4YOIA

Structure of hku4 3clpro bound to non-covalent inhibitor 1a
Total Genus 91
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
91
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 91
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yoiA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yoiA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yoiA02
3LH1A 5GIBA 2G5NA 4BAHB 4NGAH 1O5CB 2NU2E 1CA0C 3STIA 1IQGA 3VB4A 1O3AA 1P9UA 1C5OH 3SHCH 1A3BH 1F7ZA 1GVLA 3SV6A 2H2ZA 3ZVBA 1EAUA 1YKTA 4GCHG 3UREA 4ISHH 1HUTH 1HNEE 4OS5A 3M7TA 3U1IB 2BYAX 1GI1A 4RKOB 2H5DA 2B8OH 1UMAH 1TNGA 1TABE 2QGRA 1O5GH 1O30A 1ESTA 1BUIA 3T25A 2C93B 1EUFA 4Q7ZA 3MNCA 3EA7A 2YOLA 1GBTA 1QR3E 2HPPH 1C1WH 1XUKA 2ZGJA 4R8TB 1BHXF 1L1NA 1XX9A 2P94A 3RC5A 2ZU5A 3S7HB 1V2MT 2A0QB 1IAUA 3UR6A 3B23B 2VWNA 1XMNB 4X2XA 4BXSA 2R3UA 1ANCA 2XBXA 1YYY1 1MKXH 4X6NA 3NKKA 1CO7E 4ISIH 1K1JA 2ANYA 3CS7A 5A0AE 1VJ9U 1QL9A 2ANWA 3ELAH 3M5LA 3LGUA 2ASUB 4WMEA 1W0YH 4BXWA 2BHGA 3ODDA 1CA0B 1Y5BT 2W7UA 2FS9A 1OWHA 1TPOA 2JKHA 2FODA 2ZNKH 1QA7A 3LC3A 3SHAH 4CHAC 1OX1A 3UUZA 3TH2H 3RXAA 3BEUA 1SGDE 3SNEA 1KXFA 3RXVA 3K65B 3URCA 7GCHF 1HAVA 2Z3CA 4XSKU 3RMNH 1YPGH 3TGJE 2G51A 3QUMP 1DS2E 5B6OA 3NWUA 4OGXA 1PYTD 4A7IB 1W7XH 3OYPA 5JBAS 2CF9H 1BRAA 4HI3A 1S0RA 2HNTE 1ANEA 3ZVFA 1SVPA 1Z7KA 2CJIA 1GHAF 2H1UA 2J4IA 2PHBA 4GUXA 2ALVA 1GGDC 1HJAC 2G55A 3S69A 3UIRA 3BG8A 1Y5UT 4B2AA 1S6FA 5IDKA 1KIGH 4FUHA 2PKSB 3TU7H 3MU0A 1AUTC 2SNVA 3TIUA 3LGTA 1J14A 1EAIA 4DOQA 2C3SA 1WTHD 3QZRA 2V3HH 2GDDA 3QX5H 1ZOMA 3E0NB 4NA9H 4FU9A 3RP2A 1TNIA 1DM4B 1GVZA 2OUAA 2ZI2H 3O8CA 4CREA 1KYNA 2GMTB 1QB1A 2VIPA 5LH8A 1OWKA 3F9HA 1LKAA 1GHAG 4OS2A 1TIOA 4Y10E 2STAE 1P04A 1FPHH 3A8AA 3ZVAA 1QJ6B 3SJIA 2ZU4A 4OS1A 5LGOA 3A7WA 1ARBA 3SI4H 4AG1A 1SMFE 1V2ST 1GHWH 1NRSH 2FX6A 1GI8B 2CN0H 2PGBB 4ABDA 2KAIB 1HV7A 4BAMB 1JRSA 1ABJH 3JZ1B 1C1QA 3T28A 1KXDA 2O8MA 3TJNA 1MKWK 1S0QA 2IPHA 1O3LA 5DK1A 2BVSH 2BB4A 1C5ZB 1L2EA 1ZHPA 1S82A 5LPEA 1FNIA 4IN1A 3UWJH 2ZDMA 1AY6H 1FAKH 4I31A 2OTVA 3SBKA 2Y5HA 1HJAB 3Q3KA 1AWFH 1J16A 5K0HA 2IN2A 1C5RA 2IOTA 5BPEA 1JXPA 2ULLA 5E0GA 1GJDB 1TRMA 3KIDU 5DP6A 2BX4A 4I7YH 2BZ6H 1A0JA 2Y6TA 2NU4E 1TMBH 2VJ1A 4MVNA 1UTPA 1EP5A 1ID5H 1MD7A 1W11U 2CV3A 1MH0A 4TY7A 2FWWA 1O36A 1P2QA 1HXEH 1LVBA 1ZZZA 1SLWB 1F5KU 3FZDA 1DY9A 1VZQH 1QY6A 1TBQH 3A8DA 1UO6A 2ZFQH 3ENSB 1THSH 4I8GA 4K1EA 5F03A 1AZ8A 1GL1A 1P10A 2ZU2A 4HGCA 4YLUA 3LGIA 3QN7A 3U1JB 4AOQA 4SGBE 1GVKB 2LNCA 3EGKH 4UFEH 2OBOA 4VGCB 3RXHA 1FIZA 1BOQA 2P59A 4Y0ZE 2WINI 1MTWA 2ZGCA 3A85A 1LVMA 2CXVA 4B75A 2Z9GA 3SJOA 1VITH 2VH0A 4MQAA 1GBFA 3RXCA 1GHVH 1L4DA 1KLJH 2BY7X 4B2BA 1SLUB 2HALA 5FPTA 4XBDA 2XC5A 3VXFH 2XC0A 3AW1A 4X8UH 1ZJDA 1Z71A 1Z8IB 3OSYA 2WPMS 3GDUA 1UVSH 5HGGA 5DO4H 2G52A 4I8KA 2SGAA 1MUEB 5JDUB 3DHKH 2PGQB 2B5TB 2ZU3A 1MTSA 4BTTB 2AMDA 4BAKB 5GCHG 5A0CA 1ACBE 1O2IA 1OWJA 1PJPA 2FLBH 1EOLA 1IOEA 4KGAA 3CENA 3GDSA 2QN5T 3VXEH 1LHEH 3PO1B 2ZHEH 3E91A 1Y59T 3RXQA 1DANH 3BV9B 1K9OE 2ZDKA 3S7KB 1EPTA 2QXHA 1GBHA 2HPQH 2OQUA 3SU1A 1NC6A 2XBVA 4FVBA 3PWCA 3BIVH 1GBBA 3EBNA 1HAVB 4VGCC 4A1XA 3MH4A 4UFGH 1O3MA 1HAPH 1O2RA 4ZMAH 2ODYB 3L3TA 3BTDE 2ZF0H 2FOAA 2ZFTA 5F8XA 4E05H 1WQVH 2A4GA 5T3HA 1DITH 5GPIB 1FQ3A 1QTFA 3ZZCA 1BTZA 1O3PB 4CRFA 5DP9A 1A0HB 1C2MA 1GI7B 3M5OA 4WXVA 3RXUA 3V12A 1TONA 3S0NA 5DP3A 1KY9A 1O2SA 5GXPA 1MAXA 3MNXA 1FI8A 1GJCB 1RTKA 1CHOG 4ISOA 5L6NH 2GTBA 1MTVA 2VINA 3RXMA 2XC4A 5C5OA 1CE5A 2BD2A 3VPKA 2ZECA 4Y8YA 3UPEA 1RTLA 2GCTC 1FV9A 1XUFA 2FIRH 3A80A 1O38A 1Y3VA 1G9IE 3KN2A 1FY3A 3SNAA 1GDNA 1SGNE 4LZ1H 4WH6A 1Z6EA 1O2ZA 1D6RA 4O03A 2A1DB 4ABGA 2FOCA 2TIOA 2XNIA 1FAXA 2VVCA 1NFUA 5AFYH 4GHTA 4AZ2B 5DP5A 2SGDE 1C5UA 1UTKA 1C5TA 1AHTH 3A8CA 4UFDH 5FBEA 4ABHA 3EA9A 4YO9A 4WXIA 3TITA 1MZAA 4BTUB 4LK4A 1TOCB 1DXWA 1O3JA 1BRCE 2FMJA 1A2CH 2PUXB 1SB1H 3KQEA 3RDZA 4A1TA 4J2YB 3SU2A 1C5PA 3HK6B 3UOUA 3UQOA 1J8AA 4FUBA 1EPTC 3QWCH 1T31A 4NG9H 1EZUC 2GDEH 1O5DH 4Z0KA 1HLTH 4INKA 1P8VC 2WV4A 3PV4A 3QK1A 1HAOH 1DVAH 2GKVE 4A5TS 5C67A 1GI2A 4ABJA 5CE1A 4WJG2 5C5NA 3DUXH 3RXEA 3KQBA 3SZNA 3DD2H 2W3KA 1KDQB 1C1UH 2PLXA 3SJ8A 3Q76A 4JZIA 2AIQA 3M36A 1BZXE 3GCTF 3MOCA 5DPAA 1N1LA 1UHBA 1HAHH 1KLIH 4OGYA 1YPKH 1ZMNA 2ZDLA 3KGPA 3TNSA 1GBJA 3P8GA 1QJ1B 3DFJA 2FTMA 1GBEA 3ATIA 1S6HA 3PMHB 1EASA 4PROA 1GDUA 3VGCC 5EPNA 4CH8B 2Q1JA 1W14U 1ZPZA 3ZV8A 2H9TH 4AORA 3BTKE 2Y80A 1TPPA 1P2KA 2BD5A 1V2LT 2WPLS 3RXPA 4NSYA 1C2KA 2OC1A 1Z1IA 1RJXB 3K6ZA 1GJ9B 1O2YA 3GCTG 2P3TB 1O2XA 2R2MB 3AAUA 3PLBA 4F4OC 1OKXA 4UDWH 1TA6A 1UK4A 1QRZA 5J4SA 4YM9A 1K1LA 1PPBH 3F9GA 2BVXH 1AFEH 1GHZA 3ZZAA 4I8JA 2A4RA 4B2CA 3RXKA 1NFXA 2PKAA 3O8DA 1IQKA 2J95A 1XXFA 3H7TA 5FX6A 2JH0D 5C1UA 3BEIB 5K7RA 1S85A 3HKIB 2ZGXH 3NK8A 3SORA 1LCYA 2QXGA 3ZVEA 1ELBA 1Q31A 1K1MA 4YOGA 1KLTA 2AGGX 1YLDA 1NU7B 2BDGA 1CSOE 2O8WA 1V2TT 2FM2A 2VB0A 2XWBI 1BQYA 2A2QH 1CGJE 1SGPE 5EU8A 2PSYA 3EDXB 1ZPBA 1MQ5A 1HCGA 1O2TA 1C5XB 3VB7A 2GX4A 1O3NA 4J1YA 4E7RG 3BTGE 4U01A 2W3IA 2Y81A 2HLCA 1IQIA 5C1YA 3SO3A 2ZA5A 1O3FA 4MLFB 5BRRE 1GMCG 1PPEE 