4YOZA

P107 pocket domain in complex with hpv e7 peptide
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
365
structure length
342
Chain Sequence
b'EFTQSVSRLQSIVAGLKNAPSDQLINIFESCVRNPVENIMKILKGIGETFCQHYTQSTDEQPGSHIDFAVNRLKLAEILYYKILETVMVQETRRLHGMDMSVLLEQDIFHRSLMACCLEIVLFAYSSPRTFPWIIEVLNLQPFYFYKVIEVVIRSEEGLSRDMVKHLNSIEEQILESLAWSHDSALWEALQVSANKVPTCEEVIFPNRPKRTGSLALFYRKVYHLASVRLRDLCLKLDVSNELRRKIWTCFEFTLVHCPDLMKDRHLDQLLLCAFYIMAKVTKEERTFQEIMKSYRNQPQANSHVYRSVLLKERGDLIKFYNTIYVGRVKSFALKYPLSPFP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Retinoblastoma-like protein 1,Retinoblastoma-like protein 1
publication title Structural mechanisms of DREAM complex assembly and regulation.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 131
structure length 342
sequence length 365
ec nomenclature
pdb deposition date 2015-03-12

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01857 RB_B Retinoblastoma-associated protein B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4yozA01
1.10.472.10 Mainly Alpha Orthogonal Bundle Cyclin A; domain 1 Cyclin-like 4yozA02
4EORB 2WXVB 2PK9B 2X1NB 3POMA 2WMBB 2UZEB 1AD6A 1JSTB 4F6SB 1OKWB 4I3ZB 2BPMB 2W9ZA 3TNWB 1UNLD 4CFXB 5LQFB 5ICPB 5FGKB 1GH6B 3MI9B 4EOKB 4YOSA 4RODA 1H28B 1PKDB 4II5B 3BHTB 4G6LB 2QDJA 4YOZA 1JOWA 1VYWB 2B9RA 2I53A 1QMZB 4EOLB 4EOOB 1C9BA 1N4MA 3EJ1B 5IDNB 2BKZB 4OR5B 1VINA 4CFNB 1W98B 4UN0A 3EIDB 1GUXB 1H1SB 2C5OB 5ACBA 2UZDB 1H25B 4CFUB 1OIUB 2PMIB 2JGZB 3BLHB 1JKWA 3MIAB 5HVYB 3BHVB 1P5EB 3BLRB 5BNJB 1F5QB 4BCPB 4F7JB 1E9HB 4BCND 2UUEB 4EOMB 1OI9B 4EC9B 2CCHB 4BCQD 3DOGB 4EOJB 2I40B 3QHWB 2EUFA 3O0GD 4BCMD 4BCGB 4ELJA 4YC3B 2C5VB 1UNGD 4CRLB 2WIHB 4ROEA 5I5ZB 2IVXA 3QHRB 3RGFB 2WEVB 5CEIB 2WFYB 1G3NC 4KRDB 4EOPB 4F7LB 5CYIB 1TFBA 1XO2A 2F2CA 1VOLA 4EOQB 3DDQB 1FINB 1KXUA 1H4LD 3F5XB 3BLQB 1AISB 1URCB 5HBHB 2WIPB 1GY3B 1OIYB 2UZBB 1O9KB 4BCIB 4ROCA 1GUXA 4F7NB 4F6UB 2C4GB 1H27B 5IDPB 4OGRB 5HQ0B 