4YOJA

Hku4 3clpro bound to non-covalent inhibitor 2a
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
b'SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
molecule tags Hydrolase/hydrolase inhibitor
source organism Bat coronavirus hku4
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
total genus 88
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yojA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yojA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yojA02
1HJAB 1NRPH 4DT7B 2BMGB 4JK5A 5GCHF 1L1JA 2JETB 3A87A 1IQHA 1O38A 1B5GH 5DKMA 3RM2H 3RXBA 2O8MA 1EJNA 1UVPA 4Y11E 1C2KA 2BVSH 1VZQH 1PPZA 2ZF0H 4X1SU 4AB8A 2V3HH 1U6QA 3QK1A 5EG4A 1CSOE 2PW8H 1SHYA 3TLOA 5F8XA 1E36B 2FX4A 1QNJA 2H2ZA 1C1OA 4WH6A 1EAIA 1MD8A 1ZRBA 5EQRA 4M7GA 1FQ3A 1GBFA 2GT8A 1KDQA 1W0YH 2SGFE 3M36A 4INKA 1CA0B 2ZDLA 5AFYH 2FM2A 1K1MA 1MKXK 1CQQA 1FY3A 3A88A 3SHAH 1J17T 4LZ1H 2FESH 5EPNA 2Z6BD 2W3IA 1ELFA 1O31A 4BAHB 4KELA 1AE8H 2ZQ2A 1Q3XA 3KL6A 2OC8A 3OU0A 1W12U 3QZRA 1KLJH 2CXVA 5EGMA 4INLA 3PMJA 1C5TA 1TGBA 4U01A 3VXFH 2Z9KA 1SGFA 2QY0B 1GHAF 4CREA 1A4WH 1RTLA 1MD7A 2FX6A 2BYAX 4B2CA 3A89A 2UUKB 2ESTE 3UPEA 3S7HB 3BTGE 5FAHA 1DFPA 1BUIA 3BTEE 4E06H 1YPHE 2NU4E 2A5AA 4A7IB 4FVBA 1YPEH 4X8TH 1Z71A 2TBSA 2A1DB 1FAKH 5LPFA 1GBBA 4FU7A 4XOJA 2GGVB 1EJMA 1Q2WA 5EQQA 1O2GH 5CHAB 4ESTE 1H9LB 2TGDA 3PMHB 1ZHPA 3UREA 1H8DH 3A83A 3K6ZA 3UWJH 3HKJB 3NUMA 1HAPH 3RXVA 3RXDA 1YBWA 3VB7A 3FVFB 3ENSB 1IAUA 1NFYA 1KXAA 1N6YA 5SGAE 1GJDB 1FONA 4CHAB 1C5MD 1QR3E 3PLBA 4B75A 3F1SB 3SO3A 2F9OA 2ZPQA 3NPSA 2HNTF 3PMBB 2BD3A 1A46H 1EOJA 4ISHH 1SGEE 3ATKA 4X6OA 1YC0A 2DE9A 2A7JA 2PTCE 2ZA5A 5F03A 1NTPA 3F68H 4E7NA 3SW2B 2CF9H 3BEUA 1SGNE 1DT2A 3FZDA 1P12E 3A82A 4OS6A 4KTSA 2UUFB 4J2YB 1HAOH 3KQEA 3RMLH 4ZAEA 3MU5A 1ZRKA 1V3XA 3IWMA 1F5LA 1O5AB 1CVWH 3ZZBA 3TJUA 3A8CA 1B0FA 4NGAH 3RXLA 1T8NA 8GCHF 3GYLB 2QF0A 4AYYB 2ZGBH 1VITF 1Y5AT 2ULLA 3KGPA 3UFAA 1OWHA 1SL3A 3OX7U 1C1WH 4IW4E 4ISNA 4LK4A 3U98H 2QCYA 1F0TA 1G2LA 1UTJA 1Y5UT 1C5LH 3GCHB 5LPEA 1NO9H 3DA9B 1BMMH 1P2IA 3GY8A 3DD2H 3V7TA 1O39A 4X8SH 3VB6A 4MNXA 5IYTA 3QTVH 4KGAA 1FY4A 3HK3B 3QZQA 1JXPA 1ORFA 3TGKE 1L4DA 3BV9B 3TJNA 4ZKSU 1O2VA 2EI7A 1SB1H 1LHCH 1XUKA 3HPTB 1WCZA 3VB3A 3EGKH 1AB9C 1BRUP 1P2OA 4X1QU 3BTWE 4ASHA 4D7FA 3ATLA 1D3TB 1E37B 2VGCB 3SNDA 1AKSA 4I8KA 1O2TA 1GHWH 3ATMA 2BB4A 5C5OA 1G2MA 1GHBG 1OWIA 4FUCA 2Z94A 2BD5A 3P95A 3UTUH 2ZG0H 1RD3B 2VB0A 2LIZA 5E2OA 2ODYB 5ESTE 2Z3DA 3SNBA 4WXVA 1FUJA 3SJ9A 3CENA 1UTPA 1T31A 1YF4A 1O3NA 2BD8A 4FU8A 1Z1IA 1ABJH 1H9IE 4X2YA 2GV7A 3NWUA 4GCHG 2A2XH 2F83A 5C1UA 2TIOA 4XDEA 3T26A 1GDNA 1O2SA 3T25A 1NM6A 1TE0A 5F6MA 1GCDA 1PQ8A 1RIWB 5C3NA 5FPTA 3ZZ4A 3RXCA 5LGOA 3KHVA 1CA0C 4Y71A 4D7GA 1RJXB 4K1TA 1YPJH 1GMCG 1P11E 3RXSA 5JBTA 5CMXH 1TGTA 1BJUA 1XMNB 1AD8H 2B7DH 2ILNA 4IS5A 4H4FA 5FPSA 1SLVB 1N6XA 2J94A 3ZZ5A 1S85A 2Z3EA 5G4BA 4NFEA 1GI8B 1K28D 4Z0KA 2TRMA 1QQUA 3OY6U 3A86A 2VVCA 1C2FA 4OGXA 2Y5GA 2FI5E 3M5LA 4I8GA 2P95A 1AZ8A 3BEFB 4ZKNU 1F92A 2GZ8A 1W7XH 3QLPH 2Y7ZA 1UK3A 2GDDA 2TGAA 1HIAA 3A7XA 3EAJA 1V2MT 3RXOA 3SU6A 2GKVE 4YTAA 4X6NA 1TRYA 2ZPRA 3A8DA 4KTCA 2BDYA 3F9HA 1FLEE 3RDZA 1ZYOA 3LH3A 1MCVA 1XUJA 3FANA 2BD9A 3ZZ9A 4E7RG 1T4VH 2VWMA 1NFXA 2Z9JA 1Y3WA 3M5NA 4NIYA 3V0XA 3DHKH 4Z6AH 1THPB 2PLXA 4FUJA 3LGYA 1J8AA 2VVUA 2FLRH 5JPMH 3UUZA 3MH5A 3H7OA 1V2ST 2OBOA 1HV7A 3FP8E 2A7HA 3LC3A 1TNIA 1EP5A 2AIQA 4JZEH 3VB5A 3RUOA 2CMYA 1GCTC 2FYRA 1XUIA 1BBRK 1AQ7A 1CHGA 3U8TH 1GI3A 2BM2A 4NA9H 1A5HA 1C5RA 1WQVH 5GCHG 2PSYA 2HGTH 3ZVCA 5JB9S 2ZKSA 3LGUA 1V2JT 3K6YA 4A1TA 1ANCA 1UTLM 1L1NA 3K2UA 4X2XA 2NU1E 4Q2KA 2VINA 1GWAA 4IMZA 1KYNA 4FUDA 1ZMNA 1UTQA 3I77A 3B23B 4IN2A 2FI3E 2ASUB 1GMHG 1BZXE 3RC6A 2STBE 1QQ4A 1GJBB 1MU6B 4ABEA 1DITH 2ZPSA 1YLCA 1W0ZU 1HAGE 4B74A 5T6DA 5J4QA 2OTVA 4K69A 4I32A 2A32A 4AFQA 3RLYH 2UUYA 1ETSH 1D9IA 1DUEA 1Z8RA 2C8XB 3LH1A 3B9FH 3BN9A 3RU4D 3TJOA 4U2WA 1BTYA 2FPZA 2STAE 3LGIA 1QA0A 1Z1JA 4XBCA 1A5GH 5A8XA 2FLBH 3E16B 1NFUA 1P05A 2Q6DA 3TNSA 2CV3A 1MH0A 5DG6A 4I8LA 3RXRA 3EE0B 1LQDB 3ZV8A 3T29A 1W11U 3UR9A 2GMTC 1O5EH 1TB6H 5TCCA 1J16A 1DXPA 4VGCB 1HGTH 4U32A 3RXEA 1ELBA 1GHXH 6LPRA 2WPIS 1UTKA 3GISB 3GY4A 2H9HA 3E1XB 3MU4A 2SGDE 4NFFA 1AKSB 1HAVB 2V35A 4F4OC 1FPHH 1KLIH 1WTHD 3RXHA 2V0BA 1YPHC 1CT0E 2VGCC 4ZUHA 1GJ4H 2ZFTA 1C5OH 1SFQB 2TGTA 4AOQA 3A7YA 4NIXA 1BMAA 2GZ7A 3STIA 1TQ0B 1YM0A 3BTME 4ABHA 5GPIB 1YCPH 1BT7A 1N8OB 3W95A 5DP8A 7LPRA 4HFPB 2P93A 3I29A 4Y76A 3G01A 5DP4A 1RS0A 5HM2A 2Y5HA 5GJ4B 1IOEA 4Y8YA 1ZOMA 1RTKA 1SOZA 1XVMA 1JIRA 1S83A 2GCTC 5EQSA 3BTHE 1TRMA 3RMOH 4YT7H 5A2MH 1GJ6A 2WUBA 1DVAH 3UNRA 1ESAA 1PQ7A 2QAAA 1QRWA 2WPHS 1O3CA 3Q00A 5DGJA 4GLYA 3PMAB 4F49A 1CBWB 5B6OA 3ITIA 2QC2A 1SG8B 3MWIU 4AZ2B 1DPOA 2UWOA 3RP2A 1W2KH 1NRSH 2ZGJA 2FOGA 1WV7H 1O2ZA 2YNAA 4ISIH 2XBXA 2Z9GA 2GTBA 3A7ZA 1O2HA 1J9CH 4ISOA 3OYPA 1SLWB 3STJA 2ODQA 1HAIH 1MQ5A 6ESTA 2TPIZ 1Z8GA 5T6GA 2LNCA 4PROA 1GI0A 1W3CA 1ANDA 3LKWA 1RGQA 2PTNA 2A5KA 4K8BA 5J4SA 5E8EH 3BG4C 1A0HB 3NCLA 4MPXA 1DE7H 3KN2A 1KXBA 2D26C 2OCVB 2Z7FE 3GCTG 