4YO7A

Crystal structure of an abc transporter solute binding protein (ipr025997) from bacillus halodurans c-125 (bh2323, target efi-511484) with bound myo-inositol
Total Genus 104
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
104
sequence length
287
structure length
287
Chain Sequence
b'TGDSGQKVIGVSISNLDEFLTYMQDAMKEEAANYPDFEFIFSDAQNDSTQQMAQVENFISRNVDAIIVNPVDTTSAVDIVNMVNDAGIPIIIANRTFDGVDQATAFVGSESIQSGLLQMEEVAKLLNNEGNIAIMDGELGHEAQIMRTEGNKQIIEEHDGLEVVLQGTAKFDRSEGMRLMENWLNSGTEIDAVVANNDEMALGAILALEAVGKLDDVIVAGIDATPAALEAMKEGKLDVTVFQDAKGQGATSVKVAVQAANGEDVEDAMIPYELVTPENVEEYEAKY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Sugar ABC transporter (Sugar-binding protein)
publication title Crystal Structure of an ABC transporter solute binding protein (IPR025997) from Bacillus halodurans C-125 (BH2323, TARGET EFI-511484) with bound myo-inositol
rcsb
source organism Bacillus halodurans
molecule tags Solute binding protein
total genus 104
structure length 287
sequence length 287
ec nomenclature
pdb deposition date 2015-03-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13407 Peripla_BP_4 Periplasmic binding protein domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yo7A02
3.40.50.2300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yo7A01
1NTRA 2L2QA 1LBIA 1GUDA 4YP9A 5JNTA 3HSYA 1Z16A 3ROTA 4E7OA 1YMUA 1A2OA 4RK4A 1L5ZA 1ZGGA 4D74A 1C0EA 4LDZA 3I45A 4RV5A 1QMPA 3RVOA 1JDPA 2F8TA 4YCSA 5IUJC 4FB4A 2QSJA 3Q15C 4QYWA 3RH0A 1U2PA 3Q41A 1FFGA 4OTZA 2FVYA 5EWMB 3S99A 1RXEA 2FEWB 1LK0A 3H5IA 2MSKA 5PNTA 2FW0A 3EAFA 4RK7A 4EGSA 2IPLA 4N03A 2JK1A 5C5EA 3H1GA 1FFSA 2KYRA 3K4HA 4G86A 3JS5A 3DBIA 4D6XA 1URPA 4W5RA 1SXHA 5C5CA 1D2AA 1MIHA 1DCKA 4L85A 4QPJC 4OLAA 4KREA 2FLKA 2PMCA 2N9UA 1DBPA 4OATA 4ML3A 1ZGZA 3MQ4A 5FBKA 2E4XA 3HO1A 3O74A 1ZN2A 3NNDA 3OO1A 1LJUA 4UHJA 3L6UA 4JOQA 4EYOA 5KWSA 4Z0NA 2H0AA 1Z25A 3CLKA 4MS3B 2ZWMA 2QZJA 4G0OA 2PUGA 3O2JA 2MYUA 2ZAYA 2W42A 4F06A 4JA2A 1HEYA 1U0SY 2QW1A 4EVRA 1VRVA 1D4ZA 2JVKA 2O20A 2VK2A 3C3KA 4MS1B 1WETA 4JAVC 1QQAA 2MYNA 5EWLB 2FEPA 1ISSA 3CHYA 4WZZA 1DJMA 1RXIA 1NXPA 1D5WA 3N6VA 2JVIA 5JNVA 3CNBA 3MYYA 4PZ0A 4TLMB 1EWKA 3EQZA 4YR7A 3LTEA 2JRLA 1NY5A 1Z12A 3M9XA 5FWYA 1VPWA 3MMNA 1F51E 3H1EA 3JPWA 4ZPJA 1Z17A 4GNRA 3KYJB 3MM4A 1AB6A 3OM0A 4EUKA 4HYEA 4Z4EA 5BQ3A 5T7BA 3T8YA 1RZRD 1FSPA 4G0MA 4M88A 4YRZA 3DLHA 1JX6A 3Q7TA 1VLZA 5TE9A 3F7NA 4O1HA 3RVKA 4MAAA 5KQMA 4RK1A 2PUCA 3QELB 4YO7A 4E7PA 2PUDA 5IX8A 3H5OA 3UK0A 3NHMA 4WUTA 2RDMA 3LOPA 4N76A 3H5VA 1Z2DA 3CRNA 4N47A 4LE2A 4OG2A 4F12A 2FEKA 3OMXA 3IP5A 5FWXB 1E6KA 1PEAA 3F6PA 4ETNA 2PLNA 4MQFA 3H1FA 1JHZA 3NNNA 4RXMA 1QO0A 2X7XA 3IP7A 1DCFA 3EULA 3UKJA 2WJWA 2OENG 3IPCA 4RK0A 4F11A 2PAFA 1NXOA 1BDIA 3QX8A 1U2QA 4KZKA 4G0XA 1ISRA 4Z4CA 4KNYA 4MQEB 3E61A 5DGCA 4W5QA 2OQRA 5FWYB 3HV2A 3HDGA 5EWMA 3W9SA 2XDYA 3BREA 4IMJB 1Z26A 1EWTA 3BRSA 3D8UA 1EWVA 1DBQA 4ETIA 4RY9A 4P98A 1U04A 1FFWA 2FN9A 2PL9A 3FGZA 3HCWA 2LUOA 3A0UA 3T6KA 1E6LA 4WWHA 1KRWA 4IRXA 3N53A 1SRRA 4LDAA 3O2QB 2GWRA 4MGEA 4WXEA 5IC5A 1RPJA 3TB6A 1F4VA 5KQPA 2PUFA 1GCGA 4DADA 3QLTA 5EWJB 1ZESA 2JVJA 3SG0A 3N0XA 1YS7A 3DZDA 3HDVA 2TMYA 1XHFA 1BVHA 4MS3A 2FTKE 3O1JC 2HPHA 4MQFB 3JPYA 4CBVA 4N0QA 4XASA 2WJAA 1QPZA 3G1WA 5TPZA 1NATA 2NT4A 2IPNA 8ABPA 2WMYA 4JB0A 1JFVA 4MS1A 2JBAB 3H75A 5TQ2A 1XHEA 4YGXB 5EWLA 5BRAA 1PNTA 3SY8A 3ILYA 1Z13A 2GX6A 1YK0A 3JVIA 2A9QA 1NXTA 5DLEA 3KJXA 4XAQA 5BRJA 2I6FA 1KMIY 4S05A 3O1HB 3IP9A 2E4UA 1A04A 5IEBA 3OQOA 1I3CA 4JB2A 4YWHA 3TO5A 1LBHA 4RY0A 3HUTA 2FSPA 2F8SA 3LUKA 1P6UA 2GKGA 1W25A 3N0RA 4ZMSA 4RDCA 1JWLA 2LBPA 2MSWA 3D02A 3QLUC 3FDFA 4KQ9A 1DCMA 4ZMRA 1ZY2A 1JFTA 3KHTA 3JVDA 3QELA 1XWWA 2PUBA 1SD5A 2FQYA 3QLVC 4RXTA 3SQNA 3LKBA 3I5AA 4LE1A 2J48A 4Y9TA 1OXKB 1S8NA 5JNWA 1DRJA 3CFYA 1BA2A 5HKOA 3H5TA 4KV7A 1ZH4A 2ID9A 2PE5A 4HNQA 5FWXA 5TQ2B 2WWVD 3OLZA 4EYGA 4HNRA 3QK7A 3CTPA 1BDJA 1ABFA 3IDOA 3P9YA 1L5YA 3H5LA 4MYRA 1PEYA 3KS9A 2AYXA 2IPMA 3NHZA 3HK2A 2FLWA 1P6QA 2FMHA 3M9WA 1D1PA 1QKKA 4F3TA 1NXSA 2CD7A 4MQEA 3JTEA 3QLUA 3LUFA 4MR9B 2FMIA 2R47A 2GI4A 2L19A 1YS6A 4FE7A 3RQIA 4B09A 1QP0A 3MA0A 3QLVA 4TLLB 1M2EA 4MLCA 1ABEA 3IP6A 3JY6A 4L4UA 2MSLA 5ABPA 1J56A 1TMYA 1Y1LA 4Q6WA 5DCLA 3HVRA 5HSGA 3GT7A 2FN8A 2V0NA 7ABPA 4W5OA 1DC8A 3QX9A 2NZVG 3N75A 3RVRA 1USGA 3R0JA 1SXIA 2R4QA 3H5WA 1TLFA 3CG0A 3O75A 5GOTA 4YS6A 5EWJA 3CS3A 4KK4A 4WT7A 1E6MA 3DGEC 3IPAA 3KLNA 4G0QA 3Q7SA 1JDNA 4DN6A 1QP4A 3A0RB 2IOYA 2R25B 3C3MA 4Z4IA 1DBWA 1CHNA 3EQ2A 4GPAA 4TN5A 5KQGA 3HXMA 1GLGA 1JFSA 4NCAA 3OQMA 1JF8A 2JBAA 3I09A 4G0YA 4PICA 3RVSA 1YIOA 2AYZA 4MR7B 3O21A 1E2BA 3C6QA 4MLDA 4Z4GA 1YVUA 5CNMA 2QVGA 3QEMB 3OQNA 2PL1A 2QU7A 5CHYA 1YTUA 5KI6A 2WB4A 4LRQA 2WY2D 3OM1A 5KQLA 2RJOA 2CHEA 2FMFA 4RY8A 5FBHA 3RVNA 4W5TA 5IBQA 3K9CA 1ZH2A 1YMVA 3SAJA 1JL3A 3H6HA 3C97A 4O1IA 1K68A 2JCGA 3HZHA 1TM2A 2P9HA 4NV3A 2HSGA 2B4AA 3A3KA 5E3JA 1EFAA 3F73A 3QEKA 3A10A 3OLYA 3LFTA 4D6YA 3URMA 2M1ZA 3RVLA 5I4CA 4RWEA 3HJFA 3GL9A 2E4VA 1DC7A 3DLBA 3LUCA 2ID7A 1P2FA 4TMYA 4W5NA 4NICA 3FFTA 5TPWB 2WRZA 3HUUA 4RS3A 3E3MA 2VUHB 4MS4B 3N0WA 4Z4FA 1MVOA 4O5AA 3C3WA 2A9PA 