4YNMA

Ash1l wild-type set domain in complex with s-adenosyl methionine (sam)
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
215
structure length
215
Chain Sequence
AGSYKKIRSNVYVDVKPLSGYEATTCNCKKPDDDTRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEPLKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHSCDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGIIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Two Loops Undergoing Concerted Dynamics Regulate the Activity of the ASH1L Histone Methyltransferase.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transferase
molecule keywords Histone-lysine N-methyltransferase ASH1L
total genus 49
structure length 215
sequence length 215
chains with identical sequence B
ec nomenclature ec 2.1.1.43: Histone-lysine N-methyltransferase.
pdb deposition date 2015-03-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00856 SET SET domain
A PF17907 AWS AWS domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
2.170.270.10 Mainly Beta Beta Complex Beta-clip-like SET domain 4ynmA00
3CBPA 4O6FA 4YNMA 1N6AA 3F9ZA 3M53A 4MI5A 3QWWA 3KMJA 4IJ8A 3OOIA 2JV0A 3HNAA 4YNDA 3F9YA 4YPAA 3SW9A 5JINA 4NVQA 1MT6A 4Z4PA 3RQ4A 2BQZA 3FPDA 4LDGA 4J83A 5TTFA 1MVXA 5CCMA 3K5KA 4I51A 5ARFA 5AYFA 4QEPA 4BUPA 4O30A 5F6KC 3MO5A 5KJNA 1PEGA 3M5AA 3RIBA 3RJWA 1ZKKA 4YNPA 3M54A 5TEGA 3VV0A 3OXGA 5T0MA 3S8PA 3DB5A 2R3AA 5HQ8A 2RFIA 3OXLA 5EX3A 3CBMA 3MO0A 4AU7A 4RZ0A 4JLGA 2F69A 3M55A 3KMAA 3EP0A 5T5GA 3VUZA 3BO5A 5KJLA 5F5EA 4YPUA 4QEOA 3F9XA 5CPRB 3RU0A 1O9SA 2W5YA 3OPEA 3MEKA 3SWCA 5LSXA 5KJMA 3MO2A 4QENA 1N3JA 4J7FA 4C1QA 2QPWA 2IGQA 3M57A 5CCLA 4JDSA 3QWVA 3IHXA 1N6CA 4J8OA 4FMUA 3KMTA 1H3IA 5TH7A 5F59A 3RAYA 3S7DA 3TG4A 4IJDA 5HI7A 2W5ZA 3QWPA 3OXFA 1ML9A 3TG5A 1XQHA 3M58A 3S7JA 3OS5A 4H12A 5JIYA 5LSZA 3N71A 4YPEA 2O8JA 3CBOA 5F6LA 1MVHA 5T0KA 1MUFA 4WUYA 5ARGA 2G46A 5EX0A 5KJKA 4MI0A 4E47A 3S7BA 3DALA 3PDNA 5JJ0A 4J7IA 3M59A 3F9WA 5JHNA 3M56A 5EG2A 3S7FA 4NJ5A
chains in the Genus database with same CATH superfamily
