4YNRA

Doss gafa domain reduced co bound crystal structure
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
143
structure length
140
Chain Sequence
DPDLEATLRAIVHSATSLVDARYGAMEVHDRQHRVLHFVYEGIDEETVRRIGHLPKGLGVIGLLIEDPKPLRLDDVSAHPASIGFPPYHPPMRTFLGVPVRVSFGTLYLTDKTNGQPFSDDDEVLVQALAAAAGIAVANA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Redox sensor histidine kinase response regulator DevS
publication title Mycobacterium tuberculosis DosS; Kinetics and Structure of Ligand Binding.
rcsb
source organism Mycobacterium tuberculosis (strain cdc 1551 / oshkosh)
molecule tags Oxidoreductase
total genus 36
structure length 140
sequence length 143
chains with identical sequence B
ec nomenclature ec 2.7.13.3: Histidine kinase.
pdb deposition date 2015-03-10
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.30.450.40 Alpha Beta 2-Layer Sandwich Beta-Lactamase Beta-Lactamase 4ynrA00
4E04A 2GX5A 4Z1WA 1F5MA 3W2ZA 3KSGA 2XRNA 4O8GA 3LFVA 2XROA 5HPFA 3MQ0A 2Y8HA 4ME4A 2HGVA 2W1TA 4Y3IA 2KOIA 4ZRRA 4R6LA 3RFBA 2IA2A 3NOPC 3C2WA 3MF0A 5I5LA 4MDZA 2KLIA 5L8MA 5AJGA 3OBFA 4CQHA 4EU0A 5LBRA 4FOFA 3NOUC 2K31A 4BWIA 4MCWA 3S7OA 1VHMA 4YOFA 3NOTC 4G3WA 5DFXA 3K2NA 2O0YA 3EEAA 3CI6A 2VEAA 2W3EA 3KSFA 1MKMA 4LRYC 1ZTUA 1YKDA 2QYBA 2M7VA 3E98A 3TRCA 1STZA 3BJNA 4Y5FA 2W3FA 2K2NA 2O9BA 3IBRA 2LB5A 4G3KA 1TD5A 2VKSA 3R4KA 2O99A 5HL6A 2ZMFA 4GW9A 4DMZA 2LB9A 2W3DA 4R70A 1YSQA 3MMHA 4LRZE 2B18A 3VV4A 2G7UA 2OOLA 4Q0JA 3ZQ5A 3G6OA 4Q0IA 4DN0A 3CITA 2XSSA 4IJGA 4G3VA 3OOVA 1MC0A 4ETXA 3KSHA 1TF1A 3KSIA 3DBAA 3O5YA 2W3HA 1YSPA 4IUKA 4GLQA 4MMNA 2W1RA 4QPRA 2VJWA 3S7NA 4PAUA 4O01A 3S7QA 4ETZA 5TJJA 2W3GA 2O9CA 5C5KA 2VZWA 3KO6A 5HPIA 3HCYA 3E0YA 5HSQA 3NHQA 4Y2FA 5K5BA 2O9AA 4Q0HA 2W1TB 4IUHA 4EUVA 4YNRA 3S7PA 2Y79A 5DFYA 3IBJA 4LRXC 4RQ9A 4O0PA 3D3OA 2M7UA 4MN7A
chains in the Genus database with same CATH superfamily
4JGPA 1F5MA 3ZNTA 2B5RA 2QMIA 4R0QA 3WRZA 3LEZA 4KQRA 4WLAA 3MZEA 3Q7ZA 3RFBA 1NXYA 4OLDA 3VFHA 1GCEA 4NEED 3CLOA 2G2WA 2E8JA 2OWJA 4JPMA 2HDSA 3NIAA 3NULA 3NOUC 2ZOIA 2P08A 2ZJ9A 5DFXA 1I2WA 3WS5A 3MKFA 5DVAA 1ZTUA 3G35A 4DXBA 2VX8A 3VP3A 3GSGA 4K0XA 3R4KA 4IBRA 4HESA 4BMWA 1G6OA 3LR0A 4KUOA 2G2UA 3HLFA 4DDSA 1SZVA 2BLSA 2ZMAA 3BFCA 3Q7VB 1W7FA 4E3IA 3OCNA 4S2OA 4HJ4A 3Q82A 1ALQA 4C3QA 3LR5A 3O86A 4Y7PA 5CEBA 3MXSA 1QMEA 3OPRA 2VJWA 5EFWA 2BG1A 1K6SA 5F1FA 1L0FA 2HP5A 1Y54A 1RP5A 3GECA 1OTAA 2JKRI 3ZVWA 3E0YA 4S2NA 3NHQA 4OP5A 1K38A 1KGEA 4P6ZM 4R4RA 2W1TB 3O3VA 4E3OA 2EFUA 1GSXA 3JPUA 1ES4A 4KUKA 3T1RA 2A3UA 4PM5A 4MN5A 3M2JA 1ZG6A 1ES5A 4I39A 3MZDA 3MQ0A 4BENA 5CEDA 3RJUA 2Y2IA 1K25A 1S6RA 3VOZA 4UA9A 3BWLA 1OJGA 5HWTA 3NJAA 3VP1A 4ZTKA 4QHCA 4H6JB 3HLGA 4DDYA 1RGYA 5EVID 4KENB 1OMEA 2HPBA 3VE3A 3VFFA 4HJ3A 2BASA 2P9VB 1YLZA 2W3DA 1BULA 1I5QA 3MMHA 3P01A 3VV4A 4X68A 3HJIA 2IWBA 3LGOA 1JVJA 2K7SA 3F1PB 5J3WA 2AVXA 4EESA 5IT5A 3JYIA 3UB9A 3DBAA 5GL9A 3UE1A 4KG2A 4NK3A 2X71A 4ETZA 1HTZA 2ZC4B 4CLCD 3H82A 4O7DA 2Y2HA 3QHYA 5FQ9A 3V3SA 2PRFA 3FPVA 5KIZA 2A2LA 3V5MA 1YT4A 2OLVA 3M6HA 3MQQA 2M1CA 4S2JA 1SKOB 5HFOA 4QB8A 4S2MA 4KZ9A 1CK3A 1H8ZA 3SOIA 3IWIA 5HAIA 3KX0X 4RX3A 4UQIM 1WA9A 1ONHA 4OOYA 4PKYA 4WUJA 3FKWA 2W0NA 4YFMA 4E3JA 2A24B 4I5SA 1JWZA 3UN7A 5EVIA 2KLIA 4E6XA 2J9OA 5AVFA 5HD5A 5A92A 1XJ6A 3GR2A 4P0MA 3MBZA 3IX8A 1XKZA 3W4PA 3FPWA 1BLPA 3HREA 4X56A 3PBOA 3VMAA 2Y2KA 2YKHA 3K3CA 3BFFA 3P98A 5D3OA 4IVIA 2B18A 4WZ5A 4CLCA 1GA9A 4IVKA 3VSKA 5GLDA 3OCLA 4WM9A 5EOOA 5CGWA 1MXOA 1UWPX 3BLSA 1Q2PA 3SZTA 2UV0E 4ZJ2A 3EQUA 3VOLA 1EROA 1PWDA 4EXOA 1KE0A 1FR1A 2Y2LA 1TS0A 2WKRA 1PWCA 2HDRA 2Y2QA 5MC7A 4F94A 4HI4A 1L0GA 1VM1A 5FAQA 3ZDJA 2WKPA 4EQ1A 2V9AA 5AVEA 3LIBA 3PBSA 4KZ6A 4ESPA 1DP8A 1AWIA 5HD3A 4LV3A 3T1QB 1LL5A 2M7UA 5FQQA 1BYWA 4IHQA 3W2ZA 4DF6A 2P04A 3A3FA 2D01A 1UGUA 3IT9A 1PW8A 4E3KA 4OPZA 3IF6B 1ODVA 2JHEA 2ZQCA 4KZ3A 1OTIA 3S22A 3IH8A 3ZG5A 1E3UA 3CUEC 4X25A 3SH8A 5U47A 1E25A 3CAXA 3F1OB 3PYPA 2JN7A 1OTEA 1IFQA 2VEAA 2VK3A 5J8XA 3I7JA 2J3WA 4OQIA 1BTLA 5FA7A 5A90A 2O99A 1XX2A 2J80A 5DKKA 4JLFA 1PWGA 2J8YA 2VV6A 2ZC6B 5FAPA 4EERA 4EEUA 1LI9A 1MBLA 1FSYA 1BZAA 5J7EA 1MC0A 4E3LA 4NXBA 4ETXA 5E2FA 2Z6DA 4RVAA 3W8KA 2XLNA 2P74A 2ZLYA 3T12B 2W3HA 1SDEA 4QPRA 2OAP1 3T4LA 1S67L 2VGKA 3TOIA 4HNBA 3E4PA 1LSWA 3B33A 4UAAA 4B4XA 4CLCE 3CWFA 5HPIA 3E4OA 5HSQA 1IYPA 4Y2FA 4MN6A 3BFEA 5FEGA 5CTMA 1HD8A 3M2KA 1YMXA 4X55A 3TE8A 1PZOA 1XJ4A 3HL9A 2KDKA 3V67A 2JKFA 3LIEA 5L09A 2XRNA 3IH9A 3Q7VA 4OONA 4S2LA 4FH4A 3IHBA 1U60A 2R9WA 4I3IA 3Q81A 3T1XA 3MF0A 1CQAA 2EX8A 1L3LA 5CECA 4OPYA 4HH2A 4EUZA 5EOEA 4FOFA 2XH9A 1GHIA 3Q07A 4RA7A 3O87A 4DE3A 3SS3A 2V1BA 2XEPA 4OLGA 5HW3A 1I2SA 5G18A 3QP1A 2PU2A 3QNCA 2A49A 4MNRA 2GNXA 3N7WA 5EPHA 4LCMA 3R7WB 