1V2OT 2ZP0H 1P04A 4IN1A 2FTLE 5K7RA 4YOJA 2J9NA 3LJJA 1P2JA 2J4IA 2BVRH 3VXEH 1P0SH 4NA8A 1QHRB 1YPKH 1EPTB 4DY7B 4NCYA 4AFZA 3ESTA 1OP2A 2BXTH 4ABDA 4AFSA 4BAMB 2R3UA 3RXGA 2ZHWH 4R0IA 1FDPA 2HWLB 2HVXA 1K21H 3ATWA 3BEIB 4CRGA 2G52A 1LTOA 1WSSH 5GDSH 2ZU1A 4DIIH 3LJOA 1XUGA 4DCDA 1MKWK 2GT7A 2WPLS 5L6NH 3DT0H 4BTTB 1QY6A 2V6NA 4B2BA 1DANH 3RXQA 1QJ1B 1C1TA 1SC8U 1V2VT 1A3EH 1GG6C 1ID5H 3NZIA 3PLKA 3FP7E 3ZZ3A 4K60A 1C1SA 1DY9A 1AN1E 1THRH 4XSKU 4CBNA 1GGDC 3EYDA 4GHQA 3A8AA 3GY6A 3RC5A 1FV9A 2EI6A 1SGYE 1YLDA 1WBGB 3TPIZ 3GOVB 3SU2A 3DUXH 3KQCA 1DWDH 2BOKA 3MH7A 2ZFSA 5LH8A 3LOXA 4AORA 2AGGX 2VWOA 3JZ2B 3TK5A 3BG4B 3Q3XA 1DS2E 4THNH 3UNQA 5GXPA 2PKSB 4X6MA 3GDVA 1GBLA 4AX9H 2B0FA 4ISLA 3F9EA 2ALPA 2ZU3A 4DOQA 1TAWA 1AZZA 1PJPA 1RFNA 3O8CA 2NU0E 3SN8A 1GMCF 2SGAA 1HAYB 1K1LA 1UVUH 1Z8JB 4Q7XA 6GCHG 1Z6EA 4ABFA 2A5IA 4WMDA 1T8OA 4A6LA 1QBOA 2FS8A 3M3SA 2ZTXA 1TX8A 3KCGH 5GIBA 4I33A 1FJSA 1ELVA 2ZCLP 2GP9B 1GL1A 2ZHEH 1K1PA 1MMJN 3T2NA 1C5VA 1TPPA 1AFQC 1ZR0A 3V13A 1O2RA 1W13U 4ABJA 1P2QA 1GI6A 1Y5BT 1B0EA 1OX1A 4FUEA 3SU1A 1INCA 4K3JA 2NU3E 3CS7A 4TWWA 4KTUA 4GAWA 5A0BA 4I8HA 3SUGA 2OQ5A 2OLGA 2AERH 1C5UA 2A45B 1LKBA 3BTDE 3RU4T 1KY9A 1VITH 1Y3YA 2GV6A 5PTPA 4MPVA 1C9PA 3ODDA 2BTCE 2G00A 1P09A 3IITA 1C4U2 2ZTZA 1KXFA 1Z7KA 2PR3A 4NA7A 3GDSA 2P94A 5C20A 1F5RA 3QGJA 4ABGA 1TMUH 1C5NH 1W7GH 5FPYA 3MO6A 1HDTH 1KXEA 1QJ7B 1VJAU 4CH2B 4UD9H 2AGIX 5HM9A 1O3DA 1YGCH 1CGIE 1OWJA 4MLFB 4Y10E 3ZVFA 2SGEE 4SGBE 4ZMAH 1MKXH 4YLUA 2H1UA 1O32A 4LOYH 3M3VA 2QN5T 1HBTH 1ABIH 1O5BB 2PFEA 1A2CH 1P03A 1ZJKA 4YM9A 1UVOA 4B76A 1GBCA 3GY2A 4BNRA 1P9SA 2ZC9H 1SLXB 3KNXA 1Z8IB 3O8DA 3PV4A 3BTTE 3N7OA 1AI8H 3EBNA 2RA3A 2HNTE 3H7TA 1ZPZA 3RC4A 2ZQ1A 2OUAA 2FOEA 1OOKB 5EOKA 1E34B 1MTNB 1FIZA 1TQ7B 1GDQA 3M5MA 2VU8E 1Y3UA 3I78A 3OY5U 2IOTA 3SBKA 3AVZA 1E38B 5CHAC 4Y8XA 1QCPA 3TH4H 3ODFA 4UFEH 1BRBE 1GVZA 5HYOA 4UONA 1C5QA 5EW1H 2P8OC 1GJCB 1C2DA 1JMOH 1RTFB 2F9PA 3C27B 1TX6A 2D2DA 1ARCA 3SHCH 2VH0A 1C5ZB 1GBEA 1HAVA 2ZZUH 4BAOB 2O8UA 3LIWA 4IC5A 2ANKH 2PWXA 3A7VA 3VGCC 1FY1A 3LGTA 5FX5A 2ZGXH 2W3KA 1EZXC 4FUFA 1F0UA 1EJAA 4MNYA 1O2YA 1C1QA 2PKAB 2SNWA 2VIPA 1K9OE 3URDA 1C1MA 1C1UH 3ZZDA 2FYQA 1CHOF 1WU1A 2ZHDA 2UWPA 4K1EA 5EXMA 4VGCC 4NWLA 2BDAA 4AGKA 1KXCA 1MKWH 1MU8B 2ZU5A 1SHHB 5C5NA 1ZTJA 3MH4A 1O36A 4DURA 2R2WU 3TGIE 5AF9H 1O2KA 4MDSA 4YLQH 1QURH 1V2UT 1TWXB 1GHAG 1IQFA 2KAIA 1O3LA 2H5CA 3TNTA 1QL8A 1ZTKA 7GCHG 4GPGA 4ZXYH 1OKXA 1GJ5H 3MHWU 2BD7A 1GCTB 3ZVDA 1N8OC 2ZEBA 3QTOH 1MQ6A 2FODA 3PO1B 1P9UA 1GBAA 1HXFH 1VCQA 1ZHMA 3MU1A 3R3GB 5JBAS 3ZZAA 5GWZA 3SGAE 1ZSKA 4FUBA 2XWAA 1TNGA 3UWIA 1D6RA 1XXFA 3U69H 4NIVA 1LQEA 2YNBA 3SZNA 3GCOA 3MOCA 3SUDA 1MBMA 1FZZA 4UE7H 3W94A 1TGCA 1PPBH 2BLQA 4DVAU 2ZU4A 1TYNA 1A7SA 1P06A 1ETTH 1LKAA 1HNEE 4O3TA 3HK6B 1LO6A 2EC9H 3SGQE 1KLTA 3P8GA 2XBVA 3RMMH 7KMEH 2XXLA 1TOMH 3OTJE 5AVDA 1UVTH 3GCNA 1O2LA 1G3EA 2FIRH 1UJ1A 2IPHA 2D8WA 2CGAA 1UK2A 1QTFA 2O9QA 1MBQA 4CRAA 1AMHA 2J2UA 1UCYH 3SU3A 2ANWA 1PPEE 1EXFA 4CR9A 2GD4B 1P3CA 1HIAB 3GY7A 4X0WU 5FHTA 2IJOB 1V6DA 3HGNA 1C5SA 1HLTH 1HAXB 3ZZ8A 1K22H 1HJAC 1K1OA 1EB1H 1QBNA 5JBCS 1ZSJA 2BY9X 4DG4A 3C1KA 3MU8A 5L2ZH 2UWLA 3Q77A 1EPTA 3MU0A 1O5CB 2OC0A 5DK1A 8GCHG 2QXJA 4TPYA 3TGJE 2HOBA 1VITG 1PYTC 1HYLA 3AAVA 1XVOA 1HXEH 3ZVAA 4TY7A 4D9QA 1Y8TA 3AW1A 3EA7A 3PWBA 3S9AA 4NG9H 1GGDB 2XBWA 2XRCA 2XC0A 4GCHF 1C1NA 1YYY1 2FMJA 2A7CA 2P16A 3IG6B 2ZHQH 1QB1A 2G4UA 3PTNA 4XBDA 2O8TA 1XKBC 1HJ9A 1QJ6B 1ESBA 3P6ZB 2G55A 3V3MA 3CS0A 1SSXA 3P8NA 3QUMP 2P3FH 1GJ8B 3D49H 2G8TA 4CRFA 2R2MB 1TONA 2FOHA 2RA0A 2G4TA 1L1GA 1BCUH 2XW9A 7GCHF 2BY7X 1NT1A 4K2YA 1BTXA 1HAZB 1ARBA 3JZ1B 4UFDH 1P8VC 2FXRA 5DPAA 1TMTH 4UFGH 1TNKA 1AUTC 1GL0E 1O3FA 1XUFA 2C90B 1V2LT 4ZXXH 1PPHE 4HGCA 1AB9B 4Y0YE 1EKBB 1LVYA 4WH8A 1SGRE 5AFZH 1NC6A 1EAWA 2PV9B 4NSVA 4UEHH 1QL9A 2WINI 2Y80A 2XCNA 4YZUA 3MFJA 4GVUA 1RRKA 2P3TB 1P2NA 4JK6A 2BZAA 2SNVA 4JCNA 1BQYA 2F9VA 3PLPA 2ZTYA 4H6SB 3E6PH 7ESTE 3TIUA 1F0SA 1LVMA 1TALA 5FCRA 4AB9A 2WPMS 1DLKB 1FI8A 5EPYA 1DLEA 3RM0H 4Y7AA 5L2YH 2NWNA 3M7UA 1IHSH 2C8WB 3M5OA 1O2UA 2FOMB 1X7AC 2FOAA 2Q6FA 2UUJB 4Y7BA 2BQ6B 3TU7H 1G3DA 3F9GA 4OS5A 1AU8A 1MTSA 5C67A 1MCTA 4CBOA 4ABBA 1XKAC 2AMPA 1TGNA 1DX5M 2ODPA 2FZZA 1LPGB 4IGDA 2OXSA 1EASA 1KXDA 4WJG2 1DUAA 4FXGH 5C2ZA 2QA9E 1EZSC 2DUCA 3O8BA 1PQAA 3A7TA 3PYHA 2AYWA 3P8OA 1EUFA 4AFUA 1O3GA 1MTWA 4ZH8A 4ABAA 1N1LA 3ZVEA 1NRRH 2LPRA 1GJ9B 1ZGIA 2J92A 3SUFA 5ESBA 1AVXA 2QV1A 1OP8A 2C93B 1PYTD 2YOLA 4NIWA 1W8BH 2BD2A 1EZUC 1UCYK 1TLDA 1GI7B 1V2WT 1CGJE 1O35A 1DWEH 1O3JA 3FP6E 4X1PU 1H4WA 3M35A 4XBBA 3T27A 3KEEA 4ZKOU 3E3TA 3K9XB 2ZDAH 1UVSH 2CHAC 1WOFA 1G37A 1MUEB 2G5NA 3A85A 1NY22 1O2JA 1Y3XA 1BHXF 3MNSA 1AUJA 5DP7A 3WY8A 5E2PA 1P57B 1AWFH 1K1IA 1JWTA 1NS3A 3SUEA 1D6WA 1DWCH 2FTMA 2DE8A 4DW2U 1DXWA 3MO9A 1OS8A 1LCYA 3RXFA 1NROH 1P01A 2WYGA 1BTWA 4Y6DA 1O3OA 1BRAA 4UFFH 1O33A 4IC6A 2QXIA 2GCTB 1C2IA 1S6HA 2PKSC 1F2SE 1VCPA 1QB9A 1CHOG 3SJOA 2G5VA 4I31A 5H4IB 2AEIH 1UHBB 2ZU2A 4E05H 2QXGA 5A09A 1FMGA 3FAOA 4D9RA 5I46H 5JBBS 2BD4A 2VIVA 