4YOJA

Hku4 3clpro bound to non-covalent inhibitor 2a
Total Genus 88
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
88
sequence length
306
structure length
306
Chain Sequence
SGLVKMSAPSGAVENCIVQVTCGSMTLNGLWLDNTVWCPRHIMCPADQLTDPNYDALLISKTNHSFIVQKHIGAQANLRVVAHSMVGVLLKLTVDVANPSTPAYTFSTVKPGASFSVLACYNGKPTGVFTVNLRHNSTIKGSFLCGSCGSVGYTENGGVINFVYMHQMELSNGTHTGSSFDGVMYGAFEDKQTHQLQLTDKYCTINVVAWLYAAVLNGCKWFVKPTRVGIVTYNEWALSNQFTEFVGTQSIDMLAHRTGVSVEQMLAAIQSLHAGFQGKTILGQSTLEDEFTPDDVNMQVMGVVMQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 3C-like proteinase
publication title Targeting zoonotic viruses: Structure-based inhibition of the 3C-like protease from bat coronavirus HKU4-The likely reservoir host to the human coronavirus that causes Middle East Respiratory Syndrome (MERS).
pubmed doi rcsb
source organism Bat coronavirus hku4
molecule tags Hydrolase/hydrolase inhibitor
total genus 88
structure length 306
sequence length 306
chains with identical sequence B
ec nomenclature ec 2.7.7.48: RNA-directed RNA polymerase.
pdb deposition date 2015-03-11
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1840.10 Mainly Alpha Orthogonal Bundle main proteinase (3clpro) structure, domain 3 main proteinase (3clpro) structure, domain 3 4yojA03
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yojA01
2.40.10.10 Mainly Beta Beta Barrel Thrombin, subunit H Trypsin-like serine proteases 4yojA02
4NSVA 1K1IA 3TPIZ 5FBIA 1GGDB 1NRNH 2AFQB 5JPMH 1TGNA 3UQVA 1INCA 1BMNH 2JH6D 2ANMH 3P8FA 5DP4A 3TJNA 5HM9A 2BLVA 3EE0B 1TBZH 2VGCC 1FONA 2ZEBA 4WH6A 2PSXA 4X1NU 1EQ9A 2BY9X 2PFEA 2ZDNA 1GCDA 2XXLA 1UTMA 2FOAA 1J14A 2Z7FE 1B0EA 1EKBB 1BMMH 5JBAS 3U8TH 1WQSA 4BAQB 1JXPA 2C8XB 4NCYA 3P17H 2BVXH 2ZFTA 4NIVA 1UVTH 2C4FH 1CO7E 1C2FA 1AGJA 2UWOA 3AAVA 3SNAA 3B23B 3T5FH 1IOEA 3QGJA 6GCHG 2HPPH 4ISHH 3CS7A 4E06H 3SNDA 1HGTH 3K2UA 2FI3E 4R0IA 4SGBE 1FAKH 2ZKSA 4YOJA 4AZ2B 4F4OC 2NU3E 1TFXA 2VVVA 5FPYA 3MO9A 2G5VA 5EW2H 3PV4A 1KTTB 1GHZA 2BQ6B 1GMCG 2ZDKA 1BHXB 4CRAA 5B6OA 3M3TA 1O0DH 4BXSA 1YPEH 4SGAE 1LPZB 1J9CH 2HGTH 4O3UA 4MNXA 1EX3A 2IJOB 1FUJA 1SLXB 3OU0A 1LVYA 1GVKB 2GVFA 1P10A 5GWZA 1GHBG 1OYTH 3Q76A 4ISNA 1BTUA 1KIGH 3D65E 1LHCH 1K1JA 2QXJA 1LCYA 2UWPA 2V0BA 3UWJH 1DVAH 1MTVA 4JZEH 1BZXE 4R8TB 5AHGH 2QN5T 2VWLA 7KMEH 1F5LA 4WJG2 1H9IE 4LOYH 3MYWA 3RLWH 3R3GB 1LKAA 3DT0H 2CJIA 4IW4E 4OS1A 1CHOF 1RRKA 1E36B 1W8BH 1H1BA 2H5DA 2GMTC 2Z9IA 1AWHB 5DP9A 2CF9H 1C2KA 4WWYA 3D23A 3LDXH 2BDYA 1DY9A 3B8JA 1C1QA 1DFPA 5G4BA 1MD7A 3SO3A 2V3HH 1BHXF 4DIHH 3A8AA 1LO6A 1IQNA 4CRDA 1WU1A 4ABFA 4U2WA 3F6UH 2BZ6H 1Z8IB 3B9FH 1KLTA 1F0UA 4A1TA 2TPIZ 2OQUA 1IQKA 2VH0A 1NPMA 1CSOE 1SQAA 1O3GA 4H4FA 1BJUA 2VIWA 1MTNC 1D3PB 3ENSB 1PPHE 2G55A 2RDLA 4TPYA 1GMDF 4DY7B 4WF8A 3NXPA 4NWKA 2F9BH 4Q7YA 1GJBB 1BMLA 1PPCE 3SU6A 1CA0C 5AFZH 2GT7A 1BB0B 1NROH 1QA0A 2R3UA 2G4UA 1EJAA 1QCPA 3OYPA 3VB6A 2TBSA 1PQAA 1DWBH 3M3VA 4VGCB 1Z8RA 1O2ZA 1OKXA 3BN9A 2R9PA 1LHFH 3ZZ5A 5L30H 1MTNB 1HDTH 2P3FH 3QTVH 1SQTA 3TGIE 1QJ6B 5F03A 2D26C 3ATKA 5E2OA 4IN2A 5C20A 2BD3A 4D9QA 1NN6A 1HAVA 3STIA 4DURA 3P6ZB 2A0QB 2A5AA 4JMYA 1S82A 2BMGB 2M5TA 1V2PT 1ZPBA 1AY6H 1JMOH 1GJ6A 2FOEA 3UTUH 1BCUH 4X8UH 1UTJA 3BF6H 1TBQH 1NM6A 3ZZDA 3LH1A 3ZYDA 1QGFA 1QHRB 1GBFA 2LNCA 3QLPH 3MU1A 1GI6A 4ZXXH 1HAOH 5L2ZH 5EQRA 1S6FA 1GDUA 2C93B 2A4OA 2P3UB 2Y82A 5ESTE 5GIBA 1DANH 4UD9H 1C1SA 4IBLH 2FLBH 2UUKB 3ZVEA 2TGDA 1TABE 1CHOG 1HJAB 2W3KA 1SGCA 1KXFA 3BV9B 3MI4A 4K2YA 1Q3XA 5EOKA 4AYYB 3A8BA 4GHTA 1W14U 2R0LA 2QAAA 2D1JA 1DX5M 2GCTB 1O3JA 1GBDA 1Y59T 1C4Y2 1P02A 1T32A 2J38A 1MKWK 2BHGA 4X8TH 3LGVA 4I31A 3RC6A 2UUJB 3M7TA 1AB9B 4ZKRU 1DY8A 3TJVA 2BOHB 2UWLA 3MOCA 2BDHA 2BQ7B 2ALPA 2ZU3A 3CP7A 1ELFA 3RXHA 3A7ZA 3QZQA 1FY5A 5EU8A 5JB8S 1D3DB 1HB0B 3BTEE 1ETTH 1GMDG 1N6YA 2O8TA 1QR3E 3QGNB 3UOUA 1EB1H 4TY7A 1AE8H 3K65B 1O2MA 1V3XA 4ZHLU 2Y5HA 1F2SE 1P0SH 3SGQE 3SV7A 2WPKS 2W5EA 4ZKOU 1DM4B 1ABJH 2WINI 3GCTG 3PMJA 1GJ5H 2Q6GA 1O32A 2XC5A 2VIOA 3ZVGA 3KGPA 3TNTA 4CHAC 3BTWE 1C5VA 1W7GH 1OWIA 3RMOH 2ZFRH 4A6LA 1GJ4H 3MNXA 1FI8A 3UR9A 1A4WH 2Y7ZA 3EA7A 3EGKH 1A61H 2A7HA 5DJ7A 1WQVH 3RXIA 4FUHA 4B1TA 1PPGE 4AB9A 9LPRA 3GCOA 1HAPH 1G3EA 4YESB 2AH4X 2ZG0H 4ABAA 1Y5BT 1IAUA 2ODQA 4RKOB 5BRRE 1BITA 4O3TA 3PB1E 1C1WH 1YPLH 1CHGA 1RD3B 4ZKNU 3TK9A 2BLQA 1DWCH 1QY6A 4CHAB 3TH3H 4Y79A 1Z6JH 1CT0E 3ATIA 4RSPA 3KL6A 5CE1A 1NFYA 4PROA 3RXLA 3W94A 1SQOA 3LJOA 2Y7XA 2ZP0H 2VB0A 5GCHF 2TGPZ 3HK3B 1RTFB 2W3IA 1B5GH 4XBCA 2H9TH 1UMAH 1IQIA 1O36A 3A86A 1WAYB 3UQOA 3M5LA 3ATMA 2B7DH 4Y71A 4CBOA 1C2EA 1TRNA 1YP9A 3PTNA 1UCYK 3KQBA 1KXCA 3RXQA 2Z9JA 1JOUB 1O37A 4BTUB 5C1UA 1JIMA 2ZDAH 1YKTA 1PPEE 2BDCA 3SNBA 2NU2E 4FUEA 3MU8A 2VIVA 5FX6A 2VVCA 1GHYH 4NGAH 1P2NA 1GL0E 1GBAA 1XUJA 2OD3B 1FIZA 1BBRK 3LIWA 2ZGBH 2JKHA 1O39A 1F92A 4AG1A 2BYAX 3EBNA 7GCHF 3MO3A 4CRBA 4I8LA 2AERH 5K0HA 4CRCA 2GP9B 1HIAA 4ABGA 1RS0A 2BDAA 4JCNA 5DP3A 3SV2H 3DFLA 1ZPCA 1ZGVA 4OS4A 4AG2A 1W11U 2WPMS 1S6HA 2GZ7A 5F8ZA 1GDNA 2ZGHA 4YLUA 5A0CA 3ZVCA 4UFEH 3KQEA 1MUEB 2YNAA 1EZSC 1MU8B 1VITH 2P8OC 3BTME 4OS2A 1TMUH 2EEKA 1CE5A 5TJXA 2AMQA 1ANBA 3U8RH 2QCYA 1Z8JB 3UY9A 1ZYOA 3TH2H 4U01A 