4YO7A

Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi-511484) with bound myo-inositol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
287
structure length
287
Chain Sequence
TGDSGQKVIGVSISNLDEFLTYMQDAMKEEAANYPDFEFIFSDAQNDSTQQMAQVENFISRNVDAIIVNPVDTTSAVDIVNMVNDAGIPIIIANRTFDGVDQATAFVGSESIQSGLLQMEEVAKLLNNEGNIAIMDGELGHEAQIMRTEGNKQIIEEHDGLEVVLQGTAKFDRSEGMRLMENWLNSGTEIDAVVANNDEMALGAILALEAVGKLDDVIVAGIDATPAALEAMKEGKLDVTVFQDAKGQGATSVKVAVQAANGEDVEDAMIPYELVTPENVEEYEAKY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Solute binding protein
molecule keywords Sugar ABC transporter (Sugar-binding protein)
publication title Crystal Structure of an ABC transporter solute binding protein (IPR025997) from Bacillus halodurans C-125 (BH2323, TARGET EFI-511484) with bound myo-inositol
rcsb
source organism Bacillus halodurans
total genus 104
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2015-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yo7A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yo7A01
3K9CA 3RQIA 1NXVA 3RVRA 4IMJB 2F8SA 1NATA 1SRRA 3LTEA 3QELB 5ABPA 2NT4A 3RVQA 3ILYA 1DBPA 1Z13A 4MQEB 1JF8A 3DLHA 3HJFA 5T3YA 1F4VA 1ZH2A 3N6VA 1TLFA 4LDAA 5KQPA 3H5TA 1QQBA 3F6PA 3EULA 3CZCA 3RVPA 4EUKA 1E6MA 4IF4A 1ABEA 4MRMB 4EVQA 4YP9A 1YTUA 4MS1B 3HS3A 1DRJA 2A9PA 4HNRA 1JX6A 4MPTA 4RK6A 3LUJA 3HSYA 4RXMA 4DQDA 1D4ZA 4ETMA 3G1WA 1JL3A 2FN9A 1NXTA 1VRVA 2RGYA 2H0AA 5E3JA 3LFTA 4YRZA 4Z4FA 2GBPA 2A9QA 1JDPA 3RVJA 4Z9BA 1Z26A 2JVJA 3F7NA 5GOTA 1K66A 2HJ9A 3KTOA 3A0UA 3HO1A 2A9RA 2E4VA 2QV0A 5TPWB 1Z2EA 1QP0A 1SXGA 3LMKA 4JAVC 1ISRA 2MYTA 2RJOA 1ABFA 5C5CA 1SXIA 2ZWMA 1GUBA 4M88A 3JPWA 2ZAYA 4EVSA 4Q7EA 3QEMA 3CG0A 5TQ0B 3RVMA 4RV5A 4Z4IA 1DCKA 2IPLA 1URPA 4WXMA 3SNKA 1PUXA 1JFVA 5TE9A 2FEPA 2L18A 4MQFA 1YMUA 4FB4A 2IPMA 3QX8A 5DTEA 5B3JC 3JY6A 2PE5A 3CG4A 1B00A 1DZ3A 4F8JA 2YHBA 3CTPA 3HUUA 1ZAYA 1RXEA 2R4QA 1KGSA 2QR3A 2CWDA 1D2AA 3H75A 4EGSA 1USGA 4KVFA 4MLDA 1EWKA 5TQJA 4EY3A 2E4WA 6ABPA 3FDFA 3H6HA 1LJLA 3IPCA 2DRIA 2JCGA 3M9WA 2ID7A 1M5UA 1LJUA 1QP7A 3E3MA 4Z9AA 1NXPA 2MYPA 3GYBA 1C0EA 1UDRA 4OG2A 2WRZA 4MGEA 3C3WA 8ABPA 2PUDA 3I09A 4NQRA 1Z12A 5EWMB 1EFAA 3K4HA 3Q7SA 3H6GA 2LIVA 3MQ4A 4YR7A 4TN5A 1DP4A 3O75A 4G86A 3L6UA 5EWMA 4ETNA 4F12A 5IX8A 3O1HB 3NNNA 3GBPA 1TMYA 3B2NA 3D02A 5PNTA 1NTRA 3HZHA 4KQCA 5TQ2A 4LE1A 4ZPJA 1ISSA 2E4XA 3SG0A 4IILA 4EYGA 2IYNA 3TX6A 5HKOA 5KWSA 1AB6A 6CHYA 5FWXA 3T95A 1DC8A 2IDMA 2PL1A 2MYNA 4PYRA 2CD7A 2CHEA 2OENG 3KS9A 2WJWA 1M2EA 1P8AA 3FFXA 4GNRA 3F73A 3TMYA 3SQNA 4N03A 3RH0A 2PUGA 5IUKC 5B3JA 1LK0A 5D2CA 3M6MD 2PUAA 3M9XA 3ROTA 3QLTA 3T8YA 1USIA 3NHZA 2IOYA 1QP4A 4PZ0A 4JP1A 3SY8A 4RY8A 5ED4A 5JS1A 2FN8A 4Q6WA 2E4UA 3DBIA 1DG9A 2WJAA 3KYIB 4G97A 4D6YA 4LZLA 4DN6A 3NHMA 1ZHHA 1Z18A 4QYWA 2LBPA 1NXOA 1Z17A 2PAFA 1KRWA 2PLNA 3W9SA 4EYOA 5IEBA 4KK3A 2FSPA 5JNVA 1TM2A 4P1ZA 1YMVA 3RVKA 5DKFA 5BR1A 3H1EA 1CYEA 1P6UA 2JRLA 3T38A 1K68A 3HDGA 1GUDA 1Z16A 4N0QA 4UHKA 1BVHA 4G0XA 3O2SB 2R47A 4NCAA 4FE7A 3C3MA 1QNLA 4WZZA 2QXYA 3HXMA 3C6QA 1ZN2A 4F11A 5KI6A 1ZVVA 4W5OA 3JS5A 3H5IA 3LUKA 4W5NA 7ABPA 2LP4Y 4KV7A 1LBHA 3CHYA 3RVSA 3HCWA 5DCLA 1XWWA 4E7PA 2WWVD 4D74A 3HK2A 2TMYA 1DC7A 1A0OA 1PNTA 4YCSA 3CU5A 1DBQA 2MSKA 1MVOA 5KC8A 2FMIA 1JYEA 2VK2A 4QPJC 3QEMB 1FQWA 2WMYA 3N0XA 3O2QB 4XLTA 5HSGA 4JA2A 1TVMA 2H3HA 5T7BA 2AYZA 3EGCA 4LDZA 4RK7A 4ZYLA 4L4UA 1L5YA 2QVCA 1E6KA 3KYJB 1R8JA 3LUGA 4RZSA 1JWLA 4MQFB 2BGGA 2A9OA 4G0PA 4RKRA 2QU7A 1DCFA 3H5LA 5IUNC 2O20A 5I4CA 2IPAB 1W9HA 4PICA 1NXWA 1GCGA 3OO1A 3ROFA 3E61A 2JBAA 2P4UA 2PL9A 2PUBA 4W5TA 2VUHB 2IPNA 3GA5A 3OQMA 5KQLA 3I45A 1DJMA 1PEYA 2IKSA 2L2QA 3EAFA 4UHJA 4XFKA 4RSMA 1Z2DA 2HQBA 4WT7A 1L5ZA 5KQGA 4LRQA 4RK0A 1ZY2A 1EWTA 2OQRA 4XXHA 1PNRA 3ILHA 4HNQA 4PE5B 4JASB 3Q15C 3H5OA 1U04A 3JVDA 4MR8B 3A10A 3N8IA 4TLMB 5IEJA 3EQ2A 1QMPA 4G0MA 3BRSA 3KHTA 1LBIA 2FW0A 3CS3A 1DRKA 3FGZA 4N41A 1JH9A 4MS4B 4KRFA 4JOQA 1BDIA 4MR8A 3JPYA 4YGXB 1BDHA 5TQ2B 4Z99A 3F6CA 5TPZA 3MF4A 1I3CA 1S8NA 1HEYA 4LE2A 3UUGA 3LUFA 1XHFA 2E4ZA 1RZRA 5FWXB 2CHFA 4MS4A 3HM9A 4XAQA 2FMHA 3CNBA 2FTKE 2FEWB 3OM0A 3QK7A 4WUTA 3OO0A 2NUBA 1GCAA 2L17A 5FBKA 3N53A 1YVUA 2QW1A 4IGAA 4Z4GA 3CFYA 1KRXA 3N0WA 3OM1A 3H5WA 4RY0A 5JNRA 5EWLA 1ZGGA 2LUOA 4CBVA 5F64A 4L85A 2NZUG 3LUHA 3O21A 1FSPA 1D1PA 3LUAA 4S04A 1D5WA 1KMIY 5BQ3A 1VLZA 2LPMA 1OXBB 4MAAA 3JVIA 5DGCA 1FFSA 1MIHA 2AYXA 5KC9A 3O1IC 4Q6BA 1SXHA 3KSMA 5C5EA 4KREA 4RS3A 2PUEA 1W25A 4H3KB 2F8TA 4MS3B 4G0ZA 1GLGA 1QO0A 2FQWA 1JFTA 5KQMA 1YK1A 5CHYA 4P98A 5CNJA 3LKBA 3OLZA 1BAPA 3HVRA 1EHCA 3KJXA 2RJNA 4N76A 3R0JA 4MS3A 2XDYA 4ETIA 3MYYA 3GL9A 1P6QA 4G0QA 2V0NA 3MMNA 3RVNA 4NCBA 2QVGA 3N0RA 4KMRA 2QSJA 2QZJA 3OLXA 2JVKA 4LX8A 1ZITA 4TMYA 4D6XA 3H1GA 5FWYA 3TD9A 5JNSA 4PEVA 1JHZA 3S99A 3BREA 5IULC 4EVRA 3A0RB 2FQYA 3CKMA 3D8UA 3QEKA 4KQ9A 2WY2D 2B1JA 3OLVA 2GX6A 4OTZA 3DZDA 3Q41A 1MAVA 4RU1A 3HEBA 5EWJA 2PUFA 1PEAA 2MSLA 1EWVA 4RK4A 2YHAA 3HV2A 3P9YA 4XASA 4MLCA 1YS7A 3G85A 3BILA 2P9HA 2NZVG 2JB9A 4XARA 4E7OA 1U2QA 3KLNA 1ZDMA 3IP7A 5CNKA 2M98A 1U2PA 3LKVA 2VYCA 4LE0A 2PJUA 3H1FA 3TB6A 3QX9A 3IP9A 