J8OA 1MVHA 5KJKA 4BUPA 2IGQA 2BQZA 3RIBA 3OS5A 3S7DA 4YNPA 2JV0A 2O8JA 2R3AA 4I51A 5ARGA 1N6AA 1ML9A 4YNMA 4IJ8A 4MI5A 3S7FA 5CPRB 3M5AA 5HI7A 1ZKKA 4J83A 4O6FA 1XQHA 3KMAA 3VUZA 4O30A 4LDGA 3M57A 5KJMA 3M58A 4QEPA 3M54A 1N3JA 4RZ0A 3OXGA 4QENA 5TH7A 5F59A 3F9ZA 4WUYA 3MO2A 5JJ0A 3RQ4A 3MEKA 5JINA 5EX0A 3TG5A 4FMUA 3DALA 3VV0A 3M59A 3RJWA 5T0KA 3OPEA 5F6LA 4YPEA 3F9XA 5ARFA 4AU7A 4QEOA 5TTFA 5TEGA 3M55A 1H3IA 3TG4A 4JDSA 5CCLA 3K5KA 5LSZA 4YPUA 5T0MA 5HQ8A 3M53A 3KMJA 3HNAA 4E47A 1N6CA 2RFIA 2F69A 4J7FA 3FPDA 3M56A 4YPAA
chains in the Genus database with same CATH topology
3BO5A 1MVXA 3N71A 4NJ5A 3IHXA 3KMTA 4IJDA 3QWPA 5F5EA 5T5GA 1PEGA 3QWVA 3EP0A 3PDNA 3SW9A 2W5ZA 5EG2A 3CBPA 3RAYA 3MO5A 5KJNA 4J7IA 1MUFA 3S7JA 3S8PA 3CBOA 1O9SA 3F9YA 4NVQA 3SWCA 4C1QA 3OXFA 3MO0A 3OXLA 5F6KC 1MT6A 4JLGA 4MI0A 4YNDA 2QPWA 3QWWA 3F9WA 3CBMA 3RU0A 2W5YA 5JHNA 4H12A 3S7BA 4Z4PA 3DB5A 5KJLA 5AYFA 5JIYA 2G46A 3OOIA 5CCMA 5EX3A 5LSXA 4J8OA 1MVHA 5KJKA 4BUPA 2IGQA 2BQZA 3RIBA 3OS5A 3S7DA 4YNPA 2JV0A 2O8JA 2R3AA 4I51A 5ARGA 1N6AA 1ML9A 4YNMA 4IJ8A 4MI5A 3S7FA 5CPRB 3M5AA 5HI7A 1ZKKA 4J83A 4O6FA 1XQHA 3KMAA 3VUZA 4O30A 4LDGA 3M57A 5KJMA 3M58A 4QEPA 3M54A 1N3JA 4RZ0A 3OXGA 4QENA 5TH7A 5F59A 3F9ZA 4WUYA 3MO2A 5JJ0A 3RQ4A 3MEKA 5JINA 5EX0A 3TG5A 4FMUA 3DALA 3VV0A 3M59A 3RJWA 5T0KA 3OPEA 5F6LA 4YPEA 3F9XA 5ARFA 4AU7A 4QEOA 5TTFA 5TEGA 3M55A 1H3IA 3TG4A 4JDSA 5CCLA 3K5KA 5LSZA 4YPUA 5T0MA 5HQ8A 3M53A 3KMJA 3HNAA 4E47A 1N6CA 2RFIA 2F69A 4J7FA 3FPDA 3M56A 4YPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3BO5 A;  1MVX A;  3N71 A;  4NJ5 A;  3IHX A;  3KMT A;  4IJD A;  3QWP A;  5F5E A;  5T5G A;  1PEG A;  3QWV A;  3EP0 A;  3PDN A;  3SW9 A;  2W5Z A;  5EG2 A;  3CBP A;  3RAY A;  3MO5 A;  5KJN A;  4J7I A;  1MUF A;  3S7J A;  3S8P A;  3CBO A;  1O9S A;  3F9Y A;  4NVQ A;  3SWC A;  4C1Q A;  3OXF A;  3MO0 A;  3OXL A;  5F6K C;  1MT6 A;  4JLG A;  4MI0 A;  4YND A;  2QPW A;  3QWW