3CBPA 4O6FA 4YNMA 1N6AA 3F9ZA 3M53A 4MI5A 3QWWA 3KMJA 4IJ8A 3OOIA 2JV0A 3HNAA 4YNDA 3F9YA 4YPAA 3SW9A 5JINA 4NVQA 1MT6A 4Z4PA 3RQ4A 2BQZA 3FPDA 4LDGA 4J83A 5TTFA 1MVXA 5CCMA 3K5KA 4I51A 5ARFA 5AYFA 4QEPA 4BUPA 4O30A 5F6KC 3MO5A 5KJNA 1PEGA 3M5AA 3RIBA 3RJWA 1ZKKA 4YNPA 3M54A 5TEGA 3VV0A 3OXGA 5T0MA 3S8PA 3DB5A 2R3AA 5HQ8A 2RFIA 3OXLA 5EX3A 3CBMA 3MO0A 4AU7A 4RZ0A 4JLGA 2F69A 3M55A 3KMAA 3EP0A 5T5GA 3VUZA 3BO5A 5KJLA 5F5EA 4YPUA 4QEOA 3F9XA 5CPRB 3RU0A 1O9SA 2W5YA 3OPEA 3MEKA 3SWCA 5LSXA 5KJMA 3MO2A 4QENA 1N3JA 4J7FA 4C1QA 2QPWA 2IGQA 3M57A 5CCLA 4JDSA 3QWVA 3IHXA 1N6CA 4J8OA 4FMUA 3KMTA 1H3IA 5TH7A 5F59A 3RAYA 3S7DA 3TG4A 4IJDA 5HI7A 2W5ZA 3QWPA 3OXFA 1ML9A 3TG5A 1XQHA 3M58A 3S7JA 3OS5A 4H12A 5JIYA 5LSZA 3N71A 4YPEA 2O8JA 3CBOA 5F6LA 1MVHA 5T0KA 1MUFA 4WUYA 5ARGA 2G46A 5EX0A 5KJKA 4MI0A 4E47A 3S7BA 3DALA 3PDNA 5JJ0A 4J7IA 3M59A 3F9WA 5JHNA 3M56A 5EG2A 3S7FA 4NJ5A
chains in the Genus database with same CATH topology
3CBPA 4O6FA 4YNMA 1N6AA 3F9ZA 3M53A 4MI5A 3QWWA 3KMJA 4IJ8A 3OOIA 2JV0A 3HNAA 4YNDA 3F9YA 4YPAA 3SW9A 5JINA 4NVQA 1MT6A 4Z4PA 3RQ4A 2BQZA 3FPDA 4LDGA 4J83A 5TTFA 1MVXA 5CCMA 3K5KA 4I51A 5ARFA 5AYFA 4QEPA 4BUPA 4O30A 5F6KC 3MO5A 5KJNA 1PEGA 3M5AA 3RIBA 3RJWA 1ZKKA 4YNPA 3M54A 5TEGA 3VV0A 3OXGA 5T0MA 3S8PA 3DB5A 2R3AA 5HQ8A 2RFIA 3OXLA 5EX3A 3CBMA 3MO0A 4AU7A 4RZ0A 4JLGA 2F69A 3M55A 3KMAA 3EP0A 5T5GA 3VUZA 3BO5A 5KJLA 5F5EA 4YPUA 4QEOA 3F9XA 5CPRB 3RU0A 1O9SA 2W5YA 3OPEA 3MEKA 3SWCA 5LSXA 5KJMA 3MO2A 4QENA 1N3JA 4J7FA 4C1QA 2QPWA 2IGQA 3M57A 5CCLA 4JDSA 3QWVA 3IHXA 1N6CA 4J8OA 4FMUA 3KMTA 1H3IA 5TH7A 5F59A 3RAYA 3S7DA 3TG4A 4IJDA 5HI7A 2W5ZA 3QWPA 3OXFA 1ML9A 3TG5A 1XQHA 3M58A 3S7JA 3OS5A 4H12A 5JIYA 5LSZA 3N71A 4YPEA 2O8JA 3CBOA 5F6LA 1MVHA 5T0KA 1MUFA 4WUYA 5ARGA 2G46A 5EX0A 5KJKA 4MI0A 4E47A 3S7BA 3DALA 3PDNA 5JJ0A 4J7IA 3M59A 3F9WA 5JHNA 3M56A 5EG2A 3S7FA 4NJ5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CBP A;  4O6F A;  4YNM A;  1N6A A;  3F9Z A;  3M53 A;  4MI5 A;  3QWW A;  3KMJ A;  4IJ8 A;  3OOI A;  2JV0 A;  3HNA A;  4YND A;  