4YOJA

Hku4 3clpro bound to non-covalent inhibitor 2a
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
molecule tags Hydrolase/hydrolase inhibitor
molecule keywords 3C-like proteinase
total genus 88
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yojA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yojA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yojA02
4Y8ZA 3LH1A 5DGJA 1BTPA 1QBNA 1G2LA 2R2MB 1X7AC 3E8LA 4LK4A 1XMNB 2SGEE 1NROH 1YP9A 2ZTZA 4B73A 2ESTE 3GDUA 1QTFA 1Y3UA 4U01A 1FIWA 3M3SA 1Q31A 4NCYA 1ARCA 5J4SA 3KHVA 3HATH 3MNCA 4AOQA 5DP3A 1SLWB 2GT7A 1O2JA 4E06H 4MNYA 4CRDA 3QZRA 4UONA 2PKSB 2QIQA 2P94A 3ODDA 4X8VH 3F9HA 3LPRA 1AGJA 4HTCH 1ZHMA 4INLA 1NRPH 3RC4A 3HKIB 4FUJA 1FNIA 1KLIH 3A87A 4X2WA 1BDAA 1LVOA 1IQEA 1OWJA 4UFDH 4VGCB 3TJOA 3U1IB 1RIWB 3KQBA 2GX4A 2XWBI 2EI7A 3OU0A 2GZ7A 3KGPA 1C1TA 1Z8RA 1MCVA 1V2QT 1PQ8A 3V3MA 3QO6A 4XBCA 3SW2B 1FY3A 5DPAA 3GYLB 2VU8E 3E91A 2FMJA 1W7XH 1IAUA 4DURA 1DWCH 1SOZA 3MMGA 4K8YA 1C1WH 4GCHG 5F03A 1BTHH 1GHAF 1GI1A 1NO9H 1O3MA 2B7DH 3ZZ7A 1Y3WA 3RXUA 1GVLA 1FLEE 3FP7E 1G9IE 1NRSH 2FPZA 1SHHB 1V2UT 3WY8A 1MZAA 1AU8A 3TGJE 1VITF 2Z9JA 2GP9B 2CF9H 2VWOA 1O3HA 3RMLH 3U8TH 3TU7H 4IW4E 3OSYA 2PGBB 1O3FA 3TNSA 2PV9B 4Q7YA 1TGCA 1AN1E 2GKVE 2ZDVH 2ZP0H 1LHDH 3C27B 4MG3A 1UO6A 3SU1A 2XBXA 1YC0A 4D76A 3M7TA 2FS9A 4WY3A 4X2VA 3SBKA 5J4QA 1P04A 4X1RU 3T26A 4WH6A 1YBWA 2A1DB 1ZTLA 3BEIB 1JRTA 3S69A 2FLBH 2J9NA 3GCTF 3STJA 3SGQE 1AHTH 4BNRA 2A7JA 1XXFA 2ALVA 1GVZA 2ZG0H 3VGCC 1GMDF 3A81A 3RXDA 3RXJA 2OBOA 5FBEA 1QA0A 1ELVA 2Y81A 5DP6A 3RU4E 1ZMLA 1S0RA 3STIA 4LOYH 1BJUA 1GDQA 1UMAH 1OWEA 1D6RA 1FIZA 3SU5A 3QGJA 3AVZA 9ESTA 5L2ZH 2J2UA 2A32A 5JBCS 4BAMB 1O3BA 3DFLA 2RA3A 1GG6C 2BZ6H 3KQCA 4YLQH 5AHGH 2A4GA 3UFAA 1C5SA 1GHYH 2Z3EA 5EW2H 3ZVBA 3RM0H 1LVYA 4BAOB 3DT0H 3BTME 1FDPA 2P3FH 1B0FA 2BD9A 4Q7XA 3MO6A 2VGCC 4MNWA 2CGAA 1XUHA 1SPJA 1T8OA 3O8RA 3HGPA 6CHAC 1C2MA 1UTMA 3ATWA 4A7IB 1ELAA 1DOJA 2ZF0H 4B75A 2OINA 3SV9A 1QBOA 2O8TA 3VB5A 1G3CA 1BTUA 1IHTH 3BTFE 4FU8A 4TWYA 5CE1A 1IQGA 1GI3A 1P0SH 1GHBF 3SUGA 2XRCA 2A45B 1ZSKA 1OSSA 1DICA 1S6FA 2O8MA 1QB9A 3BN9A 2JETB 2BOKA 2FOAA 4XFQA 4A5TS 3BEFB 1ZGVA 1ELCA 1OKXA 1YLDA 2QCYA 1NN6A 4XOJA 3KQEA 2Q1JA 5E8EH 2UWOA 1FY5A 1A7SA 5A8XA 3SV8A 1GJDB 1AFQB 4X0WU 1MKXH 3FAOA 1BMNH 2BQ6B 3M5MA 1J17T 5TCCA 4MQAA 2WYGA 3S9CA 2UUKB 2P16A 2IPHA 1HXEH 1P12E 1P06A 1C5VA 2FZZA 1C1VH 3RMNH 2SGPE 4DIHH 1BBRE 3DFJA 2XCFA 3SJIA 3PYHA 1FMGA 3VXFH 1GHWH 3SOSA 1XKAC 1TFXA 1SFIA 1SGDE 4IN2A 3ZVCA 5AVDA 1ZSLA 2K7XA 3NUMA 4OS2A 1EQ9A 1THSH 1TX7A 2XC0A 4SGBE 2H9HA 3SJ8A 3SHCH 3RXCA 2Q6GA 4Y8YA 4DG4A 2V0BA 3LOXA 1EAWA 3HKJB 3URDA 2ZA5A 1PFXC 5E0JA 4F4OC 1GJ6A 1K21H 3MNSA 3M37A 2PSXA 2VIDA 1TOMH 4JZEH 5EOKA 5HYOA 1RS0A 1D3TB 3D65E 1Q2WA 1EXFA 3O8BA 2V6NA 4RN6A 2GDDA 5JBAS 1BRAA 1RTLA 1TNGA 1KXBA 2ZCKP 4B2BA 1LVMA 1N6YA 1UVUH 1Z1IA 3SU2A 3RDZA 2AERH 2OUAA 1C5LH 2THFB 3PLKA 2F91A 1KLTA 1UTKA 3A8CA 3UWIA 1O2TA 2FOHA 1W3CA 2GMTB 1O5GH 2FLRH 4ZKNU 1P9SA 1LPGB 2Y5FA 3FANA 1T4UH 2I6SA 2ZHEH 3SN8A 3ZZAA 1GHAG 1NY22 1O3OA 1SOTA 4MTBA 4A92A 1Z71A 2J95A 2BQ7B 1WTGH 1HIAB 1A2CH 1PPGE 4Y7BA 2B5TB 3NZIA 4NSVA 1C5WB 1ELGA 3SJOA 3RXVA 4ABAA 7ESTE 2ANYA 2GT8A 1SGNE 3BTHE 1AD8H 4MPVA 2BY6X 2ZEBA 4A1TA 2QXJA 3NKKA 2WPIS 4MPWA 1GHBG 1M9UA 1ID5H 1DUAA 1T32A 3V12A 1W12U 3JZ2B 1O2VA 2BY5X 5T3HA 5GPIB 4ZHAA 4WMEA 2GVFA 2ZQ2A 3T62A 1IOEA 1DVAH 1GI4A 1LTOA 3SQHE 2GTBA 2PR3A 1QQ4A 2WV4A 2W7SA 1T31A 2B0FA 5LH8A 2SGQE 1SMFE 3F9FA 1C2FA 1UK2A 1C5TA 1NT1A 1BA8B 3ELAH 1UK3A 2BVSH 7KMEH 2F9OA 2ZFSA 1C2LA 3UR9A 2A4OA 1BJVA 3SGBE 3SGAE 1ANBA 2ALPA 4ABDA 1QCPA 2V3OH 1V2ST 1MKWH 4O03A 1E34B 1UK4A 1HGTH 1O0DH 2UUFB 5SGAE 1D9IA 4QT8C 4ISOA 2Z3DA 1TA2A 3L3TA 3Q00A 3A8DA 4UFFH 2UWPA 5IYTA 1GHZA 4U30A 3QTVH 4DGJA 4NFEA 4ABBA 1SC8U 3OX7U 2BDYA 1NFUA 1ZSJA 2FYQA 1GCDA 3OY6U 1E38B 2CHAC 1G32B 1QB6A 3GISB 4FUDA 4UD9H 3ZV8A 1Z8GA 1GJAB 4Y10E 1O2NA 1O2IA 1V3XA 1W0YH 1UHBB 4FXGH 3GDVA 1V2KT 1TNLA 3GCNA 3A86A 2B8OH 3LJJA 4CRCA 1Y8TA 4NFFA 1TMUH 4ISLA 3UOUA 3LGTA 1GWAA 3KL6A 4NZLA 2D26C 1SLVB 2EI6A 1B7XB 3PO1C 1YF4A 1GL0E 8LPRA 2W3IA 2OQUA 1F5LA 1OPHB 1DS2E 1MCTA 1Y3YA 1O35A 1AMHA 5JB8S 1MU6B 1AUJA 1KXCA 2TGAA 1VR1H 2C3SA 1ZRBA 4IC5A 2WPHS 2XC5A 1HAVA 1SL3A 1IQLA 1TBZH 4CBOA 1VZQH 2WINI 1O5DH 4K3JA 5GIBA 1A5HA 5LGOA 3UR6A 1V2TT 2PGQB 2PKAA 1P3EA 1C5XB 2ZHFH 1O3CA 3SJ9A 2GV7A 2WYJA 2PSYA 2ZU4A 1V2JT 2CF8H 2Y6TA 4DIIH 4AG1A 5JPMH 4H6TA 3A7YA 4TPYA 1NFXA 2GCHG 2FX6A 1PPFE 1YCPM 2VGCB 3KQDA 1BTYA 2FI5E 1ZTKA 5C5NA 3M5NA 5T6DA 1LKBA 2BM2A 1F7ZA 2AMQA 2XCNA 3GOVB 3O8DA 1UTPA 2JH0D 1A46H 1YGCH 1LMWB 1C1UH 3MOCA 1SQOA 5A8ZA 1GJ7B 4YZUA 1QJ6B 1MTSA 1O3KA 2OTVA 1O2LA 1TMBH 4ZKSU 1ABJH 4Y79A 1JOUB 2GZ8A 2VVUA 1V2WT 4R8TB 2A31A 2CN0H 2YNAA 4WVPE 1V2LT 1CT0E 1S0QA 4ESTE 3M35A 1BIOA 4JZFH 5T6GA 1F5KU 3TITA 1GCTC 1XVOA 1XVMA 5F8TA 3PV4A 2STBE 2Y7ZA 1K9OE 3UOPA 5JYIA 2SGAA 1EOLA 4Y7AA 3PMJA 5EQQA 2R3YA 3E0PB 3GICB 2VVCA 4DT7B 3BF6H 3ZZ8A 2ZTXA 2ZU3A 1UTJA 1P2IA 2C8WB 1DY8A 1CA0B 2VIQA 2C8ZB 4WH8A 1O2OA 2OC0A 