1DUEA 1FPCH 1BIOA 3QO6A 4CBNA 2GKVE 1MKXK 1XX9A 2XCFA 3TNSA 5F8XA 1P03A 2PR3A 1L1GA 2PHBA 2F91A 1ZRKA 3BIVH 1FPHH 1O2IA 5A8XA 1NC6A 3PWBA 1SGQE 2ZWLH 4AGKA 3SOSA 4X2VA 2V6NA 5GCHG 3MNBA 1ORFA 1HYLA 1O2VA 1C1NA 1UK2A 1CQQA 1P3EA 2ZGJA 4TYDA 1W13U 4IMQA 1A0HB 1HCGA 1ZOMA 2GV6A 4UDWH 5ETXA 1C2MA 1P9UA 3F9EA 3Q3KA 1RXPA 2EI7A 1FDPA 1ETSH 4XSKU 4MPVA 3PROA 3ZZ4A 3FVFB 5CHAC 1DLKB 3S0NA 1FNIA 1GCTC 2BDIA 3LC5A 2G51A 1LVBA 1AU8A 5I25A 1O2XA 3LJJA 3U8OH 1AFQB 1AKSA 1A3EH 5LPRA 1FXYA 1SGNE 3HGNA 3JZ2B 2H9EH 1XUKA 2LPRA 3T28A 2BTCE 1K22H 4ABIA 1HAVB 1KDQA 1EJNA 4WMFA 2CHAB 2Q6FA 1C9TA 7GCHG 3O8RA 4AFQA 1EPTB 1UJ1A 3H7OA 1GCTB 3VB3A 1TGTA 1TLDA 1A7SA 3M37A 1IQJA 2FS9A 3FP8E 1CBWC 6CHAC 2BY8X 1D3QB 1TGBA 5T6GA 3P70B 4CRGA 1SGFA 4CREA 4J2YB 2SGDE 1HJ9A 3O8DA 1NU9A 2A1DB 1G3BA 3SU0A 5JBCS 1ARCA 2BX3A 1G9IE 1FY8E 3RXOA 1SI5H 4Y8XA 1GHAG 1WBGB 2PUQH 1A46H 5C5NA 3A82A 1SBWA 3I78A 1K1OA 4KGAA 3ZVDA 1OPHB 5EXMA 6CHAB 1ELAA 1ESTA 1A5GH 1VCQA 4INKA 4Y7AA 2AGIX 1YLCA 5E0HA 1Q2WA 1NFXA 1QNJA 1AFEH 3OY5U 1ANDA 4ABBA 1ANEA 3BTKE 1Y3XA 3ATWA 4A7IB 3GCNA 4FUDA 3RXKA 3QK1A 2ZO3H 1O2JA 1Z1JA 1GGDC 2FIRH 2ZFQH 4CR9A 1QQUA 1O3PB 1Q31A 3DFJA 1C4V2 5DPAA 4X6NA 1NRPH 1M9UA 2TIOA 1J17T 1AZ8A 4Q2KA 2JH0D 1W12U 1BMAA 2PLXA 1OYQA 4NZLA 3ZVFA 2XBYA 5E2PA 4AX9H 3MMGA 3UPEA 3BTGE 2ZTXA 1ELTA 2J4IA 3M7QA 4YM9A 1BOQA 1TX8A 5DG6A 1GI9B 2SGPE 2OBQA 3A80A 2BY5X 1TA2A 1O5DH 5AVDA 2Y5GA 1QA7A 1GBMA 2WPIS 2QXIA 2BD9A 1C1PA 2V3OH 5J4SA 3SU2A 5C5OA 4FU7A 4HGCA 1GBCA 1GI7B 1V2WT 1S0QA 1T8MA 2H9HA 1HAHH 2R2WU 3KEEA 2A2QH 3UNQA 1C5PA 2G81E 2FOMB 5FCKA 4FUBA 2SNWA 1SVPA 2HWLB 5E0JA 4UFDH 1F5KU 4UFGH 4D7FA 1ELCA 2XC4A 3LONA 1O2RA 2ZU2A 5JDUB 1V2TT 4DOQA 1GBEA 1P9SA 1OWEA 1DOJA 1AI8H 1ETRH 1QBOA 3BTTE 4X1PU 1GG6B 1SGTA 3PLPA 1THPB 1GI2A 1OS8A 3LU9B 2F3CE 4ZAEA 1P2MA 2P93A 1MBQA 3UUZA 1BJVA 1G2MA 1ZSKA 3E3TA 3RXEA 2ZTZA 1RGQA 2A32A 4O97A 2IPHA 4H6TA 4K60A 1O3CA 1QJ1B 4AB8A 3R0FA 4MPXA 1GI8B 1FV9A 2VU8E 1W2KH 1YCPK 1OP0A 4BAOB 1YPJH 2THFB 2XWBI 2ZI2H 5DP6A 3SI3H 1IQHA 4JZDH 2ZHQH 4HZHA 3VB7A 2F9NA 4LZ4B 4E05H 1SSXA 4MPUA 1O38A 3Q00A 4UE7H 2ANYA 4HFPB 1V2MT 4Y10E 4MDSA 2VWMA 4JZ1A 3GCHB 4MTBA 3SJ9A 3D49H 4ASHA 1XM1A 6ESTA 3O8CA 3BEUA 5T6FA 2Z94A 5A09A 1UVPA 3N7OA 3ZYEA 1HAGE 1SMFE 3U69H 2ZU4A 1ACBE 1TOMH 3SZNA 4K8YA 1XKAC 4B74A 1G32B 2QC2A 2PKAA 2OINA 1X7AC 1QTFA 3FZDA 2GX4A 3RC5A 4I8JA 1VZQH 1FJSA 1TGSZ 4CH8B 4VGCC 1VJ9U 2XCNA 3PLBA 3EA8A 1BA8B 1EB2A 3VXFH 1C2DA 2A7CA 3SJOA 2EA3A 3RLYH 4YO9A 2O8MA 4MPWA 1LQEA 1LQDB 2SGFE 2Z9KA 1C2LA 4ABDA 1ZTJA 4BXWA 2ZDMA 1P01A 2FYRA 3I29A 3M7UA 3EAJA 1GI1A 4OGYA 4X2WA 5EODA 1TQ0B 4DG4A 1QB9A 2Z6BD 4D7GA 1V2KT 3V3MA 2V35A 2WV5A 3MH6A 1MQ6A 1K9OE 2ZFFH 3F9HA 4Z6AH 1O3AA 2WUCA 2ZIQH 2G52A 1ZHRA 3PM3A 4NIWA 3ESTA 1HJAC 1NESE 1WTHD 2W7SA 2ZHDA 1CGHA 1C5YB 3QDZB 1AZZA 4BAKB 4AFZA 4A1XA 3FFGA 4TWYA 4JZIA 3L33A 1F0RA 1YGCH 3V0XA 1PYTC 1SOTA 2GCTC 4DCDA 1LDTT 3LOXA 1Y5UT 5EQSA 1OWHA 3I77A 2ZCHP 1T8NA 3PO1B 2J95A 4Y0YE 4X6OA 2G5NA 3A8DA 2STAE 1DICA 4A5TS 1CT4E 1NS3A 1SLUB 1V2LT 1AB9C 1SOZA 1K1PA 1KSNA 2ZZUH 4NA9H 3S7HB 2OC0A 2Q6DA 3MFJA 3SU4A 4YOGA 5FPSA 1TNHA 1CU1A 3SI4H 1NU7B 1C5XB 4IS5A 1TNKA 4CR5A 1Z7KA 2XYAA 1HAXB 5LPFA 2AEIH 3ZVBA 3GDSA 1E38B 2XC0A 1GI5A 1AO5A 2R3YA 2SGAA 4Y7BA 4I8HA 3RXJA 1LVOA 2GT8A 4H6SB 4I33A 5EG4A 4X1SU 2BD4A 2HALA 1L1NA 2VINA 2FOBA 2H5CA 4K3JA 1EP5A 4A92A 1GBHA 2C8YB 1TA6A 1UHBA 1TONA 1UTKA 1QL8A 4D8NA 1MZDA 1HPGA 4K1EA 3IWMA 1MTSA 1HAYB 3NCLA 2ZF0H 4GVUA 4O9VA 1UTNA 2HVXA 3OY6U 1RTKA 2AIPA 1P2JA 1A3BH 2QV1A 1BRCE 4X1RU 1E0FD 3ZZAA 1ZHPA 2ZHEH 2BDBA 3BTQE 1GBIA 2GCHF 2WPJS 3OSYA 3SV8A 1GI0A 2BX4A 4BTIB 1XMNB 2JETC 3MH5A 1ELVA 1SGIB 4X2YA 4YT7H 1MMJN 4ZHAA 1TMBH 2TGAA 3M5NA 4OS5A 5K7RA 1VCWA 1PQ5A 3LC3A 4NFEA 1N8OB 1O3KA 1ZZZA 1O35A 1SHYA 4GSOA 1N6XA 5T3HA 1P06A 2SNVA 4ABEA 2XNIA 3FP6E 1S81A 2FP7B 3SHAH 2HRVA 1L0ZA 1MKXH 2JETB 3GYMA 4K1SA 1BRAA 3BTHE 3FZZA 2B5TB 1B7XB 1D6RA 2OC7A 4IGDA 4MNVA 2FOGA 3AW1A 3HKJB 1GJCB 2ZA5A 4M7GA 4ZXYH 1LHGH 3QUMP 1LKBA 4JK5A 2Y5FA 3RU4T 1BBRE 1O2TA 3RU4E 4ZUHA 1E34B 2OTVA 2OBOA 1D3TB 3LPRA 4BOHA 1C1OA 3RXGA 3TGKE 2SFAA 4HTCH 1CVWH 1P2IA 1DLEA 3PTBA 1ELEE 1IQLA 4IC6A 1OP8A 3MU0A 3KF2A 1O3DA 1UK4A 2C3SA 1C5RA 2I6SA 3SV9A 1GPZA 3M5OA 2ZNKH 5HYOA 3VGCB 4WMEA 1C5UA 1V2UT 3P8NA 1C1VH 2ILNA 1C1UH 2AMDA 2IOTA 1C1RA 1SG8B 3DHKH 4FUFA 4MNWA 1QB1A 2A2XH 1IHTH 3GOVB 4YLQH 2QYIA 4MLFB 3LGUA 1JRTA 4Q7XA 1HLTH 8KME2 1TX7A 2AGEX 5FHTA 2FTMA 3IG6B 1U6QA 2ZTYA 3HATH 1ZTKA 3KQCA 2NU1E 3SHCH 4FUIA 2CV3A 3VEQB 4X8VH 3F9FA 4KELA 2R2MB 1SLVB 2VH6A 3NK8A 3TLOA 4BAHB 2VWNA 2GCHG 1UO6A 3KCGH 2ZHFH 1UK3A 3UNRA 3TU7H 5FBEA 3MWIU 1TX6A 1E37B 1ELBA 3A84A 2NU0E 2B8OH 3UREA 4CH2B 2EI8A 1YPGH 3ZZ3A 2XBWA 1HNEE 1TIOA 2OLGA 4NG9H 2F9VA 1MCTA 1JBUH 3TJOA 4OS6A 1TALA 2FDAA 3KHVA 2KAIA 3E91A 1W0YH 4XBDA 1H4WA 1DSUA 2O8WA 3OX7U 1LPGB 5FPTA 2BD8A 1HBTH 1SFIA 3FAOA 3MTYA 2LIZA 1DWDH 2Y6TA 4KKDA 1O5CB 1C5NH 4WY3A 1ZHMA 4X6MA 2ZPQA 1WSSH 1G36A 5FXLA 2H2ZA 3T27A 2ZU5A 3LH3A 2J2UA 5EW1H 1VITF 4I32A 4BTTB 3VPKA 1TRMA 3ZZ8A 1O34A 1AFQC 1VGCB 3A8CA 5FAHA 2FX6A 1O5BB 1A0LA 1GBKA 1VR1H 5JBBS 1EXFA 1RIWB 2EC9H 1HXEH 2J92A 1GWAA 1MH0A 5GPIB 5IDKA 1JRSA 2A7JA 