3F9Y A;  4YPA A;  3SW9 A;  5JIN A;  4NVQ A;  1MT6 A;  4Z4P A;  3RQ4 A;  2BQZ A;  3FPD A;  4LDG A;  4J83 A;  5TTF A;  1MVX A;  5CCM A;  3K5K A;  4I51 A;  5ARF A;  5AYF A;  4QEP A;  4BUP A;  4O30 A;  5F6K C;  3MO5 A;  5KJN A;  1PEG A;  3M5A A;  3RIB A;  3RJW A;  1ZKK A;  4YNP A;  3M54 A;  5TEG A;  3VV0 A;  3OXG A;  5T0M A;  3S8P A;  3DB5 A;  2R3A A;  5HQ8 A;  2RFI A;  3OXL A;  5EX3 A;  3CBM A;  3MO0 A;  4AU7 A;  4RZ0 A;  4JLG A;  2F69 A;  3M55 A;  3KMA A;  3EP0 A;  5T5G A;  3VUZ A;  3BO5 A;  5KJL A;  5F5E A;  4YPU A;  4QEO A;  3F9X A;  5CPR B;  3RU0 A;  1O9S A;  2W5Y A;  3OPE A;  3MEK A;  3SWC A;  5LSX A;  5KJM A;  3MO2 A;  4QEN A;  1N3J A;  4J7F A;  4C1Q A;  2QPW A;  2IGQ A;  3M57 A;  5CCL A;  4JDS A;  3QWV A;  3IHX A;  1N6C A;  4J8O A;  4FMU A;  3KMT A;  1H3I A;  5TH7 A;  5F59 A;  3RAY A;  3S7D A;  3TG4 A;  4IJD A;  5HI7 A;  2W5Z A;  3QWP A;  3OXF A;  1ML9 A;  3TG5 A;  1XQH A;  3M58 A;  3S7J A;  3OS5 A;  4H12 A;  5JIY A;  5LSZ A;  3N71 A;  4YPE A;  2O8J A;  3CBO A;  5F6L A;  1MVH A;  5T0K A;  1MUF A;  4WUY A;  5ARG A;  2G46 A;  5EX0 A;  5KJK A;  4MI0 A;  4E47 A;  3S7B A;  3DAL A;  3PDN A;  5JJ0 A;  4J7I A;  3M59 A;  3F9W A;  5JHN A;  3M56 A;  5EG2 A;  3S7F A;  4NJ5 A; 
#chains in the Genus database with same CATH topology
 3CBP A;  4O6F A;  4YNM A;  1N6A A;  3F9Z A;  3M53 A;  4MI5 A;  3QWW A;  3KMJ A;  4IJ8 A;  3OOI A;  2JV0 A;  3HNA A;  4YND A;  3F9Y A;  4YPA A;  3SW9 A;  5JIN A;  4NVQ A;  1MT6 A;  4Z4P A;  3RQ4 A;  2BQZ A;  3FPD A;  4LDG A;  4J83 A;  5TTF A;  1MVX A;  5CCM A;  3K5K A;  4I51 A;  5ARF A;  5AYF A;  4QEP A;  4BUP A;  4O30 A;  5F6K C;  3MO5 A;  5KJN A;  1PEG A;  3M5A A;  3RIB A;  3RJW A;  1ZKK A;  4YNP A;  3M54 A;  5TEG A;  3VV0 A;  3OXG A;  5T0M A;  3S8P A;  3DB5 A;  2R3A A;  5HQ8 A;  2RFI A;  3OXL A;  5EX3 A;  3CBM A;  3MO0 A;  4AU7 A;  4RZ0 A;  4JLG A;  2F69 A;  3M55 A;  3KMA A;  3EP0 A;  5T5G A;  3VUZ A;  3BO5 A;  5KJL A;  5F5E A;  4YPU A;  4QEO A;  3F9X A;  5CPR B;  3RU0 A;  1O9S A;  2W5Y A;  3OPE A;  3MEK A;  3SWC A;  5LSX A;  5KJM A;  