1TJYA 1ZESA 2HPHA 3OMXA 3EDCA 3BRQA 3EQZA 2PKXA 3OMWA 5IBQA 3L49A 2FXIA 2RDMA 1RNLA 3QELA 1YK0A 2JBAB 1C4WA 1U8TA 5CNMA 3Q9SA 1PHRA 4MQEA 4RWEA 2MSWA 2I6FA 1P2FA 1JFSA 3IP6A 2FKAA 3KLOA 3FMVA 4G0YA 1IIBA 4MRMA 2N9UA 2R25B 4W5RA 4MS1A 3T6KA 4Z4CA 1MB3A 2FQXA 4TLLB 3OLWA 3QLUA 3FFTA 2X7XA 1A2OA 4WWHA 3KG2A 3RVLA 1FFWA 2JVIA 1H9CA 5HQJA 4JB0A 3CLKA 5HM6A 1E2BA 3N75A 5JNWA 4GPAA 1YIOA 2PUCA 3H5VA 1CEYA 1DCMA 1JYFA 3IDOA 2FMKA 5TPWA 4MYRA 3O1JC 9ABPA 3MIZA 2J48A 4OATA 4YV7A 1ZGZA 4N47A 1A04A 2HSGA 5TQ0A 3UK0A 1VPWA 3FFWA 3EJWA 1J56A 2KYRA 2ID9A 3QLVC 2FVYA 4ML3A 4MR7B 3CZ5A 4OBBA 3KKEA 5GQSA 1USKA 3C3KA 4B09A 2GKGA 4RXTA 1F51E 4RXUA 4NICA 5TPZD 4RDCA 1M5TA 4F3TA 3SM9A 4KZKA 5BRJA 1RZRD 2GWRA 4MR7A 1WETA 2PMCA 4W5QA 3GRCA 4Y9TA 5JNTA 1D1QA 1T34A 3LOPA 3LUDA 1JBEA 1E6LA 3TO5A 1RPJA 2FLWA 1Z25A 1DBWA 3IPAA 1NXSA 4HYEA 4JB2A 3JTEA 5EWLB 3KCNA 5JNUA 3SAJA 2FMFA 4OLBA 1JLKA 2M1ZA 3GT7A 3MM4A 1OXKB 4O5AA 4Z4EA 1NXXA 1YS6A 4FE4A 4OLAA 1M2FA 2HQOA 3OQOA 1BA2A 3UKJA 1QQAA 2VUIB 2E4YA 4Z0NA 4MR9B 3NNDA 4Z4HA 3OQNA 1NY5A 2MYUA 1Y1LA 3DGFC 1QO0D 2JK1A 4YLEA 4YS6A 5IC5A 3CRNA 3DGEC 3O74A 4KK4A 4ZJPA 2W42A 1ZH4A 4IRXA 1MB0A 4MR9A 4DADA 1QKKA 2R48A 4EYKA 4O1HA 3URMA 3GWGA 4RK5A 3RVOA 4YO7A 3DLBA 4RY9A 5IUJC 2NT3A 4QYMA 2Q5CA 1XHEA 3O2JA 1CHNA 1RXIA 4RK1A 5FWYB 2L19A 3QLUC 1APBA 1QPZA 1FFGA 5JS2A 3HUTA 4NV3A 4G0OA 5BRAA 3Q7TA 4KNYA 4S05A 3MA0A 3QLVA 2HQRA 3HDVA 4F06A 4H60A 4KPYA 2WB4A 3I5AA 3VNAA 4EYQA 5EWJB 3GV0A 1Z15A 4ZMRA 4KFCA 4QICA 3VNBA 4WXEA 3OLYA 5DLEA 4RKQA 1AB5A 4IMIB 4N0PA 3IP5A 3Q7RA 1U0SY 3BBLA 3GBVA 3LUCA 4HNSA 3A3KA 3NBMA 1VKRA 3NNSA 3EODA 2B4AA 2FEKA 1EAYA 3I42A 4YWHA 3C97A 4O1IA 5FBHA 2GI4A 5CNIA 4ZMSA 1SD5A 2FLKA 4H3HB 1JDNA 1BDJA
chains in the Genus database with same CATH superfamily
1E3SA 4K40A 2ZRAA 1JQEA 5FXMA 2FB9A 2VJMA 3CLHA 2XMQA 1MOZA 3CXUA 2ZFUA 1XRSB 5ICSA 1C1HA 4RFSA 4ESOA 1E79D 2JFBA 4JLBA 4DJAA 2ICAA 1PK9A 4E33A 4ZCIA 5BURA 3OA0A 3DP9A 1XEXB 3EULA 4OGFA 3ELBA 3ZDDA 1EUCB 1OYVA 3BDVA 1CD5A 3M89A 1VG1A 2O2CA 3RU7A 3R7NA 4EENA 4GVPA 2RGYA 1JBQA 4AKGA 2BFFB 2CXSA 3UNXA 3FG9A 2IP1A 2W6CX 3IELA 3K0EA 4H08A 4Y0VA 4Z7JA 4TS4A 3P5BA 3OEHA 3UAYA 3EC7A 1LQTA 3P9IA 4FQ7A 4JBNA 4WN9B 5DF1A 5IK2A 5I5GA 4PG8A 2QX4A 3FW1A 1WUTA 2FR1A 3KXLA 3OJ0A 4IRMA 3DUFA 1PFGA 3EPHA 1AKQA 3S2EA 3V7NA 2PHZA 2Q5LA 4I50B 4CNQA 2ZXEA 3FZQA 4L5CA 5EP1A 4M1EA 4DBLC 1JLHA 3OF2A 3O9VA 4UBMA 3VPSA 3IVRA 5B58T 3LUBA 1TRKA 3OSUA 4N65A 3LE8A 2QAGC 3SNKA 2XB9A 3E2PA 4G0VA 3F49S 3BD6A 2L18A 3L1KA 3AF0A 4IIGA 1W85A 1ZO8A 2FPUA 4EF4A 2VBIA 1GTJ1 5IJ0B 4PRLA 1E3EA 1HFJA 3GDGA 1YBMA 1V0JA 2NTVA 4BXOB 1T2EA 1TM1E 3KB6A 4R16A 3FUUA 2VJNA 4IXWA 4OPMA 1USGA 1N7GA 1GD1O 3A1NA 3R3JA 1GKYA 1WABA 4DBLE 3P9QA 4JJKA 3HLYA 1BFDA 1SPBS 5DV9A 1RWQA 4FBGA 2XTMA 3F5QA 1UBSB 1ZM3A 5HIIA 2CXQA 4P3KA 1NMZA 4QQ8A 1BDBA 3BN3A 2OGUA 2R1TA 4YMIA 2EBFX 3BJZA 3BQNB 3G5LA 5K8UA 1AHPA 3BQ9A 3CBGA 3VA7A 1UJ5A 4U0KA 1DT5A 4BVEA 2B1RA 2RGEA 2FA9A 4LYGA 4LFBB 1BYUA 1EJBA 3PYLA 1RRPA 4P7BA 4DYHA 4PCLA 4DXHA 3N8DA 3EC1A 1Y63A 3MT9A 3C7DB 5CT8A 4ZI5A 1AUVA 1RWOA 1P1FA 1P4SA 4P3XA 1LZKA 4G86A 2XYQA 3K8ZA 3WV4A 1D8TA 3C8HA 1C2TA 3G89A 3U3XA 3VPGA 1LI7A 1GQSA 2CNDA 3HDHA 1OH8A 2WWGA 3KKNA 2NUPA 2DSNA 4Q4AA 1YDMA 2H1CA 3NBUA 1XLUA 2DUNA 2QSYA 3PHGA 4IDNA 2FR0A 1KZHA 2BFOA 3RARA 1MGPA 1Q21A 2H17A 5CYOA 1CIPA 3TM5A 4F5DA 2WPDD 2WZQA 1Y3FE 4BNDB 1W4AA 5A3SA 2BH9A 4R2IA 5C1DA 4F6RA 1CP2A 1GZ3A 4WOKA 1VBMA 2QG9A 2DBVO 2GFIA 4EBFA 1PJ4A 3OTWA 5H3CA 2E82A 3F3MA 4PYRA 2OENG 4LNUA 4OL9A 3BKWA 1D6SA 1AE1A 1TM4E 1B41A 3EUWA 2GS9A 1BE1A 3PUKA 2EQAA 2P6MA 5BO5A 4KPEC 1V6AA 2Z3VA 3JYPA 2BKLA 3QOFA 4UHHA 3JQGB 1AZSC 1VJRA 2NPIA 3B1VA 2B25A 3RF6A 4YMGA 4QU0A 1JAHA 2PBLA 1E9DA 3KNZA 1FFXA 3SI7A 4DDTA 1MIOB 4LHZA 1XKQA 4JP1A 3FPBA 5JPIA 5EEGA 4V02A 1RIIA 1TUGA 4M9ZA 2P2YA 1AGPA 3QVOA 2YNMC 4HXYA 4QODA 5KVQA 1R74A 2GN0A 1AGNA 3EGVA 1DDIA 3JXEA 5FBZA 3JU3A 4D6YA 3IALA 4V03A 3MLAA 2GHIA 1ZHHA 5DNVA 2ZZNA 4CLEA 4RELA 4CF3A 2LV8A 1OLXB 1I2DA 1KDTA 3TAUA 2CYAA 1T3TA 2FEOA 4D5GA 3FMGA 4ZVOA 4C2BA 1WMBA 5FYDA 3U3KA 5GZ1A 4M0CA 3MWDB 2CDAA 3CIFA 5KPDA 5E95A 5DKFA 5AM5A 2NXCA 5A0FA 1E2JA 2NVOA 2ACEA 3L7AA 1MNAA 3K73O 4M1ZA 4S0XA 4WZAE 2V3WA 2OFWA 4OH1A 4JXZA 1V7PC 4OK5A 1W5SA 2ORVA 3BCHA 4ZI2A 2GAOA 5CLHA 1W5EA 2BDEA 3KJEA 4JBLA 5UKDA 1KJ8A 1PV4A 2IW3A 4B32A 2XRYA 1FTWA 1BXGA 1GGKA 1SIBE 4NK4A 3CX8A 4C5AA 2A0WA 1V16A 2R8ZA 2YV5A 5JH7F 3ZWAA 2POQX 3LBHA 2Q62A 3UJNA 1XG5A 4PPQA 4YMHA 4Z86A 3QW2A 3BHIA 3FTPA 3OT1A 3GDFA 3VO2A 1ILEA 3KYDA 1YHYA 5DLQC 1QFYA 1G3IA 3JVUA 3B1ZA 4LBWA 2QQEA 3N0XA 2HWYA 1Q19A 2ODWA 3DBRB 4AZ0B 2O8CA 1XTSA 3B78A 2WNIA 3LX8A 2XX3A 3I53A 4X8OA 2P40A 4RZSA 2GPJA 1H93A 4FS8A 1BWQA 2J0EA 4WLVA 2QQFA 1Y4ZA 4LJ8A 1C3EA 4MV7A 5KSWB 1R6DA 1Q44A 4A73A 3V8MA 2V98A 5IUNC 3VPFA 6GPBA 4C7MA 1J5XA 1K9VF 3AYXB 4PICA 1LEHA 1O03A 2PKQO 3SBOA 2H1OA 4CL3A 1QFSA 4B47A 1GRRA 1XTPA 5ALXA 5KJ1A 5EZ5A 1L4BA 4R0MA 1S3SA 4ZJZA 3B3QA 3UBMA 4BNWA 5JCJA 1C2YA 4ARIA 3ZLBA 1H69A 2EFJA 4HDMA 3EAFA 4XFKA 2AB0A 1IM2A 1JDSA 4U8GA 4H4EA 3S8MA 2H8KA 3UJ8A 4QEDA 4ALMA 1HTWA 4K9DA 2B0CA 2X8AA 3GIDA 