1TVMA 5TPZD 3LUGA 3B2NA 4KK3A 4LZLA 4DQDA 4RK5A 1ZAYA 5BR1A 3TD9A 1JLKA 3HS3A 6ABPA 3HM9A 3GBPA 2IKSA 4MR8B 3BRQA 2H3HA 3GA5A 3CG4A 3OMWA 3LUJA 3OLXA 4MRMB 1ZITA 3KCNA 1Z18A 4IF4A 1QNLA 4Q7EA 4KFCA 5IULC 4JP1A 3F6CA 2LPMA 3T95A 1JYFA 4MR9A 1LJLA 3EGCA 5KC8A 1OXBB 4ZYLA 3O2SB 2R48A 2A9RA 2A9OA 1NXWA 1IIBA 3EDCA 3LKVA 3UUGA 5IUNC 1RNLA 3LUDA 4EYKA 4XXHA 1MAVA 2NUBA 5JS2A 3MIZA 4RKRA 4IMIB 4RXUA 5JNSA 2HJ9A 3CZ5A 1M5TA 2DRIA 2E4YA 1AB5A 3Q7RA 2HQOA 4JASB 2PJUA 3KLOA 2BGGA 3RVQA 2VUIB 3L49A 4RKQA 2NZUG 2QVCA 3TX6A 2RJNA 3MF4A 2JB9A 4XARA 1JBEA 3FFXA 1JYEA 3KYIB 4FE4A 1DRKA 2PKXA 3CZCA 3VNAA 3VNBA 4KMRA 2CHFA 4NCBA 1PHRA 4F8JA 3KG2A 2P4UA 4IGAA 3NNSA 4OBBA 4ETMA 4MR7A 5CNJA 4PEVA 3O1IC 1MB0A 5DTEA 3QEMA 2FQWA 2HQBA 1MB3A 5CNKA 2E4WA 4PYRA 2L18A 5JNUA 4KPYA 1CEYA 2FXIA 1D1QA 3GBVA 1QP7A 4EY3A 2QXYA 3Q9SA 1ZHHA 9ABPA 1H9CA 1USKA 4NQRA 5DKFA 2FQXA 4HNSA 1NXVA 1ZVVA 1PUXA 3GV0A 2NT3A 3GRCA 5GQSA 1C4WA 2Q5CA 4XFKA 5HM6A 3ILHA 1BAPA 4LX8A 1UDRA 3FFWA 1R8JA 5IEJA 4KVFA 4Z99A 4XLTA 3CU5A 5JNRA 1SXGA 3CKMA 2YHBA 3BILA 3EODA 1QQBA 5TPWA 3SNKA 3KSMA 4RSMA 5ED4A 1Z15A 1RZRA 1NXXA 3NBMA 4MS4A 3RVMA 2MYPA 1K66A 2QR3A 1CYEA 1QO0D 4LE0A 3OLWA 3LUAA 1JH9A 2E4ZA 4Z9AA 5D2CA 5HQJA 3FMVA 3I42A 1W9HA 2VYCA 5TQ0A 2MYTA 4Z4HA 1EHCA 4YLEA 4EVQA 4MR8A 3DGFC 2FKAA 4H60A 3SM9A 1A0OA 5IUKC 4RK6A 4P1ZA 1KGSA 2IDMA 3GWGA 4KQCA 5KC9A 1Z2EA 3KKEA 5T3YA 1GUBA 4MRMA 3RVPA 3T38A 5B3JC 2LIVA 3HEBA 4WXMA 3GYBA 4H3KB 1TJYA 1USIA 1APBA 1GCAA 4UHKA 1YK1A 4RZSA 4EYQA 3LMKA 2B1JA 4H3HB 1U8TA 2L17A 3H6GA 1B00A 1M5UA 3EJWA 3G85A 4QICA 1M2FA 2QV0A 1BDHA 2HQRA 1DP4A 4Z9BA 2IYNA 4QYMA 3M6MD 5CNIA 1VKRA 2IPAB 6CHYA 2M98A 4EVSA 4N41A 1KRXA 1DZ3A 3N8IA 2RGYA 4MPTA 3OLVA 3BBLA 4RU1A 1PNRA 4Q6BA 5B3JA 2PUAA 1T34A 2YHAA 4YV7A 3KTOA 3RVJA 4N0PA 4IILA 3LUHA 2LP4Y 5TQ0B 4ZJPA 1DG9A 2CWDA 5JS1A 4KRFA 4G0ZA 2FMKA 3ROFA 4G0PA 3TMYA 1P8AA 1ZDMA 4G97A 1EAYA 2GBPA 4PE5B 3OO0A 1FQWA 2PUEA 5TQJA 4S04A 5F64A 4OLBA
chains in the Genus database with same CATH superfamily
4MUBA 1NTRA 2A3RA 2VQFB 121PA 4BCCA 3QPBA 4GRIA 1TKBA 5T8KA 1C0EA 5BT8A 1KPGA 2WAOA 4OGKA 5IDQA 1I3MA 1PR5A 1OYYA 3HXQA 1EBFA 1O6BA 1S2MA 2EXXA 3RFFA 4BRZA 2E6KA 3SKYA 4F4DA 1BW9B 1U2PA 1EBUA 2Y1GA 4RABA 5JS6A 3S99A 1I6LA 2QJFA 4CLDA 4B6JA 3IKVA 1EJ0A 4RK7A 1CSEE 3ZNNA 5CYOA 4QUGA 3H1GA 3NETA 4B48A 5G53C 3OTHA 3I9FA 3PS9A 2NXJA 2NO6A 3EPJA 4Z1MA 2NXCA 1MIHA 1N9ZA 5F1OA 4PSVA 5EGNA 3IRVA 2NPFA 4CEIB 1K89A 1Z0AA 1ZN8A 2B1RA 1WMFA 3I5YA 5CLHA 1HDIA 3LHKA 2DPHA 3K5PA 3CWQA 4MQMA 5KX5A 1O5IA 1A8IA 1SVSA 2FKNA 2BMEA 1PGJA 3NX4A 3COZA 4Z6KA 1RLOA 2BPOA 5DTJA 1X8LA 5KOYA 3ETHA 2J32A 1E2MA 4MGYR 4YCCA 1VBFA 3FTDA 5ERYA 5FFFA 3P9XA 1O94D 2W70A 2R7LA 3UPUA 4W5WA 3T9AA 2MU1A 1IY8A 1SUSA 2JVKA 2XXAB 3IT3A 4RCYA 2RAUA 1QQAA 2D5BA 4AQYB 3OJXA 3VVCA 3WVNA 2E49A 1XZQA 1XMPA 4NE2A 3L84A 3WYDA 3U48A 1H8EA 4QTZA 3FSGD 2YYYA 3TLJA 5GWXA 2H0RA 2R7KA 3IAM6 4IIBA 5D01A 3G0GA 2YXDA 2G04A 2G72A 2YQ5A 3E18A 2YMMA 3NWBA 3VPDA 2JLYA 4IJMA 3LIIA 4YLGA 2GEKA 2XD9A 3OEWA 2CFRA 3R5XA 1RRVA 5C4IA 1A5ZA 1Z12A 3F3MA 5C46F 2JI7A 5T64A 1XZ8A 4XEHA 3ENZA 5GV7A 4C7JA 3JPWA 2CCJA 3LBNA 4GNRA 2FOXA 1D9XA 1RXUA 2ZETA 3CMCO 3ZDRA 5K7SA 3DLAA 4BVEA 2LIPA 3T8YA 3TNFA 4RKWA 1Z0UA 4N0MA 5DCWA 3A1EA 1VBNA 2UYGA 1QH0A 1QFXA 2V54A 1SCBA 3HCNA 2ZAMA 4TMXA 3T3OA 2R8XA 5FTJA 2GR9A 1DFHA 1N92A 1BMFA 3DQZA 1PT5A 1IRXA 2VR1A 3AM4A 1PWHA 5CVJA 3AILA 1P2SA 3EMDA 2NTNA 3ENQA 4I55F 1QZZA 4FVTA 3IDSA 4JC0A 4XA8A 4IL5A 3B3AA 2XUIA 3RNOA 4X92A 2OXFA 4DF3A 1Q84A 5KTPA 3UC5A 4ZEXA 3ANSA 3GRRA 3JAKB 2H2AA 1L5GB 2ID4A 2WKRA 3IJRA 3PHCA 3PI7A 3RRJA 2EGUA 1ETUA 3NHSA 3P52A 3UKJA 5IFLA 5HDQA 4C3UA 2P3LA 2PL3A 4EUEA 1E4VA 2QG9A 3MJDA 4MWCA 3DXZA 3F4BA 1T0JB 1R0SA 1Z2NX 1SOWA 4LW8A 5EHQA 3V00A 4L8YA 3W5JA 4E88A 1CNEA 1QG6A 1V6AA 2HSEA 3R1IA 3VOAA 4EENA 4UZFA 4YAIA 2XZOA 4TWRA 4RVDA 4ZTBA 4C7OB 3SBEA 2WA1A 3B1ZA 4RUKA 2C9CA 3JQ8B 5DMXA 2CLEB 4DIBA 1M2KA 1NI5A 3T7IA 3SZLA 5CCEA 4MWEA 1JNXX 4IVQA 4Y2UA 1WXXA 4X95A 3OKFA 2PDAA 3KWLA 5AM1A 4QBHA 4ZCIA 4DFDA 1CE8B 1V16A 2C4KA 3NDRA 2X4IA 3ZH9B 1P0MA 4ANFA 1NVWQ 5LMNB 4FSXA 3OQ1A 3TEJA 3TQIA 2ZPAA 1PZMA 1SOVA 2VP9A 2OCDA 3OI7A 4QATA 1Q17A 3FAZA 4F45A 3UWMA 5JJ5A 3V8VA 1PFVA 1AVTA 2FTKE 4AYXA 2JANA 2UAGA 2D2VA 2Q5FA 4E11A 1Q3KA 1NJFA 2NYRA 3BMCA 4GX5A 2PZBA 2CBGA 4RWZA 4WESB 1LDNA 1CR6A 1I13A 3EEYA 2IHYA 2X3FA 4WGGA 1XXHE 2QXTA 2ONYA 1PL7A 1H1LA 2ZBDA 3QE0A 2B8JA 4KACA 5J9FA 1U0TA 1RHMA 2H52A 1VYTA 5IAJA 3S7ZA 3L4BA 1Z13A 5HIAA 4IOKA 2OB2A 4JC4A 4H0FA 2A9QA 5DLEA 2QQ0A 3KR1A 3VC2A 2VDOB 2B7BA 4BO7A 5EMKA 4PNEA 4Q4CA 1MFZA 3YASA 2PAAA 5B1HA 1EWYA 4I5FA 4HGOA 3O31A 1JQKA 3EVAA 4TSFD 5GP1A 1E32A 2F1IA 3LHDA 4WN9A 1WX1A 1PVDA 4F0JA 1RTKA 5BORA 1YA4A 2A5LA 3U7JA 5FA5A 1OZAA 1SU8A 2ZROA 2X0DA 1VLJA 3ISVA 4ZMSA 3E4CA 4BIIA 2MSWA 1QVAA 3HLKA 2OFOA 1BKYA 1PDOA 4MW0A 3WZLA 2VEOA 5MGBA 1NA5A 4PCVA 1E0JA 2BKVA 3CR3C 4HDKA 5SYNA 1PX2A 3VAAA 4R54A 3ZWQA 1JE1A 4HPWA 5JSYA 1RI3A 1F2TB 2QW8A 4HRVA 2QS9A 3ND9A 3PC6A 1GZUA 2AC7A 4LJ4A 3SFTA 2V6BA 2NLOA 2ZBQA 4D0SA 1B6TA 3BD7A 3AF4A 3H5TA 5JLAA 5HQ3B 2XVYA 1N1GA 1N5JA 2PX6A 3L8GA 2C9ZA 2Q2VA 1NUPA 1G6HA 2O3QA 4OLHA 5D5HA 