2CHAC 2FOHA 1EZQA 1O5FH 3SUGA 3E1XB 1C5QA 1YF4A 1QFKH 2FXRA 1EPTC 3L3TA 4IMZA 1V2JT 2Z3DA 2BXTH 4NWLA 7ESTE 3SGBE 2BB4A 1OSSA 4DJZB 3A85A 2XWAA 2AMPA 3AVZA 2C8WB 1WV7H 3A7VA 5EPNA 3QWCH 4RKJB 2VWOA 1ZLRA 1DWEH 1GMHF 1DITH 1YC0A 4THNH 3T26A 1UTQA 1LPKB 3FP7E 2FM2A 8LPRA 2ALVA 1P3CA 3ZV8A 3TGJE 4BNRA 1KY9A 1F0SA 1GBJA 1D4PB 1W10U 2ZFSA 3P8GA 3RXAA 8ESTE 4AGJA 2ANKH 2PV9B 1EOLA 3M5MA 5DP7A 1Y3VA 2PSYA 1GDQA 1AE5A 3A81A 2FWWA 1W7XH 1MCVA 4FU9A 3SJIA 4ZH8A 2GZ9A 1DXWA 1K1LA 2Y80A 4K69A 3U1IB 1VJAU 1BRBE 1SFQB 4AFSA 2A4GA 2BLWA 2J94A 1KXDA 4JZFH 1SLWB 6LPRA 2ZCKP 3BTFE 1AVXA 3T62A 1AWFH 1GJ9B 1YPKH 3GY7A 3BG4B 1A0JA 4FUCA 4GUXA 1BRUP 3ODFA 5ABWA 1EUFA 2BLOA 1A5HA 5DKMA 2PKSC 2FESH 3M61U 1ANCA 1GBLA 1T8LA 1BDAA 1ELDE 4X6PA 2QY0B 2A5IA 1LVMA 1S5SA 3QZRA 5EXNA 2ODYB 2Z9GA 1NFUA 2NWNA 1O2UA 4WXVA 2B0FA 1NZQH 2YOLA 2AIQA 2WPLS 1K1MA 1K28D 1HFDA 1UHBB 3LGWA 1YCPH 2ZDLA 3KNXA 3MNCA 4KTSA 1FAXA 1NO9H 2OC8A 2Z3CA 1PJPA 1SHHB 1O3BA 4UFFH 4FUJA 1MU6B 1T31A 2PKSB 3P95A 3E16B 5A8YA 5L6NH 2C8ZB 1W0ZU 4X8SH 5HXFA 4FU8A 5SGAE 1G3CA 5FX5A 4Y6DA 3ELAH 5FCRA 2QF0A 1O2OA 1KXBA 4LK4A 3RXDA 3RUOA 3RXVA 2OXSA 1L4DA 2ZQ1A 4AFUA 3TK5A 3SJKA 2DUCA 5LPEA 3S9BA 1NRQH 3A88A 2PTCE 5C67A 1ZMJA 1C5SA 2IN2A 2G4TA 1F0TA 1XUHA 1SB1H 4HI3A 2FX4A 3T2NA 2ULLA 1GMHG 4IN1A 2ZU1A 2Z3EA 3Q77A 1P12E 1EAIA 3A87A 1Y3YA 3DUXH 4BAMB 1BTXA 1GG6C 2GGVB 3C27B 2GDEH 1B0FA 2OCVB 1IQMA 1ID5H 2BDGA 1ZTLA 1HUTH 1Y5AT 2SGQE 2ZPSA 3A7XA 3MU5A 1J16A 1H9LB 4WH8A 1GHWH 1EAWA 2OQ5A 1WOFA 4ISLA 4J1YA 4D76A 2F9OA 4ABHA 1DXPA 3SU3A 1O3EA 3CENA 1FQ3A 4XFQA 1UTPA 1GJ7B 1WCZA 2NU4E 1MD8A 1V2VT 4BANB 3LKWA 1UTOA 1AD8H 3DA9B 1GJDB 1TGCA 2CXVA 2O8LA 3SQEE 3MH4A 4MG3A 1QL7A 2VGCB 1TPAE 1J15A 2JH5D 1O30A 1C5MD 2A4QA 1N1LA 1GI4A 1TNLA 2VVUA 2ZGCA 5JYIA 5DO4H 1WTGH 3VB5A 3GCHC 1SGPE 2VJ1A 3SV6A 1C9PA 2GD4B 1SL3A 1TE0A 2WYJA 2VIDA 1YYY1 2ZDVH 2FZZA 1P2OA 4DGJA 1J8AA 2ANWA 1EATA 1PQ7A 1C1TA 1ZJKA 1O5GH 3BSQA 2PTNA 3G01A 3BIUH 4TY6A 1C5LH 4U32A 2HOBA 2A4RA 3T29A 1HIAB 1EOJA 1UVOA 1T4UH 4MNYA 3VXEH 5A2MH 5HMAA 2K7XA 2PWXA 3M35A 3T25A 3RXPA 4ISOA 3E6PH 1GVLA 2GTBA 3RP2A 4B76A 3URDA 5LGOA 2ZPRA 2F9PA 3GISB 2A5KA 1ZRBA 3F68H 4B2BA 4E7NA 4Y8ZA 1O2WA 3SORA 1G3DA 4NA8A 4E7RG 1C5OH 1RJXB 2P3TB 3V13A 3RMMH 1HJ8A 2KAIB 1AN1E 4B71A 1MKWH 1FY1A 2P59A 4FUGA 3ATLA 3JZ1B 4X2XA 1V2QT 3VFEA 2BD2A 5JBTA 2TRMA 1QURH 4DT7B 3E0PB 3RM0H 4GCHF 2UUYA 4U30A 1ARBA 2J9NA 3UR6A 3QN7A 1YBWA 3S69A 1O2LA 1HXFH 1NFWA 5CMXH 1LTOA 3URCA 1MTWA 2RA3A 1SC8U 4TWWA 4H42U 1BUIA 2AGGX 1GVZA 1TPOA 4AOQA 2GMTB 4WMDA 1THSH 2SGEE 1AIXH 1IQEA 2AS9A 1TB6H 5AF9H 3BEFB 1HRTH 1PPFE 4KTUA 4INHA 2W7UA 5ESBA 2QXHA 2BQWB 1H8IH 1IHSH 1EAUA 1Y3WA 1E35B 4ZMAH 1BTZA 1PPZA 2F83A 3SUDA 3PO1C 1ZSLA 2CF8H 5TCCA 1PPBH 3Q3YA 5AFYH 1P57B 1QQ4A 1AKSB 1ZMNA 3ZZ6A 4ZHMU 5C2ZA 3UWIA 1UVUH 1ESAA 1S85A 2A45B 1NT1A 1G37A 4DIIH 3AW0A 3P92A 1P09A 3GCTF 3A83A 5J4QA 1HAIH 1KDQB 3WY8A 1SPJA 1FIWA 3SU5A 5EPYA 3OTJE 1O2SA 4AORA 3SUEA 1V2ST 5C3NA 1CGJE 1IQGA 1DUAA 2O9QA 3RC4A 3TK6A 1QIXB 1AVGH 1LMWB 1BTWA 1CA0B 1TMTH 2P16A 1DSTA 4XOJA 1XXFA 3O8BA 3SJ8A 3SQHE 2XRCA 1FN8A 1EPTA 2FI4E 3S9AA 2BVRH 3U9AH 2HNTC 3E0NB 3KIDU 1BTPA 4NFFA 2RG3A 4UONA 1FN6A 4NA7A 1KXEA 1QRZA 4YT6H 2DE8A 2FPZA 2P95A 5A0AE 1FMGA 3PMHB 1G2LA 3GY6A 2F9UA 1UCYH 1V6DA 2D8WA 4ZROA 1IQFA 4YOIA 1P05A 1TOCB 4A1VA 4D9RA 2EI6A 1LHEH 3HK6B 5EXLA 1GI3A 1F7ZA 4I8GA 2QGRA 3KN2A 4DW2U 2CGAA 2ZGXH 4GCHG 3ODDA 5IYTA 5C1YA 1BBRH 1OOKB 1TAWA 1TPPA 3NWUA 3PLKA 1EZXC 1TYNA 2FOFA 1O33A 1T8OA 4B73A 4K8BA 1W3CA 3LGTA 4WXIA 2ZHWH 4RN6A 2PUXB 2ZCLP 5T6DA 2PGQB 1QB6A 4TPIZ 4LZ1H 1N8OC 1HAZB 1SR5C 2FI5E 1C2IA 2GDDA 1ZGIA 2FO9A 3EYDA 3P8OA 5A0BA 1SGYE 2CN0H 4NIYA 4AYVB 1H8DH 1KLIH 1TNIA 1O2HA 1O3OA 4Y8YA 1CT2E 4XBBA 1T7CA 1P2QA 4K1TA 2UUFB 3S9CA 1BQYA 2VIQA 1O3MA 3RXBA 2PW8H 2I6QA 5BPEA 1DS2E 1KXAA 3AASA 1C2GA 1ZMLA 2W26A 3IITA 5GXPA 4NZQA 1L2EA 1RTLA 2H1UA 1C2HA 3RXMA 1XVMA 3RXCA 3M3SA 1MAYA 4AN7A 3K6YA 3RXTA 3SUFA 1TNJA 1LHDH 3Q3XA 2BZAA 1UCYE 3U1JB 2QXGA 3GYLB 3GY5A 3LGYA 3M36A 4XDEA 1F5RA 1EASA 1P2KA 2HNTF 3TIUA 1YPHC 3ZZ9A 4YZUA 3SGAE 3VGCC 1OX1A 2FODA 2BY6X 1O3LA 3C1KA 5F8TA 1OWDA 3GDUA 5HGGA 3W95A 3GY8A 1C4U2 2GZ8A 4Y11E 1V2OT 4O03A 3RU4D 3TVJB 2HPQH 1TWXB 4ZKSU 1XUGA 1O5EH 1V2NT 2C90B 2VIPA 4JYUH 2QIQA 1K1NA 3UFAA 1P8VC 2G00A 2WPHS 4B2CA 5I46H 2QA9E 3QTOH 1V2RT 1AMHA 2A31A 4FVBA 1NTPA 1S83A 2QF3A 1O2NA 3LGIA 2BVSH 1FZZA 1MZAA 1PYTD 1Z8GA 3EQ0H 3MO6A 3SNCA 1TRYA 3DD2H 3EA9A 1NRSH 2YNBA 3FANA 1BTHH 2HNTE 3V12A 2FMJA 1KYNA 1ZR0A 3PYHA 3GDVA 1YPMH 4K5ZA 5DP8A 4KP0A 1FLEE 2STBE 2PGBB 3K6ZA 3PMBB 1A1RA 5C1XA 4Y76A 2P94A 3GY4A 4ABJA 1ZPZA 4ESTE 4YTAA 5E0GA 3STJA 9ESTA 1SGFG 2VNTA 5GJ4B 1YLDA 3RMNH 3QX5H 1Y8TA 3RMLH 4I7YH 1FY4A 3K9XB 3D62A 4FVDA 3HPTB 3MU4A 1GBBA 4Q80A 3A7WA 1GHXH 3ZZCA 1C5TA 1TNGA 3SBKA 4JYTA 1SGRE 1OXGA 1Z6EA 2Q1JA 2GV7A 1CGIE 3KQDA 5TCAA 3HKIB 1VGCC 2WYGA 2RCEA 1WUNH 2K1QA 2XW9A 3RXFA 1EZUC 3A89A 3ZZ7A 1RIWC 2XTTB 4GHQA 1L1JA 4Q7ZA 1D6WA 1AQ7A 1MQ5A 1AUJA 2PKAB 3F9GA 1GHAF 2FTLE 3CS0A 7LPRA 1C5WB 4LXBH 4X0WU 2FS8A 1S84A 1FY3A 1H9HE 1SGEE 2OP9A 3BTDE 3ZZBA 3GICB 4INLA 2AYWA 5HM2A 1O2YA 4B75A 4GAWA 2H6MA 1XKBC 4MVNA 1MTUA 2BXUH 4JK6A 