4YOIA

Structure of hku4 3clpro bound to non-covalent inhibitor 1a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
306
Chain Sequence
b'SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
molecule tags Hydrolase/hydrolase inhibitor
total genus 91
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yoiA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yoiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yoiA02
4NCYA 2VVVA 2QAAA 1J9CH 4FU9A 4ISLA 4IBLH 2HNTC 1KXEA 1MKWK 1T8MA 3A81A 2Y5HA 1ELTA 1GBIA 1P11E 1K1PA 4UE7H 1A5GH 1C2GA 1P03A 2UUJB 2BQ7B 4I8JA 3O8DA 1EZXC 2PKSB 4D7GA 1DLKB 1GJDB 1YM0A 2GT8A 5EGMA 3QN7A 3L33A 3E0PB 5CHAB 2ZFTA 1HXEH 4NIVA 3DT0H 4UD9H 6GCHG 2VINA 3U8RH 3RXFA 4CR5A 1AB9C 4O97A 4CHAC 1THRH 4MPXA 3T29A 1WBGB 1QB9A 1GJ5H 1SHYA 1P2NA 1IQFA 5LPEA 1EAWA 3H5CB 1FY4A 1FIWA 2B7DH 1P8VC 4H6TA 3H7OA 4KGAA 4GAWA 2O8LA 4HZHA 4ISIH 3M37A 4M7GA 4CH8B 1N6YA 2Z9JA 3T5FH 2ZGCA 1Q3XA 2VIOA 4FUJA 4DIHH 2ZDVH 3SQHE 3AW1A 4I32A 4WMFA 2PKSC 1O2GH 2F9VA 3GCHB 1TPOA 4DG4A 3KCGH 2JKHA 3RXSA 3TNTA 8ESTE 4B74A 5CHAC 4K69A 1O3IA 1O2XA 1O2KA 3Q3XA 1SGIB 4FUFA 1P57B 4J1YA 1XKBC 1AGJA 2GD4B 4ZUHA 2BOKA 1BBRH 1C4Y2 1K1OA 3C1KA 2FPZA 2WPHS 4Q2KA 1M9UA 2OP9A 3EA9A 1P04A 2RDLA 1JRSA 5EXMA 1O34A 1ZZZA 2NU2E 3MH7A 4UDWH 4ZMAH 4FU7A 1MTNB 1ELFA 3AW0A 3LGYA 1F0UA 3MNXA 1P2KA 9LPRA 1VCPA 4FUHA 1Y3VA 1W3CA 4TWWA 1MTUA 1VITH 4X2YA 1XKAC 2W7UA 2ZI2H 3TGJE 2ILNA 2H2ZA 2ZG0H 1O2IA 5PTPA 3PLBA 2ZTYA 3UOUA 1NM6A 4Y8XA 1S81A 3ZVFA 2NU4E 1GI4A 3ATWA 1BQYA 2PGBB 1L0ZA 1UCYH 2PKAA 1BCUH 1EJNA 3SNAA 3K6ZA 3RXHA 3T28A 2QXJA 3MFJA 1H9IE 4ZXXH 1Y5AT 1K2I1 1YKTA 3HK3B 4X0WU 2O9QA 1MTNC 1O3KA 3SV2H 1O5CB 3GOVB 1DOJA 1FJSA 4E7NA 4ABDA 2XBWA 4QT8C 1SOZA 4Y8ZA 1PQ8A 4O3TA 2SGEE 4YESB 3Q77A 1Q31A 1QQUA 1Y3UA 7GCHF 4YLQH 1AD8H 1NZQH 1UVUH 3D49H 1GI2A 4IMZA 5HXFA 3LGVA 1LVBA 2GVFA 1GBFA 1KXBA 1AUTC 2ZA5A 2BVXH 1W8BH 2HWLB 2WINI 2VGCB 1F7ZA 2AYWA 4CRCA 3TIUA 4X6PA 1GJAB 3RMOH 1PPFE 3TJVA 3PMAB 3FP6E 2FI5E 2IPHA 4X1QU 1HJAB 1NPMA 3BTTE 2ZU2A 4WMDA 1G3EA 1OWJA 1PPBH 1P3CA 2Y7XA 3KL6A 3PB1E 4UEHH 1G32B 2VIPA 1CT2E 3FANA 4XBDA 2DE8A 3SUEA 1QCPA 2CXVA 2FLBH 1WUNH 2VB0A 1O2UA 4RKOB 1QBVH 2GV7A 4I7YH 1PPZA 1K1IA 1Z6JH 4O9VA 1GBEA 2ZIQH 4ZHLU 1LQDB 5ESBA 2ODYB 4Y79A 2WYGA 3EAJA 3ZZBA 3ZVCA 1BJVA 2VGCC 2ZGBH 5DGJA 1C5OH 1V2KT 2HALA 4TY6A 1V2ST 1V2TT 2BD7A 4D9RA 3STIA 1SSXA 3ZZAA 4Y71A 1IQLA 3VGCB 1OKXA 4A1XA 1EATA 1P2IA 1XXFA 5FHTA 1KLIH 1GBMA 2ZFQH 2PR3A 5DPAA 2WV5A 4A7IB 1ZPCA 1HJAC 1C5PA 2XC4A 1A46H 3OYPA 1W2KH 1HIAA 5EPNA 1SQTA 1EPTA 3A8BA 3S9AA 3GY3A 4NWLA 1SGRE 4Y7AA 3K9XB 1TLDA 5T6DA 1GVKB 2XBYA 1O3BA 3UOPA 6CHAB 1EUFA 1WCZA 3A83A 4CBOA 3LH1A 1DWEH 3V13A 1AFQB 2PKAB 1B5GH 1MH0A 1FONA 2QN5T 4JMYA 4CREA 2ZFSA 3E3TA 5J4QA 1W14U 2VH0A 3Q00A 4CH2B 1Y3WA 1FY1A 2BD9A 1UTLM 1G3CA 2W3IA 3CS0A 4IGDA 4WXVA 5K7RA 3QTOH 1S82A 2SGDE 2H9HA 2QXHA 2V0BA 1HB0B 3PLKA 1EKBB 1C2KA 1ANBA 2BM2A 3QX5H 3FZZA 3RLWH 3RXPA 4A1VA 2XNIA 3SNDA 1P05A 3R3GB 4LK4A 4ESTE 4DCDA 2OTVA 5T3HA 3SU6A 2FS9A 1RJXB 3SGQE 2GCHF 1GBAA 5LGOA 1IQHA 3NWUA 1BRBE 3GCOA 5E0JA 1QJ7B 2ANWA 1P10A 2NWNA 3MO3A 5SGAE 3QLPH 4Q7ZA 1LPGB 1HAGE 1KY9A 2FOMB 1TBZH 2Q6FA 2BD2A 5JB9S 1TNHA 3AAUA 2BDGA 5HGGA 2PW8H 1S0RA 1GMHF 4OS7A 1HAHH 1YPEH 1GHZA 1IAUA 3CS7A 1O3FA 1XXDA 2I6QA 1AN1E 1LHCH 3M3SA 3BIVH 5TJXA 2BY9X 3A7TA 1O37A 4KP0A 1LTOA 2BD5A 3VB6A 2WPLS 2BHGA 1K21H 4DJZB 5DP3A 1LPZB 1Z6EA 3GY4A 2OXSA 1EJMA 1SHHB 1VGCB 5E2PA 2P16A 1HXFH 4YTAA 1W0YH 2FWWA 3C27B 3BF6H 2W26A 1EQ9A 1ANEA 1YCPM 2ZTXA 1AU8A 2OC7A 4FVBA 2FOEA 2G4UA 4GSOA 1JWTA 3HKJB 2Y5FA 3SU4A 2W5EA 1N6XA 4VGCB 2PV9B 2YOLA 5DP4A 1TRYA 1CGJE 2BD4A 3ZZ6A 3BG4C 5GIBA 5FAHA 5DG6A 4KTUA 4NIWA 1O3HA 4FUBA 3P8OA 2FYQA 1HIAB 4MNXA 4R0IA 1NESE 1EPTB 1S84A 4XSKU 3KIDU 4K60A 3KGPA 3T27A 1DWDH 1JRTA 1TFXA 1DXWA 1UTMA 1C2IA 4JZ1A 3PMHB 1F0SA 1YPGH 1ZTLA 2A4GA 2XC5A 1MTVA 1ABIH 3HKIB 1SGQE 1O5FH 4LOYH 1AWFH 2FX6A 4E7RG 2ZFPH 1XUGA 1K1MA 1KLJH 1MTSA 1GPZA 2FMJA 4AFZA 4YLUA 2H5DA 2O8MA 4GVUA 1Z1IA 4X6MA 2F83A 1BOQA 1ZOMA 1GHAF 1SGCA 2ZHDA 1MBMA 2TGPZ 5GJ4B 2F91A 3ODDA 2FI3E 1TRNA 2A5IA 4D9QA 2BVSH 4NIYA 2GZ9A 1SI5H 1EPTC 1ZR0A 1CHGA 4JZIA 4DIIH 3ENSB 2OC8A 3U98H 3VB4A 3ZZ4A 3BG8A 1C1MA 1F92A 3CENA 3LGWA 4INKA 4NG9H 1ZRKA 3M7QA 1P01A 1IQNA 2Z6BD 1DFPA 5EXNA 3PM3A 2JH0D 4I33A 4YZUA 2ZU1A 1RTLA 4MPWA 1XX9A 2Y5GA 3QK1A 1S5SA 1XUJA 1DANH 1O3EA 1QFKH 1C9TA 3UQOA 1EASA 5EW2H 4AYVB 1BMNH 1MZAA 4CRGA 1Y5UT 2AIPA 1TBQH 2IN2A 1MMJN 1GCTB 2ZHEH 2GMTB 4B73A 5JB8S 1VCWA 4NA7A 3S0NA 2FOBA 4MG3A 2ZCLP 1G2MA 1AIXH 1C5UA 2LNCA 3SGBE 2XXLA 4X1RU 3MNCA 3NUMA 2F9OA 3B8JA 1TRMA 3BTWE 1C2EA 4WVPE 2PTNA 1EOLA 1GJ7B 1DSUA 1AZ8A 4NGAH 3ZZ3A 2AIQA 1O3MA 1YBWA 4X8TH 1YPHC 1P02A 1TB6H 1P9SA 4ZKNU 2CV3A 4NSVA 3NZIA 4ZKRU 1O2OA 1TQ7B 3EA7A 5C1YA 4E05H 1A61H 5G4BA 1GMDG 2PLXA 2ANMH 1EP5A 1A1RA 2G5NA 1GJ6A 3MU5A 1G3BA 4ZKOU 3RXGA 2J95A 2XBVA 1E0FD 2G00A 1UJ1A 3M5OA 5JBAS 1TAWA 4YM9A 1VITG 1HJ8A 1HLTH 4D76A 2I6SA 1ELAA 2H9EH 1O3AA 1O3OA 3U8TH 4WMEA 2OINA 1CA0B 2UWLA 5FCKA 3F68H 1NROH 2XC0A 5LH8A 