4IIDA 3WDSA 4F6RA 1J5EB 4TYPA 3QK7A 3F71A 4C3OB 4PX5A 3TWOA 3VU1A 2H7VA 2QD1A 2C4NA 3CYFA 2M6LA 1JBQA 4MRVA 4LSGA 3UFXB 3WLQA 3H4VA 4EZEA 5B57C 4LHZA 3WS7A 2KW5A 4F3TA 2CD7A 1EJBA 4IF6A 2ODQA 2V8BA 2XDAA 1GRCA 2CHUA 1HG1A 1EX9A 1RJGA 1VE1A 2Y3IA 2ZIXB 3C6YA 3KJEA 4TLLB 1U0OC 1X8XA 1BEEA 2EHJA 4LC0A 4DQKA 2QM7A 2JFBA 1M1ZA 1NUUA 4PXYA 5JI2E 3LQ2A 3HMKA 2F1RA 5SZJA 1TYDE 8LDHA 2V0NA 4X7RA 2JCBA 4BMCA 1VI5A 1Z0FA 2ZJ7A 2C7GA 4F71A 4WN3A 3QX9A 3F46A 3U56A 4PFSA 3D2CA 2DWCA 4LV8B 2W8BA 1P3JA 2DFTA 3LXXA 5AVUA 3IOBA 2VDMB 1GPAA 2HSZA 1YB2A 2W6JD 3D5EA 3PSAA 4JIGA 1UT6A 3R40A 3V6LA 5EMLA 3WC4A 3BQ9A 3FIUA 4B6QA 3TLKA 4BP1A 4ZYWA 5B3KA 4Q3LA 1QIMA 3ZCPA 2FH5B 4K03A 1QYXA 4Y2QA 2YWRA 3PPWA 2B69A 4DLPA 2C2BA 1K8YB 5MFZA 2GFQA 4YMLA 3VPBA 2BBTA 3UOWA 2AOTA 4Q16A 2BT4A 3N3AC 1G3IA 1SZJG 4E1VA 3BMOB 4G65A 4CMIB 1JJFA 2VJNA 1TAGA 4LHEA 1HTBA 1XL1A 1HT0A 2LW7A 2WM9B 3DOHA 3HKEA 3KUXA 2CB9A 3HCRA 1IEXA 1U9CA 4GOJA 4D41A 1GQSA 3VBEA 1OWOA 4QE3A 4WLVA 4MI9A 3CSUA 3DMTC 3F5FA 3KOXA 3OHPA 2VIIA 5DBHX 4C0XA 1A71A 3M2PA 3JQ6A 4V0QA 3PF8A 3LT2A 4HRXA 1Y98A 4MA4A 3PEWA 2BM0A 2O3TA 3BMNA 1HLPA 2QMUA 3PNQA 1Z4PX 1R2QA 4NONA 2OSBA 3ZGOA 4NBVA 1UJCA 4DUGA 2XR1A 3O95A 1YVPA 3I1JA 1JPNA 4QQNA 4RX1A 1JXMA 1AGRA 4HGPA 3DJFA 5AK0A 4DSUA 1ZM2A 2ZFUA 4O5AA 5IAKA 3Q3CA 1QONA 3CT6A 4HOYA 5CGZA 4IEEA 5EAIA 1OI4A 1Y7TA 3CZ4A 4CM4B 4Z54A 2ZRIA 3F5MA 1SC6A 3ENKA 2HUNA 5A3VA 1RQGA 5LBUA 2AKAB 5E2IA 3HQ4O 1PEDA 3OMWA 3R3XA 3ZK8A 1M0EA 4PYLA 2PEYA 1M5RA 4PC2A 2F48A 1Y6ZA 5J5AA 1J20A 3G79A 1PFQA 3JWGA 1WF3A 4OAOA 3FJYA 4XLZA 2OQVA 1NMYA 1PL0A 4BMVA 1WA5A 1QTIA 3N8KA 4Y2JA 5IM5A 2DTDA 2EFCB 5TVGA 4Z53A 1DEHA 3ZOKA 2XGSA 2FN7A 4INZA 2GD0A 1I0IA 1P7YA 1QG2A 2LPMA 2PIAA 3FLAA 2ZIVB 3P0HA 4FBLA 4LC1A 3F6BX 4NAHA 3TRFA 3W7AA 2Q4RA 4BLVA 4F46A 4JSYA 4DAOA 3CVWA 3O2SB 5LQUA 4F3CA 2QRQA 3FNGA 1N7IA 5IUNC 1KOFA 3G8YA 1P2GA 4AG3A 3IKJA 5ENDA 1JA9A 2XUFA 3IUSA 3W1VA 1ADCA 1C29B 3U4IA 3ZCUA 3AJRA 2Z8YM 2AFRA 3AEQB 4FGZA 4CNBA 3VVLA 4BQIA 4RIEA 2FFRA 3LT4A 3D6TB 3IV7A 3M1IA 5F9HA 2ZBGA 1U3DA 1Q0HA 4HADA 1TMGE 2PJUA 2BHNA 2IDJA 3PQ5A 4AMUA 2ZAOA 1ULZA 2VDWB 3QPVA 3JZMA 4RPJA 2YNMC 4WCFB 1CUCA 3T1QA 4DWJA 3ZHCA 4TS9A 4D0NA 4NZYA 2QP3A 4PAWA 5IJ9A 1B0UA 3IAHA 5M04A 4O8CA 1EFUA 1V1RA 4PPQA 1G0NA 4K9OA 4W7HA 1NSTA 4AY4A 3VNAA 4XGIA 1N8KA 1NW7A 2M1XA 2XWBF 5ECYA 3RUHA 5GGYA 2CFCA 2I71A 4DA7A 3S2ZA 1KDTA 3GRUA 3HJRA 4F8JA 1A69A 2O48X 1WU8A 4ALLA 1SC1A 4ZVRA 1GQFA 4AKSA 2APJA 2D00A 4MR7A 1ES9A 4CT5A 2GN4A 1JXAA 4GOKA 5LYYA 5A9RA 1XCBA 1O5TA 4L4SA 5E1MA 4O4JA 4G8DA 3T1YB 4JU9A 2D0OB 5F3DA 1JKIA 2PEZA 4MPRA 1BE6A 3EEFA 4BEWA 2AW3A 1S1CA 1Z6QA 3I9MA 1E5VA 1CDEA 4NQRA 1ZSVA 4FS8A 4B82A 3U1BA 5TEWA 4KPEC 3WGMA 2HH9A 3KIPA 4BKOA 1FP7A 3AFIA 4MWOA 621PA 5K0BA 2CNKA 2NT3A 2WWXA 1CWUA 3V8BA 1Z35A 1N5OX 4IH1A 1ULUA 4J1TC 1NQXA 1EFRA 4YUVA 2P91A 3UW1A 3IB6A 1N8SA 3T12A 2FPIA 5A0TA 3BTOA 3IQXA 2PGIA 2AD1A 1XVAA 2G8LA 1WG8A 4I4TA 1XTJA 1V26A 5TDHA 3N07A 1QQBA 2C07A 4AY2A 4PXAA 1AF4A 3BZUA 3WMXA 1OR8A 1UMCB 2HJGA 4JHXA 4GOOD 1PD0A 1XKXA 5JY6A 3MCUA 1AKNA 1OBFO 3CXUA 1D3AA 4Y7DA 5EJ4A 3FUXA 3D4OA 4LXIA 4BKPA 3IXQA 3WNVA 4ZAGA 2FKAA 4UUOA 5IUKC 1H2EA 1CJKC 5HXAA 1Z2EA 4ENWA 3ZDDA 4M7WA 1NZJA 4HDQB 2HA3A 4M9CA 5DN6A 4F2GA 3BF7A 3BOSA 3L43A 1TMOA 4URFA 4WK4B 3V33A 5FLKA 1JDSA 1EXVA 4AL4A 4D46A 2BJHA 2CW5A 4DBVO 2EQAA 4F56A 4WZ6A 4E12A 4YUXA 2G5GX 2HQRA 1QHIA 4PYJA 4KR6A 4RTQA 2H06A 1EJ2A 1V7CA 4S1VA 5FOTA 2FLVA 2YCLA 1DWUA 1AX9A 1CQPA 5D6OA 3D3NA 3GJZA 4GVLA 1Y1SA 3R9WA 1B2RA 1W49A 1KK3A 3EC1A 3STWA 2VTDA 5KWJA 1Z38A 4DEXA 3JWJA 1T10A 4EHJA 5CPFA 4AK9A 4C1NA 3HTXA 1Q7TA 5L95A 2X6TA 3W6OA 3CVJA 1EFCA 2NVUB 4FFMA 1XDZA 3LGAA 2A88A 1BS1A 3NDPA 4QGHA 4QNRA 1DFIA 4TL6A 4IMPA 1DG9A 4KOAA 2DPXA 1QIJA 5IBCA 5JYEA 1YDFA 3ASUA 5I5EA 2YRXA 4JWTA 5KYTA 3LLVA 1BVUA 2H4ZA 1UXKA 1GPH1 4EJ6A 3IT0A 1GN8A 1C3OA 2NO7A 2R96A 4IIJB 3WHPA 2F4VB 7MHTA 3ZCVA 3DZHA 4LGMA 3MMPA 4N5NA 3L7JA 1P31A 3VOBA 1RC8A 4W9NA 3HWSA 1N77A 4M0LA 4HLUC 2O8FA 2P6OA 3W9YA 3WOHA 2OCLA 1Z0SA 3QI2A 4RLFA 3E8SA 4MVYA 1R5BA 2ZUBA 3BIOA 2HY7A 1NVMB 3A14A 4H1TA 2NSJA 3L0PA 3QVJA 1SMKA 4KPUA 4AO8A 5ADHA 5JANA 1USWA 3UMBA 5KOHB 5BWNA 3KQPA 3JVUA 1GPWB 4DPMA 1S96A 4JLPA 3NOVA 4G4SO 1Q57A 2AZXA 1PNVA 4V3BA 4YALA 1V3UA 1NLMA 1NJ8A 2FW0A 2IS2A 5IJZA 1N6KA 2H59A 1NZDA 4LOJA 1TIKA 3EIWA 4I08A 4URHA 1KYXA 2VQ6A 5L6MB 3B36A 4ZI7B 2PL5A 2UUCB 1PW5A 5BMOA 3PT5A 3G6WA 3L04A 2NU9B 1D4AA 1V3QE 4Q4LA 3FVWA 1F1JA 1LDGA 1SVNA 1P7WA 2WEKA 4NL4H 4LGYA 3ACCA 3WGLA 5LQCA 4O3MA 2FLKA 4BTLA 3RREA 3AO0B 3T3HA 4PO8A 1DBPA 1USVA 3LF1A 5FA8A 4LFBB 2C58A 3FGPA 2AFHA 2FJ0A 1X3SA 3SI7A 4RJJA 5FPHA 2O2EA 2EGGA 2HW8A 2PZAA 4DA6A 1RYMA 3OG9A 2PD3A 2CFOA 3OEHD 3UT0A 3AR9A 2R5WA 5C7IO 2FCAA 2OD9A 2W6PA 5GONA 3HPRA 3PUKA 3B13B 3IVRA 2QW1A 3QMMA 4IIGA 4YJHB 5FUMA 1UBJS 1JVSA 3AHIA 3QSGA 4LZWA 4F5EA 4UAJA 5TVKA 1FUUA 4QFBA 3BCRA 2DKFA 1Y4ZA 3BXHA 2VNKA 1ISSA 2VPPA 2AZTA 2W6MA 1H66A 2YWCA 3RSLA 4UVGA 5IC4A 2ZS9A 3I2HA 5EQJB 1GTSA 4PZ0A 2GXQA 3ANXA 2YHIA 5DMHA 3TRIA 3DD1A 3TTYA 5HRUA 1R88A 1K97A 4FMDF 1JU4A 4HN2A 3U31A 2WTMA 2GPBA 1VL0A 1P33A 1P4GA 3JSXA 4NP6A 4B84A 2Q5LA 3C8ZA 4ZO7A 4ZO9A 