4YOIA

Structure of hku4 3clpro bound to non-covalent inhibitor 1a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 91
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yoiA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yoiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yoiA02
1SFIA 3M7TA 2Y5GA 1SB1H 2QA9E 1ABJH 1RTKA 1DITH 1K2I1 1GVLA 1QRZA 2PKAB 1SGPE 4I31A 4CREA 1DSTA 1GI5A 3SZNA 5JPMH 3MTYA 4YO9A 1GI2A 1RRKA 1AVWA 2PGQB 5T6GA 1C5OH 3SGAE 1SL3A 2ZDNA 1TABE 2PW8H 1GGDB 1FAXA 4KP0A 2XTTB 2F91A 1C4V2 3IG6B 5L2YH 1XX9A 5A8ZA 1TMBH 5C1XA 4BAQB 1EPTC 2ZU2A 1MKXH 2I6SA 3N7OA 1GCTB 1LVOA 1OWJA 2A2QH 1V2QT 3S7KB 3GCTF 2Z3EA 2EA3A 1TFXA 1AGJA 1QJ7B 1UCYH 4FXGH 1ESAA 1YPHE 1Y5AT 5T6DA 1D3QB 4I8LA 1E34B 2BD3A 3FZZA 4AG2A 1GBJA 1O2JA 3K9XB 1EXFA 1THRH 1TMUH 3PO1C 1IQLA 1O3GA 1P2IA 4D76A 5AF9H 3BTFE 1C1UH 3RXHA 1NO9H 4WH8A 1LHFH 4OGYA 2QC2A 3BTHE 5F8XA 3ZZ7A 3RXCA 1T8LA 1DWEH 5BPEA 2ULLA 1HAYB 5HM9A 1GI3A 1TLDA 2I6QA 1F0UA 3VEQB 1WCZA 3P70B 1FY8E 1UVSH 2BX4A 1HAVB 1KTTB 2VNTA 2FOBA 2Y6TA 2P59A 5EPYA 4DJZB 4Y79A 1JXPA 5L2ZH 4ABBA 2WINI 5C67A 3ZZCA 1G37A 4O97A 3EAJA 3FZDA 1C9TA 1A5HA 3RXEA 3TITA 1MQ5A 2BDCA 2W3KA 1ELGA 1HLTH 3RC5A 2G4TA 4JZDH 2VIWA 1TRYA 2OINA 1O2PA 3KGPA 1W2KH 4JK6A 4ESTE 1DVAH 1ZPZA 3MWIU 3MNXA 4Y8YA 1ZSJA 1H4WA 1SGFG 2A45B 3A7WA 1F5LA 4KELA 3QDZB 3NKKA 3SBKA 3PLKA 1O2RA 1IQGA 1C2LA 3QUMP 1IQIA 2BX3A 2GT8A 1GMCF 2SNWA 4R8TB 8KME2 1F0RA 2EC9H 3KHVA 2FYQA 1KLJH 1VCQA 1ELCA 3SJIA 1Y3XA 4Z0KA 2J34A 1QY6A 3FP7E 3Q3YA 4U01A 2DUCA 2G51A 1JMOH 2UWLA 1VCPA 1EB2A 1C5QA 2BD2A 4TWYA 1KXDA 4INHA 3SU0A 3ZZBA 2XWBI 1BRAA 3KQEA 1U6QA 3ITIA 3E8LA 1UTKA 3DT0H 1BJUA 2A4GA 4X2WA 1N6XA 4UD9H 1YPKH 1S84A 3UWIA 2BLOA 4B73A 3ODFA 1GJ7B 1QHRB 3NXPA 4F4OC 1A7SA 3ZYEA 2O8TA 1C4U2 3MI4A 3V13A 2WV5A 3H7TA 1SOTA 1SR5C 2HNTF 3SU6A 1B5GH 2SGDE 1QRXA 1O2IA 2AMPA 2BZ6H 4MLFB 1O38A 5LPFA 1C5MD 4X8TH 4A92A 4K1TA 1ELVA 2ALPA 3A7XA 4X8UH 3UREA 2Q6GA 1THSH 4XE4A 4ZXYH 1GBEA 4JYUH 2VH6A 1C5NH 2ZFTA 2WYGA 2XC5A 2VB0A 2YOLA 1AZZA 3KN2A 2ZKSA 1NFUA 4BAOB 1GG6C 4SGBE 3D49H 4H6TA 1ZGIA 5ESBA 3EBNA 4FU7A 1P2JA 3RXMA 3SQHE 1BTWA 4XDEA 1Q2WA 1LHDH 3RXQA 2ZGBH 2TIOA 1MH0A 2DE8A 1GMHG 1O39A 5C1YA 1TPAE 3TVJB 4OS6A 2ZWLH 4X1PU 3T25A 1W8BH 3KL6A 1P9SA 1K21H 4Q7YA 1G3EA 2W7SA 1RTFB 4CHAB 1WYKA 2NU2E 5FPYA 3HPTB 3P8GA 4NIWA 1C1OA 2CGAA 2ZTZA 1FY1A 4K3JA 4CH2B 5DP9A 1NT1A 4ZHAA 2BD7A 1KDQA 3SU3A 1ACBE 2CJIA 1QB9A 2KAIA 1HIAA 4Q7XA 3B9FH 3GCHC 3SNBA 1ID5H 2Y5HA 1V2LT 5LPRA 2GMTB 5AHGH 1UK4A 2WUBA 1SG8B 3UTUH 4OS7A 4UFEH 5K0HA 2BY9X 4TYDA 3HGPA 3D65E 1P3EA 4Y76A 3B8JA 4OS2A 1WTGH 1P05A 1XXFA 2Q1JA 1C2IA 3SORA 4K5ZA 3UOPA 3AW1A 2AGEX 3EYDA 3SU5A 1TX7A 1V2JT 1P9UA 1ZSLA 1EP5A 7GCHG 1XVMA 1ZRKA 3E0PB 3OTJE 1NC6A 4I8JA 2UUFB 3V0XA 4JYVH 1C5VA 4KGAA 1TRNA 2A7HA 3KCGH 1TQ0B 1GJ5H 2VJ1A 5AFZH 3NPSA 2AS9A 1J8AA 1LHCH 6CHAC 3P8OA 1AI8H 4BANB 4UDWH 4AG1A 1O35A 2ZCHP 1O2HA 1Z7KA 3U1JB 2EI6A 1AVXA 4CRCA 4YT7H 2OC1A 5CE1A 4OS5A 1XM1A 1EASA 5FX6A 1BHXF 1YPLH 1Z1IA 2OBQA 3P92A 3QN7A 2B9LA 3RMLH 4WMDA 1O2ZA 5L30H 1FIWA 1ZJKA 2FOCA 4GHTA 2WUCA 1SGEE 4FUIA 3RXTA 1O3HA 2ZFSA 1CBWB 3UQVA 1C5ZB 2AYWA 4CRFA 4AB8A 3A86A 3GCOA 2BOHB 1NM6A 4GHQA 3ZZ6A 1MKXK 4UFFH 2ZHDA 1HFDA 1YPEH 1NRPH 1PQ8A 1ZSKA 4X2VA 2WV4A 1KYNA 3SNCA 1SGYE 1VITF 5EG4A 1C2HA 1Y5UT 3Q76A 1KXAA 3T26A 3SUDA 3ATKA 2C8ZB 1DUEA 3CS0A 3T5FH 2C8WB 1SI5H 3C1KA 4X6PA 1EP6A 4GAWA 5EQQA 3SV7A 1GJDB 2ZO3H 1QL8A 4YOGA 1F0TA 1W12U 2ZI2H 3F9EA 3MO9A 3ZVBA 1GWAA 3O8RA 1G3BA 2XCFA 3HKIB 3NCLA 3UR6A 1A5GH 1O30A 1SGDE 3RM2H 5DJ7A 2BD4A 2OQUA 2VIDA 2CF9H 1O2YA 3TJOA 1F0SA 1OWEA 5PTPA 5C5OA 3SNAA 1O33A 4JZFH 2R0KA 1QQ4A 1C1RA 3LH3A 1P8VC 4GVUA 2ODYB 3VGCC 1F92A 2XRCA 1VGCB 2WPLS 9ESTA 2D2DA 3F68H 3P17H 4RN6A 3FFGA 4E05H 1IQMA 2ZF0H 2H2ZA 3GY2A 2SGQE 3DFJA 1W7XH 4NWLA 3NZIA 1WQVH 4X6OA 2A4OA 2WPJS 3MNBA 5E0HA 1A3BH 3L33A 2GCHG 1FNIA 1VJAU 2GV6A 1XUJA 2EI7A 1XKBC 4LOYH 3UR9A 1JRTA 1EZUC 4WJG2 3VGCB 1C1SA 1ETSH 1F7ZA 3SJ9A 2ESTE 1XUHA 3I77A 1ARCA 3MO6A 1AKSB 2FI4E 3ATMA 4ABHA 3MU1A 4RKJB 1BIOA 2H6MA 1C5YB 2R2MB 5C20A 1GHYH 2ZTYA 2O8UA 1ELEE 1HRTH 1AVGH 1XUGA 1ZMLA 4D8NA 4DURA 4Q7ZA 6GCHG 1BT7A 1GJ6A 1K1JA 3SI4H 1EQ9A 3QTVH 3LPRA 5DP7A 1NU7B 2CN0H 3KEEA 2V3HH 1B0FA 3M35A 5EXMA 2TGPZ 1UCYK 1EJNA 1G36A 1O0DH 1XUIA 3EA8A 1QA7A 1UTLM 3QZQA 3DUXH 1DT2A 5GDSH 1UTJA 1HDTH 2STAE 5F03A 4I32A 2DE9A 4WMFA 4NIXA 2D8WA 2V35A 5K7RA 1C5TA 3UNSA 1DPOA 1LPZB 1YLCA 1OP0A 3M5OA 2Z9KA 2FTLE 5CMXH 5DP6A 1ZPCA 2P95A 4E7RG 4AGJA 1HAPH 4AFQA 2ZDAH 4X8VH 4OS4A 4FUBA 2SGEE 3SJOA 4GLYA 2GCTB 2ZFPH 1VITG 3PTNA 1S6FA 1C1TA 2ZHQH 1PQ7A 1A4WH 1V2KT 3QX5H 1RIWC 3R3GB 2Z9JA 1D6RA 1P04A 1O5CB 2FS8A 3BTGE 2VGCB 5ETXA 4GSOA 1MTSA 1HIAB 3G01A 4IN1A 1W14U 3TU7H 1NY22 3UPEA 4FUJA 4K8YA 3RMMH 4AFUA 2A5IA 3SJKA 4WF8A 4RSPA 2QGRA 4TPIZ 1MD8A 3LT3A 2FIRH 4KTCA 4MPUA 4ZAEA 1TIOA 4FUDA 2XBYA 1BB0B 1GMCG 5JDUB 1O2MA 1UHBA 5FBIA 3ZZ3A 3F6UH 3S9BA 1GBHA 1GI7B 3BTDE 4MG3A 3A8AA 2GD4B 2R9PA 4YOJA 1JIMA 1C2MA 5GCHG 1DM4B 3P8FA 2FI3E 1BDAA 1KXBA 3GY4A 2XWAA 3FP6E 