1WQVH 1XUIA 1WYKA 4AX9H 1TX8A 3GY4A 2C93B 4H4FA 1ZMNA 1ZLRA 4BAHB 4FUBA 5GDSH 1O2KA 1P3CA 4DY7B 1GI8B 4B2AA 4D7GA 4F49A 1MKWK 3PM3A 1H9HE 4I8JA 3SV2H 1C5PA 3VB7A 4I8GA 3NCLA 2J92A 5GCHG 2G5VA 9LPRA 4Y76A 3RXOA 3F9EA 2ZECA 2BY8X 4IGDA 3AASA 2AGGX 2BXUH 5FCRA 3BTKE 3SO3A 3NXPA 3RMMH 3SUEA 3U98H 1VJAU 1E36B 4MPUA 2G81E 2PW8H 3GCTG 1YPGH 1THRH 2WUBA 3BIVH 2BDGA 4WJG2 1P8VC 1SLXB 1EX3A 4UDWH 1GBEA 5E2OA 1MD8A 3QWCH 5LPEA 4CHAB 3MH6A 1TMTH 4JK5A 1CT4E 1O2PA 2FOEA 3TH2H 1O5BB 2ZTYA 3UPEA 3K2UA 4BTTB 3MNBA 4O9VA 2FIRH 3IG6B 3NK8A 2FXRA 3ZVGA 1HIAA 1LO6A 1UTOA 2FYRA 4X1QU 1TOCB 1GBBA 1V6DA 1J14A 1GMHF 4JZ1A 2BDAA 1OX1A 2OC1A 2Y82A 5DO4H 1YPKH 3SV7A 1GJ8B 3P8NA 3F6UH 2EEKA 4FVDA 1O3PB 5L6NH 1YKTA 1D3DB 1P03A 3UNQA 5F6MA 2STAE 1L1JA 4YESB 7GCHF 2JKHA 1LDTT 1C2DA 1O5EH 4JZDH 2TBSA 4H6SB 1BTXA 1BTZA 1GG6B 5F8XA 1S84A 1ZHRA 1IQIA 3LGYA 3LU9B 3N7OA 2LNCA 1QL7A 1ETRH 1MTWA 1VGCB 5EU8A 3ZZ5A 1CE5A 3TLOA 1DY9A 3MTYA 1F0UA 1AZZA 1J16A 1QRXA 5DP9A 3IITA 3H7OA 2ZU1A 2PLXA 1MTNB 3QDZB 2ZGJA 1K1NA 3A89A 2A2QH 4BAQB 1PPZA 1P10A 3P70B 4THNH 3RP2A 3T25A 5TCAA 3SQEE 1QJ7B 1K1JA 2D2DA 2RG3A 1O5AB 3RC6A 3BTWE 2Z94A 1KXDA 2C8XB 5DK1A 1EZXC 3FFGA 1LQEA 2A2XH 2HALA 1DANH 4YM9A 1ZPBA 1F2SE 1SSXA 4YO9A 1W10U 1D6WA 3GY7A 1ELTA 1SQAA 1O30A 3PLPA 7GCHG 2ZPQA 2FO9A 2J38A 2QYIA 3UNSA 1Z8JB 3MHWU 3GCHB 3AW0A 1GBTA 3URCA 2BD2A 3EBNA 2EI8A 5AFZH 4GHTA 3A7VA 1U6QA 1Z6JH 1OP8A 1PQ5A 1UVSH 3JZ1B 5HXFA 2ZFFH 1C4Y2 2G8TA 3RU4D 5H4IB 3QZQA 1HJAB 1DITH 2ZKSA 4I32A 1ELDE 1ANCA 4IN1A 4O3UA 2F9NA 2ZHQH 3UIRA 4OS1A 1O2GH 2BD8A 2O9QA 3ZZBA 3F1SB 5LPRA 4K60A 4TYDA 1RTKA 1QGFA 1CT2E 3F68H 8GCHG 1TABE 3A7ZA 1CA0C 2FTLE 3A88A 2BD7A 3S9BA 1SBWA 3ODFA 4YLUA 3K6ZA 1UVPA 3PWBA 1L4DA 3E0NB 1ELFA 1N6XA 3SJKA 4OGXA 4YT7H 1YYY1 1NC6A 1INCA 4D8NA 1Y5BT 1PJPA 4XE4A 1C2JA 1GBAA 1DLEA 5HM9A 3FP6E 4I31A 3UQVA 1DX5M 1A61H 4M7GA 2HNTE 1KXAA 1ZHPA 3NPSA 1C1RA 2H9EH 1EB2A 1BRBE 1XUFA 1EAXA 3QN7A 3I78A 3LGUA 1XM1A 4K1EA 1EJNA 1MMJN 2SNVA 3AAUA 2IOTA 3GCHC 4TWWA 1QR3E 1LPKB 1L1GA 3PTNA 1O3EA 4Q7ZA 3EDXB 3PTBA 3M36A 5ABWA 4NA9H 4B74A 2A5AA 5EPYA 5EXNA 5CMXH 2NU1E 1HXFH 2H2ZA 4KTCA 2BLVA 3MI4A 1FV9A 3M3TA 4XDEA 1CO7E 4WMDA 2ZDAH 3P95A 2ZI2H 4GLYA 2G51A 4DVAU 2GDEH 2QXGA 2PFEA 4FVBA 1TGNA 2BD5A 2J4IA 3A7WA 3B23B 1AFEH 1SLUB 3RXQA 1TNIA 3PWCA 4WWYA 2H6MA 3DD2H 1CHOG 2A4RA 2OD3B 1ZTJA 2A0QB 3QTOH 1W0ZU 1A0LA 2ANWA 1C5ZB 1LHCH 1KDQA 1TB6H 4NIVA 3MU8A 3RXFA 2V3HH 3TNTA 3ESTA 1C5MD 4HI3A 3W94A 1KY9A 1OP0A 1AWFH 4ZUHA 2OC7A 1VJ9U 3R3GB 3RXMA 2ZFRH 1A3BH 1KLJH 1HAIH 1C1NA 1CBWC 3ZVFA 3TK6A 1DSTA 1S81A 3BTGE 1NRQH 3SNAA 3P92A 1S5SA 1MUEB 1OS8A 3IWMA 2BQWB 4GVUA 4CRFA 5EGMA 2Y5GA 3UNRA 3VB3A 3BTTE 1TAWA 2AS9A 2FOGA 1HAHH 3KIDU 1O3GA 1PPHE 5HM2A 1EUFA 4IS5A 5HGGA 1OYTH 2VWLA 1SHYA 2G4TA 1IQFA 2H5DA 3A80A 1GMCF 3GDSA 3SHAH 5JBBS 2ZDKA 1F0TA 2FESH 1UTLM 4U32A 1IQHA 4JYUH 1SQTA 4INHA 4GPGA 1C1MA 2OXSA 3T29A 1CVWH 2FODA 2BY9X 2ODYB 3SI3H 2FWWA 3UTUH 1G37A 4JYVH 3TK5A 1ZPCA 3PB1E 3EA7A 1GBCA 4WMFA 1AKSB 3MU0A 1OWKA 4TPIZ 3ATIA 1AUTC 1KXEA 1MTNC 2BMGB 5I25A 1DM4B 2A5KA 1HV7A 4ISIH 1TQ7B 3W95A 1C5UA 1TALA 2FOMB 5TJXA 3L33A 2R0LA 1GI7B 3S7HB 2LIZA 1EP6A 2GZ9A 3M7UA 3T28A 1W2KH 1VGCC 3BSQA 1GBMA 1CGJE 3H5CB 1HAVB 1GVKB 2Z9LA 3VXEH 1TGSZ 2OCVB 4Y71A 1GHXH 3PROA 4MPXA 1C2IA 1PPEE 1S85A 2AIPA 1O3AA 1V2RT 4AB8A 1L0ZA 4OGYA 3TH4H 4ABIA 3M61U 5LPFA 4CREA 3SU6A 5DP4A 1TBQH 3LGWA 3D49H 1JWTA 2TGTA 1FXYA 8GCHF 1C1OA 1PYTC 1BTWA 2ASUB 4CRGA 4WF8A 1BBRH 2O8UA 8ESTE 4IMQA 1HAOH 5EXMA 2D1JA 6ESTA 1O5CB 4ABFA 2CMYA 3RLWH 4I33A 1AFQC 1C2HA 4U2WA 1C9TA 2P8OC 3A7XA 4A1VA 1DWDH 1L1NA 2C90B 4BOHA 3SUFA 1C5YB 1HAYB 2C4FH 2VIVA 3H7TA 4ZKRU 3U1JB 1NRNH 4CBNA 4AG2A 4BXWA 1BMMH 1YPHE 4ABHA 1UCYK 2FDAA 1DPOA 1SGFA 2FI3E 3ZZ4A 1MBQA 3RXRA 5A09A 2Z9KA 4OS4A 1UVOA 1O2XA 1YCPH 2F9PA 2UUYA 2ZHWH 3U8RH 4BAKB 1H9IE 2WPMS 2ZU5A 1AB9C 4XBDA 3G01A 3PMBB 2G5NA 1XUJA 1TONA 2I6QA 2CHAB 1P11E 2GCHF 3NWUA 1Z1JA 1DXWA 1MH0A 1O38A 2AMDA 4H42U 1SR5C 2WPJS 1VCWA 3M3VA 3HGNA 4LZ1H 4J1YA 4JYTA 2ZDNA 1CHGA 2M5TA 4AORA 2H9TH 1SGPE 1ARBA 1UTNA 1O2RA 4CH8B 1C5NH 2VIOA 1SGCA 4GHQA 2BZAA 2BXTH 2ZU2A 1BMAA 2P59A 1F0SA 2FX4A 1ZJDA 3P8OA 3RXBA 4A6LA 1GHVH 4ZROA 2VWMA 1A5IA 4KTSA 1O39A 1BQYA 1IHSH 5FHTA 3ZZ3A 1HRTH 2HGTH 1WQSA 1A1RA 1K2I1 4NZQA 1HUTH 2ZCLP 1OYQA 2Z9IA 1AE5A 1ZOMA 1RFNA 3RXEA 1TGTA 4TY6A 3BTDE 3EA8A 1YM0A 2ZGBH 3BG4C 1P01A 2BY7X 1P2NA 3LJOA 1BBRK 5FX6A 1N1LA 5EPNA 3R0FA 4WXVA 4ZH8A 3RUOA 4NGAH 2PUQH 4NIXA 1G3BA 1LHFH 1TE0A 1S83A 1G3EA 5A2MH 2VH0A 1MZDA 1ETSH 1GJCB 5K7RA 1GBHA 4BTUB 1ESBA 2GCTB 1HLTH 1AI8H 1ANDA 1L2EA 3HK3B 1G30B 2XXLA 1O5FH 2BDIA 1DDJA 2NU2E 5E0GA 5E2PA 2VNTA 2F9VA 3GY5A 1VCQA 1W14U 5FPYA 2GGVB 4INKA 1SGTA 3MH7A 1D4PB 1GBKA 3U69H 4CRAA 3LGVA 3EQ0H 2P95A 3QLPH 2R3UA 2TIOA 4TY7A 1EOJA 1GBDA 2O8LA 1RRKA 1TLDA 1GJ9B 2FTMA 1K1IA 4X6PA 1NRRH 2OC8A 5EQRA 3KF2A 4ZKOU 2PUXB 5GJ4B 1HJ9A 4Y6DA 1YPMH 1TRMA 3HPTB 1ZR0A 5BPEA 3ITIA 3MWIU 4K5ZA 4D9RA 1WUNH 5G4BA 1TPSA 5I46H 3P6ZB 3CS7A 3ATMA 1EJAA 1FUJA 5AFYH 3RM2H 1C1PA 1BT7A 3V13A 1EAIA 1K1LA 