6GCHF 1BB0B 2BDHA 1PQ5A 1LMWB 1S5SA 1UTNA 2P59A 2WPKS 4A92A 4HI3A 3SNEA 1SQOA 1OSSA 1SVPA 3QO6A 1ZGVA 2BLOA 4ZKRU 3SV2H 8ESTE 4X8VH 2JH6D 5EXNA 4I7YH 1GBHA 3E0NB 3RXAA 2VWLA 3SORA 1EOLA 3ZVBA 2ZHFH 1IQGA 4CH8B 3PTBA 3T28A 1TBRH 4OGYA 1A1RA 3RXTA 1GDUA 1P2KA 1SGCA 1C5YB 2A31A 1L4ZA 3LU9B 4Y8ZA 2QXHA 3AASA 4X1RU 2QF3A 3UOPA 1FN6A 3PB1E 4AG1A 1HUTH 2XCFA 1ZTLA 4KP0A 4CRBA 5HMAA 2XC5A 4NWKA 1CGHA 4YOGA 3PM3A 5DJ7A 1W14U 1QIXB 1LVBA 1UTOA 1C9TA 4AG2A 4K8YA 1GBDA 1O2XA 1OYQA 4X1NU 4BAKB 1KTTB 1AFEH 3AW0A 1BBRE 1GHYH 2WYJA 1O30A 4LZ4B 5BRRE 1G3CA 1NRNH 1BBRH 1AGJA 2R0LA 2R9PA 3LONA 2AS9A 1F5KU 1C2MA 1TFXA 1T32A 2ZFRH 1IQEA 2BY5X 2Y6TA 2FI4E 1C2HA 1ELGA 1LDTT 2ZDVH 1TMBH 1ZPCA 1NESE 1ZZZA 1CT2E 4D76A 1BTPA 3M7QA 4A5TS 1J15A 1SI5H 3UOUA 3E0PB 3QDZB 1V2KT 3SNAA 1GMDG 5A8YA 3T62A 4BXWA 1CU1A 1ZMLA 4IBLH 4K5ZA 2A4OA 5DP6A 3T5FH 3BF6H 3QN7A 3SJKA 5K0HA 2VNTA 3E90B 3F6UH 3S9BA 1V2NT 3RXPA 1THSH 2OC7A 1NFWA 1C5PA 3VFEA 5JDUB 8LPRA 4UDWH 3ZVGA 4X6PA 1LPZB 1G9IE 3PO1C 4B73A 2JKHA 3TH2H 4ZHMU 2P3UB 2Z9IA 3TVJB 5AHGH 3D62A 1C1VH 1QB6A 2R0KA 1D3QB 2W26A 2HRVA 3GY5A 3R0FA 4NZLA 3LDXH 1TRNA 3M37A 1OWEA 3U8RH 1AE5A 4I8JA 3SNCA 3A80A 2BX3A 1V2PT 1HAHH 2BLVA 3NK8A 4A1VA 1Y3VA 1D4PB 3GCTF 3RXJA 1O2PA 1DDJA 1P10A 1YP9A 4BAQB 2H9TH 1BA8B 1C4Y2 1FNIA 1GG6B 4MPWA 1H8IH 3MNCA 1VCWA 4MNVA 3SOSA 5A0CA 3B8JA 4BTUB 3RXUA 2GCHG 2CHAB 4HZHA 1O3AA 2BDIA 1JRTA 2WV5A 9LPRA 3UQVA 1FY5A 5EODA 1SGTA 5HGGA 4JZ1A 2K1QA 2ZGHA 2CN0H 1QGFA 3EQ0H 1BOQA 2M5TA 4O9VA 2Z9LA 1Z6JH 1O3MA 1AIXH 2F9NA 2BQ7B 3GY3A 1MAYA 5JB8S 1TBZH 1C5XB 1O0DH 1T7CA 1SMFE 1GJAB 3SQEE 4IMQA 3LPRA 2HALA 1GBIA 1EZQA 2OP9A 4DIHH 2F91A 1TNJA 3DFJA 1PPFE 3SV8A 3TK9A 4AYVB 4CRDA 3RXIA 1IQNA 1JBUH 4DJZB 2VIOA 2OINA 1DWBH 1O3BA 3BSQA 4X2VA 3HGPA 3S7KB 3K65B 1SQAA 5BPEA 4JZFH 2J34A 1AFQB 5F8ZA 1O3PB 4CRCA 4B1TA 4YOIA 1LHEH 2OD3B 1AY6H 1P2MA 2A4GA 2ZIQH 4TY6A 4Q7YA 2D1JA 2A4RA 1DICA 3LGVA 1GI9B 3D23A 1BTHH 4OS7A 1ZJDA 1S0RA 3PWCA 3Q3YA 3SU5A 2A4QA 3LC5A 3S69A 4CHAC 2FOFA 2Y81A 1SGPE 3ELAH 5EU8A 1O2WA 1HRTH 2C4FH 2BLWA 1WQSA 4JYVH 1YCPK 1B7XB 3U1JB 3EA9A 3P70B 4X8UH 1C2GA 1C1RA 3L3TA 1M9UA 1QFKH 4Q80A 1SR5C 1UMAH 1XXDA 4U30A 4DGJA 1UHBA 2C8YB 2EA3A 2JH0D 5T3HA 1UO6A 3S0NA 4YESB 1MTNC 2VIWA 2C8ZB 2G51A 1TX7A 4LXBH 5FBEA 3NXPA 4FUGA 2SFAA 2W5EA 1KIGH 2RCEA 1E0FD 2VH6A 3TITA 2ANYA 1O34A 2W7SA 4MQAA 1EB2A 1ETRH 1YKTA 4WMFA 5E0JA 4ZHLU 4RSPA 1JIMA 1Q31A 2ZNKH 4JZIA 2HPQH 1OPHB 3RXMA 2CJIA 1O2QA 4YO9A 1O3KA 2KAIB 3S9CA 5DP5A 2B9LA 3ATIA 3BTKE 3P92A 1EQ9A 2BDBA 2AH4X 1OWKA 1C2EA 1HFDA 2SGPE 4MVNA 1YCPM 2HLCA 4BTIB 2Q6GA 1PFXC 1GMDF 1HB0B 1EX3A 2FS9A 3U1IB 1D3PB 4H42U 1AVWA 1CBWC 3ZZCA 4CR5A 4OS1A 5C1XA 3EA8A 3VPKA 1UCYE 1AO5A 3SGBE 2ZFQH 4JYTA 1ZHRA 2FEQH 3KF2A 2AMQA 1C2LA 2ANMH 3PROA 3FZZA 2QGRA 2GX4A 1BMLA 1O2IA 1GBKA 5FBIA 1BTUA 1BDAA 1TA2A 2ZCHP 1O5GH 3VB4A 3UR6A 2ZDKA 1F7ZA 2BY6X 1BTZA 4MNWA 4XE4A 1S81A 1GJ7B 1BITA 3P17H 1OXGA 4WY3A 5E0HA 3DFLA 1GI1A 3MNBA 2PGQB 1C5WB 2XC4A 1AWHB 1NU9A 2JETC 4O97A 1FN8A 3EDXB 4AGJA 3M3TA 3BIVH 1NU7B 4INHA 2HPPH 3ZYDA 5F8TA 3SI4H 4OS4A 1GBJA 1WYKA 2ZFFH 3Q76A 2GZ9A 4WMEA 1TBQH 1FXYA 5LPRA 1CO7E 1VGCB 1DSUA 4D8NA 2O8LA 2XTTB 1QRZA 3BTQE 1HPGA 3F9FA 3SU4A 4BANB 2VVVA 1IQMA 4J1YA 1CT4E 1G32B 2EI8A 4JMYA 3UIRA 1MZDA 2GMTB 3FFGA 3MH6A 5DP9A 2BQWB 3QWCH 4B2AA 4Q7ZA 1VR1H 1C1PA 3P8FA 1TPAE 2QIQA 1TPSA 2QYIA 1AHTH 3VEQB 1FAXA 2F9UA 4X2WA 1V2QT 3LT3A 2GCHF 4Y0ZE 3RLWH 5E0GA 1GI2A 4BOHA 1O37A 4JYUH 1QBVH 4JZDH 4SGAE 3RMNH 2BZ6H 2H5DA 2P8OB 4ABIA 2O8WA 4GUXA 1L0ZA 5L30H 2BX4A 1NZQH 3MNXA 2AMDA 2OC1A 4GHTA 1SGDE 2Y5FA 1LVOA 1O5DH 2PSXA 1D3DB 1FIWA 1K1JA 3MTYA 3OSYA 2WPJS 2FP7B 1TABE 4K1SA 1Y59T 2SGQE 3TK6A 1A3BH 2R3YA 1S0QA 1A0LA 2BOHB 3HATH 1RXPA 3BG8A 3ZYEA 2BY8X 1FPCH 1S6FA 3A84A 3KQDA 1NN6A 1SGQE 1T8MA 5I25A 3MYWA 2H9EH 2ZI2H 3TJVA 1GBTA 5JYIA 2GDEH 1W10U 5TJXA 4KKDA 1EAXA 1K1NA 3SI3H 2K7XA 1UK4A 5FXLA 2V3OH 2F3CE 3KQBA 3UNSA 1YPGH 2Y82A 2I6QA 3U8OH 4B71A 5HXFA 1LPKB 4MTBA 2BDGA 4NSYA 5C1YA 1GHBF 2WUCA 1P02A 4HTCH 1QL7A 1ELEE 1ESTA 3UQOA 5EW2H 1YPMH 2A0QB 2ZDNA 1ANEA 1QA7A 2B5TB 5A0AE 2WV4A 1ZSLA 1O2MA 1KTSB 4YT6H 1EATA 4QT8C 2PGBB 3V12A 2ZO3H 1O3IA 1BHXB 2BXUH 1SPJA 2C3SA 3M61U 1S82A 1GPZA 3NKKA 2AIPA 3H5CB 4TWYA 3L33A 1G30B 2RG3A 2ZGCA 1S84A 2PHBA 1TNLA 1MTVA 1O3EA 1SOTA 5DP3A 6CHAB 3GDUA 2VIDA 1TIOA 3SJIA 3ZV9A 3BTFE 1FY8E 1O2NA 2F9BH 4FVDA 2EEKA 1C4V2 1OWDA 2FOCA 2XNIA 2CF8H 3MMGA 1SGIB 1NPMA 2RDLA 5A8ZA 1E35B 1ZLRA 1IQIA 3AAUA 1WUNH 3A8BA 1A61H 1ELTA 3E8LA 1O2OA 2AFQB 4H6TA 1CE5A 1BMNH 2XYAA 4WVPE 4R8TB 3UY9A 3ZZ7A 1ZPBA 5EXLA 1WTGH 2A2QH 5FCKA 1PPCE 3HKIB 9ESTA 1KSNA 1SLUB 4RKJB 1SGFG 1XM1A 3M7TA 4WXIA 1GMHF 2IN2A 1LHFH 1GHVH 3SV6A 1GVLA 1ELCA 1XUHA 5ABWA 1J14A 4WF8A 3U9AH 2JH5D 4MPUA 3RXKA 1MZAA 3TH3H 3SU0A 1PPGE 1WAYB 1IQLA 2VIQA 2VJ1A 1IQJA 2PUXB 1P3EA 1V2TT 1QRXA 1IHTH 1ELAA 2PUQH 2AGEX 1DOJA 1GVKB 2NU2E 1L2EA 2TGPZ 2ZWLH 1H9HE 4TPIZ 1A0JA 1C2JA 1BJVA 1G3BA 1DY8A 1HJ8A 1BRCE 4XFQA 1MTUA 2BDCA 1K2I1 2XBYA 4WWYA 3A81A 1YPLH 2FOBA 3VGCB 2BVXH 5IDKA 3MI4A 2BHGA 3D65E 1ELDE 2ZDMA 