4YOIA

Structure of hku4 3clpro bound to non-covalent inhibitor 1a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
molecule tags Hydrolase/hydrolase inhibitor
total genus 91
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yoiA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yoiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yoiA02
4VGCB 3LIWA 2F9PA 4ZKSU 3A7YA 5FPYA 2ILNA 4UFGH 1J17T 1TPAE 2JH6D 2RA0A 1ZR0A 1HRTH 1EKBB 4X2VA 4JZDH 4I33A 1ELGA 2ZGCA 3EGKH 4GPGA 3KIDU 1NN6A 3W94A 2C8XB 1FUJA 1OP2A 2FM2A 1JIRA 2FI5E 1OYTH 3QTVH 1O3HA 5LGOA 3A8DA 3BG8A 3SNAA 1UVOA 4WVPE 1C1WH 2GGVB 3FP8E 1CA0C 3EAJA 1TWXB 3OU0A 3HKIB 1O5EH 3STJA 1BB0B 1PPEE 3ATKA 1Y3XA 1ZJKA 3LGIA 3P8OA 1NRQH 2EI6A 3SNBA 2ZU2A 4JK5A 1QY6A 1RGQA 4TWWA 4UONA 3FAOA 1PPHE 2G00A 2BLWA 4NA7A 3SV8A 1EB2A 1YPEH 1NT1A 5JDUB 1AFEH 1GVLA 2R3YA 4U32A 3D23A 3MNSA 5TJXA 1O3KA 3A8AA 1BTPA 4NGAH 1T31A 1GBAA 2QXIA 4GHQA 2STAE 1GVZA 1V2PT 3GY5A 3PMBB 2A4GA 4B1TA 4Y10E 4Q2KA 5F03A 1O2ZA 2BOHB 4A6LA 1V2OT 2P93A 4BANB 1D3DB 1XUIA 2CJIA 2FESH 3TU7H 2Q6FA 1X7AC 3K2UA 2CMYA 3P8FA 1QCPA 3SW2B 1P2OA 3DHKH 6GCHG 4WMEA 1EJNA 3FP7E 1GI4A 3TGKE 4PROA 1HNEE 1WBGB 1HBTH 5F6MA 1MKXH 1THSH 1GJCB 2R9PA 3LDXH 3IWMA 1IQNA 1SQOA 1PPCE 4DJZB 3PWBA 4ZHMU 1N8OB 1HAGE 1FJSA 1U6QA 2A1DB 4X6NA 1KIGH 5HM9A 1ETSH 4ZROA 1O3DA 1TA6A 1ELCA 1Y3WA 1GHAG 1C5LH 2WPKS 1EZQA 1FN6A 3RXLA 1DM4B 3I77A 2HRVA 4IS5A 4ZUHA 3ZVCA 2PUQH 1GI3A 1T4UH 3F9FA 3GCTG 3V12A 1ZTLA 2GMTB 1B5GH 1W2KH 4A1TA 2OP9A 3SNCA 4X1QU 2VGCC 1QURH 3UTUH 3L33A 3U8TH 3QZRA 4ABBA 1ARCA 4NG9H 5J4QA 3PLKA 1TMBH 4XFQA 3NUMA 3GDUA 1CBWB 1CGHA 1LVYA 2ZFQH 1PPGE 3F1SB 3M37A 2DE9A 2UUFB 1RJXB 4AGKA 1PYTC 2BOKA 1C5MD 2SGAA 3HK6B 4YLUA 1ZRBA 4ISIH 3E91A 2FP7B 2OUAA 2J9NA 3ZZ6A 3URCA 2AH4X 6CHAC 1XVMA 1SGFG 3S9BA 3SO3A 1QJ7B 2F9VA 5T6FA 3O8DA 3VPKA 2PWXA 4B2AA 1G36A 2B0FA 1S83A 2GV7A 4DGJA 1V2NT 1N6YA 2W26A 2ZG0H 3NPSA 4MG3A 1YPGH 2TGDA 2JKHA 1TPPA 1VGCC 3SU1A 1NO9H 1WTHD 2ZI2H 1WUNH 1SQAA 1NFWA 4YOIA 3A86A 1LVMA 4KELA 2FPZA 3GCNA 3SJKA 3DA9B 1HGTH 1P10A 1O2YA 3F9EA 4NZQA 1B0EA 1DT2A 4FVDA 1MH0A 1GJ5H 3WY8A 1GCTC 1UTOA 3RU4D 5FPTA 1OWDA 3U9AH 1EASA 3MU5A 4ABJA 4ABGA 2NWNA 3EQ0H 5CMXH 2PKAB 4Y11E 4BAQB 4AN7A 5C2ZA 3PMJA 1ESBA 1J14A 4UFDH 3DFLA 1DDJA 1UHBB 3TVJB 1OKXA 5EQQA 3EA9A 3H5CB 1A3EH 1LVOA 3PROA 4MVNA 1IQIA 2NU0E 1O3MA 1G3CA 3RXIA 2WUBA 2J92A 2PKSC 4AG1A 1AN1E 2ODPA 1GL1A 2RG3A 1NM6A 4KKDA 3ZVGA 1O31A 5ABWA 4B2BA 1LVBA 1DWDH 4K1EA 4CBNA 4GLYA 1FAXA 1O3CA 1O37A 2IJOB 4LOYH 4WH8A 4JMYA 2GKVE 5DP7A 2TIOA 5LH8A 1GJ8B 2RCEA 4TYDA 1K2I1 1SGRE 3BTKE 3DD2H 2OINA 3MWIU 1O5BB 4Q7YA 1SOZA 1NRSH 2QXGA 1AVXA 3TNTA 2XC0A 2A2QH 3KL6A 1TABE 3SN8A 3LJJA 2BDYA 2J38A 2G55A 3QDZB 1GJ4H 1MCVA 2B5TB 2QC2A 1J15A 2QY0B 1O3PB 3VEQB 4FXGH 3VFEA 2D2DA 1XUHA 2LIZA 3UQOA 5A2MH 2BLOA 3HGPA 5HXFA 3Q3KA 1V2UT 5C5NA 1EAUA 3SGAE 1FPHH 3BIVH 3BG4B 4MPWA 5DGJA 1FV9A 5GPIB 3TIUA 1KTTB 2PR3A 3T28A 1SBWA 2Y7ZA 1S6FA 1WTGH 1SSXA 3MU8A 2F3CE 3GDSA 2FS8A 1GBKA 3T29A 3SJIA 2QF0A 2R0LA 2H5DA 2C3SA 2BQWB 5DK1A 4FUFA 1O5GH 2BDHA 1EP6A 1O2PA 1O2SA 1W11U 1VCWA 1O2MA 2OQ5A 3A7TA 2HGTH 4Z6AH 1ETTH 4JCNA 1QB1A 3P17H 2WUCA 2PTCE 5A8ZA 2JETC 2R3UA 3GY8A 1EP5A 1F92A 3RXJA 1FXYA 1P9UA 4RSPA 2C4FH 1MTUA 1O2RA 4ASHA 4X6OA 3VGCB 1O2GH 2IN2A 2RDLA 2O9QA 3NCLA 1LCYA 4CRDA 1UTMA 1DVAH 5HMAA 3GOVB 4UE7H 3SJOA 1SL3A 3EYDA 2V3OH 1BTXA 3TH3H 2RA3A 3FVFB 1GI8B 4DURA 4AORA 1C5YB 3PMAB 1UTNA 4ZXYH 1KLTA 3M7TA 1P3EA 1AFQC 4D7FA 4IN1A 1P2KA 1E37B 2GVFA 1L4DA 3AAVA 1DSTA 2FOAA 1C2MA 2C8WB 2BLVA 3RXSA 2G5VA 2ANYA 1GI9B 3RXKA 1V2ST 2XCFA 3PB1E 2G4UA 3SI3H 1P2MA 1BCUH 2BD7A 4CRBA 1E36B 1GI2A 2WPJS 1P04A 2UWOA 4B71A 1H9LB 4X1RU 4AFSA 3E3TA 1YPJH 4Y7AA 1C9PA 2R0KA 2ZQ2A 4X2XA 3ZZBA 2Q6DA 4E06H 1JMOH 1AVWA 1GHXH 1Q3XA 2OC7A 3KCGH 3T5FH 2A4QA 2A31A 5FBIA 5EPYA 1HJAB 4VGCC 3LGUA 2Z3DA 4H42U 4A7IB 4FUCA 1A0LA 1D3PB 1A1RA 3GYMA 4BOHA 3BTGE 3M3VA 1MTSA 4OS6A 4YOGA 2CHAC 4XOJA 5DG6A 2BM2A 4NSVA 4A5TS 1XKAC 2ZU3A 2ZDNA 4IGDA 1QHRB 1AE8H 1TGSZ 2LPRA 1B7XB 3U1JB 1C4U2 2ZDVH 1T8MA 2FTLE 2NU4E 5AFYH 5J4SA 2HPPH 1GI7B 3ATIA 1O3OA 3SUDA 3GCOA 2TRMA 8ESTE 2HNTC 2A0QB 2XW9A 5K7RA 1C1VH 1C5SA 3FP6E 1TGTA 1TX7A 5T6GA 3ELAH 5L2YH 1ZZZA 2FZZA 3ZVAA 1DXWA 3O8BA 4D9RA 2ZHDA 1XMNB 1MTNC 1DANH 1GHWH 1QQUA 1DFPA 2H9HA 3SUFA 2C8ZB 1ABIH 2Q6GA 1HCGA 1HXFH 1L1JA 1F5KU 1A5GH 3TJUA 3A81A 1BBRH 1P03A 3DFJA 1C5TA 3ZZ5A 1TQ0B 5DJ7A 3RXEA 1SR5C 3BEFB 2BDBA 3A7ZA 3P8NA 1MBMA 2FXRA 2HNTF 3RMNH 1ANBA 1K1IA 1GHYH 2GCTC 1H9IE 3BTME 4INKA 2XC5A 3MH5A 1FY5A 1XKBC 1THRH 3Q77A 3O8RA 2K7XA 2ALVA 1ESAA 3RMLH 2ZPSA 3UQVA 1GMDG 1HIAB 1Z6JH 4FUEA 4NFFA 3ZVDA 5AF9H 3D49H 4BXSA 5F8XA 4I8JA 2OLGA 2ZFRH 5T3HA 2QIQA 1ID5H 1T7CA 2XC4A 1W12U 1BMMH 3SUEA 1T8NA 2PSYA 4AFQA 4ESTE 1BRBE 5JB9S 2WPHS 2ZTZA 4J1YA 1IHSH 2QXHA 2FI3E 1O32A 3EE0B 5DP5A 4DIHH 1QR3E 3TH2H 1SGDE 1OXGA 4K5ZA 1DPOA 1MZAA 1ELBA 2AIQA 1E0FD 4X0WU 1UVUH 2OC1A 4A1XA 1O3IA 1GJAB 1G30B 3BIUH 5EOKA 5C67A 3VB7A 4X2WA 2A2XH 1TALA 5C5OA 1INCA 1UCYE 1GDQA 1SGFA 2G8TA 2IOTA 2ZA5A 1YC0A 2TPIZ 