4OGWA 4BJ5A 1S8AA 2FPKA 2AEEA 3IOCA 3DL0A 3NYRA 3GEBA 4E3WA 4G0MA 4A1FA 2X0JA 3THWB 2CMKA 4DLUA 4DDHA 4EW2A 5KX5B 1IZ9A 2JJ2D 3HCEA 4P2BA 4U39A 3OOEA 4R9RA 1E2HA 4H7KA 1VKZA 2R1UA 2FSIA 3T9CA 3WDLA 1N34B 2QL5A 3QMPA 4QPCA 1O97C 5M5BA 4CIBA 2ZUFA 1WIWA 5CXUA 1CS4C 4IZIA 3VR0A 5LQRA 3R5SA 2BF7A 3TAHA 1EDOA 5ALVA 1E6KA 1SB9A 1X7XA 1V4BA 3RSSA 2REQB 5F1PA 1PDWA 1YB6A 2WYVA 4YI5A 4EY4A 2GS9A 4GHWA 4HN4B 1R4MA 1TVCA 4Q3OA 4BV2A 4QJ5A 2VDVE 3IULA 3ZGYA 2JGKA 1E1YA 4A0FA 3GNLA 4HJRA 4YIHA 2HJWA 2PBRA 3EDYA 3K9HA 3ZV6A 5DGCA 4FGUA 2NUPA 4ZCRA 1SKMA 1R9NA 2QMYA 3IQEA 2PD4A 1J0EA 3W9SA 4NESA 3U62A 4TVSA 1CS0B 1R12A 3KQMA 3WWCA 4YAGA 4CKXA 1QHYA 1YO6A 2FPGB 4F93B 3NHFA 3OIVA 1T6NA 2GPNA 3DCJA 1VL8A 2FN4A 2H2FA 3JYQA 3O3CA 3MTAA 1LPSA 1SXJE 3WB0A 4FINA 4DIEA 5A7FA 3C5VA 1Z4QA 1C2YA 1O95A 4FMCF 4WWHA 4RSGA 3ROZA 3MRVA 4IRXA 5GINE 1D6JA 3JYHA 1TYCA 2GWRA 4QLOA 3AKYA 2A84A 2IXTA 1FLDA 5EPOA 3Q1LA 1NP3A 5KQPA 1A7AA 1SCUA 5ESWA 3DZ8A 3FZQA 1JV2B 2J09A 4QOSA 4JZKA 3LF2A 2VJDA 1TC2A 1ZVQA 3DZDA 5CD1A 1JHUA 1MNAA 4QPNA 3UAOA 4XASA 2Y8EA 3QJ5A 1GAQA 2ZJFA 2ZVPX 3PUYA 1ATIA 4UDOA 4RGYA 4YMGA 1KFBB 1AK1A 5AHRA 1NOIA 3F6SA 3HMQA 4LXTA 1IK4A 2P9GA 1CW2B 4DDKA 2Z6AA 2QGZA 3RTDA 4FYIA 3CUSA 4DTCA 5DNCA 1FB5A 2J5XA 4MI3A 3T0GA 4C5CA 1SGWA 5HS4A 3HXKA 4XUEA 4YEDA 2V3VA 4UC0A 1LLQA 3REQA 4ESVA 3IT1A 1NXTA 1VLLA 2V58A 2Y1XA 3FRIA 4MIEA 3TK1A 3THXB 3FA2A 5EJ6A 3GT3A 1DEKA 1KMIY 3HGQA 1FU7A 4YRQA 4DR4B 5L8VA 4KQ6A 2I2WA 2F64A 3G9QA 2O8BB 5EPEA 1T8YA 2C2XA 2NO4A 3OWOA 4M53A 2I22A 3HVIA 4M1TA 4HAWA 5BP7A 5HE9A 1V8DA 3GLRA 4R7ZA 3QV1A 2CGEA 3OD5A 4CMGA 2D0DA 3B6MA 5BSEA 4GMXA 3CWCA 4K1XA 4BZXA 4KODA 3S29A 1RZ3A 4C29A 4EF5A 1ZK0A 1QV6A 4WZAB 3QUAA 1LK5A 1LNZA 5A0FA 3EF3A 1BO6A 1HSZA 2PTGA 2YUIA 3Q9NA 1WUYA 2XADA 3BMCB 4JENA 3SBOA 3AEKA 4G09A 3DONA 3BK7A 1V5FA 4UZSA 4YDQA 4NMHA 3UAWA 4RPHA 1OAKA 1U8ZA 4MVJE 3MWEB 4BO6A 3IS3A 2WFLB 3M49A 5EXEA 5LIRA 2VF7A 4X60A 1PE0A 1R0RE 1H23A 2HO5A 4IGKA 5DWVA 4KQKA 1YZHA 2C04A 5GIOE 2A5JA 1W5FA 4KMMA 4FLMA 5EQTA 2W6IA 1ABFA 3NHLA 4BNTA 4HO1X 4DCNA 4MULA 4YROA 5BR8B 2C7BA 3NHZA 1WSBA 3I9V1 4N01A 2EKQA 2R6HA 1U3CA 3KOUA 3P9KA 3CF4G 3T0IA 4CQMD 4CTNA 2OM2A 4D97A 1DLJA 3JTEA 4MGKR 1TA4A 3LUFA 4O63O 3AHGA 5C52B 2HIHA 2VF5X 5AVOA 2HLNA 5BR4A 3SXUB 3RAJA 1KMCA 1Q74A 1I1QB 2G7ZA 3PGXA 4MLCA 1NUTA 2FSVA 5IP5A 3CBQA 3W1WA 3JY6A 2FEAA 1QQ6A 1GPKA 2IXEA 1ZKDA 4IWXA 5TSDA 2Z57A 4G37A 1KNXA 1M6VA 4XH9B 5DBEX 5HSGA 4CDGA 3HJBA 1G9XA 2JLAA 4JN6B 5AYVA 2DOKA 2WHYA 3LDAA 1FVOA 1G41A 5ALLA 5IDWA 4FFWA 1ZOLA 2BUCA 3L0DA 1P1KA 1WCIB 1Y63A 2DUNA 3DT9A 2CJFA 2C9MA 4HBGA 4ZAWA 1SBCA 1TLFA 2GH1A 2TMKA 3HWRA 2QQFA 3TPZA 4QULA 3PXDA 4I1OA 2FW1A 2AKYA 3DEFA 4TRJA 5LA6F 5JARA 2BGJA 2CEAA 2HU7A 3M70A 1QF7A 4B7AA 2N47A 4DWWA 3LT0A 4DKXA 2QLNA 4B8ZA 4DR2B 1L3BA 2FZGA 2G3YA 1SIOA 2CBXA 4UBMA 3PUXA 4YCLA 2SECE 3GFTA 2D5LA 4YAOA 2AGVA 4U9UA 3I09A 3W8EA 1KJ9A 1KKMA 3FJOA 1YIOA 4M1QA 3UV7A 1UJ6A 3DTVB 4A36A 5BN4A 4QJBA 2DP4E 1GADO 3BQMB 3MNFA 2CL6X 3PGMA 3QEMB 4OHPA 4EG5A 1Y0BA 5B64A 4KAFA 3I2JA 1YQXA 2FSFA 4CRWB 1NOKA 5ENVA 2P1RA 3M34A 4UNQA 1DDGA 2ACWA 3AQ4A 3ODPA 3WRWA 4R69A 4JP8A 1KOLA 1YL7A 2W90A 4B5LA 3SC6A 4ND8B 4NV3A 4BTEA 3P0JA 2ENWA 2J3HA 2WWFA 2VA9A 3GZNB 4P5PA 4K6GA 4D6YA 1JEOA 1FOEB 2M1ZA 3I04M 3ZW9A 2OM6A 2HLDA 1NVFA 2IEZA 2NZYA 4RWEA 2W4IA 3FPLA 3SSAA 3V1YA 5A06A 3CVUA 4EARA 5K6AC 4IG9A 1DJNA 1G2PA 1OGYA 2WG1A 4FDLA 3DG9A 2WFZA 4B8WA 5KTRA 3TM5A 2P40A 2WAAA 3EBOA 3RK0A 3DMGA 2CDNA 3HO8A 4OMDA 5CDYA 4MGIR 3WY9A 2AKEA 2WWRA 3K72B 1CY6A 3T9FA 2B8WA 8ATCA 4FYPA 2GWHA 1Z4JA 3FTQA 3LA6A 4ZAFA 1SQGA 1Z9BA 4RADA 5E3IA 5EXDA 3D54D 3WGVA 2ADFA 2PN1A 3W05A 3ILSA 2QTTA 4Q00A 3GLFE 3S5JA 4G5RA 1OIXA 4QGAA 2O0KA 4FDVA 1GRQA 1KY4A 5A6VA 4YWJA 2C2ZA 2JC3A 2PKQO 3A1UA 2VJCA 4L02A 4XCXA 4ZEMA 2RKBA 5B58T 3HKEB 2PA3A 1FW8A 2IYPA 5EEHA 2VT2A 5TX7A 1KEEA 2IHBA 1A76A 1LJLA 2KQUA 1Z4LA 4YRLA 3UANA 3K2BA 4KBGA 2X4GA 3PKJA 1TTHA 2GILA 1IY0A 3BKXA 4YAKA 2O8EA 2IF2A 2PT7A 5I6DA 3KZCA 1Y3DE 5THQA 2FUEA 1WCWA 2JHPA 2WYUA 2DQKA 3DWFA 3QJGA 1B6SA 5MFPA 2OXIA 3BMNB 4MDEA 3GRPA 2H63A 4NZNA 3C3JA 2CNWA 4TQGA 4ZVLA 4OCZA 1HQYE 4BLPA 1EA5A 2FZVA 2PUJA 1SY7A 2YZ2A 5M2QA 2BH9A 2EFDB 3T35A 4JXZA 3GG2A 5GJVC 1WB9A 1U1GA 1G5RA 3SBDA 2I3DA 4JXKA 4MH0R 1NLUA 5FOVA 3FUUA 4UU0A 2AXQA 2QDKA 4W6ZA 4ZEWA 3RIXA 4EG3A 2B1QA 2PYDA 1ULTA 2XDQB 1QU2A 3C6XA 2FPXA 3IQDB 4MW4A 2HBQA 3D0QA 3U5ZB 1D8AA 3OU7A 2YBEA 4K2HA 2ZIEA 2Y71A 1SA0B 3A4NA 3WJ1A 4A27A 1U9ZA 1H2HA 2N75A 4UDXX 1VZ2A 3PNBA 4YP6A 2FWNA 4DJ5X 4EYSA 1KE1A 2C20A 5CNJA 3ITEA 1Z63A 1UOPA 1PR0A 5IAEA 1DKRA 2Z1DA 1CF9A 2X9GA 4URYR 1NQAO 2X8WA 3AM3A 3COVA 2WWHA 3P94A 3Q1KA 4ND4A 5DT9A 3ZXIA 5A6SA 4OKNA 1TX4B 4FMPA 1F2UA 3A2NA 3OHMA 1M76A 1PJZA 2X0RA 3ECSA 2VQSA 3R41A 2XMGA 5BVHB 1ZKMA 1NXVA 1ZUD1 3GRCA 3KD2A 2P7IA 3EZGA 4KAJA 3BUSA 4N9WA 1C7EA 3SK0A 1BX3A 5GIPE 3ZE6A 2G25A 2O4UX 3R5HA 4BE7B 4A6DA 1NMXA 4S35A 2PV0A 3K16A 4UCQA 5DW3A 4AN1A 2ERXA 4H1WA 1E3DA 3LXMA 3N8GA 4N82A 2HNAA 2W5UA 2RAFA 1PG5A 3DZCA 4DM7A 1V5EA 3WLHA 3N7TA 1A98A 2BFBA 4IQ0A 1V1RB 4EKYA 3GFOA 5LOVB 3AUJB 4O2LA 1K3FA 2PBLA 2YIJA 3WGGA 4GPZA 3HYLA 4KE7A 5FADA 2IZ0A 5K8UA 4DV3B 