1FDOA 2F3UA 4HAUA 1CB7A 4XXHA 5CA1B 1L5WA 5G4KA 1BTOA 2HLDD 3NRCA 2RE8A 3M3HA 4EH1A 5J4KA 3RSZA 4MV3A 2Q3HA 2HA7A 4LYAA 3WWCA 2IBMA 5T64A 1OH7A 2VDWB 3RS4A 2P5SA 4M9QA 2RGAA 2WUVA 1V3VA 4V0KA 3ICVA 4X1YA 5ERYA 1AQUA 1HE3A 1TIKA 3EQ2A 4J29A 2R2GA 2YYSA 4AF7A 1SKUA 4D1YA 4WBNB 3BXPA 1V5GA 4IQ8A 3LHIA 4KRFA 5IXYA 3VO9A 1BDIA 1O87A 2I80A 1YVDA 1ZW6A 2FVXA 1VHQA 1V45E 1L4EA 4GSKA 4JLWA 4RKFA 5K6RA 5ANRB 1UKVY 3ZV3A 5IZCA 3KM0A 3NDJA 2FDXA 3TUIC 5DASA 4MS4A 2HHCA 2OAEA 4G1CA 4GEKA 3PFFA 1SFRA 3I9V1 2P65A 3OJCA 3NEAA 2NUBA 3R3SA 3TLGA 4H0NA 4FC6A 3FYSA 2YKGA 1QZZA 2B3DA 3TFQA 2GN4A 4C3UA 4ALLA 3PUZA 3ASYA 1Y1QA 2G9VA 4ZTBA 3ZR4B 3ZVKA 1AKRA 2NZUG 1KI6B 3C3BA 3EZGA 2WMNB 3FIUA 4MLPA 1TMOA 4JP3A 6Q21A 4IG4A 1WSDA 3CEHA 3FPEA 1VLZA 2P9GA 3AR9A 1XDSA 2P91A 3GT3A 2PZAA 2YV1A 4G07A 2R3SA 3LVFO 2NZ2A 3ZHSA 1X1QA 3FF4A 3BGVA 4U7PB 3CE9A 2OK7A 2VPIA 4PN3A 3QMPA 1WJGA 1S4QA 1B3RA 1OZGA 1VE9A 3KPVA 3KTDA 4O4LB 4TTRA 4CM3A 4B3RB 5JBIA 5KQMA 1YK1A 1U7XA 5JY1A 1E9SA 5IBPA 4ENRA 5EESA 3OLZA 5EJFA 3VH3A 5EJAA 1V8BA 1XRLA 2HMTA 2WJGA 3MCTA 4P81A 4J3JA 2HZBA 1BMFA 3IYLW 1SURA 4LV6A 1K63A 4CIVA 1TIPA 4IH9A 5BP7A 5A5VA 1T9ZA 1TGYA 1CS0A 3PVCA 2HM7A 3BFKA 3KWJA 1SVWA 3AY6A 1CUVA 3CLSC 1PGOA 2QAIA 3MPOA 3O3NB 4Y98A 1JHZA 2G9QA 4FI3F 4QYIB 5GM1A 2GAIA 3BREA 5CVTA 4ZRDA 3GJYA 4JQSA 3BWDD 4LUCA 4DZZA 1XBTA 3D4LA 3OIWA 2C8LA 1QIGA 4R7TA 4B4UA 4IWXA 3WZLA 5CGQB 4ARZA 3U9SA 2JGDB 2B35A 1ULTA 2PUFA 3P2YA 3GPIA 3Q12A 5KOIA 4ZRMA 3E0QA 1EESA 4UDNA 2YIJA 1ZOIA 3W7VA 3IAEA 5ILQA 5I8ZA 1TA4A 1JQDA 1Z6YA 5CM9C 5D84A 5CM8B 2ZJ6A 2Q49A 3NHYA 1ZDMA 2WHPA 1L9XA 1BWPA 1CZLA 2OBMA 2PLRA 4K9OA 2NZXA 4X91A 3R76A 3RUIA 4YUXA 5I9NA 4XWGA 1FL9A 5DP1A 3IAM6 2ZJ1A 4KQIA 1OFTA 1I6MA 4PLFA 3FMPB 3R5KA 1LSOA 1ARZA 2XNDA 3SNHA 3UANA 1Y6GA 1N2ZA 2ID8A 1NBAA 1GG8A 1E98A 1CX9B 2PDAA 3NTQA 3B13B 4G4IA 2D5CA 3K9HA 3QELA 4O4IB 2BKAA 1C4WA 2JBAB 2P67A 3EXG1 1W6RA 4U3JA 3N7UA 4MQEA 2IIQA 4NE9A 5K99A 5SZKB 3QE0A 1XDZA 4BE4A 1T5IA 4XIIA 2F90A 2CV0A 3QV1A 2WKSA 4G5OA 4YPVA 4I9FA 5FIUA 4UEQA 1RQNA 2WEKA 3VOSA 3X2EA 1FSSA 1I4WA 3CLTD 4IIFA 1J5PA 2N9UA 2YFKA 1DIHA 3D2LA 4JCCA 2OXRA 2BFDB 1ZGHA 1QQ5A 3ETLA 2CJWA 4HGZA 2HEIA 3RFUA 3TOCA 1PLJA 3U6KA 1A2OA 2ECQA 3CF2A 4ZCTA 2PJZA 3NPAA 3NKFA 4B3GA 1AN9A 1PV2A 2UVDA 3EBLA 3GLHA 5CJJA 2PQ6A 4ZRNA 3QUTA 1QUFA 4KFUA 3I8SA 1GEEA 4GPAA 1YIOA 4REQB 1DC5A 1KJQA 4LMBA 3HHPA 5FPPA 1R0RE 2FCRA 2GFQA 2IY9A 2OV3A 4RH0A 5KYVA 3T7JA 3DMYA 1CQPA 1CUWA 1OZFA 3GPDG 3O1JC 1FTQA 2PTHA 1JR2A 1P75A 4I4TB 2CBZA 1H42A 3UH0A 3CPJB 3U44B 1B0PA 1KEPA 3OZFA 1ZNZA 1DX6A 5C8VA 4ML3A 2V54A 2D7JA 5TR9A 3VAZA 1HX7A 5K05A 5ALHA 2WQ6A 1SHTX 1QFXA 1TKRA 3AVXA 3QKUA 3F8WA 4GI1A 1H2RS 1MN6A 1H6AA 3CNQS 4TX1A 4XGRA 5AKEA 4HRVA 5BQPA 4BB0A 2O0JA 1P7PA 2IXAA 3B6EA 5ES3A 2OQ2A 3IT0A 4LXQA 4R2XA 5G4LA 1A8UA 2YHIB 5HP4A 1MEEA 5ERGB 4CQJA 3LUDA 2C7VA 3JZAA 3WLIA 2FH5B 3FWKA 5SYNA 1N77A 1VG9B 2D6FA 1X7XA 5IT5A 2HWKA 3OP1A 3JALA 3RGWS 3UICA 3UMYA 1G18A 3QF4B 4BKUA 1IULA 3KWFA 2IYTA 3AMVA 3E9QA 2D7CA 2Y99A 5DISB 5HE8A 3T4UA 3R7BA 5HKKD 3NC1C 5KKNB 4B82A 3HXKA 5FR1A 3JCZA 2FOLA 3OZ7A 2F17A 1OHHD 4FE4A 3VR2D 4BFZA 5BUQA 5L7TA 1YF3A 2IYOA 2B1IA 1WMDA 1TPYA 2Q46A 3ZWOA 3EARA 3CT4A 2YFYA 2WG2A 4IDFA 1RADA 4PVDA 4JT4A 3ZU5A 1NY5A 3CA8A 3N8KA 3U4QA 3FLMA 3RHTA 2ZR9A 3LV8A 2BJWA 2X19A 4RTNA 2BH2A 1RM0A 1FFAA 2O0KA 3L40A 2OCGA 3E3OA 1M2WA 5LYJF 1O5IA 4MR9A 2B37A 4CIDA 4G4JA 3K20A 3INGA 4O1HA 2OV4A 2XODA 3PXAA 3K53A 4LJ7A 4EGJA 1CSEE 5KHOC 2HK6A 2IEAA 1TZCA 2J6BA 3C3DA 4BTVA 2PTGA 3QKRB 4D8UA 3PNMA 1HFKA 4JKYA 2Q28A 2ZBRA 3HCAA 4G0OA 5B2ZA 3LNCA 3OT4A 4UUQA 3BB3A 3BFVA 4EG8A 3JRXA 4FJ2A 1X1AA 4H60A 1G9TA 1TD9A 1TEXA 2GZMA 3HRHA 1G8AA 3MELA 4L0QA 3ZBTA 4A0RA 3DWGA 2WA2A 2ZIXB 4JBXA 5TEVA 4MJXA 3VU0A 1OTYA 3NHUA 1EQAA 4EJSA 1OAOA 1T0IA 4LWQA 3D6UA 3BXEA 1I7SB 2F6RA 4V39A 2K4MA 2ZS7A 4DCTA 1EGMB 1X74A 3H3XA 2VH2A 3X1WA 4AO8A 3DCJA 5E9JA 1ILWA 1Y6JA 3ER6A 2FCAA 2B4TO 3BE6A 1C9DB 2V4MA 4HATA 4TTIA 4HNTA 3DOJA 1YJ5A 2HB6A 1SD5A 3G5AA 4ZV7A 4LJ4A 4BEJA 4CMEC 1QNFA 3AG6A 3RQIA 1D6MA 1TKBA 1FC0A 2A0XA 3DHNA 3L7KA 3UC9A 4WCFC 5I48A 5JSFA 2AZ4A 3NAZA 1PL6A 1UAYA 2PZKA 2R1UA 3MOSA 1BCSB 4HWTA 3TG8A 2XB2A 1U2GC 2JGJA 4YB8A 3NHPA 1BSVA 3UGJA 1QPGA 3IMKA 1JF8A 3A3NA 3RF7A 3PLAE 3HJFA 3UXHA 2C4TA 3K71B 3ZCPA 2F43B 5FDFA 3UAGA 1CUIA 2W2LD 3KL2A 4L1KA 4NPCA 4R3WA 4YP9A 1ABBA 1ETUA 5KX5B 1FNCA 5ADVA 3C1OA 4AURA 1CUEA 4NYMQ 4R69A 1XZQA 3GUCA 4ETMA 3A6HA 3PHHA 3OPYA 1QFMA 3M4ZA 3O4VA 1PF7E 1Y1KE 4HFJA 3YASA 2Y68A 4QREA 4YRZA 1YE3A 2VSYA 1ZKDA 3VDQA 1SG0A 1T6BY 3CXRA 3PQ8A 1W19A 4XI9A 3FUCA 4K87A 1T29A 1GN9A 2NPFA 2WSSD 1I7LA 1RLIA 1Z5PA 1IIRA 1CLUA 4AO6A 2A5LA 4G56A 1VPLA 1W6UA 2RJOA 4JIGA 2IYUA 5C5CA 4FFWA 4W82A 4PXSA 4U2DA 3QU5A 3U9TA 3H4IA 4Q7EA 1XD8A 3BGDA 1TGVA 3EA5A 4RLSA 5KUTA 2ZAIA 2HMWA 1QF6A 3W5VA 4BWYA 1P0MA 1UMDA 2JF0A 2OVFA 4NWIA 2X2FA 5CURA 3I05A 1KAGA 2QPTA 4DARA 4OMCA 1RU3A 4CF4A 1ZNYA 1WKBA 2ZT6A 1UOEA 3NLLA 1Z33A 3AEYA 4N6OA 1Y6QA 2II6A 1AK1A 3JQ6A 3LVQE 1KFCB 4P54A 1XJ5A 5FNVA 5J59A 2PX8A 2R4QA 4Z2YA 1JLLA 4WW0A 5KNCA 3MS4A 1KMNA 3E9RA 1JG2A 3LUPA 3BSSA 2NVBA 1G42A 1C3OA 1F8UA 