2XBVA 3TIUA 1BBRE 1P01A 1BJVA 5A0BA 2BM2A 1H1BA 1GJCB 1S5SA 3Q77A 1W0ZU 4Y7AA 1Z71A 1FQ3A 1FXYA 3A80A 4YTAA 2SGAA 4B76A 1AB9B 1S81A 5HYOA 1VZQH 4A1VA 1SQTA 2SGFE 4DIHH 1J16A 3PMBB 1TOCB 2ZCLP 1P0SH 1GBAA 1P03A 1GL1A 2J9NA 2ZQ2A 3GY7A 2UWOA 1MMJN 2PUXB 2ZG0H 2VIPA 1MD7A 1BBRH 3M61U 1DOJA 1O3CA 1UHBB 1GL0E 1L1GA 2J95A 3KQCA 4U2WA 3E3TA 4XBCA 1BOQA 4FVBA 4CR5A 3AVZA 1AD8H 4ZHMU 1KXFA 5DP3A 1ZRBA 1TGBA 2PSYA 3VB6A 1O2QA 3HKJB 1FN6A 3A85A 8GCHG 1SGRE 4XOJA 3BTQE 2F9VA 1EJMA 2D26C 1PPHE 3LJJA 5DP8A 3SJ8A 4BAHB 4WXVA 1KLTA 4D9RA 1IQNA 1C5SA 2BDGA 1N1LA 3K6YA 3M5LA 5DK1A 1VGCC 1VCWA 4X1NU 2ZA5A 3H5CB 1S82A 3IWMA 1Y3VA 1ZTJA 1O3MA 1SHHB 1AFQC 2A2XH 2CHAB 1OPHB 1SQAA 3BV9B 2STBE 1RFNA 1AUJA 1IQKA 5A8YA 7ESTE 2ANYA 1O3PB 7LPRA 1SSXA 5TJXA 1HAIH 1MU6B 4ABEA 2IN2A 5JBAS 3SUEA 4CR9A 4FVDA 1A61H 3M5MA 4ISNA 3FVFB 3SQEE 1O2SA 3AASA 5ESTE 1MCVA 4AYYB 2BDBA 2BZAA 1BTPA 4AB9A 4QT8C 3TNSA 4AYVB 1GCDA 2CHAC 4A5TS 3SU1A 2TRMA 5DG6A 1KDQB 3QGNB 5BRRE 1TGNA 2ZFRH 3STIA 1QTFA 1J15A 4BTTB 3ZVFA 3LONA 1AFQB 1FUJA 2J2UA 4J2YB 1FMGA 2B0FA 1ZMNA 3SV9A 5HM2A 1JBUH 1YCPK 1FN8A 1G3CA 1AN1E 5I46H 1MTUA 1QBNA 1PPCE 4Y0YE 1FPCH 4DW2U 2BXUH 4MQAA 5E0GA 3MH5A 1FAKH 2OLGA 4OS1A 3RM0H 2BVSH 3DHKH 1D9IA 1EOJA 2HNTE 4F49A 1DXPA 3SU2A 1TNGA 3ZZ8A 2Y82A 4U32A 4YOIA 4BTUB 5EPNA 3K6ZA 1D6WA 1YKTA 2YNBA 1K1LA 1WUNH 2BLVA 4INLA 2ZPRA 1A46H 1QL9A 3PO1B 1SGIB 4WWYA 2FX4A 3C27B 2WYJA 1FY3A 5A2MH 3MH4A 4X2XA 3PMJA 2BDHA 1NU9A 2GT7A 3NWUA 1ZZZA 4YM9A 1AUTC 5EW1H 3UIRA 6ESTA 1CVWH 2FOGA 2ZGCA 4GCHG 1UTQA 1GJ8B 4OGXA 3A8BA 2TGDA 2G81E 2VWMA 2A7JA 1NZQH 3ENSB 3UFAA 1D3TB 1BZXE 1LDTT 2FOMB 2V0BA 1B7XB 2AIQA 1O2WA 1NRNH 1HAOH 4Z6AH 2YNAA 3SV8A 1ZHPA 1UJ1A 3HATH 1GG6B 2B8OH 3TLOA 3LOXA 3PB1E 1TPSA 2BVXH 4KTSA 3ZV8A 1BUIA 3U8OH 4X1RU 1FY5A 1EPTB 3BTME 1Q31A 3MO3A 1THPB 2FZZA 1PPFE 3JZ1B 1C1MA 1QGFA 3ZVAA 4DGJA 3VB5A 1BMNH 2GZ8A 1A0LA 2XBXA 3QK1A 4YLQH 1LKBA 3TGIE 4ZKOU 2HRVA 5JYIA 1OYQA 2GKVE 2B7DH 1N8OC 2A5AA 2AEIH 5JBCS 1UVPA 3VPKA 4MNXA 4YT6H 2A32A 1WAYB 4AOQA 3SNEA 4AFZA 1A0HB 1G3DA 4H4FA 1V2TT 1HAHH 1NRSH 1IQEA 2Y5FA 4CHAC 1TWXB 1ESTA 3KF2A 4FUFA 1PFXC 1TA2A 2ZPQA 1T8NA 3OY6U 2FOFA 4D9QA 1ZHRA 3EE0B 5C1UA 3UOUA 1O2UA 1ETRH 4NFEA 5F8ZA 3U8RH 1O3IA 5EQRA 1Q3XA 3IITA 4I8KA 3SHCH 1F5KU 4FUGA 2ZDKA 3RXSA 2ZPSA 3UNRA 1ANBA 1EAXA 3L3TA 1O36A 1V2PT 4FUCA 4B74A 1SGTA 1GHAF 1BRUP 1ZGVA 2RA3A 3CS7A 1TPOA 4Y10E 1HV7A 1H9IE 1F5RA 2RG3A 2C93B 1HCGA 1LQEA 3ELAH 1AU8A 1NTPA 1FIZA 3LDXH 2P94A 2LIZA 1YP9A 3RLYH 2EI8A 2BD8A 1HAZB 1P10A 1T31A 4A1XA 1T4UH 3ZVEA 3A89A 4JZ1A 4X1QU 2PFEA 1CO7E 2V6NA 2J92A 3TNTA 4ZKNU 3E0NB 1BTUA 1BTXA 1MTWA 3TH2H 2BDAA 4BTIB 1W11U 2FP7B 4B2BA 3PV4A 1HAXB 3PWCA 4ABGA 5CHAC 1FY4A 1RIWB 2PWXA 4A1TA 1O3LA 4FU9A 5F6MA 2ZU1A 1DDJA 3A7YA 2GCTC 1DWDH 3BTWE 3U9AH 1OXGA 4JK5A 2GMTC 2A4QA 2CXVA 1AFEH 5SGAE 3FP8E 2BY8X 2WPMS 2IPHA 1UO6A 1EAWA 2QXIA 3MH6A 4K1EA 1DX5M 1C5XB 3PM3A 1SLXB 1YYY1 2BY6X 2F9BH 1DY8A 1P06A 1G2LA 3CP7A 1O34A 2BQWB 2A4RA 4WXIA 1CQQA 1GHAG 4DVAU 1NPMA 1IOEA 1ZLRA 3EDXB 2BLQA 4ABJA 1QJ6B 4M7GA 3TK5A 9LPRA 5F8TA 1MUEB 3PYHA 4I8HA 2Y81A 1SOZA 1YC0A 2A7CA 2Z7FE 5I25A 1TAWA 1GJBB 1SVPA 1GI0A 1ELAA 3GYLB 3RXRA 4JZEH 1MBMA 1A3EH 4AN7A 1D3PB 3BEUA 3GICB 3V3MA 1TNLA 1HBTH 5C2ZA 1C1VH 3RXJA 2A5KA 1GMDG 2VH0A 1GBBA 2K1QA 4VGCC 3PTBA 1NN6A 2RDLA 1QL7A 2R3UA 3NK8A 2BB4A 1FV9A 1BITA 4ISHH 3SN8A 5GWZA 1BRCE 3A7TA 1GJ4H 4NFFA 2FWWA 5A0AE 1AE8H 2OXSA 3GDVA 1OWHA 3BTEE 4B2CA 5DKMA 1RD3B 2W26A 4I33A 5FCKA 1OWKA 1ELDE 2ZU5A 4E06H 3OSYA 4Y6DA 1ANCA 1SLWB 3RU4T 3TH4H 3RMNH 1MKWK 1L0ZA 1TPPA 3RXLA 5FPTA 3PLBA 3U98H 3RU4D 2PKSB 1EZSC 1MTNC 4WY3A 4AORA 1HJAC 1GCTC 1GVZA 1LHEH 1T4VH 3TK6A 2O8WA 2XXLA 2GDDA 1ANEA 1P2QA 8LPRA 4ZH8A 1BTHH 1K1NA 1SLUB 1MZAA 1EAIA 5DGJA 3BEFB 4SGAE 1ABIH 3A8DA 2C8XB 2F9OA 2PKSC 1QR3E 2AMQA 1FLEE 3QO6A 1CT4E 4ABFA 2ZC9H 1OS8A 1IHSH 2JH0D 3SV6A 3A88A 4B2AA 2A1DB 4Y7BA 2Z6BD 1HJAB 3BG4B 1EX3A 2QF0A 1UK3A 1JIRA 1C1QA 3T62A 4H6SB 1B0EA 1V2MT 2GX4A 1V2VT 2VIOA 3RXOA 4JCNA 4NWKA 1JWTA 2P3FH 1OWDA 1O5GH 4IGDA 1LO6A 1SGFA 1G30B 1CGIE 1OKXA 1QCPA 4CBNA 1GBFA 2FODA 1QJ1B 2P3UB 1FDPA 1LMWB 3FAOA 3E90B 1YPJH 5IYTA 4B1TA 3M3TA 1W13U 2QCYA 1C1WH 1EAUA 2PSXA 4HZHA 3W95A 3PMAB 4TY6A 5DP5A 1S0RA 3A87A 5CHAB 3GY6A 3BG4C 2M5TA 4Q80A 1Z8RA 1MAYA 1HAVA 1A5IA 1DE7H 4ZHLU 2BDYA 1SQOA 1Z8GA 2ZEBA 5JBBS 1KY9A 1XMNB 6GCHF 5H4IB 3RC6A 2ZDVH 3E1XB 1HUTH 8GCHF 2FI5E 4U30A 3S9CA 3S0NA 2THFB 1O5DH 1MQ6A 3EQ0H 2NU3E 3E6PH 1NFXA 2GP9B 3TPIZ 4YLUA 3BIVH 3SGQE 1DS2E 1ELTA 4O9VA 1MTVA 1UCYE 1LPGB 1C9PA 1GHXH 2H9TH 1BHXB 4X1SU 3T28A 5EGMA 3O8DA 4DT7B 2VINA 3BTTE 3SHAH 2NU4E 2BMGB 2ZFQH 3LH1A 3KQBA 4NA7A 1GJ9B 2AERH 4IMZA 2PUQH 2QF3A 1O37A 3LGVA 3LKWA 1UVUH 2BY7X 1SGCA 2BD5A 7GCHF 3SO3A 5GPIB 2P8OB 5HMAA 2F9UA 1O2KA 3ATWA 1T7CA 4ISLA 1XVOA 2C90B 2ZDMA 2RA0A 1SPJA 4PROA 3ZYDA 3MFJA 1V2WT 4VGCB 4BAKB 4JMYA 1TB6H 2XC4A 3K65B 3RXIA 2VWOA 4CH8B 1QIXB 1INCA 3RXBA 2OBOA 1BTZA 2Q6DA 2PV9B 1HJ9A 2OC7A 1P2MA 1P3CA 4DG4A 3VB7A 5T3HA 2BD9A 4XBDA 2QXGA 1T8OA 2JETC 3U8TH 2IJOB 2R2WU 