1KO8A 4GGOA 5TQ0A 1E1QA 1RQXA 1Y33E 2MYTA 3SSMA 3ZQJA 4OIMA 1TF7A 3TLMA 4NWIA 3VNSA 2MHCA 1AQJA 2PH3A 2IUYA 3E0XA 2WAYA 5FUWA 4DXAA 2ZB7A 4O4JB 4I5DA 3LFUA 1NASA 1N5LA 2XW6A 1RRMA 1RYBA 2QLBA 3A7EA 3CUUA 2CMDA 5IZCC 3OCYA 2J30A 1YK1A 1II8A 3HA2A 4UARA 3H8VA 2EG5A 4UHKA 4DJFC 5CYGA 1GUYA 1PYOA 2AI3A 5HMLA 1VIVA 3RO7A 4M6WA 3ZI7A 1M2FA 1P2BA 2N1BA 5IBPA 1DP4A 1H6CA 4L3VA 1NU8A 1QHNA 4M1EA 5J59A 4CQMB 5LNK6 4ALIA 3DVAA 1RYZA 3GCGA 1Z0JA 5CNIA 3OX3A 4NULA 4BFUA 4V1CI 2A0YA 3GJ8A 3MINA 1IBSA 2BMWA 3HEMA 4CM7A 2QN6A 4LF4B 1E62A 1ZHFA 3HJGA 3Q72A 4RKEA 4QHTA 3O0TA 1VMKA 1YE8A 1C1DA 4I4TB 4PS1A 1C1YA 1FYVA 3HJCA 4CV3A 2HMAA 3I8XA 1ZW1A 5BWOA 4HRYA 1WLYA 1FP2A 4EHDA 5K8LA 2P6RA 4CV2A 1U7PA 3LUHA 2CLMB 3TZBA 4HAXA 3EXEB 5LZ8A 4UBLA 5P8WA 1FRNA 4EA8A 3M82A 4R83A 1QP8A 3QKSB 4OFXA 4F5DA 5HYVA 3IAS6 4C76A 5JDIA 3KJFA 2J33A 1JILA 1S3SA 3UJCA 3P9SA 2F8MA 5ALZA 1GKUB 1VA4A 1XTIA 1Y9DA 2Z9BA 1FMJA 3FSRA 3RFXA 5TQJA 2PUEA 5F64A 4Y2TA 1T0PA 3MB8A 3E3NA 3PCRB 1MOQA 1I1OA 1QC5B 2WUFA 1VE6A 2Q9AA 2DM6A 3HSYA 1A2OA 4AO6A 2NTJA 2VNJA 3N2YA 1MDBA 2V7BA 3VR6D 1I7QB 4X65B 1WMSA 3U3DA 1KEVA 2PWAA 3ZQUA 2PH1A 1ESZA 2Q4BA 2R8BA 4NV0A 1EVIA 1A50B 1I4TD 2JD0A 2QUBA 1J25A 1QTNA 2VAXA 3MT0A 3H9BA 1X1AA 4OU5A 4FB4A 2RGUA 1T5LA 3GJYA 3ESZA 3KVVA 4IJWA 5DNDA 3M33A 1CU1A 5IT4A 3HU5A 2FW8A 4XUGB 3JAMA 2DQZA 3GDHA 4BMNA 2HRQA 2Q3JA 2ZBPA 5JD5A 3F6RA 3TBFA 2DC1A 2Q5QA 4I36A 4Y3UA 1UWVA 2OECA 2F00A 3GLGA 4FYWA 4P83A 2Z5GA 4S1WA 2A9KA 4G2TA 2E0IA 4A8JA 3RS0A 3DWIA 4CIVA 2J45A 1JAIA 2JIZD 4FTWA 4ZCLA 4OSPA 3CPHA 1UBOS 3CNQS 1BKDR 4YTEA 4EKEA 2HNBA 521PA 1C3OB 2GF0A 1Z5PA 2WTBA 2W6ID 1SQSA 1CY7A 5KJCA 4Q12A 2BDUA 1WXQA 2FWMX 4BFVA 1DQSA 2X86A 1SBTA 1MAWA 5FPPA 3SEQA 4EDFA 1NLYA 3MBIA 4HNAB 1OBOA 3AFNA 3GNSA 1B6GA 1L9KA 3INRA 4PLYA 4REOA 2O8FB 3O2JA 4BX8A 2RI1A 4D4MA 1K9VF 3VC7A 3FYCA 2H07A 5FORA 4BQEA 2HA4A 2PSJA 3AZOA 1D04A 3BCHA 3LYAA 3L7AA 4NBNA 4IVNA 4R2LA 2GBLC 3CKKA 2ENUA 1L4YA 5F2NA 5LXTB 2X14A 3NJ4A 2RBGA 1H5QA 5D85A 4C1BA 2HMSA 2FUG6 1HEIA 4JJ6A 1DG1G 2N46A 3LP8A 4FWBA 1GLNA 4UVIA 5T57A 5TMEA 3WB9A 5KS2A 2W6CX 3V32A 1EWKA 2NX2A 2OZKA 4J7AA 1BXZA 3LVRE 4CGYA 5C1IA 4GMGA 4Y2YA 5F3RA 3ONVA 2BGWA 3Q7QA 3RKUA 2EC5A 4DSTA 5KVQA 3H1EA 4N6GA 2PRJA 1QB8A 3ODGA 4F5ZA 1GFZA 1OGIA 2A94A 4EWLA 1HC7A 1DVRA 2R3SA 2Z4TA 4RVHA 1RDFA 1U2GC 3FLMA 4A5SA 4REMA 5K8CA 1PNOA 5B4UA 1NQTA 5EIBC 4RGQA 3G82C 4K81B 1VLZA 5JWOA 1BU8A 1V3VA 3F7NA 4M1WA 4I9UA 3HLYA 1ZK3A 4FIZA 5ILOA 3VDQA 2QTHA 2Z2IA 1CY8A 2UZ1A 1F6DA 4GI3A 3KSZO 4NJMA 4BNVA 3H16A 5ELLA 3ROEA 1A9XA 4TLCA 5GONB 1S3FA 4LJRA 4GVPA 1KEWA 1YFLA 1YE5A 4H08A 4LRSB 1J1UA 4K05A 3FYUB 4MKIA 4MVJM 1W30A 2OORC 1G8JA 3AVTA 1UM9B 4B40A 4JMLA 4I8XA 1EUDA 4RQBA 4RH3A 3F2IA 3M1AA 4RNCA 2MSCB 3KO8A 2ZQYA 3AF5A 4H1UA 4QYIA 4W63A 5EJIA 1H93A 4LSWA 3RYIA 1S2NA 3MYRA 3BB3A 4RK0A 2PT9A 3M81A 3NWJA 3RI3A 5AW8A 4Z4CA 3IT2A 4ZGGA 3VR4D 4YUZA 3GJRA 4MQUA 5KVAA 2HLDD 2CZGA 4MOWA 5BO5A 1YV9A 4NMXB 1MPXA 1YIAA 4OY3A 1XB2A 2C9YA 4Z2YA 3VH4A 2JGDA 4ALMA 4ADSG 3L06A 4Q7QA 4YV0A 2QRZA 2IBSA 2ZRMA 1E9RA 1MENA 2C2GA 3SX0A 4R1OA 1XZAA 1U3TA 1U4NA 2O2DA 3I4CA 2WSMA 3BD8A 3X43A 4EY8A 1BKSB 5JATA 3ZTTA 1WW2A 3CNNA 4MYDA 4IOJA 3BIJA 4C04A 1NX9A 2IHVA 5FI5A 4AZ3A 1Q83A 2VRCA 2E55A 1MEEA 3QXXA 5I7WA 2G9UA 3DBOB 1LU9A 1PR2A 1YR1A 4DRZA 2DFKB 1YFJA 4EY7A 4ZQIA 1ZI6A 2PLFA 1ECJA 2MCFA 3KLBA 2G4VA 4XUDA 2IXBA 1R0ZA 2L82A 1J0XO 2FPPA 4OMFG 5E8RA 2GZ3A 3U4HA 4N0QA 3L7NA 4GKVA 2F1HA 3I5MA 2IPNA 2K2WA 2V97A 3LVBA 2KWIA 4P92A 3IBCA 4HB3A 5I9LA 1S0UA 1X80A 5DV9A 4ES6A 4MS1A 2FFAA 3B1FA 3R6WA 4B4WA 3JQ9C 3H5AA 1I10A 3KB1A 3Q11A 4QSHA 5TQ2A 1U6KA 3ZX5A 1UJ2A 2WA2A 3FPFA 1G8YA 2C7VA 2NUPB 2AJBA 2C1ZA 1P4SA 1RXYA 5B1IA 3S2SA 4DLSA 4D9EA 5WRFA 1E1NA 5DWQA 4W1RA 1PJSA 2PZKA 1BU5A 4Q1VA 4I4NA 3RROA 3QVKA 4NJEA 5CT4A 3GNTA 4FFNA 1DARA 1OVMA 4H4CA 4MIOA 3U6BA 4JSRA 2QAGB 4F1KA 4MW1A 1X70A 1I3CA 1P2DA 3HKDA 3P2OA 3WL7A 4ND3A 1H69A 3WLPA 5CXQA 1M72A 1CUGA 4K7JA 4FI3F 2FSPA 5KHAA 3RD5A 4J9UE 1JR3A 3ZZMA 3HC7A 1W25A 3DAPA 2ZUSA 2X7HA 3WK6A 4Z86A 5LUAA 3UCXA 3CC8A 4YAWA 4AKEA 2A30A 1M7GA 4J43A 4RMJA 3TL6A 4PLTA 4L7VA 1GTMA 2R6R1 4YAEA 2I34A 4EQ6A 4KQ9A 2XOKD 4UEWA 1O94C 5K0LA 1ZD5A 1VHLA 1RWKA 5IG2A 3TD6A 4IIXA 4KDCA 2BTEA 3V8RA 4MUIA 2B98A 5DK4A 4QPPA 4BEVA 5KHLB 4ZK2A 2GN1A 5JS7A 1RABA 4AJ1A 1U8FO 1J09A 4ZYVA 3LCCA 1BJTA 4JUAA 1F5SA 5LZ2A 2VJKA 4TV8B 4C4XA 4I50F 1BNCA 1GIAA 3IX7A 4ENUA 3VH1A 2V7TA 5A2QA 3GLIE 2J4DA 2YY7A 3I1YA 3PGJA 4CEJA 4ZDJA 5JSUA 4UE3S 2WV9A 3BWCA 5FOQA 4G84A 2ILVA 1AIPA 3IMGA 2DSTA 3NS7A 1GUFA 3REQB 5ALNA 4IHJA 3MTDA 4C6HA 4OMCA 4U2GA 3GDGA 5BY2A 1WXEA 4X54A 3RC1A 4KP7A 3CWZA 3CEHA 4ZVVA 2ONCA 3HBNA 4YCJA 1Z7EA 3G13A 5FB3A 2Z8YA 5AKYA 3QPCA 3UFBA 3KSDO 1ZD8A 4GBJA 3CISA 5I7RA 1XAGA 3ZBPA 4BWVA 3NG1A 4JT4A 5JZBA 2PUWA 5JI3E 3KZ1E 1Y1LA 5BPHA 3HVRA 1BYUA 3U0VA 1DAIA 3PFNA 4ZOLA 2XE6A 2JA1A 3AIKA 1VLQA 3ONFA 1M7HA 3ETEA 4BQNA 1EK2A 4ZREA 1E1QD 4FFDA 3SIRA 3TIXB 4ZQFA 1J8DA 3V97A 5KKCA 3IBFA 1UC5B 2P3SA 2OCPA 1CUVA 4YN3A 4NBSA 4D0RA 3Q9LA 4R81A 3D6MA 1UEIA 3VA7A 1UK9A 2VP2A 4TTRA 4IXNA 4BZQA 1TQ8A 3OQNA 4DN6A 4TQAA 5CT5A 1B8OA 2BFEB 2I6UA 4JODA 3R0VA 1L5MA 2XYRA 