2C6TB 2V22B 1H1RB 3DDPB 3TNIB 1H1PB 4EONB 2WPAB 4CFUD 1UNHD 4F7SB 4BCKB 2WMAB 5HBJB 2IW8B 1FVVB 2C5NB 2W99A 1H1QB 1OGUB 4TTHA 5L2WB 4FX3B 1H26B 1D3UB 2C5XB 3K7AM 4CFVB 5HBEB 1OL1B 5LMKB 2W2HA 4NSTB 1JSUB 1OKVB 4EOIB 4CFMB 4IMYB 3TN8B 4YOOA 4F70B 1BU2A 2G9XB 3BHUB 2UZLB 3G33B 2CCIB 2CJMB 3M03A 4KRCB 1OL2B 2PHGA 2R7GA 2WHBB 4EOSB 2W9FA 3H4CA 4F6WB 3EOCB 1O9KA 4BCHB 5IF1B 4EC8B 5EFQB 3LQ5B 2W96A 4BCFB 4ELLA 4BCNB 1H24B 3MY5B 2IW9B 4BCOB 4BCQB 4CXAB 3TNHB 4BCJB 2PK2A 4Y72B 5HNBB 2IW6B 3MY1B 4BCMB 4CFWB 1ZP2A
chains in the Genus database with same CATH superfamily
4EORB 4ZGDB 4AKHA 5ICPB 3MI9B 4YOSA 1H28B 3HBLA 1PKDB 3BG9A 4HLQA 2QDJA 1C9BA 2I53A 2QQ8A 1N4MA 2KMGA 4UN0A 1GUXB 2BS4A 2C5OB 4CFUB 2PMIB 2JGZB 3MIAB 4BXXX 2DPPB 4BCND 3DJBA 4EOMB 1OI9B 2CCHB 2EUFA 4BCMD 2C5VB 2WIHB 1V29B 5CEIB 4KRDB 2CYZB 2F2CA 4HNUA 3DDQB 1KXUA 4ZGEB 2C4GB 1H27B 4OGRB 2V22B 3X24B 4HL4A 3WVEB 4CFUD 2WJ9A 1UNHD 2BS3A 4TTHA 3VKHA 5L2WB 1H1QB 5LMKB 3PO3S 4EOIB 4CFMB 3QXEB 1UGQB 4BBRM 2CCIB 3M03A 4BBSM 4EOSB 2WHBB 4OB1B 4OB2B 1E7PA 1H24B 5DQWA 3HZJA 2IW6B 1ZP2A 2WXVB 3HHTB 3POMA 1JSTB 1OKWB 2BPMB 3TNWB 1UNLD 1GH6B 4EOKB 3BHTB 4G6LB 4EOLB 4ZGJB 4CFNB 2BKZB 4OR5B 1VINA 1W98B 2ZPHB 4OB3B 2UZDB 1IREB 1OIUB 1JKWA 3KHIA 2CZ7B 5BNJB 4AKIA 3X26B 4BCGB 1UNGD 5I5ZB 1UGRB 2WEVB 4F7LB 4M6VA 2DD5B 3B57A 3F5XB 3BLQB 2UZBB 3WVDB 4F6UB 3QYGB 5IDPB 5IHYA 2C6TB 3A8GB 3A8LB 3DDPB 3TNIB 3QZ9B 5DQVA 2D0QB 2WMAB 1FVVB 2C5NB 2W99A 4QSHA 2C5XB 3QZ5B 2W2HA 1OL1B 4NSTB 1OKVB 3TN8B 2G9XB 3G33B 2CJMB 4KRCB 2R7GA 2W9FA 3DL1A 4EC8B 4AKGA 3MY5B 4BCQB 2ZPBB 4BCJB 4AI6A 1ENWA 2CZ0B 2ZZDB 2X1NB 2WMBB 2UZEB 4CFXB 2W9ZA 4MIMA 5FGKB 4RODA 4II5B 4YOZA 1JOWA 1VYWB 3EJ1B 5IDNB 3EIDB 4FM4B 3VKGA 5HVYB 2CZ1B 1P5EB 3BLRB 4BCPB 3GTMS 1E9HB 4EC9B 4BCQD 4HNTA 3DOGB 3O0GD 3VYHB 4ELJA 4JX4A 4CRLB 4ROEA 3QYBA 2IVXA 5CYIB 1TFBA 1VOLA 4EOQB 1H4LD 1AISB 5HBHB 1TD6A 1OIYB 3VYGB 4ROCA 3BG3A 4F7NB 2PJQA 1H1PB 4EONB 2LW4A 4F7SB 4BCKB 5HBJB 