1IQIA 6GCHF 1T32A 1KXDA 2FP7B 5T6GA 1DICA 3AVZA 1VJAU 5EQSA 3RM2H 1G2LA 1SB1H 3MH5A 3SQEE 2A4RA 8LPRA 3FP8E 2FI4E 4XE4A 1YPHE 1GI6A 1ZGIA 4AB8A 1DUEA 1EB2A 1ELEE 3BN9A 4GUXA 4TPIZ 2GCTB 1K1LA 1A3BH 4IC5A 1GI0A 2FO9A 1KIGH 4HI3A 4KTCA 3EQ0H 4K5ZA 2OQUA 3ATKA 1FPCH 1O36A 1V2NT 2PUQH 5C20A 4X6NA 1CA0C 1ELVA 2P59A 3ATLA 3SHCH 5EQRA 2J9NA 3AASA 1NRSH 2JETC 4H6SB 4IC6A 4X1SU 1DLEA 1SR5C 2NU1E 3ZZ9A 1KXFA 1NFYA 1SGPE 2BDCA 4GCHG 3SNEA 4ISHH 1WSSH 1TPSA 3QGNB 2RG3A 2FODA 3SJ8A 3A7VA 1XUIA 2GCTC 8KME2 1IHSH 5DK1A 1AB9B 3ZZDA 1C5LH 1D3DB 2R3UA 2J4IA 4BAHB 1P2OA 4ASHA 4BANB 2UWOA 1BIOA 2GKVE 1AHTH 1CQQA 1Y8TA 3SO3A 3URCA 2BZAA 4ZH8A 1Y3YA 3TH2H 5C67A 4WY3A 1D6RA 2H6MA 3LGTA 4ABHA 5AF9H 1UCYE 3RC6A 2Y6TA 1SLXB 1TMUH 4IN1A 4RKJB 3PWBA 2D26C 1FY3A 1BA8B 4WJG2 3BEUA 5GCHG 1O3GA 1YPMH 4ZROA 1ZYOA 3SUDA 5FPSA 1V2MT 2HVXA 2OC0A 2V6NA 2XWBI 4GHTA 4B76A 5GPIB 2Y81A 2GT7A 3UR6A 1L1GA 1L4ZA 1GJCB 2C93B 1P09A 3NKKA 4Q7YA 2PSXA 1VZQH 2D1JA 2FOGA 1AKSA 1F0RA 4I8KA 1A5HA 2Z7FE 4DVAU 1SL3A 3MO9A 3DD2H 1QL9A 1F0TA 3PTBA 1QL8A 4ZHAA 4INLA 4AFUA 5A0AE 4HTCH 4K1EA 2K7XA 1HUTH 1QA0A 2A7CA 3BTHE 1C1WH 1TONA 5F8XA 2BXUH 1YGCH 1SQAA 1CT0E 3TU7H 2CJIA 2R0KA 1O2RA 5EPYA 1PJPA 5E8EH 1B0EA 1P0SH 2ZDKA 4H42U 3LKWA 4X8SH 5DP8A 2ZU3A 4JYUH 5ABWA 2AGEX 4IS5A 4AG2A 1TGTA 2ALVA 1O5DH 4FUDA 2ANKH 2DE9A 3MNBA 2NU0E 1AWHB 1MKXH 1HAYB 4BAOB 5AHGH 1JXPA 4DT7B 2R3YA 5DO4H 2FS8A 2STBE 3LJOA 4X2VA 1BTHH 2FYRA 2GV6A 2A31A 9ESTA 4YOJA 3SU0A 5BRRE 1GI9B 2ZU4A 1EZUC 1MQ5A 1QA7A 3G01A 3PLPA 2GZ8A 4OS4A 1TX7A 1EP6A 3SOSA 2TBSA 2HGTH 1YPJH 3HGNA 2Z9IA 2Z3DA 5IDKA 1RIWC 1NO9H 3U1JB 2M5TA 4BTTB 1GJBB 5AFYH 3LPRA 1P3EA 3S9BA 3O8BA 2FM2A 1O2ZA 1O2VA 1FIZA 4K1SA 1SGFG 2WUBA 4B2AA 2RA3A 1ARCA 1TPAE 2LPRA 2FESH 4AFQA 4NZLA 6LPRA 5A8YA 1G37A 1TYNA 3QGJA 2GTBA 3ZVBA 3UFAA 4SGBE 2ZWLH 2IOTA 3TLOA 3ATMA 3SUFA 5FPYA 1GJ4H 3UWIA 2BDBA 2BDIA 1H8DH 1GBLA 2BY7X 2NU3E 2V35A 1L4DA 3SJOA 3MU0A 1GHBG 2BX3A 1O3JA 5DP7A 2QCYA 2H1UA 1ZHPA 4CR9A 1AKSB 1Z8GA 1YCPK 1WTHD 1LQEA 4DURA 1C4V2 2JH6D 1K1JA 3GDUA 3D62A 3A7ZA 4OS5A 3GYMA 4LZ4B 2Q6GA 1QJ1B 4J2YB 1XUFA 1OXGA 4H4FA 3P8GA 1UMAH 5FX5A 1GI3A 1NU9A 1O2SA 2G8TA 4MPUA 1O3CA 1OSSA 5J4SA 2FOFA 3R0FA 3L6PA 1UVTH 4JYVH 1FN6A 1ESBA 1XUKA 1LHEH 1O38A 2PTCE 4JK6A 2YNAA 2SFAA 3ZVGA 1MKWH 2R2MB 2C4FH 5E0GA 1FPHH 2ZP0H 4BAQB 1DITH 1D9IA 1PPEE 3RXKA 1THSH 4R8TB 1C4U2 1F5LA 1DSTA 5FBIA 1ZJDA 3UREA 1DT2A 1HAVA 2W7SA 1SGNE 5HMAA 1DPOA 3O8RA 1GGDC 1SPJA 1GVLA 2D2DA 3W94A 2CN0H 3A80A 2C90B 1KDQA 2FLRH 1NS3A 2XCNA 3RXLA 5BPEA 3BTQE 1HJ9A 1P2MA 3I29A 2AEIH 1ESTA 1O3PB 2ODQA 1THPB 3QZRA 2FEQH 1TE0A 1C1QA 1N8OC 1ZLRA 1TGNA 1UTJA 1UK2A 5JBCS 2Z94A 2DUCA 5FXLA 2W3KA 3M7UA 2ZFRH 4B71A 1UTKA 1EZQA 1O3LA 3KF2A 5AVDA 2TRMA 5IYTA 4X1PU 3FAOA 2ZDMA 4ISOA 1O30A 3M61U 1TMBH 3A7XA 3SJKA 2HOBA 1GDUA 2BY6X 1HRTH 1AVXA 1CT4E 1EJAA 2OUAA 4NZQA 3RXIA 1GCDA 2UUFB 1IQEA 2BXTH 2ZPSA 2A4QA 2ZCKP 2FTLE 2AMQA 3SUGA 3F9FA 4GHQA 2Y7ZA 3VEQB 1YP9A 2QA9E 3SU5A 2SGFE 3SV9A 2VIVA 2QXIA 4BXSA 3SU3A 1F5RA 3OX7U 1TPPA 2BZ6H 1C1PA 1FMGA 1H1BA 3UR9A 4ABFA 1OWHA 1OWDA 1YF4A 4D8NA 1NC6A 1MCVA 2HLCA 1JOUB 2VIWA 1DWCH 1NTPA 2C3SA 3BG4B 3SNCA 5L2YH 2H5CA 5L2ZH 4FUCA 2ALPA 3LC5A 1BZXE 1L1JA 1DX5M 1P2JA 1BDAA 5EODA 1A3EH 1W13U 3ZZ5A 4D7FA 1ZJKA 2SNWA 2KAIA 3MI4A 1O2TA 1O5EH 1QY6A 1F2SE 4NFEA 3U8OH 4UFGH 4MNWA 2ZC9H 2R2WU 1HAVB 1DUAA 4K2YA 3EBNA 2F9UA 2G51A 1D4PB 1C2DA 2A32A 3E6PH 1SVPA 2BY8X 1KDQB 4Z6AH 2ZZUH 3P8NA 1O33A 4CRAA 2WUCA 3TNSA 3MTYA 3JZ2B 1FXYA 4ZAEA 1BB0B 5LPFA 2QV1A 2QXGA 2A5AA 4UFEH 3V12A 2ZKSA 1YCPH 2G52A 1TX8A 3MWIU 1LDTT 2GX4A 1ESAA 1V2QT 2JH5D 5E2OA 1V2PT 1C9PA 1B7XB 3SW2B 1C5RA 3TITA 1WV7H 1E37B 1ANCA 1FY5A 3TJOA 5A0BA 2TGTA 1J16A 4XBCA 1BRCE 1ACBE 1OWKA 2AGIX 3A7YA 2BLVA 5H4IB 2AMDA 1GL1A 2ZCHP 3QZQA 3F6UH 5ETXA 3TK9A 4Y7BA 2SGPE 2CF8H 2BDAA 3GCTG 3RLYH 1PPGE 1GMDF 2G5VA 1TNJA 4GLYA 2QYIA 4NA9H 3A86A 1Y59T 3ZVEA 5A09A 1FLEE 3BTFE 2BYAX 2EEKA 2FOAA 1QBOA 4AORA 5C2ZA 5F03A 4O3UA 4BAKB 1VITF 2XTTB 1SGDE 2LIZA 1HYLA 1C1OA 1QRZA 1GI7B 1S83A 4TPYA 4ABIA 1SLWB 3P70B 2P95A 2HRVA 4FUIA 2EI8A 5GDSH 1UVSH 4OGYA 2A7JA 4HGCA 3PROA 1UTOA 1ZMLA 1C5MD 4K8BA 5I25A 1BHXF 1KSNA 2OLGA 1HFDA 1RTKA 1GHYH 2P3TB 3E91A 1O2JA 1O2PA 3SV8A 2ESTE 3HK6B 1FUJA 2QF0A 3SI3H 3K65B 1TBRH 3ZV9A 1UVOA 4F49A 1GMCG 2O8WA 4AN7A 4CRFA 4FUEA 4A6LA 5GWZA 1C1UH 4YO9A 1MD8A 2VJ1A 1SG8B 2CGAA 1FDPA 3SV7A 7ESTE 1TIOA 5JPMH 1YPLH 1GL0E 2A45B 3T25A 4UFFH 1PFXC 1FN8A 1O5BB 3B23B 3GY6A 1KLTA 1JIRA 2WPJS 1IQJA 1DS2E 1GBHA 3F9HA 3KQDA 1Z1JA 2SGQE 3W95A 1DVAH 5DP6A 5F6MA 3B9FH 1OX1A 3RXUA 1W12U 2ZDAH 1O5AB 1O5GH 1LVOA 2Z3CA 2BMGB 4GCHF 3BTGE 1NY22 1EXFA 2GGVB 3FFGA 4XOJA 1KTSB 1AUJA 2FIRH 3D65E 2PWXA 1O2YA 1ZSJA 1C1VH 4F4OC 3OY5U 3T62A 1ANDA 3VFEA 1ZHRA 1TQ0B 3SZNA 3A87A 1UTNA 3MH6A 3STJA 1C5NH 1WOFA 2P8OB 1FY8E 5C5NA 4DGJA 3TH3H 5JDUB 4LXBH 3F9GA 4KKDA 1QQ4A 1Y5BT 1O3DA 1C2FA 2H9TH 3RDZA 3ZZCA 3E0NB 2Q6DA 1BHXB 3TVJB 3PTNA 3TGKE 1C1RA 1G36A 1FZZA 1TNIA 2GDEH 3A8AA 3ELAH 1T8LA 2A1DB 2Z9LA 1TMTH 4XBBA 2A4OA 2K1QA 3A89A 2J94A 7KMEH 5DP5A 3BTME 