3SZRA 4G23A 4JP3A 4RPLA 3S4YA 1PYDA 4DBZA 2P9BA 5CYPA 5AVZA 4O2BB 5EPUA 4FFBA 1CVRA 1GLGA 1ZOPA 4H6VA 4LJLA 4OSOA 1OH7A 4G0VA 2XSZA 4YNBA 1XZFA 4D4IA 1HNXB 1J1ZA 2DPGA 2HRZA 4IDFA 1H2XA 1I7PA 3T4EA 5BXYA 4Z4GA 5K0SA 1ZRHA 4ZO4A 2QVGA 2HLHA 4ND5A 5HCIA 2NXNA 3ZOZA 2UVQA 4FMBB 4DY4A 4TV9B 5JDCC 1Z22A 4NMMA 5FQNA 5L4NA 4KYUA 3Q2OA 5TF4A 5AK4A 5KQLA 5F98A 1MRSA 4NOJA 3QKWA 1XU9A 3L0IB 2GJSA 3FMFA 4Y0VA 2Y0CA 2FE1A 2GEFA 4XZ3A 1FVXA 4YT5A 2D1TA 1Y4UA 4I9FA 2MINB 3QFRA 2R1VA 3HLTA 4L0QA 4M55A 3SS8A 1RADA 1KSFX 4M0UA 3RUPA 1M34E 3JRWA 4DV4B 3ZE8A 4O4HB 1KYWA 3DOUA 1Y5NA 4JX8A 2XWPA 3BJZA 3AXTA 5CBPA 3RUIA 3ITKA 1OC2A 2GN9A 3A4VA 4ZRNA 3QG1A 3UG6A 5J4KA 2QBYB 3DH0A 1SBNE 1FSZA 3G9UA 3H9JA 4X3PA 5CVVA 4BQOA 3OCUA 3FFTA 2X0IA 3AI7A 4YRRA 5HZKA 3NP7A 3EIEA 4DDUA 1GZVA 3LVFO 4KTTE 1BCSA 1G5PA 2QUAA 3GUZA 3TD9A 3HM9A 4OV6B 2CK3D 2CWWA 3KEGA 3A9VA 4NBWA 2GHTA 4XWYA 2IXDA 5TLSA 3RC8A 2P1ZA 4Z7NB 3I30X 4YO8A 5REQA 4G0UA 2ZM6B 3BXFA 3D7NA 1WHSB 4CIAA 1W7AA 1SB8A 3OLXA 3T1TA 3B6IA 1EGQA 1L6IA 1WHTA 5AKXA 2EFYA 2ACEA 3AW8A 5KWIA 1QNLA 4DWVA 2Q8NA 3O4GA 3IAEA 3EASA 3WAJA 2VDKB 2E5FA 3DB1A 5CLIA 1ITZA 2I1VB 1G9TA 2OAEA 1P81A 3RHZA 2X0NA 1Q44A 3KC2A 4EHIA 3HL0A 4OXKA 2ORVA 1NBME 3OHSX 3UUGA 1OV4A 3ZV3A 2NIPA 1H05A 4JI1B 1Y1KE 2CNOA 2ZBEA 2OXEA 2Q6VA 3DW1X 1G8HA 4Q05A 5E9QA 3VZQA 4EYKA 4I46A 1QVZA 2A0WA 5BV2P 2D13A 1R6XA 3H4MA 5HKBA 2PMEA 3GVHA 2UZ4A 5H8WA 4XVCA 4FGJA 1M5TA 4MB6A 4BLOA 2DRIA 4GP7A 5AO9A 2G0NA 1QDLB 2Q4TA 2POQX 5CH3A 5DGHA 2CV2A 1VL1A 4BNDA 5FLYA 2H4HA 1YRHA 4HNUA 4YQYA 1PSZA 2BGGA 4RKQA 3INGA 1L3IA 1R9GA 3DBLB 3QU2A 3GGDA 3ZTWA 1D2NA 1BC5A 5A9SB 3O26A 1OWLA 2QYTA 3ZGNA 3IC5A 3IPRA 3KLPX 2QTMA 4KYVA 4FE4A 3W79A 4UOEA 2SICE 1Q7RA 4CLOB 3LCJA 4RCVA 5IKEA 4GDMA 5IRCD 1QZXA 1FFXB 2PTHA 2VF2A 1S5PA 3DVRX 3WJ7A 1MAHA 3PHHA 5KNDH 3SC3A 3NBYC 4AICA 1YS2X 1E3IA 1OH6A 3ETJA 1JEQA 1KKUA 1ZS9A 1IN6A 4LNHA 2DHEA 1JW9B 1ZP6A 1A7KA 2C3UA 2C96A 4BY9E 1XBTA 3MILA 4V3CA 4CMEC 2ZQZA 3L9XA 4HATA 4LMAA 3DD5A 1JIUA 5HE8A 1C41A 4K9DA 4CLXA 5L40A 3U3XA 5C81A 1H9CA 2GOYA 3VPHA 1KL7A 1Y5RA 1GNRA 2CDBA 4JMPA 5DKFA 2QE7D 1V9SA 4CTJA 5L3SA 3RC9A 4DRYA 1JG1A 4NCJA 4Q03A 4YAJA 3V6MA 5JC8A 4RAOA 5EJ9A 2RHCA 5LC1A 3ABIA 1LDBA 4BVGA 1FS5A 2PGLA 4BX0A 1U2DC 2XAAA 1Z06A 4MYHA 3NRBA 2AG6A 5DNAA 3M4JA 1UKEA 3S0JA 4OFBA 5CBKA 2ONZA 3CKMA 4UTXA 1Z4KA 3O4HA 1HV8A 3BWDD 3DO6A 3MTEA 1GG5A 4KBFA 5J4HA 1CEQA 3PPVA 2RK4A 3WLSA 1M73E 1L1RA 3NBMA 2WSLA 2IV2X 3RVMA 2CXXA 4L8VA 4TVBA 3CX4A 5JROA 2ZANA 1YQWA 3DKIA 4HFMA 4LE0A 2ERCA 4MO9A 3R8XA 4QUDA 2DHRA 3KDSE 4XWAA 4MP3A 1NG1A 1RQ2A 1JWBB 1N0WA 3RHSA 1UPFA 3L41A 5JTTA 5J4YA 5DTRA 1MTOA 2WSYB 4CU5A 5F52A 4YC7A 4DMUB 1DIBA 2HZ7A 1AA9A 3I28A 3IR5A 4KQCA 2IV3A 1VHDA 5B3JC 5H9WA 3HEBA 3CRVA 3F8TA 3GYBA 1Z8FA 2ATXA 4NBKA 1F2UB 4P3KA 4ZDWA 1APBA 1NWCA 3NKVA 3S40A 1ZM4A 3JD3A 3THSA 5ARBA 1LZLA 4HPXB 2I7TA 4NNOA 4QDUA 4H3HB 4LF9B 1SIWA 2JLSA 2IYRA 4DHWA 1M5UA 4DMCA 1OYVA 1Y8CA 1U7UA 3ZE1B 3E3OA 2AFIB 3TLXA 6LDHA 2WM3A 4QYMA 4YXWA 3T4UA 4F92B 1YHZA 4GSYA 4U3JB 4WEQA 1KO5A 1N1MA 2A57A 3FWKA 3UWOA 2ZIFA 3EQ8A 5ELXA 3C2QA 5KMGA 3QENA 2FEOA 1YGPA 1VJGA 1GUZA 4GICA 4LOLA 1FF9A 1SVOA 2I66A 2ZE6A 4TTIA 2AI1A 1JZQA 3K4PA 5T8KC 5FEUA 3QKIA 5JBQA 2ZM5A 1XDSA 4FX2A 4B8YA 5CURA 3MC1A 5KKNB 2CEKA 4PYKA 2EJVA 4V0SA 3DEYX 1VBKA 3KKLA 5BVGA 2AMFA 5TQ0B 4BJ3A 5MN4A 4KRFA 3TIFA 5KTOA 2YBDA 3HH8A 1Y9JA 2GEJA 5KYUA 3TVTA 4KXMA 2PXAA 2EAUA 1NRIA 3K0AA 1RM5A 1RPAA 2O0HA 1E20A 2BTQA 1DC5A 2B0JA 3B1VA 1FQWA 5ITWA 3D3WB 2QR5A 1TYEB 4Z8YA 2QYHA 3X1WA 3QX7A 1LBIA 3O4JA 2FUNB 1GILA 1UFRA 2RG1A 5KAMA 4TXMA 1SU7A 2V7GA 2NUTA 1Z6YA 3F5QA 4XDZA 1KYZA 3DR3A 3H1BA 3MWLA 4TRMA 2Z2JA 2A9VA 3AUAA 4MYTA 4LDZA 4QGBA 4XIGS 1NW3A 4J1NA 3T41A 2YWHA 4AIIA 4PM4A 4YCSA 5IUJC 5AW2A 2QSJA 1ODTC 1I4DD 1UK7A 3GHHA 4ZOLF 2JAOA 4HAOA 1HNWB 3BE8A 3MINB 1FFGA 5F73A 2ZYTX 5EWMB 1AURA 2BP7A 1N2BA 3ESAA 4BV3A 1VE5A 4YDSA 1I6WA 1P77A 4MDHA 3TQSA 4BN4A 4CDNA 4KSBA 3AYZB 1CJSA 4ER7A 5IJWA 1QPZA 4PHCA 2JK1A 4QXRA 3DVQX 4C0JA 1Q12A 1TQDA 4AJ4A 4AECA 2P6NA 1QFZA 4KWTA 3TDNA 4UEKA 3VZCA 1YXMA 1T9GS 3WA6A 3IQWA 4IVPA 1DCKA 1M6WA 2J41A 3DC7A 2JLQA 3B2QA 2N9UA 3PPYA 3CX3A 4EW3A 3QXJA 4YI3A 4AF8A 1BTOA 4RORA 4CHGA 2W83A 4J1QA 4JT8A 3G9TA 3HL4A 4GWLA 2BFOA 3PCXA 3EVFA 1K7CA 4DB2A 1E0AA 3ORQA 2BZ0A 5CMLA 5LQAA 1Z5VA 3X1KA 4G0OA 3IQHX 4TM8A 3K0SA 1P5FA 2IHKA 5CTJA 2X8LA 5EJMA 2C83A 3AW9A 3C4VA 5B2ZA 1U11A 1IVNA 9LDTA 1W44A 1N6OA 3C3KA 1XNHA 4JAVC 5CDUA 3SDBA 5BW6B 4NZZA 1AQUA 3M9LA 4V0NA 3FY4A 1OE0A 1AXGA 2QIPA 1NXPA 2BWJA 4IO1A 2Y1WA 3D3KA 4JJGA 5JNVA 2XQIA 5JAMA 2EW2A 3BA6A 4UD2A 4UE2A 3I61A 3WGTA 2QTRA 2JIRA 5JHHB 2I55A 1JAZA 3IKMB 5LB4A 1S8FA 1Y81A 1E8MA 5K3FB 1V9CA 4Q0MA 2G4LA 2FSGA 4EF6A 1SVKA 3GLUA 4YMSA 3RADC 2PKWA 4RJIA 1FP4B 1KJZA 3JYOA 5IHPA 1QTRA 4A8JB 3NB0A 4TZKA 3NM6B 2ACKA 4WKOA 1ILWA 4EUKA 1MC4A 1XZIA 4HYEA 1KETA 4YRPA 4ISCA 4A4DA 4ZGWA 2C97A 3D4PA 3BC1A 3W8RA 4BFYA 3O8QB 4TMFA 5F23A 1WABA 1D7OA 2REBA 3LL7A 4D44A 1LV8A 3FYDA 1XKQA 1NW9B 2P5YA 2PUDA 5EFOA 4YJFA 5GPBA 1K88A 2DWUA 4JCOA 2JLUA 2CHQA 2RHOA 4P8RA 3T3GA 3SQWA 2AQKA 3JRXA 2IY8A 4N18A 2Z83A 3NWEA 4AQ7A 4D2IA 3AGQA 5LWQA 1MGOA 