3M7UA 2EEKA 4LZ1H 4ISIH 3BEIB 3LJOA 4X0WU 2VVCA 1H9LB 1GI1A 3BN9A 1GI4A 2D1JA 3GCNA 1O5AB 3GDUA 2K7XA 1LPKB 1H9HE 2ZTXA 2ANKH 1DLKB 2TGTA 3ZVGA 4B71A 4IS5A 3LGIA 2PR3A 3ODDA 4NG9H 2FOEA 2ILNA 4DIIH 2PHBA 1CU1A 3M7QA 1FPHH 2F3CE 3O8BA 1GBCA 1O3BA 1IHTH 3BF6H 3GCTG 1DWCH 3K2UA 2GTBA 1EZXC 2FOHA 1SFQB 2G4UA 4GCHF 2WPKS 1C4Y2 5HGGA 4ZKSU 5JB8S 1NFYA 3MMGA 2UUJB 1C5UA 2Q6FA 2XCNA 5EW2H 2BQ6B 4H42U 2LPRA 2Z9GA 3NUMA 1HAGE 5E8EH 5DO4H 5HXFA 3GOVB 1G2MA 3I78A 2ASUB 1O2OA 2HNTC 3E16B 3SUGA 1GBKA 1AY6H 3F9HA 3ZZ5A 1P2KA 1QURH 2CV3A 2OC8A 1DANH 4AGKA 1GI6A 2ZU3A 1GDQA 3UQOA 3GISB 4WH6A 1GVKB 1Y59T 3TGKE 1QB1A 2BDIA 4BOHA 4LZ4B 2C4FH 1O3KA 1MAXA 4IBLH 1K9OE 1RXPA 4KTUA 1O32A 1C5RA 2VIVA 4O03A 1LTOA 4X6NA 3RXVA 1LQDB 1OX1A 4ZMAH 3LC3A 1S83A 5GIBA 2HVXA 3U1IB 3KNXA 1PPBH 2P8OC 1UTPA 1LHGH 1L1JA 1H8IH 1NFWA 4O3UA 2W3IA 3JZ2B 1M9UA 2G5VA 3M36A 4NZQA 5FXLA 1TOMH 1HB0B 2XBWA 1W0YH 2IOTA 1Z8IB 3TJVA 2SGPE 1EATA 1Z8JB 1T8MA 2OD3B 4LXBH 3STJA 1P2OA 1UK2A 2QV1A 5DPAA 5FX5A 2TBSA 2B5TB 1C5WB 4ASHA 4D7GA 1ARBA 1BMAA 1GJAB 4HTCH 3D62A 4ABDA 2NU0E 3SI3H 3V7TA 3SGBE 3A83A 3MU8A 2ANMH 2JETB 4LK4A 1PYTC 2F83A 1P12E 3R0FA 4UE7H 3ZZAA 3ATIA 1GHVH 1RTLA 2QY0B 2FDAA 1BQYA 3TGJE 4K69A 5JBTA 2H9EH 2ZHWH 3QWCH 5DP4A 3EA9A 1V2NT 1BMMH 5E2OA 3VXEH 2BOKA 3RMOH 5TCAA 1P02A 4X8SH 1SGNE 3MH7A 1O3NA 5FCRA 3F9FA 4ZROA 1ORFA 1RJXB 3VXFH 2OUAA 1CA0C 1LCYA 2UWPA 1GDUA 1PPZA 1ESBA 2VWNA 1S85A 1TMTH 1O2VA 3PLPA 1FI8A 5EQSA 3E91A 1KXCA 4IN2A 5EXLA 2P3TB 2BHGA 3TK9A 2G00A 1A0JA 3M5NA 1P57B 2CF8H 2VIQA 1O2GH 1CT0E 1ZJDA 1LVMA 1C2DA 1ZPBA 3P8NA 1OP2A 1ELFA 2FYRA 1O2XA 1QNJA 3PWBA 2ZP0H 2ZNKH 5AFYH 1S0QA 1RS0A 2UUYA 2ZGJA 2ALVA 3PROA 2FPZA 3T29A 3LGTA 1UTOA 1XUFA 2J94A 4AX9H 1YPGH 1V2OT 4INKA 1TNHA 6CHAB 3OYPA 4ZKRU 4FUHA 1V2ST 1HYLA 1PPGE 4A6LA 1E38B 4NCYA 1P09A 1AE5A 1E35B 3BG8A 3QGJA 3RDZA 1ZHMA 4FU8A 2BXTH 3MU0A 2OCVB 1O3DA 3KIDU 4Y8XA 4XFQA 1TBZH 4HFPB 1FZZA 1AKSA 2GVFA 1OSSA 2ANWA 1TNIA 1O5FH 1V3XA 2ZECA 5J4QA 5GCHF 5ABWA 1QBOA 2VWLA 1AQ7A 4YESB 5A09A 2GCHF 4Y0ZE 1GBMA 1EJAA 1EOLA 3A84A 1CA8B 4NSVA 2FS9A 2QIQA 3HK3B 5A8XA 1SGQE 3S9AA 1AIXH 1CBWC 1BA8B 1GMHF 4Y11E 1C2FA 3BTKE 1OYTH 3L6PA 4CRDA 1ZOMA 4BXWA 1DICA 1L4ZA 4NSYA 3ZVCA 1ELBA 2FM2A 5GJ4B 2J38A 4MPWA 2Z9LA 4X6MA 1KSNA 1E0FD 1AMHA 3DA9B 3GY8A 2VGCC 3Q00A 4NA8A 4CRGA 2SFAA 3Q3XA 4K1SA 4UONA 2R0LA 2GDEH 1TONA 1K22H 2J4IA 4DCDA 4MTBA 5A0CA 1LKAA 1V2RT 1TBRH 1J17T 1UVOA 2UUKB 2O9QA 3M3VA 5LH8A 2Y7ZA 3ZVDA 1C2GA 2QAAA 1BBRK 3GY3A 3T27A 3MHWU 1N8OB 1Y3UA 3LC5A 2QXHA 1YM0A 1A2CH 1WBGB 4IW4E 2BY5X 1BCUH 2GZ7A 2GGVB 1GBDA 3B23B 1KIGH 1WSSH 3RXKA 1MZDA 1AZ8A 4O3TA 1DY9A 1CGHA 1W3CA 1YCPM 2H1UA 4Y71A 1K1MA 1NRRH 3KQDA 1DSUA 4TY7A 3SOSA 3SW2B 3ZZ4A 3ZZ9A 4BXSA 1TQ7B 3WY8A 2AGIX 3F1SB 1ETTH 1UVTH 4RKOB 3V12A 1S6HA 1NROH 1YPMH 5FBEA 3RXFA 2HLCA 3T2NA 1AB9C 2GZ9A 1SBWA 3URDA 1ZYOA 5E0JA 1GI9B 5EXNA 2P93A 2FMJA 1PQAA 2HPQH 4Q2KA 4FUEA 3URCA 2TGAA 3Q3KA 1V2UT 5GXPA 4E7NA 1UMAH 1IQJA 1TRMA 3A7VA 2FX6A 2QXJA 2P16A 3QZRA 1BRBE 1O2LA 4MPVA 4NGAH 5FAHA 1GHBF 3MOCA 2BLWA 1JRSA 2V3OH 4K2YA 4K60A 1GDNA 4Y8ZA 4DOQA 4BAMB 2ZGHA 5E2PA 3H7OA 5EOKA 3SNDA 1AO5A 1PJPA 1VJ9U 1FJSA 3DFLA 3UWJH 5LGOA 3O8CA 2WPIS 1GHWH 1MCTA 1J9CH 1CT2E 1J14A 1K1IA 1WV7H 3RP2A 3VFEA 1CHOF 2AFQB 1PQ5A 4CBOA 1HNEE 1TE0A 1DWBH 1CGJE 2TPIZ 1C2EA 3M3SA 2R3YA 3HGNA 1KLIH 3AW0A 4MNYA 4R0IA 1O3EA 1YF4A 2NWNA 3HK6B 1OOKB 4KKDA 1LVYA 3LGUA 5L6NH 1NESE 2PTNA 1F2SE 1YLDA 2FLRH 1AHTH 1E36B 3PMHB 1Y3WA 2ZGXH 1GPZA 1K28D 1L1NA 2OC0A 5FPSA 1OWIA 1O2TA 3ESTA 4HGCA 2XYAA 4THNH 2G55A 3RUOA 1UTMA 1Y5BT 4DY7B 1P11E 4ABAA 4MDSA 3QTOH 5TCCA 2Z3DA 1Y8TA 1SHYA 5EU8A 2KAIB 4MVNA 1GMDF 3RXAA 1EUFA 2PGBB 3ATLA 4AFSA 1QA0A 2ZHEH 1WQSA 1O3JA 3P95A 1TX6A 1TGTA 2G8TA 3OY5U 5IDKA 1D3DB 1IAUA 4UFGH 2XC0A 1PPEE 1W7GH 4I8GA 2ZDLA 3UNQA 4CRAA 4A7IB 2FEQH 2Z3CA 3SU4A 3D23A 1KTSB 3LIWA 4D7FA 5JB9S 1C1PA 4ZXXH 1GBLA 2AGGX 1ANDA 1CSOE 4K8BA 1IQFA 3RXPA 3OU0A 1GHZA 1VITH 1KXEA 3AAUA 2G52A 3GCHB 4XSKU 3M37A 1DUAA 2OTVA 2QN5T 4JYTA 2FESH 2PKAA 2JH5D 2ZZUH 1QBVH 2ZIQH 4WVPE 1EZQA 1D4PB 3SV2H 2W5EA 3SUFA 1EPTA 1WOFA 4MNWA 1O5EH 1SLVB 1TNKA 2NU1E 1PYTD 2OQ5A 1SMFE 2FOAA 2RCEA 4GUXA 4YZUA 2FTMA 1ZTLA 3S69A 2H9HA 2ZFFH 1DXWA 4NA9H 1GI8B 4ZUHA 1YGCH 3ZV9A 3S7HB 4TWWA 1V6DA 1MU8B 5EODA 1O2NA 4NZLA 3W94A 1AWFH 2GV7A 3RLWH 2C8YB 1GHBG 4TPYA 1O5BB 2PTCE 1HGTH 1FONA 1QB6A 1Z6JH 3FANA 2A31A 1RGQA 2BQ7B 1BMLA 3RC4A 3GDSA 5G4BA 1K1OA 2F9PA 1O3FA 1MTNB 5C3NA 4B75A 1YBWA 2ZHFH 5T6FA 4NIVA 3TH3H 3VB4A 1LVBA 1TNJA 2AIPA 4IMQA 1CHOG 2A0QB 1O3OA 1TA6A 2CMYA 3TJUA 2HPPH 1T32A 2FO9A 3U69H 1G9IE 3CENA 1JOUB 3A8CA 1A1RA 1W10U 8ESTE 2QYIA 1EKBB 1L4DA 2ZCKP 5FHTA 1MBQA 4ABIA 2LNCA 2JH6D 1G32B 6LPRA 1X7AC 4BNRA 2SNVA 1GBIA 1QRWA 3MNSA 2ODQA 1HXFH 2ZQ1A 3GYMA 4CRBA 1CHGA 1CA0B 1GBTA 3LU9B 2FLBH 1K1PA 1TYNA 2XNIA 5AVDA 3MU4A 1EB1H 2HALA 2H5CA 2HGTH 1Z1JA 2G5NA 4MNVA 3RU4E 2O8MA 1AWHB 4UEHH 1TBQH 2AMDA 2ZU4A 2BTCE 1C5PA 4WMEA 1CE5A 3I29A 1TGCA 2Y7XA 1ZMJA 1N6YA 1O3AA 3QLPH 1L2EA 3MYWA 3RXDA 4ISOA 1IQHA 2O8LA 1XXDA 2ODPA 3F9GA 1P2NA 3TJNA 4AZ2B 3UY9A 2VVVA 3A82A 3LGYA 4NIYA 2W7UA 2Z9IA 1UTNA 1DLEA 3BSQA 2Z94A 2H5DA 4MPXA 5LPEA 3LGWA 1HJ8A 1Z6EA 3GY5A 3AAVA 1C2JA 3ZZDA 3OX7U 1TX8A 2VU8E 2Y80A 4JZIA 5B6OA 3RXUA 1XKAC 1C5LH 4UFDH 1OP8A 2JKHA 1QQUA 3P6ZB 7KMEH 4XBBA 3MNCA 3VB3A 3BIUH 1HXEH 3EGKH 3A7ZA 2PLXA 1HPGA 1NS3A 2BYAX 2OP9A 1TGSZ 2VVUA 1QFKH 1O31A 2XW9A 1C2KA 1MKWH 1SC8U 1Y3YA 1XUKA 2FXRA 1GGDC 3EA7A 1NRQH 3A81A 1C1NA 3DD2H 1DFPA 4IC5A 4HI3A 4I7YH 2BVRH 2HOBA 4IC6A 3RXGA 1YCPH 1VR1H 4GPGA 5C5NA 1H8DH 1YPHC 2C3SA 2F9NA 1E37B 1TALA 4X2YA 1WTHD 1ZR0A 3MU5A 3UUZA 5J4SA 2WPHS 2AH4X 4J1YA 1BTYA 1ZTKA 1WU1A 2HWLB