4XSKU 2AGGX 4MNWA 3UOUA 2A32A 3V3MA 1QBOA 1LPKB 4K69A 2O8MA 1RIWB 1XUFA 3EA7A 2ZU4A 4RKOB 1WYKA 1AB9C 1V2TT 1TGNA 1XXFA 4AB9A 3UWJH 1O30A 1Y8TA 2PW8H 3S9CA 1FIZA 4INLA 3E6PH 1F5LA 1TNLA 1ARBA 1KYNA 4YESB 2BD9A 1JOUB 1ELEE 4CR5A 2FDAA 5E8EH 3SU3A 3T26A 4JZ1A 3UPEA 4XDEA 1H8IH 2VWNA 1CGIE 4AYYB 5JBTA 4ABFA 1J8AA 1G3BA 1W7XH 1L2EA 5GWZA 1ZGIA 3PMHB 1TYNA 2VVUA 2EEKA 1HJ8A 1LHGH 4CH8B 3BTTE 1TBRH 1FMGA 1CGJE 1A0HB 1MUEB 2CGAA 1TBZH 1LHCH 3MI4A 1O2KA 1TFXA 3M36A 2FTMA 3JZ2B 4MNYA 4X8VH 2BY5X 2FLRH 2FOCA 1K9OE 3P8GA 3M7UA 3OY5U 1O2WA 4GCHF 1OWEA 2PTNA 2H9EH 1BRAA 1C1PA 5JBBS 3TGIE 1QRZA 1O2LA 2VWOA 1TE0A 5EW2H 4Q80A 3TJOA 3UY9A 3PWCA 2WPMS 2CXVA 4GCHG 1JXPA 4SGAE 7ESTE 1LDTT 5L30H 1QGFA 1V2WT 4DG4A 1AGJA 1EJAA 3ZVBA 1CA8B 1TRMA 4NZLA 3AASA 1QB6A 3M5OA 5A8XA 2A5KA 3DUXH 3MOCA 1QBVH 1UVPA 4NA8A 3T25A 2BY7X 1FN8A 1P12E 3ZZCA 2LNCA 2Z7FE 2OCVB 1ZMLA 1BTHH 1O2JA 3C27B 1UK4A 3AW1A 1HAYB 1SFQB 3NWUA 6GCHF 3QN7A 3QO6A 1HAZB 3F68H 4NIVA 1O3BA 2M5TA 4BAMB 4X1NU 2J95A 2BD2A 3ZV8A 1HAPH 4KTCA 1TA2A 1MAXA 3UNRA 1M9UA 3BN9A 2QV1A 1LQEA 1VJAU 2ZPRA 3Q00A 4TWYA 2PSXA 1NU7B 3SZNA 1EPTB 2FOGA 1E34B 1Y5UT 3A80A 3MH7A 4WXVA 1QNJA 1G3DA 1FIWA 2FX6A 3MU0A 4F49A 1GHAF 2GCHF 2ZP0H 3D62A 1DY8A 1EZUC 3ZYDA 1DE7H 2GP9B 2P3UB 3RXCA 5EXMA 1D6WA 4I31A 1JRSA 1V2MT 1C2LA 1ZYOA 2UUYA 1PYTD 1F2SE 1GMHF 1F5RA 3GCTF 5JBCS 4Z0KA 2G4TA 1GG6B 2GCHG 4ABIA 1AKSB 5GJ4B 4UEHH 3B8JA 3BG4C 4AG2A 4AB8A 1DS2E 1T8OA 3T62A 1BMLA 4X6MA 4BTIB 1GMHG 1AD8H 1V2LT 1W13U 1SHHB 3LC3A 5JYIA 3F6UH 1C1TA 3SGQE 1JBUH 5JBAS 1B0FA 1MCTA 5C3NA 1SPJA 5DO4H 3URDA 3S0NA 2GX4A 1C2GA 1O3NA 4LZ4B 3LGYA 5DP8A 3ZZ8A 2NU2E 4ISOA 1YPHC 1J9CH 1XXDA 1S0QA 1SGPE 3AAUA 2UWLA 1FY4A 3NKKA 1C2KA 3PLBA 1EAIA 1TPOA 1NFXA 1C5NH 2R2WU 1FDPA 2Y81A 2DE8A 5C1XA 1DXPA 1FQ3A 1IQLA 3TNSA 2G52A 3HK3B 2VIQA 1RTKA 4DIIH 5G4BA 2W5EA 1ESTA 1BUIA 2Y80A 1F0TA 3KQDA 5SGAE 1S6HA 1KXFA 1YCPK 2PGBB 4NSYA 1TB6H 1KLIH 1Z8IB 3ITIA 4ISNA 1YBWA 3GY2A 4NCYA 4KTSA 1BQYA 1GWAA 1TGCA 4MDSA 1MD8A 1N6XA 5EU8A 1AE5A 1XVOA 1EB1H 1C5RA 2FLBH 2P59A 2ZDMA 3O8CA 3KF2A 1K28D 1GGDB 3MO6A 1OSSA 2A7HA 1C5PA 2BY6X 3QZQA 3E90B 1LTOA 5GXPA 1QTFA 1QA7A 2ZQ1A 3LJOA 3H7TA 1A4WH 2ZGHA 4E7RG 4ZMAH 2EC9H 1VJ9U 4WMDA 1ZPCA 2QCYA 1LO6A 5FHTA 4ZH8A 1V2VT 1PQ7A 2P3TB 3RXBA 1HFDA 1V2QT 1P2IA 3ZZDA 4FU8A 3KNXA 3RXDA 2WINI 2B8OH 3GDVA 1GDNA 1ANEA 1CHGA 1K1OA 2QF3A 1ETRH 1EZXC 4DOQA 3ESTA 1CA0B 2AEIH 2VU8E 1AWFH 5EPNA 4Y76A 1KDQA 1XX9A 3OYPA 1Y3YA 2FO9A 1BJUA 1QL9A 3QWCH 4DVAU 3RXRA 4OS1A 3SI4H 4X8TH 2ZDLA 2A5IA 4Y0ZE 5I25A 4ISLA 4Y6DA 5LPRA 2Z3EA 4CRFA 5E0GA 2XBVA 1SLWB 2Z6BD 3GCHC 1SFIA 2GTBA 3STIA 1Z1JA 1NU9A 1HXEH 4WXIA 3SU5A 4JZEH 1RXPA 4H4FA 4YZUA 1XUKA 2FI4E 3RLYH 1WCZA 2ZF0H 1L1NA 1LHDH 1BITA 1H1BA 3SGBE 3M61U 2B7DH 1MKWK 3A84A 3V7TA 1SG8B 5FX6A 3RXAA 4CBOA 2KAIB 4X1PU 1HYLA 1O2UA 3S9AA 1EXFA 3NXPA 1PFXC 1DX5M 1GBHA 1L4ZA 6ESTA 2G51A 4JZIA 1QQ4A 5DPAA 2BDCA 2ZO3H 1A46H 2ZFPH 1P2QA 2ZKSA 1BHXB 5JPMH 3L3TA 2P3FH 2PHBA 1OWIA 3JZ1B 1BTYA 3SV7A 1SGNE 2P8OC 4FUHA 4K8BA 3KHVA 1C2FA 2GV6A 1D9IA 2BVRH 4BAKB 3HKJB 1LQDB 4WY3A 3RXUA 4CHAC 2K1QA 1H8DH 1HV7A 2CF8H 2W3KA 1GMCF 2WV4A 2BHGA 2XBYA 1YKTA 3M5LA 4Q7XA 4R8TB 1NFUA 1XUJA 2F9BH 4KGAA 1AU8A 1DITH 3A85A 3PTNA 1O5AB 2OD3B 1F0UA 1IHTH 3RXHA 1ZLRA 1CT0E 3BF6H 1GMCG 3QGNB 5GDSH 1ANDA 3RM0H 1UVTH 1AUTC 4QT8C 5ESBA 1TAWA 3LGTA 1UK2A 1IQGA 2AMQA 2PFEA 4SGBE 1C5QA 4RKJB 1ZGVA 4J2YB 1GBCA 1SGYE 1GI5A 1RRKA 1PJPA 2ZCHP 2VWLA 4OS4A 1ZJDA 2BD8A 1AVGH 4YO9A 2BX3A 1ELTA 1WSSH 4IC6A 4HFPB 1SB1H 1HUTH 4X2YA 3KGPA 2SNVA 3PLPA 4I8GA 4K1SA 2ZFTA 5CHAB 1WOFA 2WV5A 2PLXA 1EAWA 1OOKB 1JRTA 1C4Y2 3C1KA 3RMMH 3SQHE 1SLXB 3E0PB 3M5NA 1A61H 1TPSA 1HAOH 1ZSKA 2A4RA 1AZZA 3SHCH 3H7OA 3MFJA 4JYVH 1QRWA 4FUBA 1FNIA 3MNCA 4E7NA 3V0XA 3TITA 1RIWC 2VNTA 3BEUA 3N7OA 2GT8A 1VGCB 2ULLA 4ZKOU 2AMDA 1GBMA 2BMGB 1G9IE 2A7CA 3TH4H 3SJ8A 2AGEX 2XNIA 2AS9A 4UFEH 4AGJA 4K60A 2ZCLP 4F4OC 1O5FH 3PV4A 1BTZA 4CREA 1SVPA 1FI8A 2OXSA 3I78A 1EOJA 1YLCA 1J16A 5H4IB 4YLQH 4YT7H 3EBNA 1OS8A 1NS3A 1P2JA 1CVWH 1YCPH 2FIRH 5ESTE 1GJBB 1TNGA 3U98H 5E0HA 1RD3B 3ZV9A 2BD4A 5CE1A 1ZPBA 4IC5A 1SOTA 1S5SA 3RXTA 4ZKRU 2ASUB 2VIVA 2ANWA 1JWTA 3FZZA 1ZMJA 1IQMA 8GCHF 1AHTH 1QJ6B 1TONA 2ZDKA 3T2NA 1F0SA 2XYAA 4CRAA 1ZSLA 3BTHE 2JH5D 2PKSB 2D26C 2BXTH 4RN6A 1W10U 1O2TA 3M35A 1ZOMA 1O2XA 1C9TA 2ZHEH 3K6YA 3VB4A 3BTFE 8GCHG 1NC6A 1ELDE 1YPHE 3LT3A 5LPEA 3ZYEA 1C1UH 4NWLA 1GHBF 5EW1H 1GBLA 1C2EA 1JIMA 4GUXA 4GVUA 4LK4A 1UTQA 2QA9E 1NESE 1FAKH 1KXDA 1NZQH 3ZZAA 3OTJE 1KXEA 3GY3A 4LXBH 3R0FA 5A0CA 3LH3A 1GHBG 3BEIB 2AIPA 2GZ7A 3GICB 2GD4B 3A83A 1V6DA 5EXNA 2ZWLH 4AX9H 1W14U 4Y8XA 2A45B 4Y8YA 3VXFH 2PKAA 2ZHFH 4NA9H 2BZ6H 2J2UA 4FUJA 4K1TA 1P09A 5B6OA 2GZ8A 1GMDF 2ZPQA 4R0IA 2C90B 2OBOA 4YT6H 1C5XB 1O35A 1PPZA 1UHBA 3GY4A 1G3EA 3TPIZ 4DCDA 1QB9A 3TLOA 1BDAA 4ZXXH 3NZIA 5L2ZH 3UREA 1SHYA 1G37A 4BTUB 3P6ZB 1MKWH 4CH2B 1W7GH 3MO3A 1EX3A 1BTWA 4AYVB 2QYIA 3RXVA 1BIOA 3MH4A 4AFUA 1O34A 1VZQH 4D8NA 1LHFH 2H6MA 1CO7E 2FYQA 4OGXA 1WU1A 1DWCH 3PYHA 1DY9A 1P06A 4CRGA 1EATA 2ZHWH 