4MQAA 1AHTH 1EJMA 1MAXA 2HLCA 1Z71A 3H5CB 2ZC9H 1G30B 1O3IA 2FLRH 5H4IB 2XBVA 2P8OB 2ZQ2A 1QL9A 1A5IA 3SNEA 1K2I1 4DVAU 1ESBA 2FYQA 3EDXB 2FOCA 3ZV9A 1YCPM 2ESTE 8GCHF 1TBRH 3U98H 4Z0KA 1ABIH 1YPHE 2CMYA 1GJAB 1O2KA 1PQ8A 3BEIB 1RFNA 4UEHH 3GY3A 3MH7A 2B9LA 2O8UA 1KTSB 1OP2A 1Y3UA 4I8KA 1VCPA 3GY2A 3E8LA 1NY22 3ITIA 4WVPE 3TH4H 2BD5A 5DP5A 3UNSA 5EQQA 3MNSA 4XE4A 3BG4C 2FEQH 1O2PA 1QRWA 1D9IA 1GBTA 3NPSA 1XXDA 1QJ7B 1O31A 4JYVH 1QRXA 4X1QU 2DE9A 5F6MA 1O3HA 1XUFA 3L6PA 1ELGA 5CHAB 3VB4A 4GLYA 1C2JA 1TQ7B 3V7TA 5JB9S 1C5ZB 4QT8C 1OWJA 5LH8A 2R0KA 3NZIA 3MHWU 4FXGH 4GPGA 3E90B 1AVWA 1P11E 1JWTA 1DPOA 1T4VH 5EGMA 6GCHF 2BOKA 1S0RA 2G8TA 1DT2A 5A8ZA 1OWKA 3A7TA 2BM2A 1KLJH 2Y81A 4CRFA 1O2GH 1YM0A 1DDJA 4KTCA 3PMAB 4OS7A 5E8EH 1L4ZA 2RA0A 4OGXA 4F49A 1O5AB 1XVOA 2Z9LA 2OUAA 4B2AA 3SN8A 3BG8A 2BD7A 2ZECA 4NSYA 1O3FA 1O2QA 1TPSA 3PWCA 1UTLM 1GMCF 5GDSH 1EAXA 2ZFPH 1CBWB 1VITG 3LT3A 1P04A 5DK1A 1GL1A 1AUTC 1QBVH 1A2CH 3NKKA 4IC5A 1PFXC 1DE7H 3SW2B 1BT7A 1GHVH 3RM2H 1HV7A 1MBMA 3F1SB 2TGTA 5DGJA 2ODPA 1K21H 2XBXA 3RXSA 3H7TA 4Y0ZE 3TJUA 5L2YH 1GJ8B 3HGPA 2D2DA 2WUBA 3ZVAA 1GHBF 2ASUB 1CA8B 1BTYA 2BY7X 1C1MA 3RXRA 2J34A 2OC1A 4NIXA 3S7KB 3RXUA 8GCHG 1NRRH 1UVSH 3TITA 1QBNA 1ZJDA 3RDZA 1ZSJA 3AAUA 1Z1IA 1JIRA 3UOPA 1SGDE 1THRH 4ISIH 3UIRA 3SU1A 1EP6A 1XUIA 1O3NA 3A7YA 1WYKA 5PTPA 3NUMA 2WV4A
chains in the Genus database with same CATH superfamily
4NSVA 1K1IA 3TPIZ 5C0TA 5FBIA 1GGDB 1NRNH 2AFQB 5JPMH 1TGNA 3UQVA 1INCA 1BMNH 2JH6D 2ANMH 3P8FA 5DP4A 3TJNA 5HM9A 3FN8A 2BLVA 3EE0B 1TBZH 2VGCC 1FONA 2ZEBA 4WH6A 2PSXA 4X1NU 1EQ9A 4M9FA 2BY9X 2PFEA 2ZDNA 1GCDA 2XXLA 1UTMA 2FOAA 1J14A 2Z7FE 4P02A 1B0EA 1EKBB 1BMMH 5JBAS 3U8TH 1WQSA 4BAQB 1JXPA 2C8XB 4NCYA 3P17H 2BVXH 2ZFTA 4NIVA 1UVTH 2C4FH 1CO7E 1C2FA 1AGJA 1YY3A 2UWOA 3SNAA 3AAVA 3B23B 5IK2D 1IOEA 1VKYA 3QGJA 6GCHG 2HPPH 4ISHH 3CS7A 4E06H 3SNDA 1HGTH 3K2UA 2FI3E 4R0IA 4XRNA 4SGBE 1FAKH 2ZKSA 4YOJA 4AZ2B 4F4OC 2NU3E 1TFXA 2VVVA 5FPYA 3MO9A 2G5VA 5EW2H 3PV4A 1KTTB 1GHZA 2BQ6B 1GMCG 2ZDKA 1BHXB 4CRAA 5B6OA 3M3TA 1O0DH 4BXSA 1YPEH 4SGAE 1LPZB 1J9CH 2HGTH 4O3UA 4MNXA 1EX3A 2IJOB 1FUJA 1SLXB 3OU0A 1LVYA 1GVKB 5KGOA 2GVFA 1P10A 5C94A 5GWZA 1GHBG 1OYTH 3Q76A 4ISNA 1BTUA 1KIGH 3D65E 1LHCH 1K1JA 2QXJA 1LCYA 2UWPA 2V0BA 3UWJH 2YMSB 1DVAH 1MTVA 4JZEH 1WDIA 1BZXE 2WSSD 4R8TB 5AHGH 2QN5T 2VWLA 7KMEH 1F5LA 4WJG2 2EY4C 1H9IE 4LOYH 3MYWA 3RLWH 3R3GB 1LKAA 3DT0H 2CJIA 4IW4E 4OS1A 1CHOF 1RRKA 1E36B 1W8BH 1YLNA 1H1BA 2H5DA 2GMTC 2Z9IA 1AWHB 5DP9A 2CF9H 1C2KA 4Q63A 4WWYA 3D23A 3LDXH 4ACAA 2BDYA 1DY9A 3B8JA 1C1QA 1DFPA 5G4BA 1MD7A 3SO3A 2V3HH 1BHXF 4DIHH 3A8AA 1LO6A 1IQNA 4CRDA 1WU1A 4ABFA 4U2WA 3F6UH 2BZ6H 1Z8IB 3B9FH 1KLTA 1F0UA 1W0JD 4A1TA 2TPIZ 2OQUA 1IQKA 2VH0A 1NPMA 1CSOE 1SQAA 1O3GA 4H4FA 1BJUA 2VIWA 1MTNC 1D3PB 4RT0A 2JDID 3ENSB 1PPHE 2G55A 2RDLA 4TPYA 1GMDF 4DY7B 4WF8A 3NXPA 4NWKA 2F9BH 4Q7YA 1GJBB 1BMLA 1PPCE 3SU6A 1CA0C 5AFZH 2GT7A 1BB0B 1NROH 1QA0A 2R3UA 2G4UA 1EJAA 1QCPA 3OYPA 3VB6A 2TBSA 1PQAA 1DWBH 3M3VA 4VGCB 1Z8RA 1O2ZA 1OHHD 1OKXA 3BN9A 2R9PA 1LHFH 3ZZ5A 5L30H 1MTNB 1HDTH 2P3FH 3QTVH 1SQTA 3TGIE 1QJ6B 5F03A 2D26C 3ATKA 5E2OA 4IN2A 5C20A 2BD3A 4D9QA 1NN6A 1HAVA 3STIA 4DURA 3P6ZB 2A0QB 2A5AA 4JMYA 1S82A 2BMGB 2M5TA 1V2PT 1ZPBA 1AY6H 1JMOH 1GJ6A 2FOEA 3UTUH 1E1RD 1BCUH 5FL7D 4X8UH 1UTJA 3BF6H 1TBQH 1NM6A 3ZZDA 2W6JD 2XNDD 3LH1A 3ZYDA 1QGFA 1QHRB 1GBFA 2LNCA 3QLPH 3MU1A 1GI6A 4ZXXH 1HAOH 1E1QD 5L2ZH 5EQRA 1S6FA 1GDUA 2C93B 2A4OA 2P3UB 2Y82A 5ESTE 5GIBA 1DANH 4UD9H 1C1SA 4IBLH 2FLBH 2UUKB 3ZVEA 2TGDA 1TABE 1CHOG 1HJAB 2W3KA 1SGCA 1KXFA 3BV9B 3MI4A 4K2YA 1Q3XA 5EOKA 4AYYB 3KYFA 3A8BA 4GHTA 1W14U 2R0LA 2QAAA 2D1JA 1DX5M 2GCTB 2CK3D 1O3JA 1GBDA 1Y59T 1C4Y2 1P02A 1T32A 2J38A 5HIZA 1MKWK 2BHGA 4X8TH 3LGVA 4I31A 3RC6A 1EFRD 2UUJB 3M7TA 1AB9B 4ZKRU 1DY8A 3TJVA 2BOHB 2UWLA 3MOCA 2BDHA 2BQ7B 2ALPA 2ZU3A 3CP7A 1ELFA 3RXHA 1H8HD 3A7ZA 3QZQA 1FY5A 5EU8A 5JB8S 1D3DB 1HB0B 3BTEE 1ETTH 1GMDG 1N6YA 2O8TA 1QR3E 3QGNB 3UOUA 1EB1H 4TY7A 1AE8H 3K65B 1O2MA 1V3XA 4ZHLU 2Y5HA 1F2SE 1P0SH 3UAIC 3SGQE 3SV7A 2WPKS 2W5EA 4ZKOU 1DM4B 1ABJH 2WINI 3GCTG 2V3MA 3PMJA 1GJ5H 2Q6GA 1O32A 2XC5A 2VIOA 3ZVGA 3KGPA 3TNTA 4CHAC 3BTWE 1C5VA 1W7GH 1OWIA 3RMOH 2ZFRH 4A6LA 1GJ4H 3MNXA 1FI8A 4I86A 3UR9A 1A4WH 2Y7ZA 3EA7A 3EGKH 1A61H 2A7HA 5DJ7A 1WQVH 3RXIA 4FUHA 4B1TA 1PPGE 4AB9A 2KZ4A 3GCOA 9LPRA 2RFKC 1HAPH 1G3EA 2KM0A 4YESB 2AH4X 2ZG0H 4ABAA 1Y5BT 1IAUA 2ODQA 4RKOB 5BRRE 1BITA 4O3TA 3PB1E 1C1WH 1YPLH 1CHGA 1RD3B 4ZKNU 5DSFA 3TK9A 2BLQA 1DWCH 1QY6A 4CHAB 3TH3H 4Y79A 1Z6JH 1CT0E 3ATIA 4RSPA 3KL6A 3KYGA 1NFYA 5CE1A 4PROA 3RXLA 3W94A 1SQOA 3LJOA 2Y7XA 2ZP0H 2VB0A 3PV5A 5GCHF 2TGPZ 3HK3B 1RTFB 2W3IA 1B5GH 4XBCA 2H9TH 1UMAH 1IQIA 1O36A 3A86A 1WAYB 3UQOA 3M5LA 3ATMA 2B7DH 4Y71A 4CBOA 1C2EA 3KQ5A 1TRNA 1YP9A 3PTNA 1UCYK 3KQBA 1KXCA 3RXQA 2Z9JA 1JOUB 1O37A 4BTUB 3DSGA 5C1UA 1JIMA 2ZDAH 1YKTA 1PPEE 2BDCA 3SNBA 2NU2E 4FUEA 3MU8A 2VIVA 5FX6A 2VVCA 1GHYH 4NGAH 1P2NA 1GL0E 1GBAA 1XUJA 2OD3B 1FIZA 1BBRK 3LIWA 2ZGBH 2JKHA 1O39A 1F92A 4AG1A 2BYAX 5GNDA 3EBNA 4OM9A 7GCHF 3MO3A 4CRBA 4I8LA 2AERH 5K0HA 4CRCA 2GP9B 1HIAA 4ABGA 1RS0A 2BDAA 4JCNA 5DP3A 3SV2H 3T5FH 3DFLA 1UW7A 