2GVFA 4ZROA 1O5FH 4MG3A 1T8LA 2FDAA 4AN7A 2J95A 1UTMA 4FUIA 1JRSA 2H6MA 1LHDH 2Q1JA 1EPTC 8KME2 2ZCKP 1NRQH 3A7WA 3GICB 5FX6A 1HCGA 2THFB 1MAXA 4NZQA 1GHZA 4FUHA 2XWBI 1TPOA 4GSOA 4O03A 2W7UA 3ZZ6A 3RU4E 1V2RT 2J38A 1AVGH 2Y7XA 1OP0A 1KDQB 1GI4A 1RIWC 2B8OH 1A5IA 1ANBA 1G36A 2HNTC 3QGNB 2G81E 1BIOA 2I6SA 3QX5H 5CE1A 2OQUA 3MO3A 1O3HA 1T4UH 2VWNA 3CP7A 4Y79A 3BIUH 3O8RA 1GBMA 2ZECA 1LHGH 4ZHAA 1H1BA 3LGWA 3URCA 1DM4B 3GCHC 3L6PA 1SFIA 1ZMJA 4O3UA 1SQTA 4OS2A 4BXSA 1TA6A 1XX9A 1EAUA 5DO4H 5T6FA 2FWWA 1VJ9U 2PKAA 1ACBE 5TCAA 3SV7A 2ZFPH 3Q3KA 3GYMA 4TYDA 3SV9A 1F0RA 1JOUB 4FU9A 1DSTA 1TOCB 3SQHE 4RKOB 3KIDU 1TNHA 3E91A 3SJ8A 1EP6A 1IQKA 1VGCC 1TGSZ 4RN6A 5ETXA 2FO9A 6CHAC 1OYTH 1GI5A 4A1XA 1CA8B 2ALVA 2Z3CA 1SBWA 2OBQA
chains in the Genus database with same CATH superfamily
1HJAB 1NRPH 4DT7B 2BMGB 4JK5A 5GCHF 1L1JA 5CDFE 2JETB 3A87A 1IQHA 1O38A 4DT4A 1B5GH 5DKMA 3RM2H 3RXBA 2O8MA 1EJNA 1UVPA 4Y11E 1C2KA 2BVSH 1VZQH 1PPZA 2ZF0H 4X1SU 4AB8A 2V3HH 1U6QA 3QK1A 5EG4A 1CSOE 2PW8H 1SHYA 3TLOA 5F8XA 1E36B 1VKYA 1QNJA 2FX4A 3N99A 2H2ZA 1C1OA 4WH6A 1EAIA 1MD8A 1ZRBA 5EQRA 4M7GA 1FQ3A 1GBFA 2GT8A 1KDQA 1W0YH 2SGFE 5EJZA 3M36A 4INKA 1CA0B 2JJ1D 3PRBA 2ZDLA 5AFYH 2FM2A 1K1MA 1MKXK 1CQQA 1FY3A 3A88A 3SHAH 1J17T 4LZ1H 2FESH 5EPNA 2Z6BD 2W3IA 1ELFA 1O31A 4BAHB 4KELA 1AE8H 2ZQ2A 1Q3XA 3KL6A 2OC8A 3OU0A 1W12U 3QZRA 1KLJH 2CXVA 5EGMA 4INLA 3PMJA 1C5TA 1TGBA 4U01A 3VXFH 2Z9KA 1SGFA 2QY0B 1GHAF 4CREA 1A4WH 1RTLA 4F55A 1MD7A 2FX6A 2BYAX 5T1VA 4B2CA 3A89A 3F0OA 4ACAA 2F43B 4RI0A 2UUKB 1NBME 2ESTE 3UPEA 3S7HB 3BTGE 5IK2D 5FAHA 1DFPA 3OAAD 1BUIA 3BTEE 4E06H 1YPHE 2NU4E 2A5AA 4A7IB 4FVBA 1YPEH 4X8TH 1Z71A 2TBSA 2A1DB 1FAKH 5LPFA 1GBBA 4FU7A 4XOJA 2GGVB 1EJMA 1Q2WA 5EQQA 1O2GH 5CHAB 4ESTE 1H9LB 2TGDA 3PMHB 1ZHPA 3UREA 1H8DH 3A83A 3K6ZA 4FOUC 3UWJH 3HKJB 3NUMA 1HAPH 3RXVA 3RXDA 1YBWA 3VB7A 3FVFB 3ENSB 1IAUA 1NFYA 1KXAA 1N6YA 5SGAE 1GJDB 1FONA 4CHAB 1C5MD 1QR3E 3PLBA 4RT1A 4B75A 3F1SB 3SO3A 2F9OA 2ZPQA 3NPSA 2HNTF 3PMBB 2BD3A 1A46H 1EOJA 4ISHH 1SGEE 3ATKA 4X6OA 1YC0A 2DE9A 2A7JA 2PTCE 2ZA5A 5F03A 1NTPA 3F68H 4E7NA 3SW2B 2CF9H 1K0HA 3BEUA 1SGNE 1DT2A 3FZDA 1P12E 3A82A 4OS6A 4KTSA 2UUFB 4J2YB 1HAOH 3KQEA 3RMLH 4ZAEA 3MU5A 1ZRKA 1V3XA 3IWMA 1F5LA 1O5AB 1CVWH 3ZZBA 3TJUA 3A8CA 1B0FA 4NGAH 3RXLA 1T8NA 8GCHF 3GYLB 2QF0A 4AYYB 2ZGBH 1VITF 1Y5AT 2ULLA 3KGPA 3UFAA 1OWHA 1SL3A 3OX7U 1C1WH 4IW4E 4ISNA 2YMSB 2KM0A 4LK4A 3U98H 2QCYA 1F0TA 1G2LA 1UTJA 1Y5UT 1C5LH 3GCHB 5LPEA 1NO9H 3OEED 3DA9B 1BMMH 1P2IA 3GY8A 3DD2H 3V7TA 1O39A 4X8SH 3VB6A 4MNXA 5IYTA 3QTVH 4KGAA 1FY4A 3HK3B 3QZQA 1JXPA 1ORFA 3TGKE 1L4DA 3BV9B 3TJNA 4ZKSU 1O2VA 2EI7A 1SB1H 3SZEA 1LHCH 1XUKA 3HPTB 1WCZA 3VB3A 3EGKH 1AB9C 1BRUP 1P2OA 4X1QU 3BTWE 4ASHA 4D7FA 3ATLA 1D3TB 1E37B 2VGCB 3SNDA 1AKSA 4I8KA 1O2TA 3F2GA 1GHWH 3ATMA 2BB4A 5C5OA 1G2MA 1GHBG 1OWIA 4FUCA 2Z94A 2BD5A 3P95A 3UTUH 2ZG0H 1RD3B 2VB0A 2LIZA 5E2OA 2ODYB 5ESTE 2Z3DA 3SNBA 4WXVA 1FUJA 3SJ9A 3CENA 1UTPA 1T31A 1YF4A 1O3NA 2BD8A 4FU8A 1Z1IA 1ABJH 1H9IE 4X2YA 2GV7A 3NWUA 4GCHG 2A2XH 2F83A 5C1UA 3PV5A 2TIOA 4XDEA 3T26A 1GDNA 1O2SA 3T25A 1NM6A 1TE0A 5F6MA 1GCDA 1PQ8A 1RIWB 5C3NA 5FPTA 3ZZ4A 3RXCA 5LGOA 3KHVA 1CA0C 4Y71A 4D7GA 1RJXB 4K1TA 1YPJH 1GMCG 1P11E 2IJD1 3RXSA 5JBTA 5CMXH 5CHBA 1TGTA 1BJUA 1XMNB 1AD8H 2B7DH 2ILNA 4IS5A 4H4FA 5FPSA 4YXWD 1SLVB 1N6XA 2J94A 3ZZ5A 1S85A 2Z3EA 5G4BA 4NFEA 1GI8B 1K28D 4Z0KA 2TRMA 1QQUA 3OY6U 3A86A 2VVCA 1C2FA 4OGXA 2Y5GA 2FI5E 3M5LA 4I8GA 2P95A 1AZ8A 3BEFB 4ZKNU 1F92A 2GZ8A 1W7XH 3QLPH 2Y7ZA 1UK3A 2GDDA 2TGAA 2EY4C 1HIAA 3N7EA 3A7XA 3EAJA 1V2MT 3RXOA 3SU6A 2GKVE 3AK5A 4YTAA 4X6NA 1TRYA 2ZPRA 3A8DA 4KTCA 2BDYA 3F9HA 1FLEE 3RDZA 1ZYOA 3U28C 3LH3A 1MCVA 1XUJA 3FANA 2BD9A 3ZZ9A 4E7RG 1T4VH 2VWMA 1NFXA 2Z9JA 2WSSD 1Y3WA 3M5NA 4NIYA 3V0XA 3DHKH 4Z6AH 1THPB 2PLXA 4FUJA 3LGYA 1J8AA 2VVUA 2FLRH 5JPMH 3UUZA 3MH5A 3H7OA 1V2ST 2OBOA 1HV7A 3FP8E 2A7HA 2QF4A 3LC3A 1TNIA 1EP5A 2AIQA 4JZEH 3VB5A 3RUOA 2CMYA 1MABB 1GCTC 2FYRA 1XUIA 1BBRK 1WDIA 1AQ7A 1CHGA 3U8TH 2J98A 1GI3A 2BM2A 1WXRA 4NA9H 1A5HA 1C5RA 1WQVH 5GCHG 2HGTH 2PSYA 3ZVCA 5JB9S 2ZKSA 3LGUA 3F2FA 2HLDD 1V2JT 3K6YA 4A1TA 1ANCA 1UTLM 1L1NA 3K2UA 4X2XA 2NU1E 4Q2KA 2VINA 1GWAA 4IMZA 1KYNA 4FUDA 1ZMNA 1UTQA 3I77A 2KFWA 3B23B 4IN2A 2FI3E 2ASUB 1GMHG 1BZXE 3RC6A 2STBE 1QQ4A 1GJBB 1MU6B 4ABEA 1DITH 2ZPSA 1YLCA 1W0ZU 1HAGE 4B74A 5T6DA 5J4QA 2OTVA 4K69A 4I32A 2A32A 4AFQA 3RLYH 2LELA 2UUYA 1ETSH 1D9IA 1DUEA 1Z8RA 2C8XB 2J98B 3LH1A 3B9FH 3BN9A 4ACBA 3RU4D 3TJOA 4U2WA 1BTYA 2FPZA 2STAE 3LGIA 1QA0A 1Z1JA 4XBCA 1A5GH 4P02A 5A8XA 2FLBH 3E16B 1NFUA 1P05A 2Q6DA 1BMFD 3TNSA 2CV3A 1MH0A 5DG6A 4I8LA 3RXRA 3EE0B 1LQDB 3ZV8A 3T29A 1W11U 3UR9A 2GMTC 1O5EH 1TB6H 5TCCA 1J16A 1DXPA 4VGCB 1HGTH 4U32A 3RXEA 1ELBA 1GHXH 6LPRA 2WPIS 1UTKA 3GISB 3GY4A 2H9HA 3E1XB 3MU4A 2SGDE 4NFFA 1AKSB 1HAVB 2V35A 4F4OC 1FPHH 1KLIH 1WTHD 3RXHA 2V0BA 1YPHC 1CT0E 2VGCC 4ZUHA 1GJ4H 2ZFTA 1C5OH 1SFQB 2TGTA 4AOQA 3A7YA 4NIXA 1BMAA 2GZ7A 3STIA 1TQ0B 1YM0A 3BTME 3WWFA 4ABHA 5GPIB 1YCPH 1BT7A 1N8OB 3W95A 5DP8A 7LPRA 4HFPB 