3RXQA 1MU8B 1H9HE 1BA8B 4WF8A 2HLCA 3FFGA 2I6SA 1HB0B 2W7SA 1A7SA 1N8OC 2JETB 3LGWA 3ZZ7A 3SJ9A 5DKMA 3PM3A 2XCNA 3MO9A 4B2CA 2ZU1A 2ALPA 1TNJA 2KAIA 5DP6A 1P3CA 4X8UH 1NROH 1TX6A 1FY3A 3VXEH 1AQ7A 1CU1A 2ZC9H 1HAHH 1UO6A 3RLWH 1BZXE 3ENSB 4B74A 1DUEA 5E2OA 3GISB 5L6NH 1ABJH 3QLPH 1GBEA 2GMTC 5C1UA 3SV2H 3ZZ4A 1YCPM 1WAYB 4X6PA 4IBLH 4BNRA 1NFYA 4BXWA 7GCHF 3Q76A 1HPGA 1A5IA 1YF4A 3ZVFA 3SV9A 2FOBA 2R2MB 1O2NA 1T4VH 4JYTA 1AFQB 1CBWC 2ZDAH 2V0BA 5FX5A 1BBRE 3IITA 3E1XB 3A88A 4YTAA 1MD7A 1ZRKA 7GCHG 2I6QA 2J94A 5HGGA 1CHOG 1C5VA 1UTPA 2XBXA 1A0JA 3ATLA 8LPRA 4MTBA 1TOCB 5DP9A 2EA3A 3M3TA 1D4PB 1AMHA 4WMFA 1TNKA 1YM0A 4K2YA 5C20A 1G32B 1ZMNA 1GBDA 1K22H 3HATH 1GBJA 1OP8A 3MH6A 1FPCH 3AW0A 4B73A 2HPQH 1O3LA 3QGJA 2STBE 1W3CA 1O38A 3UNSA 7KMEH 4BAHB 1WQVH 4JYUH 2JH0D 1D6RA 1S82A 3LU9B 2VWMA 3LGVA 4I7YH 3OY6U 3RUOA 1EQ9A 3MNBA 1C1OA 2ZGXH 1Z1IA 2CHAB 4H6SB 1TGBA 3QX5H 2BDIA 2ESTE 2V3HH 4OS2A 1P9SA 3U8OH 1MQ5A 1EJMA 2F9OA 3MNXA 2VH0A 2WPLS 5F8ZA 1NY22 1TMUH 3U69H 3Q3YA 1EUFA 2AERH 2DUCA 2W7UA 1P0SH 1GBTA 2TGPZ 2ODYB 1RS0A 1C5ZB 1CT4E 2Z9LA 2FEQH 3L6PA 4DW2U 1QL8A 4ABDA 1QIXB 2WYGA 1GCDA 3RP2A 2XXLA 4NIWA 2CF9H 3Q3XA 4WWYA 4TY7A 2AYWA 5ETXA 2TGTA 1O3EA 1Q2WA 1RTLA 1OX1A 1VCQA 1OP0A 3RDZA 2SGEE 2YNAA 4ABEA 1Z8GA 1K1LA 3CS0A 1MTNB 2A4OA 4YOJA 4D76A 3RXMA 4FUDA 3R3GB 1TX8A 3RMOH 1SGCA 1W0YH 3K6ZA 2F9NA 2ZZUH 2AMPA 3A8CA 3TJNA 1P8VC 4UFFH 4XBCA 4O3TA 1ZPZA 5EG4A 2VIOA 2PGQB 2GCTB 2ZGJA 3PO1B 4MPUA 4JZFH 1KXAA 3BTWE 5EGMA 1Z7KA 3RXFA 1K1JA 1C1MA 1IOEA 2BVSH 1AI8H 1BT7A 2ZFSA 3MHWU 4TPIZ 1KTSB 1VCPA 4H6TA 3KQCA 3DT0H 3F9HA 3RC4A 2ZU5A 2H5CA 4JK6A 1GI6A 3E16B 4THNH 2H1UA 1MMJN 4NWKA 2Z9JA 1WV7H 2GDEH 4B76A 1QFKH 2TGAA 2O8UA 5C1YA 1SI5H 1TQ7B 1QL7A 3SU4A 4K8YA 2ZFFH 3TGJE 2FX4A 2BQ6B 2BDAA 1YYY1 1SMFE 3EDXB 4KTUA 2A7JA 1PQ8A 2J34A 5AHGH 3SNEA 2BYAX 2BD5A 2VVVA 2GDDA 4U01A 4YM9A 1Y3UA 3RU4T 4I8LA 1GL0E 1BHXF 5JB8S 3UFAA 2HNTE 1TNHA 1AB9B 4MLFB 3E8LA 1Z71A 1EAXA 2VIPA 4FUGA 3SQEE 3VGCC 1CE5A 1HIAA 3QTOH 4M7GA 3TK6A 1ZHMA 2ODQA 2BQ7B 5FBEA 2THFB 3G01A 1C1QA 4IMZA 4D9QA 1NRNH 3ODFA 1ELAA 3D65E 5FCKA 4GAWA 1UJ1A 5CHAC 3ZVEA 5BRRE 2Y5HA 2IPHA 1GJ6A 1MZDA 1O0DH 4U2WA 1O5CB 1MQ6A 1RTFB 5A8YA 3BTEE 1G2MA 1W0ZU 2V35A 4X1SU 5IYTA 3UUZA 3SOSA 1HAVB 3S7KB 1ELFA 1LPZB 2J4IA 1ZSJA 1TIOA 1UTLM 3A87A 1ZHRA 1TNIA 3P95A 1AO5A 2C93B 2ZHQH 2O8WA 3IG6B 1DUAA 2ANKH 1ELVA 3LOXA 4KP0A 2BLQA 1TLDA 1GDUA 3HPTB 2NU1E 2XBWA 2FODA 2SGPE 3VB3A 2Y7XA 3B9FH 2FOMB 1C1NA 3A89A 3K9XB 1GBBA 1NTPA 3SUGA 1N1LA 1VITF 2FMJA 3QK1A 3SHAH 1A5HA 1SLVB 2A5AA 1YPKH 1SLUB 1O2IA 1V3XA 1C5OH 1A2CH 1OWHA 1UCYK 1HJAC 1FLEE 1DLEA 5FXLA 3MYWA 1V2KT 1BJVA 1FZZA 1S0RA 2XWAA 1VITG 3CENA 3UR6A 4DY7B 3P92A 5F8TA 3GY6A 3BV9B 1MAYA 5T6DA 4BAOB 4Y7BA 1NRPH 1O2HA 2Z3CA 4OS7A 3M7QA 4D7GA 4ZHLU 5TCAA 4CR9A 1V2RT 2WYJA 1IQEA 2Z9IA 4XBDA 1BBRK 3F9GA 1AUJA 1O2OA 7LPRA 4U30A 4WH6A 4MQAA 1SGQE 2BDGA 1BTUA 1FONA 4HI3A 1O33A 1S81A 2SNWA 3I29A 2P94A 2GT7A 1YLDA 3EA8A 4HZHA 5DP4A 2ANMH 2SFAA 2VJ1A 2D8WA 1CQQA 3M3SA 5AVDA 4I32A 1ANCA 2Q1JA 4DT7B 1GPZA 1RFNA 2ZIQH 1SQTA 3SU0A 4AOQA 2TBSA 3ATMA 2UUKB 4OS5A 2WPIS 1NPMA 1C5WB 2FOHA 4HTCH 3RC5A 2CN0H 1ZTJA 3ZZ3A 1LPGB 2YOLA 2SGFE 2W3IA 3TK5A 2O8LA 3BTQE 2SGQE 4ABAA 1C1RA 2UWPA 1EZSC 1GBIA 3FANA 4ZKNU 3RXOA 3KQBA 2BB4A 1Z6EA 2ZTYA 3UNQA 1F0RA 3HGNA 1IQJA 1AZ8A 1HDTH 2UUJB 1IQHA 5FPSA 5E2PA 3KEEA 1HJ9A 1C1SA 5A09A 1C2JA 2Z9KA 4O9VA 5I46H 2F83A 2Z9GA 2H9TH 1P05A 2VGCB 1IAUA 3VB5A 1D3TB 1ZTKA 1ZHPA 3M5MA 3OX7U 4B75A 5FAHA 1GI0A 1OYQA 2PUXB 4X8SH 1EOLA 2PV9B 3U1IB 1O5DH 1T32A 2QN5T 1Q31A 2ZECA 2P16A 3LH1A 1GJ7B 2NU3E 1K21H 1E38B 1O2QA 1A3BH 1LKAA 3MU4A 1EPTA 3ODDA 3GYLB 3RXGA 3LONA 1TBQH 1HLTH 2FOEA 1F7ZA 3LPRA 5GCHF 4Y71A 2VIWA 1DICA 2QGRA 4ZHAA 3TJVA 2VINA 3A7VA 6CHAB 1KXBA 1K1MA 1Y5AT 1BMAA 2HWLB 1ACBE 1P11E 5HM2A 3NK8A 1Z8JB 5E0JA 1ORFA 4FVBA 1UMAH 1PPFE 2BY9X 1PPBH 1MTWA 5GCHG 1LMWB 2XRCA 1DOJA 2Y82A 4ABHA 2D1JA 1AKSA 5A0AE 3KN2A 4GSOA 1FY8E 3B23B 1P57B 4O3UA 1C5UA 1XUGA 3VB6A 1NRRH 4TY6A 2OTVA 4Q7ZA 6LPRA 3AVZA 3RM2H 4AZ2B 1DLKB 1CT2E 1K1NA 1Y3VA 3MMGA 1O3JA 1VITH 3BTDE 4IN2A 1GCTB 2Y5FA 5IDKA 3UWIA 2C8YB 1OWKA 4ISHH 2H2ZA 2OQUA 5GIBA 3A7XA 2Z94A 1SGTA 1HAIH 1H4WA 3U8RH 2HVXA 2G5NA 2BTCE 2AGIX 4I8KA 3S7HB 4BTTB 1O36A 2ZEBA 9ESTA 4E05H 3GY7A 1P02A 1O2VA 1GBFA 4I8HA 1WQSA 3MU1A 4TPYA 1AWHB 1P2NA 4O03A 5BPEA 1UTKA 3MTYA 1BMNH 4OGYA 1KSNA 3A8BA 2BX4A 1SGIB 2FS9A 1AY6H 3T27A 4AFZA 1OWJA 3GCHB 4CRCA 1L1GA 1O3GA 1LHEH 1MTVA 2CV3A 2Y5GA 2F91A 3K65B 4INHA 4MPXA 1AIXH 2HALA 1GHVH 3LKWA 5TCCA 1BRUP 1HAVA 4XBBA 1DWBH 1LKBA 1FY1A 1TRNA 4LZ1H 1P01A 4Y8ZA 3TK9A 2HOBA 2ZNKH 1Z8RA 1GHZA 2B9LA 1UCYH 2AFQB 4GHTA 1O3AA 1KLJH 2GZ9A 4K3JA 1D3QB 3CP7A 1YP9A 1MKXK 4Y0YE 4FU7A 4MNVA 1C4V2 3RXPA 2ZCKP 3P70B 1W8BH 1KXCA 4IMQA 4Y79A 1UTJA 2EI8A 4MNXA 4NFEA 4UD9H 9LPRA 1QRXA 2O8TA 4NIYA 4A1VA 1DSUA 2SGDE 2FWWA 2BZAA 2P8OB 5HYOA 2EI7A 1V2JT 8KME2 4ZAEA 2G81E 1G2LA 4UDWH 4CHAB 3UIRA 1IQKA 1C2IA 1EPTC 1QA0A 4FUIA 1MU6B 2P95A 2Y6TA 1T8LA 2ZGBH 1PQAA 3PO1C 3SV6A 1C2DA 1BRCE 1PQ5A 1K1PA 2YNBA 2ZTXA 1Y5BT 3SU2A 1UVSH 1OPHB 3PTBA 3V13A 1KY9A 1GJ9B 1UK3A 1IQFA 3SU6A 2FYRA 4WJG2 5FCRA 1GG6C 1THPB 1CSOE 3W95A 3LC5A 1DWEH 4MPVA 1VR1H 2F9UA 2VIDA 4XE4A 2FOFA 1YGCH 3S69A 5A0BA 3UOPA 4A92A 3E0NB 2OBQA 3OSYA 3A7WA 2V6NA 5EQSA 5LPFA 1BOQA 1O39A 3RC6A 3SBKA 1CHOF 2XTTB 1MBQA 2QAAA 1GVKB 1GJDB 5DP3A 2BD3A 1SGEE 1XM1A 1L0ZA 2QXJA 2BVXH 1O3FA 3SORA 1E35B 1S84A 3RU4E 3A82A 1YPMH 1C2HA 3FZDA 5EXLA 5PTPA 2OC8A 1KDQB 2VVCA 5AFZH 2XWBI 1TOMH 4HGCA 5K0HA 3UR9A 2OC0A 1Y59T 1TRYA 1TMTH 3KQEA 2BXUH 5EQRA 5EODA 3SNDA 4IW4E 1YPLH 4O97A 1HAXB 3QUMP 1QJ1B 4FU9A 4NIXA 3ZZ9A 2VH6A 1QBNA 1SC8U 1GGDC 1S85A 2BY8X 1GI1A 2VB0A 3BSQA 3ATWA 3CS7A