1DP9A 2WZZA 4HJ6A 3LIFA 2HDQA 4LRZE 3GVBA 3FC7A 3LICA 3N8LA 2EA9A 4KZBA 1D1JA 2JBFA 1LHYA 1NRJA 2CC1A 4E6WA 1YM1A 3O5YA 1YSPA 4IUKA 1T18A 5EVEA 2V20A 2HZ5A 1Y4OA 4PHTA 2WGIA 3HLCA 3BFDA 1DJBA 3PR6A 1YLJA 1LI0A 4GD6A 2XA7S 3UMDA 1IKIA 4H6JA 4JF4A 1FQGA 3P7NA 3ZGAB 5CX7A 2Y79A 3GTCA 4HHDA 4BJPA 2P9VA 2Q0OA 4LV0A 4UHUA 1Q2QA 3SW1A 5EV0A 4HBTA 5M19A 3A3JA 4WN5A 3HUMA 2WKQA 1L0DA 3F1PA 5HDDA 4R6LA 3G31A 1IELA 3N8SA 3G4PA 3E4QA 1VEUA 1K55A 4MBFA 4KQOA 5GLCA 1M40A 5JYPA 4Y0UA 2X01A 4EU0A 4B93A 2K31A 4YWZA 3ISGA 3NOTC 2XD5A 1KVMA 3OZHA 3T4QA 3IXGA 1K57C 1HZOA 2QPNA 2ZQDA 1MKMA 1EW0A 3TRCA 3EGXC 4IEDA 2K2NA 4G3KA 2LB5A 4I3AA 2ZC5B 5A93A 1SKOA 4X1MA 5IS1A 3SH7A 2Z2LB 4S2NC 4GNUA 2DRWA 4PM7A 4IJGA 4DXCA 2Q9MA 2B02A 2A24A 4L9GA 5CHMA 3MS6A 4H8RA 4E3MA 1ZHHB 3IS2B 2DMWA 3KO6A 3NC8A 3T4SA 3UB6A 1XJ2A 3HCYA 4NG2A 1Z09A 4DKIA 5FI2A 4ZAMA 5L07A 1KOUA 1NYYA 3BECA 4QY5A 5M1AA 4PM6A 3CG5A 1KGGA 3UDXA 1ES3A 1S66L 4C75A 5DFYA 2Y4AA 1YLYA 3LEQA 3UDFA 1MPLA 4QU3A 1MWRA 3LO7A 4LGWA 5E43A 3HLEA 5I94A 3V3RA 1K56A 5HPFA 1E4DA 1YLPA 4UEYA 3OPLA 4QWOA 3CHWP 3NBLA 1V9YA 5CGSA 4EV4A 1K54A 3C2WA 4S2KA 1TS6A 2PYRA 2RCXA 5LBRA 2VV8A 4PKYG 1M6KA 3EGDC 3BY8A 3UE0A 4II7A 5DF9A 5CTNA 4LRYC 3H7WB 4P6ZS 4Y5FA 4QJGA 3LI8A 2L0WA 2XK1A 1NWZA 4R70A 3LCEA 1YSQA 3PAGA 2FZ0A 4WBGA 3UPNA 3NY4A 3BM6A 5G4ZA 3KSHA 1MWTA 5DKLA 1TDLA 1LL9A 3A0RA 3DTKA 1PW1A 3IF6A 4MMNA 5EECA 2W1RA 3V50A 2ZMVA 3NDGA 4BL3A 5DTTA 2PD8A 3QP2A 3NI9A 4GS9B 2O9CA 3T4JA 4L0LA 3IX4A 4GOGA 4Z9QA 1CEFA 5HZHA 4JGQA 2QJ7A 3F1OA 1ESIA 2XR0A 4EEPA 3T4KA 2VV7A 4GCZA 2WK0A 4Y15A 2CMNA 4RYEA 3S7PA 5HARA 2HV1A 1VETB 2Z6CA 1VEUB 5EVIC 1LT0A 4LRXC 2EX9A 3U4LP 2WADA 4GD8A 1BLCA 3BQ8A 3BW6A 2Y2MA 2PU4A 3C7VA 2WUQA 5KSHA 3TG9A 1T1CA 1BUEA 1D7EA 1TDGA 4I3JA 3G2ZA 3IX3A 1RCJA 3MFDA 3IWQA 4KQDA 4WZ5C 3D72A 5FAOA 4CLCC 2J9PA 1VHMA 4N9KA 1X0OA 4JKTA 4E3NA 3CMZA 3K2NA 5JYOA 4LV2A 3LIAA 2VKSA 1BLSA 4EWFA 4UA6A 1LSVA 1XXMA 1FCOA 3W4QA 1W8QA 4EETB 3G6OA 2OSUA 4GHIB 3N4IA 1EI5A 2UWXA 4G3VA 3C7UA 2Y2NA 3KSIA 2EFXA 4UQIS 3UNWA 3FV7A 4GLQA 1E3UD 4UA7A 1AXBA 1YAXA 3LR3A 3WS4A 1T1BA 2H0TA 5TJJA 1N9OA 5CRFA 1T1AA 3A0SA 3V39A 3LIDA 2ZM2A 2I9VA 2O9AA 5TGFA 4YNRA 2V8CA 4CPKA 3FYZA 1G28A 5L10A 4R23A 4FCFA 4DRTA 4MBHA 3R7WA 4KZ7A 3ZG9B 1OTDA 2GX5A 1P97A 4FSFA 2PR5A 4DJ3A 4R3BA 1BSGA 4U0XA 4NXFA 3BY9A 3PTEA 1WYBA 3IWOA 1OJ5A 1CI9A 4I38A 2VGLM 3PBQA 1QMFA 1PFLA 3UB7A 2ZQAA 5GHZA 2Y91A 5IU1A 1HLUP 2GDNA 4R3AA 4XUXA 2FFFB 4ZJ3A 2WYXA 4BWIA 2RL3A 4G3WA 2OV5A 1W79A 5CERA 1Z6FA 1GHPA 3UB8A 2FH5A 2XD1A 2WKHA 1STZA 3BJNA 5G4YA 5HWVA 3IBRA 4BQMA 4OOLA 3ZG7B 2P7JA 1V9ZA 4DMZA 3MSHA 3W4OA 2INWA 2HJEA 3OLOA 4B4ZA 5DJTA 4GN2A 4L9EA 2W27A 5E2GA 3FG8A 1PZPA 5E2EA 3TW8A 1K0KA 1N9NA 3HJKA 3LYXA 4DJ2A 4OPRA 1IYQA 2EWWA 1CF0A 5F5YA 4X69A 3MFXA 5AQAA 4XUZA 3E2KA 1YLWA 1DJCA 4D60A 2WGVA 4PM8A 1KVLA 1FR6A 3HUOA 1BT5A 3A3IA 1FCMA 5EUAA 3IBJA 4OQ0A 2MJ6A 1PYYA 4FD8A 5CHJA 4XXRA 5AQBA 2XGNA 4WF0A 3B3XA 5FQJA 1MWUA 5FQIA 4O8GA 5DJUA 1W8YA 2IWCA 1S4RA 4LENA 4ZRRA 4K08A 3FZCA 2HF6A 4Q8IA 1H0MA 5HDCA 4R4SA 1S4SA 3QP4A 4MEZA 4BL2A 4N1XA 3IS2A 3BEBA 3S7OA 5A91A 1SKFA 4CJNA 3L7HA 1F98A 2OWHA 2V0WA 4QY6A 2W3EA 3KSFA 3C4PA 1NLYA 5TFQA 3DWKA 1XFNA 4HBUA 4KZ5A 5HL6A 1XGIA 1XP4A 4FTXA 4HH3A 1F2KA 2ZQ8A 4X53A 2PYPA 4WELA 1OPXA 4M4XA 2PT7A 1C3BA 3FKVA 4OP8A 4JGRA 4DN0A 2V2FF 5F68A 3G2YA 3OOVA 1TF1A 3ULFA 2OLUA 3A3DA 3T4TA 4K91A 3OPPA 5FASA 4N1HA 1KDSA 1SDNA 2EXAA 3C5AA 2PR6A 3N6IA 1PI4A 2FFYA 3F1NB 1XFQA 1LSXA 4OOMA 1CJFA 3A0VA 3H7WA 5DF7A 2XA7M 3G34A 5FQKA 3CPTB 4RQ9A 3D4FA 2Y2GA 3VOYA 2H5SA 3BYDA 4PPRA 1MWSA 1YMSA 5KMWA 4Y3IA 3OPHA 3CJMA 2Y55A 2H0YA 3MZFA 1FCNA 2PDRA 3NOPC 1SCWA 5I5LA 1TS7A 4NXEA 2YKFA 5AJGA 4GS9A 4ARZB 3RH8B 2HDUA 3C4OA 5HDSA 3PHYA 4EQIA 4BBUA 4S2PA 4GB7A 4D2OA 3E2LA 1JTDA 1VETA 2L4RA 4BD0A 2XDMA 5BOHA 3UDIA 4OPQA 2Y2OA 1K56D 3LY4A 1RGZA 5L2FA 1PNEA 4OVDA 4OH0A 2B95A 2ZC3B 4WMCA 1YLTA 3AGDA 2J7VA 2HP6A 1DY6A 4DE1A 4PAUA 3S7QA 2Z2MB 2ZC7A 1ACFA 3D9YA 1NLZA 2JE5A 3M6BA 2V1AA 3T1SA 1S1ZA 3BRMA 3UPOA 2QKPA 4IUHA 5HAPA 5FDSA 2XFSA 5IHVA 1ZC2A 1K54C 3PBRA 4HOIA 4GDNA 5TBMB 3L9KA 3SS4A 2QJ5A 3Q1FA 3SS5A 4LFUA 4ZBEA 2PBYA 5F6AA 1CEGA 5F82A 4GHIA 1OT9A 4MLLA 2WGWB 2R9XA 4NETA 4ID4A 4BLMA 3S4XA 5DTKA 3UO9A 3ZFZA 1KE4A 5F83A 3P09A 3WS1A 4NKPA 3HUNA 4JXVA 2C6WB 2R78A 2O0YA 2QZ6A 3N8RA 1KGFA 5J4EA 1K57A 3H9WA 3IF6C 1YKDA 3RXXA 2VGJA 4XT2B 2W3FA 4FUWA 1MY8A 4C6YA 5FI6A 4KZ4A 4GDBA 3U2AA 4F3LB 2PD7A 3ZQ5A 4NXGA 1G5UA 2XSSA 3A3EA 3ZG0A 3S1YA 3HLWA 2EXBA 4ZJ1A 3ZCZA 2JKTM 2PBDP 2H28A 3UMEA 4KG6A 5EE8A 3QP6A 3GV9A 4JXWA 2Y59A 1K4EA 4JXSA 3WRTA 2EWVA 3UB5P 5FEFA 3GMWA 1YPRA 2HJ9C 3VP4A 1J3WA 2QHKA 3VE4A 4P6BA 4S2IA 2D02A 4DE0A 4KZ8A 1P9WA 1XA7A 3D3OA 3G32A 2V1ZA 5AQ7A 4Z1WA 2XFTA 