3MO2 A;  4QEN A;  1N3J A;  4J7F A;  4C1Q A;  2QPW A;  2IGQ A;  3M57 A;  5CCL A;  4JDS A;  3QWV A;  3IHX A;  1N6C A;  4J8O A;  4FMU A;  3KMT A;  1H3I A;  5TH7 A;  5F59 A;  3RAY A;  3S7D A;  3TG4 A;  4IJD A;  5HI7 A;  2W5Z A;  3QWP A;  3OXF A;  1ML9 A;  3TG5 A;  1XQH A;  3M58 A;  3S7J A;  3OS5 A;  4H12 A;  5JIY A;  5LSZ A;  3N71 A;  4YPE A;  2O8J A;  3CBO A;  5F6L A;  1MVH A;  5T0K A;  1MUF A;  4WUY A;  5ARG A;  2G46 A;  5EX0 A;  5KJK A;  4MI0 A;  4E47 A;  3S7B A;  3DAL A;  3PDN A;  5JJ0 A;  4J7I A;  3M59 A;  3F9W A;  5JHN A;  3M56 A;  5EG2 A;  3S7F A;  4NJ5 A; 
#chains in the Genus database with same CATH homology
 3CBP A;  4O6F A;  4YNM A;  1N6A A;  3F9Z A;  3M53 A;  4MI5 A;  3QWW A;  3KMJ A;  4IJ8 A;  3OOI A;  2JV0 A;  3HNA A;  4YND A;  3F9Y A;  4YPA A;  3SW9 A;  5JIN A;  4NVQ A;  1MT6 A;  4Z4P A;  3RQ4 A;  2BQZ A;  3FPD A;  4LDG A;  4J83 A;  5TTF A;  1MVX A;  5CCM A;  3K5K A;  4I51 A;  5ARF A;  5AYF A;  4QEP A;  4BUP A;  4O30 A;  5F6K C;  3MO5 A;  5KJN A;  1PEG A;  3M5A A;  3RIB A;  3RJW A;  1ZKK A;  4YNP A;  3M54 A;  5TEG A;  3VV0 A;  3OXG A;  5T0M A;  3S8P A;  3DB5 A;  2R3A A;  5HQ8 A;  2RFI A;  3OXL A;  5EX3 A;  3CBM A;  3MO0 A;  4AU7 A;  4RZ0 A;  4JLG A;  2F69 A;  3M55 A;  3KMA A;  3EP0 A;  5T5G A;  3VUZ A;  3BO5 A;  5KJL A;  5F5E A;  4YPU A;  4QEO A;  3F9X A;  5CPR B;  3RU0 A;  1O9S A;  2W5Y A;  3OPE A;  3MEK A;  3SWC A;  5LSX A;  5KJM A;  3MO2 A;  4QEN A;  1N3J A;  4J7F A;  4C1Q A;  2QPW A;  2IGQ A;  3M57 A;  5CCL A;  4JDS A;  3QWV A;  3IHX A;  1N6C A;  4J8O A;  4FMU A;  3KMT A;  1H3I A;  5TH7 A;  5F59 A;  3RAY A;  3S7D A;  3TG4 A;  4IJD A;  5HI7 A;  2W5Z A;  3QWP A;  3OXF A;  1ML9 A;  3TG5 A;  1XQH A;  3M58 A;  3S7J A;  3OS5 A;  4H12 A;  5JIY A;  5LSZ A;  3N71 A;  4YPE A;  2O8J A;  3CBO A;  5F6L A;  1MVH A;  5T0K A;  1MUF A;  4WUY A;  5ARG A;  2G46 A;  5EX0 A;  5KJK A;  4MI0 A;  4E47 A;  3S7B A;  3DAL A;  3PDN A;  5JJ0 A;  4J7I A;  3M59 A;  3F9W A;  5JHN A;  3M56 A;  5EG2 A;  3S7F A;  4NJ5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...