2IW8B 1OGUB 2DXCB 4FX3B 2CZ6B 3K7AM 4BY1X 1JSUB 4YOOA 3X20B 2UZLB 2ZPEB 3A8MB 3EOCB 1O9KA 4JX6A 2AHJB 4BCHB 5IF1B 5EFQB 3LQ5B 4BCFB 2QFZA 2IW9B 4CXAB 4Y72B 5HNBB 3BG5A 2ZPFB 4HNVA 2PK9B 4BY7X 4F6SB 1AD6A 5LQFB 2KR6A 4I3ZB 3A8OB 2DMEA 3DTOA 1AHJB 3HB9A 4EOOB 2B9RA 1QMZB 3TW7A 2QF7A 2BS2A 1H1SB 4JX5A 5ACBA 4LOCA 1H25B 3BLHB 3BHVB 1F5QB 2QDYB 4F7JB 1UGSB 2UUEB 2ZPGB 3X28B 2ZCFB 4EOJB 2ZPIB 2I40B 3HO8A 3QHWB 4YC3B 3QHRB 3RGFB 2WFYB 1G3NC 4EOPB 4Z6YA 1XO2A 1FINB 1UGPB 1URCB 2WIPB 1GY3B 1O9KB 4BCIB 1GUXA 1QLBA 2DD4B 5HQ0B 3QYHB 2G77A 1H1RB 4MFEA 2WPAB 2QGSA 4OB0B 3X25B 4NC6A 2IN3A 1H26B 1D3UB 4CFVB 5HBEB 2DXBB 4IMYB 4F70B 1BU2A 3BHUB 3NDQA 3QWLA 3A8HB 1OL2B 2PHGA 3H4CA 4F6WB 4MFDA 3QYEA 2W96A 4ELLA 4BCNB 1FKMA 4BCOB 5EJCA 3TNHB 2PK2A 3MY1B 4BCMB 4CFWB 3TW6A
chains in the Genus database with same CATH topology
4EORB 2WXVB 2PK9B 2X1NB 3POMA 2WMBB 2UZEB 1AD6A 1JSTB 4F6SB 1OKWB 4I3ZB 2BPMB 2W9ZA 3TNWB 1UNLD 4CFXB 5LQFB 5ICPB 5FGKB 1GH6B 3MI9B 4EOKB 4YOSA 4RODA 1H28B 1PKDB 4II5B 3BHTB 4G6LB 2QDJA 4YOZA 1JOWA 1VYWB 2B9RA 2I53A 1QMZB 4EOLB 4EOOB 1C9BA 1N4MA 3EJ1B 5IDNB 2BKZB 4OR5B 1VINA 4CFNB 1W98B 4UN0A 3EIDB 1GUXB 1H1SB 2C5OB 5ACBA 2UZDB 1H25B 4CFUB 1OIUB 2PMIB 2JGZB 3BLHB 1JKWA 3MIAB 5HVYB 3BHVB 1P5EB 3BLRB 5BNJB 1F5QB 4BCPB 4F7JB 1E9HB 4BCND 2UUEB 4EOMB 1OI9B 4EC9B 2CCHB 4BCQD 3DOGB 4EOJB 2I40B 3QHWB 2EUFA 3O0GD 4BCMD 4BCGB 4ELJA 4YC3B 2C5VB 1UNGD 4CRLB 2WIHB 4ROEA 5I5ZB 2IVXA 3QHRB 3RGFB 2WEVB 5CEIB 2WFYB 1G3NC 4KRDB 4EOPB 4F7LB 5CYIB 1TFBA 1XO2A 2F2CA 1VOLA 4EOQB 3DDQB 1FINB 1KXUA 1H4LD 3F5XB 3BLQB 1AISB 1URCB 5HBHB 2WIPB 1GY3B 1OIYB 2UZBB 1O9KB 4BCIB 4ROCA 1GUXA 4F7NB 4F6UB 2C4GB 1H27B 5IDPB 4OGRB 5HQ0B 2C6TB 2V22B 1H1RB 3DDPB 3TNIB 1H1PB 4EONB 2WPAB 4CFUD 1UNHD 4F7SB 4BCKB 2WMAB 5HBJB 2IW8B 1FVVB 2C5NB 2W99A 1H1QB 1OGUB 4TTHA 5L2WB 4FX3B 1H26B 1D3UB 2C5XB 3K7AM 4CFVB 5HBEB 1OL1B 5LMKB 2W2HA 4NSTB 1JSUB 1OKVB 4EOIB 4CFMB 4IMYB 3TN8B 4YOOA 4F70B 1BU2A 2G9XB 