1ZPCA 1ZGVA 4OS4A 4AG2A 1W11U 2WPMS 1S6HA 2GZ7A 5F8ZA 1GDNA 2ZGHA 4YLUA 5A0CA 3ZVCA 4UFEH 3KQEA 1MUEB 2YNAA 1EZSC 1MU8B 1VITH 5C17A 2P8OC 3BTME 2V7QD 4OS2A 1TMUH 2EEKA 1CE5A 5TJXA 2AMQA 1ANBA 3U8RH 3W1EA 2QCYA 1Z8JB 3UY9A 1ZYOA 3TH2H 4U01A 1DUEA 1FPCH 1BIOA 3QO6A 4CBNA 2GKVE 1MKXK 1XX9A 2XCFA 3F0PA 3TNSA 5F8XA 1P03A 2IJD1 2PR3A 1L1GA 2PHBA 2F91A 1ZRKA 3BIVH 1FPHH 1O2IA 5A8XA 1NC6A 3PWBA 1SGQE 2ZWLH 4AGKA 3F3BA 3SOSA 4X2VA 2V6NA 5GCHG 3MNBA 1ORFA 1HYLA 1O2VA 2AHME 1C1NA 1UK2A 1CQQA 1P3EA 2ZGJA 4TYDA 1W13U 4IMQA 1A0HB 1HCGA 1ZOMA 2GV6A 4UDWH 5ETXA 2KCYA 1C2MA 1P9UA 3F9EA 3Q3KA 1RXPA 2EI7A 3EE7A 1FDPA 1ETSH 4XSKU 4MPVA 3PROA 3ZZ4A 3FVFB 5CHAC 5EIYA 1DLKB 3S0NA 1FNIA 1GCTC 2IPQX 2BDIA 3LC5A 2G51A 1LVBA 1AU8A 5I25A 1O2XA 3LJJA 3U8OH 1AFQB 1AKSA 1A3EH 5LPRA 1FXYA 1SGNE 3HGNA 3JZ2B 2H9EH 1XUKA 2LPRA 3T28A 2BTCE 1K22H 4ABIA 1HAVB 1KDQA 1EJNA 4WMFA 2CHAB 4YXWD 2Q6FA 1C9TA 7GCHG 3O8RA 4AFQA 1EPTB 1UJ1A 3H7OA 1GCTB 3VB3A 1TGTA 5KECA 1TLDA 1A7SA 3M37A 1IQJA 2FS9A 3FP8E 1CBWC 6CHAC 2BY8X 1D3QB 1TGBA 5T6GA 3P70B 4CRGA 1SGFA 4CREA 4J2YB 2SGDE 1HJ9A 3O8DA 1NU9A 2A1DB 1G3BA 3SU0A 5JBCS 1ARCA 2BX3A 1G9IE 1FY8E 3RXOA 1SI5H 4Y8XA 1GHAG 1WBGB 2PUQH 1A46H 5C5NA 3A82A 1SBWA 3I78A 1K1OA 4KGAA 3ZVDA 1OPHB 5EXMA 6CHAB 1ELAA 1ESTA 1A5GH 1VCQA 4INKA 4Y7AA 2AGIX 1YLCA 5E0HA 1Q2WA 1NFXA 1QNJA 1AFEH 3OY5U 1ANDA 4ABBA 2L6OA 1ANEA 3BTKE 5T1VA 1Y3XA 3ATWA 4A7IB 3GCNA 4FUDA 3RXKA 3QK1A 2ZO3H 1O2JA 1Z1JA 1GGDC 2FIRH 2ZFQH 4CR9A 1QQUA 1O3PB 1Q31A 3DFJA 1C4V2 5DPAA 4X6NA 2QE7D 1NRPH 1M9UA 2TIOA 1MABB 4Z1MD 1J17T 1AZ8A 4Q2KA 2JH0D 1W12U 1BMAA 2JJ1D 2PLXA 1OYQA 4NZLA 2K8IA 3ZVFA 2XBYA 5E2PA 4AX9H 3MMGA 3UPEA 3BTGE 2ZTXA 1ELTA 2J4IA 3M7QA 4YM9A 1BOQA 1TX8A 5DG6A 5DN6D 1GI9B 2SGPE 2OBQA 3A80A 2BY5X 1TA2A 1O5DH 3MQKC 5AVDA 2Y5GA 1QA7A 1GBMA 2WPIS 2QXIA 2BD9A 1C1PA 3UB0A 2V3OH 5J4SA 3SU2A 5C5OA 4FU7A 4HGCA 1GBCA 1GI7B 1V2WT 1S0QA 1T8MA 2H9HA 1HAHH 2R2WU 3KEEA 2A2QH 3UNQA 1C5PA 2G81E 2FOMB 5FCKA 4FUBA 2SNWA 1SVPA 2HWLB 5E0JA 4UFDH 1F5KU 4UFGH 4D7FA 1ELCA 2XC4A 3LONA 1O2RA 1SKYE 2ZU2A 5JDUB 1V2TT 4DOQA 1GBEA 1P9SA 1OWEA 3PV2A 1DOJA 1AI8H 1ETRH 1QBOA 3BTTE 4B6FA 4X1PU 1GG6B 1SGTA 3PLPA 1THPB 1GI2A 1OS8A 3LU9B 2F3CE 2YMSC 4ZAEA 1P2MA 2P93A 1MBQA 3UUZA 1BJVA 1G2MA 1ZSKA 3E3TA 3RXEA 2ZTZA 1RGQA 2A32A 4O97A 2IPHA 4H6TA 1YWUA 4K60A 1O3CA 1QJ1B 3N7DA 4AB8A 3R0FA 2WZQA 4MPXA 1GI8B 1FV9A 2VU8E 1W2KH 1YCPK 1OP0A 2F4LA 3OAAD 1YPJH 2THFB 4BAOB 2XWBI 2ZI2H 5DP6A 3SI3H 1IQHA 4JZDH 2ZHQH 4HZHA 3VB7A 2F9NA 4LZ4B 4E05H 1SSXA 4MPUA 1O38A 3Q00A 4UE7H 2ANYA 4HFPB 1V2MT 4Y10E 4MDSA 2VWMA 4JZ1A 3GCHB 4MTBA 3SJ9A 3D49H 4ASHA 1XM1A 6ESTA 3O8CA 3BEUA 5T6FA 2Z94A 3F2FA 5A09A 1UVPA 3N7OA 3ZYEA 1HAGE 1SMFE 3U69H 2ZU4A 3DCLA 1ACBE 1TOMH 3SZNA 4K8YA 3N7EA 2JJ2D 1XKAC 4B74A 1G32B 2QC2A 2PKAA 2OINA 1X7AC 1QTFA 3FZDA 2GX4A 3RC5A 4I8JA 1VZQH 1FJSA 1TGSZ 4CH8B 4VGCC 1VJ9U 2XCNA 2HLDD 3PLBA 3EA8A 1BA8B 1EB2A 3VXFH 1C2DA 2A7CA 3SJOA 2EA3A 3RLYH 4YO9A 2QF4A 2O8MA 4MPWA 5KEDA 1LQEA 1LQDB 2SGFE 2Z9KA 1C2LA 4ABDA 1ZTJA 4BXWA 2ZDMA 1P01A 2FYRA 2KX4A 3I29A 3M7UA 3EAJA 1GI1A 4OGYA 4X2WA 5EODA 1TQ0B 4DG4A 1QB9A 2Z6BD 4D7GA 1V2KT 3V3MA 2V35A 2WV5A 3MH6A 1MQ6A 1K9OE 2ZFFH 3F9HA 4Z6AH 2J98A 1O3AA 3PRBA 2WUCA 2ZIQH 2G52A 1ZHRA 3PM3A 4NIWA 3ESTA 1HJAC 1NESE 1WTHD 2W7SA 2ZHDA 1CGHA 1C5YB 3QDZB 1AZZA 4BAKB 4AFZA 4A1XA 3FFGA 4TWYA 4JZIA 2KFWA 3L33A 1F0RA 1YGCH 3V0XA 1PYTC 1SOTA 2GCTC 4DCDA 1LDTT 3LOXA 1Y5UT 4F55A 5EQSA 1OWHA 3I77A 2ZCHP 2HVYB 1T8NA 3PO1B 2J95A 4Y0YE 4X6OA 2G5NA 3A8DA 2STAE 1DICA 4A5TS 1CT4E 1NS3A 1SLUB 1V2LT 1AB9C 1SOZA 1K1PA 1KSNA 2ZZUH 4NA9H 3S7HB 2OC0A 2Q6DA 3MFJA 3SU4A 4YOGA 5FPSA 1TNHA 1CU1A 3SI4H 1NU7B 1C5XB 4IS5A 1TNKA 1QZ8A 4CR5A 1Z7KA 2XYAA 1HAXB 5LPFA 2AEIH 3ZVBA 3GDSA 1E38B 2XC0A 1GI5A 1AO5A 2R3YA 2SGAA 4Y7BA 4I8HA 3RXJA 1LVOA 2GT8A 4H6SB 4I33A 5EG4A 4X1SU 2BD4A 2HALA 1L1NA 2VINA 2FOBA 2H5CA 4K3JA 1EP5A 4A92A 1GBHA 2C8YB 1TA6A 1UHBA 1TONA 1UTKA 1QL8A 4D8NA 2PP6A 1MZDA 1HPGA 4K1EA 3IWMA 1MTSA 1HAYB 3NCLA 2ZF0H 4GVUA 4O9VA 1UTNA 2HVXA 3OY6U 1RTKA 2AIPA 1P2JA 1A3BH 2QV1A 1BRCE 4X1RU 1E0FD 3ZZAA 1ZHPA 4HG6A 2ZHEH 2BDBA 3BTQE 1GBIA 2GCHF 2WPJS 3OSYA 3SV8A 1GI0A 2BX4A 4BTIB 1XMNB 2JETC 1SQRA 3MH5A 1ELVA 1SGIB 4X2YA 4YT7H 1MMJN 4ZHAA 1TMBH 2TGAA 3M5NA 4OS5A 1COWD 5K7RA 1VCWA 1PQ5A 3LC3A 4NFEA 1N8OB 1O3KA 1ZZZA 1O35A 1SHYA 4GSOA 1N6XA 5T3HA 1P06A 2SNVA 4ABEA 2XNIA 3FP6E 1S81A 2FP7B 3SHAH 2HRVA 1L0ZA 1MKXH 2JETB 3GYMA 4K1SA 1BRAA 3BTHE 3FZZA 2L74A 2B5TB 3OEHD 1B7XB 1D6RA 2OC7A 4IGDA 4MNVA 2FOGA 3AW1A 3HKJB 1GJCB 2ZA5A 3OE7D 4M7GA 4ZXYH 1LHGH 3QUMP 1LKBA 4JK5A 2Y5FA 3RU4T 1BBRE 1O2TA 3RU4E 4RT1A 4ZUHA 1E34B 2OTVA 2OBOA 1D3TB 3LPRA 4BOHA 1C1OA 3RXGA 3TGKE 2SFAA 4HTCH 1CVWH 1E79D 1P2IA 1DLEA 3PTBA 1ELEE 1IQLA 4IC6A 1OP8A 3MU0A 3KF2A 1O3DA 1UK4A 2C3SA 2F43B 1C5RA 2I6SA 3SV9A 1GPZA 3M5OA 3N99A 1S6LA 2ZNKH 5HYOA 2J97A 2WPDD 3VGCB 4WMEA 1C5UA 1V2UT 3P8NA 1C1VH 2ILNA 1C1UH 4TSFD 2AMDA 2IOTA 1C1RA 1SG8B 3DHKH 4FUFA 4MNWA 1QB1A 2A2XH 1IHTH 3GOVB 4YLQH 2QYIA 4MLFB 3LGUA 1JRTA 4Q7XA 1HLTH 8KME2 1TX7A 2AGEX 5FHTA 2FTMA 3IG6B 1U6QA 2ZTYA 3HATH 1ZTKA 3KQCA 2NU1E 3SHCH 4FUIA 2CV3A 3VEQB 4X8VH 3F9FA 4KELA 2R2MB 1SLVB 2VH6A 3NK8A 