2P78A 2IS4A 3WLPA 1KRHA 1CQIA 3T1NA 1YB1A 1JECA 1ZRSA 1UBMS 4YRJA 5HE9A 3BCUA 3PQ6A 3ICEA 3CRVA 2MYPA 5BMVF 4RD1A 1QF9A 4MEBA 4FD2A 4M8IA 1WEHA 2Y6VA 3ZTTA 3DF9A 2OC4A 3E9MA 3L4BC 4FMBB 4I19A 3C70A 1GPDG 3WXMA 3OZRA 3LW7A 4YUWA 1ULAA 4NTZA 8OHMA 4IGEA 2J9ZB 2OP1A 3EVCA 4IV0A 5DOZA 4ZCQA 4P2BA 2R9VA 1H2AS 1SHZA 4UCXA 3ROKA 1MAAA 3E9NA 2Z9DA 5JMPA 3VNSA 3LLUA 3FVWA 3FNEA 1R1DA 1S2IA 4XJXA 3T3GA 2FK7A 2EW1A 3AQ4A 1RJGA 2A7XA 3WGHA 2YZ7A 1BX1A 2ZBVA 2HBRA 3BHJA 4XWOA 4MW0A 2W7TA 4RJIA 1VXRA 3OAAD 1YRHA 1KORA 4BV9A 4HUJA 1VIYA 3GLFB 1J0EA 5FBLB 1HDOA 1RM5A 1TEHA 3QFRA 4K9RA 3JAKB 4BDSA 3QBDA 4LC9A 5LQRA 3F9RA 3P97A 1ZAKA 3QHQA 4MCAA 1L4FA 5DYTA 2A6PA 1LRKA 2W48A 3BFXA 3GT4A 2OLEA 4GEGA 4KSYA 4B6GA 4F8YA 1LSUA 2P35A 3OCUA 1MRSA 1IMJA 3KR9A 2FN7A 3IOCA 4IHKA 3WQBA 4EY4A 4I6GA 5JEDA 4GKAA 4U2CA 5B6PA 3GN2A 1HNNA 4ACBA 3BD8A 7AT1A 4HGPA 4J8PA 5TT0A 1QQ7A 4XGQA 2VO1A 4KLAA 4AKHA 2AF4C 2FUNB 4LHWA 5L4SA 1GVHA 2FZCA 4RY8A 2BGMA 3UF0A 3GEMA 2H7CA 4TLEA 3ODGA 5C52B 5JANA 2HF7A 1DG9A 5JVDB 4DMUB 4KUGA 4I1YA 4G65A 2R8XA 1E8MA 4X66B 6YASA 2LBPA 1XYGA 4W5HA 3ER9A 1WXXA 5A2QA 3AHFA 4IICA 4A2CA 1EVJA 2XPCA 3FOBA 4GLBA 3ZDFA 5KVSA 1WCYA 1Z73A 1ZEMA 4FMCF 4C0KA 5JNVA 3BF8A 1V5IA 3TCKA 2EC5A 3SYNA 1CHDA 1N4AA 1IXKA 1LNSA 1P72A 1EE2A 2QI9C 1GUDA 5CW1A 1ELOA 5BW6B 3IKMB 2J85A 2AOUB 1INLA 1NVTA 3IRVA 1BX0A 3OU7A 5EXPA 3I34X 2GDZA 4H7EA 3C6QA 5CCDA 5EPEA 4PPNA 3PGLA 4FOPA 4DM4A 3A6GA 4WZBB 4MPDA 4H17A 1GYQA 4YT2A 5KKAA 1P0IA 4G5HA 3TQRA 3UJDA 3WL8A 1C8VB 1JEYB 3FN4A 1OXSC 3IAUA 3ONWA 1HDCA 1Z6GA 4O2BB 2Z4RA 4GDMA 4PYQA 4XJSA 1GTMA 1K5DA 2V6FA 1PV1A 2PRKA 4UBKA 4MYUA 3VAYA 1M6WA 4ZD6A 5HSGA 1MFZA 3ZDQA 3AUSA 4J0DA 4NMMA 1NJ2A 3WRXA 3QQ5A 3ZHXA 2C3UA 3MJEA 5CJPA 2EBWA 2WWFA 1E1NA 3WLLA 1MX5A 3FGPA 1KARA 1KMMA 2P30A 3KBOA 4M4SA 4TRMA 2I1LA 4RKRA 4DYDA 4I1IA 5DM60 5JTUA 3THYB 1FZTA 2QRLA 1GNTA 2ZUWA 3EZ9A 4MQLA 5I4CA 4P4NA 4BE9A 3GOHA 5JAUA 1US8B 2W83A 3GLRA 2FWPA 1M2OA 3FYTA 3PTZA 1YRWA 2YS6A 4NR0A 1BW9B 3A6JA 2VHXA 5P8WA 2I34A 1ADBA 1JI3A 5HXAA 1PZMA 1ECPA 5HX7A 2XDAA 3O47A 1YQQA 2IZ5A 3ZJ4A 1PEYA 5CT5A 2PH7A 2HWUA 8GPBA 4RSMA 4QDXA 2X8LA 2YBDA 2CXOA 4Q12A 3ADKA 3SHWA 4KUEA 1NJSA 1RPTA 2E6KA 1RQRA 2NACA 2OQVA 2BE9A 4URZR 1PNRA 2R7NA 4M3NA 2CBGA 3N5KA 3V2GA 4EUSA 2IL1A 4V3CA 2AG5A 3EB9A 3K1ZA 1FP4B 2XT0A 3WWPA 3TGPA 3RNLA 2DERA 2P1RA 3ZHOA 1M10A 5L3QB 1J99A 2QV7A 2IHYA 2OB2A 4KOEC 2J87A 1J0AA 3SJBA 3NBXX 2XADA 4MVJH 4MQ5A 1CJCA 4POOA 5COAA 3QXSA 3OU2A 3NUGA 5CXQA 3L1VA 2IEYA 2ZYAA 3AEQA 2J67A 1D9ZA 3UBTA 3K1AA 4RUKA 3G68A 3LYAA 4CCAA 5KTKA 4AULA 3CS3A 3Q11A 3ICCA 1N7HA 3ED5A 9LDTA 2X2EA 3BJMA 4LXIA 1P5JA 3NAQA 4Q05A 1JA0A 3ZCSA 4UEWA 1I3CA 3EEFA 2DUMA 1KAOA 1ZUHA 1USVA 1YSCA 3RR2A 2EWVA 1DKOA 2CL7X 1UT8A 4LGVA 1SCJA 3PCTA 5DMXA 4DM3A 4QFBA 1XEAA 4IDQA 2EOAA 5K3SA 3SJAA 5FFMA 3FFAA 5CDHA 3I1YA 1KOFA 2WIDA 3QU7A 4TTPA 2FTKE 4TXHA 4UZFA 4N8DA 2ACVA 2C2WA 2O2HA 3LXRA 1VHTA 1YNOA 4C89A 1W7AA 2ISQA 3CX3A 2AEFA 3N0WA 4XE5A 1PEKE 3HEMA 2XSZD 1R5JA 5DSZA 5ILGA 1ZMBA 4M0MA 1SELA 2X2PA 3AFOA 4X6XA 3WAKA 3BG5A 4D80A 1QAQA 5K6TA 3SX2A 1GPNA 1DV1A 2QLFA 2Y1CA 2H2DA 3IILA 3DZCA 4KXWA 5DHSA 2V5AA 1G21A 1OXBB 1QGAA 2I78A 3OFSA 2EKLA 4WNAA 1FCJA 2DBRA 4LYJA 2TYSB 1RZ3A 3HI4A 5AM0A 1YT5A 1PJRA 2K2QB 1RKBA 1Z07A 3JR7A 1U0NA 3KR2A 3RTDA 3FNHA 1M8KA 2CUTA 1PTJC 5JJKA 4OLJA 1P73A 2GKOA 1R37A 1YACA 4QVKA 2D0OB 1E1YA 2XUKA 3SEFA 1FXWA 4DRYA 3DDOA 5IZ4A 3TUJC 1OAKA 5GAJA 1ECBA 1BAPA 3IMGA 4V0SA 2B30A 1HYEA 1GRQA 1OLSA 3R0JA 2VIIA 1RWNA 4JDUA 2PKWA 4LOIA 5EZQA 5FI3A 3U7JA 5LFAA 1OV4A 1Q7RA 1EFRD 2GZSA 2DQYA 2I6GA 2XAUA 2YV3A 3OZBA 3REFA 2XWSA 3G6KA 5AT1A 1YS2X 4J91A 1G8FA 1Z45A 1ZITA 1P77A 2PKEA 2QRJA 1Y6ZA 1NUAA 2VOJA 3AOEA 4GPEA 4EHIA 5KJCA 1JZSA 1UBJS 2Q41A 4TKMA 1X42A 4ZVSA 4BNHA 5BR8B 4RNDB 3UUEA 2IV7A 2X0DA 3HR4A 5BOSB 1MO5A 3OE1A 3CKKA 4Z3DA 5T8KC 3DZDA 1CIJA 5L95A 1YS1X 2RKOA 3HVJA 3IURA 1SVLA 4R1NA 4HLCA 2XZTA 3P9YA 2AGVA 3TTYA 2NSLA 1VHJA 4ZAFA 3TLMA 1BHQ1 4FFDA 1T8TA 5GGXA 4Q3EA 3T1TA 2YXBA 1NMSA 3I72A 3I01A 3M2PA 4MW7A 5DH9A 1S5PA 1Z5GA 2FYTA 3L04A 4O25A 2R2AA 1LX7A 2FXVA 4HOYA 3D7SA 1X7WB 1KF0A 1RRKA 1M8PA 1THMA 2WIKA 3K3PA 4OK3A 1G4UR 1U5CA 2RAVA 3DPIA 2XE8A 3GJ6A 3MNFA 4FKMA 3V1NA 5IM4A 2J07A 4AYXA 2NO1A 4E6PA 2QT0A 4OYHA 5FPKA 4YAOA 4MGKR 5ESWA 3GLGE 2JHCA 3EG9A 4WZAB 2ONKA 4M54A 4D8XA 1EBUA 4C0AC 3MGAA 4OQZA 4DDWA 2YZ2A 2Z8XA 1U1EA 4JLKA 1V25A 1XOIA 5A3QA 5BSUA 5IABA 1UCFA 3U61B 1ZYUA 3ZVNA 3OMLA 3VH2A 1QRAA 3G8CA 2P0YA 3GJ5A 3T15A 1QB7A 2V96A 1JKFA 5IWCA 4C6TB 2VWHA 3K72B 4G0YA 1N2CE 3WFJA 3QU9A 5D3QA 1I51A 1RLMA 1WXGA 4DL9A 3RC8A 3T6KA 3BMNB 5LDGA 4BQQA 5EKDA 2ZIVB 4A27A 3HPQA 4WWHA 1OLUB 3T5MA 3FHJA 2GO1A 2X5KO 4CMIB 5CCXA 2OFPA 3NATA 4ZJYA 2BONA 3N75A 3PDIA 1FPQA 2O2DA 4I6EA 1SR8A 3D4OA 4L9SA 1KDZA 4JYCA 4R40A 5HQ3B 1Z2NX 2NYUA 1ZVJA 1PJSA 2FZLA 2Q7XA 3ZWQA 1L4HA 4GNKA 2UZIR 3D0RA 4DLTA 3N3BC 4I9NA 1Z34A 2I6TA 1DO8A 5EN4A 3QEJA 4RL4A 2ZSFA 4IOJA 4DNFA 2CFCA 2BHRA 4N1AA 3AVUA 1MG5A 3EJWA 1J56A 4JS0A 3ZWMA 2IU4A 4BEBA 1KK0A 3O93A 4B9AA 5GQSA 4DQLA 3SVLA 1USKA 2J0UB 3QFSA 3EUAA 4A1OA 2Y1LA 3S40A 1G98A 3SFTA 1F48A 3VKVA 4BJ3A 