3BG8A 3SZNA 1JMOH 1LPZB 2SNWA 1P2MA 1SFQB 2VIWA 1NU9A 3CS0A 3AW1A 2ZDLA 1O37A 2TPIZ 1Y5UT 5DP5A 1MQ6A 1O2SA 2A7HA 2YOLA 3A85A 1A0HB 1EJMA 1XUGA 1P2KA 2WPLS 1Y3VA 2KAIB 4AZ2B 4RSPA 1ACBE 2K1QA 1QURH 1SB1H 5FBIA 1F92A 1CQQA 3Q76A 4JZIA 5IDKA 2HVXA 5AF9H 1O2HA 1V2PT 3ZVAA 2QC2A 5C67A 4O97A 2ZGHA 1KXFA 1G36A 1W8BH 1TPAE 3GY3A 3SNDA 2JETC 1C5QA 2ZDMA 4XSKU 3M5LA 4JCNA 5FX5A 1JXPA 1SG8B 2Z6BD 2D8WA 4BXSA 1T4VH 1FZZA 2FI4E 4MNXA 3T2NA 2QGRA 5C5OA 2AYWA 1GMHG 3A82A 1LVBA 4Q80A 2SFAA 2O8WA 1FAXA 2BLQA 4K69A 1EB1H 1UCYE 3UQOA 1UTQA 2ZWLH 4NIWA 5ESTE 2GMTC 1AQ7A 4AFUA 4LZ4B 1FONA 4RKOB 2F3CE 3Q3KA 1Y3XA 3UWJH 3LC5A 3T27A 4ISHH 1L4ZA 1N8OC 1SI5H 3UREA 2Y80A 4ABGA 1VITH 5EW1H 1T8LA 3MYWA 1W7GH 2FEQH 1HBTH 1TRNA 2G55A 5ESBA 3TGKE 1XKBC 1RXPA 1GBFA 1S6HA 1GCTB 1D3QB 2ZFQH 3MO9A 2XNIA 7LPRA 1B0EA 5F8ZA 3QX5H 3Q77A 2CXVA 1A0JA 1WCZA 5FAHA 1HJ8A 5FPSA 3RLYH 1QRWA 1MAXA 1SGFG 1ELBA 1Z6EA 1SGEE 2WV5A 2H5CA 3ZYEA 1GJBB 1BUIA 2F9UA 3D23A 1ZMJA 2WUCA 4AN7A 1IQMA 4X1PU 1EATA 2BX3A 3TIUA 2XYAA 4LXBH 3RXKA 2PKSC 5GCHF 4HZHA 2HNTC 5FCKA 1HFDA 4DW2U 4CR5A 2Y7XA 2BTCE 4D7FA 2ULLA 3B9FH 2XWAA 4CH2B 4CHAC 1AE8H 3TPIZ 2FOFA 3OY5U 2AIQA 1GI2A 1T8MA 2PTNA 1BITA 3QK1A 1MD7A 1H8IH 3U8OH 1KDQB 1TRYA 3DHKH 5K0HA 1CBWB 2AEIH 2BHGA 3MFJA 4ISNA 1JIRA 4B76A 2Z9GA 3UY9A 1MQ5A 1EZUC 3PO1B 3RU4T 5DKMA 2PTCE 2R9PA 1UHBA 1Y5AT 2BLOA 2A5IA 4X6NA 1BCUH 4CR9A 4ZMAH 4K1TA 1CU1A 1ZJKA 1V2VT 2AGEX 1GI9B 5A8YA 1ABIH 3MH4A 1EP5A 1AVGH 3A83A 2QAAA 4FU7A 2WPKS 4UE7H 2SGDE 1ESAA 1V2NT 4NG9H 4AYVB 4X8SH 4X2XA 2BDHA 2BDBA 2Q6FA 2PKAB 1WOFA 4Z0KA 1O3NA 1CA8B 3BV9B 1V2MT 3CP7A 4E05H 2HPQH 2Z7FE 3SU4A 1GBJA 2ZPRA 1P2JA 3OTJE 5FXLA 1FN6A 4JK6A 2QN5T 1GI5A 3GY2A 1TA6A 1T8NA 1GBLA 1HYLA 1TWXB 2UWLA 1NFYA 2W7UA 4UFEH 1EKBB 1RGQA 3ZYDA 1KTSB 2G52A 3TH3H 1H1BA 2A4QA 2FS8A 1XX9A 1K28D 4CRBA 3RXIA 3P8FA 3TVJB 2P3TB 2HWLB 1BMLA 2AGIX 3KEEA 1PQAA 4KELA 3UUZA 4MVNA 1C1QA 4GUXA 4Q2KA 2RDLA 3Q3YA 3PMHB 1IQJA 1Q3XA 2NU3E 3PLBA 4FU9A 5CHAB 1P2OA 2QXIA 2VH6A 3QUMP 3S7KB 1HDTH 4GCHF 2XBVA 3SI4H 3FP8E 1Z7KA 2F83A 1O3JA 4A1XA 1OP2A 1TBRH 2Q6DA 3SV6A 2ZGXH 1HAGE 1E0FD 1HB0B 1JIMA 5DP8A 4ZHLU 2ZNKH 1H4WA 1QA7A 2ZQ1A 3RXSA 3FZZA 4KTUA 1WV7H 3S0NA 2XW9A 4ZXXH 3TGIE 4B1TA 1AZ8A 1P2QA 1QY6A 4ASHA 1FPHH 1F0RA 3D62A 4D9QA 3OYPA 4YT6H 4AFSA 2W5EA 3Q3XA 2BVRH 1NFWA 1O31A 3A84A 5BRRE 1P09A 1MTVA 3ZZCA 1UJ1A 4AB9A 1GPZA 1MAYA 1O33A 4YOJA 1SGRE 4NWLA 3RXGA 1W11U 1A3EH 1MTUA 1GDUA 1WU1A 4FUCA 1DXPA 3SU3A 1LHGH 2ZHDA 1O2WA 1P57B 1BHXF 1DWBH 2UUJB 4B71A 1SGYE 6CHAB 1QNJA 4SGAE 1O2UA 4XBBA 2ZO3H 1QQUA 1GGDC 1JRSA 2VJ1A 1PQ7A 2ZGCA 2EA3A 1EPTA 5PTPA 1GJ4H 4I8KA 4HGCA 3EGKH 4X6OA 1HAZB 1Z8IB 1O3DA 3MU1A 1BZXE 1DFPA 1PPCE 1K22H 4R0IA 1TNJA 1GMDG 1O34A 2QA9E 3TJUA 1NTPA 4DJZB 1H8DH 3KCGH 2OBQA 1QL8A 1MKXK 2OP9A 2BD3A 4BANB 2Y5HA 1EAUA 4Y8XA 2ZPSA 4JMYA 2BB4A 4IBLH 1C2EA 1GI0A 1TQ0B 1YLCA 4VGCC 1A5GH 1CGIE 3MU5A 1CGHA 1C2GA 1BRUP 3LC3A 4MNVA 1TNKA 2ILNA 1C5OH 2IJOB 2QY0B 6LPRA 1GMCG 2TRMA 2ANMH 1FAKH 2VWNA 3BG4B 2HRVA 1RJXB 4Z6AH 2AMPA 1NM6A 4X8UH 5T6FA 4FUFA 1AIXH 2P3UB 3ZZ9A 1AVWA 2DUCA 1QHRB 1ZYOA 1Y59T 1SGQE 3K6YA 1LHEH 1CSOE 4YOGA 1SVPA 2DE8A 2VVVA 1FI8A 1O36A 2JH5D 1AKSA 4ABEA 1YPJH 3E3TA 4DCDA 5A0AE 3GY6A 2FOBA 6GCHF 2VINA 1DE7H 3T5FH 4NA7A 3ATLA 2BLWA 4OS5A 4FUIA 4UFGH 4AGKA 4PROA 1TPPA 3BEUA 1K1PA 3PMAB 1DLKB 1ELEE 1JBUH 1O3IA 2P93A 2W26A 4HFPB 5DG6A 5JDUB 3CENA 1ETTH 1UCYH 1ZZZA 2F9BH 3KN2A 4FUEA 1C5RA 1BHXB 1WSSH 2QV1A 2IN2A 1QJ1B 4I8LA 5CHAC 4Y11E 1O32A 4MLFB 1DT2A 3EYDA 2BX4A 1YPLH 1ANEA 2P8OB 4X1SU 3S9AA 1MBMA 2QXHA 2OQ5A 1XXDA 2FP7B 1TPOA 3EAJA 2LPRA 3DA9B 3I29A 1VCPA 1KSNA 4IC6A 4K1SA 5B6OA 3A7TA 1ESTA 4NWKA 4YTAA 4Y0ZE 1THPB 4GAWA 1QIXB 1FY8E 2H1UA 1HPGA 3LIWA 1N8OB 3SNCA 4NSYA 1J8AA 2G00A 2R0KA 1O3LA 4WXIA 1BB0B 3HK6B 4K8BA 3RXLA 4YOIA 3LH3A 2G4UA 3LDXH 2ZIQH 2ANKH 1NPMA 1LCYA 1EPTB 4NA8A 2V35A 3MO3A 1RD3B 1ZRKA 3SORA 2YNBA 2SGFE 5L30H 1DSUA 1HJAC 2RCEA 5DJ7A 1BRCE 2HPPH 3P17H 3VPKA 1GJ5H 3V7TA 2A7CA 4ZXYH 4AFZA 3DUXH 4X8TH 2J94A 3RMOH 1O2MA 3E90B 2NU0E 4ABJA 5E0HA 2JH6D 3VGCB 3TK9A 3LGIA 1GGDB 5GXPA 1GL1A 4J2YB 1FQ3A 2DE9A 1WTHD 2BDCA 5EXLA 4UEHH 2BOHB 3BTEE 2TGDA 1V2OT 5GWZA 2GV6A 4OS6A 1J15A 4RKJB 4DOQA 4IMZA 1K1OA 2PWXA 4Y0YE 3LKWA 4AFQA 3E16B 1GDNA 5C1YA 1QRZA 3V0XA 3ZV9A 2VIPA 3BIUH 4I7YH 1E35B 3FVFB 3GY8A 2ZFPH 3ATKA 1C1SA 2C8YB 1BOQA 1HAPH 5HMAA 1OXGA 1F5RA 1FN8A 1W13U 5C1UA 2Z3CA 1D3PB 4GSOA 1KYNA 2HNTF 1QB1A 2NU4E 5JBTA 1E37B 3LONA 1PYTD 2KAIA 1KIGH 1UVTH 4O3TA 4X2YA 2NWNA 3RC5A 3GCOA 3SNBA 1ZGIA 4FUGA 5FPTA 1O2ZA 2ODQA 3M5OA 4AYYB 1P05A 5EODA 1HCGA 5C3NA 1PPBH 2BVXH 3SNEA 3E6PH 2ZZUH 3AAVA 4NIYA 3RXTA 4KKDA 1GBIA 1DWEH 1TGBA 1C4U2 2PHBA 1TX6A 8KME2 2XBWA 1QBVH 1TNHA 1FPCH 1RIWC 2TGPZ 2GD4B 1FY4A 2R2WU 3B8JA 2BD4A 1QFKH 3VB6A 1WBGB 4E7RG 2XBYA 1H9LB 2XTTB 2GCTC 4K2YA 5C1XA 3EE0B 4MDSA 2OLGA 3A8AA 2ZCHP 3P8GA 1KTTB 5C2ZA 1C2KA 2VB0A 2B9LA 1ZPZA 1LQDB 3L6PA 3ZZ6A 4I8HA 2J34A 2RA0A 2ZC9H 3RXPA 3KNXA 3BTQE 5L2YH 3O8CA 3GYMA 2HLCA 1T7CA 2CJIA 1NU7B 6GCHG 4KP0A 4ZAEA 1VITG 4KGAA 1MU8B 1NESE 3A8BA 5DP7A 1EZQA 2W3KA 3U9AH 1OWHA 1GI6A 1NS3A 1C4V2 1OWDA 1G3DA 1XUKA 1EASA 1OWIA 3SU0A 1A4WH 4E7NA 1IQNA 1YPHC 2FOCA 1C9PA 1TYNA 5ETXA 3MU4A 1EPTC 5EG4A 1G2MA 2AH4X 2HOBA 3SUDA 5C20A 3RXAA 3ZZDA 3QGNB 4AGJA 1HNEE 1ORFA 1RTFB 2BYAX 1OOKB 4FUHA 4X1NU 5EQSA 5A0BA 1LKAA 1FY1A 1S82A 2CV3A 3C1KA 3LT3A 3TJNA 1CHOF 4ZHMU 3K9XB 3MNXA 1FJSA 1B5GH 3EA9A 5A0CA 1AWHB 3VEQB 3MH5A 3ZVDA 1EZSC 3E1XB 1P9UA 2QF3A 2ODPA 2FM2A 1SGIB 3VB4A 2ZFTA 4X6MA 1P02A 1NZQH 1YPEH 1AB9B 2AFQB 2XC4A 3ZVEA 2QF0A 1O2YA 1DUEA 3ENSB 4OS7A 1QL9A 3VFEA 1AY6H 1K1MA 3RXHA 3TJVA 1J9CH 1IQKA 1WAYB 4B2CA 3K65B 1AO5A 4BTIB 3F9GA 5JB9S 1AVXA 1O2QA 3I77A 3M7QA 3FZDA 1HAXB 1YCPK 1TIOA 2EC9H