5ELMA 3OMXA 5JXHA 2XGJA 4ZJZA 1QFYA 2C61A 2Y1DA 2KS6A 2YJ4A 4WOBA 3ZY6A 3PXBA 4LZAA 1DIRA 1K8RA 5D3MA 1GZHB 3TEMA 1NFFA 3ZU4A 1ISHA 1CJMA 2EERA 3DCNA 3EULA 2RGRA 3H1TA 3F78A 4PHGA 2QV7A 4MB2A 4OI4A 4HNTA 4NE7A 3L92A 3W3AD 2D59A 5JS8A 1U3VA 3PDIA 1TU4A 3UHOA 1JYSA 1SC3A 2F9MA 4QBIA 3F9CA 3L8HA 1NOJA 3E61A 4MQEB 2IJGX 4DEYA 3HDGA 4E5UA 3LWNA 5AP9A 4ZYXA 5HNKA 3RUDA 3TGWA 2PFSA 2XF2A 1ESNA 4L22A 4TMKA 4D4GA 3OIFA 3U1VA 3PUHA 2IIVA 2Z08A 1AO0A 4YCBA 5BSTA 3SXJA 1NE7A 3DS8A 4FD3A 4FU0A 2HR1A 3SD7A 3DKVA 2OY0A 1CYDA 1DBRA 2VDNB 3L4BC 5EE0A 4Q93A 4ZCQA 3W04A 4CDRA 1U0FA 1H2WA 3RUEA 4WKBA 1G19A 4QT4A 4DMFA 1C4XA 1XTPA 3GAZA 4QRHA 2H31A 3ZHXA 4OMUA 1GCGA 1H5UA 1LVHA 3HNPA 3KVOA 3SJZA 4D45A 4C5BA 2YV2A 4FJ0A 1L5QA 3WAGA 2R8ZA 4YJ2A 5JYCA 2PRYA 3O1JC 4EOGA 1QAMA 4CWAA 3BEDA 2OZEA 3GO4A 1B42A 1I0ZA 4PIVA 1A9TA 2PVCA 4EH1A 1AMOA 4XW2A 1KBQA 3K73O 5FUXA 3AUFA 3TG8A 2OHGA 3C8MA 3AIIA 2LR0A 4FZVA 3B1YA 5DCYA 5M3BA 3VHQA 4XRGA 1WUTA 3L6EA 4JLMA 2HK9A 2Z4SA 2ZYSA 3ZCRA 3P9QA 1UMDA 7ADHA 1YC2A 1WDKA 4Q1CA 4Y9UA 3THRA 1TO1E 1T6ZA 4KN9S 2GTPA 4R1NA 5JMOA 3GP8A 1NHWA 1E2IA 2OEPA 2VK4A 5FI1B 3AVUA 4JB8A 2R2AA 5K3OA 1PJAA 4M1KA 4OD0A 5DI3B 3L7LA 4M49A 2O14A 3DXYA 3GA7A 1P4AA 3LNTA 4XCVA 4EEZA 5AUNB 1U2ZA 1TAUA 3I04A 3ZDCA 1DRUA 1O9HA 1VL2A 2IZ1A 2VBGA 5BN3B 1GWNA 1XYVA 2Q1WA 2O8VA 2FB9A 3C43A 3DE2X 2Z8ZA 2Q0QA 2BDEA 3DKPA 3ISJA 2R4TA 4PBRA 2I4MA 4AZ3B 2V9CA 1HNNA 1P6UA 4LVCA 3VNRA 3M3PA 4R41A 4ZWNA 2BR3A 3KFLA 2GARA 1RAFA 1T2EA 3IP3A 5FL3A 4CT0A 4WLNA 3D02A 1GZ3A 4W1PA 1VPVA 1DQNA 4ASUA 3KHTA 2J7PD 1PT6A 3DZKA 3HBJA 3SQNA 1J97A 2Q3HA 2XVXA 1JQBA 3R2JA 3PUIA 1CXZA 3MJ4A 3ZVMA 3SZGA 2OUKA 1RKUA 5AVJA 2FJUA 1BA2A 1X80B 3M5DA 3AYXB 4BDTA 4CCSA 4E13A 5I3ZA 1P5JA 3RWBA 1MHTA 4UXJA 1FSSA 2PRKA 5D3KA 4RPKA 2H1SA 5TQ2B 2WWVD 3UZUA 4EYGA 3UM9A 5LP6B 1L5FA 4KAAA 2OOKA 2A92A 1FFDA 1OWPA 2WVJA 2WIGA 2H9IA 3A6ZA 1KAGA 3CPSA 3SIPA 4BGVA 1G5QA 3E9RA 4IXWA 2I65A 3U80A 2W2OA 3IEXA 3LNCA 1ZL0A 4N3GA 4I9HA 3ZWBA 1XGKA 5K09A 1I3NA 1G8KA 2D8AA 2DX7A 3L8YA 4R6XA 2FDCA 2RBKA 1P29A 4IZ6A 4Q9IA 8OHMA 1IZYA 2FQQA 4DW8A 2EYUA 3GGJA 4KGZA 1FVFA 2FZEA 3VMFA 5TB5A 1WCYA 2MSLA 3PIIA 5ADUS 3BB1A 3PK0A 1GL9B 1K6XA 2CZQA 5MN6A 4E70A 1FTGA 2ZIZA 5DE3A 4Q3DA 4ZT3A 1S6YA 3OM9A 7ABPA 4E0BA 5J2UA 5GJWC 4BAUA 4Q4HB 2NN3C 2PMWB 1BS9A 2IA5A 3WSTA 2ZYIA 4XD7A 1M2OB 3OT5A 4L0MA 4ZZ3A 4G8JA 2H48A 3UMVA 1KF0A 1I4OA 2HADA 2Q4EA 4ME6A 5CT8A 5FHQA 3ERCA 4E1BA 3KBOA 3M6LA 4OQDA 3WQQA 5A4MS 2I2CA 3ZGVA 2B5WA 3N1UA 5CXXA 5AWFC 3KKOA 2PKCA 4IHJB 4D9NA 5JD4A 2HBRA 1TUIA 1M1YB 1RQNA 2XKAA 4ALNA 4BFWA 4H0CA 4RULA 2ZUEA 2QGFA 2QZ9A 1D2GA 1FNMA 4AYTA 5E4TA 1XZPA 1YQEA 3BTUA 3F3KA 4KHZA 5JRZA 3J80A 4JLKA 4YFVA 4DJDC 2D5AA 4IXMA 3D2BA 1CUIA 5I4IA 1B1AA 1P2VA 4RLSA 2I8AA 4OYLA 1XAHA 1ZGHA 1YQQA 1LGYA 3NO4A 3U16A 4UE6A 1GV0A 3A6FA 2PWZA 1KY2A 1YMVA 3AH8A 3SAJA 2O9JA 3QWIA 4P2GA 5CITA 3DUFB 5KCZA 5CG1A 2GKOA 1IXYA 1ZCZA 3NVAA 5TT1A 5AHXA 1NNI1 3ELDA 1JJVA 2Q29A 4QL3A 4PVCA 4RA6B 1K9SA 2AT1A 2RCNA 3EG9A 2P2SA 3GEPA 3TM4A 3THYA 2I3BA 1WTAA 1PKEA 1TM5E 1GQ2A 5EE3A 2Q1UA 3U3OA 4GQIA 4BE4A 4M1SA 4BQRA 1M6NA 2H9AA 3NH6A 4K6CA 1YJBA 5KYKA 5DYIA 1KEUA 1OPRA 2IODA 2C8KA 2PS9A 1NMZA 1Q1NA 2XDWA 3CR8A 3H2KA 4PZEA 3U4QA 1JG7A 4GFDA 3P9RA 2POCA 1OXMA 1RI1A 4LRXA 2IYXA 5DHPA 1JVNA 3EQ6A 3RIMA 4FFBB 1SURA 4GKJB 2QT0A 5IJ0B 3GFQA 3Q8KA 4G5OA 2GZSA 2VTVA 4ENQA 1C3LA 2J3KA 3HDYA 2HQSA 3GA5A 3LPDA 3OF2A 4A23A 1JAYA 2WC1A 3TSAA 4RTSA 4Q5IA 1O6ZA 1MN6A 1TM4E 1HFWA 2Z5LA 2BEWB 4IF4A 4NDAA 2GYUA 4B76A 4HG2A 4MUXA 4M1MA 4QEZA 2Q2WA 1G8AA 3PTLA 4DEVA 1PZFA 5FCDA 1NRJB 2GBIA 3MCZA 1EZ4A 1YQ9A 2DGDA 2PGDA 3WNCA 5TMPA 4WNCA 3TKYA 4BGIA 4HDSA 2VRBA 3KQLA 4JBNA 2GERA 2VAMA 2WJYA 3EVZA 4TM7A 1S7GA 2GFIA 4RVGA 3MT8A 2UVPB 2XMQA 3Q7PA 4R8VA 5K4GA 4QHYA 1QKJA 5CT6A 1UP7A 2PXHA 5KYGA 4UNIA 2NUBA 1MQSA 4EEKA 2VDJA 4QQKA 3MIZA 1PR6A 3IOEA 3EJ6A 1TQ4A 4DLZA 5JAIA 1KZ9A 1LD3A 1X8KA 3DAYA 1V8FA 2G80A 4G5FA 4HGYA 5AQ1A 3AEUB 4MYCA 4P9NA 5A3RA 5C1DA 3ZJ5A 3C85A 5CLFA 1KBOA 1NP7A 1VMAA 3NLLA 1JDBB 4JASB 4OLFA 1WMDA 1KOGA 1CRWG 3AETA 2GGSA 2QM3A 2RFLA 4IY1A 2ILTA 4F7WA 1U02A 5CK4A 1A4UA 3IE2A 2WNHA 4ON9A 1ZSNA 1E2QA 3OPQA 5THKA 4YRFA 4ZI3A 1R0WA 1P44A 1EQAA 2FHSA 4IV8A 1HOXA 2B92A 1WHTB 2WYWA 1WU7A 4WXHA 5HIIA 2WTXA 2P4UA 3DBVO 2XQVA 1RLJA 3I1FA 4OBBA 2WAMA 5H02A 4BNFA 5C8YB 4ETMA 3MJRA 5EJFA 4BNYA 3T3NA 2C78A 1HUQA 3GCDA 4B7UA 3W4IA 3GZ4A 1TECE 7MDHA 2AEFA 1MB3A 5CNKA 4ITVA 1C9EA 1TO2E 1XV5A 1GU7A 2HA7A 1CEYA 3LYUA 4XJVA 3VDMA 4BVFA 3PQ4A 3ABOB 3PXGA 2PX0A 3FWYA 4BNKA 3FLBA 5I7OA 2FQXA 3ACDA 1COWD 1BFDA 1ZI9A 2PGXA 4HNSA 4XCQA 3KT3A 3WQSB 3QW2A 2X8JB 2XXBA 1FQOA 2P11A 1PNQA 2VXBA 4CN9A 1C4WA 4M8KA 1SXJA 2CYCA 3FNRA 5HM6A 1X87A 1G8MA 4RHYA 3RIGA 1GFWA 1CB0A 4LX8A 2A0KA 1NVXQ 3DEIA 4LSZA 2AVDA 4YJ2F 2OPHA 3B70A 4EHFA 3GRKA 1KQOA 5EP4A 1FTYA 1RQRA 4PRLA 5E0OA 9GPBA 1FJHA 1V45E 4AJEA 2JIDA 3GQVA 1L5OA 4D5GA 2I2BA 3R3UA 3X1DA 1DV2A 1FUIA 1D09A 3BHNA 4O6VA 3HZOA 4M99A 1RM4A 1N5DA 4R71A 4OKSA 1UKCA 2GESA 3FMVA 2YWBA 3ZDFA 2IZOA 1CJTC 2PR2A 3ZIAA 3MXTA 2P0AA 3VSCA 1TYZA 4X9XA 1CUJA 4K28A 4BVHA 3HFRA 3NAGA 4G5HA 4DIOA 2ZTLA 2HKIA 1BEZA 1NX6A 4DMLA 4XI9A 1TJYA 