2ZM8A 4MBKA 1PI5A 5FDHA 3BFGA 4ME4A 3NDEA 2HGVA 2KOIA 3IF5A 1XGJA 5FL3A 1H5XA 1JWPA 3ZVTA 4KG5A 4MDZA 3IXBA 2WKIA 5L8MA 4PM9A 4AFIA 4CQHA 3ITAA 3QP5A 4P85A 3ZYTA 1XA1A 1P9RA 4YOFA 1FOFA 1WYCA 2ZL1B 1GSVA 1IKGA 1MKIA 4JGOA 4EBNA 3AGFA 4JF5A 3QNBA 2ZQ9A 3LY3A 1NRFA 2LB9A 2JKGA 1MZUA 3QP8A 5GHYA 3OC2A 2WZXA 4R3JA 4ZDXA 3SH9A 4Q0IA 1ERQA 3CITA 1XJ3A 3DTIA 3MR0A 3O88A 4N9LA 4GJ4A 1VQQA 3WWXA 1KE3A 3ZHHA 4O01A 1PRQA 5GLBA 2VZWA 3PAEA 3TSGA 3DTEA 2DCFA 4Q0HA 3EQVA 2JKTI 1IYOA 1ZKJA 3K3DA 1K6RA 1G6AA 3ZNYA 2XQZA 4QD4A 5M18A 1W5DA 1D06A 2EX2A 2DNSA 1F9IA 4MN7A 1GSWA 3IXHA 2VA0A 1GHMA 2ACGA 3B47A 1SHVA 4R1GA 3TJZC 1DJAA 3DTMA 4B9OA 2IA2A 1JTGA 1YQSA 1O7EA 4A5RA 1L2SA 4B88A 1O07A 4HQAA 3LR4A 1ERMA 1OT6A 3T50A 3BLMA 3F1NA 3EWKA 2QYBA 1TS8A 2M7VA 4EBPA 1A0KA 2JCHA 2QWSA 3CPTA 3FWLA 1NYMA 3JVUA 3T4OA 5DTSA 4Y13A 2XF3A 1W63M 2G7UA 2ZOHA 2OOLA 5FI7A 3EOIA 1NY0A 4Y0TA 1S1YA 3C30A 1P0ZA 4OQHA 1LL8A 3IXDA 5EM0A 3S7NA 4PMAA 3C8CA 2VGLS 3KYZA 5E2HA 2W3GA 3MXRA 5C5KA 4EBLA 4ARZA 3RXWA 2HP9A 2ZQ7A 4HIAA 5KZHA 4EUVA 3ITBA 4DE2A 3HLDA 4L9FA 1ESUA 3UE6A 3BQAA 1TEMA 4JF6A 4JBFA 5HAQA 1ES2A 2V0UA 3MJQA 1KDWA 4Y17A 4E04A 2C5WB 3GRJA 3EEHA 5KSCA 3KSGA 3LFVA 4WL9A 3PXPA 1N9LA 4LPZA 4HP9A 4WZ4A 2JC7A 2X02A 4R38A 2EX6A 3H82B 3VP2A 3OBFA 1IOUA 4MCWA 3UY6A 2OAQ1 3UPPA 5CGXA 3C38A 3E98A 1N4OA 5AQ9A 1TD5A 2GZAA 2IWDA 5TBMA 3UE3A 5HWWA 2BTFP 2ZBBA 3GQZA 4KZAA 4LLOB 3DW0A 3CUEA 2GJ3A 4Y0OA 2NUTC 4Q0JA 1W63Q 4BD1A 1WE4A 4YINA 3NCKA 4N92A 1H3QA 1OTBA 2L1MA 2WGWA 4KQQA 1TVFA 5EVIB 1L0EA 5FATA 5HL1A 4BBVA 5HX9A 1FSWA 5EVLA 1NZOA 4HP4A 3B42A 3MXQA 5TR7A 5K5BA 1IYSA 2VLGA 4X1LA 4WEJA 3KYQA 3MQOA 1HVBA 3WS0A 5FQMA 4XT2A 2E8IA 5A8BA 1UWNX 3LUQA 5CXWA 2WAFA 1XPBA 4P87A 4LV1A 3DWZA 4WMCD 4HEFA 4F3LA 4CLCB 3GDIA 2NUPC 2WAEA 4LCLA 2XROA 2Y8HA 1FIKA 2W1TA 3MKEA 1S0WA 2Y2PA 4IBXA 3PBNA 3VSLA 3LI9A 1FILA 1H8MA 1K55C 1NZUA 2I72A 3IHAA 1BLHA 3ICYA 5GLAA 1K4FA 2PHYA 2J3TD 2ZM0A 3WS2A 3DAVA 1J9MA 4JXGA 3EEAA 3CI6A 4WEKA 4GZBA 4HY8A 1Y28A 4X6TA 3JVVA 1GA0A 2O9BA 5CHUA 3RTYA 3G30A 4GKUA 2ZMFA 3IQAA 4GW9A 2H10A 4U3TA 2ZD8A 1N9BA 5GHXA 1H8YA 4M3KA 2JKRM 5DF8A 5F69A 2J3TC 4WYYA 3HVFA 1PIOA 3NECA 2Q9NA 3HLBA 3HBRA 4FH2A 1EWZA 2V8FA 1JNUA 3AGEA 1G68A 2KX6A 3ZG8B 1T19A 1DRMA 3KYEA 1NJ4A 1DP6A 4BBTA 5F1GA 1ZG4A 1CI8A 4K0WA 4OQGA 4U0TA 3VP0A 1JWVA 2ZL1A 1ONGA 1VB6A 5EM1A 4OKPA 5FSRA 4EW7A 1LLBA 2WKEA 3CZDA 2Y2JA 1IEMA 3PBTA 4RX2A 4O0PA 2PAVP
chains in the Genus database with same CATH topology
4JGPA 1OTDA 2GX5A 2KDKA 1P97A 3V67A 4Z1WA 1F5MA 3LIEA 4FSFA 2PR5A 4DJ3A 2XRNA 4NXFA 3BY9A 4ME4A 2HGVA 4WLAA 1OJ5A 2KOIA 4I3IA 4I38A 3RFBA 2VGLM 3PBQA 5FL3A 3UB7A 3MF0A 5IU1A 4MDZA 4R3AA 4NEED 3CLOA 5L8MA 4AFIA 4HH2A 4CQHA 2OWJA 4FOFA 3NOUC 4BWIA 3ZYTA 4YOFA 1P9RA 2ZOIA 2P08A 4G3WA 5DFXA 2V1BA 1GSVA 3UB8A 2FH5A 1ZTUA 4JGOA 2VX8A 1STZA 3BJNA 5G4YA 5HWVA 3IBRA 2GNXA 4OOLA 3R4KA 2P7JA 1V9ZA 4BMWA 1G6OA 3R7WB 1DP9A 4DMZA 2LB9A 3LR0A 4KUOA 4HJ6A 1MZUA 3LIFA 3OC2A 4LRZE 2INWA 2HJEA 3FC7A 3LICA 3OLOA 2EA9A 3OCNA 4Q0IA 5DJTA 3CITA 1XJ3A 4L9EA 4HJ4A 1NRJA 2W27A 3FG8A 3MR0A 3LR5A 3TW8A 3O5YA 1YSPA 4IUKA 1N9NA 1T18A 3HJKA 3LYXA 4DJ2A 4GJ4A 2VJWA 5EFWA 4O01A 4PHTA 2EWWA 3PR6A 5F5YA 3MFXA 2XA7S 2VZWA 3UMDA 3GECA 1OTAA 2JKRI 3E0YA 3NHQA 4H6JA 4Q0HA 4P6ZM 3EQVA 2W1TB 2JKTI 3P7NA 1GSXA 3K3DA 5CX7A 2Y79A 4HHDA 4KUKA 3IBJA 2MJ6A 1D06A 4MN5A 4BJPA 4WF0A 1F9IA 4MN7A 1GSWA 2VA0A 3SW1A 3B47A 4O8GA 4WN5A 4I39A 5DJUA 2WKQA 3TJZC 3F1PA 3MQ0A 5HDDA 1S4RA 4ZRRA 4R6LA 4K08A 4B9OA 2IA2A 3E4QA 2HF6A 5HDCA 3BWLA 1OJGA 1S4SA 4KQOA 5HWTA 3NJAA 4EU0A 3IS2A 4HQAA 4B93A 2K31A 4YWZA 4H6JB 3S7OA 3LR4A 3NOTC 1OT6A 1F98A 2OWHA 3T4QA 3T50A 2V0WA 3F1NA 2W3EA 3KSFA 3EWKA 1MKMA 2QYBA 1TS8A 2M7VA 1EW0A 3TRCA 3EGXC 2K2NA 4G3KA 2LB5A 4I3AA 3VE3A 1NLYA 4HJ3A 2BASA 1XFNA 5HL6A 2QWSA 2W3DA 3JVUA 4HH3A 3T4OA 5IS1A 2PYPA 3MMHA 3P01A 1OPXA 4WELA 3VV4A 4M4XA 1W63M 2PT7A 2G7UA 2ZOHA 2OOLA 3HJIA 2K7SA 4JGRA 4DN0A 3EOIA 3F1PB 5J3WA 4IJGA 4EESA 5IT5A 5F68A 3OOVA 1S1YA 2B02A 3C30A 1P0ZA 1TF1A 3UB9A 3ULFA 3DBAA 2A24A 1LL8A 4L9GA 3T4TA 3S7NA 3C8CA 2VGLS 4ETZA 3KYZA 1ZHHB 2W3GA 4CLCD 3H82A 3IS2B 5C5KA 2DMWA 3KO6A 3T4SA 3UB6A 1XJ2A 3HCYA 4ARZA 3FPVA 2PR6A 5KIZA 1KOUA 2A2LA 4HIAA 3F1NB 1XFQA 4EUVA 1LSXA 4OOMA 1S66L 4L9FA 3A0VA 3H7WA 5DFYA 2XA7M 3MQQA 2M1CA 3UE6A 3BQAA 4RQ9A 2V0UA 3MJQA 4E04A 3EEHA 3KSGA 3KX0X 3LFVA 4WL9A 4UQIM 1WA9A 5HPFA 4PKYA 4WUJA 4UEYA 4Y3IA 2W0NA 3PXPA 2A24B 1N9LA 1V9YA 4I5SA 4LPZA 2PDRA 4HP9A 3NOPC 3C2WA 5I5LA 4R38A 2KLIA 1TS6A 2PYRA 3H82B 1TS7A 4NXEA 2YKFA 5AJGA 3OBFA 4GS9A 5LBRA 1IOUA 2VV8A 3RH8B 4ARZB 4PKYG 4MCWA 5AVFA 5HDSA 3EGDC 5HD5A 1XJ6A 3BY8A 3PHYA 4BBUA 2OAQ1 3FPWA 4II7A 5DF9A 4LRYC 3H7WB 3C38A 3E98A 4P6ZS 4Y5FA 3PBOA 1TD5A 2GZAA 