chains in the Genus database with same CATH superfamily
1SFIA 3M7TA 2Y5GA 1SB1H 2QA9E 1ABJH 1RTKA 1DITH 1K2I1 1GVLA 1QRZA 2PKAB 1SGPE 4I31A 4CREA 1DSTA 1GI5A 3SZNA 5JPMH 3MTYA 4YO9A 1GI2A 1RRKA 1AVWA 2PGQB 5T6GA 1C5OH 3SGAE 3EE7A 1SL3A 2ZDNA 1TABE 2PW8H 1GGDB 1FAXA 4KP0A 2XTTB 2F91A 1C4V2 3IG6B 5L2YH 5KEDA 1XX9A 5A8ZA 1TMBH 5C1XA 4BAQB 1EPTC 2ZU2A 1MKXH 2I6SA 3N7OA 2JJ2D 1GCTB 1LVOA 1OWJA 2RFKC 2JDID 2A2QH 1V2QT 3S7KB 3GCTF 2Z3EA 2EA3A 1TFXA 4ZCNA 1AGJA 1QJ7B 1UCYH 4FXGH 1ESAA 1YPHE 1Y5AT 5T6DA 1D3QB 4I8LA 1E34B 2BD3A 3FZZA 2LELA 4AG2A 1GBJA 1O2JA 3K9XB 1EXFA 1THRH 1TMUH 3OAAD 3PO1C 1IQLA 1O3GA 1P2IA 4D76A 5AF9H 3BTFE 1C1UH 3RXHA 1NO9H 4WH8A 1LHFH 4OGYA 2QC2A 3BTHE 5F8XA 3ZZ7A 3RXCA 1T8LA 1DWEH 5BPEA 2ULLA 1HAYB 5HM9A 1GI3A 1TLDA 2I6QA 1F0UA 3VEQB 1WCZA 3P70B 1FY8E 1UVSH 2BX4A 1HAVB 2AHME 1KTTB 2VNTA 2FOBA 2Y6TA 2IJD1 2P59A 5EPYA 4DJZB 4Y79A 1JXPA 5L2ZH 4ABBA 2WINI 5C67A 3ZZCA 2CK3D 5KECA 1G37A 4O97A 3EAJA 2F4LA 3FZDA 1C9TA 1A5HA 5EJLA 3RXEA 3WWFA 3TITA 1MQ5A 2BDCA 2W3KA 1ELGA 1HLTH 3RC5A 2G4TA 4JZDH 2VIWA 1TRYA 2OINA 1O2PA 3PV2A 3KGPA 1W2KH 4JK6A 4ESTE 1DVAH 1ZPZA 3MWIU 3MNXA 4Y8YA 1ZSJA 1H4WA 1SGFG 2A45B 3A7WA 1F5LA 4KELA 1MABB 1YWUA 3QDZB 3NKKA 3SBKA 3PLKA 1O2RA 1IQGA 3OTPA 1C2LA 3QUMP 1IQIA 2BX3A 2GT8A 1GMCF 2SNWA 2EQNA 4R8TB 8KME2 1F0RA 2EC9H 3KHVA 2FYQA 1KLJH 1VCQA 1ELCA 3SJIA 1Y3XA 4Z0KA 2J34A 1QY6A 3FP7E 3Q3YA 4U01A 2DUCA 2G51A 1JMOH 2UWLA 1VCPA 1EB2A 1C5QA 2BD2A 4TWYA 1KXDA 4INHA 3SU0A 3ZZBA 2XWBI 1BRAA 3KQEA 1U6QA 3ITIA 3E8LA 1UTKA 3DT0H 1BJUA 2A4GA 4X2WA 1N6XA 4UD9H 1YPKH 1S84A 3UWIA 2BLOA 4B73A 3ODFA 1GJ7B 1QHRB 3NXPA 2M2AA 2PP6A 4F4OC 1A7SA 3ZYEA 2O8TA 1C4U2 3MI4A 2OK5A 3V13A 2WV5A 3H7TA 1SOTA 1SR5C 2HNTF 2KFWA 3SU6A 1B5GH 2SGDE 1QRXA 1O2IA 2AMPA 2BZ6H 4MLFB 1O38A 5LPFA 1C5MD 4X8TH 4A92A 4K1TA 1ELVA 2ALPA 3A7XA 4X8UH 3UREA 2Q6GA 1THSH 4XE4A 3W1EA 4ZXYH 1GBEA 4JYUH 2VH6A 3SZEA 1C5NH 2ZFTA 2WYGA 2XC5A 2VB0A 2YOLA 1AZZA 3KN2A 2ZKSA 1NFUA 4BAOB 1GG6C 4SGBE 3D49H 4H6TA 1ZGIA 5ESBA 3EBNA 4FU7A 1P2JA 3RXMA 3SQHE 1BTWA 4XDEA 1Q2WA 1LHDH 3RXQA 2ZGBH 2TIOA 1MH0A 2DE8A 1GMHG 1O39A 5C1YA 1TPAE 3TVJB 4OS6A 2ZWLH 4X1PU 3T25A 1W8BH 3KL6A 1P9SA 1K21H 4Q7YA 1G3EA 2W7SA 1RTFB 4CHAB 1WYKA 2NU2E 4RT1A 5FPYA 3HPTB 3P8GA 4NIWA 1C1OA 2CGAA 2ZTZA 1FY1A 4K3JA 4CH2B 5DP9A 1NT1A 4ZHAA 2BD7A 1KDQA 3SU3A 1ACBE 2CJIA 1QB9A 2KAIA 1HIAA 4Q7XA 3B9FH 3GCHC 3SNBA 1ID5H 2Y5HA 1V2LT 5LPRA 2GMTB 5AHGH 1UK4A 2WUBA 1SG8B 3UTUH 4OS7A 4UFEH 5K0HA 2BY9X 5C94A 4TYDA 3HGPA 3D65E 1P3EA 4Y76A 3B8JA 4OS2A 1WTGH 2QF5A 1P05A 1XXFA 2Q1JA 1C2IA 3SORA 4K5ZA 3UOPA 3AW1A 2AGEX 3EYDA 3SU5A 3MQKC 1TX7A 1V2JT 1P9UA 1ZSLA 1EP5A 7GCHG 1XVMA 1ZRKA 3E0PB 3OTJE 1NC6A 4I8JA 2UUFB 3V0XA 4JYVH 1C5VA 4KGAA 1TRNA 2A7HA 3KCGH 1TQ0B 1GJ5H 2VJ1A 5AFZH 3NPSA 2AS9A 1J8AA 1LHCH 6CHAC 3P8OA 1AI8H 4BANB 4UDWH 4AG1A 1O35A 2ZCHP 1O2HA 1Z7KA 3U1JB 2EI6A 1AVXA 4CRCA 4YT7H 2OC1A 5CE1A 4OS5A 1XM1A 1QZ8A 1EASA 5FX6A 1BHXF 1YPLH 5C0TA 1Z1IA 2OBQA 3P92A 3QN7A 2B9LA 3RMLH 4WMDA 1O2ZA 3OEHD 2KCYA 5L30H 1FIWA 1ZJKA 2FOCA 4GHTA 2WUCA 1SGEE 4FUIA 3RXTA 1O3HA 2ZFSA 4DT4A 1CBWB 1WDIA 3UQVA 1C5ZB 2AYWA 4CRFA 4AB8A 3A86A 3GCOA 2BOHB 1NM6A 4GHQA 3ZZ6A 1MKXK 4UFFH 2ZHDA 1HFDA 1YPEH 1NRPH 1PQ8A 1ZSKA 4X2VA 2WV4A 1KYNA 3SNCA 1SGYE 1VITF 5EG4A 1C2HA 1Y5UT 3Q76A 1KXAA 3T26A 3SUDA 3ATKA 3F2FA 2C8ZB 1DUEA 3CS0A 3T5FH 2C8WB 1SI5H 3C1KA 4X6PA 1EP6A 4GAWA 1VKYA 5EQQA 3SV7A 1GJDB 3DSGA 2ZO3H 1QL8A 4YOGA 1F0TA 1W12U 2ZI2H 3F9EA 3MO9A 3ZVBA 3DSPA 1GWAA 3O8RA 1G3BA 2XCFA 3F0OA 3HKIB 3NCLA 3UR6A 1A5GH 1O30A 1SGDE 1FX0B 3RM2H 5DJ7A 2BD4A 2OQUA 2VIDA 2CF9H 1O2YA 3TJOA 1F0SA 2WV9A 1OWEA 5PTPA 5C5OA 3SNAA 1O33A 4JZFH 2R0KA 1QQ4A 1C1RA 3LH3A 1P8VC 4GVUA 2ODYB 1E1RD 1F92A 2XRCA 3VGCC 1VGCB 2WPLS 9ESTA 2D2DA 3F68H 3P17H 4RN6A 3FFGA 4E05H 1IQMA 3U28C 2ZF0H 2H2ZA 3GY2A 2SGQE 3DFJA 1W7XH 4NWLA 3CNRA 3NZIA 1WQVH 4X6OA 2A4OA 2WPJS 3MNBA 5E0HA 1A3BH 3L33A 2GCHG 1FNIA 1VJAU 2GV6A 1XUJA 1KMHB 2EI7A 1XKBC 4LOYH 3UR9A 1JRTA 1EZUC 1H8HD 2J5UA 4WJG2 3VGCB 1C1SA 1ETSH 1EFRD 1F7ZA 3SJ9A 2ESTE 1XUHA 3I77A 1ARCA 3MO6A 1AKSB 2FI4E 3ATMA 4ABHA 3MU1A 4RKJB 1BIOA 2H6MA 1C5YB 2R2MB 5C20A 1GHYH 2ZTYA 2O8UA 1ELEE 1HRTH 1AVGH 1XUGA 1ZMLA 4D8NA 4DURA 4Q7ZA 6GCHG 1BT7A 1GJ6A 1K1JA 3SI4H 1EQ9A 3QTVH 3LPRA 5DP7A 1NU7B 2CN0H 3KEEA 2V3HH 1B0FA 2XOKD 3M35A 5EXMA 2TGPZ 1UCYK 1EJNA 1G36A 1O0DH 1XUIA 3EA8A 1QA7A 1UTLM 3QZQA 3DUXH 1DT2A 