chains in the Genus database with same CATH superfamily
4Y8ZA 3LH1A 5DGJA 1BTPA 2EQNA 1QBNA 1G2LA 2R2MB 1X7AC 3E8LA 4LK4A 1XMNB 2SGEE 1NROH 1YP9A 2ZTZA 4B73A 2ESTE 3GDUA 1QTFA 1Y3UA 4U01A 1FIWA 3M3SA 1Q31A 4NCYA 1ARCA 5J4SA 3KHVA 3HATH 3MNCA 4AOQA 5DP3A 1SLWB 2GT7A 1O2JA 4E06H 4MNYA 4CRDA 3QZRA 4UONA 2PKSB 2QIQA 2P94A 3ODDA 4X8VH 3F9HA 3LPRA 1AGJA 4HTCH 1ZHMA 4INLA 1NRPH 3RC4A 3HKIB 4FUJA 1FNIA 1KLIH 3A87A 4X2WA 1BDAA 1LVOA 1IQEA 1OWJA 4UFDH 4VGCB 3TJOA 3U1IB 1RIWB 3FKSD 3KQBA 2GX4A 2XWBI 2EI7A 3OU0A 2GZ7A 3KGPA 1C1TA 1Z8RA 1MCVA 3UAIC 1V2QT 1PQ8A 3V3MA 3QO6A 4XBCA 3SW2B 1FY3A 5DPAA 3GYLB 2VU8E 3E91A 2FMJA 1W7XH 1IAUA 4I86A 4DURA 1DWCH 1SOZA 3MMGA 4K8YA 1C1WH 4GCHG 5F03A 1BTHH 1GHAF 1GI1A 1NO9H 1O3MA 2B7DH 3ZZ7A 1Y3WA 3RXUA 1GVLA 1FLEE 3FP7E 1G9IE 1NRSH 2FPZA 1SHHB 1V2UT 3WY8A 1MZAA 1AU8A 3TGJE 1VITF 2Z9JA 2GP9B 2CF9H 2VWOA 5CHBA 1O3HA 3RMLH 3U8TH 3TU7H 4IW4E 3OSYA 2PGBB 1O3FA 3TNSA 2PV9B 4Q7YA 1TGCA 1AN1E 2GKVE 2ZDVH 2ZP0H 1LHDH 3C27B 3WWFA 4MG3A 5DSFA 1UO6A 3SU1A 2XBXA 1YC0A 4D76A 3M7TA 2FS9A 4WY3A 4X2VA 3SBKA 5J4QA 1P04A 4X1RU 3T26A 4WH6A 1YBWA 2A1DB 1ZTLA 3BEIB 1JRTA 1WDIA 3S69A 1KMHB 2FLBH 2J9NA 3GCTF 3STJA 3SGQE 1AHTH 4BNRA 2A7JA 1XXFA 3WWBA 2KM0A 2ALVA 1GVZA 2ZG0H 3VGCC 1GMDF 3A81A 3RXDA 3RXJA 2OBOA 5FBEA 1QA0A 1ELVA 2Y81A 5DP6A 3RU4E 1ZMLA 1S0RA 3STIA 4LOYH 1BJUA 1GDQA 1UMAH 1OWEA 1D6RA 1FIZA 3SU5A 3QGJA 3AVZA 9ESTA 5L2ZH 2J2UA 2A32A 5JBCS 5EIYA 4BAMB 1O3BA 3DFLA 2RA3A 1GG6C 2BZ6H 3KQCA 4YLQH 5AHGH 2A4GA 2W6JD 3UFAA 1C5SA 1GHYH 2Z3EA 5EW2H 3ZVBA 3RM0H 1LVYA 4BAOB 3DT0H 3BTME 1FDPA 2P3FH 1B0FA 2BD9A 4Q7XA 1COWD 3MO6A 2VGCC 4MNWA 2CGAA 1XUHA 1SPJA 1T8OA 3O8RA 3HGPA 6CHAC 1C2MA 1UTMA 3ATWA 4A7IB 1ELAA 4DT4A 1DOJA 2ZF0H 4B75A 2OINA 3SV9A 1QBOA 2O8TA 3VB5A 1G3CA 1BTUA 1IHTH 3BTFE 4FU8A 4TWYA 5CE1A 1IQGA 1GI3A 3H09A 1P0SH 1GHBF 2KCOA 3SUGA 2XRCA 2A45B 1ZSKA 1OSSA 1DICA 1S6FA 2O8MA 1QB9A 3BN9A 2JJ2D 2JETB 2BOKA 2FOAA 4XFQA 4A5TS 3BEFB 1ZGVA 1ELCA 1OKXA 1YLDA 2QCYA 1NN6A 4XOJA 3KQEA 2Q1JA 5E8EH 2UWOA 1FY5A 1A7SA 5A8XA 3SV8A 1GJDB 1AFQB 4X0WU 1MKXH 3FAOA 1BMNH 2BQ6B 3M5MA 1J17T 5TCCA 4MQAA 2WYGA 3S9CA 2UUKB 2P16A 2IPHA 1HXEH 1P12E 1P06A 1C5VA 2FZZA 1C1VH 3RMNH 2SGPE 4DIHH 1BBRE 3DFJA 2XCFA 3SJIA 3PYHA 1FMGA 3VXFH 1GHWH 3SOSA 1EFRD 1XKAC 1TFXA 1SFIA 1SGDE 4IN2A 3ZVCA 5AVDA 1ZSLA 2K7XA 3NUMA 4OS2A 1EQ9A 1THSH 4RT1A 1TX7A 2XC0A 4SGBE 2H9HA 3SJ8A 3SHCH 3RXCA 4P00A 2Q6GA 4Y8YA 4DG4A 1WXRA 2V0BA 3FOAA 3LOXA 1EAWA 3HKJB 3URDA 2ZA5A 1PFXC 5E0JA 4F4OC 1GJ6A 1K21H 3MNSA 3M37A 2PSXA 2VIDA 1TOMH 4JZEH 5EOKA 5HYOA 1RS0A 1D3TB 3D65E 1Q2WA 1EXFA 3O8BA 2V6NA 4RN6A 2GDDA 5JBAS 1BRAA 1RTLA 1TNGA 1KXBA 2ZCKP 4B2BA 1LVMA 1N6YA 2QF5A 1UVUH 1Z1IA 3SU2A 3RDZA 2AERH 5C0UA 2OUAA 1C5LH 2THFB 3PLKA 2F91A 1KLTA 1UTKA 2WV9A 3A8CA 3KYGA 3UWIA 1O2TA 2FOHA 1W3CA 2GMTB 1O5GH 2FLRH 4ZKNU 2J98B 1P9SA 1LPGB 2Y5FA 3FANA 3OEHD 1T4UH 2I6SA 2ZHEH 3SN8A 3ZZAA 1GHAG 1NY22 1O3OA 1SOTA 4MTBA 4A92A 1Z71A 2J95A 2BQ7B 1WTGH 1HIAB 1A2CH 1PPGE 4Y7BA 2B5TB 3NZIA 4NSVA 1C5WB 1ELGA 3SJOA 3RXVA 4ABAA 7ESTE 2ANYA 2GT8A 1SGNE 3BTHE 2IPQX 2JIZD 1AD8H 4MPVA 2BY6X 2ZEBA 2OK5A 4A1TA 2QXJA 3NKKA 2WPIS 2W6ID 1GHBG 1M9UA 4MPWA 1ID5H 1DUAA 1T32A 3V12A 1W12U 3JZ2B 1O2VA 2BY5X 5T3HA 2KZ4A 5GPIB 4ZHAA 4WMEA 2GVFA 2ZQ2A 3DSPA 3T62A 1IOEA 1DVAH 1GI4A 1LTOA 3SQHE 2GTBA 2PR3A 1QQ4A 2WV4A 2W7SA 1T31A 2B0FA 5LH8A 2SGQE 1SMFE 3F9FA 4FETA 1C2FA 1UK2A 1C5TA 1NT1A 1BA8B 3ELAH 1UK3A 2BVSH 7KMEH 2F9OA 2ZFSA 1C2LA 3UR9A 2A4OA 1BJVA 3SGBE 3SGAE 1ANBA 2ALPA 4ABDA 1QCPA 2V3OH 1V2ST 1MKWH 4O03A 1E34B 1UK4A 1HGTH 1O0DH 2UUFB 5SGAE 1D9IA 2WSSD 4QT8C 4ISOA 2Z3DA 1TA2A 3L3TA 3Q00A 3A8DA 4UFFH 2UWPA 5IYTA 1GHZA 4U30A 3QTVH 4DGJA 4NFEA 4ABBA 1SC8U 3OX7U 2BDYA 1NFUA 1ZSJA 2FYQA 1GCDA 3OY6U 1E38B 2CHAC 1G32B 1QB6A 3GISB 4FUDA 4UD9H 3ZV8A 1Z8GA 1GJAB 4Y10E 1O2NA 1O2IA 1V3XA 1W0YH 1UHBB 4FXGH 3GDVA 1V2KT 1TNLA 3GCNA 3A86A 2B8OH 3LJJA 4CRCA 1Y8TA 4NFFA 1TMUH 4ISLA 3UOUA 3LGTA 1GWAA 3F3BA 3KL6A 4NZLA 2D26C 1SLVB 2EI6A 1B7XB 3PO1C 1YF4A 1GL0E 8LPRA 2W3IA 2OQUA 1F5LA 1OPHB 1DS2E 1MCTA 1Y3YA 1O35A 1AMHA 5JB8S 1MU6B 1AUJA 1KXCA 2TGAA 1VR1H 2C3SA 1ZRBA 4IC5A 2WPHS 2XC5A 1HAVA 1SL3A 1IQLA 1TBZH 4CBOA 1VZQH 2WINI 1O5DH 5B6LA 4K3JA 5GIBA 1A5HA 5LGOA 3UR6A 1V2TT 2PGQB 2PKAA 1P3EA 1C5XB 2ZHFH 1O3CA 3SJ9A 2GV7A 2WYJA 2PSYA 2ZU4A 1V2JT 2CF8H 2Y6TA 4DIIH 4AG1A 5JPMH 4H6TA 