4X8TH 4CH2B 3JZ2B 1ZRBA 2TGDA 2FOEA 2RA3A 1MD8A 5A0BA 5JBBS 5L2ZH 3BF6H 2UWOA 5ESBA 3E6PH 1C5SA 2ANKH 5E2OA 3SW2B 1QNJA 2ZHWH 1EX3A 1W0ZU 1EQ9A 3E1XB 3SNCA 4AFZA 2G8TA 3QTVH 1CGIE 1OXGA 3BG4C 4OS6A 5JB9S 3GY3A 1SR5C 3E3TA 2R2WU 3SV8A 2ZDNA 1FN8A 1BMAA 4YOJA 3SUEA 3FFGA 5EQQA 1AZZA 1BTYA 1YCPM 1ZR0A 4K8YA 1GCTC 1W8BH 3ATKA 1P06A 1Y3WA 2P3FH 3MHWU 1EAWA 1RIWB 1DY8A 1DT2A 1VCPA 3RC4A 1FY5A 4AB9A 1E36B 1D3QB 1O0DH 4UEHH 1SGFA 1MU8B 2FXRA 1BTUA 2D2DA 1O33A 3SUGA 3GY5A 1WOFA 2BOKA 3GY6A 4K5ZA 3MYWA 5EQRA 1F5RA 2A5AA 2BD4A 3KHVA 1SGCA 1IQFA 1P2MA 1WCZA 1GI0A 3P8FA 3AVZA 1GHBG 5EXLA 1LO6A 2NU0E 1NRPH 2Q6FA 1HYLA 4B74A 3RXJA 4ZUHA 5FCRA 4Y71A 4YT7H 4JK5A 4ABIA 1N8OC 3ZYDA 3MU1A 2Z7FE 1O2NA 4KTCA 1SL3A 2THFB 3N7OA 1LPZB 1CBWB 3OU0A 1D3TB 5JBCS 4IMZA 3ZZ6A 3U98H 1GBMA 4IW4E 5IYTA 1FY1A 4XBCA 3GCOA 3D23A 4FUEA 2JETC 1NPMA 3S9AA 4H42U 1UK3A 1KXBA 1LVYA 1DDJA 1O3CA 2A32A 4INHA 1MTNC 2FOGA 1TNHA 4H6SB 4CRAA 4Y0YE 1C5YB 1XUHA 4KTUA 4NIYA 1IQNA 1RD3B 5T6FA 1WTGH 2ZHFH 1AWHB 1UTJA 3GY2A 2HVXA 1EPTB 1O2UA 1QGFA 1EAXA 2ZPSA 3T27A 4AYVB 4DW2U 3P70B 1SOZA 1GCTB 1C2IA 1H9IE 1GMDG 2CGAA 1OWDA 1K1OA 3MU5A 2VVVA 1O5BB 3UY9A 2VH6A 4AFUA 1BDAA 4YESB 1WYKA 4FXGH 3ITIA 3MU4A 3V7TA 1SFIA 3BG4B 4Y76A 5I25A 2FOBA 2GZ7A 1SLVB 2BMGB 4MPXA 2ZCLP 4JZDH 1TALA 4HZHA 1AO5A 2PR3A 4DIIH 1HRTH 6ESTA 1GCDA 7KMEH 4NCYA 1Z8JB 4HFPB 1P09A 1GMDF 1AVGH 1N8OB 2B0FA 2G4TA 3SU3A 1EZSC 3RXSA 4O3TA 3RU4T 3MH5A 4ABEA 4D8NA 4CBNA 2ZFPH 2H9EH 2F9OA 2A5KA 1OYTH 2J34A 1UCYK 1YGCH 1RGQA 5F8TA 3LDXH 4FVDA 1KXAA 2P8OC 3E16B 2W5EA 2BD9A 4NIWA 3U8OH 4ZHLU 1P2IA 1BITA 1QHRB 4LOYH 3HGNA 4UD9H 1IQHA 2UUJB 2H9HA 1G37A 1Z8RA 2PTNA 4K1TA 1B0EA 6CHAB 1C1MA 1QURH 2XRCA 1GJ4H 3O8RA 1EKBB 3A7ZA 3SI3H 1P11E 2FESH 4BTIB 5TCCA 1TRNA 1NS3A 3P92A 1O3GA 3Q77A 3KF2A 4XBBA 1FPCH 1Y3YA 3AW0A 2Y7ZA 2QF3A 1PPCE 3A82A 3ZZ5A 1CA8B 1DLKB 1VCWA 2GCHF 3TJOA 1A5IA 1ARCA 1Q2WA 1LQDB 1AKSB 1S81A 1P02A 1KTSB 1K22H 1BTHH 1OWEA 4DJZB 3GYLB 2VVUA 1FN6A 1ETSH 2OD3B 2UUFB 3PMBB 2SNWA 2DUCA 1ZYOA 1D3DB 1EB2A 3V13A 1IHTH 1ZTKA 3B8JA 5EXMA 1O2KA 1TBZH 2QCYA 3TJUA 3M3VA 4ABAA 3RXLA 3A8BA 1NFWA 2GZ9A 2FOFA 2OC8A 1EJAA 2GGVB 1G30B 1P2JA 1EJNA 2FOHA 2G5VA 3SU0A 4THNH 2OQ5A 4BAQB 4AGKA 2QXJA 1A3EH 3SUFA 2H6MA 1NRNH 1N6YA 4D7FA 4ZKRU 3BN9A 1C1RA 5DKMA 1IQJA 1UVOA 1ZSLA 2TGAA 1BMLA 4XOJA 1TPAE 1K1PA 4QT8C 4O9VA 1PQ7A 3FP7E 1TB6H 3CS0A 1GI5A 1Z1JA 2ANMH 1SFQB 2EEKA 2GD4B 1FONA 1FDPA 2UWPA 3SUDA 2Z6BD 4AX9H 4JZ1A 1X7AC 5JYIA 3K9XB 1AKSA 2FYQA 1PQAA 3KQCA 6CHAC 4MNXA 2F9PA 3PLPA 1GGDB 1QRXA 1WV7H 2OCVB 3GISB 5EOKA 1ORFA 1N6XA 5EG4A 3I78A 3IG6B 3BSQA 3C27B 3T5FH 1O2HA 2CF8H 1GJ7B 2ZFSA 1JRTA 3ZVCA 1HB0B 4AFQA 1C1VH 2VIQA 1BMNH 1GG6B 1ZGVA 2VIOA 4AB8A 1AFQB 2WYJA 3DT0H 5A8YA 2Y82A 3UWIA 3D62A 3T29A 3LC5A 1BHXB 1C5VA 1HXFH 1IHSH 5T6DA 1C2GA 3RUOA 1O5AB 1VITG 5A8ZA 1HAIH 1DLEA 4O3UA 4E7NA 5PTPA 2GZ8A 4MG3A 1BBRK 3D49H 1T32A 5TCAA 4ZKOU 2VNTA 2ZFRH 1BRBE 1LVOA 3AAVA 1GJAB 3A7TA 3PMJA 1XUGA 4ESTE 1HAXB 2QAAA 3LGYA 2Z9JA 3Q00A 2JH5D 3D65E 1OPHB 1OYQA 2FOMB 3RM0H 5GCHF 4X8VH 4F49A 3SJ9A 3PLKA 3UNSA 7ESTE 1THRH 2AIPA 3VB5A 1BCUH 6GCHG 4ZAEA 2I6SA 1O37A 4ZROA 1HDTH 1PYTC 2GCHG 1AI8H 1C9TA 1E35B 1HBTH 1OOKB 4A1VA 4CRDA 3BIUH 1NM6A 1NO9H 1TOMH 2BLQA 1UVUH 1UHBB 2BM2A 4K60A 2UWLA 4TYDA 1DUEA 4MTBA 1GBLA 3TK9A 3RXRA 2HNTF 2V6NA 4WH8A 4WVPE 2WPJS 1ZTJA 1HAGE 1RFNA 1GWAA 4DURA 3TPIZ 1ELDE 3MNBA 4RN6A 2BDHA 4X0WU 3SV9A 2BDAA 5A09A 2A7CA 1DX5M 2C8YB 1GBAA 3RLWH 1C1TA 2ODPA 2A5IA 1C4Y2 2LIZA 5GWZA 1G3CA 4MNYA 1NRRH 1WU1A 3NUMA 1P03A 1FIWA 3M5NA 4OS4A 1TYNA 3SU5A 4X1SU 2ZPQA 1O3EA 3VFEA 2WUCA 3QDZB 5E0HA 2BQ7B 2A4QA 3RXFA 2ZDVH 1E38B 2P3UB 2BVRH 4NFEA 1QJ7B 1F0SA 5J4QA 5JBTA 1CT4E 3R0FA 1C1SA 2WPIS 3SU6A 2OLGA 1V2QT 1JIRA 2C8XB 2SGQE 2WPHS 4ZKNU 5LPRA 3TK5A 2BD3A 4Y8XA 1LTOA 7GCHG 1AQ7A 2ILNA 2ESTE 4IBLH 1QA0A 4DY7B 1O2QA 1SSXA 2J92A 2XCNA 1YPJH 1B7XB 2BDBA 1GI9B 5L30H 1DICA 1P0SH 1GI3A 3PO1C 1W10U 2VIDA 1C2HA 4X6PA 1ANBA 1PPFE 2GP9B 3ZVGA 4X1PU 3OY6U 1CU1A 4D9QA 1NY22 4FUFA 1LHFH 3A81A 2FTLE 2SGPE 2VU8E 4Q7XA 1GI6A 4IMQA 4INLA 1DFPA 4BNRA 1AN1E 1GI4A 4D7GA 4IGDA 3ATMA 4NA7A 1AMHA 1PFXC 2FZZA 5L2YH 1V2JT 2A7HA 2OC7A 1Y5AT 8ESTE 1Q3XA 2XCFA 1F0RA 1QQ4A 1YLCA 1D9IA 1YC0A 1UTOA 2C90B 1T8NA 1ELCA 4I8HA 5HYOA 2ZWLH 4ISNA 3GICB 1G2LA 2OBQA 1XVMA 3HK3B 1HJ9A 3O8BA 4NZLA 4K1SA 1E0FD 4TPIZ 3GYMA 2J2UA 2FP7B 1C5MD 2FEQH 5EW2H 2OINA 2F9NA 1IQLA 1QL7A 2AH4X 2XBWA 5SGAE 4WMFA 5DGJA 1DSTA 1AGJA 8GCHG 2GCTB 2GV7A 3NXPA 5GJ4B 1MTNB 2VWMA 2BTCE 1D6WA 1JWTA 1TGBA 1ZHMA 3P8NA 5DG6A 3A84A 2QYIA 5EW1H 2ALPA 3QLPH 1G36A 4X1QU 3RMLH 1IQMA 3GCNA 4MPUA 3T26A 3OTJE 4A6LA 2HWLB 2PW8H 3A86A 1L4ZA 2ZGHA 1HJ8A 3RMOH 1PPGE 2BOHB 2BQ6B 1P3EA 3UFAA 1D4PB 1SC8U 1BIOA 4JCNA 1BTXA 3M3TA 1J17T 1C2EA 1ZTLA 4IN2A 2BX3A 3LPRA 1A5HA 2AGIX 1ESAA 2NU3E 2O8UA 3QGNB 3EA8A 1Y3XA 2BXUH 1C4V2 4AYYB 2ZCKP 4JYUH 2O8TA 1V2WT 1THPB 3ZZ9A 4LZ4B 1J15A 2WPKS 5FXLA 1CHOF 1NRQH 2AYWA 1O32A 1YCPK 1TAWA 4ZHMU 3ZZ3A 4UONA 2C4FH 1RIWC 2F9VA 2KAIA 3UQVA 1GJ6A 2CMYA 3MWIU 2K1QA 2CHAB 1ESBA 4H4FA 