3IITA 5GCHF 1IQKA 4DY7B 2B8OH 1MUEB 1E36B 2JETB 1C2LA 1GDQA 5JBTA 1LCYA 1BTWA 2ULLA 2VH6A 3KQCA 4ABAA 3GY2A 1AVGH 3M3TA 2P8OC 2UUKB 3UIRA 2ANYA 3IG6B 1BTZA 1ZSKA 2ZQ1A 5C5OA 3TK6A 4MVNA 4K8YA 3RXRA 3EYDA 4ABBA 5EW1H 4Y10E 4JYTA 2VU8E 4OGXA 3ZVAA 4TY7A 3H7TA 4ABJA 3I78A 1CSOE 1W10U 4FVDA 5TCAA 1DXPA 1UCYK 3OTJE 2PSYA 4OS2A 1NN6A 1ETSH 3M36A 1BBRE 1EAUA 2CF9H 2CHAB 3OY6U 5L6NH 3MNSA 4UFDH 1MQ6A 3A8CA 3SI4H 2V3OH 1HBTH 1YPKH 2EA3A 1ZMJA 1NRPH 1ZTJA 4U01A 3GDSA 1RGQA 3RXTA 2ZGHA 3MHWU 3SU2A 3MMGA 2BDYA 1SGFA 2J2UA 1ZSLA 1FAXA 3E1XB 4WWYA 3RP2A 2P3FH 3Q3YA 2AERH 1NFXA 3MH4A 4XFQA 2G55A 3RU4T 4IMQA 4ABEA 2VVCA 3RXMA 4BTIB 2WPKS 1S6HA 2R9PA 3F1SB 1BTPA 4WH8A 2CHAC 4AOQA 3MYWA 4OS1A 4Q7XA 2F9NA 3VPKA 1V2VT 1TOCB 3RUOA 5FX6A 1T7CA 3RMMH 1FAKH 1P06A 4Z0KA 4CRDA 1SGTA 1AI8H 2BX4A 1H9LB 3DFJA 1KXCA 3K2UA 1BTXA 1AO5A 1TGBA 1T8OA 1NFUA 1TWXB 2IJOB 2ZPRA 3TJUA 2F9BH 3M3VA 1O39A 1SOTA 4YOGA 1GWAA 1SFIA 1LKAA 3BEIB 1QIXB 2V3HH 4B2CA 1N1LA 2WV4A 1HAIH 4NWKA 2BQWB 3SJ9A 3S9CA 2Z9GA 5B6OA 1A0HB 3M35A 1JBUH 4TWYA 1WTGH 2XYAA 2VWNA 1GHBF 1MD7A 5C3NA 3SBKA 3S7HB 3BV9B 4Q80A 2G4TA 2A7HA 1TNGA 3PYHA 3ZYDA 1IOEA 2Y80A 3RC4A 5C1XA 5JYIA 1T8NA 1TNKA 1H8IH 1UTQA 1AQ7A 4A1TA 3PO1B 2AMPA 1MBQA 5GXPA 1IQGA 1V2OT 1RIWB 2VIQA 4AGJA 1QURH 1V6DA 3T2NA 3LH3A 1E34B 4RSPA 1YYY1 2EI7A 2VNTA 2XBXA 1S0QA 4MNYA 2ZTZA 1Z8IB 2HNTE 4KTSA 3LGUA 1C5QA 2BOHB 1SBWA 1KXAA 4CRBA 2J38A 1CU1A 2ZPQA 1G3DA 3RM0H 2AGGX 1KYNA 1CO7E 2G81E 2ZEBA 2XWAA 1SC8U 2D8WA 1LHDH 1AE5A 1CE5A 1O32A 3RXJA 1K28D 3CP7A 1C5TA 2P93A 3GICB 1QB6A 1BRAA 2Z9KA 3O8CA 3RXOA 1DY9A 1UHBA 3KEEA 1HNEE 3PO1C 1WAYB 1GBJA 2VWMA 1OYQA 2FOCA 1OYTH 1JMOH 3U9AH 4X8UH 2A2XH 3QUMP 3MO6A 1GBTA 4UONA 3A88A 1OP0A 4U32A 4ZHMU 2UWPA 3AAVA 3GCHC 3UY9A 1C5XB 4DW2U 1BMLA 1GBDA 1TOMH 2C8ZB 2HPQH 3QTVH 4TYDA 4AB9A 3N7OA 1T4UH 3DUXH 1GI1A 1OP2A 1TA2A 2ZQ2A 1BTYA 2ZGJA 4IN2A 1OS8A 3UNRA 1EAXA 1SQOA 4Y8YA 2ODPA 2PUXB 2QY0B 3M5NA 4JZDH 8GCHF 1BMMH 2B0FA 1DY8A 3PMJA 1XVOA 1ZTKA 4X2WA 3VXFH 4I8HA 3LU9B 1PYTC 1ETTH 1SGEE 1GGDB 1MTWA 1X7AC 3A7WA 1A5IA 3EE0B 1OWEA 1GHVH 1SLUB 4BAMB 1ABJH 3VXEH 3BTDE 4DOQA 1AVWA 2OQ5A 1ZHMA 3ZZ8A 1FNIA 1BT7A 3NCLA 1BJUA 1QR3E 1N8OB 1C5WB 3LJJA 1EOJA 2TGAA 2PFEA 3KQBA 3RXAA 1AY6H 1ARBA 3ITIA 3ODFA 3KQEA 3S69A 1QL7A 1TA6A 2ZGXH 1INCA 3JZ1B 1U6QA 4A5TS 3QO6A 1V2RT 4BOHA 3BTKE 4NFFA 3A82A 1OWIA 4I8GA 5HM9A 4JCNA 1VR1H 4X8VH 1GBKA 3TGIE 3EDXB 2AS9A 1WU1A 4MLFB 1YLDA 5EOKA 5AFZH 4RN6A 1O3NA 3DHKH 3A84A 3ZVDA 3TK5A 1L1NA 2OD3B 1E35B 2OC1A 1Z7KA 3RXVA 1CBWB 3VB7A 2R0LA 2PGQB 1PQ7A 5JBBS 3P92A 1SLVB 3RU4E 1UHBB 1WQVH 1VCQA 2Q1JA 2BLQA 1BITA 3LDXH 4YT7H 3GISB 1FQ3A 2SGAA 3BIUH 1C5SA 3GY8A 2RCEA 1OPHB 3ESTA 5C1UA 5K0HA 1QTFA 5EG4A 2FDAA 4BXWA 1V2LT 1UTPA 1GVZA 3PV4A 1OOKB 1H9HE 3ZV8A 3Q76A 8GCHG 1HAZB 3V7TA 1B0FA 1HV7A 1O2NA 1CVWH 3KNXA 4B1TA 1CBWC 5A8XA 2THFB 5EU8A 1E38B 4MQAA 3RXCA 2EI6A 1Y3XA 1WYKA 7GCHG 4I8LA 1IQMA 4OS6A 1HGTH 2A2QH 1A0LA 3RXDA 2XW9A 3VGCC 3GCTF 1FI8A 1P9UA 1G30B 1QRWA 3E90B 1MU6B 3LC3A 3URDA 3MU1A 3VB5A 4B2BA 3SHAH 5EXLA 1LHGH 1QJ6B 1S85A 3HGPA 1C1TA 4JZEH 1L2EA 4WH6A 4FXGH 5CE1A 3UWJH 1A4WH 5ESTE 1IHTH 1ETRH 1Z71A 1A7SA 1O2HA 1AMHA 2P3UB 3GDVA 6CHAC 1YLCA 4HFPB 3OSYA 4THNH 1AFQC 1LHFH 3IWMA 5DKMA 5FBEA 1C5ZB 3LONA 3UNQA 3BTEE 4MNVA 3SV6A 5F8TA 1V2WT 1RXPA 1ZRBA 1EX3A 2FTMA 2B9LA 2WPIS 5FPTA 1O2QA 2ZNKH 3MOCA 1DDJA 2TPIZ 1GMCF 1BUIA 1C2JA 1W7XH 3E8LA 1AZZA 1RTFB 1XMNB 1PQ5A 3RXEA 1O31A 1Z8RA 1ZMNA 2YNBA 1CGIE 1DWBH 3GCNA 4IW4E 1GJ8B 1P12E 5A8ZA 1NT1A 2GP9B 2AH4X 4X1NU 1TGSZ 1XUHA 2BB4A 4Y11E 1RS0A 1O2MA 3V3MA 2GZ7A 4BTUB 2OBQA 3NK8A 4WXIA 1PPHE 3LGIA 1KTTB 2FOHA 3FVFB 4KELA 2CMYA 4NIXA 4O03A 1D3PB 4YOIA 1QRXA 4LZ1H 1O35A 5A0CA 3BSQA 1HAPH 2TIOA 4Y0YE 1ORFA 1PQAA 2A0QB 1OP8A 1HAOH 1WQSA 1UK3A 2ZO3H 2C8WB 2UUYA 1NU7B 1RD3B 5F8ZA 4JK5A 1CHOF 1VGCC 2VIDA 3EA8A 1TABE 3FP7E 2FZZA 1NFWA 1D3QB 3NPSA 3SGAE 1C5VA 3TJNA 2OBOA 2ASUB 3MU4A 3P17H 2B5TB 3M5LA 2GCHG 1BTUA 1EAIA 4U2WA 1TALA 2BD8A 3RMNH 4VGCC 1LMWB 4XDEA 3M7TA 1HPGA 3RMLH 1LPKB 7LPRA 1LVYA 1DE7H 2BTCE 1SFQB 1Z8JB 3S7KB 3UUZA 2XCFA 1HCGA 3I77A 3V0XA 2FXRA 3U69H 1O0DH 3Q3KA 1C2HA 1C1SA 1SMFE 5L30H 4A92A 3PWCA 1GMHG 1MAXA 1ELDE 4Y76A 4ZKSU 1C1NA 4AZ2B 4K1TA 1XM1A 4MTBA 3A8DA 1EB1H 5E0HA 5I46H 1K9OE 1GJ9B 2KAIB 2XRCA 4MPVA 1J17T 2HPPH 1BMAA 1UVPA 1CGHA 5HM2A 2ZHFH 4GPGA 1TX6A 3P8FA 3SORA 3P95A 3D23A 4Y6DA 1ZGVA 1W11U 2F3CE 4FUGA 4ISNA 1MAYA 2O8UA 2VWOA 3HATH 1V3XA 3U1IB 1A2CH 4U30A 1O2LA 2A5KA 2ZF0H 4FU8A 2GDDA 1ELCA 1Q2WA 1P2QA 3UTUH 1GG6B 1VJ9U 4MDSA 2BQ6B 3GY5A 2BLOA 1T31A 1AE8H 4WF8A 4NSYA 3VB3A 3GY7A 2QGRA 2OCVB 2RA0A 1D6WA 5HYOA 1BRUP 1K22H 2F9PA 1CA8B 3RC5A 3TPIZ 4X2XA 2BLWA 2QF3A 3SN8A 1HAXB 3UNSA 4PROA 3DFLA 1QBNA 4INHA 4AYYB 3LIWA 1T4VH 1CHOG 2J34A 5CMXH 1A0JA 2O8TA 1J14A 3BEFB 2ZECA 5T6FA 1C2MA 2ZU5A 5DP9A 1ZPBA 1MCTA 1ZPZA 2BDHA 2HNTF 2VVUA 1RFNA 2ZDNA 1YC0A 1W0ZU 4I31A 5FCRA 4ZXYH 1GCTC 1BBRK 1NRQH 1PYTD 1D3TB 2STAE 2GMTC 1GHAG 4E06H 3RU4D 1GG6C 1J15A 1G9IE 1GHWH 2SNVA 3FZDA 4AFSA 2P94A 1HDTH 1J8AA 3UQVA 1JIMA 2J92A 1MKXK 4YT6H 2Y82A 4AG1A 3F9EA 3P6ZB 1QGFA 4K3JA 3LOXA 2ZHWH 2QIQA 1S6FA 3QDZB 4SGAE 2TGDA 1MZDA 1RRKA 1H4WA 2WYJA 4ABGA 3QWCH 4JZFH 3M5MA 2ZDLA 1O2WA 2AFQB 4B75A 2BD3A 4Y0ZE 2C8YB 1ELGA 3NXPA 3K6YA 3ZYEA 3SNBA 1LKBA 3RXQA 3PMBB 5LPRA 2BVRH 1UO6A 5EQQA 1ELBA 1NRRH 3HPTB 1K1NA 3LT3A 3TH4H 6ESTA 3KHVA 2ZFFH 1MU8B 1SGYE 2EC9H 3SU1A 1EZSC 1LVMA 1QNJA 1V2UT 1LO6A 1F5KU 1TNLA 1DM4B 3UPEA 2Z3EA 1GI8B 4X6OA 3A85A 4BNRA 1V2JT 1GHXH 5TCCA 3MU8A 5DJ7A 1GDNA 1ID5H 3OU0A 1TGCA 3E16B 1GI5A 3KN2A 3DA9B 1PPCE 1AFEH 3ZZ7A 3T26A 2VWLA 3L3TA 4AGKA 1GBBA 2FX4A 1FV9A 1UK4A 3EGKH 3ATIA 1QB1A 3SJIA 2ZHQH 2PHBA 5A2MH 1W7GH 4AX9H 4NA8A 1NRNH 2BY5X 3WY8A 1C5YB 1GBCA 2QC2A 2WPMS 4CBNA 1QHRB 3GYLB 3RXBA 4CHAB 1XVMA 2C8XB