3TLOA 4BAHB 2VWNA 2GCHG 1UO6A 3KCGH 2ZHFH 1UK3A 3UNRA 3TU7H 5FBEA 3MWIU 1TX6A 1E37B 1ELBA 3A84A 2NU0E 2B8OH 3UREA 4CH2B 2EI8A 1YPGH 1H8ED 2XBWA 1HNEE 1TIOA 3ZZ3A 2OLGA 4NG9H 2F9VA 1MCTA 1JBUH 1NBME 3TJOA 4OS6A 1TALA 2FDAA 3KHVA 2KAIA 3E91A 1W0YH 4XBDA 1H4WA 1DSUA 2O8WA 3OX7U 1LPGB 5FPTA 2BD8A 1HBTH 1SFIA 3FAOA 3MTYA 2LIZA 1DWDH 2Y6TA 4KKDA 1O5CB 1C5NH 4WY3A 1ZHMA 4X6MA 2ZPQA 1WSSH 1G36A 5FXLA 2H2ZA 3T27A 2ZU5A 3LH3A 2J2UA 4Q4LA 5EW1H 1VITF 4I32A 4BTTB 3VPKA 1TRMA 3ZZ8A 1O34A 1AFQC 1VGCB 3A8CA 5FAHA 2FX6A 1O5BB 1A0LA 1GBKA 1VR1H 5JBBS 1EXFA 1RIWB 2EC9H 1HXEH 2J92A 1GWAA 1MH0A 5GPIB 1WXRA 5IDKA 1JRSA 2A7JA 2CHAC 2FOHA 1EZQA 1O5FH 3CNRA 3SUGA 3E1XB 1C5QA 1YF4A 1QFKH 2FXRA 1EPTC 3L3TA 4IMZA 1V2JT 2Z3DA 2BXTH 4NWLA 7ESTE 1BMFD 3SGBE 2BB4A 4ZCNA 1OSSA 4DJZB 3A85A 2XWAA 2AMPA 3AVZA 2C8WB 1WV7H 3A7VA 5EPNA 3QWCH 2K0QA 4RKJB 2VWOA 1ZLRA 1DWEH 1GMHF 1DITH 1YC0A 4THNH 3T26A 1UTQA 1LPKB 3FP7E 2FM2A 1K0HA 8LPRA 2ALVA 1P3CA 3ZV8A 3TGJE 4BNRA 1KY9A 1F0SA 1GBJA 1D4PB 1W10U 2ZFSA 3P8GA 3RXAA 8ESTE 4AGJA 2ANKH 2PV9B 1EOLA 3M5MA 5DP7A 1Y3VA 2PSYA 1GDQA 1AE5A 3A81A 2FWWA 1W7XH 1MCVA 4FU9A 3SJIA 4ZH8A 2GZ9A 1DXWA 1K1LA 2Y80A 4K69A 3U1IB 1VJAU 1BRBE 1SFQB 4AFSA 2A4GA 2BLWA 2J94A 1KXDA 4JZFH 1SLWB 6LPRA 2ZCKP 3BTFE 1AVXA 3T62A 1AWFH 1GJ9B 1YPKH 3GY7A 3BG4B 1A0JA 4FUCA 4GUXA 1BRUP 3ODFA 5ABWA 1EUFA 2BLOA 1A5HA 5DKMA 2PKSC 2FESH 3M61U 1ANCA 1GBLA 1T8LA 1BDAA 1ELDE 4X6PA 5HIYA 2QY0B 2A5IA 1LVMA 1S5SA 3QZRA 5EXNA 2ODYB 3DSPA 2Z9GA 1NFUA 2NWNA 1O2UA 4WXVA 2B0FA 1NZQH 3U28C 2YOLA 2AIQA 2WPLS 1K1MA 1K28D 1HFDA 1UHBB 3LGWA 1YCPH 2ZDLA 3KNXA 3MNCA 4KTSA 1FAXA 1NO9H 2OC8A 2Z3CA 1PJPA 1SHHB 1O3BA 4UFFH 4FUJA 1MU6B 1T31A 2PKSB 3P95A 3E16B 5A8YA 5L6NH 2C8ZB 1W0ZU 4X8SH 5HXFA 4FU8A 5SGAE 1G3CA 5FX5A 4FETA 4Y6DA 3ELAH 5FCRA 2QF0A 1O2OA 1KXBA 2WHXA 4LK4A 3RXDA 3RUOA 3RXVA 2OXSA 1L4DA 2ZQ1A 4AFUA 3TK5A 3SJKA 2DUCA 5LPEA 3S9BA 1NRQH 3A88A 2PTCE 5C67A 1ZMJA 1C5SA 2IN2A 2G4TA 1F0TA 1XUHA 1SB1H 4HI3A 2FX4A 3T2NA 2ULLA 1GMHG 4IN1A 2ZU1A 2Z3EA 3Q77A 1P12E 1EAIA 3A87A 1Y3YA 3DUXH 4BAMB 1BTXA 1GG6C 2GGVB 3C27B 2GDEH 1B0FA 2OCVB 1IQMA 1ID5H 2BDGA 1ZTLA 1HUTH 1Y5AT 2SGQE 2ZPSA 3A7XA 3MU5A 1J16A 2W6ID 1H9LB 4WH8A 1GHWH 1EAWA 2OQ5A 1WOFA 4ISLA 4J1YA 4D76A 2F9OA 4ABHA 1DXPA 3SU3A 1O3EA 3CENA 1FQ3A 4XFQA 2WV9A 1UTPA 1GJ7B 1WCZA 2NU4E 5EJ1A 1MD8A 1V2VT 4BANB 3LKWA 1UTOA 1AD8H 3DA9B 1GJDB 1TGCA 2CXVA 2O8LA 3SQEE 3MH4A 4MG3A 1QL7A 2VGCB 1TPAE 1J15A 2JH5D 1O30A 1C5MD 2A4QA 1N1LA 1GI4A 1TNLA 2VVUA 2ZGCA 3SZEA 5JYIA 5DO4H 1WTGH 3VB5A 3GCHC 1SGPE 2VJ1A 3SV6A 1C9PA 2GD4B 1SL3A 1TE0A 2WYJA 2VIDA 1YYY1 2ZDVH 1P2OA 2FZZA 4DGJA 1J8AA 2ANWA 1EATA 1PQ7A 1C1TA 1ZJKA 1O5GH 3BSQA 3AK5A 2PTNA 3G01A 3BIUH 4TY6A 1C5LH 4U32A 4XD7D 2HOBA 2A4RA 3T29A 1HIAB 1EOJA 1UVOA 1T4UH 4MNYA 3VXEH 5A2MH 5HMAA 2K7XA 2PWXA 3M35A 3T25A 3RXPA 4ISOA 3E6PH 1GVLA 2GTBA 3RP2A 4B76A 3OTPA 3URDA 5LGOA 2ZPRA 2F9PA 3GISB 2A5KA 1ZRBA 3F68H 3OFND 4B2BA 4E7NA 4Y8ZA 1O2WA 3SORA 1G3DA 4NA8A 4E7RG 1C5OH 1RJXB 3OEED 2P3TB 3V13A 3RMMH 1HJ8A 2KAIB 1AN1E 4B71A 1MKWH 1FY1A 2P59A 4FUGA 3ATLA 3JZ1B 4X2XA 1V2QT 3VFEA 2BD2A 5JBTA 2TRMA 1QURH 4DT7B 3E0PB 4B6EA 5C0UA 3RM0H 4GCHF 2UUYA 4U30A 2JIZD 1ARBA 2J9NA 3UR6A 3FO8D 3QN7A 1YBWA 2KCPA 3S69A 1O2LA 1HXFH 1NFWA 5CMXH 1LTOA 3PRDA 3URCA 1MTWA 4ACBA 2RA3A 1SC8U 4TWWA 4H42U 1BUIA 2AGGX 1GVZA 1TPOA 4AOQA 2GMTB 4WMDA 1THSH 2SGEE 1AIXH 1IQEA 2AS9A 1TB6H 5AF9H 3BEFB 1HRTH 1PPFE 4KTUA 4INHA 2W7UA 5ESBA 2QXHA 2BQWB 1H8IH 1IHSH 1EAUA 5HKKD 1Y3WA 1E35B 4ZMAH 1BTZA 1PPZA 2F83A 3SUDA 3PO1C 1ZSLA 2CF8H 5TCCA 1PPBH 3Q3YA 5AFYH 1P57B 1QQ4A 1AKSB 1ZMNA 3ZZ6A 4ZHMU 5C2ZA 3UWIA 2KCOA 1UVUH 1ESAA 1S85A 2A45B 1NT1A 1G37A 4DIIH 3AW0A 3P92A 1P09A 3GCTF 3A83A 5J4QA 1HAIH 2KR7A 1KDQB 3WY8A 1SPJA 1FIWA 3SU5A 5EPYA 3OTJE 1O2SA 4AORA 3SUEA 1V2ST 5C3NA 1CGJE 1IQGA 1DUAA 2O9QA 3RC4A 3TK6A 1QIXB 1AVGH 1LMWB 1BTWA 1CA0B 1TMTH 2P16A 1DSTA 4XOJA 1XXFA 3O8BA 3SJ8A 3SQHE 2XRCA 1FN8A 1EPTA 2FI4E 2YMSD 3S9AA 2BVRH 3U9AH 2HNTC 3E0NB 3KIDU 1BTPA 4NFFA 2RG3A 4UONA 1FN6A 4NA7A 1KXEA 1QRZA 4YT6H 2DE8A 2FPZA 2P95A 5A0AE 1FMGA 3PMHB 1G2LA 3GY6A 2F9UA 1UCYH 1V6DA 2D8WA 4ZROA 1IQFA 4YOIA 1P05A 1TOCB 4A1VA 2J5UA 4D9RA 2EI6A 1LHEH 3HK6B 5EXLA 1GI3A 1F7ZA 4I8GA 2QGRA 3KN2A 4DW2U 1KMHB 2CGAA 2ZGXH 4GCHG 2KCAA 3ODDA 5IYTA 5C1YA 1BBRH 3SYJA 1OOKB 1TAWA 1TPPA 3NWUA 3PLKA 1EZXC 1TYNA 2FOFA 1O33A 1T8OA 4B73A 4AC9A 4K8BA 1W3CA 3LGTA 4WXIA 2ZHWH 4RN6A 2PUXB 2ZCLP 5T6DA 2PGQB 1QB6A 4DT4A 4TPIZ 4LZ1H 1N8OC 1HAZB 1SR5C 2FI5E 1C2IA 2GDDA 1ZGIA 2FO9A 3EYDA 3P8OA 5A0BA 1SGYE 2CN0H 4NIYA 4AYVB 1H8DH 1KLIH 1TNIA 1O2HA 1O3OA 4Y8YA 1CT2E 4XBBA 1T7CA 1P2QA 4K1TA 2UUFB 3S9CA 1BQYA 2VIQA 1O3MA 3ZIAD 3RXBA 2PW8H 2I6QA 5BPEA 1DS2E 1KXAA 3AASA 1C2GA 1ZMLA 2W26A 3IITA 4FOUC 5GXPA 4NZQA 1L2EA 1RTLA 2H1UA 1C2HA 3RXMA 1XVMA 3RXCA 2M2AA 3M3SA 1MAYA 4AN7A 3K6YA 3RXTA 3SUFA 3WWBA 1TNJA 1LHDH 3Q3XA 2BZAA 1UCYE 3U1JB 2QXGA 3GYLB 3GY5A 2QF5A 3LGYA 3M36A 4XDEA 1F5RA 1EASA 1P2KA 2HNTF 2XOKD 3NRLA 3TIUA 1YPHC 3ZZ9A 4YZUA 3SGAE 3VGCC 1OX1A 2FODA 2BY6X 1O3LA 3C1KA 5F8TA 3DSOA 1OWDA 3GDUA 5EJLA 5HGGA 3W95A 3GY8A 1C4U2 2GZ8A 4Y11E 1V2OT 4O03A 3RU4D 3WWFA 3TVJB 2HPQH 1TWXB 4ZKSU 1XUGA 1O5EH 