4YP1A

Misting with cda
Total Genus 58
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
58
sequence length
183
structure length
178
Chain Sequence
NVAHGLAWSYYIGYLRLILPGLQARIRMFNQLHNNMLSGAGSRRLYILFPLDCGVPDNLSVVDPNIRFRDMLPQQNIDRAGIKNRVYSNSVYEILENGQPAGVCILEYATPLQTLFAMSQDAKAGFSREDRLEQAKLFCRTLEEILEDVPESRNNCRLIVYQEPFSLSQEVLRHIRQE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Insights into the Distinct Binding Mode of Cyclic Di-AMP with SaCpaA_RCK.
pubmed doi rcsb
source organism Mus musculus
molecule tags Immune system
molecule keywords Stimulator of interferon genes protein
total genus 58
structure length 178
sequence length 183
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-03-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
3.40.50.12100 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold Rossmann fold 4yp1A02
4QXQA 5CFRA 5CFMA 4LOHA 4F5EA 4KC0A 4LOKA 4F9GA 4YP1A 4KBYA 5CFQA 5CFNA 4LOIA 4EF4A 5CFOA 4EF5A 4EMTA 4F5WA 4F5DA 5CFLA 4QXOA 4F5YA 4F9EA 4LOLA 4KSYA 4LOJA 4QXPA 4JC5A 4QXRA 5CFPA 4EMUA 5BQXA
chains in the Genus database with same CATH superfamily
3IALA 2HO4A 1WCIA 4ZEWA 4AY2A 3JQQA 1ZINA 1Y5LA 1SVNA 3KELA 5MGBA 3IHKA 3EC2A 3RKSA 3WIUA 4F4JA 3PD0A 4B6PA 2FPIB 3ZZTA 1YDGA 1ZN9A 2C04A 1CB0A 3ETJA 4OSEA 3EXHC 3STTA 3R9XB 2ODBA 3H2BA 4TVOA 5LQNA 3E5NA 1ZKMA 3RVBA 2AMFA 2DYKA 1GZUA 1KIFA 1O94D 1Z6PA 1WY7A 2N42A 1VYHA 3WK6A 1T9AA 3HXPA 3AVTA 1U28C 3G1TA 5A2QA 3GMSA 4DBZA 1E98A 1SQ6A 1S9HA 4G09A 2ZAMA 4CMJA 4ZODA 1DKUA 3QUTA 3FNEA 1E1RD 5J4LA 4F9FA 1W1UA 2B82A 4Q9KA 5DP2A 2GBLA 1XP8A 3D3WA 4D82A 5ERGB 3RIXA 1V8ZA 3WK9A 3BCSA 3PWKA 4OPMA 2WB2A 4MI1A 3MCZA 1SAYA 1Z0IA 1ST3A 1TF2A 3BMNB 3FE2A 1UH5A 