chains in the Genus database with same CATH superfamily
4NCYA 2VVVA 2QAAA 1J9CH 4FU9A 4ISLA 4IBLH 2HNTC 1KXEA 1MKWK 1T8MA 3A81A 2Y5HA 1ELTA 1GBIA 1P11E 1K1PA 4UE7H 1A5GH 1C2GA 1P03A 2UUJB 2BQ7B 4I8JA 3O8DA 1EZXC 2PKSB 4D7GA 1DLKB 1GJDB 1YM0A 2GT8A 5EGMA 3QN7A 3L33A 3E0PB 5CHAB 2ZFTA 1HXEH 4NIVA 3DT0H 4UD9H 6GCHG 2VINA 3U8RH 3RXFA 4CR5A 1AB9C 4O97A 4CHAC 1THRH 4MPXA 4Q63A 3T29A 1W0JD 1WBGB 1QB9A 1GJ5H 1SHYA 1P2NA 1IQFA 5LPEA 1EAWA 3H5CB 1FY4A 1FIWA 2B7DH 1P8VC 4H6TA 1YY3A 2XOKD 3H7OA 4GAWA 4KGAA 2KCOA 2O8LA 4HZHA 4ISIH 3M37A 3KYGA 4M7GA 4CH8B 1N6YA 2Z9JA 3T5FH 2ZGCA 1Q3XA 2KCYA 2VIOA 4FUJA 4DIHH 2ZDVH 3SQHE 3AW1A 4I32A 4WMFA 2PKSC 1O2GH 2F9VA 3GCHB 1TPOA 4DG4A 2V7QD 3KCGH 2JKHA 3RXSA 3TNTA 8ESTE 4B74A 5CHAC 4K69A 1O3IA 1O2XA 1O2KA 3Q3XA 1SGIB 4FUFA 1P57B 5KGOA 4J1YA 2OK5A 3N7DA 1XKBC 1AGJA 2GD4B 4ZUHA 2BOKA 1BBRH 1C4Y2 1K1OA 3C1KA 2FPZA 2WPHS 3OE7D 4Q2KA 1M9UA 2OP9A 3EA9A 1P04A 2RDLA 1JRSA 5EXMA 1O34A 1ZZZA 2NU2E 3MH7A 4UDWH 4ZMAH 4FU7A 1MTNB 1ELFA 3AW0A 3LGYA 1F0UA 3MNXA 1P2KA 9LPRA 1VCPA 4FUHA 1Y3VA 1W3CA 4TWWA 3EE7A 1MTUA 1VITH 4X2YA 1XKAC 2W7UA 2YMSD 2ZI2H 3TGJE 2ILNA 2H2ZA 2ZG0H 1O2IA 5PTPA 3PLBA 2ZTYA 3UOUA 3SZEA 1NM6A 1W0KD 4Y8XA 1S81A 3ZVFA 2NU4E 1GI4A 3ATWA 1BQYA 2PGBB 1L0ZA 1UCYH 2PKAA 1BCUH 1EJNA 3SNAA 3K6ZA 3RXHA 3T28A 2QXJA 3MFJA 5CHBA 1H9IE 4ZXXH 1Y5AT 1K2I1 1YKTA 3HK3B 4X0WU 2O9QA 1MTNC 1O3KA 3SV2H 1O5CB 3DSOA 3GOVB 1DOJA 1FJSA 4E7NA 4ABDA 2XBWA 4QT8C 1SOZA 4Y8ZA 1PQ8A 4O3TA 2SGEE 4YESB 3Q77A 1Q31A 1QQUA 1Y3UA 7GCHF 4YLQH 1AD8H 1NZQH 1UVUH 3D49H 4B6FA 1GI2A 4IMZA 5HXFA 3LGVA 1LVBA 2GVFA 1GBFA 1KXBA 1AUTC 2ZA5A 2BVXH 1W8BH 2HWLB 2WINI 2VGCB 1F7ZA 2AYWA 4CRCA 3TIUA 4X6PA 1GJAB 3RMOH 1PPFE 3TJVA 3PMAB 3FP6E 2FI5E 1SKYE 2IPHA 4X1QU 1HJAB 1NPMA 3BTTE 2ZU2A 4WMDA 1G3EA 1OWJA 1PPBH 1P3CA 2Y7XA 3KL6A 3PB1E 4UEHH 1G32B 2VIPA 1CT2E 3FANA 4XBDA 1S6LA 2DE8A 3SUEA 1QCPA 2CXVA 2FLBH 1WUNH 2VB0A 1O2UA 4RKOB 1QBVH 2GV7A 4I7YH 1PPZA 1K1IA 1Z6JH 4O9VA 1GBEA 2ZIQH 4ZHLU 1LQDB 5ESBA 2ODYB 4Y79A 2WYGA 3EAJA 3ZZBA 3ZVCA 1BJVA 2VGCC 2ZGBH 5DGJA 1C5OH 1V2KT 2HALA 4TY6A 1V2ST 1V2TT 2BD7A 2QF4A 4D9RA 3STIA 1SSXA 3ZZAA 4Y71A 1IQLA 4RT1A 1NBME 3VGCB 1OKXA 4A1XA 4ASUD 1EATA 1P2IA 1XXFA 5FHTA 1KLIH 1GBMA 2ZFQH 4P02A 2PR3A 5DPAA 2WV5A 5DSFA 4A7IB 1ZPCA 1HJAC 1H8ED 3VG8A 5HIYA 1C5PA 2XC4A 1A46H 3OYPA 1W2KH 1HIAA 5EPNA 1SQTA 1EPTA 5HKKD 3A8BA 3S9AA 3GY3A 4NWLA 1SGRE 4Y7AA 3K9XB 1TLDA 3F0PA 5T6DA 1GVKB 2XBYA 1O3BA 3UOPA 6CHAB 1EUFA 1WCZA 3A83A 4CBOA 3LH1A 1DWEH 3V13A 1AFQB 2KFWA 2PKAB 1B5GH 1MH0A 1FONA 2QN5T 3OFND 4JMYA 4CREA 2ZFSA 3E3TA 5J4QA 1W14U 2VH0A 3Q00A 4CH2B 2JJ2D 1Y3WA 1FY1A 2BD9A 1BMFD 1UTLM 1G3CA 2W3IA 3CS0A 4IGDA 4WXVA 5K7RA 3QTOH 1S82A 2SGDE 2H9HA 2QXHA 2V0BA 1HB0B 3PLKA 1EKBB 1C2KA 1ANBA 2BM2A 3QX5H 3FZZA 1COWD 3RLWH 3RXPA 4A1VA 2XNIA 3SNDA 1P05A 3R3GB 4LK4A 4ESTE 4DCDA 2OTVA 5T3HA 3SU6A 2FS9A 1RJXB 3SGQE 2GCHF 1GBAA 5LGOA 1IQHA 3NWUA 1BRBE 3GCOA 5E0JA 1QJ7B 2ANWA 1P10A 2NWNA 3MO3A 5SGAE 3QLPH 4Q7ZA 2WPDD 1LPGB 1HAGE 1KY9A 2FOMB 1TBZH 2Q6FA 2BD2A 5JB9S 1TNHA 3AAUA 2BDGA 5HGGA 1QZ8A 2PW8H 1S0RA 1GMHF 4OS7A 1HAHH 1YPEH 1GHZA 1IAUA 3CS7A 1O3FA 1XXDA 2I6QA 1AN1E 1LHCH 3M3SA 3BIVH 5TJXA 2BY9X 3A7TA 1O37A 4KP0A 1LTOA 2BD5A 3VB6A 2WPLS 2YMSB 2BHGA 1K21H 4DJZB 5DP3A 1LPZB 1Z6EA 3GY4A 2OXSA 1EJMA 1SHHB 1VGCB 5E2PA 2P16A 1HXFH 4YTAA 1W0YH 2FWWA 3C27B 3BF6H 2W26A 1EQ9A 1ANEA 1YCPM 2ZTXA 1AU8A 2OC7A 4FVBA 2FOEA 2G4UA 4GSOA 1JWTA 3HKJB 2Y5FA 3SU4A 2W5EA 1N6XA 4VGCB 2PV9B 2YOLA 5DP4A 1TRYA 1CGJE 2BD4A 3ZZ6A 3BG4C 5GIBA 5FAHA 5DG6A 4KTUA 4NIWA 1O3HA 4FUBA 1E1RD 3P8OA 2FYQA 1HIAB 4MNXA 3PRDA 1NESE 4R0IA 1EPTB 1S84A 4XSKU 3KIDU 4K60A 3KGPA 3F3BA 3T27A 1EFRD 1DWDH 1JRTA 1TFXA 1DXWA 1UTMA 1C2IA 4JZ1A 3PMHB 1F0SA 1YPGH 1ZTLA 2A4GA 2XC5A 1MTVA 1ABIH 3HKIB 1SGQE 1O5FH 4LOYH 1AWFH 2FX6A 4E7RG 2ZFPH 1XUGA 1K1MA 1KLJH 1MTSA 1GPZA 2FMJA 4AFZA 4YLUA 2H5DA 2O8MA 4GVUA 4F48B 1Z1IA 4X6MA 2F83A 1BOQA 1ZOMA 1GHAF 1SGCA 2ZHDA 3FOAA 1MBMA 2TGPZ 5GJ4B 2F91A 3ODDA 2FI3E 1TRNA 2A5IA 4D9QA 2BVSH 4NIYA 2GZ9A 1SI5H 1EPTC 1FX0B 1ZR0A 1CHGA 5T1VA 4JZIA 4DIIH 3ENSB 2OC8A 3U98H 3VB4A 3ZZ4A 3BG8A 1C1MA 1F92A 3CENA 3LGWA 2PP6A 4INKA 4NG9H 1ZRKA 3M7QA 5EIYA 1P01A 1IQNA 2Z6BD 1DFPA 5EXNA 3PM3A 2JH0D 4TT3D 4I33A 4YZUA 2ZU1A 1RTLA 4MPWA 1XX9A 2Y5GA 3QK1A 1S5SA 2QF5A 1XUJA 1DANH 1O3EA 1QFKH 