5GDSH 1UTJA 1HDTH 2STAE 5F03A 4I32A 2DE9A 4WMFA 4NIXA 2D8WA 2V35A 5K7RA 1C5TA 3UNSA 1DPOA 1LPZB 1YLCA 1OP0A 3M5OA 2Z9KA 2FTLE 5CMXH 5DP6A 1ZPCA 2P95A 4E7RG 4AGJA 1HAPH 4AFQA 2ZDAH 4X8VH 4OS4A 4FUBA 2SGEE 3SJOA 4GLYA 2GCTB 2ZFPH 1VITG 2WZQA 3PTNA 3ZIAD 1S6FA 1C1TA 2ZHQH 1PQ7A 1A4WH 1V2KT 3QX5H 1RIWC 3R3GB 2Z9JA 1D6RA 1P04A 1O5CB 2FS8A 3BTGE 2VGCB 5ETXA 4GSOA 3OFND 1MTSA 1HIAB 3G01A 4IN1A 3DSOA 1W14U 3TU7H 1NY22 3UPEA 4FUJA 4K8YA 3RMMH 4AFUA 2A5IA 3SJKA 4WF8A 4RSPA 2QGRA 4TPIZ 1MD8A 3LT3A 2FIRH 4KTCA 4MPUA 4ZAEA 1TIOA 4FUDA 2XBYA 1BB0B 5EJ1A 1GMCG 5JDUB 1O2MA 1UHBA 5FBIA 3ZZ3A 3F6UH 3S9BA 1GBHA 1GI7B 3BTDE 4MG3A 3A8AA 2GD4B 2R9PA 4YOJA 1JIMA 1C2MA 5GCHG 1COWD 1DM4B 3P8FA 2FI3E 1BDAA 1KXBA 3GY4A 2XWAA 3FP6E 2XBVA 3TIUA 1BBRE 3PV5A 1P01A 1BJVA 5A0BA 2BM2A 1H1BA 3PRBA 1GJCB 1S5SA 3Q77A 1W0ZU 3FN8A 4Y7AA 1Z71A 1FQ3A 1FXYA 3A80A 4YTAA 2SGAA 4B76A 1AB9B 1S81A 5HYOA 1VZQH 4A1VA 1SQTA 2SGFE 4DIHH 1J16A 3PMBB 1TOCB 2ZCLP 1P0SH 1GBAA 1P03A 1GL1A 2J9NA 2ZQ2A 3GY7A 2UWOA 1MMJN 2PUXB 2HLDD 2ZG0H 2VIPA 1MD7A 5GNDA 1BBRH 3FOAA 3M61U 1DOJA 1O3CA 1UHBB 1GL0E 2J98A 1L1GA 2J95A 3KQCA 4U2WA 3E3TA 3N7DA 4XBCA 3OEED 1BOQA 4FVBA 4CR5A 3AVZA 1AD8H 4ZHMU 5CDFE 1KXFA 5DP3A 1ZRBA 1TGBA 2PSYA 3VB6A 1O2QA 3HKJB 1FN6A 3A85A 5HKKD 8GCHG 1SGRE 1UW7A 4XOJA 3BTQE 2F9VA 4Z1MD 1EJMA 2D26C 1PPHE 3LJJA 3H09A 5DP8A 3SJ8A 4BAHB 4WXVA 1KLTA 4D9RA 1IQNA 1C5SA 2BDGA 1N1LA 3K6YA 3M5LA 5F53A 5DK1A 1VGCC 1VCWA 4X1NU 5CHBA 2ZA5A 3H5CB 1S82A 3IWMA 1Y3VA 1ZTJA 1O3MA 1SHHB 1AFQC 2A2XH 2CHAB 1OPHB 1SQAA 3BV9B 2STBE 1E79D 2GJGA 1RFNA 1AUJA 1IQKA 5A8YA 7ESTE 2ANYA 1O3PB 2V7QD 1SSXA 5TJXA 7LPRA 1HAIH 1MU6B 4ABEA 2IN2A 5JBAS 3SUEA 4CR9A 4FVDA 1A61H 3M5MA 4ISNA 3FVFB 3SQEE 1O2SA 3AASA 5ESTE 1MCVA 4RT0A 4AYYB 2BDBA 2BZAA 1BTPA 4AB9A 4QT8C 3TNSA 4AYVB 1GCDA 2CHAC 4A5TS 3SU1A 2TRMA 5DG6A 1KDQB 3QGNB 5BRRE 1TGNA 2ZFRH 3STIA 5B6LA 1QTFA 1J15A 4BTTB 3ZVFA 3LONA 4FETA 1AFQB 5FL7D 1FUJA 2J2UA 4J2YB 1FMGA 2B0FA 1ZMNA 3SV9A 5HM2A 1JBUH 1YCPK 1FN8A 1G3CA 1AN1E 5I46H 1MTUA 1QBNA 1PPCE 4Y0YE 1FPCH 4DW2U 2BXUH 4MQAA 5E0GA 3MH5A 1FAKH 2KCOA 2OLGA 4OS1A 3RM0H 2BVSH 3DHKH 1D9IA 1EOJA 2HNTE 4F49A 1DXPA 5DN6D 3SU2A 1TNGA 3ZZ8A 3N99A 2Y82A 4U32A 4YOIA 2KX4A 4BTUB 4RI0A 5EPNA 3K6ZA 1D6WA 1YKTA 2YNBA 1K1LA 1WUNH 2BLVA 4INLA 2ZPRA 1A46H 1QL9A 3PO1B 1SGIB 4WWYA 2FX4A 3C27B 2WYJA 1FY3A 5A2MH 3MH4A 4X2XA 3PMJA 2BDHA 1NU9A 2GT7A 3NWUA 1NBME 1ZZZA 4YM9A 1AUTC 5EW1H 3UIRA 6ESTA 1CVWH 5HIZA 2FOGA 2ZGCA 4GCHG 1UTQA 1GJ8B 4OGXA 3A8BA 2TGDA 2G81E 2VWMA 2A7JA 1NZQH 3ENSB 3UFAA 1D3TB 1BZXE 1LDTT 2FOMB 2V0BA 1B7XB 2AIQA 2YMSB 1O2WA 1NRNH 1HAOH 4Z6AH 2YNAA 3SV8A 1ZHPA 1UJ1A 3HATH 1GG6B 2B8OH 3TLOA 3LOXA 3PB1E 1TPSA 2BVXH 4KTSA 3ZV8A 1BUIA 3U8OH 4X1RU 1FY5A 1EPTB 3BTME 1Q31A 3MO3A 1THPB 2FZZA 1PPFE 3JZ1B 1C1MA 1QGFA 3ZVAA 4DGJA 3VB5A 1BMNH 2GZ8A 1A0LA 2XBXA 3QK1A 4YLQH 1LKBA 3TGIE 4ZKOU 2HRVA 5JYIA 1OYQA 2GKVE 2B7DH 1N8OC 2A5AA 2AEIH 5JBCS 1UVPA 3VPKA 4MNXA 4YT6H 2A32A 1WAYB 4AOQA 3SNEA 4AFZA 1A0HB 1G3DA 4H4FA 1V2TT 1HAHH 1NRSH 1IQEA 2Y5FA 4CHAC 1TWXB 1ESTA 3KF2A 4FUFA 1PFXC 1TA2A 2ZPQA 1T8NA 3OY6U 2FOFA 4D9QA 1ZHRA 3EE0B 5C1UA 3UOUA 1O2UA 1ETRH 4NFEA 5F8ZA 3U8RH 1O3IA 5EQRA 4ACBA 1Q3XA 3IITA 4I8KA 3SHCH 1F5KU 4FUGA 2ZDKA 2W6ID 3RXSA 2ZPSA 3UNRA 1ANBA 1EAXA 3L3TA 1WXRA 1O36A 1V2PT 4FUCA 4B74A 1SGTA 1GHAF 1BRUP 1ZGVA 2RA3A 3CS7A 1TPOA 4Y10E 1HV7A 1H9IE 1F5RA 2RG3A 2C93B 1HCGA 1LQEA 3ELAH 1AU8A 1NTPA 5C17A 1FIZA 3LDXH 2P94A 2LIZA 1YP9A 3RLYH 2EI8A 2BD8A 1HAZB 1P10A 1T31A 4A1XA 1T4UH 3ZVEA 3A89A 4JZ1A 4X1QU 2PFEA 1CO7E 2V6NA 2J92A 3TNTA 4ZKNU 3E0NB 1BTUA 1BTXA 1MTWA 3TH2H 2BDAA 4BTIB 1W11U 2FP7B 4B2BA 3PV4A 3F3BA 1HAXB 3PWCA 4ABGA 5CHAC 1FY4A 1RIWB 2PWXA 4A1TA 1O3LA 4FU9A 5F6MA 2ZU1A 1DDJA 3A7YA 2GCTC 1DWDH 3BTWE 3U9AH 1SKYE 1OXGA 4JK5A 2GMTC 4M9FA 2A4QA 2CXVA 1AFEH 5SGAE 3FP8E 2BY8X 2WPMS 2IPHA 1UO6A 1EAWA 2QXIA 3MH6A 4K1EA 1DX5M 1C5XB 3PM3A 1SLXB 1YYY1 2BY6X 2F9BH 1DY8A 1P06A 1G2LA 3CP7A 1O34A 2BQWB 2A4RA 4WXIA 1CQQA 1GHAG 4DVAU 1NPMA 1IOEA 2K8IA 1ZLRA 3EDXB 2BLQA 4ABJA 1QJ6B 4M7GA 3TK5A 9LPRA 5F8TA 1MUEB 3PYHA 4I8HA 2Y81A 1SOZA 1YC0A 2A7CA 2Z7FE 3F2HA 5I25A 1TAWA 1GJBB 1SVPA 1GI0A 1ELAA 3GYLB 3RXRA 4JZEH 1MBMA 1A3EH 4AN7A 1D3PB 3BEUA 3GICB 3V3MA 1TNLA 1HBTH 5C2ZA 1C1VH 3RXJA 2A5KA 1GMDG 2VH0A 1GBBA 2K1QA 4VGCC 3PTBA 1NN6A 2RDLA 1QL7A 2R3UA 3NK8A 3DCLA 2BB4A 1FV9A 1BITA 4ISHH 3SN8A 5GWZA 1BRCE 3A7TA 1GJ4H 4NFFA 2FWWA 5A0AE 1AE8H 2OXSA 3GDVA 1OWHA 3BTEE 4B2CA 5DKMA 1RD3B 2W26A 4I33A 5FCKA 1OWKA 1ELDE 2ZU5A 4E06H 1SQRA 3OSYA 4Y6DA 1ANCA 1SLWB 3RU4T 3TH4H 3RMNH 1MKWK 1L0ZA 1TPPA 3RXLA 5FPTA 3PLBA 3U98H 3RU4D 2PKSB 4Q63A 1EZSC 3UB0A 1MTNC 4WY3A 4AORA 2JJ1D 1HJAC 1GCTC 1GVZA 1LHEH 1T4VH 3TK6A 2O8WA 2XXLA 2GDDA 1ANEA 1P2QA 8LPRA 4ZH8A 1BTHH 1K1NA 1SLUB 1MZAA 1EAIA 2WHXA 5DGJA 3BEFB 4SGAE 1ABIH 3A8DA 2C8XB 2F9OA 3UAIC 2PKSC 1QR3E 2AMQA 1FLEE 3QO6A 1CT4E 4ABFA 2ZC9H 1OS8A 2KZ4A 1IHSH 2JH0D 3SV6A 3A88A 4B2AA 2A1DB 4I86A 4Y7BA 2Z6BD 1HJAB 3BG4B 1EX3A 2QF0A 1UK3A 1JIRA 1C1QA 3T62A 4H6SB 1B0EA 1V2MT 2GX4A 1V2VT 