2STBE 2QY0B 4U2WA 1ZMLA 2XW9A 1YPEH 5I46H 3NCLA 3ZV9A 3ZVDA 2AFQB 3MU8A 3Q3YA 1H8IH 3TGKE 3E0PB 1BTWA 2BY8X 1SOTA 3M7QA 4X2WA 1UTNA 3DFLA 1O3BA 2C8ZB 2HNTC 1P2OA 2ZFFH 3RM2H 5DP8A 1V2NT 2BLWA 3VEQB 3IWMA 1DPOA 4B71A 1K21H 1NROH 4I33A 2F91A 1EP6A 3PYHA 1TNLA 1C1OA 8KME2 1P05A 1YM0A 6LPRA 2Y7XA 1W12U 5FAHA 1CQQA 5F8ZA 3ZZDA 1FXYA 3Q3XA 3LIWA 3PTBA 2BQWB 1ETTH 3QZQA 4BOHA 1XUJA 2OC0A 4DCDA 1O35A 1MAYA 1Z6JH 2TBSA 1A1RA 4Y6DA 4ZXYH 3MI4A 3UTUH 2GT8A 1ABIH 1CT0E 3GCHB 1QL8A 1JBUH 5EPYA 1G3EA 1GDQA 3MO3A 2TPIZ 5FPYA 3P6ZB 4O97A 3E90B 1H8DH 1NN6A 2G81E 3TH4H 1KXEA 3HATH 1BRUP 3I29A 3NZIA 1O5EH 3ZYEA 1A0LA 1UCYE 1SGTA 1AVWA 1ELTA 3PM3A 4XE4A 2ZP0H 1GJ8B 4IC5A 2QA9E 1B5GH 2QC2A 1CHGA 1RS0A 3TLOA 2BY6X 5A8XA 1V2KT 2WYGA 2BZAA 3MNSA 1DE7H 3C1KA 2H5CA 1SGYE 3PROA 3ZZ4A 2RG3A 2AGEX 1O39A 1QB9A 2V0BA 2ZU1A 4Y8ZA 2VIWA 2BD8A 1ELEE 1JMOH 3M37A 1GMHF 1MZDA 3LKWA 4TPYA 2TGTA 4KP0A 3K6YA 4ZHAA 1BJUA 5AHGH 1S5SA 1E37B 2F3CE 4FUGA 2EA3A 3E8LA 3PB1E 1W7GH 2WV5A 1UTQA 1A7SA 2AS9A 1KDQA 1KXCA 2HOBA 1P01A 3OX7U 1T8LA 2Z9KA 2P93A 2ZQ1A 4M7GA 4YT6H 3RXGA 3P17H 1T7CA 3TJVA 1ELVA 2FS8A 4KELA 3GCHC 1VR1H 1F0UA 4FUCA 1IQEA 3LGVA 1DWEH 1PPZA 3EYDA 2J38A 1WSSH 1EOJA 4CRCA 3TVJB 2QIQA 2Z3DA 2NWNA 1SGEE 3SNBA 1PPHE 2G4UA 1TX7A 3KNXA 1SQOA 4A92A 4UE7H 2ZKSA 1GHYH 1LPGB 2ZEBA 3V3MA 3M61U 5CHAC 1INCA 2GMTC 3SU4A 4NIVA 4ZH8A 1SQTA 2Z3EA 4IC6A 2ZC9H 2BDCA 9ESTA 1TMUH 1QQUA 5FCKA 2AERH 2PFEA 4GPGA 4K69A 3F1SB 1ZGIA 4NA8A 1HIAB 1DWBH 2OP9A 1AIXH 3KL6A 1RXPA 3T2NA 1GJBB 2EI6A 2PV9B 4RKJB 3ZZ7A 1CVWH 1V2UT 5AVDA 4MPWA 4YTAA 3RXIA 1C5QA 4TWYA 1XXDA 3BTQE 3F68H 1SPJA 1LQEA 1K1IA 4DIHH 3MTYA 4GCHF 3FVFB 3P95A 4Z6AH 1W13U 4B76A 1TLDA 1BBRH 1ZSKA 3TK6A 4X2VA 1MCVA 4JZEH 1SGFG 1FY4A 3URDA 4AN7A 3LJJA 1P57B 3GDVA 4X8SH 5FX5A 1BT7A 3M35A 4E06H 4JZFH 3V0XA 3VB6A 1XUIA 4Y7AA 3FP8E 5JB8S 1T4UH 1FZZA 1L0ZA 1OS8A 2F9BH 2ODQA 3DA9B 3M3SA 1QB6A 1XVOA 4KKDA 1AB9B 3PWBA 2ZG0H 3GY8A 3RLYH 1C2LA 1B0FA 1NFYA 3H5CB 3RXDA 2YNAA 1F2SE 1JIMA 1EB1H 1GPZA 3W94A 2FI4E 1MU6B 1LHDH 3RC6A 1UTMA 2ZTXA 3FP6E 5DJ7A 1H9HE 8GCHF 2R0LA 4GAWA 1GG6C 1SGIB 2BLVA 3HPTB 3BTFE 3HKJB 3GY7A 1HAZB 2ZTYA 3QTOH 4YLQH 1O5FH 2AMQA 1A61H 3U8RH 1G32B 1V2PT 1TQ7B 4OS7A 3SNDA 1LPKB 2XTTB 1RTFB 1NU9A 3LU9B 1V3XA 3A83A 2M5TA 1J9CH 1C5NH 2W26A 3U8TH 4K2YA 3RMMH 1K28D 2PWXA 1YPHC 1LHCH 1W3CA 3ODFA 1GL0E 2FI3E 1EATA 4CR5A 4TWWA 3S9BA 3K2UA 4YOIA 4K3JA 1SBWA 1P9SA 2D1JA 3SGQE 5ABWA 4NZQA 1TX6A 2RCEA 1TX8A 1Y3UA 2FO9A 4JMYA 4IS5A 2GV6A 3SGBE 1AU8A 5C2ZA 1WQSA 3EQ0H 1UTLM 1Z8GA 9LPRA 4FUIA 2PSXA 1U6QA 1GJ5H 2NU1E 1C1NA 3BEFB 2PKSC 3HGPA 1MKXK 2BD7A 2TGPZ 2Y5FA 5E8EH 3M5MA 1LMWB 1FJSA 1OSSA 2VWOA 3MO6A 2R3YA 1TGNA 2HRVA 2Q6GA 1G3BA 1O2PA 4CR9A 5F6MA 1T8OA 4X2YA 3UNQA 2J9NA 2VIVA 5E0JA 2FI5E 3GY4A 2PUQH 3FANA 1VGCC 3F6UH 5GDSH 3R3GB 1YPLH 1C1PA 2P95A 4WMDA 1XKAC 2I6QA 4FU7A 2QF0A 3BTWE 4I8LA 3UNRA 1TWXB 1MTUA 4FUDA 3LGWA 3PTNA 4DT7B 3BTTE 3ESTA 1LKBA 1P12E 4Q80A 4CRBA 3P8OA 4I32A 1YCPH 1DXPA 2FYRA 2RDLA 3BTME 3EE0B 1DSUA 2AMPA 4NWKA 3F9EA 4Q7YA 1CBWC 1TQ0B 2D8WA 2BDIA 3MO9A 3IITA 1HFDA 4CHAB 1TE0A 1NZQH 2A45B 1XKBC 1UK2A 4X6MA 1DWCH 1GMCF 2DE8A 3A87A 1NT1A 5FBIA 5FPSA 4ZXXH 1SQAA 1F5LA 4CRGA 2VGCB 5ETXA 2BDYA 1DOJA 4U32A 5FHTA 2ZTZA 2SGFE 5AF9H 1A4WH 1SG8B 1O2JA 2TRMA 1O34A 3NPSA 1HPGA 5CHAB 3G01A 1D3PB 4U30A 3U9AH 1SGRE 1VGCB 3KEEA 3SV7A 2BY9X 1BBRE 2VWLA 3PMAB 5HXFA 2JH6D 4NSVA 1TGTA 2F9UA 1YF4A 1ZPCA 2IJOB 1BJVA 2ZCHP 1AFQC 4AGJA 3FAOA 5HMAA 1ZHRA 1AD8H 1O2MA 2Z94A 3KCGH 1TRYA 3ATWA 1OP0A 1UVTH 2ZHQH 1O2WA 1BB0B 4JYVH 4JYTA 3T62A 2V35A 2XWAA 2B7DH 3W95A 3QGJA 2XYAA 1L1GA 1O2LA 1SHHB 1GHBF 5CMXH 2SFAA 1NTPA 3RXTA 2FLRH 4BAOB 5EXNA 1LHGH 2A2XH 1SLXB 2LPRA 2A31A 2XXLA 1O31A 1O3IA 1K2I1 2R0KA 5H4IB 1AUJA 1GBIA 2ZO3H 2FPZA 1C5LH 2W7SA 4ASHA 2AEIH 4GSOA 3KQDA 8LPRA 1BTPA 4DGJA 1TA2A 1G3DA 2ZQ2A 1L1JA 2V3OH 2ZDAH 4HTCH 2P8OB 3LT3A 2O9QA 3RU4E 1PQ5A 1FY8E 2F83A 2FDAA 5T6GA 1G2MA 2JETB 3ATLA 3F9FA 1AE8H 1ELFA 3SV2H 1O2OA 1EZQA 4D9RA 1GBDA 1O3KA 3VB3A 4X1NU 3FZZA 4UFFH 5C20A 1BA8B 3MFJA 1TNJA 4MPVA 1UJ1A 1PQ8A 2XBYA 4KTSA 1O3DA 4GLYA 1TPSA 2ZIQH 1SHYA 1ZLRA 5AFZH 3TH3H 3M7UA 2RA0A 2ZZUH 3A88A 3WY8A 2DE9A 1GHXH 2A7JA 3AASA 1KTTB 2UUYA 1C4U2 1ELAA 4Y79A 2Z9IA 5G4BA 3A7XA 1ZMJA 1F92A 1H1BA 1S83A 1YPHE 1A46H 1NESE 1TBRH 1E34B 3SN8A 7LPRA 3A89A 1V2VT 3OY5U 1GMHG 3MH7A 5C1XA 5TJXA 3TNTA 1FMGA 4Y7BA 2CHAC 5EQSA 3SGAE 1O3OA 2BY5X 3LOXA 3SQHE 3RXBA 1QRWA 1GBKA 2EI8A 1DUAA 2J94A 1VJAU 3SJKA 3GOVB 4RSPA 3SQEE 4WY3A 2FX4A 4AFSA 4Y11E 4YZUA 4ZKSU 1F0TA 2UUKB 2ZHDA 2EC9H 1ZSJA 4D76A 1P2NA 1QFKH 4MNWA 4B73A 1SGQE 1MQ6A 1AE5A 2QV1A 2G00A 3U69H 3L6PA 4ABBA 2PTCE 5HM2A 1WUNH 5C3NA 1RRKA 1HIAA 1ZRKA 5JPMH 1H4WA 3H7OA 2C8WB 4H6TA 2K7XA 1A5GH 3BTHE 1ELGA 1YPMH 2GVFA 1UVPA 1VCQA 1FUJA 1C2JA 1O2VA 2B9LA 3UOPA 3I77A 4NFFA 1OWIA 5E2PA 3B9FH 1C2FA 1W2KH 1ZJKA 1P3CA 4DG4A 1S84A 1TNKA 1O2GH 2D26C 1XM1A 1Y8TA 1C9PA 5DP7A 2SGEE 2Q6DA 1CT2E 4XDEA 2PKAB 1V2RT 1QBNA 1HGTH 1TGSZ 3A7VA 2EI7A 4ISLA 1EZXC 1TGCA 1QBVH 2YNBA 2Z9LA 5EGMA 1K1NA 1VITF 1V6DA 3L33A 4NWLA 1ANDA 1YBWA 1M9UA 4TY6A 1CGHA 1LDTT 1TMTH 1YP9A 5EODA 3S9CA 4X6OA 4X1RU 1BMMH 1WBGB 4MDSA 1TFXA 1C5WB 1JOUB 1HAYB 1H9LB 1OP8A 3VGCB 1O3HA 1QCPA 1QIXB 2P16A 1T4VH 3SOSA 1UCYH 2WUBA 3LH3A 3QO6A 2VGCC 4SGAE 4B1TA 3TGIE 6GCHF 1AB9C 3STJA 4FUJA 4AG2A 1WAYB 1V2OT 3BTEE 1ETRH 3RXOA 4NIXA 4LXBH 3MH6A 2R9PA 1GBCA 4R0IA 3LONA 2Y5GA 4WF8A 4JK6A 2GT7A 4GVUA 3RU4D 4WWYA 1OP2A 1DWDH 1C2DA 5HM9A 1EXFA 4BANB 1MBQA 4XFQA 1MKWH 2ZPRA 4ABFA 1QBOA 3MMGA 4FU8A 2OXSA 2BLOA 1MBMA 1SI5H 3ZZ8A 2QXIA 2HGTH 1EJMA 3EAJA 2ZGBH 4MNVA 3UR9A 2A4OA 4GHQA 4DVAU 2BXTH 4K8BA 1KSNA 5LPFA 3LJOA 3A7YA 1MCTA 1MMJN 3CP7A 1AVXA 3ZZBA 1FLEE 1T8MA 2O8LA 4Q2KA 5DP4A 5ESTE 4CBOA 5A2MH