5TBMA 2L4RA 3LI8A 2YKHA 3UE3A 5HWWA 2L0WA 3K3CA 1NWZA 2ZBBA 4R70A 1YSQA 4LLOB 2B18A 2FZ0A 3CUEA 2GJ3A 2NUTC 4Q0JA 1W63Q 5G4ZA 4CLCA 3KSHA 1H3QA 3OCLA 5DKLA 1OTBA 2L1MA 3A0RA 4MMNA 2W1RA 2ZMVA 1UWPX 4PAUA 3S7QA 2PD8A 4BBVA 3T4JA 4GS9B 2O9CA 3EQUA 4L0LA 3VOLA 4HP4A 4EXOA 1NLZA 3B42A 3MXQA 1TS0A 2V1AA 2WKRA 5HZHA 4JGQA 1S1ZA 2QJ7A 5K5BA 2QKPA 5MC7A 3F1OA 2VLGA 4EEPA 4WEJA 4HI4A 3KYQA 4IUHA 3T4KA 3MQOA 2VV7A 4GCZA 3PBRA 2CMNA 3S7PA 4HOIA 2HV1A 5TBMB 2WKPA 2Z6CA 2V9AA 1LT0A 3LIBA 4LRXC 4XT2A 3PBSA 5AVEA 2QJ5A 1DP8A 1UWNX 5A8BA 3LUQA 5HD3A 2M7UA 1BYWA 4F3LA 4IHQA 4CLCB 5F6AA 3GDIA 2NUPC 3W2ZA 3BQ8A 2P04A 3BW6A 2D01A 2XROA 4GHIA 1UGUA 2Y8HA 1OT9A 2W1TA 3PBNA 5KSHA 3LI9A 1ODVA 2JHEA 1H8MA 1T1CA 1D7EA 1OTIA 4I3JA 3ICYA 4KQDA 3CUEC 3D72A 2PHYA 2J3TD 4CLCC 4NKPA 1VHMA 3CAXA 3F1OB 1X0OA 3PYPA 2JN7A 3K2NA 1OTEA 1IFQA 2O0YA 2R78A 3CI6A 3EEAA 4WEKA 2VEAA 4HY8A 5J4EA 1Y28A 3H9WA 3JVVA 3LIAA 1YKDA 4XT2B 2W3FA 2J3WA 2O9BA 2VKSA 3RTYA 2O99A 2ZMFA 4GW9A 2J80A 5DKKA 1LSVA 3U2AA 4F3LB 2PD7A 2VV6A 4EERA 2JKRM 3ZQ5A 4EEUA 4NXGA 4EETB 3G6OA 4GHIB 5F69A 2J3TC 2XSSA 4G3VA 5J7EA 2JKTM 1MC0A 4ETXA 4NXBA 2Z6DA 3KSIA 2H28A 4UQIS 3UMEA 2W3HA 4GLQA 4QPRA 2OAP1 3T4LA 1YAXA 4EQ1A 1S67L 3LR3A 1T1BA 1JNUA 5TJJA 4HNBA 3E4PA 1LSWA 1N9OA 3B33A 2EWVA 2KX6A 4CLCE 1T1AA 1T19A 3A0SA 3CWFA 5HPIA 3E4OA 1DRMA 3LIDA 5HSQA 1DP6A 4Y2FA 4BBTA 2I9VA 4MN6A 2O9AA 2HJ9C 4YNRA 2QHKA 1VB6A 4EW7A 3VE4A 3TE8A 1G28A 2D02A 3PBTA 1P9WA 1XJ4A 4O0PA 3D3OA 3R7WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4E04 A;  2GX5 A;  4Z1W A;  1F5M A;  3W2Z A;  3KSG A;  2XRN A;  4O8G A;  3LFV A;  2XRO A;  5HPF A;  3MQ0 A;  2Y8H A;  4ME4 A;  2HGV A;  2W1T A;  4Y3I A;  2KOI A;  4ZRR A;  4R6L A;  3RFB A;  2IA2 A;  3NOP C;  3C2W A;  3MF0 A;  5I5L A;  4MDZ A;  2KLI A;  5L8M A;  5AJG A;  3OBF A;  4CQH A;  4EU0 A;  5LBR A;  4FOF A;  3NOU C;  2K31 A;  4BWI A;  4MCW A;  3S7O A;  1VHM A;  4YOF A;  3NOT C;  4G3W A;  5DFX A;  3K2N A;  2O0Y A;  3EEA A;  3CI6 A;  2VEA A;  2W3E A;  3KSF A;  1MKM A;  4LRY C;  1ZTU A;  1YKD A;  2QYB A;  2M7V A;  3E98 A;  3TRC A;  1STZ A;  3BJN A;  4Y5F A;  2W3F A;  2K2N A;  2O9B A;  3IBR A;  2LB5 A;  4G3K A;  1TD5 A;  2VKS A;  3R4K A;  2O99 A;  5HL6 A;  2ZMF A;  4GW9 A;  4DMZ A;  2LB9 A;  2W3D A;  4R70 A;  1YSQ A;  3MMH A;  4LRZ E;  2B18 A;  3VV4 A;  2G7U A;  2OOL A;  4Q0J A;  3ZQ5 A;  3G6O A;  4Q0I A;  4DN0 A;  3CIT A;  2XSS A;  4IJG A;  4G3V A;  3OOV A;  1MC0 A;  4ETX A;  3KSH A;  1TF1 A;  3KSI A;  3DBA A;  3O5Y A;  2W3H A;  1YSP A;  4IUK A;  4GLQ A;  4MMN A;  2W1R A;  4QPR A;  2VJW A;  3S7N A;  4PAU A;  4O01 A;  3S7Q A;  4ETZ A;  5TJJ A;  2W3G A;  2O9C A;  5C5K A;  2VZW A;  3KO6 A;  5HPI A;  3HCY A;  3E0Y A;  5HSQ A;  3NHQ A;  4Y2F A;  5K5B A;  2O9A A;  4Q0H A;  2W1T B;  4IUH A;  4EUV A;  4YNR A;  3S7P A;  2Y79 A;  5DFY A;  3IBJ A;  4LRX C;  4RQ9 A;  4O0P A;  3D3O A;  2M7U A;  4MN7 A; 
#chains in the Genus database with same CATH topology
 4JGP A;  1F5M A;  3ZNT A;  2B5R A;  2QMI A;  4R0Q A;  3WRZ A;  3LEZ A;  4KQR A;  4WLA A;  3MZE A;  3Q7Z A;  3RFB A;  1NXY A;  4OLD A;  3VFH A;  1GCE A;  4NEE D;  3CLO A;  2G2W A;  2E8J A;  2OWJ A;  4JPM A;  2HDS A;  3NIA A;  3NUL A;  3NOU C;  2ZOI A;  2P08 A;  2ZJ9 A;  5DFX A;  1I2W A;  3WS5 A;  3MKF A;  5DVA A;  1ZTU A;  3G35 A;  4DXB A;  2VX8 A;  3VP3 A;  3GSG A;  4K0X A;  3R4K A;  4IBR A;  4HES A;  4BMW A;  1G6O A;  3LR0 A;  4KUO A;  2G2U A;  3HLF A;  4DDS A;  1SZV A;  2BLS A;  2ZMA A;  3BFC A;  3Q7V B;  1W7F A;  4E3I A;  3OCN A;  4S2O A;  4HJ4 A;  3Q82 A;  1ALQ A;  4C3Q A;  3LR5 A;  3O86 A;  4Y7P A;  5CEB A;  3MXS A;  1QME A;  3OPR A;  2VJW A;  5EFW A;  2BG1 A;  1K6S A;  5F1F A;  1L0F A;  2HP5 A;  1Y54 A;  1RP5 A;  3GEC A;  1OTA A;  2JKR I;  3ZVW A;  3E0Y A;  4S2N A;  3NHQ A;  4OP5 A;  1K38 A;  1KGE A;  4P6Z M;  4R4R A;  2W1T B;  3O3V A;  4E3O A;  2EFU A;  1GSX A;  3JPU A;  1ES4 A;  4KUK A;  3T1R A;  2A3U A;  4PM5 A;  4MN5 A;  3M2J A;  1ZG6 A;  1ES5 A;  4I39 A;  3MZD A;  3MQ0 A;  4BEN A;  5CED A;  3RJU A;  2Y2I A;  1K25 A;  1S6R A;  3VOZ A;  4UA9 A;  3BWL A;  1OJG A;  5HWT A;  3NJA A;  3VP1 A;  4ZTK A;  4QHC A;  4H6J B;  3HLG A;  4DDY A;  1RGY A;  5EVI D;  4KEN B;  1OME A;  2HPB A;  3VE3 A;  3VFF A;  4HJ3 A;  2BAS A;  2P9V B;  1YLZ A;  2W3D A;  1BUL A;  1I5Q A;  3MMH A;  3P01 A;  3VV4 A;  4X68 A;  3HJI A;  2IWB A;  3LGO A;  1JVJ A;  2K7S A;  3F1P B;  5J3W A;  2AVX A;  4EES A;  5IT5 A;  3JYI A;  3UB9 A;  3DBA A;  5GL9 A;  3UE1 A;  4KG2 A;  4NK3 A;  2X71 A;  4ETZ A;  1HTZ A;  2ZC4 B;  4CLC D;  3H82 A;  4O7D A;  2Y2H A;  3QHY A;  5FQ9 A;  3V3S A;  2PRF A;  3FPV A;  5KIZ A;  2A2L A;  3V5M A;  1YT4 A;  2OLV A;  3M6H A;  3MQQ A;  2M1C A;  4S2J