3A7YA 4TPYA 1FX0B 1NFXA 2GCHG 2FX6A 1PPFE 1YCPM 2VGCB 3KQDA 1BTYA 2FI5E 1ZTKA 5C5NA 4TT3D 3M5NA 5T6DA 1MABB 1QZ8A 1LKBA 1S6LA 2BM2A 1F7ZA 2EY4C 2AMQA 2XCNA 3GOVB 3O8DA 1UTPA 2JH0D 1A46H 1YGCH 1LMWB 1C1UH 3MOCA 3SYJA 1SQOA 5A8ZA 1GJ7B 4YZUA 5HKKD 1QJ6B 1MTSA 1O3KA 5C94A 2OTVA 1O2LA 1TMBH 4ZKSU 1ABJH 4Y79A 1JOUB 2GZ8A 2VVUA 1V2WT 4R8TB 2A31A 2CN0H 2YNAA 4WVPE 1V2LT 1CT0E 1S0QA 4ESTE 3M35A 1BIOA 4JZFH 5T6GA 1F5KU 3TITA 1GCTC 1XVOA 1XVMA 5F8TA 2LELA 3PV4A 2STBE 2Y7ZA 1K9OE 3UOPA 5T1VA 5JYIA 2SGAA 1K0HA 1EOLA 4Y7AA 3PMJA 5EQQA 2R3YA 3E0PB 3GICB 2VVCA 4DT7B 3BF6H 3ZZ8A 2ZTXA 2ZU3A 1UTJA 1P2IA 2C8WB 1DY8A 1CA0B 2VIQA 2C8ZB 4WH8A 1O2OA 2OC0A 1WQVH 1XUIA 1WYKA 4AX9H 1TX8A 2WZQA 3GY4A 2C93B 4H4FA 1ZMNA 1ZLRA 4BAHB 4FUBA 5GDSH 1O2KA 1P3CA 4DY7B 1GI8B 4B2AA 4D7GA 4F49A 1MKWK 3PM3A 1H9HE 4I8JA 3SV2H 1C5PA 3VB7A 4I8GA 3NCLA 2J92A 5GCHG 2G5VA 9LPRA 4Y76A 3RXOA 3F9EA 2ZECA 2BY8X 4IGDA 3AASA 2AGGX 2BXUH 5FCRA 3BTKE 3SO3A 3NXPA 3RMMH 3SUEA 3U98H 1VJAU 1E36B 4MPUA 2G81E 2PW8H 3GCTG 1YPGH 1THRH 2WUBA 3BIVH 2BDGA 4WJG2 1P8VC 1SLXB 1EX3A 4UDWH 1GBEA 5E2OA 1MD8A 3QWCH 5LPEA 4CHAB 3MH6A 2J98A 1TMTH 4JK5A 1CT4E 1O2PA 2FOEA 3TH2H 1O5BB 2ZTYA 3UPEA 3K2UA 4BTTB 3MNBA 4O9VA 2FIRH 3KYFA 3IG6B 3NK8A 2FXRA 3ZVGA 1HIAA 1LO6A 1UTOA 2FYRA 4X1QU 1TOCB 1GBBA 1V6DA 1J14A 1GMHF 4JZ1A 2BDAA 1OX1A 2OC1A 2Y82A 5DO4H 1YPKH 3SV7A 1GJ8B 3P8NA 2JJ1D 3F6UH 2EEKA 4FVDA 1O3PB 5L6NH 1YKTA 1D3DB 1P03A 3UNQA 5F6MA 2STAE 1L1JA 3PRBA 4YESB 7GCHF 2JKHA 1LDTT 1C2DA 1O5EH 4JZDH 2TBSA 1NBME 4H6SB 1BTXA 1BTZA 1GG6B 5F8XA 1S84A 1ZHRA 1IQIA 3LGYA 3LU9B 3N7OA 2LNCA 1QL7A 1ETRH 1MTWA 1VGCB 5EU8A 3ZZ5A 3N7EA 1CE5A 3TLOA 1DY9A 3MTYA 1F0UA 1AZZA 1J16A 1QRXA 5DP9A 3IITA 3H7OA 2ZU1A 2PLXA 1MTNB 3QDZB 2ZGJA 1K1NA 3A89A 2A2QH 4BAQB 1PPZA 1P10A 3P70B 4THNH 3RP2A 3T25A 5TCAA 3SQEE 4F55A 2KR7A 1QJ7B 1K1JA 2D2DA 2RG3A 1O5AB 3RC6A 1H8ED 3BTWE 2Z94A 1KXDA 2C8XB 5DK1A 1EZXC 3FFGA 1LQEA 2A2XH 3FO8D 2HALA 1DANH 4YM9A 1ZPBA 1F2SE 1SSXA 4YO9A 1W10U 1D6WA 3GY7A 1ELTA 1SQAA 1O30A 3PLPA 7GCHG 2ZPQA 2FO9A 2J38A 2QYIA 3UNSA 1Z8JB 3MHWU 3GCHB 2YMSB 3AW0A 1GBTA 2KCPA 3URCA 2BD2A 3EBNA 2EI8A 5AFZH 4GHTA 3A7VA 1U6QA 1Z6JH 1OP8A 1PQ5A 1UVSH 3JZ1B 5HXFA 2ZFFH 1C4Y2 2G8TA 3RU4D 5H4IB 3QZQA 1HJAB 1DITH 2ZKSA 4RI0A 4I32A 1ELDE 2L74A 1ANCA 4IN1A 4O3UA 2F9NA 2ZHQH 3UIRA 4OS1A 1O2GH 2BD8A 2O9QA 3ZZBA 3F1SB 5LPRA 4K60A 4TYDA 5KEDA 1RTKA 1QGFA 1CT2E 3F68H 8GCHG 1TABE 3A7ZA 1CA0C 2FTLE 3A88A 2BD7A 3S9BA 1SBWA 2AHME 3ODFA 4YLUA 3K6ZA 1UVPA 3PWBA 1L4DA 3E0NB 1ELFA 1N6XA 3SJKA 4OGXA 4YT7H 1YYY1 1NC6A 1W0KD 2JDID 1INCA 4D8NA 1Y5BT 1PJPA 4XE4A 1C2JA 1GBAA 1DLEA 5HM9A 3FP6E 4I31A 3UQVA 1DX5M 1A61H 4M7GA 2HNTE 1KXAA 1ZHPA 3NPSA 2XOKD 1C1RA 2H9EH 1EB2A 1BRBE 1XUFA 1EAXA 3QN7A 3I78A 3LGUA 1XM1A 4K1EA 1EJNA 3MQKC 1MMJN 2SNVA 1BMFD 3AAUA 2IOTA 3GCHC 2CK3D 4TWWA 1QR3E 1LPKB 1L1GA 1SQRA 3PTNA 1O3EA 4Q7ZA 4F48B 3EDXB 3PTBA 3M36A 5ABWA 4NA9H 4B74A 2A5AA 5EPYA 5EXNA 5CMXH 2NU1E 1HXFH 2H2ZA 4KTCA 2BLVA 3MI4A 1FV9A 3M3TA 4XDEA 1CO7E 4WMDA 2ZDAH 3P95A 2ZI2H 4GLYA 2G51A 4DVAU 2GDEH 2QXGA 2PFEA 4FVBA 1TGNA 2BD5A 2J4IA 3A7WA 1OHHD 3B23B 1AFEH 1SLUB 3SZEA 3RXQA 1TNIA 3PWCA 4WWYA 2H6MA 3PV5A 3DD2H 1CHOG 2A4RA 2OD3B 1ZTJA 2A0QB 3QTOH 1W0ZU 2LP6A 1A0LA 2ANWA 1C5ZB 1LHCH 1KDQA 3N99A 1TB6H 3F2GA 4NIVA 3MU8A 3RXFA 2V3HH 3TNTA 3ESTA 1C5MD 4HI3A 3W94A 1KY9A 1OP0A 1AWFH 1W0JD 4ZUHA 2OC7A 1VJ9U 3R3GB 3RXMA 2ZFRH 1A3BH 1KLJH 1HAIH 3KQ5A 1C1NA 3NRLA 1CBWC 3ZVFA 3TK6A 1DSTA 1S81A 3BTGE 1NRQH 3SNAA 3P92A 1S5SA 1MUEB 1OS8A 3IWMA 2BQWB 4GVUA 4CRFA 5EGMA 2Y5GA 3UNRA 3VB3A 3BTTE 1TAWA 2AS9A 2FOGA 1HAHH 3KIDU 1O3GA 1PPHE 5HM2A 1EUFA 4IS5A 5HGGA 1OYTH 2VWLA 1SHYA 3DSGA 2G4TA 1IQFA 2H5DA 3A80A 1GMCF 3GDSA 3SHAH 5JBBS 2V7QD 2ZDKA 1F0TA 2FESH 1UTLM 4U32A 5GNDA 1IQHA 4JYUH 1SQTA 4INHA 4GPGA 1C1MA 2OXSA 3T29A 1CVWH 2FODA 2BY9X 2ODYB 3SI3H 2FWWA 3UTUH 1G37A 4JYVH 3TK5A 1ZPCA 3PB1E 3EA7A 1GBCA 4WMFA 1AKSB 3MU0A 1OWKA 4TPIZ 3PV2A 3ATIA 1AUTC 1KXEA 1MTNC 2BMGB 5I25A 1DM4B 2A5KA 1HV7A 4ISIH 1TQ7B 3W95A 1C5UA 1TALA 2FOMB 5TJXA 3L33A 2R0LA 1GI7B 3S7HB 2LIZA 1EP6A 2GZ9A 3M7UA 3T28A 1W2KH 1VGCC 3BSQA 1GBMA 1CGJE 3H5CB 1HAVB 1GVKB 2Z9LA 3VXEH 1TGSZ 2OCVB 4Y71A 1GHXH 3PROA 4MPXA 1C2IA 2VBCA 1PPEE 1S85A 2AIPA 1O3AA 1V2RT 4AB8A 1L0ZA 4OGYA 3TH4H 4ABIA 3M61U 5LPFA 4CREA 3SU6A 5DP4A 1TBQH 3LGWA 3D49H 1JWTA 2TGTA 1FXYA 8GCHF 1C1OA 1PYTC 1BTWA 2ASUB 4CRGA 4WF8A 1BBRH 2O8UA 8ESTE 4IMQA 3ZIAD 1HAOH 5EXMA 2D1JA 3DSOA 6ESTA 1O5CB 4ABFA 2CMYA 3RLWH 4I33A 1AFQC 1C2HA 4U2WA 1C9TA 2P8OC 3A7XA 4A1VA 1YLNA 5C17A 1VKYA 1DWDH 1L1NA 2C90B 3EE7A 4BOHA 3FN8A 3SUFA 1C5YB 1HAYB 2C4FH 2VIVA 3H7TA 4ZKRU 3U1JB 1NRNH 4CBNA 4AG2A 4BXWA 1BMMH 1YPHE 4ABHA 1UCYK 4ZCNA 2FDAA 1DPOA 1SGFA 2FI3E 3ZZ4A 1MBQA 3RXRA 5A09A 2Z9KA 4OS4A 1UVOA 2PP6A 1O2XA 1YCPH 2F9PA 2UUYA 2ZHWH 3U8RH 4BAKB 1H9IE 2WPMS 2ZU5A 1AB9C 4XBDA 3G01A 3PMBB 2G5NA 1XUJA 1TONA 2I6QA 2CHAB 1P11E 2GCHF 1E79D 1Z1JA 2QF4A 3NWUA 1DXWA 1MH0A 1O38A 5HIYA 2KCAA 2AMDA 3F0OA 4H42U 1SR5C 2WPJS 1VCWA 3M3VA 3HGNA 4LZ1H 4J1YA 4JYTA 2ZDNA 1CHGA 2M5TA 