A;  3F9W A;  3CBM A;  3RU0 A;  2W5Y A;  5JHN A;  4H12 A;  3S7B A;  4Z4P A;  3DB5 A;  5KJL A;  5AYF A;  5JIY A;  2G46 A;  3OOI A;  5CCM A;  5EX3 A;  5LSX A;  4J8O A;  1MVH A;  5KJK A;  4BUP A;  2IGQ A;  2BQZ A;  3RIB A;  3OS5 A;  3S7D A;  4YNP A;  2JV0 A;  2O8J A;  2R3A A;  4I51 A;  5ARG A;  1N6A A;  1ML9 A;  4YNM A;  4IJ8 A;  4MI5 A;  3S7F A;  5CPR B;  3M5A A;  5HI7 A;  1ZKK A;  4J83 A;  4O6F A;  1XQH A;  3KMA A;  3VUZ A;  4O30 A;  4LDG A;  3M57 A;  5KJM A;  3M58 A;  4QEP A;  3M54 A;  1N3J A;  4RZ0 A;  3OXG A;  4QEN A;  5TH7 A;  5F59 A;  3F9Z A;  4WUY A;  3MO2 A;  5JJ0 A;  3RQ4 A;  3MEK A;  5JIN A;  5EX0 A;  3TG5 A;  4FMU A;  3DAL A;  3VV0 A;  3M59 A;  3RJW A;  5T0K A;  3OPE A;  5F6L A;  4YPE A;  3F9X A;  5ARF A;  4AU7 A;  4QEO A;  5TTF A;  5TEG A;  3M55 A;  1H3I A;  3TG4 A;  4JDS A;  5CCL A;  3K5K A;  5LSZ A;  4YPU A;  5T0M A;  5HQ8 A;  3M53 A;  3KMJ A;  3HNA A;  4E47 A;  1N6C A;  2RFI A;  2F69 A;  4J7F A;  3FPD A;  3M56 A;  4YPA A; 
#chains in the Genus database with same CATH topology
 3BO5 A;  1MVX A;  3N71 A;  4NJ5 A;  3IHX A;  3KMT A;  4IJD A;  3QWP A;  5F5E A;  5T5G A;  1PEG A;  3QWV A;  3EP0 A;  3PDN A;  3SW9 A;  2W5Z A;  5EG2 A;  3CBP A;  3RAY A;  3MO5 A;  5KJN A;  4J7I A;  1MUF A;  3S7J A;  3S8P A;  3CBO A;  1O9S A;  3F9Y A;  4NVQ A;  3SWC A;  4C1Q A;  3OXF A;  3MO0 A;  3OXL A;  5F6K C;  1MT6 A;  4JLG A;  4MI0 A;  4YND A;  2QPW A;  3QWW A;  3F9W A;  3CBM A;  3RU0 A;  2W5Y A;  5JHN A;  4H12 A;  3S7B A;  4Z4P A;  3DB5 A;  5KJL A;  5AYF A;  5JIY A;  2G46 A;  3OOI A;  5CCM A;  5EX3 A;  5LSX A;  4J8O A;  1MVH A;  5KJK A;  4BUP A;  2IGQ A;  2BQZ A;  3RIB A;  3OS5 A;  3S7D A;  4YNP A;  2JV0 A;  2O8J A;  2R3A A;  4I51 A;  5ARG A;  1N6A A;  1ML9 A;  4YNM A;  4IJ8 A;  4MI5 A;  3S7F A;  5CPR B;  3M5A A;  5HI7 A;  1ZKK A;  4J83 A;  4O6F A;  1XQH A;  3KMA A;  3VUZ A;  4O30 A;  4LDG A;  3M57 A;  5KJM A;  3M58 A;  4QEP A;  3M54 A;  1N3J A;  