A;  1SKO B;  5HFO A;  4QB8 A;  4S2M A;  4KZ9 A;  1CK3 A;  1H8Z A;  3SOI A;  3IWI A;  5HAI A;  3KX0 X;  4RX3 A;  4UQI M;  1WA9 A;  1ONH A;  4OOY A;  4PKY A;  4WUJ A;  3FKW A;  2W0N A;  4YFM A;  4E3J A;  2A24 B;  4I5S A;  1JWZ A;  3UN7 A;  5EVI A;  2KLI A;  4E6X A;  2J9O A;  5AVF A;  5HD5 A;  5A92 A;  1XJ6 A;  3GR2 A;  4P0M A;  3MBZ A;  3IX8 A;  1XKZ A;  3W4P A;  3FPW A;  1BLP A;  3HRE A;  4X56 A;  3PBO A;  3VMA A;  2Y2K A;  2YKH A;  3K3C A;  3BFF A;  3P98 A;  5D3O A;  4IVI A;  2B18 A;  4WZ5 A;  4CLC A;  1GA9 A;  4IVK A;  3VSK A;  5GLD A;  3OCL A;  4WM9 A;  5EOO A;  5CGW A;  1MXO A;  1UWP X;  3BLS A;  1Q2P A;  3SZT A;  2UV0 E;  4ZJ2 A;  3EQU A;  3VOL A;  1ERO A;  1PWD A;  4EXO A;  1KE0 A;  1FR1 A;  2Y2L A;  1TS0 A;  2WKR A;  1PWC A;  2HDR A;  2Y2Q A;  5MC7 A;  4F94 A;  4HI4 A;  1L0G A;  1VM1 A;  5FAQ A;  3ZDJ A;  2WKP A;  4EQ1 A;  2V9A A;  5AVE A;  3LIB A;  3PBS A;  4KZ6 A;  4ESP A;  1DP8 A;  1AWI A;  5HD3 A;  4LV3 A;  3T1Q B;  1LL5 A;  2M7U A;  5FQQ A;  1BYW A;  4IHQ A;  3W2Z A;  4DF6 A;  2P04 A;  3A3F A;  2D01 A;  1UGU A;  3IT9 A;  1PW8 A;  4E3K A;  4OPZ A;  3IF6 B;  1ODV A;  2JHE A;  2ZQC A;  4KZ3 A;  1OTI A;  3S22 A;  3IH8 A;  3ZG5 A;  1E3U A;  3CUE C;  4X25 A;  3SH8 A;  5U47 A;  1E25 A;  3CAX A;  3F1O B;  3PYP A;  2JN7 A;  1OTE A;  1IFQ A;  2VEA A;  2VK3 A;  5J8X A;  3I7J A;  2J3W A;  4OQI A;  1BTL A;  5FA7 A;  5A90 A;  2O99 A;  1XX2 A;  2J80 A;  5DKK A;  4JLF A;  1PWG A;  2J8Y A;  2VV6 A;  2ZC6 B;  5FAP A;  4EER A;  4EEU A;  1LI9 A;  1MBL A;  1FSY A;  1BZA A;  5J7E A;  1MC0 A;  4E3L A;  4NXB A;  4ETX A;  5E2F A;  2Z6D A;  4RVA A;  3W8K A;  2XLN A;  2P74 A;  2ZLY A;  3T12 B;  2W3H A;  1SDE A;  4QPR A;  2OAP 1;  3T4L A;  1S67 L;  2VGK A;  3TOI A;  4HNB A;  3E4P A;  1LSW A;  3B33 A;  4UAA A;  4B4X A;  4CLC E;  3CWF A;  5HPI A;  3E4O A;  5HSQ A;  1IYP A;  4Y2F A;  4MN6 A;  3BFE A;  5FEG A;  5CTM A;  1HD8 A;  3M2K A;  1YMX A;  4X55 A;  3TE8 A;  1PZO A;  1XJ4 A;  3HL9 A;  2KDK A;  3V67 A;  2JKF A;  3LIE A;  5L09 A;  2XRN A;  3IH9 A;  3Q7V A;  4OON A;  4S2L A;  4FH4 A;  3IHB A;  1U60 A;  2R9W A;  4I3I A;  3Q81 A;  3T1X A;  3MF0 A;  1CQA A;  2EX8 A;  1L3L A;  5CEC A;  4OPY A;  4HH2 A;  4EUZ A;  5EOE A;  4FOF A;  2XH9 A;  1GHI A;  3Q07 A;  4RA7 A;  3O87 A;  4DE3 A;  3SS3 A;  2V1B A;  2XEP A;  4OLG A;  5HW3 A;  1I2S A;  5G18 A;  3QP1 A;  2PU2 A;  3QNC A;  2A49 A;  4MNR A;  2GNX A;  3N7W A;  5EPH A;  4LCM A;  3R7W B;  1DP9 A;  2WZZ A;  4HJ6 A;  3LIF A;  2HDQ A;  4LRZ E;  3GVB A;  3FC7 A;  3LIC A;  3N8L A;  2EA9 A;  4KZB A;  1D1J A;  2JBF A;  1LHY A;  1NRJ A;  2CC1 A;  4E6W A;  1YM1 A;  3O5Y A;  1YSP A;  4IUK A;  1T18 A;  5EVE A;  2V20 A;  2HZ5 A;  1Y4O A;  4PHT A;  2WGI A;  3HLC A;  3BFD A;  1DJB A;  3PR6 A;  1YLJ A;  1LI0 A;  4GD6 A;  2XA7 S;  3UMD A;  1IKI A;  4H6J A;  4JF4 A;  1FQG A;  3P7N A;  3ZGA B;  5CX7 A;  2Y79 A;  3GTC A;  4HHD A;  4BJP A;  2P9V A;  2Q0O A;  4LV0 A;  4UHU A;  1Q2Q A;  3SW1 A;  5EV0 A;  4HBT A;  5M19 A;  3A3J A;  4WN5 A;  3HUM A;  2WKQ A;  1L0D A;  3F1P A;  5HDD A;  4R6L A;  3G31 A;  1IEL A;  3N8S A;  3G4P A;  3E4Q A;  1VEU A;  1K55 A;  4MBF A;  4KQO A;  5GLC A;  1M40 A;  5JYP A;  4Y0U A;  2X01 A;  4EU0 A;  4B93 A;  2K31 A;  4YWZ A;  3ISG A;  3NOT C;  2XD5 A;  1KVM A;  3OZH A;  3T4Q A;  3IXG A;  1K57 C;  1HZO A;  2QPN A;  2ZQD A;  1MKM A;  1EW0 A;  3TRC A;  3EGX C;  4IED A;  2K2N A;  4G3K A;  2LB5 A;  4I3A A;  2ZC5 B;  5A93 A;  1SKO A;  4X1M A;  5IS1 A;  3SH7 A;  2Z2L B;  4S2N C;  4GNU A;  2DRW A;  4PM7 A;  4IJG A;  4DXC A;  2Q9M A;  2B02 A;  2A24 A;  4L9G A;  5CHM A;  3MS6 A;  4H8R A;  4E3M A;  1ZHH B;  3IS2 B;  2DMW A;  3KO6 A;  3NC8 A;  3T4S A;  3UB6 A;  1XJ2 A;  3HCY A;  4NG2 A;  1Z09 A;  4DKI A;  5FI2 A;  4ZAM A;  5L07 A;  1KOU A;  1NYY A;  3BEC A;  4QY5 A;  5M1A A;  4PM6 A;  3CG5 A;  1KGG A;  3UDX A;  1ES3 A;  1S66 L;  4C75 A;  5DFY A;  2Y4A A;  1YLY A;  3LEQ A;  3UDF A;  1MPL A;  4QU3 A;  1MWR A;  3LO7 A;  4LGW A;  5E43 A;  3HLE A;  5I94 A;  3V3R A;  1K56 A;  5HPF A;  1E4D A;  1YLP A;  4UEY A;  3OPL A;  4QWO A;  3CHW P;  3NBL A;  1V9Y A;  5CGS A;  4EV4 A;  1K54 A;  3C2W A;  4S2K A;  1TS6 A;  2PYR A;  2RCX A;  5LBR A;  2VV8 A;  4PKY G;  1M6K A;  3EGD C;  3BY8 A;  3UE0 A;  4II7 A;  5DF9 A;  5CTN A;  4LRY C;  3H7W B;  4P6Z S;  4Y5F A;  4QJG A;  3LI8 A;  2L0W A;  2XK1 A;  1NWZ A;  4R70 A;  3LCE A;  1YSQ A;  3PAG A;  2FZ0 A;  4WBG A;  3UPN A;  3NY4 A;  3BM6 A;  5G4Z A;  3KSH A;  1MWT A;  5DKL A;  1TDL A;  1LL9 A;  3A0R A;  3DTK A;  1PW1 A;  3IF6 A;  4MMN A;  5EEC A;  2W1R A;  3V50 A;  2ZMV A;  3NDG A;  4BL3 A;  5DTT A;  2PD8 A;  3QP2 A;  3NI9 A;  4GS9 B;  2O9C A;  3T4J A;  4L0L A;  3IX4 A;  4GOG A;  4Z9Q