1KQ3A 2AEJA 1EWYA 3WLQA 5BRJA 5JRZA 2A57A 2HMYB 1CF9A 4W5QA 1JFFA 2IF0A 4PHTA 5JADA 1CUHA 4W1RA 2XDWA 2DHQA 3OUTA 2ZIWB 4BE7B 4BZPA 4OHBA 3TTWA 3WDKA 1Z5NA 5JWOA 4CYMA 4GL4A 3L6DA 1RPJA 3HKCA 3FRIA 5JSYA 1XSEA 5BXQC 3H9GA 1X19A 3RYFB 1OT5A 2OB1A 5ADUS 1GRNA 2NGRA 3TCXB 1NUSA 3RS3A 4YI5A 4ZP1A 4J6FA 3N70A 4HY3A 2HLPA 3IO3A 4QGFA 3VSDA 2GTIA 1Z4QA 3A70A 4MYDA 4I4CA 1X1RA 4DUZB 3GZNB 3I1IA 4NENB 2HQOA 2O3JA 3R5JA 1E8DA 1Z88A 1II8A 1UK6A 3E3LA 3S2YA 2X86A 2VWGA 3C6YA 3GVPA 3PWSA 3VDNB 4BNLA 1PIWA 1NOIA 2X5OA 4F3CA 5CX1B 1DX9A 2NV0A 4BJ6A 2BFMA 2Z3WA 2ZS8A 1U0LA 1JI0A 3BOSA 2XWJI 2Y3IA 1QGED 3N8NA 5EKTA 1QHGA 2BFEA 2HA0A 4FKBA 5F1PA 2JK1A 3D2BA 4EW2A 4IDGA 5K4AA 1KDYA 4Y2GA 3UHOA 3R8CA 1SKQA 1GGFA 2JFVA 3I0NA 1K7EB 3AEKB 1NVMB 2QR5A 1TZKA 2D1RA 4GWGA 3HYRA 1YAHA 4PGFA 5EJMA 3D4BA 4HNUA 2V7BA 4W99A 2L82A 1EP9A 1GTG1 5BRAA 3KJHA 3Q10A 2G06A 2V6BA 4ECAA 2ZI9A 3D8HA 4G25A 1NMQA 2PSDA 1FYFA 3HDVA 1GYRA 2WB4A 3GZ4A 3FVRA 3OOYA 4NNJA 1CR1A 1P5HA 4ZMRA 4WDRA 1RAIA 4X00A 3PEEA 3NOOA 3G0HA 1NN0A 4LJRA 3KQPA 3GR6A 3ZCTA 5DLEA 5DTQA 4WLNA 1N1GA 3C1TA 2INGX 4E21A 4UM8B 4UASA 1LV8A 2DTEA 4DUYB 5D8DA 1Z4JA 1L7RA 2GSDA 2RGDA 1ZIDA 3B9BA 4IF6A 3LNTA 2FEKA 4JI8B 3D3WB 3RRYA 1XPOA 3A1UA 4HVAA 1W47A 2C0CA 2BGRA 2JJ1A 3HBLA 1P81A 2BLNA 4NBVA 4NH4A 5ALUA 4RVUA 3CLVA 3H3FA 3PDWA 4GDFA 1PW7A 3ZHBA 2QR2A 3F7OA 1FJGB 1DMSA 3B6KA 5AJYA 1FS4A 4FUQA 1IOWA 1G6OA 4DA7A 1PO7A 1TW3A 3QVVA 2B7LA 1MF7A 4QXRA 3BSYA 2C9OA 3GUVA 2GEJA 3B5EA 2F48A 2CY0A 3AJ8A 3ILYA 5LB4A 1E2FA 4LDAA 4E2ZA 1N9GB 5AKGA 3K0KA 4KVAA 3CLUD 1T2AA 1Y5RA 5FHRA 2QX6A 3NYWA 1F3LA 4B7UA 3SD7A 2NX2A 1AGXA 1XEWY 4RXMA 3C6KA 1D4ZA 1Z5OA 3E9YA 4JX8A 1KFJB 5AI4A 4XQ9A 2BI7A 3NETA 5IK2D 3VU1A 4CFZA 1NI4A 3AUFA 4GW3A 2M32A 1T3HA 3M6XA 4KDFA 2R6AA 4ABTA 4GMGA 4GM1A 3LWBA 4EDFA 3AP3A 3MCAA 3NTLA 3I1JA 5DEIA 5SY6A 3A25A 1H9AA 1VOTA 2MU1A 1EG2A 2E4VA 5AI6A 1PVVA 2BYTA 1UC8A 1QE3A 1NU6A 4QX6A 5JDIC 1PDVA 1Q2UA 2XOEA 1NY6A 3QE3A 2OV6A 2K87A 2NW6A 4KE7A 5AHKA 5G1NA 3VZSA 4PGHA 2J4FA 2ORED 3FAKA 3L93A 3L9XA 4IHJA 1DJNA 4JGGA 1BMTA 1C81A 4E07A 3ZDBA 2B82A 1KJIA 1RWMA 2FPOA 1VA5A 3CURA 2VP9A 2GQ0A 2HUNA 5KHLB 5I5EA 5LWHA 2XTJA 3H2GA 3AEUB 5B6IA 5KVAA 2NV6A 1UC9A 4PWYA 3RBVA 2R8EA 4IJ5A 4IUYA 2VPZA 3QX8A 4OHMA 5B3JC 1B00A 2OGTA 2FF5A 2VHCA 3VZDA 2CYCA 4DIDA 5CD1A 3M1IA 2E89A 2WFLB 1Z5VA 1JPVA 4LAFA 4PYIA 4TMZA 4AZWA 3P2IA 1ISMA 2VT3A 4FGUA 5K8VA 2FFJA 3EVZA 4QXMA 5JW6A 3VPHA 4BKMA 2RONA 4KR2A 1CEEA 1P18A 3QMVA 3IR7A 5H83A 3LRPA 2RD2A 3V2HA 2ASEA 1BVRA 1LJUA 4LBZA 1DQNA 5DOVA 2QW0X 1O3YA 2JIZD 1N5KA 3OLCX 3NIFB 5EJGA 1Z3IX 4LZAA 1Z08A 2P4SA 1OXTA 1V11B 1RCUA 2W4MA 2HNBA 2Z2KA 1R6XA 3GIWA 4FXPA 1TF7A 2ECFA 2VJQA 2Y1XA 4I55B 5K2MA 2PA3A 3K4HA 1J22A 2OY0A 5BVHA 3IKTA 3MRVA 1QWSA 2LIVA 3WRWA 3L46A 2PUEA 4DLAA 3O75A 5FADA 4DRZA 4G8BA 4EBBA 5FEMA 4GOLD 4IRUB 3A1VA 2G3YA 3PQ2A 2NXWA 3KLMX 2P1DA 1O96A 1UR5A 1ZMOA 4I2NA 2VHWA 2WF6A 2Q3LA 121PA 2F67A 3E3AA 3GFOA 1NJ5A 3DAGA 2VZEA 1O4WA 1M6VA 1P2GA 2O0HA 2Y1GA 1FNMA 1JNYA 3F2VA 4BQSA 4C08A 5E0KB 3HA2A 4UAJA 3ESXA 5FBQB 3AKCA 3MUOA 4E5YA 2DB3A 2VDOB 3NJ8A 2CDRA 2Z09A 1HDEA 2C98A 3AIOA 3IKLA 4JUFA 1B16A 5DNWA 4BB5A 3NANA 4AQDA 1QC5A 5LQJA 2VZ0A 3WXBA 5JSZB 5G53C 3UGQA 2PGAA 4YJHA 5TV2A 1R7RA 1WU7A 3EY9A 3KUDA 2GZ2A 5TVGA 1R6TA 4Q7KA 4NRDA 5EHGA 2R44A 3E8MA 2YVLA 4PO8A 4GR9A 3KQMA 3AUJB 1A8PA 2XOKA 2ZRHA 2EYQA 2OHJA 1W4BA 4UUPA 5ICGA 1OU0A 2EGUA 3C16C 4QM7A 2V7WA 1VLMA 1GVNB 3QKTA 1GILA 4ZT3A 3KYIB 4X20B 3UXMA 4L50A 1UKZA 4DN6A 1IY1A 3K8QA 4MI6A 1GCOA 2CXNA 1IQ0A 2KE5A 3Q7EA 3ZVMA 1Y6RA 1FFBA 4K26A 4C4XA 3P4UA 4GOXA 1IG3A 1TMGE 1T8YA 4M8SA 4UVIA 4ZXPA 4KK3A 2GCOB 1KI7A 3QY0A 4GOOD 2CNNA 4DNQA 2ZJ7A 3JYOA 3U56A 1RJDA 4R41A 1TLLA 3NKLA 4DXDA 2QJWA 2W11A 4IZIA 3FSEA 1YHNA 3ZQJA 3H1EA 3SJUA 5JALA 5LZ4A 4RFVA 5DO9A 1A7UA 1IY9A 3BK7A 1CYEA 1Y7IA 4PRYA 5DI3A 6LDHA 4N0QA 3K0FA 2OEPA 1IBRA 1ZK2A 3D5QA 4N8EA 4TTJA 1FU7A 3VJMA 3IHKA 1ZI8A 3WB9A 4MVJD 1KI4A 1MXHA 2VP5A 2VQSA 3BL5A 3ENKA 3PR1A 5KI6A 3C5WP 1ZVVA 4W5OA 1TYZA 4RIHA 2Z08A 3CHYA 4G89A 1PR3A 2X0EA 4KZPA 3U6BA 1XWWA 2VJDA 3SZRA 5DHPA 1V26A 3OKPA 2ZB3A 4C7JA 6ADHA 4EHLA 1ZUWA 2KW5A 1Z0KA 1S6YA 3CMCO 3MWEA 3OWXA 4J7CA 1MA0A 2GRJA 4Y6RA 4G6ZA 1BGVA 1PR2A 3CW9A 4NBLA 4ERXA 1UXGA 4V0MA 3AW9A 3N7TA 3ZXIA 2WR8A 3GJQA 5JAQA 1LTKA 5KWVA 1WXWA 2X14A 3TLEA 3U37A 5IKEA 4CN9A 5IDXA 2DM6A 2R85A 3A6DA 1J49A 2VAPA 4CKWB 3QX3A 4GS5A 1DS6A 2VQ3A 4ZYLA 5CW2A 1A5SB 3L77A 4QPDA 2CVHA 3VTZA 3RS2A 4A8JC 3ZY6A 4CQMA 3B7PA 5E1BA 2D8AA 2OBNA 3DDHA 1GA1A 5CA1F 1M76A 3TEFA 1E1CA 1F8FA 3DYVA 3ND6A 3H19A 3LY5A 3NT4A 3W3AA 4TWRA 4QSHA 4YMSA 5LJLA 1SG6A 3UT6A 2GXSA 4MWDA 2VHVA 2XHZA 3E7PA 3X3HA 1RBYA 4ZHQB 2ZVPX 3DG9A 3EG5A 1VHLA 5JBNA 1YE5A 1CLEA 2EDAA 3JZMA 3PLRA 4YAJA 1M3SA 3TEMA 5A4KA 2WVGA 3DXZA 3VJRA 3EVNA 1GU7A 2IKSA 4FZ3A 2CLHB 2CMDA 3L8EA 4WVFA 4X7PA 4PNEA 4JYBA 4MAMA 1JHQA 1S2OA 4NNOA 5AIAA 5IJXA 4ND3A 2IU0A 1KHTA 3MK31 3QKSB 1L5ZA 2GM5A 3I9MA 4BKRA 5DLPA 5KQGA 4PYMA 3COJA 1AF7A 3UB4A 3WFIA 1SUEA 2V6GA 2WF7A 5AK3A 4PE5B 1KTVA 1XROA 2X4GA 4R1UA 3RSQA 5L6LB 4MCHA 1GQOA 4OQEA 3ZGYA 1OZ0A 4FZVA 1K7FB 1SC9A 3I2IA 3NV9A 