2GJGA 1V2NT 2C90B 2VIPA 4JYUH 2QIQA 3FKSD 1K1NA 1W0KD 3UFAA 1P8VC 2G00A 2WPHS 4B2CA 5I46H 2QA9E 3QTOH 1V2RT 1AMHA 2A31A 4FVBA 1NTPA 1S83A 2QF3A 1O2NA 3LGIA 2BVSH 1FZZA 1MZAA 1PYTD 1Z8GA 3EQ0H 3MO6A 3SNCA 1TRYA 3DD2H 3EA9A 1NRSH 2YNBA 3FANA 1BTHH 2HNTE 1FX0B 3V12A 4F48B 2FMJA 1KYNA 1ZR0A 3FOAA 3PYHA 3GDVA 1YPMH 4K5ZA 5DP8A 4KP0A 1FLEE 2STBE 2PGBB 3F2HA 3K6ZA 3PMBB 1A1RA 5C1XA 4Y76A 2P94A 3GY4A 4ABJA 1ZPZA 4ESTE 4YTAA 5E0GA 3STJA 9ESTA 1SGFG 2VNTA 5GJ4B 1YLDA 3RMNH 3QX5H 1Y8TA 3RMLH 4I7YH 1FY4A 3K9XB 3D62A 4FVDA 3HPTB 3MU4A 1GBBA 4Q80A 3A7WA 1GHXH 3ZZCA 1C5TA 1TNGA 3SBKA 4JYTA 1SGRE 1OXGA 1Z6EA 2Q1JA 2GV7A 1CGIE 3KQDA 5TCAA 3HKIB 1VGCC 2WYGA 1NBMD 2RCEA 1WUNH 2K1QA 2XW9A 3RXFA 5B6LA 1EZUC 3A89A 3ZZ7A 1RIWC 2XTTB 5CDFE 4GHQA 4TT3D 1L1JA 4Q7ZA 1D6WA 1AQ7A 1MQ5A 1AUJA 2PKAB 3F9GA 1GHAF 2FTLE 3CS0A 7LPRA 1C5WB 4LXBH 4X0WU 2FS8A 1S84A 1FY3A 1H9HE 2EQNA 1SGEE 2OP9A 3BTDE 3ZZBA 5EJZA 3GICB 4INLA 2AYWA 5HM2A 1O2YA 4B75A 4GAWA 2H6MA 1XKBC 4MVNA 1MTUA 2BXUH 4JK6A 4MQAA 3WW7A 1AHTH 1EJMA 2OK5A 1MAXA 2HLCA 1Z71A 3H5CB 2ZC9H 1G30B 1O3IA 2FLRH 5H4IB 2XBVA 2P8OB 2ZQ2A 1QL9A 3F2GA 1A5IA 3SNEA 1K2I1 4DVAU 1ESBA 2FYQA 3EDXB 2FOCA 3ZV9A 1YCPM 2ESTE 8GCHF 1TBRH 3U98H 4Z0KA 1ABIH 1YPHE 2CMYA 1GJAB 1O2KA 1PQ8A 3BEIB 1RFNA 4UEHH 3GY3A 3MH7A 2B9LA 2O8UA 1KTSB 2J98B 1OP2A 1Y3UA 4I8KA 1VCPA 3GY2A 3E8LA 1NY22 3ITIA 4WVPE 3TH4H 2BD5A 5DP5A 3UNSA 5EQQA 3MNSA 4XE4A 3GS9A 3BG4C 2FEQH 1O2PA 1QRWA 2LELA 1D9IA 1GBTA 3NPSA 1XXDA 1QJ7B 1O31A 3H09A 4JYVH 1QRXA 4X1QU 2DE9A 5F6MA 1O3HA 1XUFA 3L6PA 1ELGA 5CHAB 3VB4A 4GLYA 1C2JA 1TQ7B 3V7TA 5JB9S 1C5ZB 4QT8C 1OWJA 5LH8A 2R0KA 3NZIA 3MHWU 4FXGH 2VBCA 3E90B 1AVWA 1P11E 4GPGA 1JWTA 1DPOA 1T4VH 5EGMA 6GCHF 2BOKA 1S0RA 2G8TA 1DT2A 4P00A 5A8ZA 1OWKA 3A7TA 2BM2A 1KLJH 2Y81A 4CRFA 1O2GH 1YM0A 1DDJA 4KTCA 3PMAB 4OS7A 5E8EH 1L4ZA 2RA0A 4OGXA 4F49A 1O5AB 1XVOA 2Z9LA 2OUAA 4B2AA 3SN8A 2LP6A 2BD7A 2ZECA 3BG8A 4NSYA 1O3FA 1O2QA 1TPSA 3PWCA 1UTLM 3F0OA 1GMCF 5GDSH 1EAXA 2ZFPH 1CBWB 1VITG 3LT3A 1P04A 5DK1A 1GL1A 1AUTC 1QBVH 1A2CH 3NKKA 4IC5A 1PFXC 1DE7H 3SW2B 1BT7A 1GHVH 3RM2H 5CHBA 1HV7A 1MBMA 3F1SB 2TGTA 5DGJA 2ODPA 1K21H 2XBXA 3VG8A 3RXSA 3H7TA 4Y0ZE 3TJUA 2RDEA 1GJ8B 5L2YH 3HGPA 2D2DA 4RI0A 2WUBA 3ZVAA 1GHBF 2ASUB 1CA8B 1BTYA 2BY7X 4ASUD 1C1MA 3RXRA 2J34A 2OC1A 4NIXA 3S7KB 3RXUA 8GCHG 1NRRH 1UVSH 3TITA 1QBNA 1ZJDA 3RDZA 1ZSJA 3AAUA 1Z1IA 5F53A 1JIRA 3UOPA 1SGDE 1THRH 4ISIH 3UIRA 3SU1A 1EP6A 1XUIA 1O3NA 3A7YA 1WYKA 5PTPA 3NUMA 2WV4A
chains in the Genus database with same CATH topology
4NSVA 1K1IA 3TPIZ 5FBIA 1GGDB 1NRNH 2AFQB 5JPMH 1TGNA 3UQVA 1INCA 1BMNH 2JH6D 2ANMH 3P8FA 5DP4A 3TJNA 5HM9A 2BLVA 3EE0B 1TBZH 2VGCC 1FONA 2ZEBA 4WH6A 2PSXA 4X1NU 1EQ9A 2BY9X 2PFEA 2ZDNA 1GCDA 2XXLA 1UTMA 2FOAA 1J14A 2Z7FE 1B0EA 1EKBB 1BMMH 5JBAS 3U8TH 1WQSA 4BAQB 1JXPA 2C8XB 4NCYA 3P17H 2BVXH 2ZFTA 4NIVA 1UVTH 2C4FH 1CO7E 1C2FA 1AGJA 2UWOA 3AAVA 3SNAA 3B23B 3T5FH 1IOEA 3QGJA 6GCHG 2HPPH 4ISHH 3CS7A 4E06H 3SNDA 1HGTH 3K2UA 2FI3E 4R0IA 4SGBE 1FAKH 2ZKSA 4YOJA 4AZ2B 4F4OC 2NU3E 1TFXA 2VVVA 5FPYA 3MO9A 2G5VA 5EW2H 3PV4A 1KTTB 1GHZA 2BQ6B 1GMCG 2ZDKA 1BHXB 4CRAA 5B6OA 3M3TA 1O0DH 4BXSA 1YPEH 4SGAE 1LPZB 1J9CH 2HGTH 4O3UA 4MNXA 1EX3A 2IJOB 1FUJA 1SLXB 3OU0A 1LVYA 1GVKB 2GVFA 1P10A 5GWZA 1GHBG 1OYTH 3Q76A 4ISNA 1BTUA 1KIGH 3D65E 1LHCH 1K1JA 2QXJA 1LCYA 2UWPA 2V0BA 3UWJH 1DVAH 1MTVA 4JZEH 1BZXE 4R8TB 5AHGH 2QN5T 2VWLA 7KMEH 1F5LA 4WJG2 1H9IE 4LOYH 3MYWA 3RLWH 3R3GB 1LKAA 3DT0H 2CJIA 4IW4E 4OS1A 1CHOF 1RRKA 1E36B 1W8BH 1H1BA 2H5DA 2GMTC 2Z9IA 1AWHB 5DP9A 2CF9H 1C2KA 4WWYA 3D23A 3LDXH 2BDYA 1DY9A 3B8JA 1C1QA 1DFPA 5G4BA 1MD7A 3SO3A 2V3HH 1BHXF 4DIHH 3A8AA 1LO6A 1IQNA 4CRDA 1WU1A 4ABFA 4U2WA 3F6UH 2BZ6H 1Z8IB 3B9FH 1KLTA 1F0UA 4A1TA 2TPIZ 2OQUA 1IQKA 2VH0A 1NPMA 1CSOE 1SQAA 1O3GA 4H4FA 1BJUA 2VIWA 1MTNC 1D3PB 3ENSB 1PPHE 2G55A 2RDLA 4TPYA 1GMDF 4DY7B 4WF8A 3NXPA 4NWKA 2F9BH 4Q7YA 1GJBB 1BMLA 1PPCE 3SU6A 1CA0C 5AFZH 2GT7A 1BB0B 1NROH 1QA0A 2R3UA 2G4UA 1EJAA 1QCPA 3OYPA 3VB6A 2TBSA 1PQAA 1DWBH 3M3VA 4VGCB 1Z8RA 1O2ZA 1OKXA 3BN9A 2R9PA 1LHFH 3ZZ5A 5L30H 1MTNB 1HDTH 2P3FH 3QTVH 1SQTA 3TGIE 1QJ6B 5F03A 2D26C 3ATKA 5E2OA 4IN2A 5C20A 2BD3A 4D9QA 1NN6A 1HAVA 3STIA 4DURA 3P6ZB 2A0QB 2A5AA 4JMYA 1S82A 2BMGB 2M5TA 1V2PT 1ZPBA 1AY6H 1JMOH 1GJ6A 2FOEA 3UTUH 1BCUH 4X8UH 1UTJA 3BF6H 1TBQH 1NM6A 3ZZDA 3LH1A 3ZYDA 1QGFA 1QHRB 1GBFA 2LNCA 3QLPH 3MU1A 1GI6A 4ZXXH 1HAOH 5L2ZH 5EQRA 1S6FA 1GDUA 2C93B 2A4OA 2P3UB 2Y82A 5ESTE 5GIBA 1DANH 4UD9H 1C1SA 4IBLH 2FLBH 2UUKB 3ZVEA 2TGDA 1TABE 1CHOG 1HJAB 2W3KA 1SGCA 1KXFA 3BV9B 3MI4A 4K2YA 1Q3XA 5EOKA 4AYYB 3A8BA 4GHTA 1W14U 2R0LA 2QAAA 2D1JA 1DX5M 2GCTB 1O3JA 1GBDA 1Y59T 1C4Y2 1P02A 1T32A 2J38A 1MKWK 2BHGA 4X8TH 3LGVA 4I31A 3RC6A 2UUJB 3M7TA 1AB9B 4ZKRU 1DY8A 3TJVA 2BOHB 2UWLA 3MOCA 2BDHA 2BQ7B 2ALPA 2ZU3A 3CP7A 1ELFA 3RXHA 3A7ZA 3QZQA 1FY5A 5EU8A 5JB8S 1D3DB 1HB0B 3BTEE 1ETTH 1GMDG 1N6YA 2O8TA 1QR3E 3QGNB 3UOUA 1EB1H 4TY7A 1AE8H 3K65B 1O2MA 1V3XA 4ZHLU 2Y5HA 1F2SE 1P0SH 3SGQE 3SV7A 2WPKS 2W5EA 4ZKOU 1DM4B 1ABJH 2WINI 3GCTG 3PMJA 1GJ5H 2Q6GA 1O32A 2XC5A 2VIOA 3ZVGA 3KGPA 3TNTA 4CHAC 3BTWE 1C5VA 1W7GH 1OWIA 3RMOH 2ZFRH 4A6LA 1GJ4H 3MNXA 1FI8A 3UR9A 1A4WH 