4DS3A 4BJ3A 2OZVA 3LWZA 4DV4B 1GR0A 1IJFA 3UO8B 2XCLA 2CLMB 3TMKA 4L2IB 4Q1AA 4JQYA 1WPXA 4OYYA 4LBVA 4BLRA 4BMSA 4YJFB 3TR5A 1XVTA 5KYWA 3DKIA 2YS6A 4G0YA 4TLBA 1Q1BA 2R1UA 5EJMA 4GP7A 4GVXA 2AWNA 3QHAA 5J58A 4FW9A 3IDSA 1HT3A 2FQYA 1WMDA 1EFTA 3AO0B 2Z6UA 1RRPA 5EIHA 4RYDA 1D1PA 2YHAA 3NIGB 4AZTA 1OI4A 3LLSA 4E5MA 5IAEA 3KVYA 3AB3A 4Y2XA 3ZDZB 4PAWA 2P9YA 3UAZA 3DC7A 3TX6A 2WLSA 1NOIA 4BCDA 4DLBA 3JU3A 1JL3A 3FZQA 4K3UA 4A73A 4LFCB 4FFWA 3BIFA 1QTRA 2RJ3A 3EB9A 5CVVA 1TM1E 3A9WA 5SYNA 4CGYA 5JI3E 2IYNA 1ZVVA 5KQSA 1TUEA 4XAQA 2PJUA 2OB2A 5DGXA 3VDRA 1V8FA 2HY7A 4LQDA 2A3NA 4B3BA 1SUCA 4FDVA 4QBGB 2VHQA 5K3OA 1E7YA 3UAXA 2OP0A 1TIBA 3I4FA 4N7RA 4EB8A 2YWGA 3UHAA 1HOXA 2IDMA 2W48A 4W1QA 1OC4A 2I9PA 3AFGA 2JD2A 3BJEA 1YBHA 4OG2A 3EOBI 1Z0DA 3PU6A 2I2FA 3UAWA 2LIPA 3RLFA 2REOA 3UWKA 3QE4A 2CVPA 4YA6A 1W5FA 2QSZA 1SHZA 2CYAA 2V0CA 2WU4A 2ZCVA 3BGIA 4IYJA 4B2LA 4DTCA 4EYEA 1I7SB 3WGIA 3JW8A 3TTUA 2G6BA 1SQSA 2ACVA 4CR7A 4QYIB 4OX9Y 2P8SA 1RNLA 3FNBA 2PRYA 4YDHB 2DWQA 1NSTA 3MFYA 4MITA 3S8MA 5I7UA 2FKNA 3EWAA 3GRCA 3D0KA 3I5UA 1OXVA 3A9SA 1PG5A 4I50A 1ECJA 2X41A 3VH1A 2BSAA 1UM8A 1WHTA 3ND9A 5GJBA 5JZMA 4Y6GB 5MGNA 2X86A 5KKCA 2BI7A 1NF3A 3O21A 3S7ZA 4TV9B 4GQIA 2PU7A 5KI6A 3C1AA 1RAEA 3ABQB 4L8YA 1A2QA 4PR3A 2Z5VA 3ZKAA 3HKCB 1HM5A 3JD2A 1OI2A 4GMFA 3HXOA 2DR3A 3TFOA 4K9SA 1NZDA 3W77A 4AO8A 4CIWA 1F6WA 5EJ5A 1Z5OA 2HDWA 2B35A 3I9NA 3IV9A 4M9UA 4XUDA 5TR9A 1S5PA 4ABYA 2Z2JA 4BEVA 3D6JA 1H2AS 2PUWA 1QH1A 4GXTA 4EFKA 3DMRA 1JZQA 4X95A 5I7RA 3ZJUA 4RL4A 3R0JA 1F0KA 5A0FA 1MU0A 3AJDA 4GPIB 1QPZA 2DBRA 5DYIA 3WA6A 3RW9A 4R68A 3N5KA 2DEUA 2B4RO 3VZSA 2XD9A 4ZOQI 1DX4A 1EX6A 4V0NA 2A86A 4ND1A 4MSUA 4D98A 2Q3LA 1IDN1 2FEPA 2XD4A 1PT6A 4Q00A 4P9NA 3ZN2A 1BWSA 3C5HA 1Z4IA 5C8YB 2J9ZB 3PCXA 1JSLA 4RF3A 4ENPA 4AURA 1MZPA 4L7QA 1QGOA 4WSOA 5ARCA 1RLTA 1CKEA 2OGUA 2J08A 1BX3A 1N6HA 1Q0PA 4TV8A 4HOYA 3RFFA 1EGHA 3ESCA 1OROA 2PRIA 4PG6A 3LQYA 4MRNA 1AC5A 4EG6A 1CJUC 2WWFA 3RV3A 4FZ3A 3SYRA 4FBGA 1GKUB 3JQCA 4RD0A 5G0WA 4ZWNA 5EJ7A 3VKHA 1HV8A 1YE3A 3BILA 3Q9SA 3LFHA 1NYQA 4IDOA 3DL2A 3BCRA 5HE9A 5C35A 1OT5A 5CXQA 1JJ7A 4MEJA 2HRRA 3EZNA 3SKVA 3W4JA 5DRYA 1HSZA 3V42A 2C3MA 4AD8A 2PGLA 1PCXA 1E2KA 2ZBGA 4NENA 1V8PA 4RCZA 4DMKA 4WKPA 1I32A 2Q6LA 5ALNA 4WBNB 1PJ8A 1JVNA 1THZA 1GAQA 1NFRA 1QYVA 1PDVA 3AUAA 3EG9B 3SD7A 5CCEA 4FFLA 4Q93A 2BGWA 1JAYA 2CNLA 1GTMA 2ZVDA 5G3ZA 1N57A 5JWOA 5KS2A 5FV7A 1U3WA 3U40A 1GVNB 4DXDA 2LCQA 4X64B 1OH5A 1AQUA 2AFVA 3IFSA 4YRBA 4K9QA 4F9TA 4N5NA 1JS1X 2O5VA 4L1KA 1M54A 3IAUA 1TJ5A 4JBHA 2PLNA 4IOJA 3DLTA 4J7AA 3OPQA 3CZQA 4AX4A 4WCFB 4KFTA 4MPTA 3ASVA 1AN0A 1CW2B 1UDAA 4TTQA 5KQPA 3HSKA 3P20A 5GZ6A 3W5JA 2UUCB 4B45A 3DEKA 4AXBA 4CQNA 3LUAA 5D6OA 1B0AA 1ZUNB 5KTTA 3K2IA 3C6QA 3LJKA 1A8HA 2ERXA 4HNHA 5EY5B 4PC3A 1BA2A 1ZCAA 3F78A 5JD6A 3T9AA 1A72A 1XCMA 1RHRA 3D9QX 3AVPA 4R8LA 4XYEA 3QRWA 3QVGA 3R75A 2XA9A 4CUJA 3D6HA 2Q0QA 4NAVA 3KK0A 3KWJA 4UDOA 5AT1A 3O3CA 1IB0A 4E21A 2H92A 1JFSA 4IHAA 1LS6A 2QUAA 5ALRA 2AMJA 4AY5A 4MHTA 2JGLA 4J7CA 2FPXA 4OL9A 1UK8A 5DW0A 1UJMA 3ZDEA 5JEEA 4U7WA 3UG6A 5I4CA 5CIYA 1TM5E 1GV0A 2A6PA 2PWZA 4B83A 1E5TA 3LCRA 2IPXA 4QLBA 1VRCA 4HP8A 2AOTA 1GG9A 4FEEA 3GUUA 4MJ3A 2JEOA 4X85A 1UJNA 3LT4A 1GZ4A 4BMZA 5CPFA 2P9FA 4WLVA 3U4CA 4II3A 4RAQA 3HUTA 1RKXA 2WTEA 3GRKA 4PHTA 2KPOA 2IXAA 4IQFA 2BHNA 3C8DA 2WUEA 2GCIA 5EFOA 4CN8A 1Z56C 3DMNA 3RU9A 3ELUA 4AAYA 3NHJA 1UPTA 1XNHA 4B6EA 5JW6A 4P4TA 2H5JA 1AKTA 