2VIOA 3RXOA 4JCNA 4NWKA 1JWTA 2P3FH 3SYJA 1OWDA 1O5GH 4IGDA 1LO6A 3WW7A 1SGFA 1G30B 1CGIE 1OKXA 1QCPA 4CBNA 1GBFA 2FODA 1QJ1B 2P3UB 1FDPA 1LMWB 3FAOA 3E90B 1YPJH 5IYTA 4B1TA 3M3TA 3F0PA 5EJZA 1W13U 2QCYA 1C1WH 1EAUA 2PSXA 4HZHA 3W95A 3PMAB 4AC9A 4TY6A 5DP5A 1S0RA 3A87A 5CHAB 3GY6A 3BG4C 2M5TA 4Q80A 1Z8RA 1MAYA 1HAVA 1A5IA 1DE7H 4ZHLU 2BDYA 1SQOA 1Z8GA 2ZEBA 5JBBS 1KY9A 1XMNB 6GCHF 3WWBA 5H4IB 3RC6A 2ZDVH 3E1XB 1HUTH 8GCHF 2FI5E 4U30A 5IK2D 3S9CA 3S0NA 2THFB 1O5DH 1MQ6A 2LP6A 3EQ0H 2NU3E 3E6PH 1NFXA 2GP9B 3TPIZ 4YLUA 3BIVH 3SGQE 1DS2E 1ELTA 4O9VA 1MTVA 1UCYE 1LPGB 1C9PA 1GHXH 2H9TH 1BHXB 4X1SU 3T28A 5EGMA 3O8DA 4DT7B 2VINA 3BTTE 3SHAH 2NU4E 2BMGB 2ZFQH 3LH1A 3KQBA 4NA7A 1GJ9B 2AERH 4IMZA 2PUQH 2QF3A 1O37A 3LGVA 3LKWA 1UVUH 2BY7X 1SGCA 2BD5A 7GCHF 3SO3A 5GPIB 2P8OB 5HMAA 2L74A 2KR7A 2F9UA 1O2KA 3ATWA 1T7CA 4ISLA 1XVOA 2C90B 2ZDMA 2RA0A 1SPJA 4PROA 3ZYDA 3FKSD 3MFJA 1V2WT 4VGCB 4BAKB 4JMYA 4Q4LA 1TB6H 2F43B 2XC4A 3K65B 3RXIA 1E1QD 2VWOA 4CH8B 1QIXB 1INCA 3RXBA 2OBOA 1BTZA 2Q6DA 2PV9B 1HJ9A 2OC7A 1P2MA 1P3CA 4DG4A 3VB7A 5T3HA 2BD9A 4XBDA 2QXGA 1T8OA 2JETC 3U8TH 2IJOB 2R2WU 3M7UA 2WSSD 2EEKA 4LZ1H 4ISIH 3BEIB 3LJOA 4X0WU 2VVCA 1H9LB 1GI1A 3BN9A 1GI4A 2D1JA 3GCNA 1O5AB 3GDUA 2K7XA 1LPKB 4P02A 1H9HE 2ZTXA 2ANKH 1DLKB 2TGTA 3ZVGA 4B71A 4IS5A 3LGIA 2PR3A 3ODDA 4NG9H 2FOEA 2ILNA 2YMSC 2PHBA 1CU1A 3M7QA 4F48B 1FPHH 4DIIH 2F3CE 3O8BA 1GBCA 1O3BA 1IHTH 3BF6H 3GCTG 1DWCH 3K2UA 2GTBA 1EZXC 2FOHA 1SFQB 2G4UA 4GCHF 2WPKS 1C4Y2 5HGGA 4ZKSU 5JB8S 1NFYA 3MMGA 2UUJB 1C5UA 2Q6FA 5T1VA 2XCNA 5EW2H 2BQ6B 2VBCA 4H42U 2LPRA 2Z9GA 3NUMA 1HAGE 5E8EH 5DO4H 5HXFA 3GOVB 1G2MA 3I78A 2ASUB 1O2OA 2HNTC 3E16B 3SUGA 1GBKA 1AY6H 3F9HA 3ZZ5A 4OM9A 1P2KA 1QURH 2CV3A 2J98B 2OC8A 1DANH 4AGKA 2V3MA 1GI6A 2ZU3A 1GDQA 3UQOA 3GISB 4ACAA 4WH6A 1GVKB 1Y59T 3TGKE 1QB1A 2BDIA 4BOHA 4LZ4B 2C4FH 1O3KA 1MAXA 4IBLH 1K9OE 1RXPA 4KTUA 1O32A 1BMFD 1C5RA 2VIVA 3OE7D 4O03A 1LTOA 4X6NA 3RXVA 1LQDB 1OX1A 4ZMAH 3LC3A 1S83A 5GIBA 2HVXA 3U1IB 3KNXA 1PPBH 2P8OC 1UTPA 1LHGH 1L1JA 1H8IH 1NFWA 4O3UA 2W3IA 3JZ2B 1M9UA 2G5VA 3M36A 4NZQA 5FXLA 1TOMH 1HB0B 2XBWA 1W0YH 2IOTA 1Z8IB 3TJVA 2SGPE 1EATA 1Z8JB 1T8MA 2OD3B 4LXBH 3STJA 1P2OA 1UK2A 2QV1A 5DPAA 5FX5A 2TBSA 2B5TB 1C5WB 4ASHA 4D7GA 1ARBA 1BMAA 1GJAB 4HTCH 3D62A 4ABDA 2NU0E 3SI3H 3V7TA 3SGBE 3A83A 3MU8A 2ANMH 2JETB 4LK4A 1PYTC 2F83A 1P12E 3R0FA 4UE7H 3ZZAA 3ATIA 3GS9A 1GHVH 1RTLA 2QY0B 2FDAA 3AK5A 1BQYA 3TGJE 4K69A 5JBTA 2H9EH 2ZHWH 3QWCH 5DP4A 3EA9A 1V2NT 1BMMH 5E2OA 3VXEH 2BOKA 3RMOH 5TCAA 1P02A 4X8SH 1SGNE 3MH7A 1O3NA 5FCRA 3F9FA 4ZROA 1W0KD 5KGOA 1ORFA 1RJXB 3VXFH 2OUAA 1CA0C 1LCYA 2UWPA 1GDUA 1PPZA 1ESBA 2VWNA 1S85A 1TMTH 1O2VA 3PLPA 1FI8A 5EQSA 3E91A 1KXCA 4IN2A 5EXLA 2P3TB 2BHGA 2J97A 3TK9A 2G00A 1A0JA 3M5NA 1P57B 2CF8H 2VIQA 1O2GH 1CT0E 1ZJDA 1LVMA 2W6JD 1C2DA 1ZPBA 3P8NA 1OP2A 1ELFA 2FYRA 1O2XA 1QNJA 3PWBA 2ZP0H 2ZNKH 5AFYH 1S0QA 1RS0A 2UUYA 2ZGJA 2ALVA 3PROA 2XNDD 2FPZA 3T29A 3LGTA 1UTOA 1XUFA 2J94A 4AX9H 1YPGH 1V2OT 3NRLA 4INKA 1TNHA 6CHAB 3OYPA 4ZKRU 4FUHA 1V2ST 1HYLA 1PPGE 2WPDD 4A6LA 1E38B 4NCYA 1P09A 2L6OA 1AE5A 4HG6A 2JIZD 1E35B 3BG8A 3QGJA 3RDZA 1ZHMA 4FU8A 2BXTH 3MU0A 2OCVB 1O3DA 3KIDU 4Y8XA 4XFQA 1TBZH 3N7EA 4HFPB 1FZZA 1AKSA 2GVFA 3FO8D 1OSSA 2ANWA 1TNIA 1O5FH 1V3XA 2ZECA 4FOUC 5J4QA 5GCHF 5ABWA 1QBOA 2VWLA 1AQ7A 4YESB 5A09A 2GCHF 4Y0ZE 1GBMA 1EJAA 1EOLA 3A84A 1CA8B 4NSVA 2FS9A 2QIQA 3HK3B 5A8XA 1SGQE 3S9AA 1AIXH 1CBWC 1BA8B 1GMHF 4Y11E 1C2FA 3BTKE 1OYTH 3L6PA 4CRDA 1ZOMA 4BXWA 1DICA 1L4ZA 4NSYA 3ZVCA 2EY4C 1ELBA 2FM2A 3PRDA 5GJ4B 2J38A 4MPWA 2Z9LA 4X6MA 1KSNA 1E0FD 1AMHA 3DA9B 3GY8A 2VGCC 3Q00A 4NA8A 4CRGA 2SFAA 3Q3XA 4K1SA 1NBMD 2R0LA 4UONA 2GDEH 1TONA 1K22H 2J4IA 4DCDA 4MTBA 5A0CA 1LKAA 5C0UA 1V2RT 2KM0A 1TBRH 1J17T 1UVOA 2UUKB 2O9QA 3M3VA 5LH8A 2Y7ZA 3ZVDA 2HVYB 1C2GA 2QAAA 1BBRK 3GY3A 3T27A 3MHWU 1N8OB 1Y3UA 3LC5A 2QXHA 1YM0A 1A2CH 1WBGB 4IW4E 4B6EA 1H8ED 2BY5X 1BCUH 4F55A 2GZ7A 2GGVB 1GBDA 3B23B 1KIGH 1WSSH 3RXKA 1MZDA 1AZ8A 1OHHD 4O3TA 1DY9A 1CGHA 1W3CA 1YCPM 2H1UA 4Y71A 1K1MA 1NRRH 3KQDA 1DSUA 4TY7A 3SOSA 3SW2B 3ZZ4A 3ZZ9A 4BXSA 1TQ7B 3WY8A 4P00A 2AGIX 3F1SB 1ETTH 1UVTH 4RKOB 3V12A 1S6HA 1NROH 1YPMH 5FBEA 3RXFA 2HLCA 3T2NA 1AB9C 2GZ9A 1SBWA 3URDA 1ZYOA 5E0JA 1GI9B 5EXNA 2P93A 2FMJA 1PQAA 2HPQH 4Q2KA 4FUEA 3URCA 2TGAA 3KYFA 3Q3KA 1V2UT 5GXPA 4E7NA 1UMAH 1IQJA 1TRMA 3A7VA 2FX6A 2QXJA 2P16A 3QZRA 1BRBE 1O2LA 4MPVA 4NGAH 5FAHA 1GHBF 3MOCA 2BLWA 1YLNA 1JRSA 2V3OH 4K2YA 4K60A 1GDNA 4Y8ZA 4DOQA 4BAMB 2ZGHA 5E2PA 3H7OA 5EOKA 3SNDA 1AO5A 1PJPA 1VJ9U 1FJSA 3DFLA 3UWJH 5LGOA 3O8CA 2WPIS 1GHWH 1MCTA 1J9CH 1CT2E 1J14A 1K1IA 1WV7H 3RP2A 3VFEA 1CHOF 2AFQB 1PQ5A 4CBOA 1HNEE 1TE0A 1DWBH 1CGJE 2TPIZ 1C2EA 3M3SA 2R3YA 3HGNA 1KLIH 3AW0A 4MNYA 4R0IA 1O3EA 1YF4A 2NWNA 3HK6B 1OOKB 4KKDA 1LVYA 3LGUA 5L6NH 1NESE 2PTNA 1F2SE 1YLDA 2FLRH 1AHTH 4YXWD 1E36B 3PMHB 1Y3WA 2ZGXH 1GPZA 1K28D 1L1NA 2OC0A 5FPSA 1OWIA 5EIYA 1O2TA 3ESTA 4HGCA 2XYAA 4THNH 2G55A 3RUOA 1UTMA 1Y5BT 4DY7B 1P11E 4ABAA 4MDSA 3QTOH 5TCCA 2Z3DA 4B6FA 