A;  1CEF A;  5HZH A;  4JGQ A;  2QJ7 A;  3F1O A;  1ESI A;  2XR0 A;  4EEP A;  3T4K A;  2VV7 A;  4GCZ A;  2WK0 A;  4Y15 A;  2CMN A;  4RYE A;  3S7P A;  5HAR A;  2HV1 A;  1VET B;  2Z6C A;  1VEU B;  5EVI C;  1LT0 A;  4LRX C;  2EX9 A;  3U4L P;  2WAD A;  4GD8 A;  1BLC A;  3BQ8 A;  3BW6 A;  2Y2M A;  2PU4 A;  3C7V A;  2WUQ A;  5KSH A;  3TG9 A;  1T1C A;  1BUE A;  1D7E A;  1TDG A;  4I3J A;  3G2Z A;  3IX3 A;  1RCJ A;  3MFD A;  3IWQ A;  4KQD A;  4WZ5 C;  3D72 A;  5FAO A;  4CLC C;  2J9P A;  1VHM A;  4N9K A;  1X0O A;  4JKT A;  4E3N A;  3CMZ A;  3K2N A;  5JYO A;  4LV2 A;  3LIA A;  2VKS A;  1BLS A;  4EWF A;  4UA6 A;  1LSV A;  1XXM A;  1FCO A;  3W4Q A;  1W8Q A;  4EET B;  3G6O A;  2OSU A;  4GHI B;  3N4I A;  1EI5 A;  2UWX A;  4G3V A;  3C7U A;  2Y2N A;  3KSI A;  2EFX A;  4UQI S;  3UNW A;  3FV7 A;  4GLQ A;  1E3U D;  4UA7 A;  1AXB A;  1YAX A;  3LR3 A;  3WS4 A;  1T1B A;  2H0T A;  5TJJ A;  1N9O A;  5CRF A;  1T1A A;  3A0S A;  3V39 A;  3LID A;  2ZM2 A;  2I9V A;  2O9A A;  5TGF A;  4YNR A;  2V8C A;  4CPK A;  3FYZ A;  1G28 A;  5L10 A;  4R23 A;  4FCF A;  4DRT A;  4MBH A;  3R7W A;  4KZ7 A;  3ZG9 B;  1OTD A;  2GX5 A;  1P97 A;  4FSF A;  2PR5 A;  4DJ3 A;  4R3B A;  1BSG A;  4U0X A;  4NXF A;  3BY9 A;  3PTE A;  1WYB A;  3IWO A;  1OJ5 A;  1CI9 A;  4I38 A;  2VGL M;  3PBQ A;  1QMF A;  1PFL A;  3UB7 A;  2ZQA A;  5GHZ A;  2Y91 A;  5IU1 A;  1HLU P;  2GDN A;  4R3A A;  4XUX A;  2FFF B;  4ZJ3 A;  2WYX A;  4BWI A;  2RL3 A;  4G3W A;  2OV5 A;  1W79 A;  5CER A;  1Z6F A;  1GHP A;  3UB8 A;  2FH5 A;  2XD1 A;  2WKH A;  1STZ A;  3BJN A;  5G4Y A;  5HWV A;  3IBR A;  4BQM A;  4OOL A;  3ZG7 B;  2P7J A;  1V9Z A;  4DMZ A;  3MSH A;  3W4O A;  2INW A;  2HJE A;  3OLO A;  4B4Z A;  5DJT A;  4GN2 A;  4L9E A;  2W27 A;  5E2G A;  3FG8 A;  1PZP A;  5E2E A;  3TW8 A;  1K0K A;  1N9N A;  3HJK A;  3LYX A;  4DJ2 A;  4OPR A;  1IYQ A;  2EWW A;  1CF0 A;  5F5Y A;  4X69 A;  3MFX A;  5AQA A;  4XUZ A;  3E2K A;  1YLW A;  1DJC A;  4D60 A;  2WGV A;  4PM8 A;  1KVL A;  1FR6 A;  3HUO A;  1BT5 A;  3A3I A;  1FCM A;  5EUA A;  3IBJ A;  4OQ0 A;  2MJ6 A;  1PYY A;  4FD8 A;  5CHJ A;  4XXR A;  5AQB A;  2XGN A;  4WF0 A;  3B3X A;  5FQJ A;  1MWU A;  5FQI A;  4O8G A;  5DJU A;  1W8Y A;  2IWC A;  1S4R A;  4LEN A;  4ZRR A;  4K08 A;  3FZC A;  2HF6 A;  4Q8I A;  1H0M A;  5HDC A;  4R4S A;  1S4S A;  3QP4 A;  4MEZ A;  4BL2 A;  4N1X A;  3IS2 A;  3BEB A;  3S7O A;  5A91 A;  1SKF A;  4CJN A;  3L7H A;  1F98 A;  2OWH A;  2V0W A;  4QY6 A;  2W3E A;  3KSF A;  3C4P A;  1NLY A;  5TFQ A;  3DWK A;  1XFN A;  4HBU A;  4KZ5 A;  5HL6 A;  1XGI A;  1XP4 A;  4FTX A;  4HH3 A;  1F2K A;  2ZQ8 A;  4X53 A;  2PYP A;  4WEL A;  1OPX A;  4M4X A;  2PT7 A;  1C3B A;  3FKV A;  4OP8 A;  4JGR A;  4DN0 A;  2V2F F;  5F68 A;  3G2Y A;  3OOV A;  1TF1 A;  3ULF A;  2OLU A;  3A3D A;  3T4T A;  4K91 A;  3OPP A;  5FAS A;  4N1H A;  1KDS A;  1SDN A;  2EXA A;  3C5A A;  2PR6 A;  3N6I A;  1PI4 A;  2FFY A;  3F1N B;  1XFQ A;  1LSX A;  4OOM A;  1CJF A;  3A0V A;  3H7W A;  5DF7 A;  2XA7 M;  3G34 A;  5FQK A;  3CPT B;  4RQ9 A;  3D4F A;  2Y2G A;  3VOY A;  2H5S A;  3BYD A;  4PPR A;  1MWS A;  1YMS A;  5KMW A;  4Y3I A;  3OPH A;  3CJM A;  2Y55 A;  2H0Y A;  3MZF A;  1FCN A;  2PDR A;  3NOP C;  1SCW A;  5I5L A;  1TS7 A;  4NXE A;  2YKF A;  5AJG A;  4GS9 A;  4ARZ B;  3RH8 B;  2HDU A;  3C4O A;  5HDS A;  3PHY A;  4EQI A;  4BBU A;  4S2P A;  4GB7 A;  4D2O A;  3E2L A;  1JTD A;  1VET A;  2L4R A;  4BD0 A;  2XDM A;  5BOH A;  3UDI A;  4OPQ A;  2Y2O A;  1K56 D;  3LY4 A;  1RGZ A;  5L2F A;  1PNE A;  4OVD A;  4OH0 A;  2B95 A;  2ZC3 B;  4WMC A;  1YLT A;  3AGD A;  2J7V A;  2HP6 A;  1DY6 A;  4DE1 A;  4PAU A;  3S7Q A;  2Z2M B;  2ZC7 A;  1ACF A;  3D9Y A;  1NLZ A;  2JE5 A;  3M6B A;  2V1A A;  3T1S A;  1S1Z A;  3BRM A;  3UPO A;  2QKP A;  4IUH A;  5HAP A;  5FDS A;  2XFS A;  5IHV A;  1ZC2 A;  1K54 C;  3PBR A;  4HOI A;  4GDN A;  5TBM B;  3L9K A;  3SS4 A;  2QJ5 A;  3Q1F A;  3SS5 A;  4LFU A;  4ZBE A;  2PBY A;  5F6A A;  1CEG A;  5F82 A;  4GHI A;  1OT9 A;  4MLL A;  2WGW B;  2R9X A;  4NET A;  4ID4 A;  4BLM A;  3S4X A;  5DTK A;  3UO9 A;  3ZFZ A;  1KE4 A;  5F83 A;  3P09 A;  3WS1 A;  4NKP A;  3HUN A;  4JXV A;  2C6W B;  2R78 A;  2O0Y A;  2QZ6 A;  3N8R A;  1KGF A;  5J4E A;  1K57 A;  3H9W A;  3IF6 C;  1YKD A;  3RXX A;  2VGJ A;  4XT2 B;  2W3F A;  4FUW A;  1MY8 A;  4C6Y A;  5FI6 A;  4KZ4 A;  4GDB A;  3U2A A;  4F3L B;  2PD7 A;  3ZQ5 A;  4NXG A;  1G5U A;  2XSS A;  3A3E A;  3ZG0 A;  3S1Y A;  3HLW A;  2EXB A;  4ZJ1 A;  3ZCZ A;  2JKT M;  2PBD P;  2H28 A;  3UME A;  4KG6 A;  5EE8 A;  3QP6 A;  3GV9 A;  4JXW A;  2Y59 A;  1K4E A;  4JXS A;  3WRT A;  2EWV A;  3UB5 P;  5FEF A;  3GMW A;  1YPR A;  2HJ9 C;  3VP4 A;  1J3W A;  2QHK A;  3VE4 A;  4P6B A;  4S2I