4AORA 2H9TH 1SGPE 1ARBA 1UTNA 1O2RA 4CH8B 1C5NH 2J97A 2VIOA 1SGCA 4GHQA 2BZAA 2BXTH 2ZU2A 1BMAA 2KFWA 2P59A 1F0SA 2FX4A 1ZJDA 3P8OA 3RXBA 4A6LA 4B6FA 1GHVH 4ZROA 2VWMA 1A5IA 4KTSA 1O39A 1BQYA 1IHSH 5FHTA 3ZZ3A 1HRTH 2HGTH 5HIZA 1WQSA 1A1RA 1K2I1 4NZQA 1HUTH 2ZCLP 1OYQA 2Z9IA 1AE5A 1ZOMA 1RFNA 3RXEA 5EJZA 1TGTA 4TY6A 2HVYB 3BTDE 3EA8A 1YM0A 2ZGBH 3BG4C 1P01A 1E1RD 2BY7X 1P2NA 3LJOA 1BBRK 5FX6A 1N1LA 5EPNA 3R0FA 4WXVA 4ZH8A 3RUOA 4NGAH 2PUQH 4NIXA 1G3BA 1LHFH 3OFND 1TE0A 1S83A 1G3EA 3N7DA 5A2MH 2VH0A 1MZDA 1ETSH 1GJCB 5K7RA 1GBHA 4BTUB 1ESBA 2GCTB 1HLTH 1AI8H 1ANDA 1L2EA 3HK3B 1G30B 2V3MA 2XXLA 1O5FH 2BDIA 1DDJA 2NU2E 5E0GA 5E2PA 2VNTA 2F9VA 3GY5A 1VCQA 1W14U 5FPYA 2GGVB 4INKA 1SGTA 3MH7A 3GS9A 1D4PB 1GBKA 3U69H 4CRAA 3LGVA 3EQ0H 2P95A 3QLPH 2R3UA 2TIOA 4TY7A 1EOJA 1GBDA 2O8LA 1RRKA 1TLDA 1GJ9B 2FTMA 1K1IA 4X6PA 4OM9A 1NRRH 2OC8A 5EQRA 3KF2A 4ZKOU 2PUXB 5GJ4B 1HJ9A 4Y6DA 1YPMH 1TRMA 3HPTB 1ZR0A 5BPEA 3ITIA 3MWIU 4K5ZA 4D9RA 1WUNH 5G4BA 1TPSA 5I46H 3P6ZB 3CS7A 3ATMA 1EJAA 1FUJA 5AFYH 3RM2H 1C1PA 4Z1MD 1BT7A 3V13A 1EAIA 1K1LA 3BG8A 3SZNA 1JMOH 1LPZB 2SNWA 1P2MA 1SFQB 2VIWA 1NU9A 3CS0A 3AW1A 2ZDLA 1O37A 2TPIZ 1Y5UT 5DP5A 1MQ6A 1O2SA 2A7HA 2YOLA 3A85A 1A0HB 1EJMA 1XUGA 1P2KA 2F43B 2WPLS 1Y3VA 2KAIB 4AZ2B 4RSPA 1ACBE 2K1QA 1QURH 1SB1H 5FBIA 1F92A 5C0TA 1CQQA 3Q76A 4JZIA 5IDKA 2HVXA 5AF9H 1O2HA 1V2PT 3ZVAA 4FOUC 2QC2A 5C67A 4O97A 2ZGHA 1KXFA 1G36A 1W8BH 1TPAE 3GY3A 3SNDA 2JETC 4TSFD 4Q4LA 1C5QA 2ZDMA 4XSKU 3M5LA 4JCNA 5FX5A 1JXPA 1SG8B 2Z6BD 3PRDA 2D8WA 4BXSA 1T4VH 1FZZA 2FI4E 2XNDD 2GJGA 4MNXA 5IK2D 3T2NA 2QGRA 5C5OA 2AYWA 3VG8A 1GMHG 3A82A 1LVBA 4Q80A 2SFAA 2O8WA 1FAXA 2BLQA 4K69A 1EB1H 1UCYE 3UQOA 1UTQA 2ZWLH 4NIWA 1YWUA 2GMTC 1AQ7A 5ESTE 4AFUA 4LZ4B 1FONA 4RKOB 2F3CE 3Q3KA 1Y3XA 3UWJH 4B6EA 3LC5A 3T27A 4ISHH 1L4ZA 1N8OC 1SI5H 3UREA 2Y80A 4ABGA 1VITH 5FL7D 5EW1H 1T8LA 3MYWA 1W7GH 2FEQH 1HBTH 1TRNA 2G55A 5ESBA 3TGKE 1XKBC 1RXPA 4HG6A 1GBFA 1S6HA 1GCTB 1D3QB 2ZFQH 3MO9A 4XD7D 2XNIA 7LPRA 1B0EA 5F8ZA 2K8IA 3QX5H 3Q77A 2CXVA 1A0JA 1WCZA 5FAHA 1HJ8A 5FPSA 3RLYH 1QRWA 3F2FA 1MAXA 1SGFG 1ELBA 1Z6EA 1SGEE 2WV5A 2H5CA 3ZYEA 1GJBB 1BUIA 2F9UA 3D23A 1ZMJA 2WUCA 3F2HA 4AN7A 1IQMA 4X1PU 1EATA 2BX3A 5EJLA 3TIUA 2XYAA 4LXBH 3RXKA 2PKSC 5GCHF 4HZHA 2HNTC 5FCKA 1HFDA 2YMSC 4DW2U 4CR5A 2Y7XA 2BTCE 4D7FA 2ULLA 3B9FH 2XWAA 4CH2B 4CHAC 1AE8H 3TPIZ 2FOFA 3OY5U 2AIQA 1GI2A 1T8MA 2PTNA 1YY3A 1BITA 3QK1A 1MD7A 1H8IH 3U8OH 1KDQB 1TRYA 3DHKH 5K0HA 1CBWB 2AEIH 2BHGA 3MFJA 4ISNA 1JIRA 4B76A 2Z9GA 3UY9A 1MQ5A 1EZUC 3PO1B 3RU4T 5DKMA 2PTCE 2R9PA 1UHBA 1Y5AT 2BLOA 2A5IA 4X6NA 1BCUH 4CR9A 4ZMAH 4K1TA 1CU1A 1ZJKA 1V2VT 2AGEX 1GI9B 5A8YA 1ABIH 3MH4A 1EP5A 1AVGH 3A83A 2QAAA 4FU7A 2WPKS 4UE7H 2SGDE 1ESAA 1V2NT 3U28C 4NG9H 4AYVB 4X8SH 4X2XA 2BDHA 2BDBA 2Q6FA 1WOFA 2PKAB 4Z0KA 1O3NA 1CA8B 3BV9B 1V2MT 3CP7A 4E05H 2HPQH 2Z7FE 3SU4A 1GBJA 2ZPRA 1P2JA 3OTJE 5FXLA 4M9FA 1FN6A 4JK6A 2QN5T 1GI5A 3GY2A 1TA6A 1T8NA 1GBLA 1HYLA 1TWXB 2UWLA 1NFYA 2W7UA 4UFEH 1EKBB 1RGQA 3ZYDA 1KTSB 2G52A 3TH3H 1H1BA 2A4QA 2FS8A 1XX9A 1K28D 4CRBA 3RXIA 3P8FA 3TVJB 2P3TB 2HWLB 1BMLA 2AGIX 3KEEA 1PQAA 2K0QA 4KELA 4MVNA 3UUZA 1C1QA 4GUXA 4Q2KA 2RDLA 3Q3YA 3PMHB 1IQJA 1Q3XA 2NU3E 3PLBA 4FU9A 5CHAB 1P2OA 2QXIA 2VH6A 3QUMP 3S7KB 1HDTH 4GCHF 2XBVA 3SI4H 3FP8E 1Z7KA 2F83A 1O3JA 4A1XA 1OP2A 1TBRH 2Q6DA 3SV6A 2ZGXH 1HAGE 1E0FD 1HB0B 1JIMA 5DP8A 4ZHLU 2ZNKH 1H4WA 1QA7A 2ZQ1A 3RXSA 3FZZA 4KTUA 1WV7H 5EJ1A 3S0NA 2KX4A 2XW9A 4ZXXH 3TGIE 4B1TA 1AZ8A 1P2QA 1QY6A 4ASHA 1FPHH 1F0RA 3D62A 4D9QA 3OYPA 4YT6H 4AFSA 2W5EA 3Q3XA 2BVRH 1NFWA 3W1EA 2QE7D 1O31A 2M2AA 3A84A 1P09A 5BRRE 1MTVA 3ZZCA 1UJ1A 4AB9A 4YXWD 1GPZA 1MAYA 1O33A 4YOJA 1SGRE 4NWLA 3RXGA 1W11U 1A3EH 1MTUA 1GDUA 1WU1A 4FUCA 1DXPA 3SU3A 1LHGH 2ZHDA 1O2WA 1P57B 1BHXF 1DWBH 2UUJB 4B71A 1SGYE 6CHAB 1QNJA 4SGAE 1O2UA 4XBBA 2ZO3H 1QQUA 1GGDC 1JRSA 2VJ1A 1PQ7A 2ZGCA 2EA3A 1EPTA 5PTPA 1GJ4H 4I8KA 4HGCA 3EGKH 4X6OA 1HAZB 1Z8IB 1O3DA 3MU1A 1BZXE 1DFPA 1PPCE 1K22H 4R0IA 1TNJA 1GMDG 1O34A 2QA9E 3TJUA 1NTPA 4DJZB 1H8DH 3KCGH 2OBQA 1QL8A 1MKXK 2OP9A 2BD3A 4BANB 2Y5HA 1EAUA 4Y8XA 2ZPSA 4JMYA 2BB4A 4IBLH 1C2EA 1GI0A 1TQ0B 1YLCA 4VGCC 1A5GH 1CGIE 3MU5A 1CGHA 1C2GA 1BRUP 3LC3A 4MNVA 1TNKA 2WHXA 2YMSD 2ILNA 1C5OH 4ACBA 2IJOB 2QY0B 6LPRA 1GMCG 2TRMA 2ANMH 1FAKH 2VWNA 3BG4B 2HRVA 1RJXB 4Z6AH 2AMPA 1NM6A 4X8UH 5T6FA 4FUFA 1AIXH 2P3UB 3ZZ9A 1AVWA 2DUCA 1QHRB 1ZYOA 1Y59T 1SGQE 3K6YA 5KECA 1LHEH 1CSOE 4YOGA 1SVPA 2DE8A 3OAAD 2VVVA 1FI8A 1O36A 2JH5D 1AKSA 4ABEA 1YPJH 3E3TA 4DCDA 5A0AE 3GY6A 2FOBA 6GCHF 2VINA 1DE7H 3T5FH 4NA7A 3ATLA 2BLWA 1NBMD 4OS5A 4FUIA 4UFGH 4AGKA 4PROA 1TPPA 3BEUA 1K1PA 3PMAB 1DLKB 1ELEE 1JBUH 1O3IA 2P93A 2W26A 4HFPB 5DG6A 5JDUB 3CENA 2RFKC 1ETTH 1UCYH 1ZZZA 2F9BH 3KN2A 4FUEA 1C5RA 1BHXB 1WSSH 2QV1A 2IN2A 1QJ1B 4I8LA 5CHAC 4Y11E 1O32A 4MLFB 1DT2A 3EYDA 2BX4A 1YPLH 1ANEA 2P8OB 4X1SU 3S9AA 1MBMA 2QXHA 2OQ5A 1XXDA 2FP7B 1TPOA 3EAJA 2LPRA 3DA9B 3I29A 1VCPA 1KSNA 3UB0A 4IC6A 4K1SA 5B6OA 4P02A 3A7TA 1ESTA 4NWKA 4YTAA 4Y0ZE 1THPB 4GAWA 1QIXB 1FY8E 2H1UA 