3BHUB 2UZLB 3G33B 2CCIB 2CJMB 3M03A 4KRCB 1OL2B 2PHGA 2R7GA 2WHBB 4EOSB 2W9FA 3H4CA 4F6WB 3EOCB 1O9KA 4BCHB 5IF1B 4EC8B 5EFQB 3LQ5B 2W96A 4BCFB 4ELLA 4BCNB 1H24B 3MY5B 2IW9B 4BCOB 4BCQB 4CXAB 3TNHB 4BCJB 2PK2A 4Y72B 5HNBB 2IW6B 3MY1B 4BCMB 4CFWB 1ZP2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4EOR B;  2WXV B;  2PK9 B;  2X1N B;  3POM A;  2WMB B;  2UZE B;  1AD6 A;  1JST B;  4F6S B;  1OKW B;  4I3Z B;  2BPM B;  2W9Z A;  3TNW B;  1UNL D;  4CFX B;  5LQF B;  5ICP B;  5FGK B;  1GH6 B;  3MI9 B;  4EOK B;  4YOS A;  4ROD A;  1H28 B;  1PKD B;  4II5 B;  3BHT B;  4G6L B;  2QDJ A;  4YOZ A;  1JOW A;  1VYW B;  2B9R A;  2I53 A;  1QMZ B;  4EOL B;  4EOO B;  1C9B A;  1N4M A;  3EJ1 B;  5IDN B;  2BKZ B;  4OR5 B;  1VIN A;  4CFN B;  1W98 B;  4UN0 A;  3EID B;  1GUX B;  1H1S B;  2C5O B;  5ACB A;  2UZD B;  1H25 B;  4CFU B;  1OIU B;  2PMI B;  2JGZ B;  3BLH B;  1JKW A;  3MIA B;  5HVY B;  3BHV B;  1P5E B;  3BLR B;  5BNJ B;  1F5Q B;  4BCP B;  4F7J B;  1E9H B;  4BCN D;  2UUE B;  4EOM B;  1OI9 B;  4EC9 B;  2CCH B;  4BCQ D;  3DOG B;  4EOJ B;  2I40 B;  3QHW B;  2EUF A;  3O0G D;  4BCM D;  4BCG B;  4ELJ A;  4YC3 B;  2C5V B;  1UNG D;  4CRL B;  2WIH B;  4ROE A;  5I5Z B;  2IVX A;  3QHR B;  3RGF B;  2WEV B;  5CEI B;  2WFY B;  1G3N C;  4KRD B;  4EOP B;  4F7L B;  5CYI B;  1TFB A;  1XO2 A;  2F2C A;  1VOL A;  4EOQ B;  3DDQ B;  1FIN B;  1KXU A;  1H4L D;  3F5X B;  3BLQ B;  1AIS B;  1URC B;  5HBH B;  2WIP B;  1GY3 B;  1OIY B;  2UZB B;  1O9K B;  4BCI B;  4ROC A;  1GUX A;  4F7N B;  4F6U B;  2C4G B;  1H27 B;  5IDP B;  4OGR B;  5HQ0 B;  2C6T B;  2V22 B;  1H1R B;  3DDP B;  3TNI B;  1H1P B;  4EON B;  2WPA B;  4CFU D;  1UNH D;  4F7S B;  4BCK B;  2WMA B;  5HBJ B;  2IW8 B;  1FVV B;  2C5N B;  2W99 A;  1H1Q B;  1OGU B;  4TTH A;  5L2W B;  4FX3 B;  1H26 B;  1D3U B;  2C5X B;  3K7A M;  4CFV B;  5HBE B;  1OL1 B;  5LMK B;  2W2H A;  4NST B;  1JSU B;  1OKV B;  4EOI B;  4CFM B;  4IMY B;  3TN8 B;  4YOO A;  4F70 B;  