chains in the Genus database with same CATH superfamily
3LH1A 5GIBA 2G5NA 4BAHB 4NGAH 1O5CB 2NU2E 1CA0C 3STIA 1IQGA 3VB4A 1O3AA 1P9UA 1C5OH 3SHCH 1A3BH 1F7ZA 1GVLA 3SV6A 2H2ZA 3ZVBA 1EAUA 1YKTA 4GCHG 3UREA 4ISHH 1HUTH 1HNEE 4OS5A 3M7TA 3U1IB 2BYAX 1GI1A 4RKOB 2H5DA 2B8OH 1UMAH 1TNGA 1TABE 2QGRA 1VKYA 1O5GH 2RDEA 1O30A 1ESTA 1BUIA 3T25A 2C93B 1EUFA 4Q7ZA 3MNCA 3EA7A 2YOLA 1GBTA 1QR3E 2KR7A 2HPPH 3PRBA 1C1WH 1XUKA 2ZGJA 4R8TB 4FETA 1BHXF 1L1NA 1XX9A 2P94A 1NBME 3RC5A 3DCLA 2ZU5A 3S7HB 1V2MT 2A0QB 1IAUA 3UR6A 3B23B 2VWNA 1XMNB 4X2XA 4BXSA 5CDFE 2R3UA 1ANCA 2XBXA 1YYY1 1W0JD 1MKXH 4X6NA 1S6LA 3NKKA 1CO7E 4ISIH 1K1JA 2ANYA 3CS7A 5A0AE 1VJ9U 1QL9A 2ANWA 2J98A 2KZ4A 4AC9A 4DT4A 3ELAH 3M5LA 3LGUA 2ASUB 4WMEA 1W0YH 4BXWA 2BHGA 3ODDA 1CA0B 1Y5BT 2W7UA 2FS9A 1OWHA 1TPOA 2JKHA 2FODA 2ZNKH 1QA7A 4RT1A 3LC3A 3SHAH 4CHAC 1OX1A 3UUZA 3TH2H 3RXAA 3BEUA 1SGDE 3SNEA 1KXFA 3RXVA 4ASUD 3K65B 3URCA 7GCHF 1HAVA 2Z3CA 4XSKU 1MABB 3RMNH 1YPGH 3TGJE 2G51A 3QUMP 1DS2E 1YY3A 5B6OA 3NWUA 4OGXA 1PYTD 4A7IB 1W7XH 3OYPA 5JBAS 2GJGA 2CF9H 1BRAA 4HI3A 1S0RA 2HNTE 1ANEA 3ZVFA 1SVPA 1Z7KA 2CJIA 1GHAF 2H1UA 2J4IA 2PHBA 4GUXA 2ALVA 1GGDC 1HJAC 2G55A 3S69A 3UIRA 3BG8A 1Y5UT 3PV5A 4B2AA 1S6FA 5IDKA 1KIGH 4FUHA 2PKSB 3TU7H 1KMHB 3MU0A 1AUTC 2SNVA 3TIUA 3LGTA 1J14A 1EAIA 4DOQA 2C3SA 1WTHD 3QZRA 2V3HH 2GDDA 3QX5H 1ZOMA 3E0NB 4NA9H 4FU9A 3RP2A 1TNIA 1DM4B 1GVZA 2OUAA 2ZI2H 3O8CA 4CREA 1KYNA 3F2HA 2GMTB 1QB1A 2VIPA 5LH8A 1OWKA 3F9HA 1LKAA 1GHAG 4OS2A 1TIOA 2KCOA 4Y10E 2STAE 1P04A 1FPHH 3A8AA 3ZVAA 1QJ6B 3SJIA 2ZU4A 4OS1A 5LGOA 3A7WA 1ARBA 3SI4H 4AG1A 1SMFE 1V2ST 2L6OA 1GHWH 1NRSH 2FX6A 1GI8B 2CN0H 2PGBB 4ABDA 2KAIB 1HV7A 4BAMB 1JRSA 1ABJH 3JZ1B 1C1QA 3T28A 1KXDA 2O8MA 3TJNA 1MKWK 1S0QA 2IPHA 1O3LA 5DK1A 5HKKD 2BVSH 2BB4A 1C5ZB 1L2EA 1ZHPA 1S82A 5LPEA 2LP6A 1FNIA 4IN1A 3UWJH 2ZDMA 1AY6H 1FAKH 4I31A 2OTVA 3SBKA 2Y5HA 1HJAB 3Q3KA 1AWFH 1J16A 5K0HA 4ZCNA 2IN2A 1C5RA 2IOTA 5BPEA 1JXPA 2ULLA 5E0GA 2WPDD 1GJDB 1TRMA 3KIDU 5DP6A 2BX4A 4I7YH 2BZ6H 1A0JA 2Y6TA 2NU4E 1TMBH 2VJ1A 4MVNA 1UTPA 1EP5A 1ID5H 1MD7A 1W11U 2CV3A 1MH0A 4TY7A 2FWWA 1O36A 1P2QA 1HXEH 1LVBA 1ZZZA 1SLWB 1F5KU 3FZDA 1DY9A 1VZQH 1QY6A 1TBQH 3DSPA 3A8DA 1UO6A 2ZFQH 3ENSB 1THSH 4I8GA 4K1EA 5F03A 1AZ8A 1GL1A 1P10A 2ZU2A 4HGCA 5GNDA 4YLUA 3LGIA 1YLNA 1W0KD 3QN7A 3U1JB 4AOQA 4SGBE 1GVKB 2LNCA 3EGKH 4UFEH 2OBOA 4VGCB 3RXHA 1FIZA 1BOQA 2P59A 4Y0ZE 2WINI 1MTWA 2ZGCA 3A85A 1LVMA 2CXVA 4B75A 2Z9GA 3SJOA 1VITH 2VH0A 4MQAA 1GBFA 3RXCA 1GHVH 1L4DA 1KLJH 2BY7X 4B2BA 1SLUB 2HALA 2YMSD 5FPTA 4XBDA 2XC5A 3VXFH 2XC0A 3AW1A 4X8UH 1ZJDA 1Z71A 1SQRA 1Z8IB 3OSYA 2WPMS 3GDUA 1UVSH 5HGGA 5DO4H 3F0OA 2G52A 4I8KA 2SGAA 1MUEB 2CK3D 5JDUB 3DHKH 2PGQB 2B5TB 2ZU3A 1MTSA 4BTTB 2AMDA 4BAKB 5GCHG 2HLDD 1ACBE 1O2IA 1OWJA 5A0CA 2HVYB 1PJPA 2FLBH 1EOLA 1IOEA 4KGAA 3CENA 3GDSA 2QN5T 3VXEH 1LHEH 3PO1B 2ZHEH 3E91A 1Y59T 3RXQA 1DANH 3BV9B 1K9OE 2ZDKA 3S7KB 1EPTA 2QXHA 1GBHA 2HPQH 2OQUA 3SU1A 1NC6A 2XBVA 4FVBA 3PWCA 3BIVH 1GBBA 3EBNA 1HAVB 4VGCC 4A1XA 3MH4A 4UFGH 1O3MA 1HAPH 2J98B 1O2RA 4ZMAH 2ODYB 3L3TA 3BTDE 2ZF0H 2FOAA 2ZFTA 3FKSD 5F8XA 4E05H 1WQVH 2A4GA 5T3HA 1DITH 5KEDA 5GPIB 1FQ3A 1QTFA 3ZZCA 1BTZA 1O3PB 4CRFA 5DP9A 1A0HB 1OHHD 1C2MA 1GI7B 3M5OA 4WXVA 3RXUA 3V12A 1TONA 3S0NA 5DP3A 1KY9A 1O2SA 5GXPA 1MAXA 3MNXA 1FI8A 1GJCB 1RTKA 1CHOG 4ISOA 5L6NH 2GTBA 1MTVA 2VINA 3RXMA 2XC4A 5C5OA 1CE5A 1YWUA 2BD2A 3VPKA 2ZECA 4Y8YA 3UPEA 1RTLA 2GCTC 1FV9A 1XUFA 2FIRH 3A80A 1O38A 1Y3VA 1G9IE 4B6EA 3KN2A 1FY3A 3SNAA 1GDNA 1SGNE 4LZ1H 4WH6A 1Z6EA 1O2ZA 1D6RA 4O03A 2A1DB 4ABGA 4Q4LA 2FOCA 2TIOA 2XNIA 1FAXA 3GS9A 2VVCA 1NFUA 5AFYH 4GHTA 4AZ2B 5DP5A 2SGDE 1C5UA 1UTKA 1C5TA 1AHTH 3A8CA 4UFDH 5FBEA 4ABHA 3EA9A 4YO9A 4WXIA 3TITA 1MZAA 4BTUB 3DSOA 1TOCB 4LK4A 1DXWA 1O3JA 1BRCE 2FMJA 1A2CH 2PUXB 1SB1H 3KQEA 3RDZA 4A1TA 4J2YB 3SU2A 1C5PA 3HK6B 3UOUA 3UQOA 1J8AA 4FUBA 1EPTC 3QWCH 1T31A 5DSFA 4NG9H 1EZUC 2GDEH 1O5DH 4Z0KA 1HLTH 4INKA 1P8VC 2WV4A 5KGOA 3PV4A 3QK1A 1HAOH 1DVAH 2GKVE 4A5TS 5C67A 1GI2A 4ABJA 5CE1A 4WJG2 5C5NA 3DUXH 3RXEA 3KQBA 3WWBA 1BMFD 3SZNA 3DD2H 2W3KA 1KDQB 1C1UH 2PLXA 3SJ8A 3Q76A 4JZIA 2AIQA 3M36A 1BZXE 3GCTF 3MOCA 5DPAA 1N1LA 2KX4A 1UHBA 1HAHH 1KLIH 4OGYA 1YPKH 1ZMNA 2ZDLA 4RT0A 3KGPA 3TNSA 1GBJA 3P8GA 1QJ1B 3DFJA 2FTMA 1GBEA 3ATIA 1S6HA 3PMHB 1EASA 4PROA 1GDUA 3VGCC 5EPNA 4CH8B 2Q1JA 1W14U 1ZPZA 