1Y8TA 1SHYA 5EU8A 2KAIB 2K0QA 4MVNA 5HIYA 1GMDF 3RXAA 5DSFA 1EUFA 2PGBB 3ATLA 4AFSA 1QA0A 2ZHEH 1WQSA 3KYGA 1O3JA 3P95A 1TX6A 1TGTA 2G8TA 3OY5U 5IDKA 1D3DB 1IAUA 4UFGH 2XC0A 1PPEE 1W7GH 4I8GA 2ZDLA 3UNQA 4CRAA 4A7IB 2FEQH 2Z3CA 3SU4A 3D23A 1KTSB 3LIWA 4D7FA 5JB9S 1C1PA 4ZXXH 1GBLA 2AGGX 1ANDA 1CSOE 4K8BA 1IQFA 3RXPA 3OU0A 1GHZA 1VITH 1KXEA 3AAUA 2G52A 3GCHB 4XSKU 3M37A 1DUAA 2OTVA 2QN5T 4JYTA 2FESH 2PKAA 2JH5D 2ZZUH 1QBVH 2ZIQH 4WVPE 1EZQA 1D4PB 3SV2H 2KCPA 2W5EA 3SUFA 1EPTA 1WOFA 4MNWA 1O5EH 1SLVB 1TNKA 2NU1E 1PYTD 2OQ5A 1SMFE 2FOAA 2RCEA 4GUXA 4YZUA 2FTMA 1ZTLA 3S69A 2H9HA 2ZFFH 2KCAA 1DXWA 4NA9H 1GI8B 4ZUHA 1W0JD 1YGCH 3ZV9A 3S7HB 4TWWA 1V6DA 1MU8B 5EODA 1O2NA 4NZLA 3W94A 1AWFH 2GV7A 2IPQX 3RLWH 2C8YB 1GHBG 4TPYA 1O5BB 2PTCE 1HGTH 1FONA 1QB6A 3VG8A 1Z6JH 3FANA 2A31A 1RGQA 2BQ7B 1BMLA 2QF4A 3RC4A 3GDSA 4TSFD 5G4BA 1K1OA 2F9PA 1O3FA 2QE7D 1MTNB 5C3NA 4B75A 1YBWA 2ZHFH 5T6FA 4NIVA 3TH3H 3VB4A 1LVBA 1TNJA 2AIPA 4IMQA 1CHOG 2A0QB 1O3OA 1TA6A 2CMYA 3TJUA 2HPPH 1T32A 2FO9A 3U69H 1G9IE 1YY3A 3CENA 1JOUB 3A8CA 1A1RA 1W10U 8ESTE 2QYIA 1EKBB 1L4DA 2ZCKP 4XD7D 1MBQA 5FHTA 2LNCA 4ABIA 2JH6D 1G32B 6LPRA 1X7AC 4BNRA 2SNVA 1GBIA 1QRWA 3MNSA 2ODQA 1HXFH 2ZQ1A 3GYMA 4CRBA 1CHGA 1CA0B 1GBTA 3LU9B 2FLBH 1K1PA 1TYNA 2XNIA 5AVDA 3MU4A 1EB1H 2HALA 2H5CA 2HGTH 1Z1JA 2G5NA 4MNVA 3RU4E 2O8MA 1AWHB 4UEHH 1TBQH 2AMDA 2ZU4A 2BTCE 1C5PA 4WMEA 1CE5A 3I29A 1TGCA 2Y7XA 1ZMJA 1N6YA 1O3AA 3KQ5A 2YMSD 3QLPH 1L2EA 3MYWA 3RXDA 4ISOA 1IQHA 2O8LA 1XXDA 2ODPA 3F9GA 1P2NA 3TJNA 4AZ2B 3UY9A 2VVVA 3A82A 3LGYA 4NIYA 2W7UA 2Z9IA 1UTNA 3F2GA 1DLEA 3BSQA 2Z94A 1S6LA 2H5DA 4MPXA 5LPEA 3LGWA 1HJ8A 1Z6EA 3GY5A 3AAVA 1C2JA 3ZZDA 3OX7U 1TX8A 2VU8E 2Y80A 4JZIA 5B6OA 3RXUA 1XKAC 1C5LH 4UFDH 1OP8A 2JKHA 1QQUA 3P6ZB 7KMEH 4XBBA 3MNCA 3VB3A 3BIUH 1HXEH 3EGKH 3A7ZA 2PLXA 1HPGA 1NS3A 2BYAX 2OP9A 1TGSZ 2VVUA 1QFKH 1O31A 2XW9A 1C2KA 2RDEA 1MKWH 1SC8U 1Y3YA 1XUKA 2FXRA 1GGDC 3EA7A 1NRQH 3A81A 1C1NA 3DD2H 1DFPA 4XRNA 4IC5A 4HI3A 4I7YH 2BVRH 1K0HA 2HOBA 4IC6A 3RXGA 1YCPH 1VR1H 4GPGA 5C5NA 1H8DH 1YPHC 2C3SA 2F9NA 1E37B 1TALA 4X2YA 1WTHD 1ZR0A 3MU5A 4TT3D 3UUZA 5J4SA 2WPHS 2AH4X 4J1YA 1BTYA 1ZTKA 1WU1A 2HWLB 4ASUD
chains in the Genus database with same CATH topology
1SFIA 3M7TA 2Y5GA 1SB1H 2QA9E 1ABJH 1RTKA 1DITH 1K2I1 1GVLA 1QRZA 2PKAB 1SGPE 4I31A 4CREA 1DSTA 1GI5A 3SZNA 5JPMH 3MTYA 4YO9A 1GI2A 1RRKA 1AVWA 2PGQB 5T6GA 1C5OH 3SGAE 1SL3A 2ZDNA 1TABE 2PW8H 1GGDB 1FAXA 4KP0A 2XTTB 2F91A 1C4V2 3IG6B 5L2YH 1XX9A 5A8ZA 1TMBH 5C1XA 4BAQB 1EPTC 2ZU2A 1MKXH 2I6SA 3N7OA 1GCTB 1LVOA 1OWJA 2A2QH 1V2QT 3S7KB 3GCTF 2Z3EA 2EA3A 1TFXA 1AGJA 1QJ7B 1UCYH 4FXGH 1ESAA 1YPHE 1Y5AT 5T6DA 1D3QB 4I8LA 1E34B 2BD3A 3FZZA 4AG2A 1GBJA 1O2JA 3K9XB 1EXFA 1THRH 1TMUH 3PO1C 1IQLA 1O3GA 1P2IA 4D76A 5AF9H 3BTFE 1C1UH 3RXHA 1NO9H 4WH8A 1LHFH 4OGYA 2QC2A 3BTHE 5F8XA 3ZZ7A 3RXCA 1T8LA 1DWEH 5BPEA 2ULLA 1HAYB 5HM9A 1GI3A 1TLDA 2I6QA 1F0UA 3VEQB 1WCZA 3P70B 1FY8E 1UVSH 2BX4A 1HAVB 1KTTB 2VNTA 2FOBA 2Y6TA 2P59A 5EPYA 4DJZB 4Y79A 1JXPA 5L2ZH 4ABBA 2WINI 5C67A 3ZZCA 1G37A 4O97A 3EAJA 3FZDA 1C9TA 1A5HA 3RXEA 3TITA 1MQ5A 2BDCA 2W3KA 1ELGA 1HLTH 3RC5A 2G4TA 4JZDH 2VIWA 1TRYA 2OINA 1O2PA 3KGPA 1W2KH 4JK6A 4ESTE 1DVAH 1ZPZA 3MWIU 3MNXA 4Y8YA 1ZSJA 1H4WA 1SGFG 2A45B 3A7WA 1F5LA 4KELA 3QDZB 3NKKA 3SBKA 3PLKA 1O2RA 1IQGA 1C2LA 3QUMP 1IQIA 2BX3A 2GT8A 1GMCF 2SNWA 4R8TB 8KME2 1F0RA 2EC9H 3KHVA 2FYQA 1KLJH 1VCQA 1ELCA 3SJIA 1Y3XA 4Z0KA 2J34A 1QY6A 3FP7E 3Q3YA 4U01A 2DUCA 2G51A 1JMOH 2UWLA 1VCPA 1EB2A 1C5QA 2BD2A 4TWYA 1KXDA 4INHA 3SU0A 3ZZBA 2XWBI 1BRAA 3KQEA 1U6QA 3ITIA 3E8LA 1UTKA 3DT0H 1BJUA 2A4GA 4X2WA 1N6XA 4UD9H 1YPKH 1S84A 3UWIA 2BLOA 4B73A 3ODFA 1GJ7B 1QHRB 3NXPA 4F4OC 1A7SA 3ZYEA 2O8TA 1C4U2 3MI4A 3V13A 2WV5A 3H7TA 1SOTA 1SR5C 2HNTF 3SU6A 1B5GH 2SGDE 1QRXA 1O2IA 2AMPA 2BZ6H 4MLFB 1O38A 5LPFA 1C5MD 4X8TH 4A92A 4K1TA 1ELVA 2ALPA 3A7XA 4X8UH 3UREA 2Q6GA 1THSH 4XE4A 4ZXYH 1GBEA 4JYUH 2VH6A 1C5NH 2ZFTA 2WYGA 2XC5A 2VB0A 2YOLA 1AZZA 3KN2A 2ZKSA 1NFUA 4BAOB 1GG6C 4SGBE 3D49H 4H6TA 1ZGIA 5ESBA 3EBNA 4FU7A 1P2JA 3RXMA 3SQHE 1BTWA 4XDEA 1Q2WA 1LHDH 3RXQA 2ZGBH 2TIOA 1MH0A 2DE8A 1GMHG 1O39A 5C1YA 1TPAE 3TVJB 4OS6A 2ZWLH 4X1PU 3T25A 1W8BH 3KL6A 1P9SA 1K21H 4Q7YA 1G3EA 2W7SA 1RTFB 4CHAB 1WYKA 2NU2E 5FPYA 3HPTB 3P8GA 4NIWA 1C1OA 2CGAA 2ZTZA 1FY1A 4K3JA 4CH2B 5DP9A 1NT1A 4ZHAA 2BD7A 1KDQA 3SU3A 1ACBE 2CJIA 1QB9A 2KAIA 1HIAA 4Q7XA 3B9FH 3GCHC 3SNBA 1ID5H 2Y5HA 1V2LT 5LPRA 2GMTB 5AHGH 1UK4A 2WUBA 1SG8B 3UTUH 4OS7A 4UFEH 5K0HA 2BY9X 4TYDA 3HGPA 3D65E 1P3EA 4Y76A 3B8JA 4OS2A 1WTGH 1P05A 1XXFA 2Q1JA 1C2IA 3SORA 4K5ZA 3UOPA 3AW1A 2AGEX 3EYDA 3SU5A 1TX7A 1V2JT 1P9UA 1ZSLA 1EP5A 7GCHG 1XVMA 1ZRKA 3E0PB 3OTJE 1NC6A 4I8JA 2UUFB 3V0XA 4JYVH 1C5VA 4KGAA 1TRNA 2A7HA 3KCGH 1TQ0B 1GJ5H 2VJ1A 5AFZH 3NPSA 2AS9A 1J8AA 1LHCH 6CHAC 3P8OA 1AI8H 4BANB 4UDWH 4AG1A 1O35A 2ZCHP 1O2HA 1Z7KA 3U1JB 2EI6A 1AVXA 4CRCA 4YT7H 2OC1A 5CE1A 4OS5A 1XM1A 1EASA 5FX6A 1BHXF 1YPLH 1Z1IA 2OBQA 3P92A 3QN7A 2B9LA 3RMLH 4WMDA 1O2ZA 5L30H 1FIWA 1ZJKA 2FOCA 4GHTA 