4ASUD 1HPGA 4ACAA 3LIWA 1N8OB 3SNCA 4NSYA 1J8AA 2G00A 2HLDD 2R0KA 1O3LA 4WXIA 1BB0B 3HK6B 4K8BA 3RXLA 4YOIA 3LH3A 2G4UA 3LDXH 2ZIQH 2ANKH 1NPMA 1LCYA 1EPTB 4NA8A 2V35A 3MO3A 1RD3B 1ZRKA 3SORA 2YNBA 2J5UA 2SGFE 5L30H 1DSUA 1HJAC 2RCEA 5DJ7A 1BRCE 2HPPH 3P17H 3VPKA 1GJ5H 3V7TA 2A7CA 4ZXYH 4AFZA 3DUXH 4X8TH 3AK5A 2J94A 3RMOH 1O2MA 3E90B 2NU0E 4ABJA 5E0HA 2JH6D 3VGCB 3TK9A 3LGIA 1GGDB 5GXPA 1GL1A 4J2YB 1FQ3A 2DE9A 1H8HD 3DCLA 1WTHD 2BDCA 5EXLA 4UEHH 2BOHB 3BTEE 2TGDA 1V2OT 5GWZA 2GV6A 4OS6A 1J15A 4RKJB 4DOQA 4IMZA 1K1OA 2PWXA 4Y0YE 3LKWA 5KGOA 4AFQA 3E16B 4AC9A 1GDNA 5C1YA 2F4LA 1QRZA 3V0XA 3ZV9A 2VIPA 3BIUH 4I7YH 1E35B 3FVFB 3GY8A 2ZFPH 2WPDD 3ATKA 5F53A 1C1SA 2C8YB 1BOQA 1HAPH 5HMAA 1OXGA 1F5RA 1FN8A 1W13U 5C1UA 2Z3CA 1D3PB 4GSOA 1KYNA 2HNTF 1QB1A 2NU4E 3F0PA 5JBTA 1E37B 3LONA 1PYTD 2KAIA 1KIGH 1UVTH 4O3TA 4X2YA 2NWNA 5DN6D 2KCYA 3GCOA 3SNBA 3RC5A 1ZGIA 4FUGA 5FPTA 3WW7A 1O2ZA 2ODQA 3M5OA 4AYYB 1P05A 5EODA 1HCGA 5C3NA 1PPBH 2BVXH 3SNEA 3E6PH 2ZZUH 3AAVA 4NIYA 3RXTA 4KKDA 4RT0A 1GBIA 1DWEH 3OEED 1TGBA 1C4U2 2PHBA 1TX6A 1E1QD 2XBWA 8KME2 1QBVH 2L6OA 4XRNA 1TNHA 1FPCH 1RIWC 2TGPZ 2GD4B 1FY4A 2R2WU 3B8JA 2BD4A 1QFKH 3VB6A 1WBGB 4E7RG 2XBYA 1H9LB 2XTTB 2GCTC 4K2YA 5C1XA 3EE0B 4MDSA 2OLGA 3A8AA 2ZCHP 3P8GA 1KTTB 5C2ZA 1C2KA 2IJD1 2VB0A 2B9LA 1ZPZA 1LQDB 3L6PA 3ZZ6A 4I8HA 2J34A 2RA0A 2ZC9H 3RXPA 3KNXA 3BTQE 5L2YH 3O8CA 3GYMA 2HLCA 1T7CA 2CJIA 1NU7B 3OTPA 6GCHG 4KP0A 4ZAEA 1VITG 4KGAA 1MU8B 1NESE 3A8BA 5DP7A 1EZQA 2W3KA 3U9AH 1OWHA 1GI6A 1NS3A 1C4V2 1OWDA 1G3DA 1XUKA 1UW7A 1EASA 1OWIA 3SU0A 4Q63A 3OE7D 1A4WH 4E7NA 1IQNA 1YPHC 2FOCA 1C9PA 1TYNA 5ETXA 3MU4A 1EPTC 5EG4A 1G2MA 2AH4X 2HOBA 3SUDA 5C20A 3RXAA 3ZZDA 1SKYE 3QGNB 4AGJA 1HNEE 1ORFA 1RTFB 5CDFE 2BYAX 1OOKB 4FUHA 4X1NU 5EQSA 5A0BA 1LKAA 1FY1A 1S82A 2CV3A 3C1KA 3LT3A 3TJNA 1CHOF 4ZHMU 3K9XB 3MNXA 1FJSA 1B5GH 3EA9A 5A0CA 3CNRA 1AWHB 3VEQB 3MH5A 3ZVDA 1EZSC 3E1XB 1P9UA 2ODPA 2FM2A 2QF3A 2RDEA 1SGIB 3VB4A 2ZFTA 4X6MA 1P02A 1NZQH 1YPEH 1AB9B 2AFQB 2XC4A 3ZVEA 2QF0A 1O2YA 1DUEA 3ENSB 4OS7A 1QL9A 3VFEA 1AY6H 1K1MA 3RXHA 3TJVA 1J9CH 1IQKA 1WAYB 4B2CA 3K65B 1AO5A 4BTIB 3F9GA 5JB9S 1AVXA 1O2QA 3I77A 3M7QA 3FZDA 1HAXB 1YCPK 1TIOA 2EC9H
chains in the Genus database with same CATH topology
4Y8ZA 3LH1A 5DGJA 1BTPA 1QBNA 1G2LA 2R2MB 1X7AC 3E8LA 4LK4A 1XMNB 2SGEE 1NROH 1YP9A 2ZTZA 4B73A 2ESTE 3GDUA 1QTFA 1Y3UA 4U01A 1FIWA 3M3SA 1Q31A 4NCYA 1ARCA 5J4SA 3KHVA 3HATH 3MNCA 4AOQA 5DP3A 1SLWB 2GT7A 1O2JA 4E06H 4MNYA 4CRDA 3QZRA 4UONA 2PKSB 2QIQA 2P94A 3ODDA 4X8VH 3F9HA 3LPRA 1AGJA 4HTCH 1ZHMA 4INLA 1NRPH 3RC4A 3HKIB 4FUJA 1FNIA 1KLIH 3A87A 4X2WA 1BDAA 1LVOA 1IQEA 1OWJA 4UFDH 4VGCB 3TJOA 3U1IB 1RIWB 3KQBA 2GX4A 2XWBI 2EI7A 3OU0A 2GZ7A 3KGPA 1C1TA 1Z8RA 1MCVA 1V2QT 1PQ8A 3V3MA 3QO6A 4XBCA 3SW2B 1FY3A 5DPAA 3GYLB 2VU8E 3E91A 2FMJA 1W7XH 1IAUA 4DURA 1DWCH 1SOZA 3MMGA 4K8YA 1C1WH 4GCHG 5F03A 1BTHH 1GHAF 1GI1A 1NO9H 1O3MA 2B7DH 3ZZ7A 1Y3WA 3RXUA 1GVLA 1FLEE 3FP7E 1G9IE 1NRSH 2FPZA 1SHHB 1V2UT 3WY8A 1MZAA 1AU8A 3TGJE 1VITF 2Z9JA 2GP9B 2CF9H 2VWOA 1O3HA 3RMLH 3U8TH 3TU7H 4IW4E 3OSYA 2PGBB 1O3FA 3TNSA 2PV9B 4Q7YA 1TGCA 1AN1E 2GKVE 2ZDVH 2ZP0H 1LHDH 3C27B 4MG3A 1UO6A 3SU1A 2XBXA 1YC0A 4D76A 3M7TA 2FS9A 4WY3A 4X2VA 3SBKA 5J4QA 1P04A 4X1RU 3T26A 4WH6A 1YBWA 2A1DB 1ZTLA 3BEIB 1JRTA 3S69A 2FLBH 2J9NA 3GCTF 3STJA 3SGQE 1AHTH 4BNRA 2A7JA 1XXFA 2ALVA 1GVZA 2ZG0H 3VGCC 1GMDF 3A81A 3RXDA 3RXJA 2OBOA 5FBEA 1QA0A 1ELVA 2Y81A 5DP6A 3RU4E 1ZMLA 1S0RA 3STIA 4LOYH 1BJUA 1GDQA 1UMAH 1OWEA 1D6RA 1FIZA 3SU5A 3QGJA 3AVZA 9ESTA 5L2ZH 2J2UA 2A32A 5JBCS 4BAMB 1O3BA 3DFLA 2RA3A 1GG6C 2BZ6H 3KQCA 4YLQH 5AHGH 2A4GA 3UFAA 1C5SA 1GHYH 2Z3EA 5EW2H 3ZVBA 3RM0H 1LVYA 4BAOB 3DT0H 3BTME 1FDPA 2P3FH 1B0FA 2BD9A 4Q7XA 3MO6A 2VGCC 4MNWA 2CGAA 1XUHA 1SPJA 1T8OA 3O8RA 3HGPA 6CHAC 1C2MA 1UTMA 3ATWA 4A7IB 1ELAA 1DOJA 2ZF0H 4B75A 2OINA 3SV9A 1QBOA 2O8TA 3VB5A 1G3CA 1BTUA 1IHTH 3BTFE 4FU8A 4TWYA 5CE1A 1IQGA 1GI3A 1P0SH 1GHBF 3SUGA 2XRCA 2A45B 1ZSKA 1OSSA 1DICA 1S6FA 2O8MA 1QB9A 3BN9A 2JETB 2BOKA 2FOAA 4XFQA 4A5TS 3BEFB 1ZGVA 1ELCA 1OKXA 1YLDA 2QCYA 1NN6A 4XOJA 3KQEA 2Q1JA 5E8EH 2UWOA 1FY5A 1A7SA 5A8XA 3SV8A 1GJDB 1AFQB 4X0WU 1MKXH 3FAOA 1BMNH 2BQ6B 3M5MA 1J17T 5TCCA 4MQAA 2WYGA 3S9CA 2UUKB 2P16A 2IPHA 1HXEH 1P12E 1P06A 1C5VA 2FZZA 1C1VH 3RMNH 2SGPE 4DIHH 1BBRE 3DFJA 2XCFA 3SJIA 3PYHA 1FMGA 3VXFH 1GHWH 3SOSA 1XKAC 1TFXA 1SFIA 1SGDE 4IN2A 3ZVCA 5AVDA 1ZSLA 2K7XA 3NUMA 4OS2A 1EQ9A 1THSH 1TX7A 2XC0A 4SGBE 2H9HA 3SJ8A 3SHCH 3RXCA 2Q6GA 4Y8YA 4DG4A 2V0BA 3LOXA 1EAWA 3HKJB 3URDA 2ZA5A 1PFXC 5E0JA 4F4OC 1GJ6A 1K21H 3MNSA 3M37A 2PSXA 2VIDA 1TOMH 4JZEH 5EOKA 5HYOA 1RS0A 1D3TB 3D65E 1Q2WA 1EXFA 3O8BA 2V6NA 4RN6A 2GDDA 5JBAS 1BRAA 1RTLA 1TNGA 1KXBA 2ZCKP 4B2BA 1LVMA 1N6YA 1UVUH 1Z1IA 3SU2A 3RDZA 2AERH 2OUAA 1C5LH 2THFB 3PLKA 2F91A 1KLTA 1UTKA 3A8CA 3UWIA 1O2TA 2FOHA 1W3CA 2GMTB 1O5GH 2FLRH 4ZKNU 1P9SA 1LPGB 2Y5FA 3FANA 1T4UH 2I6SA 2ZHEH 3SN8A 3ZZAA 1GHAG 1NY22 1O3OA 1SOTA 4MTBA 4A92A 1Z71A 2J95A 2BQ7B 1WTGH 1HIAB 1A2CH 1PPGE 4Y7BA 2B5TB 3NZIA 4NSVA 