3ZV8A 2H9TH 2AHME 4AORA 3BTKE 2Y80A 1TPPA 1P2KA 2BD5A 1V2LT 2WPLS 3RXPA 4NSYA 1C2KA 2OC1A 1Z1IA 1RJXB 3K6ZA 1GJ9B 1O2YA 3GCTG 2P3TB 1O2XA 2R2MB 3AAUA 3PLBA 4F4OC 1OKXA 4UDWH 1TA6A 1UK4A 1QRZA 5J4SA 4YM9A 1K1LA 1PPBH 3F9GA 2BVXH 1AFEH 1GHZA 3ZZAA 2EY4C 4I8JA 2A4RA 4B2CA 3RXKA 1NFXA 2PKAA 3O8DA 1IQKA 2J95A 1XXFA 3H7TA 5FX6A 2JH0D 5C1UA 3KYGA 3BEIB 5K7RA 1S85A 3HKIB 2ZGXH 3NK8A 3SORA 1LCYA 2QXGA 3ZVEA 1ELBA 1Q31A 1K1MA 4YOGA 1KLTA 3PRDA 2AGGX 1YLDA 1NU7B 2BDGA 1CSOE 2O8WA 2QE7D 1V2TT 2FM2A 2VB0A 2XWBI 1BQYA 5C0UA 2QF4A 2A2QH 1CGJE 1SGPE 5EU8A 2PSYA 3EDXB 1ZPBA 1MQ5A 1HCGA 4B6FA 1FX0B 1O2TA 1C5XB 3N7EA 3VB7A 2GX4A 1O3NA 4J1YA 4E7RG 3BTGE 4U01A 2W3IA 2Y81A 2HLCA 1IQIA 5C1YA 3SO3A 2ZA5A 1O3FA 4MLFB 5BRRE 1GMCG 1PPEE 4X8TH 4CH2B 3JZ2B 1ZRBA 2TGDA 2FOEA 5C0TA 2RA3A 1MD8A 5A0BA 5JBBS 5L2ZH 3BF6H 3N99A 2UWOA 5ESBA 3E6PH 1C5SA 2ANKH 2JDID 5E2OA 3SW2B 1QNJA 2ZHWH 1EX3A 1W0ZU 1EQ9A 3E1XB 3SNCA 4AFZA 2G8TA 3QTVH 1CGIE 1OXGA 3BG4C 4OS6A 3UB0A 5JB9S 3GY3A 1SR5C 3E3TA 2R2WU 3SV8A 2ZDNA 1FN8A 1BMAA 4YOJA 3SUEA 3FFGA 5EQQA 1AZZA 1BTYA 1YCPM 1ZR0A 4K8YA 1GCTC 1W8BH 3ATKA 1P06A 1Y3WA 4XRNA 2P3FH 3MHWU 1EAWA 1RIWB 1DY8A 1DT2A 1VCPA 3RC4A 1FY5A 4AB9A 1E36B 1D3QB 1O0DH 4UEHH 1SGFA 1MU8B 2FXRA 1BTUA 2D2DA 1O33A 3SUGA 3GY5A 1WOFA 2BOKA 3GY6A 4K5ZA 3MYWA 5EQRA 1F5RA 2A5AA 2BD4A 3KHVA 1SGCA 1IQFA 1P2MA 1WCZA 4ACAA 1GI0A 3P8FA 3AVZA 1GHBG 5EXLA 1LO6A 2NU0E 1NRPH 2Q6FA 1HYLA 4B74A 3RXJA 4ZUHA 5FCRA 4Y71A 4YT7H 4JK5A 4ABIA 1N8OC 3ZYDA 2V3MA 3MU1A 2Z7FE 3FO8D 1O2NA 4KTCA 1SL3A 2THFB 3N7OA 3F3BA 1LPZB 1CBWB 3OU0A 1D3TB 5JBCS 4IMZA 3ZZ6A 3U98H 1GBMA 4IW4E 5IYTA 1E1RD 1FY1A 4XBCA 4YXWD 3GCOA 3D23A 4FUEA 2JETC 1NPMA 3S9AA 4H42U 1UK3A 1KXBA 1LVYA 1DDJA 1O3CA 2A32A 2F43B 4INHA 1MTNC 2FOGA 1TNHA 4H6SB 4CRAA 4Y0YE 1C5YB 1XUHA 4KTUA 4NIYA 1IQNA 1RD3B 5T6FA 1WTGH 2ZHFH 1AWHB 1UTJA 3GY2A 2HVXA 1EPTB 1O2UA 1QGFA 1EAXA 2ZPSA 3T27A 4AYVB 4DW2U 3P70B 1SOZA 1GCTB 1C2IA 1H9IE 1GMDG 2CGAA 1OWDA 1K1OA 3MU5A 2VVVA 1O5BB 3UY9A 2VH6A 4AFUA 1BDAA 4YESB 1WYKA 4FXGH 3ZIAD 3ITIA 3MU4A 3V7TA 1SFIA 2JIZD 3BG4B 4Y76A 5I25A 3DSGA 2FOBA 2GZ7A 1SLVB 2BMGB 4MPXA 2ZCLP 4JZDH 1TALA 4HZHA 1AO5A 2PR3A 4DIIH 1HRTH 6ESTA 1GCDA 7KMEH 4NCYA 1Z8JB 4HFPB 1P09A 1GMDF 1AVGH 1N8OB 2B0FA 2G4TA 3SU3A 1EZSC 3RXSA 3N7DA 4O3TA 3RU4T 3MH5A 4ABEA 4D8NA 4CBNA 2ZFPH 2H9EH 3PV2A 2F9OA 2A5KA 1OYTH 2J34A 1UCYK 1YGCH 1RGQA 5F8TA 3LDXH 4FVDA 1KXAA 2P8OC 3E16B 2W5EA 2BD9A 4NIWA 3U8OH 4ZHLU 1P2IA 1BITA 1QHRB 4LOYH 3HGNA 4UD9H 1IQHA 2UUJB 2H9HA 1G37A 1Z8RA 2PTNA 4K1TA 1B0EA 6CHAB 1C1MA 1QURH 2XRCA 1GJ4H 3O8RA 1EKBB 3A7ZA 3SI3H 1P11E 2FESH 2W6JD 4BTIB 5TCCA 1TRNA 1NS3A 3UAIC 3P92A 1O3GA 3Q77A 3KF2A 4XBBA 1FPCH 1Y3YA 3AW0A 2Y7ZA 2QF3A 1PPCE 3A82A 3ZZ5A 1CA8B 1DLKB 1VCWA 2GCHF 3TJOA 1A5IA 1ARCA 1Q2WA 1LQDB 1AKSB 1S81A 1P02A 1KTSB 3CNRA 1K22H 3AK5A 1BTHH 1OWEA 4DJZB 3GYLB 2VVUA 1FN6A 1ETSH 2OD3B 2UUFB 3F0PA 3PMBB 5CHBA 2SNWA 2DUCA 1ZYOA 1D3DB 1EB2A 3V13A 1IHTH 1ZTKA 3B8JA 5EXMA 1O2KA 1TBZH 2QCYA 3TJUA 3M3VA 4ABAA 3RXLA 3A8BA 1NFWA 2GZ9A 2FOFA 2OC8A 1EJAA 2GGVB 4M9FA 1G30B 1P2JA 1EJNA 2FOHA 2G5VA 3SU0A 4THNH 2OQ5A 4BAQB 4AGKA 2QXJA 1A3EH 3SUFA 3FOAA 2H6MA 1NRNH 1N6YA 4D7FA 4ZKRU 3BN9A 1C1RA 5DKMA 1IQJA 1UVOA 1ZSLA 2TGAA 1BMLA 4XOJA 1TPAE 1K1PA 4QT8C 4O9VA 1PQ7A 3FP7E 1TB6H 3CS0A 1GI5A 1Z1JA 2ANMH 1SFQB 5EJ1A 2EEKA 2GD4B 1FONA 1FDPA 2UWPA 3SUDA 2Z6BD 4AX9H 4JZ1A 1X7AC 5JYIA 3K9XB 2W6ID 1AKSA 2FYQA 1PQAA 3KQCA 6CHAC 4MNXA 2F9PA 3PLPA 1GGDB 1QRXA 1WV7H 2OCVB 3GISB 5EOKA 1ORFA 1N6XA 5EG4A 3I78A 3IG6B 3BSQA 3C27B 3T5FH 1O2HA 2CF8H 1GJ7B 2ZFSA 1JRTA 3ZVCA 1HB0B 4AFQA 1C1VH 2VIQA 1BMNH 1GG6B 1ZGVA 2J5UA 2VIOA 4AB8A 1AFQB 2WYJA 3DT0H 5A8YA 2Y82A 3UWIA 3D62A 3T29A 3LC5A 1BHXB 1C5VA 1HXFH 1IHSH 5T6DA 1C2GA 3RUOA 1O5AB 1VITG 5A8ZA 1HAIH 1DLEA 4O3UA 4E7NA 5PTPA 2GZ8A 4MG3A 2K0QA 1BBRK 3D49H 1T32A 5TCAA 4ZKOU 2VNTA 4I86A 2K8IA 2ZFRH 1BRBE 1LVOA 3AAVA 1GJAB 3A7TA 3PMJA 1XUGA 4ESTE 1K0HA 1HAXB 2QAAA 3LGYA 2Z9JA 3Q00A 1H8HD 2JH5D 3D65E 1OPHB 1OYQA 2FOMB 3RM0H 5GCHF 4X8VH 4F49A 5T1VA 3SJ9A 3PLKA 3UNSA 7ESTE 1THRH 2AIPA 3VB5A 1BCUH 6GCHG 4ZAEA 2I6SA 1O37A 4ZROA 1HDTH 1PYTC 2GCHG 1AI8H 1C9TA 1E35B 1HBTH 1OOKB 4A1VA 4CRDA 3SZEA 3BIUH 3H09A 1NM6A 1NO9H 1TOMH 2BLQA 1UVUH 2WSSD 1UHBB 2BM2A 4K60A 2UWLA 4TYDA 1DUEA 4MTBA 1GBLA 3TK9A 3RXRA 2HNTF 2V6NA 4WH8A 4WVPE 2WPJS 2RFKC 1ZTJA 1HAGE 1RFNA 1GWAA 4DURA 3TPIZ 1ELDE 3MNBA 4RN6A 2BDHA 4X0WU 3SV9A 2BDAA 5A09A 2A7CA 1DX5M 2C8YB 1GBAA 3RLWH 1C1TA 2ODPA 2A5IA 1C4Y2 2LIZA 5GWZA 1G3CA 4MNYA 1NRRH 1WU1A 3NUMA 1P03A 1FIWA 3M5NA 4OS4A 1TYNA 3SU5A 4X1SU 2ZPQA 1O3EA 3VFEA 5C17A 2WUCA 3QDZB 5E0HA 2BQ7B 2A4QA 3RXFA 2ZDVH 1E38B 2P3UB 2BVRH 4NFEA 1QJ7B 1F0SA 5J4QA 5JBTA 1CT4E 3R0FA 1C1SA 2WPIS 3SU6A 2OLGA 1V2QT 1JIRA 1UW7A 2C8XB 2SGQE 2WPHS 4ZKNU 5LPRA 3TK5A 2BD3A 4Y8XA 1LTOA 7GCHG 1AQ7A 2ILNA 2ESTE 4IBLH 1QA0A 4DY7B 1O2QA 1SSXA 2J92A 2XCNA 1YPJH 1B7XB 2BDBA 1GI9B 5L30H 3U28C 1DICA 1P0SH 1GI3A 3OEHD 3PO1C 1W10U 2VIDA 1C2HA 4X6PA 1ANBA 1PPFE 2GP9B 3ZVGA 4X1PU 3OY6U 1CU1A 4D9QA 2F4LA 1NY22 4FUFA 1LHFH 