2IPQX 2P93A 3I29A 4Y76A 3G01A 5DP4A 1RS0A 5HM2A 2Y5HA 5GJ4B 3DSOA 1IOEA 4Y8YA 4P00A 1ZOMA 1RTKA 1SOZA 1XVMA 1JIRA 1S83A 2GCTC 5EQSA 3BTHE 1TRMA 3RMOH 4YT7H 5A2MH 1GJ6A 2WUBA 1DVAH 3UNRA 3VG8A 1ESAA 1PQ7A 2QAAA 1QRWA 2WPHS 1O3CA 3Q00A 5DGJA 4GLYA 3PMAB 4F49A 1CBWB 5B6OA 3ITIA 2QC2A 1SG8B 3MWIU 4AZ2B 4HG6A 1DPOA 2UWOA 3RP2A 1W2KH 5KGOA 1NRSH 2ZGJA 2FOGA 1WV7H 1O2ZA 2YNAA 4ISIH 2XBXA 2Z9GA 2GTBA 3A7ZA 1O2HA 1J9CH 4ISOA 1FX0B 2CK3D 3OYPA 1SLWB 3STJA 2ODQA 1HAIH 1MQ5A 6ESTA 5KECA 2TPIZ 1Z8GA 5T6GA 2LNCA 4PROA 1GI0A 1W3CA 1ANDA 3LKWA 1RGQA 2PTNA 3WWBA 2A5KA 4K8BA 1YY3A 5J4SA 5E8EH 3BG4C 1A0HB 5HIZA 3NCLA 4MPXA 1DE7H 3KN2A 1KXBA 2D26C 2OCVB 2Z7FE 3GCTG 1V2OT 2ZP0H 1P04A 4IN1A 2FTLE 5K7RA 4YOJA 2J9NA 3LJJA 1P2JA 2J4IA 2BVRH 3F0PA 3VXEH 1P0SH 4NA8A 1QHRB 1YPKH 1EPTB 4DY7B 4NCYA 4AFZA 3ESTA 1OP2A 2BXTH 4ABDA 4AFSA 4BAMB 2R3UA 3RXGA 2ZHWH 4R0IA 1FDPA 2HWLB 2HVXA 1K21H 3ATWA 3BEIB 4CRGA 2G52A 1LTOA 1WSSH 5GDSH 2ZU1A 4DIIH 3LJOA 1XUGA 4DCDA 1MKWK 2GT7A 2WPLS 5L6NH 3DT0H 4BTTB 1QY6A 2V6NA 4B2BA 1DANH 3RXQA 1QJ1B 1C1TA 1SC8U 1V2VT 1A3EH 1GG6C 1ID5H 3NZIA 3PLKA 3FP7E 3ZZ3A 4K60A 1C1SA 1DY9A 1AN1E 1THRH 4XSKU 4CBNA 1GGDC 3EYDA 4GHQA 3A8AA 3GY6A 3RC5A 1FV9A 2EI6A 4XRNA 1SGYE 1YLDA 1WBGB 3TPIZ 3GOVB 3SU2A 3DUXH 3KQCA 3KQ5A 1DWDH 2BOKA 3MH7A 2QE7D 2ZFSA 5LH8A 4B6FA 3LOXA 5EIYA 4AORA 2AGGX 2VWOA 3JZ2B 3TK5A 3BG4B 3Q3XA 1DS2E 4THNH 3UNQA 5GXPA 2PKSB 4X6MA 3GDVA 1GBLA 4AX9H 2B0FA 4ISLA 3F9EA 2ALPA 2M2AA 2ZU3A 4DOQA 1TAWA 1AZZA 1PJPA 1RFNA 3O8CA 2NU0E 3SN8A 1GMCF 2SGAA 1HAYB 1K1LA 1UVUH 1Z8JB 4Q7XA 6GCHG 1Z6EA 4ABFA 2A5IA 4WMDA 1T8OA 1NBMD 4A6LA 1QBOA 2FS8A 3M3SA 2ZTXA 1TX8A 3KCGH 5GIBA 4I33A 1FJSA 1ELVA 2ZCLP 2GP9B 1GL1A 2ZHEH 1K1PA 1MMJN 3T2NA 1C5VA 1TPPA 1AFQC 1ZR0A 3V13A 1O2RA 1W13U 4ABJA 1P2QA 1GI6A 1Y5BT 1B0EA 1OX1A 4FUEA 3SU1A 1INCA 4K3JA 2NU3E 3CS7A 4TWWA 4KTUA 4GAWA 5A0BA 4I8HA 3SUGA 2OQ5A 2OLGA 2AERH 1C5UA 2A45B 1LKBA 3BTDE 3RU4T 1KY9A 1VITH 1Y3YA 2GV6A 5PTPA 4MPVA 1C9PA 3ODDA 2BTCE 2G00A 1P09A 3KYFA 3IITA 1C4U2 2ZTZA 1KXFA 1Z7KA 2PR3A 4NA7A 3GDSA 2P94A 5C20A 1F5RA 3FN8A 3QGJA 4ABGA 1TMUH 3NRLA 1C5NH 1W7GH 5FPYA 3MO6A 3FO8D 1HDTH 1KXEA 1QJ7B 1VJAU 4CH2B 4UD9H 2AGIX 5HM9A 1O3DA 1YGCH 1CGIE 1OWJA 4MLFB 4Y10E 3ZVFA 2SGEE 4SGBE 4ZMAH 1MKXH 4YLUA 2H1UA 1O32A 4LOYH 3M3VA 2QN5T 1HBTH 1ABIH 1O5BB 2PFEA 1A2CH 1P03A 1ZJKA 4YM9A 1UVOA 4OM9A 4B76A 1GBCA 3GY2A 2RDEA 4BNRA 1P9SA 2ZC9H 1SLXB 3KNXA 1Z8IB 3O8DA 3PV4A 3BTTE 3N7OA 1AI8H 3EBNA 2RA3A 2HNTE 3H7TA 1ZPZA 3RC4A 2ZQ1A 2OUAA 2FOEA 1OOKB 5DSFA 5EOKA 1E34B 1MTNB 1FIZA 1TQ7B 1GDQA 3M5MA 2VU8E 1Y3UA 3I78A 3OY5U 2IOTA 3SBKA 3AVZA 1E38B 5CHAC 4Y8XA 1QCPA 3TH4H 3ODFA 4UFEH 1BRBE 1GVZA 5HYOA 4UONA 1C5QA 5EW1H 2P8OC 1GJCB 1C2DA 1JMOH 1RTFB 2F9PA 3C27B 1TX6A 2D2DA 1ARCA 3SHCH 2VH0A 1C5ZB 1GBEA 1HAVA 2ZZUH 4BAOB 2O8UA 3LIWA 4IC5A 2ANKH 2XNDD 2PWXA 3A7VA 3VGCC 1FY1A 3LGTA 5FX5A 3WW7A 2ZGXH 2W3KA 1EZXC 4F48B 4FUFA 1F0UA 1EJAA 4MNYA 4ASUD 1O2YA 1C1QA 2PKAB 2SNWA 2VIPA 1K9OE 3URDA 1C1MA 1C1UH 3ZZDA 2FYQA 1CHOF 2WHXA 1WU1A 2ZHDA 2UWPA 4K1EA 5EXMA 4VGCC 4NWLA 2BDAA 4AGKA 1KXCA 1MKWH 1MU8B 2ZU5A 1SHHB 5C5NA 1ZTJA 3MH4A 1O36A 4DURA 2R2WU 3TGIE 5AF9H 1O2KA 4MDSA 4YLQH 1QURH 1V2UT 1TWXB 1GHAG 1IQFA 1OHHD 2KAIA 2LP6A 1O3LA 2H5CA 3TNTA 1QL8A 1ZTKA 7GCHG 4GPGA 4ZXYH 1OKXA 1GJ5H 3MHWU 2BD7A 1GCTB 3ZVDA 1N8OC 2ZEBA 3QTOH 1MQ6A 2FODA 3PO1B 1P9UA 1GBAA 3N7DA 3PV2A 1HXFH 1E79D 1VCQA 1ZHMA 3MU1A 3R3GB 5JBAS 3ZZAA 5GWZA 3SGAE 1ZSKA 4FUBA 2XWAA 1TNGA 3UWIA 1D6RA 1XXFA 3U69H 4NIVA 1LQEA 2YNBA 5C17A 3SZNA 3GCOA 3MOCA 3SUDA 1MBMA 1FZZA 4UE7H 3W94A 1TGCA 1PPBH 2BLQA 4DVAU 2ZU4A 1TYNA 1A7SA 1P06A 1ETTH 1LKAA 1HNEE 4O3TA 3HK6B 1LO6A 2EC9H 3SGQE 1KLTA 3P8GA 2XBVA 3RMMH 7KMEH 2XXLA 1TOMH 3OTJE 5AVDA 1UVTH 3GCNA 1O2LA 1G3EA 2FIRH 1UJ1A 1E1RD 2IPHA 2D8WA 2CGAA 1UK2A 1QTFA 2O9QA 3DSGA 1MBQA 2WZQA 4CRAA 1AMHA 2J2UA 1UCYH 3SU3A 2ANWA 1PPEE 1EXFA 4CR9A 2GD4B 1P3CA 1HIAB 3GY7A 4X0WU 5FHTA 2IJOB 1V6DA 3HGNA 1C5SA 1HLTH 1HAXB 3ZZ8A 5HKKD 1K22H 1HJAC 1K1OA 1EB1H 1QBNA 2JJ2D 5JBCS 1ZSJA 2BY9X 4DG4A 3UAIC 3C1KA 3MU8A 5L2ZH 2UWLA 3Q77A 4I86A 1EPTA 3MU0A 1O5CB 2OC0A 5DK1A 8GCHG 2QXJA 4TPYA 3TGJE 2HOBA 1VITG 1PYTC 1HYLA 3AAVA 1XVOA 1SQRA 1HXEH 4M9FA 3ZVAA 4TY7A 4D9QA 1Y8TA 3AW1A 3EA7A 3PWBA 3S9AA 4NG9H 1GGDB 2XBWA 1COWD 2XRCA 2XC0A 4GCHF 1C1NA 1YYY1 2FMJA 2A7CA 2P16A 3IG6B 1YWUA 2ZHQH 1QB1A 2G4UA 3PTNA 4XBDA 2O8TA 1XKBC 1HJ9A 5KEDA 1H8HD 1QJ6B 1ESBA 3P6ZB 2G55A 3V3MA 3CS0A 2V7QD 5B6LA 1SSXA 3P8NA 3QUMP 2P3FH 1GJ8B 3D49H 2G8TA 4CRFA 2R2MB 1TONA 2FOHA 2RA0A 2G4TA 1L1GA 1BCUH 2XW9A 7GCHF 2BY7X 1NT1A 4K2YA 1BTXA 1HAZB 1ARBA 3JZ1B 4UFDH 1P8VC 2FXRA 5DPAA 1TMTH 4UFGH 1TNKA 1AUTC 1GL0E 1O3FA 1XUFA 2C90B 1V2LT 4ZXXH 1PPHE 4HGCA 3MQKC 1AB9B 4Y0YE 1EKBB 1LVYA 4WH8A 1SGRE 5AFZH 1NC6A 1EAWA 2PV9B 4NSVA 4UEHH 1QL9A 2WINI 2Y80A 2XCNA 4YZUA 4B6EA 3MFJA 4GVUA 1RRKA 2P3TB 1P2NA 4JK6A 2BZAA 2SNVA 4JCNA 1BQYA 2F9VA 3PLPA 2ZTYA 4H6SB 3E6PH 7ESTE 3TIUA 1F0SA 1LVMA 1TALA 5FCRA 4AB9A 2WPMS 1DLKB 1FI8A 5EPYA 1DLEA 3RM0H 4Y7AA 5L2YH 2NWNA 3M7UA 1IHSH 2C8WB 3M5OA 1O2UA 2FOMB 