1BU2 A;  2G9X B;  3BHU B;  2UZL B;  3G33 B;  2CCI B;  2CJM B;  3M03 A;  4KRC B;  1OL2 B;  2PHG A;  2R7G A;  2WHB B;  4EOS B;  2W9F A;  3H4C A;  4F6W B;  3EOC B;  1O9K A;  4BCH B;  5IF1 B;  4EC8 B;  5EFQ B;  3LQ5 B;  2W96 A;  4BCF B;  4ELL A;  4BCN B;  1H24 B;  3MY5 B;  2IW9 B;  4BCO B;  4BCQ B;  4CXA B;  3TNH B;  4BCJ B;  2PK2 A;  4Y72 B;  5HNB B;  2IW6 B;  3MY1 B;  4BCM B;  4CFW B;  1ZP2 A; 
#chains in the Genus database with same CATH topology
 4EOR B;  4ZGD B;  4AKH A;  5ICP B;  3MI9 B;  4YOS A;  1H28 B;  3HBL A;  1PKD B;  3BG9 A;  4HLQ A;  2QDJ A;  1C9B A;  2I53 A;  2QQ8 A;  1N4M A;  2KMG A;  4UN0 A;  1GUX B;  2BS4 A;  2C5O B;  4CFU B;  2PMI B;  2JGZ B;  3MIA B;  4BXX X;  2DPP B;  4BCN D;  3DJB A;  4EOM B;  1OI9 B;  2CCH B;  2EUF A;  4BCM D;  2C5V B;  2WIH B;  1V29 B;  5CEI B;  4KRD B;  2CYZ B;  2F2C A;  4HNU A;  3DDQ B;  1KXU A;  4ZGE B;  2C4G B;  1H27 B;  4OGR B;  2V22 B;  3X24 B;  4HL4 A;  3WVE B;  4CFU D;  2WJ9 A;  1UNH D;  2BS3 A;  4TTH A;  3VKH A;  5L2W B;  1H1Q B;  5LMK B;  3PO3 S;  4EOI B;  4CFM B;  3QXE B;  1UGQ B;  4BBR M;  2CCI B;  3M03 A;  4BBS M;  4EOS B;  2WHB B;  4OB1 B;  4OB2 B;  1E7P A;  1H24 B;  5DQW A;  3HZJ A;  2IW6 B;  1ZP2 A;  2WXV B;  3HHT B;  3POM A;  1JST B;  1OKW B;  2BPM B;  3TNW B;  1UNL D;  1GH6 B;  4EOK B;  3BHT B;  4G6L B;  4EOL B;  4ZGJ B;  4CFN B;  2BKZ B;  4OR5 B;  1VIN A;  1W98 B;  2ZPH B;  4OB3 B;  2UZD B;  1IRE B;  1OIU B;  1JKW A;  3KHI A;  2CZ7 B;  5BNJ B;  4AKI A;  3X26 B;  4BCG B;  1UNG D;  5I5Z B;  1UGR B;  2WEV B;  4F7L B;  4M6V A;  2DD5 B;  3B57 A;  3F5X B;  3BLQ B;  2UZB B;  3WVD B;  4F6U B;  3QYG B;  5IDP B;  5IHY A;  2C6T B;  3A8G B;  3A8L B;  3DDP B;  3TNI B;  3QZ9 B;  5DQV A;  2D0Q B;  2WMA B;  1FVV B;  2C5N B;  2W99 A;  4QSH A;  2C5X B;  3QZ5 B;  2W2H A;  1OL1 B;  4NST B;  1OKV B;  3TN8 B;  2G9X B;  3G33 B;  2CJM B;  4KRC B;  2R7G A;  2W9F A;  3DL1 A;  4EC8 B;  4AKG A;  3MY5 B;  4BCQ B;  2ZPB B;  4BCJ B;  4AI6 A;  1ENW A;  2CZ0 B;  2ZZD B;  2X1N B;  2WMB B;  2UZE B;  4CFX B;  2W9Z A;  4MIM A;  5FGK B;  4ROD A;  4II5 B;  4YOZ A;  1JOW A;  1VYW B;  3EJ1 B;  5IDN B;  3EID B;  4FM4 B;  3VKG A;  5HVY B;  2CZ1 B;  1P5E B;  3BLR B;  4BCP B;  3GTM S;  1E9H B;  4EC9 B;  4BCQ D;  4HNT A;  3DOG B;  3O0G D;  3VYH B;  4ELJ A;  4JX4 A;  4CRL B;  4ROE A;  3QYB A;  2IVX A;  5CYI B;  1TFB A;  1VOL A;  4EOQ B;  1H4L D;  1AIS B;  5HBH B;  1TD6 A;  1OIY B;  3VYG B;  4ROC A;  3BG3 A;  4F7N B;  2PJQ A;  1H1P B;  4EON B;  2LW4 A;  4F7S B;  4BCK B;  5HBJ B;  2IW8 B;  1OGU B;  2DXC B;  4FX3 B;  2CZ6 B;  3K7A M;  4BY1 X;  1JSU B;  4YOO A;  3X20 B;  2UZL B;  2ZPE B;  3A8M B;  3EOC B;  1O9K A;  4JX6 A;  2AHJ B;  4BCH B;  5IF1 B;  5EFQ B;  3LQ5 B;  4BCF B;  2QFZ A;  2IW9 B;  4CXA B;  4Y72 B;  5HNB B;  3BG5 A;  2ZPF B;  4HNV A;  2PK9 B;  4BY7 X;  4F6S B;  1AD6 A;  5LQF B;  2KR6 A;  4I3Z B;  3A8O B;  2DME A;  3DTO A;  1AHJ B;  3HB9 A;  4EOO B;  2B9R A;  1QMZ B;  3TW7 A;  2QF7 A;  2BS2 A;  1H1S B;  4JX5 A;  5ACB A;  4LOC A;  1H25 B;  3BLH B;  3BHV B;  1F5Q B;  2QDY B;  4F7J B;  1UGS B;  2UUE B;  2ZPG B;  3X28 B;  2ZCF B;  4EOJ B;  2ZPI B;  2I40 B;  3HO8 A;  3QHW B;  4YC3 B;  3QHR B;  3RGF B;  2WFY B;  1G3N C;  4EOP B;  4Z6Y A;  1XO2 A;  1FIN B;  1UGP B;  1URC B;  2WIP B;  1GY3 B;  1O9K B;  4BCI B;  1GUX A;  1QLB A;  2DD4 B;  5HQ0 B;  3QYH B;  2G77 A;  1H1R B;  4MFE A;  2WPA B;  2QGS A;  4OB0 B;  3X25 B;  4NC6 A;  2IN3 A;  1H26 B;  1D3U B;  4CFV B;  5HBE B;  2DXB B;  4IMY B;  4F70 B;  1BU2 A;  3BHU B;  3NDQ A;  3QWL A;  3A8H B;  1OL2 B;  2PHG A;  3H4C A;  4F6W B;  4MFD A;  3QYE A;  2W96 A;  4ELL A;  4BCN B;  1FKM A;  4BCO B;  5EJC A;  3TNH B;  2PK2 A;  3MY1 B;  4BCM B;  4CFW B;  3TW6 A; 
#chains in the Genus database with same CATH homology