3A81A 2FTLE 3KQ5A 2SGPE 2VU8E 4Q7XA 1GI6A 4IMQA 4INLA 1DFPA 4BNRA 1AN1E 1GI4A 4D7GA 4IGDA 3ATMA 4NA7A 1AMHA 1PFXC 2FZZA 5L2YH 1V2JT 2A7HA 2OC7A 1Y5AT 8ESTE 1Q3XA 2XCFA 1F0RA 1QQ4A 1YLCA 1D9IA 1YC0A 1UTOA 2C90B 1T8NA 2YMSC 5IK2D 1ELCA 4I8HA 5HYOA 2ZWLH 4ISNA 3GICB 1G2LA 2OBQA 1XVMA 3HK3B 1HJ9A 3O8BA 4NZLA 4K1SA 1E0FD 4TPIZ 2V7QD 3GYMA 2J2UA 2FP7B 1C5MD 2FEQH 5EW2H 2OINA 2F9NA 1IQLA 1QL7A 2AH4X 2XBWA 5SGAE 4WMFA 5DGJA 1DSTA 1AGJA 8GCHG 2GCTB 2GV7A 5HIZA 3NXPA 5GJ4B 1MTNB 2VWMA 2BTCE 1D6WA 1JWTA 1TGBA 1ZHMA 3P8NA 4TSFD 5DG6A 3A84A 2QYIA 5EW1H 2ALPA 3QLPH 4F55A 1G36A 4X1QU 3RMLH 1IQMA 3OEED 3GCNA 4MPUA 3T26A 3OTJE 4A6LA 2HWLB 2PW8H 3A86A 1L4ZA 2ZGHA 1HJ8A 3RMOH 1PPGE 2BOHB 2BQ6B 1P3EA 3UFAA 1D4PB 1SC8U 1BIOA 4JCNA 1BTXA 2KFWA 3M3TA 2WZQA 1J17T 1C2EA 1ZTLA 4IN2A 2BX3A 3LPRA 1A5HA 2AGIX 1ESAA 2NU3E 3OE7D 2O8UA 2OK5A 3QGNB 3EA8A 1Y3XA 2BXUH 1C4V2 4AYYB 2ZCKP 4JYUH 1SKYE 2O8TA 1V2WT 1THPB 3ZZ9A 4LZ4B 4RI0A 1J15A 2WPKS 5FXLA 1CHOF 1NRQH 2AYWA 5EJZA 1O32A 1YCPK 1TAWA 4ZHMU 3ZZ3A 4UONA 2C4FH 1RIWC 2F9VA 2KAIA 3UQVA 1GJ6A 2CMYA 3MWIU 2K1QA 2CHAB 1ESBA 4H4FA 3WWFA 2STBE 2QY0B 4U2WA 1ZMLA 2XW9A 1YPEH 5I46H 3NCLA 3ZV9A 3ZVDA 1H8ED 2AFQB 3MU8A 3Q3YA 1H8IH 3TGKE 3E0PB 1BTWA 2BY8X 1SOTA 3M7QA 4X2WA 1UTNA 3DFLA 1O3BA 2C8ZB 2HNTC 1P2OA 2ZFFH 3RM2H 5DP8A 1V2NT 2BLWA 3VEQB 3IWMA 1DPOA 4B71A 1K21H 1NROH 4I33A 2F91A 1EP6A 3PYHA 1TNLA 1C1OA 8KME2 1P05A 1YM0A 6LPRA 2Y7XA 1W12U 5FAHA 1CQQA 5F8ZA 3ZZDA 2KCPA 1FXYA 3Q3XA 3LIWA 3PTBA 2BQWB 1ETTH 3QZQA 4BOHA 1XUJA 2OC0A 4DCDA 1O35A 1MAYA 1Z6JH 2TBSA 1A1RA 4Y6DA 4ZXYH 3MI4A 3UTUH 2GT8A 1ABIH 1CT0E 3GCHB 1QL8A 1JBUH 5EPYA 1G3EA 1GDQA 3MO3A 2TPIZ 5FPYA 3P6ZB 4O97A 3E90B 1H8DH 1NN6A 2G81E 3TH4H 2KCYA 1KXEA 3HATH 1BRUP 3I29A 3NZIA 1O5EH 3ZYEA 1A0LA 1UCYE 1WXRA 1SGTA 1AVWA 1ELTA 3PM3A 4XE4A 2ZP0H 1GJ8B 4IC5A 2QA9E 1B5GH 2QC2A 1CHGA 1RS0A 3TLOA 2BY6X 5A8XA 1V2KT 2WYGA 2BZAA 3MNSA 1DE7H 3C1KA 2WV9A 2H5CA 1SGYE 3PROA 3ZZ4A 2RG3A 2AGEX 1O39A 1QB9A 2V0BA 2ZU1A 4Y8ZA 2VIWA 2BD8A 1ELEE 1JMOH 3M37A 1GMHF 1MZDA 3LKWA 4TPYA 2TGTA 4KP0A 3K6YA 4ZHAA 1BJUA 5AHGH 1S5SA 1E37B 2F3CE 2XNDD 4FUGA 2EA3A 3E8LA 3PB1E 1W7GH 2WV5A 1UTQA 1A7SA 2AS9A 1KDQA 1KXCA 2HOBA 1P01A 3OX7U 1T8LA 2Z9KA 2P93A 2ZQ1A 4M7GA 4YT6H 3RXGA 3P17H 1T7CA 3TJVA 1ELVA 2FS8A 4KELA 3GCHC 1VR1H 1F0UA 4FUCA 1IQEA 3LGVA 1WDIA 1DWEH 1PPZA 3EYDA 2J38A 1WSSH 1EOJA 4CRCA 3TVJB 2QIQA 2PP6A 2Z3DA 2NWNA 1SGEE 3SNBA 1PPHE 2G4UA 1TX7A 3KNXA 1SQOA 4A92A 4UE7H 2ZKSA 1GHYH 1LPGB 2ZEBA 3V3MA 3M61U 5CHAC 1INCA 2GMTC 3SU4A 4NIVA 4ZH8A 1SQTA 2Z3EA 4IC6A 2ZC9H 2BDCA 9ESTA 1TMUH 1EFRD 1QQUA 2AERH 2PFEA 4GPGA 4K69A 3F1SB 1ZGIA 4NA8A 5FCKA 1HIAB 1DWBH 2OP9A 1AIXH 3KL6A 1RXPA 3T2NA 1GJBB 3KYFA 2EI6A 2PV9B 4RKJB 3ZZ7A 1CVWH 1V2UT 5AVDA 4MPWA 4YTAA 3RXIA 1C5QA 4TWYA 1XXDA 3BTQE 3F68H 1SPJA 1LQEA 1K1IA 4DIHH 3MTYA 4GCHF 3FVFB 3P95A 4Z6AH 1W13U 4B76A 1TLDA 1BBRH 1ZSKA 3TK6A 4X2VA 3NRLA 1MCVA 4JZEH 1SGFG 1FY4A 3URDA 4AN7A 3LJJA 1P57B 3GDVA 4X8SH 5FX5A 1BT7A 3M35A 4E06H 4ACBA 4JZFH 3V0XA 4Z1MD 3VB6A 1XUIA 4Y7AA 3FP8E 5JB8S 1T4UH 1FZZA 1L0ZA 1OS8A 2F9BH 2ODQA 3DA9B 3M3SA 1COWD 1QB6A 1XVOA 4KKDA 1AB9B 3PWBA 2ZG0H 3GY8A 3RLYH 1C2LA 1B0FA 1NFYA 3H5CB 3RXDA 2YNAA 1F2SE 1JIMA 1EB1H 1GPZA 2LELA 2FI4E 3W94A 1MU6B 1LHDH 3RC6A 1UTMA 2ZTXA 3FP6E 5DJ7A 1H9HE 8GCHF 2R0LA 4GAWA 1GG6C 1SGIB 2BLVA 3HPTB 3BTFE 3HKJB 3FN8A 3GY7A 1HAZB 2ZTYA 3QTOH 4YLQH 1O5FH 2AMQA 1A61H 3U8RH 1G32B 1E1QD 1V2PT 1TQ7B 4OS7A 3SNDA 1LPKB 2XTTB 1RTFB 1NU9A 3LU9B 1V3XA 3A83A 2M5TA 3VG8A 2JJ2D 1J9CH 1C5NH 2W26A 3U8TH 4K2YA 3RMMH 1K28D 2PWXA 1YPHC 1LHCH 1W3CA 3ODFA 1GL0E 2FI3E 1EATA 4CR5A 4TWWA 3S9BA 3K2UA 4YOIA 4K3JA 1SBWA 1P9SA 2D1JA 3SGQE 5ABWA 4NZQA 1TX6A 2RCEA 1TX8A 1Y3UA 2FO9A 4JMYA 4IS5A 2GV6A 3SGBE 1AU8A 5C2ZA 1WQSA 3EQ0H 1UTLM 1Z8GA 9LPRA 2EQNA 4FUIA 2PSXA 1U6QA 1GJ5H 2NU1E 1C1NA 3BEFB 2PKSC 3HGPA 1MKXK 2BD7A 2TGPZ 2Y5FA 5E8EH 3M5MA 1LMWB 1FJSA 4F48B 1OSSA 2VWOA 3MO6A 2R3YA 1TGNA 2HRVA 2Q6GA 1G3BA 3F2FA 1O2PA 4CR9A 5F6MA 1T8OA 4X2YA 2QF5A 3UNQA 2J9NA 2VIVA 5E0JA 2FI5E 3GY4A 2PUQH 3FANA 1VGCC 3F6UH 5GDSH 3R3GB 2XOKD 1YPLH 1C1PA 2P95A 4WMDA 1XKAC 2IPQX 2M2AA 2I6QA 4FU7A 2QF0A 3BTWE 4I8LA 4OM9A 3UNRA 1TWXB 1MTUA 4FUDA 3LGWA 3PTNA 2WHXA 4DT7B 3BTTE 3ESTA 1LKBA 1P12E 4Q80A 4CRBA 3P8OA 5C94A 4I32A 1YCPH 1DXPA 2FYRA 2RDLA 3BTME 3EE0B 1DSUA 2AMPA 4NWKA 3F9EA 4Q7YA 1CBWC 1TQ0B 2D8WA 2BDIA 3MO9A 3IITA 1HFDA 4CHAB 1TE0A 1NZQH 2A45B 1XKBC 1UK2A 2VBCA 4X6MA 1DWCH 2DE8A 1GMCF 3A87A 1QZ8A 1NT1A 5FBIA 5FPSA 4ZXXH 1SQAA 1F5LA 4CRGA 2VGCB 5ETXA 2BDYA 3F2GA 1DOJA 4U32A 5FHTA 2ZTZA 2SGFE 5AF9H 1A4WH 4TT3D 5F53A 1SG8B 1O2JA 2TRMA 1O34A 3NPSA 1HPGA 5CHAB 3G01A 1D3PB 4U30A 3U9AH 1SGRE 1VGCB 3KEEA 3SV7A 2BY9X 1BBRE 2VWLA 3PMAB 5HXFA 2JH6D 4NSVA 1TGTA 2F9UA 1YF4A 1ZPCA 2IJOB 1BJVA 2ZCHP 1AFQC 4AGJA 3FAOA 5HMAA 1ZHRA 1AD8H 1O2MA 2Z94A 3KCGH 1TRYA 3ATWA 1OP0A 1UVTH 2ZHQH 1O2WA 1BB0B 1E79D 4JYVH 4JYTA 3T62A 2V35A 2XWAA 2B7DH 3W95A 3QGJA 2XYAA 1L1GA 1O2LA 1SHHB 1GHBF 5CMXH 2SFAA 1NTPA 2YMSB 3RXTA 2FLRH 4BAOB 5EXNA 1LHGH 2A2XH 1SLXB 