2Y7ZA 3EA7A 3EGKH 1A61H 2A7HA 5DJ7A 1WQVH 3RXIA 4FUHA 4B1TA 1PPGE 4AB9A 9LPRA 3GCOA 1HAPH 1G3EA 4YESB 2AH4X 2ZG0H 4ABAA 1Y5BT 1IAUA 2ODQA 4RKOB 5BRRE 1BITA 4O3TA 3PB1E 1C1WH 1YPLH 1CHGA 1RD3B 4ZKNU 3TK9A 2BLQA 1DWCH 1QY6A 4CHAB 3TH3H 4Y79A 1Z6JH 1CT0E 3ATIA 4RSPA 3KL6A 5CE1A 1NFYA 4PROA 3RXLA 3W94A 1SQOA 3LJOA 2Y7XA 2ZP0H 2VB0A 5GCHF 2TGPZ 3HK3B 1RTFB 2W3IA 1B5GH 4XBCA 2H9TH 1UMAH 1IQIA 1O36A 3A86A 1WAYB 3UQOA 3M5LA 3ATMA 2B7DH 4Y71A 4CBOA 1C2EA 1TRNA 1YP9A 3PTNA 1UCYK 3KQBA 1KXCA 3RXQA 2Z9JA 1JOUB 1O37A 4BTUB 5C1UA 1JIMA 2ZDAH 1YKTA 1PPEE 2BDCA 3SNBA 2NU2E 4FUEA 3MU8A 2VIVA 5FX6A 2VVCA 1GHYH 4NGAH 1P2NA 1GL0E 1GBAA 1XUJA 2OD3B 1FIZA 1BBRK 3LIWA 2ZGBH 2JKHA 1O39A 1F92A 4AG1A 2BYAX 3EBNA 7GCHF 3MO3A 4CRBA 4I8LA 2AERH 5K0HA 4CRCA 2GP9B 1HIAA 4ABGA 1RS0A 2BDAA 4JCNA 5DP3A 3SV2H 3DFLA 1ZPCA 1ZGVA 4OS4A 4AG2A 1W11U 2WPMS 1S6HA 2GZ7A 5F8ZA 1GDNA 2ZGHA 4YLUA 5A0CA 3ZVCA 4UFEH 3KQEA 1MUEB 2YNAA 1EZSC 1MU8B 1VITH 2P8OC 3BTME 4OS2A 1TMUH 2EEKA 1CE5A 5TJXA 2AMQA 1ANBA 3U8RH 2QCYA 1Z8JB 3UY9A 1ZYOA 3TH2H 4U01A 1DUEA 1FPCH 1BIOA 3QO6A 4CBNA 2GKVE 1MKXK 1XX9A 2XCFA 3TNSA 5F8XA 1P03A 2PR3A 1L1GA 2PHBA 2F91A 1ZRKA 3BIVH 1FPHH 1O2IA 5A8XA 1NC6A 3PWBA 1SGQE 2ZWLH 4AGKA 3SOSA 4X2VA 2V6NA 5GCHG 3MNBA 1ORFA 1HYLA 1O2VA 1C1NA 1UK2A 1CQQA 1P3EA 2ZGJA 4TYDA 1W13U 4IMQA 1A0HB 1HCGA 1ZOMA 2GV6A 4UDWH 5ETXA 1C2MA 1P9UA 3F9EA 3Q3KA 1RXPA 2EI7A 1FDPA 1ETSH 4XSKU 4MPVA 3PROA 3ZZ4A 3FVFB 5CHAC 1DLKB 3S0NA 1FNIA 1GCTC 2BDIA 3LC5A 2G51A 1LVBA 1AU8A 5I25A 1O2XA 3LJJA 3U8OH 1AFQB 1AKSA 1A3EH 5LPRA 1FXYA 1SGNE 3HGNA 3JZ2B 2H9EH 1XUKA 2LPRA 3T28A 2BTCE 1K22H 4ABIA 1HAVB 1KDQA 1EJNA 4WMFA 2CHAB 2Q6FA 1C9TA 7GCHG 3O8RA 4AFQA 1EPTB 1UJ1A 3H7OA 1GCTB 3VB3A 1TGTA 1TLDA 1A7SA 3M37A 1IQJA 2FS9A 3FP8E 1CBWC 6CHAC 2BY8X 1D3QB 1TGBA 5T6GA 3P70B 4CRGA 1SGFA 4CREA 4J2YB 2SGDE 1HJ9A 3O8DA 1NU9A 2A1DB 1G3BA 3SU0A 5JBCS 1ARCA 2BX3A 1G9IE 1FY8E 3RXOA 1SI5H 4Y8XA 1GHAG 1WBGB 2PUQH 1A46H 5C5NA 3A82A 1SBWA 3I78A 1K1OA 4KGAA 3ZVDA 1OPHB 5EXMA 6CHAB 1ELAA 1ESTA 1A5GH 1VCQA 4INKA 4Y7AA 2AGIX 1YLCA 5E0HA 1Q2WA 1NFXA 1QNJA 1AFEH 3OY5U 1ANDA 4ABBA 1ANEA 3BTKE 1Y3XA 3ATWA 4A7IB 3GCNA 4FUDA 3RXKA 3QK1A 2ZO3H 1O2JA 1Z1JA 1GGDC 2FIRH 2ZFQH 4CR9A 1QQUA 1O3PB 1Q31A 3DFJA 1C4V2 5DPAA 4X6NA 1NRPH 1M9UA 2TIOA 1J17T 1AZ8A 4Q2KA 2JH0D 1W12U 1BMAA 2PLXA 1OYQA 4NZLA 3ZVFA 2XBYA 5E2PA 4AX9H 3MMGA 3UPEA 3BTGE 2ZTXA 1ELTA 2J4IA 3M7QA 4YM9A 1BOQA 1TX8A 5DG6A 1GI9B 2SGPE 2OBQA 3A80A 2BY5X 1TA2A 1O5DH 5AVDA 2Y5GA 1QA7A 1GBMA 2WPIS 2QXIA 2BD9A 1C1PA 2V3OH 5J4SA 3SU2A 5C5OA 4FU7A 4HGCA 1GBCA 1GI7B 1V2WT 1S0QA 1T8MA 2H9HA 1HAHH 2R2WU 3KEEA 2A2QH 3UNQA 1C5PA 2G81E 2FOMB 5FCKA 4FUBA 2SNWA 1SVPA 2HWLB 5E0JA 4UFDH 1F5KU 4UFGH 4D7FA 1ELCA 2XC4A 3LONA 1O2RA 2ZU2A 5JDUB 1V2TT 4DOQA 1GBEA 1P9SA 1OWEA 1DOJA 1AI8H 1ETRH 1QBOA 3BTTE 4X1PU 1GG6B 1SGTA 3PLPA 1THPB 1GI2A 1OS8A 3LU9B 2F3CE 4ZAEA 1P2MA 2P93A 1MBQA 3UUZA 1BJVA 1G2MA 1ZSKA 3E3TA 3RXEA 2ZTZA 1RGQA 2A32A 4O97A 2IPHA 4H6TA 4K60A 1O3CA 1QJ1B 4AB8A 3R0FA 4MPXA 1GI8B 1FV9A 2VU8E 1W2KH 1YCPK 1OP0A 4BAOB 1YPJH 2THFB 2XWBI 2ZI2H 5DP6A 3SI3H 1IQHA 4JZDH 2ZHQH 4HZHA 3VB7A 2F9NA 4LZ4B 4E05H 1SSXA 4MPUA 1O38A 3Q00A 4UE7H 2ANYA 4HFPB 1V2MT 4Y10E 4MDSA 2VWMA 4JZ1A 3GCHB 4MTBA 3SJ9A 3D49H 4ASHA 1XM1A 6ESTA 3O8CA 3BEUA 5T6FA 2Z94A 5A09A 1UVPA 3N7OA 3ZYEA 1HAGE 1SMFE 3U69H 2ZU4A 1ACBE 1TOMH 3SZNA 4K8YA 1XKAC 4B74A 1G32B 2QC2A 2PKAA 2OINA 1X7AC 1QTFA 3FZDA 2GX4A 3RC5A 4I8JA 1VZQH 1FJSA 1TGSZ 4CH8B 4VGCC 1VJ9U 2XCNA 3PLBA 3EA8A 1BA8B 1EB2A 3VXFH 1C2DA 2A7CA 3SJOA 2EA3A 3RLYH 4YO9A 2O8MA 4MPWA 1LQEA 1LQDB 2SGFE 2Z9KA 1C2LA 4ABDA 1ZTJA 4BXWA 2ZDMA 1P01A 2FYRA 3I29A 3M7UA 3EAJA 1GI1A 4OGYA 4X2WA 5EODA 1TQ0B 4DG4A 1QB9A 2Z6BD 4D7GA 1V2KT 3V3MA 2V35A 2WV5A 3MH6A 1MQ6A 1K9OE 2ZFFH 3F9HA 4Z6AH 1O3AA 2WUCA 2ZIQH 2G52A 1ZHRA 3PM3A 4NIWA 3ESTA 1HJAC 1NESE 1WTHD 2W7SA 2ZHDA 1CGHA 1C5YB 3QDZB 1AZZA 4BAKB 4AFZA 4A1XA 3FFGA 4TWYA 4JZIA 3L33A 1F0RA 1YGCH 3V0XA 1PYTC 1SOTA 2GCTC 4DCDA 1LDTT 3LOXA 1Y5UT 5EQSA 1OWHA 3I77A 2ZCHP 1T8NA 3PO1B 2J95A 4Y0YE 4X6OA 2G5NA 3A8DA 2STAE 1DICA 4A5TS 1CT4E 1NS3A 1SLUB 1V2LT 1AB9C 1SOZA 1K1PA 1KSNA 2ZZUH 4NA9H 3S7HB 2OC0A 2Q6DA 3MFJA 3SU4A 4YOGA 5FPSA 1TNHA 1CU1A 3SI4H 1NU7B 1C5XB 4IS5A 1TNKA 4CR5A 1Z7KA 2XYAA 1HAXB 5LPFA 2AEIH 3ZVBA 3GDSA 1E38B 2XC0A 1GI5A 1AO5A 2R3YA 2SGAA 4Y7BA 4I8HA 3RXJA 1LVOA 2GT8A 4H6SB 4I33A 5EG4A 4X1SU 2BD4A 2HALA 1L1NA 2VINA 2FOBA 2H5CA 4K3JA 1EP5A 4A92A 1GBHA 2C8YB 1TA6A 1UHBA 1TONA 1UTKA 1QL8A 4D8NA 1MZDA 1HPGA 4K1EA 3IWMA 1MTSA 1HAYB 3NCLA 2ZF0H 4GVUA 4O9VA 1UTNA 2HVXA 3OY6U 1RTKA 2AIPA 1P2JA 1A3BH 2QV1A 1BRCE 4X1RU 1E0FD 3ZZAA 1ZHPA 2ZHEH 2BDBA 3BTQE 1GBIA 2GCHF 2WPJS 3OSYA 3SV8A 1GI0A 2BX4A 4BTIB 1XMNB 2JETC 3MH5A 1ELVA 1SGIB 4X2YA 4YT7H 1MMJN 4ZHAA 1TMBH 2TGAA 3M5NA 4OS5A 5K7RA 1VCWA 1PQ5A 3LC3A 4NFEA 1N8OB 1O3KA 1ZZZA 1O35A 1SHYA 4GSOA 1N6XA 5T3HA 1P06A 2SNVA 4ABEA 2XNIA 3FP6E 1S81A 2FP7B 3SHAH 2HRVA 1L0ZA 1MKXH 2JETB 3GYMA 4K1SA 1BRAA 3BTHE 3FZZA 2B5TB 1B7XB 1D6RA 2OC7A 4IGDA 4MNVA 2FOGA 3AW1A 3HKJB 1GJCB 2ZA5A 4M7GA 4ZXYH 1LHGH 3QUMP 1LKBA 4JK5A 2Y5FA 3RU4T 1BBRE 1O2TA 3RU4E 4ZUHA 1E34B 2OTVA 2OBOA 1D3TB 3LPRA 4BOHA 1C1OA 3RXGA 3TGKE