4YRDA 4P3NA 1RYBA 1P0QA 1ISPA 1U04A 3PDUA 5EVJA 3ZIUA 1SA0A 2D5AA 4D3SA 4DCMA 3A10A 2PXAA 3RYTC 1WB9A 4IJKA 2FRVA 3CUWA 4OXNA 4QDUA 4DVJA 2FW0A 4PRKA 4BO5A 3BHNA 4JJIA 5KYXA 2ERYA 1MJGA 4JA0A 5IARA 3LL7A 3D5TA 1ZVKA 3JAWB 3O9ZA 1TFUA 2WNSA 3PC8C 3NT2A 4FFPA 4MGIR 1ECLA 1PUJA 4DDKA 3EX7C 1Z83A 5BW8A 4XB1A 5ICCA 2YWBA 5HRCA 3K0BA 3QK7A 5LCXA 2FEWB 1DIGA 3FVQA 1G5PA 4KIWA 4O2AA 3ZWBA 2EJVA 3LJKA 2NUTB 1QYXA 1TYEB 3PT9A 4ID9A 4O4LF 4NBSA 3OE7A 1U4SA 3RTCA 3V8NA 4CKCB 4B46A 1B0AA 1WCWA 4EJ0A 5BN5B 4YCCA 3KPUA 4YJ3F 3IQFA 1PDWA 1O57A 4XOIA 1Q1QA 1VSQA 2PV7A 1JEDA 3U0BA 1K7SN 3FZEA 2HJVA 2ODBA 2OR3A 2XT6A 3MSCA 4Z0TA 2HSEA 2QRNA 1GAXA 1TO1E 3ICWA 4OHRA 3OJOA 1P7VA 2EARA 4P33A 1NM5A 1ORIA 1Q11A 4QEKA 4QJBA 5GZ6A 3UT5A 4DMMA 4CT5A 3IULA 3WJAA 4ERNA 3HU1A 5C5EA 3RYHB 2DMRA 2WHXA 4MA0A 4MW9A 5ALLA 1YBFA 1G3MA 3FDXA 1KVQA 2VUSA 5REQB 2C9ZA 2G7MC 4IX1A 4XEHA 4C0HA 1WA5A 2PIAA 4PZZA 2AC7A 4TQUS 3GDWA 4NU8X 5BSTA 3WL5A 4JH0A 3QUQA 3LCCA 1IVNA 3P1JA 1A8HA 2ZRLA 4RHXA 2QVGA 3N0RA 4H6PA 4FFBB 4I5FA 4YRPA 1T2CA 4IXNA 2YASA 2WHRA 1RFLA 3L0CA 5FWYA 2H07A 4H6WA 4IBOA 4L4SA 1MTOA 4WINA 3DPUA 3JQFA 3TDMA 4XSVA 3UOGA 1N2SA 2TMKA 4KQ9A 2EIHA 4D8VA 2XMDA 3OPXA 5ELXA 3G0OA 3LCJA 1HTBA 2QGNA 4KOAA 3HEBA 3KHSA 3PKZA 5EWJA 4O33A 2O7RA 4QPPA 5JYDA 4GXRA 4O4IF 1UXIA 5CITA 5LMUB 2QLTA 5IJWA 2XT9A 1IZYA 3SLGA 4NZMA 4O6VA 5B6JA 1EK0A 1E18A 5KMGA 2FZGA 1PP4A 1DC6A 1WPGA 1YDGA 3HN6A 3KLNA 2BOVA 2BEJA 2PAAA 2XUJA 2RGGA 1ZD4A 1YZUA 1IPEA 1P0CA 4ZOLA 1S2MA 4JJFA 3TOZA 3PUHA 2AI1A 1PYOA 5A5FA 4OBWA 1Z6TA 5KYUB 1N5OX 2W2KB 3OMXA 1EZ1A 4PF1A 1VJ5A 4XEUA 2HRBA 4BJ1A 1ICIA 4YRLA 2XKJE 3BRQA 4BB9A 4ME6A 5J2UB 4HB3A 4MVJP 5ALGA 1XL0A 2Y05A 3DKRA 4EKNB 2GYYA 3UCXA 1AZLA 4HGQA 1YK0A 2X3FA 3WZ2A 1ZNWA 1U8TA 4CL8A 1JTEA 2PD4A 4XD2A 3VKHA 3KUKA 3GRUA 3SIPA 4F91B 1R6VA 2D1FA 4RSHA 1P2FA 4XFDA 3C8ZA 3T7TA 4RZXA 1RPZA 1HDRA 4Q4HA 2WINI 4I4TF 3ZQKA 4TMXA 1F2TB 2EJUA 2AE1A 4TUYB 4LJ5A 4CWAA 3K31A 5EIWA 4I8DA 4LJAA 4N5NA 1K3TA 4Z4CA 2G4VA 4HWPA 5KB3A 8AT1A 1OW3B 4M0EA 3PLNA 3THWB 5I7RA 2H8GA 2H63A 3N2EA 4TMWA 4MI3A 1FMJA 1YS9A 4LECA 2ILVA 4ZT6A 2BEVA 1K8XB 2R1VA 4YT8A 4RPKA 3HP4A 4ASUA 2C9DA 5FOXA 3QVGA 4E2YA 1EHIA 2BGNA 4U6NA 4CIXA 2FSIA 3ZJTA 1TM5E 1H6DA 2CVFA 3IUBA 4C22A 4DTCA 2MSCB 5TF4A 1MA3A 5H80A 3ZCRA 4R71A 3TIVA 5K3EA 2YVKA 1ZZGA 1ZK3A 2RHLA 2CL5A 3O2NA 3PJFA 4GMKA 4TV9F 5JISA 5AJUA 1IYZA 2X8BA 2H4XA 2OAQ1 3NWOA 4RGQA 5CLQA 2IOQA 5D7BA 4RIEA 1E3WA 1IHYA 3A4YA 5HCIA 1TQ2A 5ARBA 1EVIA 3GRCA 4IDDA 2ADOA 3Q3VA 2G76A 2X1MA 5DBHX 2JDID 1ZRHA 4CLOB 3DKVA 5IANA 1VPDA 2I3AA 3IUYA 1NSFA 1FVXA 3C41J 1QIKA 3SQWA 1PJTA 3KQNA 3IUJA 1HMPA 2RHMA 4HYEA 3KCNA 5I4IA 3BIJA 1QYDA 1N9ZA 2IZ0A 4WECA 5FNZA 4EEKA 3S1SA 3GLIA 4QRDA 4PGGA 3GG9A 4WFQA 1A2KC 2FFHA 3C5HA 1FDIA 1UM8A 3QXCA 4Z1MA 3T9CA 4Z4EA 3GHYA 5SY4A 1V6SA 5BPHA 1M2FA 4FNOA 5CD9A 1YZFA 2O5CA 1I24A 2C7GA 1Q1NA 2YWDA 5D86A 3O4IA 3AL2A 5B7QA 3ZWYA 4JI6B 2E4YA 3KFXA 1NVUQ 5DW0A 2ZJAA 3HEAA 1L3BA 4JLPA 2J33A 5HJ2A 4WEQA 5HS6A 2ZYUX 3AILA 1E5XA 3D9QX 2H06A 1U3FA 1I01A 1T5DX 3DKPA 4PQGA 1ADYA 1M7BA 2I1VB 1P5FA 1JDUA 2DR3A 5CP8A 3CSUA 1WVIA 2I91A 3AY3A 3QA9A 3SZMA 5A4FS 2XI4A 4HCJA 2VRCA 1WVGA 2XMSA 3LQFA 3QLEA 4NG4A 3DFMA 1T26A 3GWGA 1YJBA 1H3NA 2FW1A 1VLQA 1QU3A 2ZBFA 4MTLA 3DVLA 4UMFA 2WM8A 5LVAA 3FCOA 2UYGA 1DEHA 4GAEA 4S1WA 3I6QA 2EJBA 2ZRQA 3EXEB 5IVHA 3D8SA 5GMOA 3HZRA 5FTNA 2HQRA 2G63A 3E9DA 2I03A 3G8BA 3VSCA 2CMKA 1FFEA 4JWKA 2VDVE 1ZFNA 3EXHA 5F9FA 2Z5VA 5DK4A 3PPIA 3NJ4A 5JECA 2R5FA 1SU6A 3BBLA 3O82A 3LUCA 5T4HA 4A0GA 1Z0SA 3GP5A 3K9QO 5LP6B 1IHXA 5EFZA 4PAMA 1IL0A 3DHVA 2ZEJA 2ZWAA 1ENYA 4NFLA 5KX5F 1NC3A 3RC3A 4YXFA 5MHTA 1DRVA 1MV8A 4AMYA 5DPMA 4EZEA 1KZ7B 1XCPA 5D51S 3TLKA 4NDAA 5JS8A 2IS6A 2ST1A 4XB6B 3SQMA 3AHJA 3OFND 3RVRA 2HF8A 5LLTA 2AR7A 3RJMA 2PGOA 2GAJA 4K86A 1TCAA 1Z6QA 1DBPA 3PA6A 2VG8A 3NUZA 4HZGA 4BS9A 4EO4A 1TTTA 1HZJA 3L4JA 2ZAGA 2GARA 2FG7C 2BI4A 3DVAB 3QOXA 3NH9A 4HR7A 4EQ6B 4EUKA 4IF4A 3GUHA 5A9TA 4EVQA 1QGOA 3CWZA 4NCXA 4DT1B 3WAGA 4HNRA 4M98A 5HOEA 3LUJA 1KO5A 1XQ9A 4HQOA 2YJZA 1A9SA 2DQZA 2QXUA 3IBTA 3GQVA 3QUBA 3RUPA 5JMTA 2UXBB 5IN5A 1CY4A 1K86A 2OHXA 3UK2A 5E0OA 3ADDA 3ZYCA 3SFZA 3EOZA 3L5KA 4EB8A 5IP5A 1Y98A 3RGGA 1MJHA 1ISRA 3D6JA 5HFJA 1A7JA 1ABFA 5CT4A 3N2ZB 1J9GA 1SVOA 3C24A 4FHDA 4E08A 1QS0A 5TQ0B 3VYTB 3LPAA 4L72A 1E2EA 1SRQA 4RVDA 4HDOB 1F2UA 2JFUA 2KQUA 4RV5A 3JWIA 1DCKA 1QHSA 8ATCA 4FHZA 1QM5A 1AURA 3FWPA 3SS8A 4MGYR 3FXAA 1NXQA 4KNWA 1IUOA 4GPBA 1NG1A 1N25A 4LV8B 1S02A 4UBIA 3RIXA 3PICA 5T5QA 2XRFA 3LDGA 2V9ZA 1N2CB 1Q22A 2GRAA 1YIAA 2VTBB 4HZUA 4KVFA 4QGBA 1XB2A 2X6QA 3AGPA 1IM8A 4KXNA 4XX0A 5A4DA 2X0KA 1X9GA 2O3RA 3S2GA 1P7WA 2XCLA 3I5YA 4LY6A 2H57A 4YGYA 4CODB 5C37A 3S28A 5AXAA 2YXLA 2LXNA 2WP0A 2GKSA 3OZVA 3H2HA 2BMWA 3EISA 4DR2B 2EZ8A 2CFRA 2EF1A 2OZVA 4O5OA 4OH7A 2QVYX 4B85A 3MGKA 3GGJA 4Y2RA 2I6QA 4MTCA 4P6VF 3W8FA 1L6IA 4M49A 2WI8A 1SQSA 2LD4A 1R8SA 1G7TA 3II6X 3D3NA 4J49A 5K3FA 2OGSA 1LDMA 5FHQA 2HV8A 4DCGA 1L7MA 1JKJA 2O2XA 4LDPA 2UVPA 1WU8A 2E6UX 4HNGA 2HDHA 4LOJA 4MP8A 4ETNA 4Y2QA 3EGIA 4HDNA 4DLZA 4EB0A 1QU2A 1N75A 2O9JA 3LWNA 1Y8AA 2P90A 2X9QA 