2LPRA 2A31A 2XXLA 1O31A 1O3IA 1K2I1 5FL7D 2R0KA 5H4IB 1AUJA 1GBIA 2ZO3H 2FPZA 1C5LH 2W7SA 4ASHA 2AEIH 4GSOA 3KQDA 8LPRA 1BTPA 4DGJA 1TA2A 1G3DA 2ZQ2A 1L1JA 2V3OH 2ZDAH 3W1EA 4HTCH 2P8OB 3LT3A 5KECA 4P02A 2O9QA 3RU4E 1PQ5A 1FY8E 2F83A 2FDAA 5T6GA 1G2MA 2JETB 3ATLA 3F9FA 1AE8H 1ELFA 3SV2H 1O2OA 2KM0A 1EZQA 4D9RA 1GBDA 1O3KA 3VB3A 4X1NU 5EIYA 3FZZA 4UFFH 5C20A 1BA8B 3MFJA 1TNJA 4MPVA 1UJ1A 1PQ8A 2XBYA 4KTSA 1O3DA 3OFND 4GLYA 1TPSA 2ZIQH 1SHYA 1ZLRA 5AFZH 3TH3H 3M7UA 2RA0A 2ZZUH 3A88A 3WY8A 2DE9A 1GHXH 2A7JA 3AASA 1KTTB 3OAAD 2IJD1 2UUYA 1C4U2 1ELAA 4Y79A 2Z9IA 5G4BA 3A7XA 2L74A 1ZMJA 1F92A 1H1BA 1S83A 1YPHE 1A46H 1NESE 1TBRH 1E34B 5B6LA 3SN8A 7LPRA 3A89A 1V2VT 3OY5U 4FOUC 5DN6D 1GMHG 3MH7A 4Q63A 5C1XA 5TJXA 3TNTA 1FMGA 4XD7D 4Y7BA 2CHAC 3OTPA 5EQSA 3SGAE 1O3OA 2BY5X 2J97A 3LOXA 3SQHE 3RXBA 1QRWA 1GBKA 2EI8A 3EE7A 1DUAA 2J94A 1VJAU 3SJKA 3GOVB 4RSPA 3SQEE 4WY3A 2FX4A 4AFSA 4Y11E 4YZUA 4ZKSU 1F0TA 2UUKB 2ZHDA 2EC9H 1ZSJA 4D76A 1P2NA 1QFKH 4MNWA 3WW7A 4B73A 1SGQE 1MQ6A 1AE5A 2QV1A 2G00A 3U69H 3L6PA 4ABBA 2PTCE 5HM2A 1WUNH 5C3NA 1RRKA 1HIAA 1ZRKA 5JPMH 1H4WA 3MQKC 3H7OA 2C8WB 4H6TA 2K7XA 1A5GH 3BTHE 1ELGA 1YPMH 2GVFA 1UVPA 1VCQA 1FUJA 1C2JA 1O2VA 2B9LA 3UOPA 3I77A 4NFFA 1OWIA 5E2PA 5HIYA 3B9FH 1C2FA 1W2KH 1ZJKA 1P3CA 4DG4A 1S84A 1TNKA 1O2GH 2D26C 1XM1A 1Y8TA 1C9PA 5DP7A 2SGEE 2Q6DA 1CT2E 4XDEA 1NBMD 2PKAB 1V2RT 1QBNA 1HGTH 1TGSZ 3A7VA 2EI7A 4ISLA 1EZXC 1TGCA 1QBVH 2YNBA 2Z9LA 5EGMA 2JJ1D 1K1NA 1VITF 1V6DA 3L33A 4NWLA 1ANDA 1YBWA 1M9UA 4TY6A 1CGHA 1LDTT 1TMTH 1YP9A 5EODA 3S9CA 4X6OA 4X1RU 1BMMH 1WBGB 4MDSA 1TFXA 1C5WB 1JOUB 1HAYB 1H9LB 1OP8A 3VGCB 1O3HA 2KCAA 1QCPA 1QIXB 2P16A 1T4VH 3SOSA 1UCYH 2WUBA 3LH3A 3QO6A 2VGCC 4SGAE 4B1TA 3TGIE 6GCHF 1AB9C 3STJA 4FUJA 4AG2A 1WAYB 1V2OT 3BTEE 1ETRH 3RXOA 4NIXA 4LXBH 3MH6A 2R9PA 1GBCA 4R0IA 3LONA 2Y5GA 4WF8A 4JK6A 2GT7A 4GVUA 3RU4D 4WWYA 1OP2A 1DWDH 1C2DA 5HM9A 1EXFA 4BANB 1MBQA 4XFQA 1MKWH 2ZPRA 4ABFA 1QBOA 3MMGA 3SYJA 4FU8A 2OXSA 2BLOA 1MBMA 1SI5H 3ZZ8A 5EJLA 2QXIA 2HGTH 1EJMA 3EAJA 4HG6A 2ZGBH 4MNVA 3UR9A 2A4OA 4GHQA 4DVAU 2BXTH 4K8BA 1KSNA 5LPFA 3LJOA 4P00A 3A7YA 1MCTA 1MMJN 3CP7A 1AVXA 3ZZBA 1FLEE 1T8MA 2O8LA 4Q2KA 5DP4A 5ESTE 4CBOA 5A2MH
chains in the Genus database with same CATH topology
3LH1A 5GIBA 2G5NA 4BAHB 4NGAH 1O5CB 2NU2E 1CA0C 3STIA 1IQGA 3VB4A 1O3AA 1P9UA 1C5OH 3SHCH 1A3BH 1F7ZA 1GVLA 3SV6A 2H2ZA 3ZVBA 1EAUA 1YKTA 4GCHG 3UREA 4ISHH 1HUTH 1HNEE 4OS5A 3M7TA 3U1IB 2BYAX 1GI1A 4RKOB 2H5DA 2B8OH 1UMAH 1TNGA 1TABE 2QGRA 1O5GH 1O30A 1ESTA 1BUIA 3T25A 2C93B 1EUFA 4Q7ZA 3MNCA 3EA7A 2YOLA 1GBTA 1QR3E 2HPPH 1C1WH 1XUKA 2ZGJA 4R8TB 1BHXF 1L1NA 1XX9A 2P94A 3RC5A 2ZU5A 3S7HB 1V2MT 2A0QB 1IAUA 3UR6A 3B23B 2VWNA 1XMNB 4X2XA 4BXSA 2R3UA 1ANCA 2XBXA 1YYY1 1MKXH 4X6NA 3NKKA 1CO7E 4ISIH 1K1JA 2ANYA 3CS7A 5A0AE 1VJ9U 1QL9A 2ANWA 3ELAH 3M5LA 3LGUA 2ASUB 4WMEA 1W0YH 4BXWA 2BHGA 3ODDA 1CA0B 1Y5BT 2W7UA 2FS9A 1OWHA 1TPOA 2JKHA 2FODA 2ZNKH 1QA7A 3LC3A 3SHAH 4CHAC 1OX1A 3UUZA 3TH2H 3RXAA 3BEUA 1SGDE 3SNEA 1KXFA 3RXVA 3K65B 3URCA 7GCHF 1HAVA 2Z3CA 4XSKU 3RMNH 1YPGH 3TGJE 2G51A 3QUMP 1DS2E 5B6OA 3NWUA 4OGXA 1PYTD 4A7IB 1W7XH 3OYPA 5JBAS 2CF9H 1BRAA 4HI3A 1S0RA 2HNTE 1ANEA 3ZVFA 1SVPA 1Z7KA 2CJIA 1GHAF 2H1UA 2J4IA 2PHBA 4GUXA 2ALVA 1GGDC 1HJAC 2G55A 3S69A 3UIRA 3BG8A 1Y5UT 4B2AA 1S6FA 5IDKA 1KIGH 4FUHA 2PKSB 3TU7H 3MU0A 1AUTC 2SNVA 3TIUA 3LGTA 1J14A 1EAIA 4DOQA 2C3SA 1WTHD 3QZRA 2V3HH 2GDDA 3QX5H 1ZOMA 3E0NB 4NA9H 4FU9A 3RP2A 1TNIA 1DM4B 1GVZA 2OUAA 2ZI2H 3O8CA 4CREA 1KYNA 2GMTB 1QB1A 2VIPA 5LH8A 1OWKA 3F9HA 1LKAA 1GHAG 4OS2A 1TIOA 4Y10E 2STAE 1P04A 1FPHH 3A8AA 3ZVAA 1QJ6B 3SJIA 2ZU4A 4OS1A 5LGOA 3A7WA 1ARBA 3SI4H 4AG1A 1SMFE 1V2ST 1GHWH 1NRSH 2FX6A 1GI8B 2CN0H 2PGBB 4ABDA 2KAIB 1HV7A 4BAMB 1JRSA 1ABJH 3JZ1B 1C1QA 3T28A 1KXDA 2O8MA 3TJNA 1MKWK 1S0QA 2IPHA 1O3LA 5DK1A 2BVSH 2BB4A 1C5ZB 1L2EA 1ZHPA 1S82A 5LPEA 1FNIA 4IN1A 3UWJH 2ZDMA 1AY6H 1FAKH 4I31A 2OTVA 3SBKA 2Y5HA 1HJAB 3Q3KA 1AWFH 1J16A 5K0HA 2IN2A 1C5RA 2IOTA 5BPEA 1JXPA 2ULLA 5E0GA 1GJDB 1TRMA 3KIDU 5DP6A 2BX4A 4I7YH 2BZ6H 1A0JA 2Y6TA 2NU4E 1TMBH 2VJ1A 4MVNA 1UTPA 1EP5A 1ID5H 1MD7A 1W11U 2CV3A 1MH0A 4TY7A 2FWWA 1O36A 1P2QA 1HXEH 1LVBA 1ZZZA 1SLWB 1F5KU 3FZDA 1DY9A 1VZQH 1QY6A 1TBQH 3A8DA 1UO6A 2ZFQH 3ENSB 1THSH 4I8GA 4K1EA 5F03A 1AZ8A 1GL1A 1P10A 2ZU2A 4HGCA 4YLUA 3LGIA 3QN7A 3U1JB 4AOQA 4SGBE 1GVKB 2LNCA 3EGKH 4UFEH 2OBOA 4VGCB 3RXHA 1FIZA 1BOQA 2P59A 4Y0ZE 2WINI 1MTWA 2ZGCA 3A85A 1LVMA 2CXVA 4B75A 2Z9GA 3SJOA 1VITH 2VH0A 4MQAA 1GBFA 3RXCA 1GHVH 1L4DA 1KLJH 2BY7X 4B2BA 1SLUB 2HALA 5FPTA 4XBDA 2XC5A 3VXFH 2XC0A 3AW1A 4X8UH 1ZJDA 1Z71A 1Z8IB 3OSYA 2WPMS 3GDUA 1UVSH 5HGGA 5DO4H 2G52A 4I8KA 2SGAA 1MUEB 5JDUB 3DHKH 2PGQB 2B5TB 2ZU3A 1MTSA 4BTTB 2AMDA 4BAKB 5GCHG 5A0CA 1ACBE 1O2IA 1OWJA 1PJPA 2FLBH 1EOLA 1IOEA 4KGAA 3CENA 3GDSA 2QN5T 3VXEH 1LHEH 3PO1B 2ZHEH 3E91A 1Y59T 3RXQA 1DANH 3BV9B 1K9OE 2ZDKA 3S7KB 1EPTA 2QXHA 1GBHA 2HPQH 2OQUA 3SU1A 1NC6A 2XBVA 4FVBA 3PWCA 3BIVH 1GBBA 3EBNA 1HAVB 4VGCC 4A1XA 3MH4A 4UFGH 1O3MA 1HAPH 1O2RA 4ZMAH 2ODYB 