1C9TA 1K0HA 3GS9A 3UQOA 1EASA 5EW2H 4AYVB 1BMNH 1MZAA 4CRGA 2W6ID 1Y5UT 2AIPA 1TBQH 2IN2A 1MMJN 1GCTB 2ZHEH 2GMTB 4B73A 5JB8S 1VCWA 4NA7A 3S0NA 2FOBA 4MG3A 2ZCLP 1G2MA 1AIXH 1C5UA 2LNCA 3SGBE 2XXLA 4X1RU 3MNCA 3NUMA 2F9OA 3B8JA 1TRMA 3BTWE 1C2EA 2LP6A 4WVPE 2PTNA 1EOLA 1GJ7B 1DSUA 1AZ8A 4NGAH 3ZZ3A 2AIQA 1O3MA 1YBWA 4X8TH 1YPHC 1P02A 2F4LA 1TB6H 1P9SA 4ZKNU 2CV3A 4NSVA 3NZIA 4ZKRU 1O2OA 1TQ7B 3EA7A 5C1YA 4E05H 1A61H 5G4BA 1GMDG 2PLXA 2ANMH 1EP5A 1A1RA 2G5NA 1GJ6A 1NBMD 3KYFA 3MU5A 5FL7D 1G3BA 1MABB 3RXGA 2J95A 4ZKOU 2XBVA 1E0FD 2G00A 1UJ1A 3M5OA 5JBAS 1TAWA 4YM9A 1VITG 1HJ8A 5B6LA 1HLTH 4D76A 2I6SA 1ELAA 2H9EH 1O3AA 1O3OA 3U8TH 4WMEA 2OINA 1CA0B 2UWLA 5FCKA 3F68H 1NROH 2XC0A 5LH8A 1IQIA 6GCHF 1T32A 1KXDA 2FP7B 5T6GA 1DICA 3AVZA 1VJAU 5EQSA 3RM2H 1G2LA 1SB1H 3MH5A 3SQEE 2A4RA 8LPRA 3FP8E 2FI4E 4XE4A 1YPHE 1GI6A 1ZGIA 4AB8A 1DUEA 1EB2A 3WW7A 1ELEE 3BN9A 4GUXA 4TPIZ 2GCTB 1K1LA 1A3BH 4IC5A 1GI0A 2FO9A 1KIGH 4HI3A 4KTCA 3EQ0H 4K5ZA 2OQUA 2F43B 3ATKA 1FPCH 1O36A 1V2NT 2PUQH 5C20A 4X6NA 1CA0C 1ELVA 2P59A 3ATLA 3FN8A 3SHCH 5EQRA 2J9NA 3AASA 1NRSH 2JETC 3OTPA 4H6SB 4IC6A 5HIZA 4X1SU 1DLEA 1SR5C 2NU1E 3ZZ9A 1KXFA 1NFYA 1SGPE 2BDCA 4GCHG 3SNEA 4ISHH 1WSSH 1TPSA 3QGNB 2RG3A 2FODA 3SJ8A 3A7VA 2QE7D 1XUIA 2GCTC 8KME2 1IHSH 5DK1A 1AB9B 3ZZDA 1C5LH 1D3DB 2R3UA 2J4IA 4BAHB 1P2OA 4ASHA 4BANB 2UWOA 5C0UA 1BIOA 3NRLA 2GKVE 1AHTH 1CQQA 1Y8TA 3SO3A 3URCA 2BZAA 4ZH8A 1Y3YA 3TH2H 5C67A 4WY3A 1D6RA 2H6MA 3LGTA 4ABHA 5AF9H 1UCYE 3RC6A 2Y6TA 1SLXB 1TMUH 4IN1A 4RKJB 3PWBA 3F2GA 2D26C 1FY3A 1BA8B 4WJG2 3BEUA 5GCHG 1O3GA 1YPMH 4ZROA 1ZYOA 3SUDA 5FPSA 1V2MT 2HVXA 2OC0A 2V6NA 2XWBI 4GHTA 4I86A 4B76A 5GPIB 2Y81A 2GT7A 3UR6A 1L1GA 1L4ZA 1GJCB 2C93B 1P09A 3NKKA 4Q7YA 2PSXA 1VZQH 2D1JA 2FOGA 1AKSA 1F0RA 4I8KA 1A5HA 2Z7FE 4DVAU 1SL3A 2J5UA 3MO9A 3DD2H 1QL9A 1F0TA 5KECA 3PTBA 1QL8A 4ZHAA 3WWBA 4INLA 4AFUA 5A0AE 4HTCH 4K1EA 2K7XA 1HUTH 1QA0A 2A7CA 4ACAA 3BTHE 1C1WH 1TONA 5F8XA 2BXUH 5CDFE 1YGCH 1SQAA 1CT0E 3TU7H 2CJIA 2R0KA 1O2RA 5EPYA 1PJPA 5E8EH 1B0EA 1P0SH 2ZDKA 4H42U 2L6OA 3LKWA 4X8SH 2ZU3A 4JYUH 5DP8A 5ABWA 2AGEX 4IS5A 4AG2A 1TGTA 2ALVA 1O5DH 4FUDA 2ANKH 2DE9A 3MNBA 2NU0E 1AWHB 1MKXH 1HAYB 4BAOB 3PV5A 5AHGH 1JXPA 4DT7B 2R3YA 5DO4H 2FS8A 2STBE 3LJOA 4X2VA 1BTHH 2FYRA 2GV6A 2A31A 9ESTA 4YOJA 3SU0A 5BRRE 1GI9B 2ZU4A 1EZUC 1MQ5A 1QA7A 3G01A 3PLPA 2GZ8A 4OS4A 1TX7A 1EP6A 3SOSA 2TBSA 2HGTH 1YPJH 3HGNA 2Z9IA 2Z3DA 5IDKA 1RIWC 1NO9H 3U1JB 2M5TA 4BTTB 1GJBB 5AFYH 3LPRA 1P3EA 3S9BA 5EJLA 3O8BA 2FM2A 1O2ZA 1O2VA 1FIZA 4K1SA 1SGFG 2WUBA 4B2AA 3F2HA 2RA3A 1ARCA 1TPAE 2LPRA 2FESH 4AFQA 4NZLA 6LPRA 5A8YA 1G37A 1TYNA 3QGJA 2GTBA 3ZVBA 3UFAA 3W1EA 4SGBE 2ZWLH 2IOTA 3TLOA 3ATMA 3SUFA 5FPYA 1GJ4H 3UWIA 2BDBA 2BDIA 1H8DH 1GBLA 2BY7X 2NU3E 2V35A 1L4DA 3SJOA 3MU0A 1GHBG 2BX3A 1O3JA 5DP7A 2QCYA 2H1UA 1ZHPA 4CR9A 1AKSB 1Z8GA 1YCPK 1WTHD 1LQEA 4DURA 1C4V2 2JH6D 1K1JA 3GDUA 3D62A 3A7ZA 4OS5A 3GYMA 4LZ4B 2Q6GA 1QJ1B 4J2YB 1XUFA 1OXGA 4H4FA 3P8GA 1UMAH 5FX5A 1GI3A 1NU9A 1O2SA 2G8TA 4MPUA 1O3CA 1OSSA 5J4SA 2FOFA 3R0FA 3L6PA 4YXWD 1UVTH 4JYVH 1FN6A 1ESBA 1XUKA 1LHEH 1O38A 2PTCE 4JK6A 2YNAA 2SFAA 3ZVGA 1MKWH 2R2MB 2C4FH 2K0QA 5E0GA 1FPHH 2ZP0H 4BAQB 1DITH 1D9IA 1PPEE 3RXKA 1THSH 4R8TB 1C4U2 1F5LA 1DSTA 5FBIA 1ZJDA 3UREA 1DT2A 1HAVA 2W7SA 1SGNE 5HMAA 1DPOA 3O8RA 1GGDC 1SPJA 1GVLA 2D2DA 3W94A 2CN0H 3A80A 2C90B 1KDQA 2FLRH 1NS3A 2XCNA 3RXLA 5BPEA 3BTQE 1HJ9A 1P2MA 3I29A 1E79D 2AEIH 1ESTA 1O3PB 2ODQA 1OHHD 1THPB 2IJD1 4RT0A 3QZRA 2FEQH 3FKSD 1TE0A 1C1QA 4DT4A 5GNDA 1N8OC 1ZLRA 1TGNA 1UTJA 1UK2A 5JBCS 2Z94A 2DUCA 5FXLA 2W3KA 3M7UA 2ZFRH 4B71A 1UTKA 1EZQA 3UB0A 1O3LA 3KF2A 2J98A 5AVDA 2TRMA 5IYTA 4X1PU 3FAOA 2ZDMA 4ISOA 1O30A 2M2AA 3M61U 4ACBA 1TMBH 3A7XA 3SJKA 2HOBA 1GDUA 2BY6X 1HRTH 1AVXA 1CT4E 1EJAA 2OUAA 4NZQA 3RXIA 1GCDA 2UUFB 1IQEA 2BXTH 2ZPSA 2A4QA 2ZCKP 1YLNA 2FTLE 2AMQA 3SUGA 3F9FA 4GHQA 2Y7ZA 3VEQB 1YP9A 2QA9E 3SU5A 2SGFE 3SV9A 2VIVA 2QXIA 4BXSA 3SU3A 1F5RA 3OX7U 1TPPA 2BZ6H 1C1PA 1FMGA 1H1BA 3UR9A 4ABFA 1OWHA 1OWDA 1YF4A 4D8NA 1NC6A 1MCVA 2HLCA 1JOUB 2VIWA 1DWCH 1NTPA 2C3SA 3BG4B 3SNCA 5L2YH 2H5CA 5L2ZH 4FUCA 2LELA 2ALPA 3LC5A 1BZXE 1L1JA 1DX5M 1P2JA 1BDAA 5EODA 2EY4C 1A3EH 1W13U 3ZZ5A 4D7FA 1ZJKA 2SNWA 2KAIA 3MI4A 3WWFA 1O2TA 1O5EH 1QY6A 1F2SE 4NFEA 3U8OH 4UFGH 4MNWA 2ZC9H 2R2WU 1HAVB 1DUAA 4K2YA 3EBNA 2F9UA 2G51A 2J97A 2RFKC 2K8IA 1D4PB 1C2DA 2A32A 3E6PH 1SVPA 2BY8X 1KDQB 4Z6AH 2ZZUH 3P8NA 1O33A 4CRAA 2WUCA 3TNSA 3MTYA 3JZ2B 1FXYA 4ZAEA 1BB0B 5LPFA 2QV1A 2QXGA 2A5AA 4UFEH 3V12A 5EJZA 2ZKSA 1YCPH 2G52A 1TX8A 3MWIU 1LDTT 2GX4A 1ESAA 5C0TA 1V2QT 2JH5D 5E2OA 1V2PT 1C9PA 1B7XB 3SW2B 1C5RA 3TITA 1WV7H 1E37B 1ANCA 1FY5A 3TJOA 5A0BA 2TGTA 1J16A 4XBCA 1BRCE 1ACBE 1OWKA 2AGIX 3A7YA 4AC9A 2BLVA 5H4IB 2AMDA 1GL1A 2ZCHP 3QZQA 3F6UH 5ETXA 3TK9A 2JDID 4Y7BA 2SGPE 2CF8H 2BDAA 3GCTG 3RLYH 1PPGE 1GMDF 2G5VA 1TNJA 4GLYA 2QYIA 4NA9H 3A86A 1Y59T 4Z1MD 3N99A 3ZVEA 5A09A 1FLEE 3BTFE 2BYAX 2EEKA 2FOAA 1QBOA 4AORA 5C2ZA 2KCAA 5F03A 4O3UA 4BAKB 1VITF 2XTTB 1SGDE 2LIZA 1HYLA 1C1OA 1QRZA 1GI7B 1S83A 