2Z58A 2NUAA 1OV6A 3I2KA 4G1UC 4MRSA 3IE2A 3AM3A 1GIAA 1V9LA 1H1LB 1DBVO 1N2HA 3QVTA 4U7FA 5ERXA 3MERA 1IBKB 3H7IA 4Y6OA 4HQ6A 1UEJA 3INTA 4X7RA 4AS3A 5BNTA 2Q5OA 5FWXA 2H92A 3R6LA 2V3CC 2WT9A 3CMMA 3RJ9A 2RHWA 3SZUA 3UGKA 4RYDA 4BNYA 1WOMA 3D43A 4GZMA 3BGIA 5A0VA 1P44A 5IT0A 5J3JA 3Q8XB 3K2IA 4RTRA 1ZJJA 1DUSA 4R1TA 1LK0A 1QLJA 1MH9A 4Y6QA 4UJ5A 3LBNA 1ISJA 2ZI7A 3NEPX 4D0NA 2IOYA 1RXWA 1NPYA 1XAGA 4PHHA 3U7FB 3OFJA 5IJZA 2ZETA 1A71A 5THQA 2QTGA 4FINA 1KJJA 4XWYA 3QXXA 3HXQA 1U81A 3RSSA 3ZNNA 4E15A 1WUJS 1DEOA 4IDPA 1RS0A 2WHYA 4XSGA 2PLNA 1D09A 1LBEA 1CYDA 3R6TA 1L1QA 3ZLTA 2BFBB 2QQ0A 2B36A 1E2PA 2GBGA 3KZCA 4O2BF 5AJTA 3GGSA 3MGCA 3RVKA 3ZD7A 1H0RA 1H2FA 4H4DA 2JRLA 1W1WA 3FPGA 1DEXA 5C51B 2R6FA 3G7SA 2FPXA 1EE1A 4UM5A 1NVXQ 3COSA 3UO8B 4BFSA 2WW8A 3BL6A 2QX7A 4HFNA 1F0PA 3R3HA 5GV8A 2WABA 4M8NE 5AUOB 1FXSA 1PSDA 2PYDA 4MYHA 2ESRA 4QGAA 4XLZA 3UXEA 1AUOA 4F11A 5BV7A 2C96A 3H04A 3HLKA 4RAQA 2OECA 1XQWA 3ZU6A 5CFMA 2VDQB 1VCHA 4DV6B 2ZROA 3F6SA 4Y2XA 5FPHA 2YZGA 2JEOA 3O8LA 3HK2A 4DLBA 2XRZA 1DOAA 1VKOA 2TMYA 4ZT2A 2IEZA 5KTMA 2PQ2A 3ANLA 5IZCC 3MGGA 1Y3BE 2IE8A 3UENA 2ZRBA 2VK2A 3MHTA 4KRXA 3VR3D 5JCPA 3X1JA 1D1SA 3BK1A 2Y71A 4NP6A 4DV3B 3ZZ1A 1SC3A 4R9NA 1IN1A 4Y9DA 3HBJA 1KC3A 2P2CA 4N18A 2VHTA 3SN6A 4CV0A 3EY4A 3R4CA 1TYAE 1KVRA 1WW2A 2YN0A 3IO5A 3KYJB 3AVVA 1VC2A 4M46A 2OCLA 3NDRA 4YFVA 1UJBA 1O94A 1XKLA 2I7CA 2QMUA 1JQAA 4HNAB 3LX4A 3HCOA 4U9HS 1AMOA 1ULSA 1B42A 1ZD9A 2NM0A 6PFKA 4AS1A 2M1XA 1XZMA 3QMMA 1PR0A 3EXG2 3GQBB 4JJ7A 4OSPA 4XFJA 4LWPA 1A4IA 2PCLA 4PS0A 4X1KA 1U6KA 5AMXA 5CB8A 1LZLA 4ZYZA 5JH7A 5A04A 1W35A 1FSFA 2KWIA 3GI1A 2AZTA 2JJQA 3AI1A 4TXMA 1XAIA 5EIBD 4DDVA 1P2TA 1OKKA 3ZZNA 1RBMA 1VIAA 1ZJZA 3TI7A 2F4VB 1HT2E 3LYHA 4XA8A 4WT7A 4ZOAA 4RK0A 2AW3A 1EWTA 2DLNA 2B5OA 3LZ6A 3P9XA 3USCS 4HNQA 4P82A 1V39A 3GDHA 3CZ9A 4P5PA 4V0RA 4DPMA 2IV3A 3FKSD 4FX5A 1U2DA 2XDQB 1GL6A 3AXTA 3IDFA 3K94A 3SM3A 3MCWA 3H0KA 5JD3A 2GPSA 2P3SA 1QMPA 2P9ZA 3B5JA 3UB3A 4G5GA 1E4EB 2I9KA 4PIVA 2CLCX 3HN7A 1TU0A 4ROSA 4C3VA 5AJHA 5BVGB 3FPLA 1GRCA 3OE5A 4L51A 4F86A 1HY3A 1MC8A 3VDXA 2DFPA 2K7ZA 1TT5B 2WD9A 1YQ9A 4DE5A 5HJ7A 2GZ3A 1QIFA 3UEOA 5E6SB 1XHFA 2I1WA 4HI0E 3R2JA 4ILKA 1Q7GA 4JYMA 4PTLA 4UNRA 3LVRE 3K09A 2QLJA 3A28A 3NYIA 1RHKA 3RUCA 2W90A 3BCSA 4R9UC 3VGPA 2VN8A 4HGOA 3VR5H 1I2ZA 4DMRA 3QNWA 2X9VA 4ZO6A 4B0PA 4RJTA 1ENZA 4KL8S 3MTGA 2FSUA 4W8OA 5JNRA 3BWCA 3BA6A 2X0RA 2PXHA 2YQ5A 3ZC3A 4ALKA 4HNVA 1YKGA 1BWSA 4GUAA 2FRDA 4K0RA 3SC2A 3EHDA 1KMIY 3CVUA 4O3FA 3EFEA 1ZH6A 2IY8A 4RE6A 1V4VA 4JBIA 1Q6YA 3TQOA 5LMZA 4O63O 5ICFA 2QL7A 4MUNA 4Z9YA 4K8OA 4EFLA 4KXMA 3KZNA 3KSMA 1Q5PA 5BN3B 3AVQA 4OU5A 2N75A 3W5SA 4BO7A 1ML4A 4H3KB 3K6RA 4ZIRA 2F8TA 1OX5A 4TV8B 2HHHB 4G0ZA 1RYZA 2C59A 5TMEA 3VR1A 5AHXA 3KDSE 5LA6A 1QORA 1ZIXA 3L01A 4KCGA 1PT9A 1ZS9A 2PCJA 4EELA 1W59A 1WOYA 1EHCA 2ZCVA 4QTZA 5CFOA 1DE0A 2HO5A 2PEYA 3FSJX 1IN5A 1ZIOA 4YRKA 2CK3D 3B12A 1TW2A 4QBHA 5DBOA 5IFKA 2I6UA 4L57A 4O59O 1J1ZA 2RHDA 2HHJA 3U39A 1C0KA 3TRIA 5ADHA 4JQYA 3ZV4A 1CS4C 1SBQA 3PGKA 1NUPA 2XE6A 4YFYA 3DE3X 4EK9A 2Z8ZA 4TL7A 4DLNA 3CUKA 4D0RA 5JC8A 3E7XA 2BF7A 4X3CA 3KYCA 2C82A 1P9LA 3GRVA 3ENWA 4I1RA 4CLRA 4L28A 3NHLA 4PC1A 1XRJA 3JQCA 1ZMRA 2I4MA 3MZ0A 2C2HA 4RK4A 3HV2A 4H27A 2PT5A 1NX9A 3DE2X 3OWOA 3ZYZA 5L53A 3DCNA 3GLHE 2VOEA 2B4QA 2ZKLA 3MC1A 4EG6A 3TTXA 4S1PA 2JB9A 4KN8A 3IP7A 3KV3O 4PGMA 3TW4A 4BWVA 5K0BA 1L4UA 2EGHA 2QTVB 2IH2A 1T5BA 4C4PA 2WG1A 3RBZA 4URYR 3NGXA 2IHUA 2NV2B 1N2XA 1WF6A 3DJYA 1IRIA 1J0DA 3GK3A 3N2GA 4MLZA 1J2TA 3QWFA 2ZYGA 3SF8A 2JIMA 3LPLA 5J43A 4JVSB 2AL7A 3MTQA 3DDUA 4KACA 4D5EA 3Q9SA 1SCKA 2NAPA 3CRW1 3D6FA 4RF2A 4ENQA 4G1VA 5JTTA 2BGWA 2I6FA 1Q1AA 4F2WA 1WZIA 2EX1A 2R6CA 3MJHA 4UQPA 4WACA 2B3TA 2FKAA 3R9IA 3W5DA 1PHPA 3EHEA 1ZHOA 4AXBA 1F06A 4IVRA 4TROA 4EKYA 1I13A 1EYZA 1ZH8A 1T6ZA 2ZYIA 3V7FA 1NWHA 1SQ5A 1D8AA 1UBTS 3EYAA 2BZSA 4J07A 4X85A 5IM5A 4JB3A 1CQWA 3WLNA 3DV0B 3Q87B 3RVLA 4EZBA 1JE1A 2DFKB 3GT0A 3NIDB 4JB0A 2COKA 2QM0A 3PBKA 2I8CA 1XQXA 3WNQA 1K08A 1LK5A 2PH3A 3O8DA 2PPLA 4LWOA 1JSRA 4PSKA 4UMEA 3TR5A 4EI8A 1A5TA 5C3MA 4RO0A 2QUZA 1CF4A 4WFIA 2VDLB 1CJBA 1RXYA 4J1SA 4IHQA 4MVJM 4TYWA 1CR2A 5FPQA 4JU8A 1AM4D 2Y1WA 4F9GA 2A7QA 1W29A 3GJZA 1L8AA 2IEGA 3JQQA 3IBCA 3R8XA 4OMFG 3BIWA 4JXKA 4R01A 1F51E 3WWDA 5HHTA 4NJMA 1QH8A 4OB7A 4PFQA 3IEXA 3OOHA 4TS3A 4DIMA 4EJSC 1OAOC 2NPOA 4ZU6X 1HBJA 4JD5A 1BE0A 1PD1A 3RAFC 1XU9A 4OI4A 1Y81A 4YUYA 1N3YA 4A8JB 1RRGA 2O2JA 3BHMA 3IAS1 5JIBA 3KSRA 3U19A 2C9BA 2Z30A 5CAEB 3NC4A 1S9HA 3I5XA 2ZR0A 2XD9A 3DM9B 2SKDA 4HYYA 2HNAA 4OLBA 4RPLA 4F2HA 1ZQ9A 4O5AA 4FYWA 3BTSA 1T3LA 3ZDCA 2OCDA 3PDHA 1RYYA 5LNK6 4P84A 2WE8A 3S27A 4BJHB 1QQAA 3M34A 2SBTA 3JQBA 4UCFA 5AVQA 7ADHA 1CFJA 4M1OA 4Z0NA 3NNDA 2GEKA 1D7OA 4M86A 2D1QA 5FI5A 2Q4OA 1E5QA 1RD4A 4N8SA 3RADC 1AO3A 1QV7A 3D8RA 4TMKA 3ILXA 1Z47A 1JG4A 5JOQA 3AONB 4FYMA 2V74B 4Z6KA 4HPWA 1P6XA 5TGDA 3MMSA 2ON6A 2CZQA 2FZWA 1HKHA 2VQDA 2W42A 5BRNA 2B2XA 1ZH4A 2ZBGA 4TZ6A 1JAXA 3NV7A 3MBOA 3SS7X 4ZAWA 4BFLA 4NCHA 3WLOA 1T0JB 4RF4A 5ARDA 4R81A 1BMDA 4AJKA 2NT3A 1UFOA 1XHEA 4FFNA 3OFVA 3TNJA 1TK9A 4Z0HO 5I7AA 3QLUC 