chains in the Genus database with same CATH superfamily
4VGCB 3LIWA 2F9PA 4ZKSU 3A7YA 5FPYA 2ILNA 4UFGH 1J17T 1TPAE 2JH6D 2RA0A 1ZR0A 1HRTH 1EKBB 4X2VA 4JZDH 4I33A 1ELGA 1E1RD 2ZGCA 3EGKH 4GPGA 3KIDU 1NN6A 3W94A 2C8XB 1FUJA 1OP2A 2FM2A 1JIRA 2FI5E 1OYTH 3QTVH 1O3HA 5LGOA 3A8DA 3BG8A 3SNAA 1UVOA 4WVPE 1C1WH 2GGVB 3FP8E 1CA0C 3EAJA 2CK3D 1TWXB 3OU0A 2HVYB 3HKIB 1O5EH 3STJA 1BB0B 1PPEE 3ATKA 1Y3XA 2WZQA 1ZJKA 3LGIA 3AK5A 3P8OA 1NRQH 2EI6A 3PRBA 3SNBA 2ZU2A 4JK5A 1QY6A 1RGQA 4TWWA 4UONA 3FAOA 1PPHE 2BLWA 2G00A 4NA7A 3SV8A 1EB2A 1YPEH 1NT1A 4TT3D 5JDUB 1AFEH 1GVLA 2QE7D 2R3YA 4U32A 3D23A 3MNSA 5TJXA 1O3KA 3A8AA 1BTPA 4NGAH 1T31A 1GBAA 2QXIA 4GHQA 2STAE 4P02A 1QZ8A 1GVZA 1V2PT 3GY5A 3PMBB 2A4GA 4B1TA 4Y10E 4Q2KA 5F03A 1O2ZA 2BOHB 4A6LA 1V2OT 2P93A 4BANB 1D3DB 1XUIA 2CJIA 2FESH 3TU7H 2Q6FA 1X7AC 3DSOA 3K2UA 2CMYA 3P8FA 1QCPA 5T1VA 3SW2B 1P2OA 3DHKH 6GCHG 4WMEA 1EJNA 3FP7E 1GI4A 3TGKE 4PROA 1HNEE 1WBGB 1HBTH 5F6MA 1MKXH 1THSH 3F0PA 1GJCB 2R9PA 3LDXH 3IWMA 1IQNA 1SQOA 1PPCE 3DCLA 4DJZB 3PWBA 4ZHMU 1N8OB 1HAGE 1FJSA 1U6QA 2A1DB 4X6NA 1KIGH 5HM9A 1ETSH 4ZROA 1O3DA 1TA6A 1ELCA 1Y3WA 1GHAG 2K0QA 1C5LH 2WPKS 1EZQA 1FN6A 3RXLA 1DM4B 3I77A 2HRVA 4IS5A 4ZUHA 2RFKC 3ZVCA 2PUQH 1GI3A 1T4UH 2L6OA 3F9FA 3GCTG 3V12A 1ZTLA 2GMTB 1B5GH 1W2KH 4A1TA 2OP9A 3SNCA 4X1QU 2VGCC 1QURH 3UTUH 3L33A 3U8TH 3QZRA 4ABBA 1ARCA 4NG9H 5J4QA 3PLKA 1TMBH 4XFQA 3NUMA 3GDUA 2JIZD 4ZCNA 1CBWB 1CGHA 1LVYA 2ZFQH 1PPGE 3F1SB 3M37A 2DE9A 2UUFB 1RJXB 4AGKA 1PYTC 2BOKA 1C5MD 2SGAA 3HK6B 4YLUA 4I86A 1ZRBA 4ISIH 3E91A 2FP7B 2OUAA 2J9NA 3ZZ6A 3URCA 2AH4X 6CHAC 1XVMA 1SGFG 3S9BA 3SO3A 1QJ7B 2F9VA 5T6FA 3O8DA 3VPKA 2PWXA 4B2AA 1G36A 2B0FA 1S83A 2GV7A 4DGJA 1V2NT 1N6YA 2W26A 2ZG0H 3NPSA 4MG3A 1YPGH 2TGDA 2JKHA 1TPPA 1VGCC 3SU1A 1NO9H 1WTHD 2ZI2H 1WUNH 1SQAA 1NFWA 4YOIA 3A86A 1LVMA 4KELA 2FPZA 3GCNA 3SJKA 3DA9B 1HGTH 1P10A 1O2YA 3F9EA 4NZQA 1B0EA 1DT2A 4FVDA 1MH0A 1GJ5H 3WY8A 1GCTC 1UTOA 3RU4D 5FPTA 1OWDA 3U9AH 1EASA 3MU5A 4ABJA 4ABGA 2NWNA 3EQ0H 5CMXH 2PKAB 4Y11E 4BAQB 4AN7A 5C2ZA 3F3BA 3PMJA 1ESBA 1J14A 4UFDH 3DFLA 2KR7A 1DDJA 1UHBB 3F2FA 3TVJB 1OKXA 5EQQA 3EA9A 3H5CB 1A3EH 1LVOA 3PROA 4MVNA 1IQIA 2NU0E 1O3MA 4B6FA 1G3CA 3RXIA 2WUBA 2J92A 2PKSC 4AG1A 1AN1E 2ODPA 1GL1A 2RG3A 1NM6A 4KKDA 3ZVGA 1O31A 5ABWA 4B2BA 1LVBA 1DWDH 4K1EA 4CBNA 4GLYA 1FAXA 1O3CA 1O37A 2IJOB 4LOYH 4WH8A 4JMYA 2GKVE 5DP7A 2TIOA 5LH8A 1GJ8B 2RCEA 4TYDA 3WWBA 1K2I1 1SGRE 3BTKE 3DD2H 2OINA 3MWIU 1O5BB 4Q7YA 1SOZA 1NRSH 2QXGA 1AVXA 3TNTA 2XC0A 2A2QH 3KL6A 1TABE 3SN8A 3LJJA 2BDYA 3SZEA 2J38A 2G55A 3QDZB 1GJ4H 5EIYA 1MCVA 2B5TB 2QC2A 1J15A 2QY0B 1O3PB 3VEQB 4FXGH 3VFEA 2D2DA 1XUHA 2LIZA 3UQOA 5A2MH 2BLOA 3HGPA 5HXFA 3Q3KA 1SQRA 1V2UT 5C5NA 1EAUA 3SGAE 1FPHH 3BIVH 3BG4B 3FKSD 4MPWA 5DGJA 1FV9A 5GPIB 3TIUA 1KTTB 2PR3A 3T28A 1SBWA 2Y7ZA 1S6FA 1WTGH 1SSXA 3MU8A 2F3CE 3GDSA 2FS8A 1GBKA 3T29A 1SKYE 3SJIA 2QF0A 2R0LA 2H5DA 2C3SA 2BQWB 5DK1A 4FUFA 1O5GH 2BDHA 1EP6A 1O2PA 1O2SA 1W11U 1VCWA 1O2MA 2OQ5A 3A7TA 2HGTH 4Z6AH 1ETTH 4JCNA 1QB1A 3P17H 2WUCA 2PTCE 5A8ZA 2JETC 2R3UA 3GY8A 1EP5A 1F92A 3RXJA 1FXYA 1P9UA 4RSPA 2C4FH 1MTUA 1O2RA 4ASHA 3PV5A 4X6OA 3VGCB 1O2GH 2IN2A 2RDLA 2O9QA 1E79D 3NCLA 1LCYA 4CRDA 1UTMA 1DVAH 5HMAA 3GOVB 1K0HA 4UE7H 3SJOA 1H8HD 1SL3A 3EYDA 2V3OH 1BTXA 3TH3H 2RA3A 3FVFB 1KMHB 1GI8B 4DURA 2VBCA 3N7DA 3KYGA 4AORA 1C5YB 3PMAB 1UTNA 4ZXYH 1KLTA 3M7TA 1P3EA 1AFQC 4D7FA 4IN1A 1P2KA 1E37B 2GVFA 1L4DA 3AAVA 1DSTA 2WPDD 2FOAA 1C2MA 2C8WB 2BLVA 3RXSA 2G5VA 2ANYA 1GI9B 3RXKA 1V2ST 2XCFA 3PB1E 2G4UA 3SI3H 3KQ5A 1P2MA 1BCUH 1WXRA 2LP6A 2BD7A 4CRBA 1E36B 1GI2A 2WPJS 1P04A 2UWOA 4B71A 1H9LB 4X1RU 4AFSA 3E3TA 1EFRD 1YPJH 4Y7AA 1C9PA 2R0KA 3VG8A 2ZQ2A 4X2XA 3ZZBA 2Q6DA 4E06H 1JMOH 1AVWA 1GHXH 1Q3XA 2OC7A 3KCGH 3T5FH 3U28C 2A4QA 2A31A 2YMSD 5FBIA 5EPYA 1HJAB 4VGCC 3LGUA 2Z3DA 4H42U 4A7IB 2K8IA 4FUCA 1A0LA 1D3PB 1A1RA 3GYMA 4BOHA 1MABB 3BTGE 3M3VA 1MTSA 4OS6A 4YOGA 2CHAC 4XOJA 5DG6A 2BM2A 4NSVA 4A5TS 5EJLA 1XKAC 2ZU3A 2ZDNA 4IGDA 1QHRB 1AE8H 1TGSZ 3FOAA 2LPRA 3DSPA 1B7XB 3U1JB 1C4U2 2ZDVH 1T8MA 2FTLE 2NU4E 5AFYH 4OM9A 5J4SA 2HPPH 1GI7B 3ATIA 1O3OA 3SUDA 3GCOA 2TRMA 8ESTE 2HNTC 2A0QB 5C0TA 2XW9A 5K7RA 1C1VH 1C5SA 3FP6E 1TGTA 1TX7A 5T6GA 3ELAH 5HIZA 5L2YH 1ZZZA 2FZZA 3ZVAA 1DXWA 3O8BA 4D9RA 2ZHDA 1XMNB 1MTNC 1DANH 1GHWH 1QQUA 1DFPA 2H9HA 3SUFA 2C8ZB 1ABIH 2Q6GA 1HCGA 1HXFH 1L1JA 