2WUCA 1SGEE 4FUIA 3RXTA 1O3HA 2ZFSA 1CBWB 3UQVA 1C5ZB 2AYWA 4CRFA 4AB8A 3A86A 3GCOA 2BOHB 1NM6A 4GHQA 3ZZ6A 1MKXK 4UFFH 2ZHDA 1HFDA 1YPEH 1NRPH 1PQ8A 1ZSKA 4X2VA 2WV4A 1KYNA 3SNCA 1SGYE 1VITF 5EG4A 1C2HA 1Y5UT 3Q76A 1KXAA 3T26A 3SUDA 3ATKA 2C8ZB 1DUEA 3CS0A 3T5FH 2C8WB 1SI5H 3C1KA 4X6PA 1EP6A 4GAWA 5EQQA 3SV7A 1GJDB 2ZO3H 1QL8A 4YOGA 1F0TA 1W12U 2ZI2H 3F9EA 3MO9A 3ZVBA 1GWAA 3O8RA 1G3BA 2XCFA 3HKIB 3NCLA 3UR6A 1A5GH 1O30A 1SGDE 3RM2H 5DJ7A 2BD4A 2OQUA 2VIDA 2CF9H 1O2YA 3TJOA 1F0SA 1OWEA 5PTPA 5C5OA 3SNAA 1O33A 4JZFH 2R0KA 1QQ4A 1C1RA 3LH3A 1P8VC 4GVUA 2ODYB 3VGCC 1F92A 2XRCA 1VGCB 2WPLS 9ESTA 2D2DA 3F68H 3P17H 4RN6A 3FFGA 4E05H 1IQMA 2ZF0H 2H2ZA 3GY2A 2SGQE 3DFJA 1W7XH 4NWLA 3NZIA 1WQVH 4X6OA 2A4OA 2WPJS 3MNBA 5E0HA 1A3BH 3L33A 2GCHG 1FNIA 1VJAU 2GV6A 1XUJA 2EI7A 1XKBC 4LOYH 3UR9A 1JRTA 1EZUC 4WJG2 3VGCB 1C1SA 1ETSH 1F7ZA 3SJ9A 2ESTE 1XUHA 3I77A 1ARCA 3MO6A 1AKSB 2FI4E 3ATMA 4ABHA 3MU1A 4RKJB 1BIOA 2H6MA 1C5YB 2R2MB 5C20A 1GHYH 2ZTYA 2O8UA 1ELEE 1HRTH 1AVGH 1XUGA 1ZMLA 4D8NA 4DURA 4Q7ZA 6GCHG 1BT7A 1GJ6A 1K1JA 3SI4H 1EQ9A 3QTVH 3LPRA 5DP7A 1NU7B 2CN0H 3KEEA 2V3HH 1B0FA 3M35A 5EXMA 2TGPZ 1UCYK 1EJNA 1G36A 1O0DH 1XUIA 3EA8A 1QA7A 1UTLM 3QZQA 3DUXH 1DT2A 5GDSH 1UTJA 1HDTH 2STAE 5F03A 4I32A 2DE9A 4WMFA 4NIXA 2D8WA 2V35A 5K7RA 1C5TA 3UNSA 1DPOA 1LPZB 1YLCA 1OP0A 3M5OA 2Z9KA 2FTLE 5CMXH 5DP6A 1ZPCA 2P95A 4E7RG 4AGJA 1HAPH 4AFQA 2ZDAH 4X8VH 4OS4A 4FUBA 2SGEE 3SJOA 4GLYA 2GCTB 2ZFPH 1VITG 3PTNA 1S6FA 1C1TA 2ZHQH 1PQ7A 1A4WH 1V2KT 3QX5H 1RIWC 3R3GB 2Z9JA 1D6RA 1P04A 1O5CB 2FS8A 3BTGE 2VGCB 5ETXA 4GSOA 1MTSA 1HIAB 3G01A 4IN1A 1W14U 3TU7H 1NY22 3UPEA 4FUJA 4K8YA 3RMMH 4AFUA 2A5IA 3SJKA 4WF8A 4RSPA 2QGRA 4TPIZ 1MD8A 3LT3A 2FIRH 4KTCA 4MPUA 4ZAEA 1TIOA 4FUDA 2XBYA 1BB0B 1GMCG 5JDUB 1O2MA 1UHBA 5FBIA 3ZZ3A 3F6UH 3S9BA 1GBHA 1GI7B 3BTDE 4MG3A 3A8AA 2GD4B 2R9PA 4YOJA 1JIMA 1C2MA 5GCHG 1DM4B 3P8FA 2FI3E 1BDAA 1KXBA 3GY4A 2XWAA 3FP6E 2XBVA 3TIUA 1BBRE 1P01A 1BJVA 5A0BA 2BM2A 1H1BA 1GJCB 1S5SA 3Q77A 1W0ZU 4Y7AA 1Z71A 1FQ3A 1FXYA 3A80A 4YTAA 2SGAA 4B76A 1AB9B 1S81A 5HYOA 1VZQH 4A1VA 1SQTA 2SGFE 4DIHH 1J16A 3PMBB 1TOCB 2ZCLP 1P0SH 1GBAA 1P03A 1GL1A 2J9NA 2ZQ2A 3GY7A 2UWOA 1MMJN 2PUXB 2ZG0H 2VIPA 1MD7A 1BBRH 3M61U 1DOJA 1O3CA 1UHBB 1GL0E 1L1GA 2J95A 3KQCA 4U2WA 3E3TA 4XBCA 1BOQA 4FVBA 4CR5A 3AVZA 1AD8H 4ZHMU 1KXFA 5DP3A 1ZRBA 1TGBA 2PSYA 3VB6A 1O2QA 3HKJB 1FN6A 3A85A 8GCHG 1SGRE 4XOJA 3BTQE 2F9VA 1EJMA 2D26C 1PPHE 3LJJA 5DP8A 3SJ8A 4BAHB 4WXVA 1KLTA 4D9RA 1IQNA 1C5SA 2BDGA 1N1LA 3K6YA 3M5LA 5DK1A 1VGCC 1VCWA 4X1NU 2ZA5A 3H5CB 1S82A 3IWMA 1Y3VA 1ZTJA 1O3MA 1SHHB 1AFQC 2A2XH 2CHAB 1OPHB 1SQAA 3BV9B 2STBE 1RFNA 1AUJA 1IQKA 5A8YA 7ESTE 2ANYA 1O3PB 7LPRA 1SSXA 5TJXA 1HAIH 1MU6B 4ABEA 2IN2A 5JBAS 3SUEA 4CR9A 4FVDA 1A61H 3M5MA 4ISNA 3FVFB 3SQEE 1O2SA 3AASA 5ESTE 1MCVA 4AYYB 2BDBA 2BZAA 1BTPA 4AB9A 4QT8C 3TNSA 4AYVB 1GCDA 2CHAC 4A5TS 3SU1A 2TRMA 5DG6A 1KDQB 3QGNB 5BRRE 1TGNA 2ZFRH 3STIA 1QTFA 1J15A 4BTTB 3ZVFA 3LONA 1AFQB 1FUJA 2J2UA 4J2YB 1FMGA 2B0FA 1ZMNA 3SV9A 5HM2A 1JBUH 1YCPK 1FN8A 1G3CA 1AN1E 5I46H 1MTUA 1QBNA 1PPCE 4Y0YE 1FPCH 4DW2U 2BXUH 4MQAA 5E0GA 3MH5A 1FAKH 2OLGA 4OS1A 3RM0H 2BVSH 3DHKH 1D9IA 1EOJA 2HNTE 4F49A 1DXPA 3SU2A 1TNGA 3ZZ8A 2Y82A 4U32A 4YOIA 4BTUB 5EPNA 3K6ZA 1D6WA 1YKTA 2YNBA 1K1LA 1WUNH 2BLVA 4INLA 2ZPRA 1A46H 1QL9A 3PO1B 1SGIB 4WWYA 2FX4A 3C27B 2WYJA 1FY3A 5A2MH 3MH4A 4X2XA 3PMJA 2BDHA 1NU9A 2GT7A 3NWUA 1ZZZA 4YM9A 1AUTC 5EW1H 3UIRA 6ESTA 1CVWH 2FOGA 2ZGCA 4GCHG 1UTQA 1GJ8B 4OGXA 3A8BA 2TGDA 2G81E 2VWMA 2A7JA 1NZQH 3ENSB 3UFAA 1D3TB 1BZXE 1LDTT 2FOMB 2V0BA 1B7XB 2AIQA 1O2WA 1NRNH 1HAOH 4Z6AH 2YNAA 3SV8A 1ZHPA 1UJ1A 3HATH 1GG6B 2B8OH 3TLOA 3LOXA 3PB1E 1TPSA 2BVXH 4KTSA 3ZV8A 1BUIA 3U8OH 4X1RU 1FY5A 1EPTB 3BTME 1Q31A 3MO3A 1THPB 2FZZA 1PPFE 3JZ1B 1C1MA 1QGFA 3ZVAA 4DGJA 3VB5A 1BMNH 2GZ8A 1A0LA 2XBXA 3QK1A 4YLQH 1LKBA 3TGIE 4ZKOU 2HRVA 5JYIA 1OYQA 2GKVE 2B7DH 1N8OC 2A5AA 2AEIH 5JBCS 1UVPA 3VPKA 4MNXA 4YT6H 2A32A 1WAYB 4AOQA 3SNEA 4AFZA 1A0HB 1G3DA 4H4FA 1V2TT 1HAHH 1NRSH 1IQEA 2Y5FA 4CHAC 1TWXB 1ESTA 3KF2A 4FUFA 1PFXC 1TA2A 2ZPQA 1T8NA 3OY6U 2FOFA 4D9QA 1ZHRA 3EE0B 5C1UA 3UOUA 1O2UA 1ETRH 4NFEA 5F8ZA 3U8RH 1O3IA 5EQRA 1Q3XA 3IITA 4I8KA 3SHCH 1F5KU 4FUGA 2ZDKA 3RXSA 2ZPSA 3UNRA 1ANBA 1EAXA 3L3TA 1O36A 1V2PT 4FUCA 4B74A 1SGTA 1GHAF 1BRUP 1ZGVA 2RA3A 3CS7A 1TPOA 4Y10E 1HV7A 1H9IE 1F5RA 2RG3A 2C93B 1HCGA 1LQEA 3ELAH 1AU8A 1NTPA 1FIZA 3LDXH 2P94A 2LIZA 1YP9A 3RLYH 2EI8A 2BD8A 1HAZB 1P10A 1T31A 4A1XA 1T4UH 3ZVEA 3A89A 4JZ1A 4X1QU 2PFEA 1CO7E 2V6NA 2J92A 3TNTA 4ZKNU 3E0NB 1BTUA 1BTXA 1MTWA 3TH2H 2BDAA 4BTIB 1W11U 2FP7B 4B2BA 3PV4A 1HAXB 3PWCA 4ABGA 5CHAC 1FY4A 1RIWB 2PWXA 4A1TA 1O3LA 4FU9A 5F6MA 2ZU1A 1DDJA 3A7YA 2GCTC 1DWDH 3BTWE 3U9AH 1OXGA 4JK5A 2GMTC 2A4QA 2CXVA 1AFEH 5SGAE 3FP8E 2BY8X 2WPMS 2IPHA 1UO6A 1EAWA 2QXIA 3MH6A 4K1EA 1DX5M 1C5XB 3PM3A 1SLXB 1YYY1 2BY6X 2F9BH 1DY8A 1P06A 1G2LA 3CP7A 1O34A 2BQWB 2A4RA 4WXIA 1CQQA 1GHAG 4DVAU 1NPMA 1IOEA 1ZLRA 3EDXB 2BLQA 4ABJA 1QJ6B 4M7GA 3TK5A 9LPRA 5F8TA 1MUEB 3PYHA