1J2RA 3TZKA 3CUUA 3ZLUA 3HUFA 4J0QA 4URWR 2BN4A 1B7GO 4JP8A 1THGA 4B6FA 4BYMA 2D0PB 3E8XA 1W1UA 3I5AA 3O03A 1EQUA 4QOFA 2WF8A 1M8JA 1CJTC 1VIDA 2IYZA 2Q6IA 1AKNA 3IV7A 4I1VA 1U7ZA 2BFNA 2JHFA 4FSHA 4WXEA 3FDZB 3I2GA 4WY8A 1H4QA 1NVFA 2EQBA 3KO8A 4MVJF 2PZFA 3GYGA 4FYHA 4BWFB 4R9RA 1U0SY 2A3NA 2JJ1D 4WKGA 3SR4A 3AO0B 2GJSA 2YJNA 3EVDA 1WV1A 1CY7A 2AFIA 2OORA 5LYJA 3F78A 5ULLA 1QYIA 1EAYA 3KJQA 3T7EA 3VR6H 2AG1A 2EEPA 4YC7A 1L0BA 3NFRA 4CEHB 2OD7A 1QGUB 2WIFA 3EMVA 3JQ8A 2IT1A 3I5MA 1BXRB 4JP2A 2ZBPA 3KUCA 4UU7A 1L6RA 1T2DA 5TC4A 5TVKA 3FKJA 1WXQA 3W2TA 4FWTA 1S2DA 1EVLA 1GNSA 4F3KA 5B1HA 4DRXB 5KYTA 1SRRA 1DV2A 3LTEA 4K46A 5A7FA 4KP7A 1C30B 2NT4A 3E6AA 3VNVA 2ZREA 3S6JA 1KYQA 5F7ZA 4CUKA 4LK2A 1ZH2A 3AF1A 2DETA 4EJ2A 1YC5A 3UMJA 4QQKA 3THXA 4DA8A 2JKVA 4NPAA 5HG0A 2Z2ZA 3OCJA 1H05A 2GO7A 2XKAA 4K6OA 5E6RB 621PA 3K30A 2XWQA 4DQDA 4M83A 1Y1RA 1YUMA 3PX7A 1R66A 4DR5B 1RAGA 1SCAA 4URUR 3ST7A 4RHYA 2VPTA 1SQFA 1JDPA 4HUQA 1FE8A 1PNVA 2HSDA 2ZG6A 5K7SA 1E1KA 1QX4A 2WAMA 4QG3A 2Q1UA 2CNKA 1V71A 1Z7YA 2FJPA 2G17A 1VJCA 3R5XA 4RM2A 5L3SB 1LDYA 2CUZA 1PBTA 3NALA 3MAAC 1OA1A 4E13A 3CISA 1T2UA 3O4HA 1G6HA 4IIVA 3A1FA 1MABB 4JVMA 4LQCA 4K6MA 1SJ9A 2B9VA 3CB4A 4INJA 4JBYA 2H65A 4Z4IA 4BEVA 3DL4A 4CMGA 1E7QA 1JQ3A 4NZOA 1GZHB 1SNYA 4TYQA 1G2PA 3SSAA 5EI5A 3NBFA 1I9GA 1NDQA 1GPH1 3IVGA 5B2EA 3LWZA 1ZG3A 3VTKA 4F8JA 3IPRA 1AOXA 4NJEA 1RXEA 1QP8A 3DQZA 3T3OA 4KAXA 4TYYA 4A0SA 1MRZA 4D3DA 1XXHA 1FS6A 4ZTZB 3FDFA 1YJ8A 4DBZA 2W6IA 3U09A 2QQGA 1C8BA 5A9SB 5JUWA 5LQUA 4ITRC 2GD0A 3EVTA 3AESA 3IS3A 1DZIA 4CV2A 1M2NA 2V7TA 5HCNA 1U0RA 3WB2A 3TOVA 1XFDA 3JSAA 1GGJA 2JGMA 2YJ4A 3N87A 2C84A 3O38A 3QI7A 2JLUA 4CFYA 4Z7OB 1KEVA 3IUPA 1FNBA 2VNIA 1G16A 4LRXA 1KP9A 2REQA 3F67A 1FP1D 3LC7O 4MI1A 3O4JA 4DJTA 5KSOA 1RMTA 4YR7A 3L7MA 1L5HA 5HILA 2QB5A 3NASA 3MRTA 3CWCA 3E53A 2GK3A 2ZE7A 2J3HA 2ZPTX 3IJ5A 1XTTA 2H08A 3G8YA 3LA6A 3ZOZA 5EWMA 2XMPA 1RVV1 2FI1A 3GJ7A 2BGJA 1DIOB 2WVJA 5IX8A 2H2FA 2ORIA 3NNNA 4PLWA 4L16A 4DB2A 1NQAO 1NLYA 3AF4A 3R3VA 4ATNA 2ERXA 2HBZA 1OXVA 4LTMA 1ISSA 4C7OB 2XQIA 1DPGA 2BRUA 5CEFA 5JDCA 4QELA 2J1LA 1LCIA 4MRVA 1MDBA 2CVOA 2J3JA 1AB6A 1F2VA 3PWTA 4WN3A 5BMVA 3E18A 4NH0A 3EGXA 3GX1A 4MKHA 3VZCA 4H3SA 5T4BA 421PA 4D42A 1R4MB 2H1FA 3U2QA 1DIBA 5ITWA 2GM4A 1ESEA 2ZDQA 3IPXA 3JYNA 3WRXC 5KOJB 2G70A 2PX2A 4JB8A 4OGLA 5EAIA 1KJYA 4GKBA 3F73A 5K0NA 4XOUA 1E1RD 2WUFA 3FUVA 4Y6GB 1TUEA 3IMEA 1D4FA 2QTRA 4UOEA 4D4HA 1FTGA 1CNEA 1HFEL 1KJ9A 1SZDA 3AKDA 3LHSA 3LD9A 4WLEA 1B93A 2XW6A 1E6WA 3QTBA 2D13A 1E0KA 4UHDA 3NVAA 3PJRA 4TRNA 3RTEA 1PG5A 4YA6A 1D0VA 2YW9A 4HXGA 4Y1FA 3RUDA 2FPMA 3RRJA 1GSAA 5HUQA 3C7KA 1LB1B 2J6IA 4PZAA 2J8ZA 3LDHA 2X0FA 1F0KA 4XM1A 3WHLA 3HCPA 4KGZA 4ES6A 4D2IA 7MHTA 3LGAA 3NHKA 2RHBA 3ISJA 4KO2S 2B6HA 3V8PA 2EBUA 1RAEA 4HWGA 2VDMB 4M6WA 4Q0MA 3OECA 3VISA 1DT3A 4RAOA 5CFPA 3RS8A 4EI2A 1PYDA 4CQNA 4XR4A 4TMVA 1LW7A 1TX4B 2CD9A 2OCKA 4IVNA 3VI3B 3I61A 4EA9A 4FFOA 3WISA 3QBEA 1DXOA 1L7OA 2ZJBA 3GAMA 5IT9A 4MGZR 2QY9A 3I83A 1IVYA 2O5VA 5DXFA 1O9HA 1NVGA 1R5NA 1N0VC 3Q9UA 2CN1A 4R0NA 5L9AA 3R5HA 4R6XA 3DDZX 2P2GA 1AGRA 4WZZA 4UHFA 1HLFA 3FBWA 5EHNA 1UT6A 4P35A 3RRXA 4DILA 2H4FA 3M1AA 2NO4A 4P8RA 4KQHA 4NS4A 5CDYA 3BPSA 3RVSA 3C15C 3MYRA 5BMOA 2CF5A 2FF7A 4CEIA 4NCJA 1UBGA 4WK2B 3QENA 3ND9A 1A0OA 4V1CB 5I7EA 1LK7A 3RS9A 5BNIA 1GZUA 1QYWA 3A9SA 5GM2A 1C9MA 4HG2A 2ZSIA 3JQ7A 3DZFA 3O2QB 4FR0A 4IPTA 2WSIA 5CVJA 5DN6A 4DTIA 4QZVA 2R96A 4PYJA 3ROMA 2VF8A 3VR5D 3IESA 1UPTA 3U7EB 3W04A 1JLMA 2QVCA 3V9PA 3FTNA 1U90A 1R2QA 1T1SA 2FSSA 3JX9A 4M0UA 5EKXA 4M9XA 3L7YA 1PL0A 1NBIA 4HDKA 4KGVA 4EFKA 1DCFA 3DTNA 1PLLA 2XMGA 1SUCA 4BVLA 5AUNB 4ZYYA 2HHAA 4X84A 2N46A 3OO1A 3LKZA 3ROFA 3TIXB 3ZV6A 2RIRA 2BTOA 2XEXA 2XYVA 3WWOA 3OQMA 1KYTA 2W00A 3CGWA 3FRHA 3DKKA 2X42A 4KQMA 4N01A 3ZHTA 1DJMA 1MQ8B 1P2BA 1PX2A 1H85A 3BFPA 1KEEA 1QK5A 1A95A 2R1TB 1X8JA 1N7IA 4F7WA 1VYTA 3P2JA 3LM8A 2CJFA 3EAQA 4UDXX 5JASA 3IPYA 1JDJA 1G9SA 2AFHA 3DNFA 4HRAA 5GONB 1OFUA 4J6EA 1Q14A 3E84A 4XQCA 1C14A 4DUPA 3PRYA 1L4KA 1NNLA 1T8UA 3Q3IA 1FQKA 3C87A 1AXEA 1WUHS 3DEKA 5BNZA 3TRFA 4MW1A 1NP6A 1U3DA 1ZIYA 1FK8A 4XRGA 3HYTA 4YRQA 3AOEC 4HS9A 4KDRA 4G0MA 4OO3A 4E22A 5DTMA 2ODEA 2IW1A 2NUPB 4Q4AB 3ZU2A 3GU3A 3BRWA 1OH6A 4WY2A 3KDAA 1SEPA 4M89A 5D3MB 3T0IA 3CVOA 1BDHA 4G2NA 1WX1A 2QTHA 4O2LA 5BNWA 3GPBA 1J8MF 5FV4A 3MLBA 5D6OA 5EHIA 1ZA1A 1NPDA 1BHSA 3PENA 1X7YA 5EYPB 1VBKA 3E7DA 3M5CA 1TB4A 3A4LA 3OEWA 1TYCA 2NU6B 3S2SA 3SSOA 5GINE 3O73A 4GBED 3AZPA 1JV2B 4C7VA 5CTJA 4MW6A 3JV7A 4YCDA 1JR4A 3LT1A 2VYVD 4BBJA 2LUOA 4WL0A 1K0FA 4UNIA 4PBTA 2O8FA 4LRSB 1KZGB 4YEDA 3ROPA 4S04A 2H1SA 3HCDA 4UM9D 3R9KA 4PYLA 3Q3GE 1EVZA 4C88A 1FFSA 3QEBZ 3ECCA 5JE8A 5B5SA 5IMBA 2WZBA 4A6EA 2ZR7A 3U3MA 2OXTA 2C5HA 5HCUA 3AXSA 3GN1A 2V7UA 2EW8A 1MTZA 3BWVA 4KN9S 3RSOA 1WW8A 3VC2A 1DIAA 2VLBA 1L2TA 3KU1A 4OB8A 4HK4A 2I2CA 1ZLXA 5JQGF 3GNTA 3RFVA 3FOEC 1JHVA 3K0CA 1R64A 2WA1A 4J1TA 1Q0SA 5EERA 5M04A 1E5VA 1U8UA 2RJNA 3Q6IA 3NU1A 2GN8A 2AMYA 5E4FA 3VRHA 1T25A 1NQWA 3HDJA 3W5AA 3MYYA 3MMNA 3QOWA 1E0SA 4AY3A 1OB5A 5JYEA 1G41A 4ESHA 5KYWA 5HR5A 3VUEA 4GPIB 5EJ7A 1EX9A