1J2JA 1GGKA 1BXRB 3HY6A 3NTUA 4HH0A 5M3BA 4N5IX 1ZAYA 2NSYA 3GJ4A 1W581 5ELLA 2BEJA 1V5EA 4GOND 4Y9SA 2PGDA 3P27A 3DPSA 4NAHA 5F7ZA 3IRUA 1T0BA 3SF8A 2P4HX 3NWOA 4PY2A 2BZSA 2DCUA 1B8UA 2AWOA 2IU0A 1L4LA 1VCMA 4UEQA 2WWVD 1RACA 3SXJA 3UEOA 2CLDX 1CHNA 1Q14A 3ML1A 4KKVA 1C4KA 4OYRA 4WXYB 3AY3A 5AXCA 2JVKA 3LPNA 1NI3A 4EG4A 2OCLA 4A9AA 2DJ5A 2SNIE 4LF7B 1PQYA 1PDWA 1ODLA 2BZGA 3QOFA 1H42A 3HY3A 4J9VA 3OTOB 4Y1EA 1HNZB 3UFXA 3PEYA 2XCSB 3ZKWA 2D2IA 4UE2A 1X1SA 1TTTA 4YRMA 4Q9JA 2IFTA 4TT8A 2WWIA 5E9AA 1ZY2A 2RAFA 5IJ0A 4BBAA 3BQ9A 4G9BA 1QDUA 9GPBA 3W2EA 2WSIA 5LQDA 5DSTA 4ZV7A 2W2VA 4G67A 4AJKA 4EUHA 1RIIA 3V2HA 1ZONA 1QRUA 3FLEA 5CFOA 3UB2A 1NNI1 1W29A 2VZEA 3AT1A 2HMYB 1O6GA 4B3HA 5ITWA 1PL6A 3H4IA 3P2OA 4JS0A 5A4JA 1FRQA 2HDNB 1L1EA 3HCRA 2H4ZA 4OQQA 5FBZA 4N7MA 4DA9A 1JHXA 1XCJA 1B15A 4MTLA 2ODWA 4XFDA 3DTNA 4FYMA 2PQ0A 4M9QA 2ZU0C 2GXSA 1ADCA 1XLUA 4WOBA 4NOKA 2N9UA 5E0OA 5JANA 4B3RB 4HAZA 1W96A 1JSRA 1Z62A 3ORSA 3BDAA 4NV1A 2C1XA 2R1VB 3Q0TA 2C4VA 3EISA 4NCJA 1IBMB 2YZGA 1E9FA 3BDIA 4NQRA 2DC1A 5DXAA 3DCIA 4MWGA 4WZAB 3ZW9A 1Q1EA 2NV2B 1YUMA 5EPUA 5HIJA 4DA7A 1PR0A 4J29A 4HY3A 3R5SA 1RI2A 2JIBA 3RIEA 3UA3A 4HB0A 1RRGA 3KQOA 4EGSA 6PFKA 3UNXA 1KTVA 1EFDN 4MK4A 3Q9UA 3B1KA 4I1VA 4I1OA 3KP1A 4NIMA 1R0ZA 4DSOA 4UFOA 3OOWA 1LDBA 3N2IA 2A67A 4M2LA 4EDFA 4UTRA 4UBIA 4ZQHA 1QCZA 2R6JA 1E2JA 1RW4A 1GG5A 2VQFB 1Z68A 1H9CA 1O96A 3ZYCA 3NORA 8GPBA 1Q57A 4FOSA 1CUBA 1M8FA 1QVAA 3LC0A 4YK7A 3KETA 2HLNA 1SVUA 1JVSA 3ITDA 2V54A 2IHTA 4MO9A 5ILQA 4BFVA 4ZCPA 5KJEA 2QJFA 2EP7A 3PNPA 4ODIA 5KSWB 3THWB 4M3NA 2EQBA 4EHAA 2C7PA 4ZKEA 4LQLA 2X5XA 1VHWA 1L5VA 3IPYA 2JJ8A 2C8KA 3I53A 3RYIB 3DT9A 3PWSA 2B99A 2CNWA 4HL6A 4F11A 1EYZA 1UXJA 