1X7AC 2FOAA 2Q6FA 2UUJB 4Y7BA 2BQ6B 3TU7H 2YMSD 1G3DA 3F9GA 4OS5A 1AU8A 1MTSA 1E1QD 5C67A 1MCTA 4CBOA 4ABBA 1XKAC 2AMPA 1TGNA 1DX5M 2ODPA 2FZZA 1LPGB 4IGDA 2HVYB 2OXSA 1EASA 1KXDA 4WJG2 1DUAA 4FXGH 5C2ZA 2QA9E 1EZSC 2DUCA 2J97A 1PQAA 3A7TA 3O8BA 2AYWA 3PYHA 3P8OA 1EUFA 4AFUA 1O3GA 1MTWA 4ZH8A 4ABAA 1N1LA 3ZVEA 1NRRH 2LPRA 1GJ9B 1ZGIA 2J92A 3SUFA 5ESBA 1AVXA 2QV1A 1OP8A 2C93B 1PYTD 2YOLA 4NIWA 1W8BH 2BD2A 1EZUC 1UCYK 1TLDA 1GI7B 1V2WT 1CGJE 1O35A 1DWEH 2L6OA 1O3JA 3FP6E 4X1PU 1H4WA 3M35A 4XBBA 3T27A 3KEEA 4ZKOU 3E3TA 3K9XB 2ZDAH 1UVSH 2CHAC 1WOFA 1G37A 1MUEB 2G5NA 3A85A 1NY22 1O2JA 1Y3XA 1BHXF 3MNSA 1AUJA 5DP7A 3WY8A 5E2PA 1P57B 1AWFH 1K1IA 1JWTA 1NS3A 3SUEA 1D6WA 1DWCH 2FTMA 2DE8A 4DW2U 1DXWA 3MO9A 1OS8A 1LCYA 3RXFA 3W1EA 1NROH 1P01A 2WYGA 1BTWA 4Y6DA 2K8IA 1O3OA 5C94A 1BRAA 4UFFH 1O33A 4IC6A 2QXIA 2GCTB 3FKSD 1C2IA 1S6HA 2PKSC 1F2SE 1VCPA 1QB9A 1CHOG 3SJOA 2G5VA 4I31A 5H4IB 2AEIH 1UHBB 2ZU2A 4E05H 2QXGA 5A09A 1FMGA 3FAOA 4D9RA 5I46H 5JBBS 2BD4A 2VIVA 6GCHF 1BB0B 2BDHA 1PQ5A 1LMWB 1S5SA 1UTNA 2P59A 2WPKS 4A92A 4HI3A 3SNEA 1SQOA 1OSSA 1SVPA 3QO6A 1ZGVA 2BLOA 4ZKRU 3SV2H 8ESTE 4X8VH 2JH6D 5EXNA 4I7YH 1GBHA 3E0NB 3RXAA 2VWLA 3SORA 1EOLA 3ZVBA 2ZHFH 1IQGA 4CH8B 3PTBA 3T28A 1TBRH 4OGYA 1A1RA 3F3BA 3RXTA 1GDUA 1P2KA 1SGCA 5C0TA 1C5YB 2A31A 1L4ZA 2F4LA 3LU9B 4Y8ZA 2QXHA 3AASA 4X1RU 2QF3A 3UOPA 1FN6A 1W0JD 3PB1E 4AG1A 1HUTH 2XCFA 1ZTLA 4KP0A 4CRBA 5HMAA 2XC5A 4NWKA 1QZ8A 4TT3D 1CGHA 4YOGA 3PM3A 5DJ7A 1W14U 1QIXB 1LVBA 1UTOA 1C9TA 4AG2A 4K8YA 1GBDA 1O2XA 1OYQA 4X1NU 4BAKB 1KTTB 1AFEH 3AW0A 1BBRE 3OTPA 1GHYH 2WYJA 1O30A 4LZ4B 5BRRE 1G3CA 1NRNH 1BBRH 1AGJA 2R0LA 2R9PA 3LONA 2AS9A 1F5KU 1C2MA 1TFXA 1T32A 2ZFRH 1IQEA 2BY5X 2Y6TA 2KR7A 2FI4E 1C2HA 1ELGA 1LDTT 2ZDVH 1TMBH 1ZPCA 1NESE 1ZZZA 1CT2E 4D76A 1BTPA 3M7QA 4A5TS 1J15A 1SI5H 2WV9A 3UOUA 3E0PB 3QDZB 1V2KT 3SNAA 1GMDG 5A8YA 3T62A 4BXWA 1CU1A 1ZMLA 4IBLH 4K5ZA 2A4OA 5DP6A 4TSFD 3BF6H 3T5FH 3QN7A 3SJKA 3CNRA 5K0HA 2VNTA 3E90B 3F6UH 3S9BA 1V2NT 3RXPA 1THSH 2OC7A 1NFWA 1C5PA 3VFEA 2KCOA 8LPRA 4UDWH 5JDUB 3ZVGA 4X6PA 1LPZB 1G9IE 3PO1C 4B73A 2JKHA 3TH2H 4ZHMU 2P3UB 2Z9IA 3TVJB 5AHGH 3D62A 1C1VH 1QB6A 2R0KA 1D3QB 2W26A 2HRVA 3GY5A 3R0FA 4NZLA 3LDXH 1TRNA 3M37A 2JIZD 1OWEA 3U8RH 1AE5A 4I8JA 3SNCA 3A80A 2BX3A 3DCLA 1V2PT 1HAHH 2BLVA 3NK8A 4A1VA 1Y3VA 1D4PB 4RT0A 3GCTF 3RXJA 1O2PA 3KYGA 1DDJA 1P10A 1YP9A 4BAQB 2H9TH 1BA8B 1C4Y2 1FNIA 1GG6B 2EQNA 4MPWA 1H8IH 3MNCA 1VCWA 4MNVA 3SOSA 5A0CA 3B8JA 4BTUB 3RXUA 2GCHG 2CHAB 4HZHA 1O3AA 2BDIA 1JRTA 2WV5A 9LPRA 3UQVA 1W0KD 1FY5A 5EODA 1SGTA 5HGGA 4JZ1A 2W6JD 2K1QA 2ZGHA 2CN0H 1QGFA 3EQ0H 1BOQA 2M5TA 1KMHB 2Z9LA 1Z6JH 4O9VA 1O3MA 1AIXH 1S6LA 2F9NA 2BQ7B 3GY3A 1MAYA 2J5UA 5JB8S 1TBZH 1C5XB 1O0DH 1T7CA 1SMFE 1GJAB 3SQEE 4IMQA 3LPRA 2HALA 1GBIA 2K0QA 1EZQA 3UB0A 2OP9A 4DIHH 2F91A 5DN6D 1TNJA 3DFJA 5C0UA 1PPFE 3SV8A 3TK9A 3DSPA 4AYVB 4CRDA 3EE7A 3RXIA 1IQNA 1JBUH 4DJZB 2VIOA 2OINA 1DWBH 1O3BA 3BSQA 3H09A 4X2VA 3HGPA 3S7KB 3K65B 1SQAA 5BPEA 4JZFH 2J34A 1AFQB 5F8ZA 1O3PB 4CRCA 4B1TA 4YOIA 1LHEH 2OD3B 1AY6H 1P2MA 2A4GA 2ZIQH 4TY6A 4Q7YA 2D1JA 2A4RA 1DICA 3LGVA 4Q4LA 1GI9B 3D23A 1BTHH 4OS7A 1ZJDA 1S0RA 3PWCA 3Q3YA 2AHME 3SU5A 2A4QA 3LC5A 3S69A 4CHAC 2FOFA 2Y81A 1SGPE 3ELAH 5EU8A 1O2WA 1HRTH 2C4FH 2BLWA 1WQSA 4JYVH 1YCPK 1B7XB 3U1JB 3EA9A 3P70B 4X8UH 1C2GA 1C1RA 3L3TA 1M9UA 1QFKH 4Q80A 1SR5C 1UMAH 1XXDA 4U30A 1EFRD 4DGJA 1UHBA 2C8YB 2EA3A 2JH0D 5T3HA 1UO6A 3S0NA 4YESB 1MTNC 2VIWA 2C8ZB 2G51A 3OEHD 1TX7A 4LXBH 5FBEA 3NXPA 4FUGA 2SFAA 2W5EA 1KIGH 2RCEA 1E0FD 2VH6A 3TITA 2ANYA 1O34A 2W7SA 4MQAA 1EB2A 1ETRH 1YKTA 4WMFA 5E0JA 4ZHLU 4RSPA 1JIMA 1Q31A 2ZNKH 4JZIA 2HPQH 1OPHB 3RXMA 2CJIA 1O2QA 4YO9A 1O3KA 2KAIB 3S9CA 5EJLA 5DP5A 2B9LA 3ATIA 3BTKE 3P92A 1EQ9A 2BDBA 2AH4X 1OWKA 1C2EA 1HFDA 2SGPE 2KZ4A 4MVNA 1YCPM 2HLCA 4BTIB 2Q6GA 4XD7D 1PFXC 1GMDF 1HB0B 1EX3A 2FS9A 3U1IB 1D3PB 4H42U 1AVWA 1CBWC 3ZZCA 4CR5A 4OS1A 5C1XA 3EA8A 3VPKA 1UCYE 1AO5A 3SGBE 2ZFQH 4JYTA 1ZHRA 2FEQH 3KF2A 2AMQA 1C2LA 2ANMH 3PROA 1UW7A 3FZZA 2QGRA 3OE7D 2GX4A 1BMLA 1O2IA 1GBKA 5FBIA 1BTUA 1BDAA 1TA2A 2ZCHP 1O5GH 3VB4A 3UR6A 2ZDKA 1F7ZA 2BY6X 1BTZA 4MNWA 4XE4A 2KCAA 1S81A 1GJ7B 1BITA 3P17H 1OXGA 5FL7D 4Q63A 4WY3A 5E0HA 3DFLA 1GI1A 3MNBA 2PGQB 1C5WB 2XC4A 1AWHB 1NU9A 2JETC 4O97A 1FN8A 3EDXB 4AGJA 2VBCA 3M3TA 3BIVH 1NU7B 4INHA 2HPPH 5F53A 3ZYDA 5F8TA 3SI4H 4OS4A 1GBJA 1WYKA 2ZFFH 3Q76A 2GZ9A 4WMEA 1TBQH 1FXYA 5LPRA 1CO7E 1VGCB 1DSUA 4D8NA 2O8LA 2XTTB 1QRZA 3BTQE 1HPGA 3F9FA 3SU4A 4BANB 2VVVA 1IQMA 4J1YA 1CT4E 1G32B 2EI8A 4JMYA 3SYJA 3UIRA 1MZDA 2GMTB 3FFGA 3MH6A 5DP9A 2BQWB 3QWCH 4B2AA 4Q7ZA 1VR1H 1C1PA 3P8FA 1TPAE 2QIQA 1SKYE 1TPSA 2QYIA 1AHTH 3VEQB 1FAXA 2F9UA 3GS9A 4X2WA 5EJ1A 1V2QT 3LT3A 2GCHF 4Y0ZE 3RLWH 5E0GA 1GI2A 4BOHA 1O37A 4JYUH 1QBVH 4JZDH 4SGAE 3RMNH 2BZ6H 2H5DA 2P8OB 4ABIA 2O8WA 4GUXA 1L0ZA 5L30H 2BX4A 1NZQH 3MNXA 2AMDA 2OC1A 2XOKD 4GHTA 1SGDE 2Y5FA 1LVOA 1O5DH 4ZCNA 2PSXA 1D3DB 1FIWA 1K1JA 3MTYA 3OSYA 2WPJS 2FP7B 1TABE 2L74A 4K1SA 1Y59T 2SGQE 3TK6A 3PRDA 1A3BH 2R3YA 1S0QA 1A0LA 2BOHB 3HATH 1RXPA 