A;  2D02 A;  4DE0 A;  4KZ8 A;  1P9W A;  1XA7 A;  3D3O A;  3G32 A;  2V1Z A;  5AQ7 A;  4Z1W A;  2XFT A;  2ZM8 A;  4MBK A;  1PI5 A;  5FDH A;  3BFG A;  4ME4 A;  3NDE A;  2HGV A;  2KOI A;  3IF5 A;  1XGJ A;  5FL3 A;  1H5X A;  1JWP A;  3ZVT A;  4KG5 A;  4MDZ A;  3IXB A;  2WKI A;  5L8M A;  4PM9 A;  4AFI A;  4CQH A;  3ITA A;  3QP5 A;  4P85 A;  3ZYT A;  1XA1 A;  1P9R A;  4YOF A;  1FOF A;  1WYC A;  2ZL1 B;  1GSV A;  1IKG A;  1MKI A;  4JGO A;  4EBN A;  3AGF A;  4JF5 A;  3QNB A;  2ZQ9 A;  3LY3 A;  1NRF A;  2LB9 A;  2JKG A;  1MZU A;  3QP8 A;  5GHY A;  3OC2 A;  2WZX A;  4R3J A;  4ZDX A;  3SH9 A;  4Q0I A;  1ERQ A;  3CIT A;  1XJ3 A;  3DTI A;  3MR0 A;  3O88 A;  4N9L A;  4GJ4 A;  1VQQ A;  3WWX A;  1KE3 A;  3ZHH A;  4O01 A;  1PRQ A;  5GLB A;  2VZW A;  3PAE A;  3TSG A;  3DTE A;  2DCF A;  4Q0H A;  3EQV A;  2JKT I;  1IYO A;  1ZKJ A;  3K3D A;  1K6R A;  1G6A A;  3ZNY A;  2XQZ A;  4QD4 A;  5M18 A;  1W5D A;  1D06 A;  2EX2 A;  2DNS A;  1F9I A;  4MN7 A;  1GSW A;  3IXH A;  2VA0 A;  1GHM A;  2ACG A;  3B47 A;  1SHV A;  4R1G A;  3TJZ C;  1DJA A;  3DTM A;  4B9O A;  2IA2 A;  1JTG A;  1YQS A;  1O7E A;  4A5R A;  1L2S A;  4B88 A;  1O07 A;  4HQA A;  3LR4 A;  1ERM A;  1OT6 A;  3T50 A;  3BLM A;  3F1N A;  3EWK A;  2QYB A;  1TS8 A;  2M7V A;  4EBP A;  1A0K A;  2JCH A;  2QWS A;  3CPT A;  3FWL A;  1NYM A;  3JVU A;  3T4O A;  5DTS A;  4Y13 A;  2XF3 A;  1W63 M;  2G7U A;  2ZOH A;  2OOL A;  5FI7 A;  3EOI A;  1NY0 A;  4Y0T A;  1S1Y A;  3C30 A;  1P0Z A;  4OQH A;  1LL8 A;  3IXD A;  5EM0 A;  3S7N A;  4PMA A;  3C8C A;  2VGL S;  3KYZ A;  5E2H A;  2W3G A;  3MXR A;  5C5K A;  4EBL A;  4ARZ A;  3RXW A;  2HP9 A;  2ZQ7 A;  4HIA A;  5KZH A;  4EUV A;  3ITB A;  4DE2 A;  3HLD A;  4L9F A;  1ESU A;  3UE6 A;  3BQA A;  1TEM A;  4JF6 A;  4JBF A;  5HAQ A;  1ES2 A;  2V0U A;  3MJQ A;  1KDW A;  4Y17 A;  4E04 A;  2C5W B;  3GRJ A;  3EEH A;  5KSC A;  3KSG A;  3LFV A;  4WL9 A;  3PXP A;  1N9L A;  4LPZ A;  4HP9 A;  4WZ4 A;  2JC7 A;  2X02 A;  4R38 A;  2EX6 A;  3H82 B;  3VP2 A;  3OBF A;  1IOU A;  4MCW A;  3UY6 A;  2OAQ 1;  3UPP A;  5CGX A;  3C38 A;  3E98 A;  1N4O A;  5AQ9 A;  1TD5 A;  2GZA A;  2IWD A;  5TBM A;  3UE3 A;  5HWW A;  2BTF P;  2ZBB A;  3GQZ A;  4KZA A;  4LLO B;  3DW0 A;  3CUE A;  2GJ3 A;  4Y0O A;  2NUT C;  4Q0J A;  1W63 Q;  4BD1 A;  1WE4 A;  4YIN A;  3NCK A;  4N92 A;  1H3Q A;  1OTB A;  2L1M A;  2WGW A;  4KQQ A;  1TVF A;  5EVI B;  1L0E A;  5FAT A;  5HL1 A;  4BBV A;  5HX9 A;  1FSW A;  5EVL A;  1NZO A;  4HP4 A;  3B42 A;  3MXQ A;  5TR7 A;  5K5B A;  1IYS A;  2VLG A;  4X1L A;  4WEJ A;  3KYQ A;  3MQO A;  1HVB A;  3WS0 A;  5FQM A;  4XT2 A;  2E8I A;  5A8B A;  1UWN X;  3LUQ A;  5CXW A;  2WAF A;  1XPB A;  4P87 A;  4LV1 A;  3DWZ A;  4WMC D;  4HEF A;  4F3L A;  4CLC B;  3GDI A;  2NUP C;  2WAE A;  4LCL A;  2XRO A;  2Y8H A;  1FIK A;  2W1T A;  3MKE A;  1S0W A;  2Y2P A;  4IBX A;  3PBN A;  3VSL A;  3LI9 A;  1FIL A;  1H8M A;  1K55 C;  1NZU A;  2I72 A;  3IHA A;  1BLH A;  3ICY A;  5GLA A;  1K4F A;  2PHY A;  2J3T D;  2ZM0 A;  3WS2 A;  3DAV A;  1J9M A;  4JXG A;  3EEA A;  3CI6 A;  4WEK A;  4GZB A;  4HY8 A;  1Y28 A;  4X6T A;  3JVV A;  1GA0 A;  2O9B A;  5CHU A;  3RTY A;  3G30 A;  4GKU A;  2ZMF A;  3IQA A;  4GW9 A;  2H10 A;  4U3T A;  2ZD8 A;  1N9B A;  5GHX A;  1H8Y A;  4M3K A;  2JKR M;  5DF8 A;  5F69 A;  2J3T C;  4WYY A;  3HVF A;  1PIO A;  3NEC A;  2Q9N A;  3HLB A;  3HBR A;  4FH2 A;  1EWZ A;  2V8F A;  1JNU A;  3AGE A;  1G68 A;  2KX6 A;  3ZG8 B;  1T19 A;  1DRM A;  3KYE A;  1NJ4 A;  1DP6 A;  4BBT A;  5F1G A;  1ZG4 A;  1CI8 A;  4K0W A;  4OQG A;  4U0T A;  3VP0 A;  1JWV A;  2ZL1 A;  1ONG A;  1VB6 A;  5EM1 A;  4OKP A;  5FSR A;  4EW7 A;  1LLB A;  2WKE A;  3CZD A;  2Y2J A;  1IEM A;  3PBT A;  4RX2 A;  4O0P A;  2PAV P; 
#chains in the Genus database with same CATH homology
 4JGP A;  1OTD A;  2GX5 A;  2KDK A;  1P97 A;  3V67 A;  4Z1W A;  1F5M A;  3LIE A;  4FSF A;  2PR5 A;  4DJ3 A;  2XRN A;  4NXF A;  3BY9 A;  4ME4 A;  2HGV A;  4WLA A;  1OJ5 A;  2KOI A;  4I3I A;  4I38 A;  3RFB A;  2VGL M;  3PBQ A;  5FL3 A;  3UB7 A;  3MF0 A;  5IU1 A;  4MDZ A;  4R3A A;  4NEE D;  3CLO A;  5L8M A;  4AFI A;  4HH2 A;  4CQH A;  2OWJ A;  4FOF A;  3NOU C;  4BWI A;  3ZYT A;  4YOF A;  1P9R A;  2ZOI A;  2P08 A;  4G3W A;  5DFX A;  2V1B A;  1GSV A;  3UB8 A;  2FH5 A;  1ZTU A;  4JGO A;  2VX8 A;  1STZ A;  3BJN A;  5G4Y A;  5HWV A;  3IBR A;  2GNX A;  4OOL A;  3R4K A;  2P7J A;  1V9Z A;  4BMW A;  1G6O A;  3R7W B;  1DP9 A;  4DMZ A;  2LB9 A;  3LR0 A;  4KUO A;  4HJ6 A;  1MZU A;  3LIF A;  3OC2 A;  4LRZ E;  2INW A;  2HJE A;  3FC7 A;  3LIC A;  3OLO A;  2EA9 A;  3OCN A;  4Q0I A;  5DJT A;  3CIT A;  1XJ3 A;  4L9E A;  4HJ4 A;  1NRJ A;  2W27 A;  3FG8 A;  3MR0 A;  3LR5 A;  3TW8 A;  3O5Y