2H1CA 2V3VA 5LZ7A 2JBAA 2RK4A 1MX9A 4ZOLB 5LMZA 1DZ3A 1VL1A 2C2ZA 3L7LA 1L4KA 1QNFA 3MTDA 2XMCA 4LHEA 3R9IA 3RJZA 1JTVA 3LPAA 3K15A 4ZU1X 4OGFA 2C59A 4A23A 2EF1A 1R6UA 1E2PA 1RWVA 2FWPA 3AM5A 3G0GA 3GRUA 4PLPA 2HA3A 1RKQA 2QAGB 4RVFA 4F86A 4RABA 2O5CA 1A4XA 3OMLA 3OJLA 3JTEA 4DZTA 1OB5A 5JQGA 2YZMA 3VVCA 2ATVA 5K8JB 4BEBA 1SMKA 1U0JA 1X9IA 1ZGZA 3AU9A 5HBRA 3JZMA 1JDBC 1IY8A 3FIJA 4OATA 1OBOA 1XK7A 2IEZA 3IEUA 4D3FA 1Y1TA 3AYZB 2GXAA 1IVNA 2JGDA 1AE1A 5BUQA 2CDAA 1KFJB 4LZLA 5LWQA 4GLBA 3OQ6A 5DTMA 4L8LA 4FLFA 3CPHA 1E2IA 3OEEA 3IAFA 2O50A 3EULA 3K1AB 1R8XA 2MSWA 4N5DA 4UMDA 1V1RB 3D6UA 1Y33E 2CXQA 3VR1A 3T7SA 1L3IA 1NX6A 3TQRA 4BKRA 4MUEA 5BN3A 4QC2A 1V43A 5DYNA 1ONNA 1RVV1 2HV8A 1U81A 1F2DA 1GQQA 1P1HA 4NEQA 5EXSA 3RTAA 2G9ZA 3AG6A 4CEIB 3HZZA 5JVDB 1HYHA 2WABA 1T8TA 2OK7A 2R8PA 3F3KA 1KQNA 1C0IA 2JGJA 3TIIA 4AY3A 4I1SA 5LZ9A 4M9XA 4O2AA 4N40A 4LY9A 5EIAA 3GEGA 5TT0A 4BLQA 4O4IF 5FUQA 4PNHA 3HR8A 2WF7A 4X7RA 3K0FA 1W4CA 2EBHX 2VHUA 3AI7A 1SWWA 3RFTA 1DCFA 1GO2A 4KYVA 3SLRA 4OVKA 2W70A 3M6WA 2JD1A 4MVJP 4G5GA 1QH0A 4MMYB 5HUHA 2IP4A 4KMOA 5K6AA 1NJ8A 1H2BA 2QNBA 1IOVA 3NNNA 5EKDA 4X7PA 1SD5A 3TVTA 3L43A 3MGGA 1EDBA 2F8LA 1HT1E 2WDPA 3WGUA 4AKGA 4FHDA 2HLDD 4MRAA 3B7WA 4RWEA 3VOSA 4A1OA 5H59A 1TNDA 1DJMA 1FYFA 3ZVKA 3PXGA 4G4GA 2Z8YM 3FPCA 4YDQA 3SJCA 3R20A 3O3NB 4DUYB 2HSGA 5CT5A 4EKIA 5JCXA 2WKWA 1DAFA 3KEMA 3H1FA 3PHIA 4M89A 4MV3A 4EZBA 1GRVA 3LL4A 2OWEA 4RJLA 2GN9A 4I2NA 3OD1A 3HYRA 3UKDA 1RI5A 4HDOB 5KJ1A 1XNGA 3HC7A 1WVMA 3P9NA 3N0TA 3W04A 3BS4A 3MCTA 1K7SN 3QPVA 1GPMA 2ZAOA 5ALOA 2OQVA 3GLGA 1FP7A 4KYIB 1YKSA 1TK3A 1YC5A 2IHNA 2WG0A 4DCSA 5KMGA 3DCNA 5IYZA 4MW5A 2UYHA 1QIJA 4WZBE 5GJWC 4MWOA 3HKBB 1NBEA 1IMOA 