4TPYA 4ABIA 2HVYB 1SLWB 3P70B 2P95A 2HRVA 4FUIA 2EI8A 5GDSH 1UVSH 4OGYA 2A7JA 4HGCA 3PROA 1UTOA 2WHXA 1ZMLA 1C5MD 4K8BA 5I25A 1BHXF 1KSNA 2OLGA 1HFDA 1RTKA 1GHYH 2P3TB 3E91A 1O2JA 1O2PA 3SV8A 2ESTE 3HK6B 1FUJA 2QF0A 3SI3H 3K65B 1TBRH 3ZV9A 1UVOA 4F49A 1GMCG 2O8WA 1VKYA 4AN7A 4CRFA 4FUEA 4A6LA 5GWZA 1C1UH 4YO9A 1MD8A 2VJ1A 1SG8B 2CGAA 1FDPA 3SV7A 7ESTE 1TIOA 5JPMH 1YPLH 1GL0E 2A45B 3T25A 4UFFH 1PFXC 1FN8A 1O5BB 3B23B 3GY6A 1KLTA 4M9FA 1JIRA 2WPJS 3AK5A 1IQJA 1DS2E 1GBHA 3F9HA 3KQDA 1Z1JA 2SGQE 3W95A 1DVAH 5DP6A 3PRBA 5F6MA 3B9FH 1OX1A 3RXUA 1W12U 2ZDAH 1O5AB 1O5GH 1LVOA 2Z3CA 2BMGB 4GCHF 3BTGE 1NY22 1EXFA 2GGVB 3FFGA 4XOJA 1KTSB 1AUJA 2FIRH 3D65E 2PWXA 1O2YA 1ZSJA 1C1VH 4F4OC 3OY5U 3T62A 1ANDA 3VFEA 1ZHRA 1TQ0B 3SZNA 3A87A 1UTNA 3MH6A 3STJA 1C5NH 1WOFA 3F0OA 2P8OB 1FY8E 5C5NA 4DGJA 3TH3H 5JDUB 4LXBH 3F9GA 4KKDA 1QQ4A 1Y5BT 1O3DA 1C2FA 2H9TH 3RDZA 3ZZCA 3E0NB 2Q6DA 1BHXB 3TVJB 3PTNA 3TGKE 1C1RA 1G36A 1FZZA 1TNIA 2GDEH 3A8AA 3N7EA 3ELAH 2IPQX 1T8LA 2A1DB 2Z9LA 1TMTH 4XBBA 2A4OA 2K1QA 3A89A 1E1QD 2J94A 7KMEH 5DP5A 3BTME 3IITA 5GCHF 1IQKA 4DY7B 2B8OH 1MUEB 1E36B 2JETB 1C2LA 1GDQA 2V3MA 5JBTA 1LCYA 1BTWA 2ULLA 2VH6A 3KQCA 4ABAA 3GY2A 1AVGH 3M3TA 2P8OC 2UUKB 3UIRA 2ANYA 2W6JD 3IG6B 1BTZA 2KX4A 1ZSKA 2ZQ1A 3H09A 5C5OA 3TK6A 4FOUC 4MVNA 4K8YA 3RXRA 3EYDA 4ABBA 5EW1H 4Y10E 4JYTA 2VU8E 4OGXA 3ZVAA 4TY7A 3H7TA 4ABJA 3I78A 1CSOE 4XD7D 4F55A 1W10U 3DSGA 4FVDA 5TCAA 1DXPA 1UCYK 3OTJE 2PSYA 4OS2A 1NN6A 1ETSH 3M36A 1BBRE 1EAUA 2CF9H 2CHAB 3OY6U 5L6NH 3MNSA 4UFDH 1MQ6A 3FO8D 3A8CA 3SI4H 2V3OH 1HBTH 1YPKH 2EA3A 1ZMJA 1NRPH 1ZTJA 4U01A 3GDSA 1RGQA 3RXTA 2ZGHA 3MHWU 3SU2A 3MMGA 2BDYA 1SGFA 2J2UA 1ZSLA 1FAXA 3E1XB 4WWYA 3RP2A 5IK2D 2P3FH 3Q3YA 2AERH 1NFXA 3MH4A 4XFQA 2G55A 3RU4T 4IMQA 4ABEA 2VVCA 3RXMA 4BTIB 2WPKS 1S6HA 2R9PA 3F1SB 1BTPA 4WH8A 4B6EA 2CHAC 4AOQA 3MYWA 4OS1A 4Q7XA 2F9NA 3VPKA 1V2VT 1TOCB 3RUOA 5FX6A 1T7CA 3RMMH 1FAKH 1P06A 4Z0KA 4CRDA 1SGTA 1AI8H 2BX4A 1H9LB 3DFJA 1KXCA 3K2UA 1BTXA 5EJ1A 1AO5A 1TGBA 1T8OA 1NFUA 1TWXB 2IJOB 2ZPRA 3TJUA 2F9BH 3M3VA 3OEHD 1O39A 1SOTA 4YOGA 1GWAA 1SFIA 1LKAA 3BEIB 1QIXB 2V3HH 4B2CA 1N1LA 2WV4A 1HAIH 4NWKA 2BQWB 3SJ9A 3S9CA 2Z9GA 5B6OA 1A0HB 3M35A 1JBUH 4TWYA 1WTGH 2XYAA 2VWNA 1GHBF 1MD7A 5C3NA 3SBKA 3S7HB 3BV9B 4Q80A 2G4TA 2A7HA 1TNGA 3PYHA 3ZYDA 1IOEA 2Y80A 3RC4A 1H8HD 5C1XA 5JYIA 1T8NA 1TNKA 1H8IH 1UTQA 1AQ7A 4A1TA 5C17A 3PO1B 2AMPA 1MBQA 5GXPA 1IQGA 1V2OT 1RIWB 2VIQA 4AGJA 1QURH 1V6DA 3T2NA 4Q4LA 3LH3A 1E34B 2EQNA 5KEDA 4RSPA 1YYY1 2EI7A 2VNTA 2XBXA 1S0QA 4MNYA 2ZTZA 1Z8IB 2HNTE 1WXRA 4KTSA 3LGUA 1C5QA 3DSPA 2BOHB 1SBWA 2RDEA 1KXAA 4CRBA 2HLDD 2J38A 1CU1A 2ZPQA 1G3DA 3RM0H 2AGGX 1KYNA 1CO7E 2G81E 2ZEBA 2XWAA 1SC8U 2D8WA 1LHDH 1AE5A 1CE5A 1O32A 3RXJA 1K28D 2KR7A 3CP7A 1C5TA 2P93A 3GICB 1QB6A 1BRAA 2Z9KA 2WZQA 3O8CA 3RXOA 1DY9A 1UHBA 3KEEA 1HNEE 3PO1C 1WAYB 1GBJA 2VWMA 1OYQA 2FOCA 1OYTH 1JMOH 3U9AH 2GJGA 4X8UH 2A2XH 3QUMP 3MO6A 1GBTA 4UONA 3A88A 1OP0A 4U32A 4ZHMU 2UWPA 3AAVA 3GCHC 3UY9A 1C5XB 4DW2U 1BMLA 1GBDA 1TOMH 2C8ZB 2HPQH 3QTVH 4TYDA 4AB9A 3N7OA 1T4UH 3DUXH 1GI1A 1OP2A 1TA2A 2ZQ2A 1BTYA 2ZGJA 4IN2A 1OS8A 3UNRA 1EAXA 1SQOA 4Y8YA 2ODPA 2PUXB 2QY0B 3M5NA 3OEED 4JZDH 8GCHF 1BMMH 2B0FA 1DY8A 2WSSD 1XVOA 3PMJA 1ZTKA 4X2WA 1KMHB 3VXFH 4I8HA 3LU9B 1PYTC 1ETTH 1SGEE 3U28C 1GGDB 1MTWA 1X7AC 3A7WA 1A5IA 3EE0B 1OWEA 1GHVH 1SLUB 4BAMB 1ABJH 3SYJA 3VXEH 3BTDE 4DOQA 4P00A 1YWUA 2JIZD 1AVWA 2OQ5A 1ZHMA 3ZZ8A 1FNIA 1BT7A 3NCLA 1BJUA 1QR3E 1N8OB 1C5WB 3LJJA 1EOJA 2TGAA 2PFEA 3KQBA 3RXAA 1AY6H 1ARBA 3ITIA 3ODFA 3KQEA 3S69A 1QL7A 1TA6A 2ZGXH 1INCA 3JZ1B 1U6QA 4A5TS 3QO6A 1V2RT 4BOHA 3BTKE 4NFFA 3A82A 1OWIA 4I8GA 5HM9A 4JCNA 1VR1H 4X8VH 1GBKA 3TGIE 3EDXB 2AS9A 1WU1A 4MLFB 1YLDA 5EOKA 5AFZH 4RN6A 1O3NA 4TSFD 3DHKH 3A84A 3ZVDA 3TK5A 1L1NA 2OD3B 1E35B 2KM0A 2OC1A 1Z7KA 3RXVA 1CBWB 3VB7A 2R0LA 2PGQB 1PQ7A 5JBBS 3P92A 1SLVB 2AHME 3RU4E 1UHBB 1WQVH 1VCQA 2Q1JA 2BLQA 1BITA 3LDXH 3PV2A 4YT7H 3GISB 1FQ3A 2SGAA 3BIUH 1C5SA 3GY8A 2RCEA 1OPHB 3ESTA 5C1UA 5K0HA 1QTFA 5EG4A 2FDAA 4BXWA 1V2LT 1UTPA 1GVZA 3PV4A 1OOKB 1H9HE 3ZV8A 3Q76A 8GCHG 1HAZB 3V7TA 1B0FA 1HV7A 1O2NA 1CVWH 2XNDD 3KNXA 4B1TA 1CBWC 5A8XA 2THFB 5EU8A 1E38B 4MQAA 3RXCA 1SQRA 2EI6A 1Y3XA 1WYKA 7GCHG 4I8LA 1IQMA 4OS6A 1HGTH 2A2QH 1A0LA 3RXDA 2XW9A 3VGCC 3GCTF 1FI8A 1P9UA 1G30B 1QRWA 3E90B 2WV9A 1MU6B 3LC3A 3KQ5A 3URDA 3MU1A 3VB5A 4B2BA 3SHAH 5EXLA 1LHGH 1QJ6B 1S85A 3HGPA 1UW7A 1C1TA 4JZEH 1L2EA 4WH6A 4FXGH 5CE1A 3UWJH 1A4WH 5ESTE 1IHTH 1ETRH 1Z71A 1A7SA 1O2HA 1AMHA 2P3UB 3GDVA 6CHAC 1YLCA 4HFPB 3OSYA 4THNH 1AFQC 1LHFH 3IWMA 5DKMA 5FBEA 1C5ZB 3LONA 3UNQA 3BTEE 4MNVA 3SV6A 5F8TA 1V2WT 1RXPA 1ZRBA 1EX3A 2FTMA 2B9LA 2WPIS 5FPTA 1O2QA 2ZNKH 3MOCA 1DDJA 2TPIZ 1GMCF 1BUIA 1C2JA 1W7XH 3E8LA 1AZZA 1RTFB 1XMNB 1PQ5A 3RXEA 1O31A 1Z8RA 1ZMNA 2YNBA 1CGIE 1DWBH 3GCNA 4IW4E 1GJ8B 1P12E 5A8ZA 1NT1A 2GP9B 2AH4X 4X1NU 1TGSZ 1XUHA 2BB4A 4Y11E 1RS0A 1O2MA 3V3MA 2GZ7A 4BTUB 3UAIC 2OBQA 3NK8A 4WXIA 1PPHE 3LGIA 1KTTB 2FOHA 2J98B 1WDIA 3FVFB 4KELA 2CMYA 4NIXA 4O03A 1D3PB 4YOIA 1QRXA 