1F5KU 1A5GH 3TJUA 3A81A 1BBRH 1P03A 3DFJA 1C5TA 3ZZ5A 1TQ0B 5DJ7A 3RXEA 1SR5C 3BEFB 2BDBA 3A7ZA 3P8NA 1MBMA 2FXRA 2HNTF 3RMNH 1ANBA 1K1IA 1GHYH 2GCTC 1H9IE 3BTME 4INKA 2XC5A 3MH5A 1FY5A 1XKBC 1THRH 3Q77A 3O8RA 2K7XA 2ALVA 1ESAA 3RMLH 2ZPSA 3UQVA 1GMDG 1HIAB 1Z6JH 4FUEA 4NFFA 3ZVDA 5AF9H 3D49H 4BXSA 5F8XA 4I8JA 2OLGA 2ZFRH 5CHBA 5T3HA 2QIQA 1ID5H 1T7CA 2XC4A 1W12U 1BMMH 3SUEA 1T8NA 2PSYA 4AFQA 4ESTE 1BRBE 5JB9S 2WPHS 2ZTZA 4J1YA 1IHSH 1YLNA 2QXHA 2FI3E 1O32A 3EE0B 5DP5A 4DIHH 1QR3E 3TH2H 2XOKD 1SGDE 1OXGA 4K5ZA 1DPOA 1MZAA 1ELBA 2AIQA 1E0FD 4X0WU 1UVUH 2OC1A 4A1XA 1O3IA 1GJAB 1G30B 3BIUH 5EOKA 4FETA 5C67A 3VB7A 4X2WA 2A2XH 1TALA 5C5OA 1INCA 1UCYE 1GDQA 1SGFA 2G8TA 2IOTA 2ZA5A 1YC0A 2TPIZ 4XSKU 2AGGX 4MNWA 3UOUA 2A32A 3V3MA 1QBOA 1LPKB 4K69A 2O8MA 1RIWB 1XUFA 3EA7A 2ZU4A 4RKOB 1WYKA 1AB9C 1V2TT 1TGNA 1XXFA 4AB9A 3UWJH 1O30A 1Y8TA 2PW8H 3S9CA 1FIZA 4INLA 5KECA 3E6PH 1F5LA 1TNLA 1ARBA 1KYNA 4YESB 2BD9A 1VKYA 1JOUB 1ELEE 4CR5A 2FDAA 5E8EH 3SU3A 3T26A 4JZ1A 3UPEA 4XDEA 1H8IH 2VWNA 1CGIE 4AYYB 5JBTA 4ABFA 1J8AA 1G3BA 1W7XH 1L2EA 5GWZA 3GS9A 1ZGIA 3PMHB 1TYNA 2VVUA 2EEKA 1HJ8A 1LHGH 4CH8B 3BTTE 4XRNA 1TBRH 1FMGA 1CGJE 1A0HB 1MUEB 2CGAA 1TBZH 1LHCH 3MI4A 1O2KA 1TFXA 2J98B 3M36A 3ZIAD 2FTMA 3JZ2B 4MNYA 4X8VH 2BY5X 2FLRH 2FOCA 1K9OE 3P8GA 3M7UA 3OY5U 1O2WA 4GCHF 1OWEA 2PTNA 2H9EH 1BRAA 1C1PA 5JBBS 3TGIE 1QRZA 1O2LA 2VWOA 1TE0A 5EW2H 2KX4A 4Q80A 3TJOA 3UY9A 3PWCA 2LELA 2WPMS 2CXVA 4GCHG 1JXPA 4SGAE 7ESTE 1LDTT 5L30H 1QGFA 1V2WT 3OAAD 4DG4A 1AGJA 1EJAA 3ZVBA 1CA8B 1TRMA 4NZLA 2J97A 3AASA 1QB6A 3M5OA 5A8XA 2A5KA 3DUXH 3MOCA 1QBVH 1UVPA 4NA8A 3T25A 2BY7X 1FN8A 1P12E 3ZZCA 2YMSB 2LNCA 2Z7FE 3OTPA 1NBME 2OCVB 1ZMLA 1BTHH 1O2JA 3C27B 1UK4A 3AW1A 1HAYB 1SFQB 3NWUA 6GCHF 2PP6A 3QN7A 3QO6A 1HAZB 3F68H 4NIVA 1O3BA 2M5TA 4BAMB 4X1NU 3F2HA 2J95A 2BD2A 3ZV8A 1HAPH 4KTCA 1TA2A 1MAXA 3UNRA 1M9UA 3BN9A 2QV1A 1LQEA 1VJAU 2ZPRA 3Q00A 4TWYA 2PSXA 1NU7B 3SZNA 1EPTB 2FOGA 1E34B 1Y5UT 3A80A 3MH7A 2WHXA 4WXVA 1QNJA 1G3DA 1FIWA 2FX6A 3MU0A 4F49A 1GHAF 2GCHF 2ZP0H 3D62A 1DY8A 1EZUC 3ZYDA 1DE7H 2GP9B 2P3UB 3RXCA 5EXMA 1D6WA 4I31A 1JRSA 1V2MT 1C2LA 1ZYOA 2UUYA 1PYTD 1F2SE 1GMHF 1F5RA 3GCTF 2QF5A 5JBCS 4Z0KA 2G4TA 1GG6B 2GCHG 4ABIA 1AKSB 5GJ4B 4UEHH 3B8JA 3BG4C 4AG2A 4AB8A 1DS2E 1T8OA 3T62A 1BMLA 4X6MA 4BTIB 1GMHG 1AD8H 1V2LT 1W13U 1SHHB 3LC3A 5JYIA 3F6UH 1C1TA 3SGQE 1JBUH 5JBAS 1B0FA 1MCTA 5C3NA 1SPJA 3OEHD 5DO4H 3URDA 2OK5A 3S0NA 2GX4A 5HIYA 1C2GA 1BMFD 1O3NA 4LZ4B 3LGYA 5DP8A 3ZZ8A 2NU2E 4ISOA 1YPHC 1J9CH 3OFND 1XXDA 1S0QA 1SGPE 3AAUA 2UWLA 1FY4A 3NKKA 1C2KA 3PLBA 1EAIA 1TPOA 1NFXA 1C5NH 2R2WU 1FDPA 2Y81A 2DE8A 5C1XA 1DXPA 1YWUA 1FQ3A 1IQLA 3TNSA 2G52A 3PV2A 3HK3B 2VIQA 3N99A 1RTKA 4DIIH 5G4BA 5KEDA 2W5EA 1ESTA 1BUIA 2Y80A 1F0TA 3KQDA 5SGAE 1S6HA 1KXFA 1YCPK 2PGBB 4NSYA 1TB6H 1KLIH 1Z8IB 3ITIA 4ISNA 1YBWA 3GY2A 4NCYA 4KTSA 1BQYA 1GWAA 1TGCA 4MDSA 1MD8A 1N6XA 5EU8A 1AE5A 1XVOA 1EB1H 1C5RA 2FLBH 2P59A 2ZDMA 3O8CA 3KF2A 1K28D 2F4LA 1GGDB 3MO6A 1OSSA 2A7HA 1C5PA 2BY6X 3QZQA 3E90B 1LTOA 5GXPA 1QTFA 1QA7A 2ZQ1A 3LJOA 3H7TA 1A4WH 2ZGHA 4E7RG 4ZMAH 2EC9H 1VJ9U 4WMDA 1ZPCA 2QCYA 1LO6A 5FHTA 4ZH8A 1V2VT 1PQ7A 2P3TB 3RXBA 1HFDA 1V2QT 1P2IA 3ZZDA 4FU8A 3KNXA 3RXDA 2WINI 5HKKD 2B8OH 3GDVA 1GDNA 1ANEA 1CHGA 1K1OA 2QF3A 1ETRH 1EZXC 4DOQA 3ESTA 1CA0B 2AEIH 2VU8E 1AWFH 5EPNA 2IJD1 4Y76A 1KDQA 1XX9A 3OYPA 1Y3YA 2FO9A 3KYFA 1BJUA 1QL9A 3QWCH 4DVAU 3RXRA 4OS1A 3SI4H 4X8TH 2ZDLA 2A5IA 4Y0ZE 5I25A 4ISLA 4Y6DA 5LPRA 2Z3EA 4CRFA 5E0GA 2XBVA 1SLWB 2Z6BD 3GCHC 1SFIA 2GTBA 3STIA 1Z1JA 1NU9A 1HXEH 4WXIA 3SU5A 4JZEH 1RXPA 2KZ4A 4H4FA 4YZUA 1XUKA 2FI4E 3RLYH 3F2GA 1WCZA 3W1EA 2ZF0H 1L1NA 1LHDH 1BITA 1H1BA 3SGBE 3PRDA 3M61U 2B7DH 1MKWK 3A84A 3V7TA 1SG8B 5FX6A 3RXAA 4CBOA 2KAIB 3DSGA 4X1PU 1HYLA 1O2UA 3S9AA 1EXFA 3NXPA 1PFXC 1DX5M 1GBHA 1L4ZA 6ESTA 2G51A 4JZIA 1QQ4A 5DPAA 2BDCA 2ZO3H 1A46H 2ZFPH 1P2QA 2ZKSA 1BHXB 5JPMH 3L3TA 2P3FH 2PHBA 1OWIA 3JZ1B 1BTYA 3SV7A 1SGNE 2P8OC 4FUHA 4K8BA 3KHVA 1C2FA 2GV6A 1D9IA 2BVRH 2KCAA 4BAKB 3HKJB 1LQDB 4WY3A 3RXUA 4CHAC 2K1QA 1H8DH 1HV7A 2CF8H 2W3KA 1GMCF 1NBMD 2WV4A 2BHGA 2XBYA 1YKTA 3M5LA 4Q7XA 4R8TB 1NFUA 1XUJA 2F9BH 4KGAA 1AU8A 1DITH 3A85A 3PTNA 1O5AB 2OD3B 4Q4LA 1F0UA 1IHTH 3RXHA 1ZLRA 1CT0E 3BF6H 1GMCG 3QGNB 5GDSH 1ANDA 3RM0H 1UVTH 1AUTC 4QT8C 5ESBA 1TAWA 3LGTA 1UW7A 1UK2A 1IQGA 2AMQA 2PFEA 4SGBE 1C5QA 4RKJB 1ZGVA 4J2YB 1GBCA 1SGYE 1GI5A 1RRKA 1PJPA 2ZCHP 2VWLA 4OS4A 1ZJDA 2BD8A 1AVGH 4YO9A 1OHHD 2BX3A 1ELTA 1WSSH 4IC6A 4HFPB 1SB1H 1HUTH 4X2YA 3KGPA 2SNVA 3PLPA 4I8GA 4K1SA 2ZFTA 5CHAB 1WOFA 2WV5A 2PLXA 3OE7D 1EAWA 1OOKB 1JRTA 1C4Y2 3C1KA 3RMMH 3SQHE 1SLXB 3E0PB 3M5NA 5DSFA 1A61H 1TPSA 1HAOH 1ZSKA 3WW7A 2A4RA 1AZZA 3SHCH 3H7OA 3MFJA 4JYVH 1QRWA 4Q63A 4FUBA 1FNIA 2W6JD 3MNCA 4E7NA 3V0XA 3TITA 1RIWC 2VNTA 3BEUA 3N7OA 2GT8A 1VGCB 2ULLA 4ZKOU 2AMDA 1GBMA 2BMGB 1G9IE 2A7CA 3TH4H 3SJ8A 2AGEX 2XNIA 2AS9A 4UFEH 4AGJA 4K60A 2ZCLP 4F4OC 1O5FH 3PV4A 5C0UA 1BTZA 4CREA 1SVPA 1FI8A 2OXSA 3I78A 1EOJA 1YLCA 1J16A 5H4IB 4YLQH 4YT7H 3EBNA 1OS8A 1NS3A 