3L3TA 3BTDE 2ZF0H 2FOAA 2ZFTA 5F8XA 4E05H 1WQVH 2A4GA 5T3HA 1DITH 5GPIB 1FQ3A 1QTFA 3ZZCA 1BTZA 1O3PB 4CRFA 5DP9A 1A0HB 1C2MA 1GI7B 3M5OA 4WXVA 3RXUA 3V12A 1TONA 3S0NA 5DP3A 1KY9A 1O2SA 5GXPA 1MAXA 3MNXA 1FI8A 1GJCB 1RTKA 1CHOG 4ISOA 5L6NH 2GTBA 1MTVA 2VINA 3RXMA 2XC4A 5C5OA 1CE5A 2BD2A 3VPKA 2ZECA 4Y8YA 3UPEA 1RTLA 2GCTC 1FV9A 1XUFA 2FIRH 3A80A 1O38A 1Y3VA 1G9IE 3KN2A 1FY3A 3SNAA 1GDNA 1SGNE 4LZ1H 4WH6A 1Z6EA 1O2ZA 1D6RA 4O03A 2A1DB 4ABGA 2FOCA 2TIOA 2XNIA 1FAXA 2VVCA 1NFUA 5AFYH 4GHTA 4AZ2B 5DP5A 2SGDE 1C5UA 1UTKA 1C5TA 1AHTH 3A8CA 4UFDH 5FBEA 4ABHA 3EA9A 4YO9A 4WXIA 3TITA 1MZAA 4BTUB 4LK4A 1TOCB 1DXWA 1O3JA 1BRCE 2FMJA 1A2CH 2PUXB 1SB1H 3KQEA 3RDZA 4A1TA 4J2YB 3SU2A 1C5PA 3HK6B 3UOUA 3UQOA 1J8AA 4FUBA 1EPTC 3QWCH 1T31A 4NG9H 1EZUC 2GDEH 1O5DH 4Z0KA 1HLTH 4INKA 1P8VC 2WV4A 3PV4A 3QK1A 1HAOH 1DVAH 2GKVE 4A5TS 5C67A 1GI2A 4ABJA 5CE1A 4WJG2 5C5NA 3DUXH 3RXEA 3KQBA 3SZNA 3DD2H 2W3KA 1KDQB 1C1UH 2PLXA 3SJ8A 3Q76A 4JZIA 2AIQA 3M36A 1BZXE 3GCTF 3MOCA 5DPAA 1N1LA 1UHBA 1HAHH 1KLIH 4OGYA 1YPKH 1ZMNA 2ZDLA 3KGPA 3TNSA 1GBJA 3P8GA 1QJ1B 3DFJA 2FTMA 1GBEA 3ATIA 1S6HA 3PMHB 1EASA 4PROA 1GDUA 3VGCC 5EPNA 4CH8B 2Q1JA 1W14U 1ZPZA 3ZV8A 2H9TH 4AORA 3BTKE 2Y80A 1TPPA 1P2KA 2BD5A 1V2LT 2WPLS 3RXPA 4NSYA 1C2KA 2OC1A 1Z1IA 1RJXB 3K6ZA 1GJ9B 1O2YA 3GCTG 2P3TB 1O2XA 2R2MB 3AAUA 3PLBA 4F4OC 1OKXA 4UDWH 1TA6A 1UK4A 1QRZA 5J4SA 4YM9A 1K1LA 1PPBH 3F9GA 2BVXH 1AFEH 1GHZA 3ZZAA 4I8JA 2A4RA 4B2CA 3RXKA 1NFXA 2PKAA 3O8DA 1IQKA 2J95A 1XXFA 3H7TA 5FX6A 2JH0D 5C1UA 3BEIB 5K7RA 1S85A 3HKIB 2ZGXH 3NK8A 3SORA 1LCYA 2QXGA 3ZVEA 1ELBA 1Q31A 1K1MA 4YOGA 1KLTA 2AGGX 1YLDA 1NU7B 2BDGA 1CSOE 2O8WA 1V2TT 2FM2A 2VB0A 2XWBI 1BQYA 2A2QH 1CGJE 1SGPE 5EU8A 2PSYA 3EDXB 1ZPBA 1MQ5A 1HCGA 1O2TA 1C5XB 3VB7A 2GX4A 1O3NA 4J1YA 4E7RG 3BTGE 4U01A 2W3IA 2Y81A 2HLCA 1IQIA 5C1YA 3SO3A 2ZA5A 1O3FA 4MLFB 5BRRE 1GMCG 1PPEE 4X8TH 4CH2B 3JZ2B 1ZRBA 2TGDA 2FOEA 2RA3A 1MD8A 5A0BA 5JBBS 5L2ZH 3BF6H 2UWOA 5ESBA 3E6PH 1C5SA 2ANKH 5E2OA 3SW2B 1QNJA 2ZHWH 1EX3A 1W0ZU 1EQ9A 3E1XB 3SNCA 4AFZA 2G8TA 3QTVH 1CGIE 1OXGA 3BG4C 4OS6A 5JB9S 3GY3A 1SR5C 3E3TA 2R2WU 3SV8A 2ZDNA 1FN8A 1BMAA 4YOJA 3SUEA 3FFGA 5EQQA 1AZZA 1BTYA 1YCPM 1ZR0A 4K8YA 1GCTC 1W8BH 3ATKA 1P06A 1Y3WA 2P3FH 3MHWU 1EAWA 1RIWB 1DY8A 1DT2A 1VCPA 3RC4A 1FY5A 4AB9A 1E36B 1D3QB 1O0DH 4UEHH 1SGFA 1MU8B 2FXRA 1BTUA 2D2DA 1O33A 3SUGA 3GY5A 1WOFA 2BOKA 3GY6A 4K5ZA 3MYWA 5EQRA 1F5RA 2A5AA 2BD4A 3KHVA 1SGCA 1IQFA 1P2MA 1WCZA 1GI0A 3P8FA 3AVZA 1GHBG 5EXLA 1LO6A 2NU0E 1NRPH 2Q6FA 1HYLA 4B74A 3RXJA 4ZUHA 5FCRA 4Y71A 4YT7H 4JK5A 4ABIA 1N8OC 3ZYDA 3MU1A 2Z7FE 1O2NA 4KTCA 1SL3A 2THFB 3N7OA 1LPZB 1CBWB 3OU0A 1D3TB 5JBCS 4IMZA 3ZZ6A 3U98H 1GBMA 4IW4E 5IYTA 1FY1A 4XBCA 3GCOA 3D23A 4FUEA 2JETC 1NPMA 3S9AA 4H42U 1UK3A 1KXBA 1LVYA 1DDJA 1O3CA 2A32A 4INHA 1MTNC 2FOGA 1TNHA 4H6SB 4CRAA 4Y0YE 1C5YB 1XUHA 4KTUA 4NIYA 1IQNA 1RD3B 5T6FA 1WTGH 2ZHFH 1AWHB 1UTJA 3GY2A 2HVXA 1EPTB 1O2UA 1QGFA 1EAXA 2ZPSA 3T27A 4AYVB 4DW2U 3P70B 1SOZA 1GCTB 1C2IA 1H9IE 1GMDG 2CGAA 1OWDA 1K1OA 3MU5A 2VVVA 1O5BB 3UY9A 2VH6A 4AFUA 1BDAA 4YESB 1WYKA 4FXGH 3ITIA 3MU4A 3V7TA 1SFIA 3BG4B 4Y76A 5I25A 2FOBA 2GZ7A 1SLVB 2BMGB 4MPXA 2ZCLP 4JZDH 1TALA 4HZHA 1AO5A 2PR3A 4DIIH 1HRTH 6ESTA 1GCDA 7KMEH 4NCYA 1Z8JB 4HFPB 1P09A 1GMDF 1AVGH 1N8OB 2B0FA 2G4TA 3SU3A 1EZSC 3RXSA 4O3TA 3RU4T 3MH5A 4ABEA 4D8NA 4CBNA 2ZFPH 2H9EH 2F9OA 2A5KA 1OYTH 2J34A 1UCYK 1YGCH 1RGQA 5F8TA 3LDXH 4FVDA 1KXAA 2P8OC 3E16B 2W5EA 2BD9A 4NIWA 3U8OH 4ZHLU 1P2IA 1BITA 1QHRB 4LOYH 3HGNA 4UD9H 1IQHA 2UUJB 2H9HA 1G37A 1Z8RA 2PTNA 4K1TA 1B0EA 6CHAB 1C1MA 1QURH 2XRCA 1GJ4H 3O8RA 1EKBB 3A7ZA 3SI3H 1P11E 2FESH 4BTIB 5TCCA 1TRNA 1NS3A 3P92A 1O3GA 3Q77A 3KF2A 4XBBA 1FPCH 1Y3YA 3AW0A 2Y7ZA 2QF3A 1PPCE 3A82A 3ZZ5A 1CA8B 1DLKB 1VCWA 2GCHF 3TJOA 1A5IA 1ARCA 1Q2WA 1LQDB 1AKSB 1S81A 1P02A 1KTSB 1K22H 1BTHH 1OWEA 4DJZB 3GYLB 2VVUA 1FN6A 1ETSH 2OD3B 2UUFB 3PMBB 2SNWA 2DUCA 1ZYOA 1D3DB 1EB2A 3V13A 1IHTH 1ZTKA 3B8JA 5EXMA 1O2KA 1TBZH 2QCYA 3TJUA 3M3VA 4ABAA 3RXLA 3A8BA 1NFWA 2GZ9A 2FOFA 2OC8A 1EJAA 2GGVB 1G30B 1P2JA 1EJNA 2FOHA 2G5VA 3SU0A 4THNH 2OQ5A 4BAQB 4AGKA 2QXJA 1A3EH 3SUFA 2H6MA 1NRNH 1N6YA 4D7FA 4ZKRU 3BN9A 1C1RA 5DKMA 1IQJA 1UVOA 1ZSLA 2TGAA 1BMLA 4XOJA 1TPAE 1K1PA 4QT8C 4O9VA 1PQ7A 3FP7E 1TB6H 3CS0A 1GI5A 1Z1JA 2ANMH 1SFQB 2EEKA 2GD4B 1FONA 1FDPA 2UWPA 3SUDA 2Z6BD 4AX9H 4JZ1A 1X7AC 5JYIA 3K9XB 1AKSA 2FYQA 1PQAA 3KQCA 6CHAC 4MNXA 2F9PA 3PLPA 1GGDB 1QRXA 1WV7H 2OCVB 3GISB 5EOKA 1ORFA 1N6XA 5EG4A 3I78A 3IG6B 3BSQA 3C27B 3T5FH 1O2HA 2CF8H 1GJ7B 2ZFSA 1JRTA 3ZVCA 1HB0B 4AFQA 1C1VH 2VIQA 1BMNH 1GG6B 1ZGVA 2VIOA 4AB8A 1AFQB 2WYJA 3DT0H 5A8YA 2Y82A 3UWIA 3D62A 3T29A 3LC5A 1BHXB 1C5VA 1HXFH 1IHSH 5T6DA 1C2GA 3RUOA 1O5AB 1VITG 5A8ZA 1HAIH 1DLEA 4O3UA 4E7NA 5PTPA 2GZ8A 4MG3A 1BBRK 3D49H 1T32A 5TCAA 4ZKOU 2VNTA 2ZFRH 1BRBE 1LVOA 3AAVA 1GJAB 3A7TA 3PMJA 1XUGA 4ESTE 1HAXB 2QAAA 3LGYA 2Z9JA 3Q00A 2JH5D 3D65E 1OPHB 1OYQA 2FOMB 3RM0H 5GCHF 4X8VH 4F49A 3SJ9A 3PLKA 3UNSA 7ESTE 1THRH 2AIPA 3VB5A 1BCUH 6GCHG 4ZAEA 2I6SA 1O37A 4ZROA 1HDTH 1PYTC