A;  1YSP A;  4IUK A;  1N9N A;  1T18 A;  3HJK A;  3LYX A;  4DJ2 A;  4GJ4 A;  2VJW A;  5EFW A;  4O01 A;  4PHT A;  2EWW A;  3PR6 A;  5F5Y A;  3MFX A;  2XA7 S;  2VZW A;  3UMD A;  3GEC A;  1OTA A;  2JKR I;  3E0Y A;  3NHQ A;  4H6J A;  4Q0H A;  4P6Z M;  3EQV A;  2W1T B;  2JKT I;  3P7N A;  1GSX A;  3K3D A;  5CX7 A;  2Y79 A;  4HHD A;  4KUK A;  3IBJ A;  2MJ6 A;  1D06 A;  4MN5 A;  4BJP A;  4WF0 A;  1F9I A;  4MN7 A;  1GSW A;  2VA0 A;  3SW1 A;  3B47 A;  4O8G A;  4WN5 A;  4I39 A;  5DJU A;  2WKQ A;  3TJZ C;  3F1P A;  3MQ0 A;  5HDD A;  1S4R A;  4ZRR A;  4R6L A;  4K08 A;  4B9O A;  2IA2 A;  3E4Q A;  2HF6 A;  5HDC A;  3BWL A;  1OJG A;  1S4S A;  4KQO A;  5HWT A;  3NJA A;  4EU0 A;  3IS2 A;  4HQA A;  4B93 A;  2K31 A;  4YWZ A;  4H6J B;  3S7O A;  3LR4 A;  3NOT C;  1OT6 A;  1F98 A;  2OWH A;  3T4Q A;  3T50 A;  2V0W A;  3F1N A;  2W3E A;  3KSF A;  3EWK A;  1MKM A;  2QYB A;  1TS8 A;  2M7V A;  1EW0 A;  3TRC A;  3EGX C;  2K2N A;  4G3K A;  2LB5 A;  4I3A A;  3VE3 A;  1NLY A;  4HJ3 A;  2BAS A;  1XFN A;  5HL6 A;  2QWS A;  2W3D A;  3JVU A;  4HH3 A;  3T4O A;  5IS1 A;  2PYP A;  3MMH A;  3P01 A;  1OPX A;  4WEL A;  3VV4 A;  4M4X A;  1W63 M;  2PT7 A;  2G7U A;  2ZOH A;  2OOL A;  3HJI A;  2K7S A;  4JGR A;  4DN0 A;  3EOI A;  3F1P B;  5J3W A;  4IJG A;  4EES A;  5IT5 A;  5F68 A;  3OOV A;  1S1Y A;  2B02 A;  3C30 A;  1P0Z A;  1TF1 A;  3UB9 A;  3ULF A;  3DBA A;  2A24 A;  1LL8 A;  4L9G A;  3T4T A;  3S7N A;  3C8C A;  2VGL S;  4ETZ A;  3KYZ A;  1ZHH B;  2W3G A;  4CLC D;  3H82 A;  3IS2 B;  5C5K A;  2DMW A;  3KO6 A;  3T4S A;  3UB6 A;  1XJ2 A;  3HCY A;  4ARZ A;  3FPV A;  2PR6 A;  5KIZ A;  1KOU A;  2A2L A;  4HIA A;  3F1N B;  1XFQ A;  4EUV A;  1LSX A;  4OOM A;  1S66 L;  4L9F A;  3A0V A;  3H7W A;  5DFY A;  2XA7 M;  3MQQ A;  2M1C A;  3UE6 A;  3BQA A;  4RQ9 A;  2V0U A;  3MJQ A;  4E04 A;  3EEH A;  3KSG A;  3KX0 X;  3LFV A;  4WL9 A;  4UQI M;  1WA9 A;  5HPF A;  4PKY A;  4WUJ A;  4UEY A;  4Y3I A;  2W0N A;  3PXP A;  2A24 B;  1N9L A;  1V9Y A;  4I5S A;  4LPZ A;  2PDR A;  4HP9 A;  3NOP C;  3C2W A;  5I5L A;  4R38 A;  2KLI A;  1TS6 A;  2PYR A;  3H82 B;  1TS7 A;  4NXE A;  2YKF A;  5AJG A;  3OBF A;  4GS9 A;  5LBR A;  1IOU A;  2VV8 A;  3RH8 B;  4ARZ B;  4PKY G;  4MCW A;  5AVF A;  5HDS A;  3EGD C;  5HD5 A;  1XJ6 A;  3BY8 A;  3PHY A;  4BBU A;  2OAQ 1;  3FPW A;  4II7 A;  5DF9 A;  4LRY C;  3H7W B;  3C38 A;  3E98 A;  4P6Z S;  4Y5F A;  3PBO A;  1TD5 A;  2GZA A;  5TBM A;  2L4R A;  3LI8 A;  2YKH A;  3UE3 A;  5HWW A;  2L0W A;  3K3C A;  1NWZ A;  2ZBB A;  4R70 A;  1YSQ A;  4LLO B;  2B18 A;  2FZ0 A;  3CUE A;  2GJ3 A;  2NUT C;  4Q0J A;  1W63 Q;  5G4Z A;  4CLC A;  3KSH A;  1H3Q A;  3OCL A;  5DKL A;  1OTB A;  2L1M A;  3A0R A;  4MMN A;  2W1R A;  2ZMV A;  1UWP X;  4PAU A;  3S7Q A;  2PD8 A;  4BBV A;  3T4J A;  4GS9 B;  2O9C A;  3EQU A;  4L0L A;  3VOL A;  4HP4 A;  4EXO A;  1NLZ A;  3B42 A;  3MXQ A;  1TS0 A;  2V1A A;  2WKR A;  5HZH A;  4JGQ A;  1S1Z A;  2QJ7 A;  5K5B A;  2QKP A;  5MC7 A;  3F1O A;  2VLG A;  4EEP A;  4WEJ A;  4HI4 A;  3KYQ A;  4IUH A;  3T4K A;  3MQO A;  2VV7 A;  4GCZ A;  3PBR A;  2CMN A;  3S7P A;  4HOI A;  2HV1 A;  5TBM B;  2WKP A;  2Z6C A;  2V9A A;  1LT0 A;  3LIB A;  4LRX C;  4XT2 A;  3PBS A;  5AVE A;  2QJ5 A;  1DP8 A;  1UWN X;  5A8B A;  3LUQ A;  5HD3 A;  2M7U A;  1BYW A;  4F3L A;  4IHQ A;  4CLC B;  5F6A A;  3GDI A;  2NUP C;  3W2Z A;  3BQ8 A;  2P04 A;  3BW6 A;  2D01 A;  2XRO A;  4GHI A;  1UGU A;  2Y8H A;  1OT9 A;  2W1T A;  3PBN A;  5KSH A;  3LI9 A;  1ODV A;  2JHE A;  1H8M A;  1T1C A;  1D7E A;  1OTI A;  4I3J A;  3ICY A;  4KQD A;  3CUE C;  3D72 A;  2PHY A;  2J3T D;  4CLC C;  4NKP A;  1VHM A;  3CAX A;  3F1O B;  1X0O A;  3PYP A;  2JN7 A;  3K2N A;  1OTE A;  1IFQ A;  2O0Y A;  2R78 A;  3CI6 A;  3EEA A;  4WEK A;  2VEA A;  4HY8 A;  5J4E A;  1Y28 A;  3H9W A;  3JVV A;  3LIA A;  1YKD A;  4XT2 B;  2W3F A;  2J3W A;  2O9B A;  2VKS A;  3RTY A;  2O99 A;  2ZMF A;  4GW9 A;  2J80 A;  5DKK A;  1LSV A;  3U2A A;  4F3L B;  2PD7 A;  2VV6 A;  4EER A;  2JKR M;  3ZQ5 A;  4EEU A;  4NXG A;  4EET B;  3G6O A;  4GHI B;  5F69 A;  2J3T C;  2XSS A;  4G3V A;  5J7E A;  2JKT M;  1MC0 A;  4ETX A;  4NXB A;  2Z6D A;  3KSI A;  2H28 A;  4UQI S;  3UME A;  2W3H A;  4GLQ A;  4QPR A;  2OAP 1;  3T4L A;  1YAX A;  4EQ1 A;  1S67 L;  3LR3 A;  1T1B A;  1JNU A;  5TJJ A;  4HNB A;  3E4P A;  1LSW A;  1N9O A;  3B33 A;  2EWV A;  2KX6 A;  4CLC E;  1T1A A;  1T19 A;  3A0S A;  3CWF A;  5HPI A;  3E4O A;  1DRM A;  3LID A;  5HSQ A;  1DP6 A;  4Y2F A;  4BBT A;  2I9V A;  4MN6 A;  2O9A A;  2HJ9 C;  4YNR A;  2QHK A;  1VB6 A;  4EW7 A;  3VE4 A;  3TE8 A;  1G28 A;  2D02 A;  3PBT A;  1P9W A;  1XJ4 A;  4O0P A;  3D3O A;  3R7W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...