1P2JA 1CVWH 1YCPH 2FIRH 2KCPA 5ESTE 1GJBB 1TNGA 3U98H 5E0HA 1RD3B 3ZV9A 2BD4A 5CE1A 1ZPBA 4IC5A 2F43B 1SOTA 1S5SA 3RXTA 4ZKRU 2ASUB 2VIVA 2ANWA 5GNDA 2L74A 1JWTA 3FZZA 1ZMJA 1IQMA 8GCHF 1AHTH 1QJ6B 1TONA 2ZDKA 2KCYA 3T2NA 1F0SA 2XYAA 4CRAA 1ZSLA 3BTHE 2JH5D 2PKSB 2D26C 2BXTH 4RN6A 1W10U 1O2TA 3M35A 1ZOMA 1O2XA 1C9TA 2ZHEH 3K6YA 3VB4A 3BTFE 8GCHG 1NC6A 1ELDE 1YPHE 3LT3A 5LPEA 3ZYEA 1C1UH 4FOUC 4NWLA 1GHBF 5EW1H 1GBLA 1C2EA 1JIMA 4GUXA 4GVUA 4LK4A 1UTQA 2QA9E 1NESE 1FAKH 1KXDA 1NZQH 3ZZAA 3OTJE 1KXEA 3GY3A 4LXBH 3R0FA 5A0CA 3LH3A 1GHBG 3BEIB 2AIPA 2GZ7A 3GICB 2GD4B 3A83A 1V6DA 5EXNA 2ZWLH 4AX9H 2XNDD 1W14U 4Y8XA 2A45B 4Y8YA 3VXFH 2YMSC 2PKAA 2ZHFH 4NA9H 2BZ6H 2J2UA 4FUJA 4K1TA 1P09A 5B6OA 2GZ8A 1GMDF 2ZPQA 4R0IA 2C90B 2OBOA 4YT6H 1C5XB 1O35A 1PPZA 1UHBA 3GY4A 1G3EA 2JJ1D 3TPIZ 4DCDA 1QB9A 3TLOA 1BDAA 4ZXXH 3NZIA 5L2ZH 3UREA 1SHYA 1G37A 4BTUB 3P6ZB 1MKWH 4CH2B 1W7GH 3MO3A 1EX3A 1BTWA 4AYVB 2QYIA 3RXVA 5C17A 1BIOA 3MH4A 4AFUA 1O34A 1VZQH 4D8NA 1LHFH 2H6MA 1CO7E 2FYQA 4OGXA 1WU1A 1DWCH 3PYHA 1DY9A 1P06A 4CRGA 1EATA 2ZHWH 3RXQA 1MU8B 1H9HE 1BA8B 4WF8A 2HLCA 3FFGA 2I6SA 1HB0B 2W7SA 1A7SA 4ACBA 1N8OC 2JETB 3LGWA 3ZZ7A 3SJ9A 5DKMA 3PM3A 2XCNA 3MO9A 4B2CA 2ZU1A 2ALPA 1TNJA 2KAIA 5DP6A 1P3CA 4X8UH 1NROH 1TX6A 1FY3A 3VXEH 1AQ7A 1CU1A 2ZC9H 1HAHH 2EY4C 1UO6A 3RLWH 1BZXE 3ENSB 4B74A 2AHME 1DUEA 5E2OA 3GISB 5L6NH 1ABJH 3QLPH 1GBEA 3EE7A 2GMTC 5C1UA 3SV2H 3ZZ4A 1YCPM 1WAYB 4X6PA 4IBLH 4BNRA 1NFYA 4BXWA 7GCHF 3Q76A 1HPGA 1A5IA 1YF4A 3ZVFA 3SV9A 2RDEA 2FOBA 2R2MB 1O2NA 1T4VH 4JYTA 1AFQB 1CBWC 2ZDAH 2V0BA 5FX5A 1BBRE 3IITA 3E1XB 3A88A 4YTAA 1MD7A 1ZRKA 7GCHG 2I6QA 2J94A 5HGGA 1CHOG 1C5VA 1UTPA 2XBXA 1A0JA 3ATLA 2GJGA 8LPRA 4MTBA 1TOCB 5DP9A 2EA3A 3M3TA 1D4PB 1AMHA 4YXWD 4WMFA 3F0OA 1TNKA 1YM0A 4K2YA 5C20A 2V7QD 4XD7D 1G32B 1ZMNA 1GBDA 1K22H 5DN6D 3HATH 1GBJA 1OP8A 3MH6A 1FPCH 3AW0A 4B73A 2HPQH 1O3LA 3QGJA 2STBE 1W3CA 1O38A 3UNSA 7KMEH 4BAHB 1WQVH 1FX0B 4JYUH 2JH0D 1D6RA 1S82A 3LU9B 5EJZA 2VWMA 3LGVA 4I7YH 3OY6U 3RUOA 1EQ9A 3MNBA 1C1OA 5EJ1A 2ZGXH 1Z1IA 2CHAB 4H6SB 1TGBA 3QX5H 2BDIA 2ESTE 2V3HH 2HLDD 4OS2A 1P9SA 3U8OH 1MQ5A 1EJMA 2F9OA 3MNXA 2VH0A 2WPLS 5F8ZA 5C94A 1NY22 1TMUH 3U69H 3Q3YA 1EUFA 2AERH 2DUCA 1W0KD 2W7UA 1P0SH 1GBTA 2TGPZ 2ODYB 1RS0A 1C5ZB 1CT4E 2Z9LA 2FEQH 3L6PA 4DW2U 1QL8A 4ABDA 1QIXB 2WYGA 4F48B 1GCDA 3RP2A 2XXLA 4NIWA 4ACAA 5IK2D 2CF9H 3Q3XA 4WWYA 4TY7A 2AYWA 2JDID 5ETXA 2TGTA 1O3EA 1Q2WA 1RTLA 1OX1A 1VCQA 1OP0A 3MQKC 3RDZA 2SGEE 2YNAA 4ABEA 1Z8GA 1K1LA 3CS0A 1MTNB 2A4OA 4YOJA 4D76A 3RXMA 4FUDA 3R3GB 1TX8A 3RMOH 1SGCA 1W0YH 3K6ZA 2F9NA 2ZZUH 2AMPA 2KCOA 3A8CA 3TJNA 1P8VC 4UFFH 4XBCA 4O3TA 1ZPZA 5EG4A 2VIOA 2PGQB 2GCTB 2ZGJA 3PO1B 4MPUA 4JZFH 1KXAA 3BTWE 5EGMA 1Z7KA 3RXFA 1K1JA 1C1MA 1IOEA 2BVSH 1AI8H 1BT7A 2ZFSA 3MHWU 4TPIZ 1KTSB 1VCPA 4H6TA 3KQCA 3DT0H 3F9HA 3RC4A 2ZU5A 2H5CA 1YY3A 4JK6A 1GI6A 3E16B 4THNH 2H1UA 3FO8D 1MMJN 4NWKA 2Z9JA 1WV7H 2GDEH 4B76A 1QFKH 3UAIC 2TGAA 2O8UA 5C1YA 1SI5H 1TQ7B 1QL7A 3SU4A 4K8YA 2ZFFH 3TGJE 3NRLA 2FX4A 2BQ6B 2BDAA 1YYY1 1SMFE 3EDXB 4KTUA 2A7JA 1PQ8A 2J34A 5AHGH 3SNEA 2BYAX 2BD5A 2VVVA 2GDDA 4U01A 4YM9A 5B6LA 1Y3UA 3RU4T 4RT0A 3SYJA 4I8LA 1GL0E 1BHXF 5JB8S 1H8ED 3UFAA 2HNTE 1TNHA 1AB9B 3WWFA 4MLFB 3E8LA 1Z71A 1EAXA 2VIPA 5FL7D 4FUGA 3SQEE 3VGCC 1CE5A 1HIAA 3QTOH 4M7GA 5KGOA 3TK6A 1E1QD 1ZHMA 2ODQA 2BQ7B 5FBEA 2THFB 3G01A 1C1QA 4IMZA 4D9QA 1NRNH 3ODFA 1ELAA 3D65E 5FCKA 4GAWA 1UJ1A 5CHAC 3ZVEA 5BRRE 2Y5HA 2IPHA 2KFWA 1GJ6A 1MZDA 2EQNA 1O0DH 4U2WA 1O5CB 2W6ID 1MQ6A 1RTFB 5A8YA 3BTEE 1G2MA 1W0ZU 2V35A 4X1SU 5IYTA 3UUZA 3SOSA 1HAVB 3S7KB 1ELFA 1LPZB 2J4IA 1ZSJA 1TIOA 1UTLM 3A87A 1ZHRA 1TNIA 3P95A 1AO5A 2C93B 2ZHQH 2O8WA 3IG6B 1DUAA 2ANKH 1ELVA 3LOXA 4KP0A 2BLQA 1TLDA 1GDUA 3HPTB 2NU1E 2XBWA 4B6EA 2FODA 2SGPE 3VB3A 2Y7XA 3B9FH 2FOMB 1C1NA 3A89A 3K9XB 1GBBA 1NTPA 3SUGA 1N1LA 1VITF 2FMJA 3QK1A 3SHAH 1A5HA 1SLVB 2A5AA 1YPKH 1SLUB 1O2IA 3N7EA 1V3XA 1C5OH 1A2CH 1OWHA 1UCYK 1HJAC 1FLEE 1DLEA 5FXLA 3MYWA 1V2KT 1BJVA 1FZZA 1S0RA 2XWAA 1VITG 2V3MA 3CENA 3UR6A 3P92A 4DY7B 5F8TA 3GY6A 3BV9B 1MAYA 5T6DA 4BAOB 1WDIA 4Y7BA 1NRPH 1O2HA 2Z3CA 4OS7A 3M7QA 4D7GA 4ZHLU 5TCAA 4CR9A 1V2RT 2WYJA 1IQEA 2Z9IA 4XBDA 1BBRK 3F9GA 1AUJA 1O2OA 7LPRA 2QF4A 4U30A 2J98A 3H09A 4WH6A 4MQAA 1SGQE 2BDGA 1BTUA 1FONA 4HI3A 1O33A 1S81A 2SNWA 3I29A 2P94A 2GT7A 1YLDA 3EA8A 4HZHA 5DP4A 2ANMH 2SFAA 2VJ1A 2D8WA 1CQQA 3M3SA 5AVDA 4I32A 1ANCA 2Q1JA 4DT7B 1GPZA 1RFNA 2ZIQH 1SQTA 3SU0A 4AOQA 2TBSA 3ATMA 2UUKB 4OS5A 4TSFD 2WPIS 1NPMA 1C5WB 2FOHA 4HTCH 3RC5A 2CN0H 1ZTJA 3ZZ3A 1LPGB 2YOLA 2SGFE 2W3IA 3TK5A 1W0JD 2O8LA 3BTQE 2SGQE 4ABAA 1C1RA 2UWPA 1EZSC 1GBIA 3FANA 4ZKNU 4ASUD 3RXOA 3KQBA 2BB4A 1Z6EA 2ZTYA 3UNQA 1F0RA 3HGNA 1IQJA 1AZ8A 1HDTH 2UUJB 1IQHA 5FPSA 5E2PA 2J5UA 3KEEA 1HJ9A 3OEED 1C1SA 5A09A 1C2JA 2Z9KA 4O9VA 5I46H 2F83A 2Z9GA 2H9TH 2IPQX 1P05A 2VGCB 1IAUA 3VB5A 1D3TB 1ZTKA 1ZHPA 3M5MA 3OX7U 4B75A 5FAHA 1GI0A 1OYQA 2PUXB 4X8SH 1EOLA 2PV9B 3U1IB 1O5DH 1T32A 2QN5T 1Q31A 2ZECA 2P16A 3LH1A 1GJ7B 1S6LA 2NU3E 4RT1A 1K21H 1E38B 