 4EOR B;  2WXV B;  2PK9 B;  2X1N B;  3POM A;  2WMB B;  2UZE B;  1AD6 A;  1JST B;  4F6S B;  1OKW B;  4I3Z B;  2BPM B;  2W9Z A;  3TNW B;  1UNL D;  4CFX B;  5LQF B;  5ICP B;  5FGK B;  1GH6 B;  3MI9 B;  4EOK B;  4YOS A;  4ROD A;  1H28 B;  1PKD B;  4II5 B;  3BHT B;  4G6L B;  2QDJ A;  4YOZ A;  1JOW A;  1VYW B;  2B9R A;  2I53 A;  1QMZ B;  4EOL B;  4EOO B;  1C9B A;  1N4M A;  3EJ1 B;  5IDN B;  2BKZ B;  4OR5 B;  1VIN A;  4CFN B;  1W98 B;  4UN0 A;  3EID B;  1GUX B;  1H1S B;  2C5O B;  5ACB A;  2UZD B;  1H25 B;  4CFU B;  1OIU B;  2PMI B;  2JGZ B;  3BLH B;  1JKW A;  3MIA B;  5HVY B;  3BHV B;  1P5E B;  3BLR B;  5BNJ B;  1F5Q B;  4BCP B;  4F7J B;  1E9H B;  4BCN D;  2UUE B;  4EOM B;  1OI9 B;  4EC9 B;  2CCH B;  4BCQ D;  3DOG B;  4EOJ B;  2I40 B;  3QHW B;  2EUF A;  3O0G D;  4BCM D;  4BCG B;  4ELJ A;  4YC3 B;  2C5V B;  1UNG D;  4CRL B;  2WIH B;  4ROE A;  5I5Z B;  2IVX A;  3QHR B;  3RGF B;  2WEV B;  5CEI B;  2WFY B;  1G3N C;  4KRD B;  4EOP B;  4F7L B;  5CYI B;  1TFB A;  1XO2 A;  2F2C A;  1VOL A;  4EOQ B;  3DDQ B;  1FIN B;  1KXU A;  1H4L D;  3F5X B;  3BLQ B;  1AIS B;  1URC B;  5HBH B;  2WIP B;  1GY3 B;  1OIY B;  2UZB B;  1O9K B;  4BCI B;  4ROC A;  1GUX A;  4F7N B;  4F6U B;  2C4G B;  1H27 B;  5IDP B;  4OGR B;  5HQ0 B;  2C6T B;  2V22 B;  1H1R B;  3DDP B;  3TNI B;  1H1P B;  4EON B;  2WPA B;  4CFU D;  1UNH D;  4F7S B;  4BCK B;  2WMA B;  5HBJ B;  2IW8 B;  1FVV B;  2C5N B;  2W99 A;  1H1Q B;  1OGU B;  4TTH A;  5L2W B;  4FX3 B;  1H26 B;  1D3U B;  2C5X B;  3K7A M;  4CFV B;  5HBE B;  1OL1 B;  5LMK B;  2W2H A;  4NST B;  1JSU B;  1OKV B;  4EOI B;  4CFM B;  4IMY B;  3TN8 B;  4YOO A;  4F70 B;  1BU2 A;  2G9X B;  3BHU B;  2UZL B;  3G33 B;  2CCI B;  2CJM B;  3M03 A;  4KRC B;  1OL2 B;  2PHG A;  2R7G A;  2WHB B;  4EOS B;  2W9F A;  3H4C A;  4F6W B;  3EOC B;  1O9K A;  4BCH B;  5IF1 B;  4EC8 B;  5EFQ B;  3LQ5 B;  2W96 A;  4BCF B;  4ELL A;  4BCN B;  1H24 B;  3MY5 B;  2IW9 B;  4BCO B;  4BCQ B;  4CXA B;  3TNH B;  4BCJ B;  2PK2 A;  4Y72 B;  5HNB B;  2IW6 B;  3MY1 B;  4BCM B;  4CFW B;  1ZP2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...