4LZ1H 1O35A 5A0CA 3BSQA 1HAPH 2TIOA 4Y0YE 1ORFA 1PQAA 2A0QB 4HG6A 4XRNA 5F53A 1OP8A 1HAOH 1WQSA 1UK3A 2YMSC 2ZO3H 2C8WB 2UUYA 1NU7B 1RD3B 5F8ZA 4JK5A 1CHOF 1VGCC 2KZ4A 2VIDA 4ZCNA 3EA8A 1TABE 3FP7E 2FZZA 1NFWA 1D3QB 3NPSA 3SGAE 1C5VA 3TJNA 2OBOA 2ASUB 3MU4A 3P17H 2B5TB 3M5LA 2GCHG 1BTUA 1EAIA 4U2WA 1TALA 2BD8A 3RMNH 4VGCC 1LMWB 4XDEA 3M7TA 1HPGA 3RMLH 1LPKB 7LPRA 1LVYA 1DE7H 4RI0A 2BTCE 1SFQB 1Z8JB 3S7KB 3UUZA 2XCFA 3ZIAD 1HCGA 3I77A 3V0XA 2FXRA 3U69H 1O0DH 3Q3KA 1C2HA 1C1SA 1SMFE 5L30H 4A92A 3PWCA 4OM9A 1GMHG 1MAXA 1ELDE 4Y76A 3DCLA 4ZKSU 1C1NA 4AZ2B 4K1TA 1XM1A 4MTBA 3A8DA 1EB1H 5E0HA 5I46H 1K9OE 1GJ9B 2KAIB 2XRCA 4MPVA 1J17T 2HPPH 1BMAA 1UVPA 1CGHA 5HM2A 2ZHFH 4GPGA 1TX6A 3P8FA 3SORA 3P95A 3D23A 4Y6DA 1ZGVA 2CK3D 1W11U 2F3CE 4FUGA 4ISNA 1MAYA 2O8UA 2VWOA 3HATH 2JJ1D 1V3XA 3U1IB 1A2CH 4U30A 1O2LA 4FETA 2A5KA 2ZF0H 4FU8A 2GDDA 1ELCA 1Q2WA 1P2QA 3UTUH 1GG6B 1VJ9U 4MDSA 2BQ6B 3GY5A 2BLOA 1T31A 1AE8H 4WF8A 4NSYA 3VB3A 3GY7A 2QGRA 2OCVB 2RA0A 1D6WA 5HYOA 1BRUP 1K22H 2F9PA 1CA8B 3RC5A 3TPIZ 4X2XA 2BLWA 2QF3A 3SN8A 1HAXB 3UNSA 4PROA 3DFLA 1QBNA 4INHA 4AYYB 3LIWA 1T4VH 1CHOG 5DN6D 2J34A 5CMXH 1A0JA 2O8TA 1J14A 3BEFB 2ZECA 5T6FA 1C2MA 2ZU5A 5DP9A 1ZPBA 3CNRA 1MCTA 1ZPZA 2BDHA 2HNTF 2VVUA 1RFNA 2ZDNA 1YC0A 1W0ZU 4I31A 2VBCA 5FCRA 4ZXYH 1GCTC 1BBRK 1NRQH 1PYTD 1D3TB 2STAE 2GMTC 1GHAG 4E06H 3RU4D 1GG6C 2L74A 1J15A 1G9IE 1GHWH 2SNVA 3FZDA 4AFSA 2P94A 1HDTH 1J8AA 3UQVA 1JIMA 2J92A 1MKXK 4YT6H 2Y82A 4AG1A 3F9EA 3P6ZB 1QGFA 4K3JA 3LOXA 2ZHWH 2QIQA 1S6FA 3QDZB 4SGAE 2TGDA 1MZDA 1RRKA 1H4WA 2WYJA 4ABGA 3QWCH 4JZFH 3M5MA 2ZDLA 3F2FA 1O2WA 2AFQB 4B75A 2BD3A 4Y0ZE 2C8YB 1ELGA 3NXPA 3K6YA 3ZYEA 3SNBA 1LKBA 3RXQA 3PMBB 5LPRA 2BVRH 1UO6A 5EQQA 1ELBA 1NRRH 3HPTB 1K1NA 3LT3A 3TH4H 6ESTA 3KHVA 2ZFFH 1MU8B 2EC9H 1SGYE 3SU1A 3MQKC 1EZSC 1LVMA 1QNJA 1V2UT 1LO6A 1F5KU 1TNLA 1DM4B 3UPEA 2Z3EA 1GI8B 4X6OA 3A85A 4BNRA 1V2JT 1GHXH 5TCCA 3MU8A 5DJ7A 2KCPA 1GDNA 1ID5H 3OU0A 1TGCA 3E16B 1GI5A 3KN2A 3DA9B 1PPCE 1AFEH 3ZZ7A 3T26A 2VWLA 3L3TA 5C94A 4AGKA 1GBBA 2FX4A 1FV9A 1UK4A 3EGKH 3ATIA 1QB1A 3SJIA 2ZHQH 2PHBA 5A2MH 1W7GH 3OAAD 4AX9H 4NA8A 1NRNH 2BY5X 3WY8A 1C5YB 1GBCA 2QC2A 2WPMS 4CBNA 1QHRB 3GYLB 3RXBA 4CHAB 1XVMA 2C8XB
chains in the Genus database with same CATH topology
4NCYA 2VVVA 2QAAA 1J9CH 4FU9A 4ISLA 4IBLH 2HNTC 1KXEA 1MKWK 1T8MA 3A81A 2Y5HA 1ELTA 1GBIA 1P11E 1K1PA 4UE7H 1A5GH 1C2GA 1P03A 2UUJB 2BQ7B 4I8JA 3O8DA 1EZXC 2PKSB 4D7GA 1DLKB 1GJDB 1YM0A 2GT8A 5EGMA 3QN7A 3L33A 3E0PB 5CHAB 2ZFTA 1HXEH 4NIVA 3DT0H 4UD9H 6GCHG 2VINA 3U8RH 3RXFA 4CR5A 1AB9C 4O97A 4CHAC 1THRH 4MPXA 3T29A 1WBGB 1QB9A 1GJ5H 1SHYA 1P2NA 1IQFA 5LPEA 1EAWA 3H5CB 1FY4A 1FIWA 2B7DH 1P8VC 4H6TA 3H7OA 4KGAA 4GAWA 2O8LA 4HZHA 4ISIH 3M37A 4M7GA 4CH8B 1N6YA 2Z9JA 3T5FH 2ZGCA 1Q3XA 2VIOA 4FUJA 4DIHH 2ZDVH 3SQHE 3AW1A 4I32A 4WMFA 2PKSC 1O2GH 2F9VA 3GCHB 1TPOA 4DG4A 3KCGH 2JKHA 3RXSA 3TNTA 8ESTE 4B74A 5CHAC 4K69A 1O3IA 1O2XA 1O2KA 3Q3XA 1SGIB 4FUFA 1P57B 4J1YA 1XKBC 1AGJA 2GD4B 4ZUHA 2BOKA 1BBRH 1C4Y2 1K1OA 3C1KA 2FPZA 2WPHS 4Q2KA 1M9UA 2OP9A 3EA9A 1P04A 2RDLA 1JRSA 5EXMA 1O34A 1ZZZA 2NU2E 3MH7A 4UDWH 4ZMAH 4FU7A 1MTNB 1ELFA 3AW0A 3LGYA 1F0UA 3MNXA 1P2KA 9LPRA 1VCPA 4FUHA 1Y3VA 1W3CA 4TWWA 1MTUA 1VITH 4X2YA 1XKAC 2W7UA 2ZI2H 3TGJE 2ILNA 2H2ZA 2ZG0H 1O2IA 5PTPA 3PLBA 2ZTYA 3UOUA 1NM6A 4Y8XA 1S81A 3ZVFA 2NU4E 1GI4A 3ATWA 1BQYA 2PGBB 1L0ZA 1UCYH 2PKAA 1BCUH 1EJNA 3SNAA 3K6ZA 3RXHA 3T28A 2QXJA 3MFJA 1H9IE 4ZXXH 1Y5AT 1K2I1 1YKTA 3HK3B 4X0WU 2O9QA 1MTNC 1O3KA 3SV2H 1O5CB 3GOVB 1DOJA 1FJSA 4E7NA 4ABDA 2XBWA 4QT8C 1SOZA 4Y8ZA 1PQ8A 4O3TA 2SGEE 4YESB 3Q77A 1Q31A 1QQUA 1Y3UA 7GCHF 4YLQH 1AD8H 1NZQH 1UVUH 3D49H 1GI2A 4IMZA 5HXFA 3LGVA 1LVBA 2GVFA 1GBFA 1KXBA 1AUTC 2ZA5A 2BVXH 1W8BH 2HWLB 2WINI 2VGCB 1F7ZA 2AYWA 4CRCA 3TIUA 4X6PA 1GJAB 3RMOH 1PPFE 3TJVA 3PMAB 3FP6E 2FI5E 2IPHA 4X1QU 1HJAB 1NPMA 3BTTE 2ZU2A 4WMDA 1G3EA 1OWJA 1PPBH 1P3CA 2Y7XA 3KL6A 3PB1E 4UEHH 1G32B 2VIPA 1CT2E 3FANA 4XBDA 2DE8A 3SUEA 1QCPA 2CXVA 2FLBH 1WUNH 2VB0A 1O2UA 4RKOB 1QBVH 2GV7A 4I7YH 1PPZA 1K1IA 1Z6JH 4O9VA 1GBEA 2ZIQH 4ZHLU 1LQDB 5ESBA 2ODYB 4Y79A 2WYGA 3EAJA 3ZZBA 3ZVCA 1BJVA 2VGCC 2ZGBH 5DGJA 1C5OH 1V2KT 2HALA 4TY6A 1V2ST 1V2TT 2BD7A 4D9RA 3STIA 1SSXA 3ZZAA 4Y71A 1IQLA 3VGCB 1OKXA 4A1XA 1EATA 1P2IA 1XXFA 5FHTA 1KLIH 1GBMA 2ZFQH 2PR3A 5DPAA 2WV5A 4A7IB 1ZPCA 1HJAC 1C5PA 2XC4A 1A46H 3OYPA 1W2KH 1HIAA 5EPNA 1SQTA 1EPTA 3A8BA 3S9AA 3GY3A 4NWLA 1SGRE 4Y7AA 3K9XB 1TLDA 5T6DA 1GVKB 2XBYA 1O3BA 3UOPA 6CHAB 1EUFA 1WCZA 3A83A 4CBOA 3LH1A 1DWEH 3V13A 1AFQB 2PKAB 1B5GH 1MH0A 1FONA 2QN5T 4JMYA 4CREA 2ZFSA 3E3TA 5J4QA 1W14U 2VH0A 3Q00A 4CH2B 1Y3WA 1FY1A 2BD9A 1UTLM 1G3CA 2W3IA 3CS0A 4IGDA 4WXVA 5K7RA 3QTOH 1S82A 2SGDE 2H9HA 2QXHA 2V0BA 1HB0B 3PLKA 1EKBB 1C2KA 1ANBA 2BM2A 3QX5H 3FZZA 3RLWH 3RXPA 4A1VA 2XNIA 3SNDA 1P05A 3R3GB 4LK4A 4ESTE 4DCDA 2OTVA 5T3HA 3SU6A 2FS9A 1RJXB 3SGQE 2GCHF 1GBAA 5LGOA 1IQHA 3NWUA 1BRBE 3GCOA 5E0JA 1QJ7B 2ANWA 1P10A 2NWNA 3MO3A 5SGAE 3QLPH 4Q7ZA 1LPGB 1HAGE 1KY9A 2FOMB 1TBZH 2Q6FA 2BD2A 5JB9S 1TNHA 3AAUA 