1O2QA 1A3BH 1LKAA 3MU4A 4P00A 1EPTA 3ODDA 3GYLB 3RXGA 3LONA 1TBQH 1HLTH 2FOEA 1F7ZA 3LPRA 5GCHF 4Y71A 2VIWA 1DICA 2QGRA 4ZHAA 3TJVA 2VINA 3A7VA 6CHAB 1KXBA 1K1MA 1Y5AT 1BMAA 2HWLB 1ACBE 1P11E 5HM2A 3NK8A 1Z8JB 5E0JA 1ORFA 4FVBA 1UMAH 1PPFE 2BY9X 1PPBH 1MTWA 5GCHG 1LMWB 2XRCA 1DOJA 2Y82A 4ABHA 2D1JA 1AKSA 5A0AE 3KN2A 5F53A 2KM0A 2JJ2D 4GSOA 1FY8E 3B23B 1P57B 4O3UA 1C5UA 1XUGA 3VB6A 1NRRH 4TY6A 2OTVA 4Q7ZA 6LPRA 3AVZA 3RM2H 4AZ2B 1DLKB 1CT2E 1K1NA 1Y3VA 3MMGA 1O3JA 1VITH 3BTDE 4IN2A 4DT4A 1GCTB 2Y5FA 5IDKA 3UWIA 2C8YB 2WV9A 1OWKA 4ISHH 2H2ZA 2OQUA 5GIBA 3A7XA 2Z94A 1SGTA 1HAIH 1H4WA 3U8RH 2HVXA 2G5NA 2BTCE 2AGIX 4I8KA 3S7HB 4BTTB 1O36A 2ZEBA 9ESTA 4E05H 3GY7A 1P02A 1O2VA 1GBFA 4I8HA 1WQSA 3MU1A 4TPYA 1AWHB 1P2NA 4O03A 5BPEA 1UTKA 3MTYA 1BMNH 4OGYA 1KSNA 3A8BA 2BX4A 1SGIB 2FS9A 1AY6H 5CDFE 3T27A 4AFZA 1OWJA 3GCHB 4CRCA 1L1GA 1O3GA 1LHEH 1MTVA 2CV3A 2Y5GA 2F91A 3K65B 4INHA 4MPXA 1AIXH 2HALA 1GHVH 3LKWA 5TCCA 1BRUP 1HAVA 4XBBA 1DWBH 1LKBA 1FY1A 1TRNA 4LZ1H 1P01A 4Y8ZA 3TK9A 2HOBA 2ZNKH 1Z8RA 1GHZA 2B9LA 1UCYH 2AFQB 4GHTA 1O3AA 1KLJH 2GZ9A 4K3JA 1D3QB 3CP7A 1YP9A 1MKXK 4Y0YE 4FU7A 4MNVA 1C4V2 3RXPA 2ZCKP 3P70B 1W8BH 1KXCA 4IMQA 4Y79A 1UTJA 2EI8A 4MNXA 4NFEA 4UD9H 9LPRA 1QRXA 2O8TA 4NIYA 4A1VA 1DSUA 2SGDE 2FWWA 2BZAA 2P8OB 5HYOA 2EI7A 1V2JT 8KME2 4ZAEA 2G81E 1G2LA 4UDWH 4CHAB 3UIRA 1IQKA 1C2IA 1EPTC 1QA0A 4FUIA 4Z1MD 1MU6B 2P95A 2Y6TA 1T8LA 2ZGBH 1PQAA 3PO1C 3SV6A 1C2DA 3FN8A 4M9FA 4RI0A 1BRCE 1PQ5A 1K1PA 2YNBA 2ZTXA 1Y5BT 3SU2A 1UVSH 1OPHB 3PTBA 3V13A 1KY9A 1GJ9B 3CNRA 1UK3A 1IQFA 3SU6A 2FYRA 4WJG2 5FCRA 1GG6C 1THPB 1CSOE 3W95A 4HG6A 3LC5A 1DWEH 4MPVA 1VR1H 2F9UA 2VIDA 4XE4A 2FOFA 1YGCH 3S69A 5A0BA 4F55A 3UOPA 4A92A 3E0NB 2OBQA 3OSYA 3A7WA 2V6NA 5EQSA 5LPFA 1BOQA 1O39A 3RC6A 3SBKA 1CHOF 2XTTB 1MBQA 2QAAA 1GVKB 1GJDB 5DP3A 2BD3A 1SGEE 1XM1A 1L0ZA 2QXJA 2BVXH 1O3FA 2M2AA 3SORA 1E35B 2WSSD 1COWD 1S84A 3RU4E 3A82A 1YPMH 1C2HA 3FZDA 5EXLA 5PTPA 2OC8A 1KDQB 2VVCA 5AFZH 2XWBI 1TOMH 4HGCA 5K0HA 3UR9A 2OC0A 1Y59T 1TRYA 1TMTH 3KQEA 3UB0A 2BXUH 5EQRA 5EODA 4AC9A 3SNDA 4IW4E 1YPLH 4O97A 1HAXB 3QUMP 1QJ1B 4FU9A 4NIXA 3ZZ9A 2VH6A 1QBNA 1SC8U 1GGDC 1S85A 2BY8X 1GI1A 2VB0A 3BSQA 3ATWA 3CS7A
chains in the Genus database with same CATH topology
4VGCB 3LIWA 2F9PA 4ZKSU 3A7YA 5FPYA 2ILNA 4UFGH 1J17T 1TPAE 2JH6D 2RA0A 1ZR0A 1HRTH 1EKBB 4X2VA 4JZDH 4I33A 1ELGA 2ZGCA 3EGKH 4GPGA 3KIDU 1NN6A 3W94A 2C8XB 1FUJA 1OP2A 2FM2A 1JIRA 2FI5E 1OYTH 3QTVH 1O3HA 5LGOA 3A8DA 3BG8A 3SNAA 1UVOA 4WVPE 1C1WH 2GGVB 3FP8E 1CA0C 3EAJA 1TWXB 3OU0A 3HKIB 1O5EH 3STJA 1BB0B 1PPEE 3ATKA 1Y3XA 1ZJKA 3LGIA 3P8OA 1NRQH 2EI6A 3SNBA 2ZU2A 4JK5A 1QY6A 1RGQA 4TWWA 4UONA 3FAOA 1PPHE 2G00A 2BLWA 4NA7A 3SV8A 1EB2A 1YPEH 1NT1A 5JDUB 1AFEH 1GVLA 2R3YA 4U32A 3D23A 3MNSA 5TJXA 1O3KA 3A8AA 1BTPA 4NGAH 1T31A 1GBAA 2QXIA 4GHQA 2STAE 1GVZA 1V2PT 3GY5A 3PMBB 2A4GA 4B1TA 4Y10E 4Q2KA 5F03A 1O2ZA 2BOHB 4A6LA 1V2OT 2P93A 4BANB 1D3DB 1XUIA 2CJIA 2FESH 3TU7H 2Q6FA 1X7AC 3K2UA 2CMYA 3P8FA 1QCPA 3SW2B 1P2OA 3DHKH 6GCHG 4WMEA 1EJNA 3FP7E 1GI4A 3TGKE 4PROA 1HNEE 1WBGB 1HBTH 5F6MA 1MKXH 1THSH 1GJCB 2R9PA 3LDXH 3IWMA 1IQNA 1SQOA 1PPCE 4DJZB 3PWBA 4ZHMU 1N8OB 1HAGE 1FJSA 1U6QA 2A1DB 4X6NA 1KIGH 5HM9A 1ETSH 4ZROA 1O3DA 1TA6A 1ELCA 1Y3WA 1GHAG 1C5LH 2WPKS 1EZQA 1FN6A 3RXLA 1DM4B 3I77A 2HRVA 4IS5A 4ZUHA 3ZVCA 2PUQH 1GI3A 1T4UH 3F9FA 3GCTG 3V12A 1ZTLA 2GMTB 1B5GH 1W2KH 4A1TA 2OP9A 3SNCA 4X1QU 2VGCC 1QURH 3UTUH 3L33A 3U8TH 3QZRA 4ABBA 1ARCA 4NG9H 5J4QA 3PLKA 1TMBH 4XFQA 3NUMA 3GDUA 1CBWB 1CGHA 1LVYA 2ZFQH 1PPGE 3F1SB 3M37A 2DE9A 2UUFB 1RJXB 4AGKA 1PYTC 2BOKA 1C5MD 2SGAA 3HK6B 4YLUA 1ZRBA 4ISIH 3E91A 2FP7B 2OUAA 2J9NA 3ZZ6A 3URCA 2AH4X 6CHAC 1XVMA 1SGFG 3S9BA 3SO3A 1QJ7B 2F9VA 5T6FA 3O8DA 3VPKA 2PWXA 4B2AA 1G36A 2B0FA 1S83A 2GV7A 4DGJA 1V2NT 1N6YA 2W26A 2ZG0H 3NPSA 4MG3A 1YPGH 2TGDA 2JKHA 1TPPA 1VGCC 3SU1A 1NO9H 1WTHD 2ZI2H 1WUNH 1SQAA 1NFWA 4YOIA 3A86A 1LVMA 4KELA 2FPZA 3GCNA 3SJKA 3DA9B 1HGTH 1P10A 1O2YA 3F9EA 4NZQA 1B0EA 1DT2A 4FVDA 1MH0A 1GJ5H 3WY8A 1GCTC 1UTOA 3RU4D 5FPTA 1OWDA 3U9AH 1EASA 3MU5A 4ABJA 4ABGA 2NWNA 3EQ0H 5CMXH 2PKAB 4Y11E 4BAQB 4AN7A 5C2ZA 3PMJA 1ESBA 1J14A 4UFDH 3DFLA 1DDJA 1UHBB 3TVJB 1OKXA 5EQQA 3EA9A 3H5CB 1A3EH 1LVOA 3PROA 4MVNA 1IQIA 2NU0E 1O3MA 1G3CA 3RXIA 2WUBA 2J92A 2PKSC 4AG1A 1AN1E 2ODPA 1GL1A 2RG3A 1NM6A 4KKDA 3ZVGA 1O31A 5ABWA 4B2BA 1LVBA 1DWDH 4K1EA 4CBNA 4GLYA 1FAXA 1O3CA 1O37A 2IJOB 4LOYH 4WH8A 4JMYA 2GKVE 5DP7A 2TIOA 5LH8A 1GJ8B 2RCEA 4TYDA 1K2I1 1SGRE 3BTKE 3DD2H 2OINA 3MWIU 1O5BB 4Q7YA 1SOZA 1NRSH 2QXGA 1AVXA 3TNTA 2XC0A 2A2QH 3KL6A 1TABE 3SN8A 3LJJA 2BDYA 2J38A 2G55A 3QDZB 1GJ4H 1MCVA 2B5TB 2QC2A 1J15A 2QY0B 1O3PB 3VEQB 4FXGH 3VFEA 2D2DA 1XUHA 2LIZA 3UQOA 5A2MH 2BLOA 3HGPA 5HXFA 3Q3KA 1V2UT 5C5NA 1EAUA 3SGAE 1FPHH 3BIVH 3BG4B 4MPWA 5DGJA 1FV9A 5GPIB 3TIUA 1KTTB 2PR3A 3T28A 1SBWA 2Y7ZA 1S6FA 1WTGH 1SSXA 3MU8A 2F3CE 3GDSA 2FS8A 1GBKA 3T29A 3SJIA 2QF0A 2R0LA 2H5DA 2C3SA 2BQWB 5DK1A 4FUFA 1O5GH 2BDHA 1EP6A 1O2PA 1O2SA 1W11U 1VCWA 1O2MA 2OQ5A 3A7TA 2HGTH 4Z6AH 1ETTH 