1C5WB 1ELGA 3SJOA 3RXVA 4ABAA 7ESTE 2ANYA 2GT8A 1SGNE 3BTHE 1AD8H 4MPVA 2BY6X 2ZEBA 4A1TA 2QXJA 3NKKA 2WPIS 4MPWA 1GHBG 1M9UA 1ID5H 1DUAA 1T32A 3V12A 1W12U 3JZ2B 1O2VA 2BY5X 5T3HA 5GPIB 4ZHAA 4WMEA 2GVFA 2ZQ2A 3T62A 1IOEA 1DVAH 1GI4A 1LTOA 3SQHE 2GTBA 2PR3A 1QQ4A 2WV4A 2W7SA 1T31A 2B0FA 5LH8A 2SGQE 1SMFE 3F9FA 1C2FA 1UK2A 1C5TA 1NT1A 1BA8B 3ELAH 1UK3A 2BVSH 7KMEH 2F9OA 2ZFSA 1C2LA 3UR9A 2A4OA 1BJVA 3SGBE 3SGAE 1ANBA 2ALPA 4ABDA 1QCPA 2V3OH 1V2ST 1MKWH 4O03A 1E34B 1UK4A 1HGTH 1O0DH 2UUFB 5SGAE 1D9IA 4QT8C 4ISOA 2Z3DA 1TA2A 3L3TA 3Q00A 3A8DA 4UFFH 2UWPA 5IYTA 1GHZA 4U30A 3QTVH 4DGJA 4NFEA 4ABBA 1SC8U 3OX7U 2BDYA 1NFUA 1ZSJA 2FYQA 1GCDA 3OY6U 1E38B 2CHAC 1G32B 1QB6A 3GISB 4FUDA 4UD9H 3ZV8A 1Z8GA 1GJAB 4Y10E 1O2NA 1O2IA 1V3XA 1W0YH 1UHBB 4FXGH 3GDVA 1V2KT 1TNLA 3GCNA 3A86A 2B8OH 3LJJA 4CRCA 1Y8TA 4NFFA 1TMUH 4ISLA 3UOUA 3LGTA 1GWAA 3KL6A 4NZLA 2D26C 1SLVB 2EI6A 1B7XB 3PO1C 1YF4A 1GL0E 8LPRA 2W3IA 2OQUA 1F5LA 1OPHB 1DS2E 1MCTA 1Y3YA 1O35A 1AMHA 5JB8S 1MU6B 1AUJA 1KXCA 2TGAA 1VR1H 2C3SA 1ZRBA 4IC5A 2WPHS 2XC5A 1HAVA 1SL3A 1IQLA 1TBZH 4CBOA 1VZQH 2WINI 1O5DH 4K3JA 5GIBA 1A5HA 5LGOA 3UR6A 1V2TT 2PGQB 2PKAA 1P3EA 1C5XB 2ZHFH 1O3CA 3SJ9A 2GV7A 2WYJA 2PSYA 2ZU4A 1V2JT 2CF8H 2Y6TA 4DIIH 4AG1A 5JPMH 4H6TA 3A7YA 4TPYA 1NFXA 2GCHG 2FX6A 1PPFE 1YCPM 2VGCB 3KQDA 1BTYA 2FI5E 1ZTKA 5C5NA 3M5NA 5T6DA 1LKBA 2BM2A 1F7ZA 2AMQA 2XCNA 3GOVB 3O8DA 1UTPA 2JH0D 1A46H 1YGCH 1LMWB 1C1UH 3MOCA 1SQOA 5A8ZA 1GJ7B 4YZUA 1QJ6B 1MTSA 1O3KA 2OTVA 1O2LA 1TMBH 4ZKSU 1ABJH 4Y79A 1JOUB 2GZ8A 2VVUA 1V2WT 4R8TB 2A31A 2CN0H 2YNAA 4WVPE 1V2LT 1CT0E 1S0QA 4ESTE 3M35A 1BIOA 4JZFH 5T6GA 1F5KU 3TITA 1GCTC 1XVOA 1XVMA 5F8TA 3PV4A 2STBE 2Y7ZA 1K9OE 3UOPA 5JYIA 2SGAA 1EOLA 4Y7AA 3PMJA 5EQQA 2R3YA 3E0PB 3GICB 2VVCA 4DT7B 3BF6H 3ZZ8A 2ZTXA 2ZU3A 1UTJA 1P2IA 2C8WB 1DY8A 1CA0B 2VIQA 2C8ZB 4WH8A 1O2OA 2OC0A 1WQVH 1XUIA 1WYKA 4AX9H 1TX8A 3GY4A 2C93B 4H4FA 1ZMNA 1ZLRA 4BAHB 4FUBA 5GDSH 1O2KA 1P3CA 4DY7B 1GI8B 4B2AA 4D7GA 4F49A 1MKWK 3PM3A 1H9HE 4I8JA 3SV2H 1C5PA 3VB7A 4I8GA 3NCLA 2J92A 5GCHG 2G5VA 9LPRA 4Y76A 3RXOA 3F9EA 2ZECA 2BY8X 4IGDA 3AASA 2AGGX 2BXUH 5FCRA 3BTKE 3SO3A 3NXPA 3RMMH 3SUEA 3U98H 1VJAU 1E36B 4MPUA 2G81E 2PW8H 3GCTG 1YPGH 1THRH 2WUBA 3BIVH 2BDGA 4WJG2 1P8VC 1SLXB 1EX3A 4UDWH 1GBEA 5E2OA 1MD8A 3QWCH 5LPEA 4CHAB 3MH6A 1TMTH 4JK5A 1CT4E 1O2PA 2FOEA 3TH2H 1O5BB 2ZTYA 3UPEA 3K2UA 4BTTB 3MNBA 4O9VA 2FIRH 3IG6B 3NK8A 2FXRA 3ZVGA 1HIAA 1LO6A 1UTOA 2FYRA 4X1QU 1TOCB 1GBBA 1V6DA 1J14A 1GMHF 4JZ1A 2BDAA 1OX1A 2OC1A 2Y82A 5DO4H 1YPKH 3SV7A 1GJ8B 3P8NA 3F6UH 2EEKA 4FVDA 1O3PB 5L6NH 1YKTA 1D3DB 1P03A 3UNQA 5F6MA 2STAE 1L1JA 4YESB 7GCHF 2JKHA 1LDTT 1C2DA 1O5EH 4JZDH 2TBSA 4H6SB 1BTXA 1BTZA 1GG6B 5F8XA 1S84A 1ZHRA 1IQIA 3LGYA 3LU9B 3N7OA 2LNCA 1QL7A 1ETRH 1MTWA 1VGCB 5EU8A 3ZZ5A 1CE5A 3TLOA 1DY9A 3MTYA 1F0UA 1AZZA 1J16A 1QRXA 5DP9A 3IITA 3H7OA 2ZU1A 2PLXA 1MTNB 3QDZB 2ZGJA 1K1NA 3A89A 2A2QH 4BAQB 1PPZA 1P10A 3P70B 4THNH 3RP2A 3T25A 5TCAA 3SQEE 1QJ7B 1K1JA 2D2DA 2RG3A 1O5AB 3RC6A 3BTWE 2Z94A 1KXDA 2C8XB 5DK1A 1EZXC 3FFGA 1LQEA 2A2XH 2HALA 1DANH 4YM9A 1ZPBA 1F2SE 1SSXA 4YO9A 1W10U 1D6WA 3GY7A 1ELTA 1SQAA 1O30A 3PLPA 7GCHG 2ZPQA 2FO9A 2J38A 2QYIA 3UNSA 1Z8JB 3MHWU 3GCHB 3AW0A 1GBTA 3URCA 2BD2A 3EBNA 2EI8A 5AFZH 4GHTA 3A7VA 1U6QA 1Z6JH 1OP8A 1PQ5A 1UVSH 3JZ1B 5HXFA 2ZFFH 1C4Y2 2G8TA 3RU4D 5H4IB 3QZQA 1HJAB 1DITH 2ZKSA 4I32A 1ELDE 1ANCA 4IN1A 4O3UA 2F9NA 2ZHQH 3UIRA 4OS1A 1O2GH 2BD8A 2O9QA 3ZZBA 3F1SB 5LPRA 4K60A 4TYDA 1RTKA 1QGFA 1CT2E 3F68H 8GCHG 1TABE 3A7ZA 1CA0C 2FTLE 3A88A 2BD7A 3S9BA 1SBWA 3ODFA 4YLUA 3K6ZA 1UVPA 3PWBA 1L4DA 3E0NB 1ELFA 1N6XA 3SJKA 4OGXA 4YT7H 1YYY1 1NC6A 1INCA 4D8NA 1Y5BT 1PJPA 4XE4A 1C2JA 1GBAA 1DLEA 5HM9A 3FP6E 4I31A 3UQVA 1DX5M 1A61H 4M7GA 2HNTE 1KXAA 1ZHPA 3NPSA 1C1RA 2H9EH 1EB2A 1BRBE 1XUFA 1EAXA 3QN7A 3I78A 3LGUA 1XM1A 4K1EA 1EJNA 1MMJN 2SNVA 3AAUA 2IOTA 3GCHC 4TWWA 1QR3E 1LPKB 1L1GA 3PTNA 1O3EA 4Q7ZA 3EDXB 3PTBA 3M36A 5ABWA 4NA9H 4B74A 2A5AA 5EPYA 5EXNA 5CMXH 2NU1E 1HXFH 2H2ZA 4KTCA 2BLVA 3MI4A 1FV9A 3M3TA 4XDEA 1CO7E 4WMDA 2ZDAH 3P95A 2ZI2H 4GLYA 2G51A 4DVAU 2GDEH 2QXGA 2PFEA 4FVBA 1TGNA 2BD5A 2J4IA 3A7WA 3B23B 1AFEH 1SLUB 3RXQA 1TNIA 3PWCA 4WWYA 2H6MA 3DD2H 1CHOG 2A4RA 2OD3B 1ZTJA 2A0QB 3QTOH 1W0ZU 1A0LA 2ANWA 1C5ZB 1LHCH 1KDQA 1TB6H 4NIVA 3MU8A 3RXFA 2V3HH 3TNTA 3ESTA 1C5MD 4HI3A 3W94A 1KY9A 1OP0A 1AWFH 4ZUHA 2OC7A 1VJ9U 3R3GB 3RXMA 2ZFRH 1A3BH 1KLJH 1HAIH 1C1NA 1CBWC 3ZVFA 3TK6A 1DSTA 1S81A 3BTGE 1NRQH 3SNAA 3P92A 1S5SA 1MUEB 1OS8A 3IWMA 2BQWB 4GVUA 4CRFA 5EGMA 2Y5GA 3UNRA 3VB3A 3BTTE 1TAWA 2AS9A 2FOGA 1HAHH 3KIDU 1O3GA 1PPHE 5HM2A 1EUFA 4IS5A 5HGGA 1OYTH 2VWLA 1SHYA 2G4TA 1IQFA 2H5DA 3A80A 1GMCF 3GDSA 3SHAH 5JBBS 2ZDKA 1F0TA 2FESH 1UTLM 4U32A 1IQHA 4JYUH 1SQTA 4INHA 4GPGA 1C1MA 2OXSA 3T29A 1CVWH 2FODA 2BY9X 2ODYB 3SI3H 2FWWA 3UTUH 1G37A 4JYVH 3TK5A 1ZPCA 3PB1E 3EA7A 1GBCA 4WMFA 1AKSB 3MU0A 1OWKA 4TPIZ 3ATIA 1AUTC 1KXEA 1MTNC 2BMGB 5I25A 1DM4B 2A5KA 1HV7A 4ISIH 1TQ7B 3W95A 1C5UA 1TALA 2FOMB 5TJXA 3L33A 2R0LA 1GI7B 3S7HB 2LIZA 1EP6A 2GZ9