2BDGA 5HGGA 2PW8H 1S0RA 1GMHF 4OS7A 1HAHH 1YPEH 1GHZA 1IAUA 3CS7A 1O3FA 1XXDA 2I6QA 1AN1E 1LHCH 3M3SA 3BIVH 5TJXA 2BY9X 3A7TA 1O37A 4KP0A 1LTOA 2BD5A 3VB6A 2WPLS 2BHGA 1K21H 4DJZB 5DP3A 1LPZB 1Z6EA 3GY4A 2OXSA 1EJMA 1SHHB 1VGCB 5E2PA 2P16A 1HXFH 4YTAA 1W0YH 2FWWA 3C27B 3BF6H 2W26A 1EQ9A 1ANEA 1YCPM 2ZTXA 1AU8A 2OC7A 4FVBA 2FOEA 2G4UA 4GSOA 1JWTA 3HKJB 2Y5FA 3SU4A 2W5EA 1N6XA 4VGCB 2PV9B 2YOLA 5DP4A 1TRYA 1CGJE 2BD4A 3ZZ6A 3BG4C 5GIBA 5FAHA 5DG6A 4KTUA 4NIWA 1O3HA 4FUBA 3P8OA 2FYQA 1HIAB 4MNXA 4R0IA 1NESE 1EPTB 1S84A 4XSKU 3KIDU 4K60A 3KGPA 3T27A 1DWDH 1JRTA 1TFXA 1DXWA 1UTMA 1C2IA 4JZ1A 3PMHB 1F0SA 1YPGH 1ZTLA 2A4GA 2XC5A 1MTVA 1ABIH 3HKIB 1SGQE 1O5FH 4LOYH 1AWFH 2FX6A 4E7RG 2ZFPH 1XUGA 1K1MA 1KLJH 1MTSA 1GPZA 2FMJA 4AFZA 4YLUA 2H5DA 2O8MA 4GVUA 1Z1IA 4X6MA 2F83A 1BOQA 1ZOMA 1GHAF 1SGCA 2ZHDA 1MBMA 2TGPZ 5GJ4B 2F91A 3ODDA 2FI3E 1TRNA 2A5IA 4D9QA 2BVSH 4NIYA 2GZ9A 1SI5H 1EPTC 1ZR0A 1CHGA 4JZIA 4DIIH 3ENSB 2OC8A 3U98H 3VB4A 3ZZ4A 3BG8A 1C1MA 1F92A 3CENA 3LGWA 4INKA 4NG9H 1ZRKA 3M7QA 1P01A 1IQNA 2Z6BD 1DFPA 5EXNA 3PM3A 2JH0D 4I33A 4YZUA 2ZU1A 1RTLA 4MPWA 1XX9A 2Y5GA 3QK1A 1S5SA 1XUJA 1DANH 1O3EA 1QFKH 1C9TA 3UQOA 1EASA 5EW2H 4AYVB 1BMNH 1MZAA 4CRGA 1Y5UT 2AIPA 1TBQH 2IN2A 1MMJN 1GCTB 2ZHEH 2GMTB 4B73A 5JB8S 1VCWA 4NA7A 3S0NA 2FOBA 4MG3A 2ZCLP 1G2MA 1AIXH 1C5UA 2LNCA 3SGBE 2XXLA 4X1RU 3MNCA 3NUMA 2F9OA 3B8JA 1TRMA 3BTWE 1C2EA 4WVPE 2PTNA 1EOLA 1GJ7B 1DSUA 1AZ8A 4NGAH 3ZZ3A 2AIQA 1O3MA 1YBWA 4X8TH 1YPHC 1P02A 1TB6H 1P9SA 4ZKNU 2CV3A 4NSVA 3NZIA 4ZKRU 1O2OA 1TQ7B 3EA7A 5C1YA 4E05H 1A61H 5G4BA 1GMDG 2PLXA 2ANMH 1EP5A 1A1RA 2G5NA 1GJ6A 3MU5A 1G3BA 4ZKOU 3RXGA 2J95A 2XBVA 1E0FD 2G00A 1UJ1A 3M5OA 5JBAS 1TAWA 4YM9A 1VITG 1HJ8A 1HLTH 4D76A 2I6SA 1ELAA 2H9EH 1O3AA 1O3OA 3U8TH 4WMEA 2OINA 1CA0B 2UWLA 5FCKA 3F68H 1NROH 2XC0A 5LH8A 1IQIA 6GCHF 1T32A 1KXDA 2FP7B 5T6GA 1DICA 3AVZA 1VJAU 5EQSA 3RM2H 1G2LA 1SB1H 3MH5A 3SQEE 2A4RA 8LPRA 3FP8E 2FI4E 4XE4A 1YPHE 1GI6A 1ZGIA 4AB8A 1DUEA 1EB2A 1ELEE 3BN9A 4GUXA 4TPIZ 2GCTB 1K1LA 1A3BH 4IC5A 1GI0A 2FO9A 1KIGH 4HI3A 4KTCA 3EQ0H 4K5ZA 2OQUA 3ATKA 1FPCH 1O36A 1V2NT 2PUQH 5C20A 4X6NA 1CA0C 1ELVA 2P59A 3ATLA 3SHCH 5EQRA 2J9NA 3AASA 1NRSH 2JETC 4H6SB 4IC6A 4X1SU 1DLEA 1SR5C 2NU1E 3ZZ9A 1KXFA 1NFYA 1SGPE 2BDCA 4GCHG 3SNEA 4ISHH 1WSSH 1TPSA 3QGNB 2RG3A 2FODA 3SJ8A 3A7VA 1XUIA 2GCTC 8KME2 1IHSH 5DK1A 1AB9B 3ZZDA 1C5LH 1D3DB 2R3UA 2J4IA 4BAHB 1P2OA 4ASHA 4BANB 2UWOA 1BIOA 2GKVE 1AHTH 1CQQA 1Y8TA 3SO3A 3URCA 2BZAA 4ZH8A 1Y3YA 3TH2H 5C67A 4WY3A 1D6RA 2H6MA 3LGTA 4ABHA 5AF9H 1UCYE 3RC6A 2Y6TA 1SLXB 1TMUH 4IN1A 4RKJB 3PWBA 2D26C 1FY3A 1BA8B 4WJG2 3BEUA 5GCHG 1O3GA 1YPMH 4ZROA 1ZYOA 3SUDA 5FPSA 1V2MT 2HVXA 2OC0A 2V6NA 2XWBI 4GHTA 4B76A 5GPIB 2Y81A 2GT7A 3UR6A 1L1GA 1L4ZA 1GJCB 2C93B 1P09A 3NKKA 4Q7YA 2PSXA 1VZQH 2D1JA 2FOGA 1AKSA 1F0RA 4I8KA 1A5HA 2Z7FE 4DVAU 1SL3A 3MO9A 3DD2H 1QL9A 1F0TA 3PTBA 1QL8A 4ZHAA 4INLA 4AFUA 5A0AE 4HTCH 4K1EA 2K7XA 1HUTH 1QA0A 2A7CA 3BTHE 1C1WH 1TONA 5F8XA 2BXUH 1YGCH 1SQAA 1CT0E 3TU7H 2CJIA 2R0KA 1O2RA 5EPYA 1PJPA 5E8EH 1B0EA 1P0SH 2ZDKA 4H42U 3LKWA 4X8SH 5DP8A 2ZU3A 4JYUH 5ABWA 2AGEX 4IS5A 4AG2A 1TGTA 2ALVA 1O5DH 4FUDA 2ANKH 2DE9A 3MNBA 2NU0E 1AWHB 1MKXH 1HAYB 4BAOB 5AHGH 1JXPA 4DT7B 2R3YA 5DO4H 2FS8A 2STBE 3LJOA 4X2VA 1BTHH 2FYRA 2GV6A 2A31A 9ESTA 4YOJA 3SU0A 5BRRE 1GI9B 2ZU4A 1EZUC 1MQ5A 1QA7A 3G01A 3PLPA 2GZ8A 4OS4A 1TX7A 1EP6A 3SOSA 2TBSA 2HGTH 1YPJH 3HGNA 2Z9IA 2Z3DA 5IDKA 1RIWC 1NO9H 3U1JB 2M5TA 4BTTB 1GJBB 5AFYH 3LPRA 1P3EA 3S9BA 3O8BA 2FM2A 1O2ZA 1O2VA 1FIZA 4K1SA 1SGFG 2WUBA 4B2AA 2RA3A 1ARCA 1TPAE 2LPRA 2FESH 4AFQA 4NZLA 6LPRA 5A8YA 1G37A 1TYNA 3QGJA 2GTBA 3ZVBA 3UFAA 4SGBE 2ZWLH 2IOTA 3TLOA 3ATMA 3SUFA 5FPYA 1GJ4H 3UWIA 2BDBA 2BDIA 1H8DH 1GBLA 2BY7X 2NU3E 2V35A 1L4DA 3SJOA 3MU0A 1GHBG 2BX3A 1O3JA 5DP7A 2QCYA 2H1UA 1ZHPA 4CR9A 1AKSB 1Z8GA 1YCPK 1WTHD 1LQEA 4DURA 1C4V2 2JH6D 1K1JA 3GDUA 3D62A 3A7ZA 4OS5A 3GYMA 4LZ4B 2Q6GA 1QJ1B 4J2YB 1XUFA 1OXGA 4H4FA 3P8GA 1UMAH 5FX5A 1GI3A 1NU9A 1O2SA 2G8TA 4MPUA 1O3CA 1OSSA 5J4SA 2FOFA 3R0FA 3L6PA 1UVTH 4JYVH 1FN6A 1ESBA 1XUKA 1LHEH 1O38A 2PTCE 4JK6A 2YNAA 2SFAA 3ZVGA 1MKWH 2R2MB 2C4FH 5E0GA 1FPHH 2ZP0H 4BAQB 1DITH 1D9IA 1PPEE 3RXKA 1THSH 4R8TB 1C4U2 1F5LA 1DSTA 5FBIA 1ZJDA 3UREA 1DT2A 1HAVA 2W7SA 1SGNE 5HMAA 1DPOA 3O8RA 1GGDC 1SPJA 1GVLA 2D2DA 3W94A 2CN0H 3A80A 2C90B 1KDQA 2FLRH 1NS3A 2XCNA 3RXLA 5BPEA 3BTQE 1HJ9A 1P2MA 3I29A 2AEIH 1ESTA 1O3PB 2ODQA 1THPB 3QZRA 2FEQH 1TE0A 1C1QA 1N8OC 1ZLRA 1TGNA 1UTJA 1UK2A 5JBCS 2Z94A 2DUCA 5FXLA 2W3KA 3M7UA 2ZFRH 4B71A 1UTKA 1EZQA 1O3LA 3KF2A 5AVDA 2TRMA 5IYTA 4X1PU 3FAOA 2ZDMA 4ISOA 1O30A 3M61U 1TMBH 3A7XA 3SJKA 2HOBA 1GDUA 2BY6X 1HRTH 1AVXA 1CT4E 1EJAA 2OUAA 4NZQA 3RXIA 1GCDA 2UUFB 1IQEA 2BXTH 2ZPSA 2A4QA 2ZCKP 2FTLE 2AMQA 3SUGA 3F9FA 4GHQA 2Y7ZA 3VEQB 1YP9A 2QA9E 3SU5A 2SGFE 3SV9A 2VIVA 2QXIA 4BXSA 3SU3A 1F5RA 3OX7U 1TPPA 2BZ6H 1C1PA 1FMGA 1H1BA 3UR9A 4ABFA 1OWHA 1OWDA 1YF4A 4D8NA 1NC6A 1MCVA 2HLCA 1JOUB 2VIWA 1DWCH 1NTPA 2C3SA 3BG4B 3SNCA 5L2YH 2H5CA 5L2ZH 4FUCA 2ALPA 3LC5A 1BZXE 1L1JA 1DX5M