4JCNA 1QB1A 3P17H 2WUCA 2PTCE 5A8ZA 2JETC 2R3UA 3GY8A 1EP5A 1F92A 3RXJA 1FXYA 1P9UA 4RSPA 2C4FH 1MTUA 1O2RA 4ASHA 4X6OA 3VGCB 1O2GH 2IN2A 2RDLA 2O9QA 3NCLA 1LCYA 4CRDA 1UTMA 1DVAH 5HMAA 3GOVB 4UE7H 3SJOA 1SL3A 3EYDA 2V3OH 1BTXA 3TH3H 2RA3A 3FVFB 1GI8B 4DURA 4AORA 1C5YB 3PMAB 1UTNA 4ZXYH 1KLTA 3M7TA 1P3EA 1AFQC 4D7FA 4IN1A 1P2KA 1E37B 2GVFA 1L4DA 3AAVA 1DSTA 2FOAA 1C2MA 2C8WB 2BLVA 3RXSA 2G5VA 2ANYA 1GI9B 3RXKA 1V2ST 2XCFA 3PB1E 2G4UA 3SI3H 1P2MA 1BCUH 2BD7A 4CRBA 1E36B 1GI2A 2WPJS 1P04A 2UWOA 4B71A 1H9LB 4X1RU 4AFSA 3E3TA 1YPJH 4Y7AA 1C9PA 2R0KA 2ZQ2A 4X2XA 3ZZBA 2Q6DA 4E06H 1JMOH 1AVWA 1GHXH 1Q3XA 2OC7A 3KCGH 3T5FH 2A4QA 2A31A 5FBIA 5EPYA 1HJAB 4VGCC 3LGUA 2Z3DA 4H42U 4A7IB 4FUCA 1A0LA 1D3PB 1A1RA 3GYMA 4BOHA 3BTGE 3M3VA 1MTSA 4OS6A 4YOGA 2CHAC 4XOJA 5DG6A 2BM2A 4NSVA 4A5TS 1XKAC 2ZU3A 2ZDNA 4IGDA 1QHRB 1AE8H 1TGSZ 2LPRA 1B7XB 3U1JB 1C4U2 2ZDVH 1T8MA 2FTLE 2NU4E 5AFYH 5J4SA 2HPPH 1GI7B 3ATIA 1O3OA 3SUDA 3GCOA 2TRMA 8ESTE 2HNTC 2A0QB 2XW9A 5K7RA 1C1VH 1C5SA 3FP6E 1TGTA 1TX7A 5T6GA 3ELAH 5L2YH 1ZZZA 2FZZA 3ZVAA 1DXWA 3O8BA 4D9RA 2ZHDA 1XMNB 1MTNC 1DANH 1GHWH 1QQUA 1DFPA 2H9HA 3SUFA 2C8ZB 1ABIH 2Q6GA 1HCGA 1HXFH 1L1JA 1F5KU 1A5GH 3TJUA 3A81A 1BBRH 1P03A 3DFJA 1C5TA 3ZZ5A 1TQ0B 5DJ7A 3RXEA 1SR5C 3BEFB 2BDBA 3A7ZA 3P8NA 1MBMA 2FXRA 2HNTF 3RMNH 1ANBA 1K1IA 1GHYH 2GCTC 1H9IE 3BTME 4INKA 2XC5A 3MH5A 1FY5A 1XKBC 1THRH 3Q77A 3O8RA 2K7XA 2ALVA 1ESAA 3RMLH 2ZPSA 3UQVA 1GMDG 1HIAB 1Z6JH 4FUEA 4NFFA 3ZVDA 5AF9H 3D49H 4BXSA 5F8XA 4I8JA 2OLGA 2ZFRH 5T3HA 2QIQA 1ID5H 1T7CA 2XC4A 1W12U 1BMMH 3SUEA 1T8NA 2PSYA 4AFQA 4ESTE 1BRBE 5JB9S 2WPHS 2ZTZA 4J1YA 1IHSH 2QXHA 2FI3E 1O32A 3EE0B 5DP5A 4DIHH 1QR3E 3TH2H 1SGDE 1OXGA 4K5ZA 1DPOA 1MZAA 1ELBA 2AIQA 1E0FD 4X0WU 1UVUH 2OC1A 4A1XA 1O3IA 1GJAB 1G30B 3BIUH 5EOKA 5C67A 3VB7A 4X2WA 2A2XH 1TALA 5C5OA 1INCA 1UCYE 1GDQA 1SGFA 2G8TA 2IOTA 2ZA5A 1YC0A 2TPIZ 4XSKU 2AGGX 4MNWA 3UOUA 2A32A 3V3MA 1QBOA 1LPKB 4K69A 2O8MA 1RIWB 1XUFA 3EA7A 2ZU4A 4RKOB 1WYKA 1AB9C 1V2TT 1TGNA 1XXFA 4AB9A 3UWJH 1O30A 1Y8TA 2PW8H 3S9CA 1FIZA 4INLA 3E6PH 1F5LA 1TNLA 1ARBA 1KYNA 4YESB 2BD9A 1JOUB 1ELEE 4CR5A 2FDAA 5E8EH 3SU3A 3T26A 4JZ1A 3UPEA 4XDEA 1H8IH 2VWNA 1CGIE 4AYYB 5JBTA 4ABFA 1J8AA 1G3BA 1W7XH 1L2EA 5GWZA 1ZGIA 3PMHB 1TYNA 2VVUA 2EEKA 1HJ8A 1LHGH 4CH8B 3BTTE 1TBRH 1FMGA 1CGJE 1A0HB 1MUEB 2CGAA 1TBZH 1LHCH 3MI4A 1O2KA 1TFXA 3M36A 2FTMA 3JZ2B 4MNYA 4X8VH 2BY5X 2FLRH 2FOCA 1K9OE 3P8GA 3M7UA 3OY5U 1O2WA 4GCHF 1OWEA 2PTNA 2H9EH 1BRAA 1C1PA 5JBBS 3TGIE 1QRZA 1O2LA 2VWOA 1TE0A 5EW2H 4Q80A 3TJOA 3UY9A 3PWCA 2WPMS 2CXVA 4GCHG 1JXPA 4SGAE 7ESTE 1LDTT 5L30H 1QGFA 1V2WT 4DG4A 1AGJA 1EJAA 3ZVBA 1CA8B 1TRMA 4NZLA 3AASA 1QB6A 3M5OA 5A8XA 2A5KA 3DUXH 3MOCA 1QBVH 1UVPA 4NA8A 3T25A 2BY7X 1FN8A 1P12E 3ZZCA 2LNCA 2Z7FE 2OCVB 1ZMLA 1BTHH 1O2JA 3C27B 1UK4A 3AW1A 1HAYB 1SFQB 3NWUA 6GCHF 3QN7A 3QO6A 1HAZB 3F68H 4NIVA 1O3BA 2M5TA 4BAMB 4X1NU 2J95A 2BD2A 3ZV8A 1HAPH 4KTCA 1TA2A 1MAXA 3UNRA 1M9UA 3BN9A 2QV1A 1LQEA 1VJAU 2ZPRA 3Q00A 4TWYA 2PSXA 1NU7B 3SZNA 1EPTB 2FOGA 1E34B 1Y5UT 3A80A 3MH7A 4WXVA 1QNJA 1G3DA 1FIWA 2FX6A 3MU0A 4F49A 1GHAF 2GCHF 2ZP0H 3D62A 1DY8A 1EZUC 3ZYDA 1DE7H 2GP9B 2P3UB 3RXCA 5EXMA 1D6WA 4I31A 1JRSA 1V2MT 1C2LA 1ZYOA 2UUYA 1PYTD 1F2SE 1GMHF 1F5RA 3GCTF 5JBCS 4Z0KA 2G4TA 1GG6B 2GCHG 4ABIA 1AKSB 5GJ4B 4UEHH 3B8JA 3BG4C 4AG2A 4AB8A 1DS2E 1T8OA 3T62A 1BMLA 4X6MA 4BTIB 1GMHG 1AD8H 1V2LT 1W13U 1SHHB 3LC3A 5JYIA 3F6UH 1C1TA 3SGQE 1JBUH 5JBAS 1B0FA 1MCTA 5C3NA 1SPJA 5DO4H 3URDA 3S0NA 2GX4A 1C2GA 1O3NA 4LZ4B 3LGYA 5DP8A 3ZZ8A 2NU2E 4ISOA 1YPHC 1J9CH 1XXDA 1S0QA 1SGPE 3AAUA 2UWLA 1FY4A 3NKKA 1C2KA 3PLBA 1EAIA 1TPOA 1NFXA 1C5NH 2R2WU 1FDPA 2Y81A 2DE8A 5C1XA 1DXPA 1FQ3A 1IQLA 3TNSA 2G52A 3HK3B 2VIQA 1RTKA 4DIIH 5G4BA 2W5EA 1ESTA 1BUIA 2Y80A 1F0TA 3KQDA 5SGAE 1S6HA 1KXFA 1YCPK 2PGBB 4NSYA 1TB6H 1KLIH 1Z8IB 3ITIA 4ISNA 1YBWA 3GY2A 4NCYA 4KTSA 1BQYA 1GWAA 1TGCA 4MDSA 1MD8A 1N6XA 5EU8A 1AE5A 1XVOA 1EB1H 1C5RA 2FLBH 2P59A 2ZDMA 3O8CA 3KF2A 1K28D 1GGDB 3MO6A 1OSSA 2A7HA 1C5PA 2BY6X 3QZQA 3E90B 1LTOA 5GXPA 1QTFA 1QA7A 2ZQ1A 3LJOA 3H7TA 1A4WH 2ZGHA 4E7RG 4ZMAH 2EC9H 1VJ9U 4WMDA 1ZPCA 2QCYA 1LO6A 5FHTA 4ZH8A 1V2VT 1PQ7A 2P3TB 3RXBA 1HFDA 1V2QT 1P2IA 3ZZDA 4FU8A 3KNXA 3RXDA 2WINI 2B8OH 3GDVA 1GDNA 1ANEA 1CHGA 1K1OA 2QF3A 1ETRH 1EZXC 4DOQA 3ESTA 1CA0B 2AEIH 2VU8E 1AWFH 5EPNA 4Y76A 1KDQA 1XX9A 3OYPA 1Y3YA 2FO9A 1BJUA 1QL9A 3QWCH 4DVAU 3RXRA 4OS1A 3SI4H 4X8TH 2ZDLA 2A5IA 4Y0ZE 5I25A 4ISLA 4Y6DA 5LPRA 2Z3EA 4CRFA 5E0GA 2XBVA 1SLWB 2Z6BD 3GCHC 1SFIA 2GTBA 3STIA 1Z1JA 1NU9A 1HXEH 4WXIA 3SU5A 4JZEH 1RXPA 4H4FA 4YZUA 1XUKA 2FI4E 3RLYH 1WCZA 2ZF0H 1L1NA 1LHDH 1BITA 1H1BA 3SGBE 3M61U 2B7DH 1MKWK 3A84A 3V7TA 1SG8B 5FX6A 3RXAA 4CBOA 2KAIB 4X1PU 1HYLA 1O2UA 3S9AA 1EXFA 3NXPA 1PFXC 1DX5M 1GBHA 1L4ZA 6ESTA 2G51A 4JZIA 1QQ4A 5DPAA 2BDCA 2ZO3H 1A46H 2ZFPH 1P2QA 2ZKSA 1BHXB 5JPMH 3L3TA 2P3FH 2PHBA 1OWIA 3JZ1B 1BTYA 3SV7A 1SGNE 2P8OC 4FUHA 4K8BA 3KHVA 1C2FA 2GV6A 1D9IA 2BVRH 4BAKB 3HKJB 1LQDB 4WY3A 3RXUA 4CHAC 2K1QA 1H8DH 1HV7A 2CF8H 2W3KA 1GMCF 2WV4A