3BG8A 3ZYEA 2BY8X 1FPCH 1S6FA 3A84A 3KQDA 1NN6A 3ZIAD 1SGQE 1T8MA 5I25A 3MYWA 2H9EH 2ZI2H 3TJVA 1GBTA 5JYIA 2GDEH 1W10U 5TJXA 4KKDA 1EAXA 1K1NA 3SI3H 2K7XA 1UK4A 5FXLA 2V3OH 2F3CE 3KQBA 3UNSA 1YPGH 2Y82A 2I6QA 3U8OH 4B71A 5HXFA 1LPKB 5HIYA 4MTBA 2BDGA 2JDID 4NSYA 5C1YA 1GHBF 2WUCA 1P02A 4HTCH 1QL7A 1ELEE 1ESTA 3UQOA 5EW2H 1YPMH 2A0QB 2ZDNA 1ANEA 1QA7A 2B5TB 5A0AE 2WV4A 1ZSLA 1O2MA 1KTSB 4YT6H 1EATA 4QT8C 2PGBB 3V12A 2ZO3H 1O3IA 1BHXB 2BXUH 1SPJA 2C3SA 3M61U 1S82A 1GPZA 4FETA 3NKKA 2AIPA 3H5CB 4TWYA 3L33A 2GJGA 2V3MA 1G30B 2RG3A 2KCPA 2ZGCA 1S84A 2PHBA 1TNLA 1MTVA 1O3EA 1SOTA 5DP3A 6CHAB 3GDUA 2VIDA 1TIOA 3SJIA 3ZV9A 3BTFE 1FY8E 1O2NA 2F9BH 4FVDA 2EEKA 1C4V2 1OWDA 3F2HA 2FOCA 2XNIA 2CF8H 2YMSC 3MMGA 2OK5A 1SGIB 1NPMA 2RDLA 5A8ZA 1E35B 1ZLRA 1IQIA 3AAUA 1WUNH 3A8BA 1A61H 1ELTA 3E8LA 1O2OA 2AFQB 4H6TA 1CE5A 1BMNH 2XYAA 4WVPE 4R8TB 3UY9A 3ZZ7A 1ZPBA 5EXLA 1WTGH 2A2QH 5FCKA 1PPCE 2KX4A 3HKIB 9ESTA 1KSNA 1SLUB 4RKJB 1SGFG 1XM1A 3M7TA 4WXIA 1GMHF 2IN2A 1LHFH 1GHVH 3SV6A 1GVLA 1ELCA 2QF5A 1XUHA 5ABWA 1J14A 4WF8A 3U9AH 2JH5D 4MPUA 2RFKC 3RXKA 1MZAA 3TH3H 3SU0A 1PPGE 1WAYB 1IQLA 2VIQA 2VJ1A 1IQJA 2PUXB 1P3EA 1V2TT 1QRXA 1IHTH 1ELAA 2PUQH 2AGEX 1DOJA 1GVKB 2NU2E 1L2EA 2TGPZ 2ZWLH 1H9HE 4TPIZ 1A0JA 1C2JA 1BJVA 1G3BA 2W6ID 1DY8A 1HJ8A 1BRCE 4XFQA 1MTUA 2BDCA 1K2I1 2XBYA 4WWYA 3A81A 1YPLH 2FOBA 3VGCB 2BVXH 5IDKA 3MI4A 2BHGA 3D65E 1ELDE 2ZDMA 2GVFA 2PP6A 4ZROA 1O5FH 4MG3A 1T8LA 2FDAA 4AN7A 2J95A 1UTMA 4FUIA 1JRSA 2H6MA 1LHDH 2Q1JA 1EPTC 8KME2 2ZCKP 1NRQH 3A7WA 3GICB 5FX6A 2KCYA 1HCGA 2THFB 1MAXA 4NZQA 1GHZA 4FUHA 2XWBI 1TPOA 4GSOA 4O03A 2W7UA 3ZZ6A 3RU4E 2WPDD 1V2RT 5GNDA 1YLNA 2J38A 1AVGH 2Y7XA 1OP0A 1KDQB 1GI4A 1RIWC 2B8OH 1A5IA 1ANBA 1G36A 2HNTC 3QGNB 2G81E 1BIOA 2I6SA 3QX5H 5CE1A 2OQUA 3MO3A 1O3HA 1T4UH 2VWNA 3CP7A 4Y79A 3BIUH 3O8RA 1GBMA 2ZECA 1LHGH 4ZHAA 4Z1MD 1H1BA 3LGWA 3URCA 1DM4B 3GCHC 3L6PA 1SFIA 1ZMJA 4O3UA 1SQTA 4OS2A 4BXSA 1TA6A 1XX9A 1EAUA 5DO4H 5T6FA 2FWWA 1VJ9U 2PKAA 3OFND 3FOAA 1ACBE 5TCAA 3SV7A 2ZFPH 3Q3KA 3GYMA 4TYDA 3SV9A 1F0RA 1JOUB 4FU9A 1DSTA 1TOCB 4AC9A 3SQHE 4RKOB 3KIDU 1TNHA 3E91A 3SJ8A 1EP6A 1IQKA 1VGCC 1H8ED 1TGSZ 4RN6A 5ETXA 2FO9A 6CHAC 1OYTH 1GI5A 4A1XA 1CA8B 2ALVA 2Z3CA 1SBWA 2OBQA
chains in the Genus database with same CATH topology
1HJAB 1NRPH 4DT7B 2BMGB 4JK5A 5GCHF 1L1JA 2JETB 3A87A 1IQHA 1O38A 1B5GH 5DKMA 3RM2H 3RXBA 2O8MA 1EJNA 1UVPA 4Y11E 1C2KA 2BVSH 1VZQH 1PPZA 2ZF0H 4X1SU 4AB8A 2V3HH 1U6QA 3QK1A 5EG4A 1CSOE 2PW8H 1SHYA 3TLOA 5F8XA 1E36B 2FX4A 1QNJA 2H2ZA 1C1OA 4WH6A 1EAIA 1MD8A 1ZRBA 5EQRA 4M7GA 1FQ3A 1GBFA 2GT8A 1KDQA 1W0YH 2SGFE 3M36A 4INKA 1CA0B 2ZDLA 5AFYH 2FM2A 1K1MA 1MKXK 1CQQA 1FY3A 3A88A 3SHAH 1J17T 4LZ1H 2FESH 5EPNA 2Z6BD 2W3IA 1ELFA 1O31A 4BAHB 4KELA 1AE8H 2ZQ2A 1Q3XA 3KL6A 2OC8A 3OU0A 1W12U 3QZRA 1KLJH 2CXVA 5EGMA 4INLA 3PMJA 1C5TA 1TGBA 4U01A 3VXFH 2Z9KA 1SGFA 2QY0B 1GHAF 4CREA 1A4WH 1RTLA 1MD7A 2FX6A 2BYAX 4B2CA 3A89A 2UUKB 2ESTE 3UPEA 3S7HB 3BTGE 5FAHA 1DFPA 1BUIA 3BTEE 4E06H 1YPHE 2NU4E 2A5AA 4A7IB 4FVBA 1YPEH 4X8TH 1Z71A 2TBSA 2A1DB 1FAKH 5LPFA 1GBBA 4FU7A 4XOJA 2GGVB 1EJMA 1Q2WA 5EQQA 1O2GH 5CHAB 4ESTE 1H9LB 2TGDA 3PMHB 1ZHPA 3UREA 1H8DH 3A83A 3K6ZA 3UWJH 3HKJB 3NUMA 1HAPH 3RXVA 3RXDA 1YBWA 3VB7A 3FVFB 3ENSB 1IAUA 1NFYA 1KXAA 1N6YA 5SGAE 1GJDB 1FONA 4CHAB 1C5MD 1QR3E 3PLBA 4B75A 3F1SB 3SO3A 2F9OA 2ZPQA 3NPSA 2HNTF 3PMBB 2BD3A 1A46H 1EOJA 4ISHH 1SGEE 3ATKA 4X6OA 1YC0A 2DE9A 2A7JA 2PTCE 2ZA5A 5F03A 1NTPA 3F68H 4E7NA 3SW2B 2CF9H 3BEUA 1SGNE 1DT2A 3FZDA 1P12E 3A82A 4OS6A 4KTSA 2UUFB 4J2YB 1HAOH 3KQEA 3RMLH 4ZAEA 3MU5A 1ZRKA 1V3XA 3IWMA 1F5LA 1O5AB 1CVWH 3ZZBA 3TJUA 3A8CA 1B0FA 4NGAH 3RXLA 1T8NA 8GCHF 3GYLB 2QF0A 4AYYB 2ZGBH 1VITF 1Y5AT 2ULLA 3KGPA 3UFAA 1OWHA 1SL3A 3OX7U 1C1WH 4IW4E 4ISNA 4LK4A 3U98H 2QCYA 1F0TA 1G2LA 1UTJA 1Y5UT 1C5LH 3GCHB 5LPEA 1NO9H 3DA9B 1BMMH 1P2IA 3GY8A 3DD2H 3V7TA 1O39A 4X8SH 3VB6A 4MNXA 5IYTA 3QTVH 4KGAA 1FY4A 3HK3B 3QZQA 1JXPA 1ORFA 3TGKE 1L4DA 3BV9B 3TJNA 4ZKSU 1O2VA 2EI7A 1SB1H 1LHCH 1XUKA 3HPTB 1WCZA 3VB3A 3EGKH 1AB9C 1BRUP 1P2OA 4X1QU 3BTWE 4ASHA 4D7FA 3ATLA 1D3TB 1E37B 2VGCB 3SNDA 1AKSA 4I8KA 1O2TA 1GHWH 3ATMA 2BB4A 5C5OA 1G2MA 1GHBG 1OWIA 4FUCA 2Z94A 2BD5A 3P95A 3UTUH 2ZG0H 1RD3B 2VB0A 2LIZA 5E2OA 2ODYB 5ESTE 2Z3DA 3SNBA 4WXVA 1FUJA 3SJ9A 3CENA 1UTPA 1T31A 1YF4A 1O3NA 2BD8A 4FU8A 1Z1IA 1ABJH 1H9IE 4X2YA 2GV7A 3NWUA 4GCHG 2A2XH 2F83A 5C1UA 2TIOA 4XDEA 3T26A 1GDNA 1O2SA 3T25A 1NM6A 1TE0A 5F6MA 1GCDA 1PQ8A 1RIWB 5C3NA 5FPTA 3ZZ4A 3RXCA 5LGOA 3KHVA 1CA0C 4Y71A 4D7GA 1RJXB 4K1TA 1YPJH 1GMCG 1P11E 3RXSA 5JBTA 5CMXH 1TGTA 1BJUA 1XMNB 1AD8H 2B7DH 2ILNA 4IS5A 4H4FA 5FPSA 1SLVB 1N6XA 2J94A 3ZZ5A 1S85A 2Z3EA 5G4BA 4NFEA 1GI8B 1K28D 4Z0KA 2TRMA 1QQUA 3OY6U 3A86A 2VVCA 1C2FA 4OGXA 2Y5GA 2FI5E 3M5LA 4I8GA 2P95A 1AZ8A 3BEFB 4ZKNU 1F92A 2GZ8A 1W7XH 3QLPH 2Y7ZA 1UK3A 2GDDA 2TGAA 1HIAA 3A7XA 3EAJA 1V2MT 3RXOA 3SU6A 2GKVE 4YTAA 4X6NA 1TRYA 2ZPRA 3A8DA 4KTCA 2BDYA 3F9HA 1FLEE 3RDZA 1ZYOA 3LH3A 1MCVA 1XUJA 3FANA 2BD9A 3ZZ9A 4E7RG 1T4VH 2VWMA 1NFXA 2Z9JA 1Y3WA 3M5NA 4NIYA 