4RZ0 A;  3OXG A;  4QEN A;  5TH7 A;  5F59 A;  3F9Z A;  4WUY A;  3MO2 A;  5JJ0 A;  3RQ4 A;  3MEK A;  5JIN A;  5EX0 A;  3TG5 A;  4FMU A;  3DAL A;  3VV0 A;  3M59 A;  3RJW A;  5T0K A;  3OPE A;  5F6L A;  4YPE A;  3F9X A;  5ARF A;  4AU7 A;  4QEO A;  5TTF A;  5TEG A;  3M55 A;  1H3I A;  3TG4 A;  4JDS A;  5CCL A;  3K5K A;  5LSZ A;  4YPU A;  5T0M A;  5HQ8 A;  3M53 A;  3KMJ A;  3HNA A;  4E47 A;  1N6C A;  2RFI A;  2F69 A;  4J7F A;  3FPD A;  3M56 A;  4YPA A; 
#chains in the Genus database with same CATH homology
 3BO5 A;  1MVX A;  3N71 A;  4NJ5 A;  3IHX A;  3KMT A;  4IJD A;  3QWP A;  5F5E A;  5T5G A;  1PEG A;  3QWV A;  3EP0 A;  3PDN A;  3SW9 A;  2W5Z A;  5EG2 A;  3CBP A;  3RAY A;  3MO5 A;  5KJN A;  4J7I A;  1MUF A;  3S7J A;  3S8P A;  3CBO A;  1O9S A;  3F9Y A;  4NVQ A;  3SWC A;  4C1Q A;  3OXF A;  3MO0 A;  3OXL A;  5F6K C;  1MT6 A;  4JLG A;  4MI0 A;  4YND A;  2QPW A;  3QWW A;  3F9W A;  3CBM A;  3RU0 A;  2W5Y A;  5JHN A;  4H12 A;  3S7B A;  4Z4P A;  3DB5 A;  5KJL A;  5AYF A;  5JIY A;  2G46 A;  3OOI A;  5CCM A;  5EX3 A;  5LSX A;  4J8O A;  1MVH A;  5KJK A;  4BUP A;  2IGQ A;  2BQZ A;  3RIB A;  3OS5 A;  3S7D A;  4YNP A;  2JV0 A;  2O8J A;  2R3A A;  4I51 A;  5ARG A;  1N6A A;  1ML9 A;  4YNM A;  4IJ8 A;  4MI5 A;  3S7F A;  5CPR B;  3M5A A;  5HI7 A;  1ZKK A;  4J83 A;  4O6F A;  1XQH A;  3KMA A;  3VUZ A;  4O30 A;  4LDG A;  3M57 A;  5KJM A;  3M58 A;  4QEP A;  3M54 A;  1N3J A;  4RZ0 A;  3OXG A;  4QEN A;  5TH7 A;  5F59 A;  3F9Z A;  4WUY A;  3MO2 A;  5JJ0 A;  3RQ4 A;  3MEK A;  5JIN A;  5EX0 A;  3TG5 A;  4FMU A;  3DAL A;  3VV0 A;  3M59 A;  3RJW A;  5T0K A;  3OPE A;  5F6L A;  4YPE A;  3F9X A;  5ARF A;  4AU7 A;  4QEO A;  5TTF A;  5TEG A;  3M55 A;  1H3I A;  3TG4 A;  4JDS A;  5CCL A;  3K5K A;  5LSZ A;  4YPU A;  5T0M A;  5HQ8 A;  3M53 A;  3KMJ A;  3HNA A;  4E47 A;  1N6C A;  2RFI A;  2F69 A;  4J7F A;  3FPD A;  3M56 A;  4YPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...