3IIIA 1A4XA 1FY2A 4EYQA 1YKFA 2G6BA 3EYWA 2B1JA 3MWFA 4RE5A 1EWQA 5L3SB 1JZTA 2YYSA 3T7EA 5LOVF 1RCFA 1YVRA 2UUBB 1Q0SA 1PV1A 1Q6YA 2YDXA 4NYIQ 1AS3A 3TZ6A 3KQKA 1N9GA 3H9QA 4ILKA 3VTAA 4G5XA 4UMFA 1SG6A 4D26A 4DM3A 4W9NC 6CHYA 4OQMA 3B3FA 2B7LA 4FD2A 5H16A 3LC1O 3OAAD 3FPBA 3HV0A 4JT9A 1KERA 3A04A 4S2EA 5IT0A 1REQA 1GR1A 4NEHB 5IYZA 1I5OA 2CJWA 3AFMA 4HX5A 4UVEA 2FFHA 2OG1A 2LE0A 1PZGA 3BBLA 4FW8A 2GZDA 1XEFA 3NFYA 1MJHA 4N7BA 1HYEA 2YHAA 4NLLA 4H7HA 4QEKA 4UHCA 1LPBB 5EIAA 5JH7B 2OC9A 1G5TA 2WHEA 4WOCA 4UHFA 1KDYA 1CIPA 2YH2A 2WUVA 4ENRA 3A26A 3K4QA 1AQNA 1QZ3A 1XXHB 3EZYA 4X24A 1D2MA 1XK7A 1KH1A 4RIGA 4BZPA 1CUZA 4RQTA 3L2OB 4MVJA 3X2FA 3P2MA 1X1TA 1MC8A 1EAYA 1EFVA 2I8LA 2CL0X 3AI2A 1NFRA 1TK9A 2CXHA 3K1AA 3NYIA 3RU9A 5DYYA 2EOAA 3I34X 4JL8A 4CG2A 1UBRS 5JWRA 1QCDA 4OLBA 4BV9A 5HS6A 3E9YA 3A3NA 3FF4A 3I39X 1KJ8A 3RS7A 4N49A 3KR9A 4DG9A 2I91A 3ZGZA 2C42A 3A31A 4RF5A 3BSFA 1XKLA 4D4LA 4ZXPA 2W2VA 4GX0A 4DJTA 3LX8A 4K2AA 1W4ZA 3IH5A 3O1LA 3IDFA 3ZVRA 4DV2B 2QG6A 1FYFA 1A7JA 3FPCA 3KVRA 2VJBA 1LBQA 1RYDA 1NI4B 3E3LA 1HE4A 1CUBA 2AB0A 3A3OA 3Q15C 4EFNA 4LF8B 4XPZA 3KTAA 1RYFA 2R1TA 1ESMA 3AL2A 3K1ZA 3MT7A 5ESXA 5JCZA 4M38A 3ZDZB 3P2KA 5D5PA 1DPFA 1G55A 5DHUA 2ZE8A 2VCHA 3FW1A 1DKUA 3FNEA 3IJPA 3LCVB 3MCTA 2J9FB 5KCMA 3DEZA 3D4LA 3EGIA 5BSUA 5CB4A 5B4TA 4IEIA 4RHEA 3KUUA 5BNIA 5HKKD 1EXWA 1G6KA 5EIOA 5E1OA 5TJHA 1DQPA 1LSJA 2IPXA 4RZUA 1VB5A 5EP1A 3KL2A 1SHZA 4TT3A 1WEKA 1HI9A 3DHEA 2K7FA 1GSOA 4KKXB 1RMYA 3BAZA 3K0AB 1PS8A 1KSGA 1MOZA 3MRSA 4RO0A 2O7QA 3KBBA 2W2TA 3K0FA 3PFIA 4JOQA 1UBKS 1UK8A 1FDUA 3Q3EA 4M1OA 4MV6A 4UJ3A 3TEFA 3VHRA 4E94A 4DR1B 1PLJA 2VC2B 3OX4A 3W8FA 3K8OE 3T3MB 3UGTA 1L7MA 1BOOA 1LSSA 1UBGA 2NUTB 3H2SA 1EAMA 1W5AA 1R66A 4J6FA 4EFLA 4EG8A 1LH0A 4UFNA 2ESRA 2YC4C 4RH0A 4PZLA 1AV7A 2RGCA 5K0ZA 3KJZA 3NIGB 1JDUA 4IHKA 4OJMX 4KVAA 2FX2A 5KUTA 3OESA 4IUYA 4R8SA 3DE1X 1C81A 4P3NA 2W22A 1FPQA 1RVDA 4XD7D 3LZCA 3MWYW 1RIFA 4QU8A 3OY7A 1Z33A 2C5EA 4IJKA 1ZXLA 2YFYA 3OPNA 3RWMB 2JJ8A 1BIFA 4G5GA 3UENA 3ZLUA 4UTPA 1MO6A 5AJZA 2V96A 5DBFA 3TQOA 4JR2A 1EWRA 1VE3A 3TDKA 1Z17A 1UKAA 5AOVA 3O8LA 5TV2A 3ZWMA 4BGUA 3OM0A 3CLUD 3E9EA 3EHDA 4QOHA 3X0DA 5GADl 1CZUA 1YOVA 2I67A 4M88A 2QD3A 2Y1KA 3RYCA 2BHTA 4QZVA 2BFAA 1Q6ZA 4HAYA 1IHUA 4C20A 1J9GA 5A02A 2ATVA 1KWKA 4RK1A 1DKNA 2IC5A 2NM0A 1IRIA 1XTVA 1G291 2EX1A 1CQZA 1OXVA 1TM7E 1ZAKA 2PT5A 4H7PA 5BQFA 5JMWA 3BSWA 3FB4A 3AJAA 2IYTA 2I7CA 3C14C 3I6MA 3IAFA 3C6ZA 3FOAA 3RANA 1GA1A 1WJGA 2Z3VA 4OHVA 1LNQA 4RVFA 3QFHA 1CR4A 1QYWA 3QVUA 1ZNYA 4YMVA 3EUWA 3OLQA 2WILA 1O95C 3NHAA 3DAHA 4J75A 1J24A 4OH7A 5FTKA 4KO4S 1EQUA 3RSGA 2G67A 1GZ4A 5CVDA 5EJ5A 3OEEA 5LD2C 3NNNA 4K87A 1BD3A 1YR9A 4ESEA 1VPDA 5G0UA 4CF6A 1FQKA 3A2KA 4KLNA 5K51A 2OENG 4QREA 2GK3A 4MTCA 4P7GA 1HY3A 1NXOA 2RHHA 5IPFA 4Z9XA 2VLBA 1SUAA 5C31A 4K9RA 3NM4A 4NY1A 4QNNA 1R00A 3LHFA 4EG1A 1XFAA 3RWOA 5H81A 4XIYA 2XDYA 5K0NA 4DLBA 4DVJA 3A2LA 3T3EA 2VN8A 3V9PA 4EFMA 1O0CA 3AKEA 2BFCB 4PNHA 1U04A 2P4QA 1Y6FA 2RARA 3SOZA 3FGZA 3HCWA 4KBYA 4RE6A 3SYRA 1K8XB 1DQRA 1DKQA 1F20A 3CCCA 5J2TA 4MA0A 2ISCA 1KXJA 1UADA 5K05A 1R6VA 1K6IA 4GX1A 4JJIA 3IBTA 3PC4A 4C7XA 1NKVA 3LY8A 1RPJA 3M1YA 3CUVA 2G08A 4FHZA 2ZVDA 2VPWA 2HRRA 1YULA 3DVSX 1WUHS 3EB9A 5AUPB 5BMVA 2HCTA 3HWWA 3S2EA 5DM0A 1VKJA 4LJYA 4XX0A 3ZI0A 3B5EA 4F3YA 2DJIA 1QHEA 4P33A 4ENVA 4FM9A 1NW6A 3R9XA 2J0EA 4MW2A 5D3MB 2QJWA 3ZWVA 2P0YA 3IUEA 1DC4A 1V48A 2TMGA 2ZI7A 3G2QA 3OZ7A 4L6IA 2V1XA 1GG8A 4JB0A 2O5CA 1EP1B 1EPUA 5CA1B 2JLVA 1NVDA 1PQYA 1YR7A 2SKEA 2VSNA 1JLSA 3HUEA 3I23A 1PFGA 3PDIB 4XB6B 4ABYA 1Y7IA 2CT8A 1LI5A 3GZTB 3DT8A 3A9RA 5E2AA 1KP3A 2XKKA 1MA3A 3H2HA 4L4RA 1YZTA 5ALJA 3K7EA 4MO2A 5BW8A 1K3UB 1ZD2P 4OK5A 4EG4A 3ZHRA 3TRKA 3A4IA 1NRWA 4FYHA 2F3RA 4R1UA 3G2MA 3UJDA 1BS2A 1RWQA 3A6DA 3C0KA 3ET4A 1KJNA 1YKGA 5IEBA 3ZDAA 1A04A 3NV9A 4H0NA 4IQ8A 2I6QA 2OG2A 4CDMA 2PU5A 2ZULA 3QYPA 2EU8A 1UIMA 3F3YA 5FR1A 4B3CA 5HJEA 3WRXA 4B3SB 2B6NA 4KO2S 3OSUA 5LYJA 4CM3A 1UWCA 3REGA 4JI2B 4G8CA 2VZEA 2BCEA 3DULA 3VSEA 1ZLYA 1QIEA 4BJ6A 3K30A 1THTA 1TUBA 3H11B 4E33A 2PGOA 1B74A 2QUHA 3WXBA 3ZR4B 4M46A 4GC5A 3EIFA 4JKYA 2HMVA 1T13A 2ZI6A 2FSVC 3O4IA 2Q3CA 3PNPA 2PQ6A 4I3FA 4RLQA 3ME5A 1HXHA 3M4YA 3NONA 2O7SA 4ZT7A 5BW5A 1SN7A 3M6WA 1DRWA 2OGTA 2XRYA 4LDJA 1TM1E 4UQPA 3UB4A 2ID9A 2VJMB 3F2VA 1JMKC 3OLZA 4JK3A 2O2YA 4KWHA 4AW9A 2JZOA 1SO8A 3KFVA 1DJOA 3N2KB 2R87A 4RZXA 4UMDA 1YQTA 5D84A 2DT5A 3A4YA 3P2EA 2ZB3A 2PGAA 1AXRA 2NZ2A 3GAFA 1EFPB 1TFRA 1SUWA 4HH4A 1YWGO 1SXJD 1UDBA 1X3LA 3ZGXA 2XCTB 2ZJZA 4PAQA 3U0BA 1NXSA 1QCYA 3ZNPA 2ZI3A 1IUKA 2P30A 1YS6A 4I4CA 5IYZF 2GM5A 4V24A 5FKJA 2ZQ5A 4DQVA 4TYYA 2ZEJA 1F4PA 3RQSA 3IP6A 2F3SA 4HWPA 3HR7A 3O4RA 4M87A 4KHPB 3AB7A 4QELA 5ABPA 2Q28A 4GAEA 1L7DA 3W5HA 1FQJA 2V6FA 3PC2A 1SELA 5LBIA 3G1UA 2JFZA 4BO1A 4DV5B 3TBHA 2ZP1A 4E5VA 1QHXA 3R44A 1F8FA 1EUCA 3ZIAD 2ZJAA 3WO1A 4YUWA 3R7SA 4PSCA 2P9FA 1P0CA 3TR5A 1NM5A 1Y82A 1Z56C 2XQFA 3UA4A 2B35A 3BFJA 4DS3A 1ZVMA 3IL2A 1H8HA 3PWSA 3W0LB 1QAOA 3DDSA 3RE1A 1BX1A 3U1TA 1EFHA 3WK5A 4TZ6A 2G0AA 2C3OA 4L2IA 2BKXA 4KRYA 4GPAA 1QRAA 3EQ2A 3W2IA 3L8FA 3AKZA 2IXAA 3RASA 1L5HB 2ON6A 2WTNA 2VSFA 1XD2A