3V0XA 3DHKH 4Z6AH 1THPB 2PLXA 4FUJA 3LGYA 1J8AA 2VVUA 2FLRH 5JPMH 3UUZA 3MH5A 3H7OA 1V2ST 2OBOA 1HV7A 3FP8E 2A7HA 3LC3A 1TNIA 1EP5A 2AIQA 4JZEH 3VB5A 3RUOA 2CMYA 1GCTC 2FYRA 1XUIA 1BBRK 1AQ7A 1CHGA 3U8TH 1GI3A 2BM2A 4NA9H 1A5HA 1C5RA 1WQVH 5GCHG 2PSYA 2HGTH 3ZVCA 5JB9S 2ZKSA 3LGUA 1V2JT 3K6YA 4A1TA 1ANCA 1UTLM 1L1NA 3K2UA 4X2XA 2NU1E 4Q2KA 2VINA 1GWAA 4IMZA 1KYNA 4FUDA 1ZMNA 1UTQA 3I77A 3B23B 4IN2A 2FI3E 2ASUB 1GMHG 1BZXE 3RC6A 2STBE 1QQ4A 1GJBB 1MU6B 4ABEA 1DITH 2ZPSA 1YLCA 1W0ZU 1HAGE 4B74A 5T6DA 5J4QA 2OTVA 4K69A 4I32A 2A32A 4AFQA 3RLYH 2UUYA 1ETSH 1D9IA 1DUEA 1Z8RA 2C8XB 3LH1A 3B9FH 3BN9A 3RU4D 3TJOA 4U2WA 1BTYA 2FPZA 2STAE 3LGIA 1QA0A 1Z1JA 4XBCA 1A5GH 5A8XA 2FLBH 3E16B 1NFUA 1P05A 2Q6DA 3TNSA 2CV3A 1MH0A 5DG6A 4I8LA 3RXRA 3EE0B 1LQDB 3ZV8A 3T29A 1W11U 3UR9A 2GMTC 1O5EH 1TB6H 5TCCA 1J16A 1DXPA 4VGCB 1HGTH 4U32A 3RXEA 1ELBA 1GHXH 6LPRA 2WPIS 1UTKA 3GISB 3GY4A 2H9HA 3E1XB 3MU4A 2SGDE 4NFFA 1AKSB 1HAVB 2V35A 4F4OC 1FPHH 1KLIH 1WTHD 3RXHA 2V0BA 1YPHC 1CT0E 2VGCC 4ZUHA 1GJ4H 2ZFTA 1C5OH 1SFQB 2TGTA 4AOQA 3A7YA 4NIXA 1BMAA 2GZ7A 3STIA 1TQ0B 1YM0A 3BTME 4ABHA 5GPIB 1YCPH 1BT7A 1N8OB 3W95A 5DP8A 7LPRA 4HFPB 2P93A 3I29A 4Y76A 3G01A 5DP4A 1RS0A 5HM2A 2Y5HA 5GJ4B 1IOEA 4Y8YA 1ZOMA 1RTKA 1SOZA 1XVMA 1JIRA 1S83A 2GCTC 5EQSA 3BTHE 1TRMA 3RMOH 4YT7H 5A2MH 1GJ6A 2WUBA 1DVAH 3UNRA 1ESAA 1PQ7A 2QAAA 1QRWA 2WPHS 1O3CA 3Q00A 5DGJA 4GLYA 3PMAB 4F49A 1CBWB 5B6OA 3ITIA 2QC2A 1SG8B 3MWIU 4AZ2B 1DPOA 2UWOA 3RP2A 1W2KH 1NRSH 2ZGJA 2FOGA 1WV7H 1O2ZA 2YNAA 4ISIH 2XBXA 2Z9GA 2GTBA 3A7ZA 1O2HA 1J9CH 4ISOA 3OYPA 1SLWB 3STJA 2ODQA 1HAIH 1MQ5A 6ESTA 2TPIZ 1Z8GA 5T6GA 2LNCA 4PROA 1GI0A 1W3CA 1ANDA 3LKWA 1RGQA 2PTNA 2A5KA 4K8BA 5J4SA 5E8EH 3BG4C 1A0HB 3NCLA 4MPXA 1DE7H 3KN2A 1KXBA 2D26C 2OCVB 2Z7FE 3GCTG 1V2OT 2ZP0H 1P04A 4IN1A 2FTLE 5K7RA 4YOJA 2J9NA 3LJJA 1P2JA 2J4IA 2BVRH 3VXEH 1P0SH 4NA8A 1QHRB 1YPKH 1EPTB 4DY7B 4NCYA 4AFZA 3ESTA 1OP2A 2BXTH 4ABDA 4AFSA 4BAMB 2R3UA 3RXGA 2ZHWH 4R0IA 1FDPA 2HWLB 2HVXA 1K21H 3ATWA 3BEIB 4CRGA 2G52A 1LTOA 1WSSH 5GDSH 2ZU1A 4DIIH 3LJOA 1XUGA 4DCDA 1MKWK 2GT7A 2WPLS 5L6NH 3DT0H 4BTTB 1QY6A 2V6NA 4B2BA 1DANH 3RXQA 1QJ1B 1C1TA 1SC8U 1V2VT 1A3EH 1GG6C 1ID5H 3NZIA 3PLKA 3FP7E 3ZZ3A 4K60A 1C1SA 1DY9A 1AN1E 1THRH 4XSKU 4CBNA 1GGDC 3EYDA 4GHQA 3A8AA 3GY6A 3RC5A 1FV9A 2EI6A 1SGYE 1YLDA 1WBGB 3TPIZ 3GOVB 3SU2A 3DUXH 3KQCA 1DWDH 2BOKA 3MH7A 2ZFSA 5LH8A 3LOXA 4AORA 2AGGX 2VWOA 3JZ2B 3TK5A 3BG4B 3Q3XA 1DS2E 4THNH 3UNQA 5GXPA 2PKSB 4X6MA 3GDVA 1GBLA 4AX9H 2B0FA 4ISLA 3F9EA 2ALPA 2ZU3A 4DOQA 1TAWA 1AZZA 1PJPA 1RFNA 3O8CA 2NU0E 3SN8A 1GMCF 2SGAA 1HAYB 1K1LA 1UVUH 1Z8JB 4Q7XA 6GCHG 1Z6EA 4ABFA 2A5IA 4WMDA 1T8OA 4A6LA 1QBOA 2FS8A 3M3SA 2ZTXA 1TX8A 3KCGH 5GIBA 4I33A 1FJSA 1ELVA 2ZCLP 2GP9B 1GL1A 2ZHEH 1K1PA 1MMJN 3T2NA 1C5VA 1TPPA 1AFQC 1ZR0A 3V13A 1O2RA 1W13U 4ABJA 1P2QA 1GI6A 1Y5BT 1B0EA 1OX1A 4FUEA 3SU1A 1INCA 4K3JA 2NU3E 3CS7A 4TWWA 4KTUA 4GAWA 5A0BA 4I8HA 3SUGA 2OQ5A 2OLGA 2AERH 1C5UA 2A45B 1LKBA 3BTDE 3RU4T 1KY9A 1VITH 1Y3YA 2GV6A 5PTPA 4MPVA 1C9PA 3ODDA 2BTCE 2G00A 1P09A 3IITA 1C4U2 2ZTZA 1KXFA 1Z7KA 2PR3A 4NA7A 3GDSA 2P94A 5C20A 1F5RA 3QGJA 4ABGA 1TMUH 1C5NH 1W7GH 5FPYA 3MO6A 1HDTH 1KXEA 1QJ7B 1VJAU 4CH2B 4UD9H 2AGIX 5HM9A 1O3DA 1YGCH 1CGIE 1OWJA 4MLFB 4Y10E 3ZVFA 2SGEE 4SGBE 4ZMAH 1MKXH 4YLUA 2H1UA 1O32A 4LOYH 3M3VA 2QN5T 1HBTH 1ABIH 1O5BB 2PFEA 1A2CH 1P03A 1ZJKA 4YM9A 1UVOA 4B76A 1GBCA 3GY2A 4BNRA 1P9SA 2ZC9H 1SLXB 3KNXA 1Z8IB 3O8DA 3PV4A 3BTTE 3N7OA 1AI8H 3EBNA 2RA3A 2HNTE 3H7TA 1ZPZA 3RC4A 2ZQ1A 2OUAA 2FOEA 1OOKB 5EOKA 1E34B 1MTNB 1FIZA 1TQ7B 1GDQA 3M5MA 2VU8E 1Y3UA 3I78A 3OY5U 2IOTA 3SBKA 3AVZA 1E38B 5CHAC 4Y8XA 1QCPA 3TH4H 3ODFA 4UFEH 1BRBE 1GVZA 5HYOA 4UONA 1C5QA 5EW1H 2P8OC 1GJCB 1C2DA 1JMOH 1RTFB 2F9PA 3C27B 1TX6A 2D2DA 1ARCA 3SHCH 2VH0A 1C5ZB 1GBEA 1HAVA 2ZZUH 4BAOB 2O8UA 3LIWA 4IC5A 2ANKH 2PWXA 3A7VA 3VGCC 1FY1A 3LGTA 5FX5A 2ZGXH 2W3KA 1EZXC 4FUFA 1F0UA 1EJAA 4MNYA 1O2YA 1C1QA 2PKAB 2SNWA 2VIPA 1K9OE 3URDA 1C1MA 1C1UH 3ZZDA 2FYQA 1CHOF 1WU1A 2ZHDA 2UWPA 4K1EA 5EXMA 4VGCC 4NWLA 2BDAA 4AGKA 1KXCA 1MKWH 1MU8B 2ZU5A 1SHHB 5C5NA 1ZTJA 3MH4A 1O36A 4DURA 2R2WU 3TGIE 5AF9H 1O2KA 4MDSA 4YLQH 1QURH 1V2UT 1TWXB 1GHAG 1IQFA 2KAIA 1O3LA 2H5CA 3TNTA 1QL8A 1ZTKA 7GCHG 4GPGA 4ZXYH 1OKXA 1GJ5H 3MHWU 2BD7A 1GCTB 3ZVDA 1N8OC 2ZEBA 3QTOH 1MQ6A 2FODA 3PO1B 1P9UA 1GBAA 1HXFH 1VCQA 1ZHMA 3MU1A 3R3GB 5JBAS 3ZZAA 5GWZA 3SGAE 1ZSKA 4FUBA 2XWAA 1TNGA 3UWIA 1D6RA 1XXFA 3U69H 4NIVA 1LQEA 2YNBA 3SZNA 3GCOA 3MOCA 3SUDA 1MBMA 1FZZA 4UE7H 3W94A 1TGCA 1PPBH 2BLQA 4DVAU 2ZU4A 1TYNA 1A7SA 1P06A 1ETTH 1LKAA 1HNEE 4O3TA 3HK6B 1LO6A 2EC9H 3SGQE 1KLTA 3P8GA 2XBVA 3RMMH 7KMEH 2XXLA 1TOMH 3OTJE 5AVDA 1UVTH 3GCNA 1O2LA 1G3EA 2FIRH 1UJ1A 2IPHA 2D8WA 2CGAA 1UK2A 1QTFA 2O9QA 1MBQA 4CRAA 1AMHA 2J2UA 1UCYH 3SU3A 2ANWA 1PPEE 1EXFA 4CR9A 2GD4B 1P3CA 1HIAB 3GY7A 4X0WU 5FHTA 2IJOB 1V6DA 3HGNA 1C5SA 1HLTH 1HAXB 3ZZ8A 1K22H 1HJAC 1K1OA 1EB1H 1QBNA 5JBCS 1ZSJA 2BY9X 4DG4A 3C1KA 3MU8A 5L2ZH 2UWLA 3Q77A 1EPTA 3MU0A 1O5CB 2OC0A 5DK1A 8GCHG 2QXJA 4TPYA 3TGJE 2HOBA 1VITG 1PYTC