3K73O 4LF8B 3ZW7A 5G3YA 3G7NA 1YIAA 4GMXA 3ZGNA 5DM60 1XRMA 2DLCX 4AROA 2O2CA 1OU0A 2EW1A 3L8EA 3M9WA 2WAMA 3BEDA 3EBOA 2I4IA 4LHZA 1BVYF 3M6MD 4YY3B 5BVGB 4XW2A 3UGJA 5K9ZA 5A71A 4R8RA 3BX1A 5FLYA 5C1BA 1JEYA 1DEXA 4AUEA 2MMGA 3CUWA 3RYFB 4EF6A 2PAFA 4IIJA 1QCYA 2NSDA 4TYPA 3R24A 5ALUA 1E77A 3FUWA 3UB4A 2X4IA 3KV1A 4D0NA 2H18A 1E0DA 4B9EA 4RV9A 3QLJA 5JZVA 3PFHA 4BO2A 4WTOA 4B5KA 1MC8A 4XVHA 3GNTA 2AR9A 4E08A 4DY4A 4O3MA 2YYSA 3B36A 2YYAA 2XVMA 1DKQA 5U1PA 3L1VA 5EJ2A 3ZY2A 3JD4A 3TD9A 2EZTA 3P9IA 3G2NA 3PKZA 3GZNB 2QRVB 4FDMA 1MO3A 4Q82A 1WP9A 1BXZA 4WMLA 5FOQA 4EI8A 1DT5A 3NAGA 3A4NA 1AUQA 1RVDA 2BHRA 3S2EA 4IQ0A 2Q6VA 1TC1A 2Z8YA 4N3CA 4Z7NB 5DU2A 4I6GA 3RRJA 2FZEA 5B7NA 5JASA 1PV4A 1PW7A 3G9ZA 2WWXA 1P91A 3EGWA 1XLTC 3Q3CA 1PP4A 3F90A 4YRAA 4C6RA 4XGKA 1EGMB 4BNYA 3MFQA 3DTVB 2J09A 2JIZD 1JAHA 3DEHA 4FDTA 1LLFA 3EA0A 1R6TA 5IJAA 5IZ4A 5A5GA 1SD2A 1I33A 1XMQB 1DMRA 3U60B 1N33B 3RC3A 1JALA 2PZGA 2F00A 3OKPA 2B8WA 2QGNA 3JQGB 4OY3A 5IKOA 2XCTB 3AR2A 3GPCA 4JLMA 2QN2A 1LTHR 3KFVA 4LJ4A 1L5GB 4F7WA 1PFKA 4FOLA 3I28A 3RS7A 2BLNA 1DLJA 3QY9A 2PZFA 3CLUD 4M0LA 2QAIA 1OBVA 1UC4B 1QO0A 4DNPA 3EY9A 2O6HA 1U8FO 1F17A 3CZRA 2A88A 3LHFA 3OU2A 1YZFA 4NDAA 5DN6D 5KYWB 2C2MA 4GS5A 4R16A 4FGKA 4FNOA 2IY9A 3HS3A 1W35A 4WBSA 3ESRA 4RPLA 1M1NB 4QREA 3DOUA 2GZ2A 2IEIA 2W4QA 4S1OA 4ZALA 4UTNA 2AW3A 2JLRA 1DBPA 3NUZA 1ZN2A 2I8CA 1J56A 4JI5B 1D9ZA 1ZDMA 3CYFA 3ONEA 3WP1B 5LR6A 2IX3A 4D5GA 3RC1A 1WL8A 1O0SA 3OURA 2CB9A 3PNQA 5BRNA 1KE2A 3P0RA 3VOBA 3ZGXA 5BYBA 3C3KA 4FILA 1TM2A 4KIFA 3CO0S 3TSZA 1NMXA 5AICA 1OTXA 3D6MA 3G2LA 2C84A 3QF4A 1UBHS 1VE7A 2OO7A 4IH4A 5T8KA 1UBKS 3L0CA 1L5HA 3WHPA 3T5AA 4M1SA 1PBTA 1M76A 2OCGA 3CSSA 5HKBA 3K05A 1A9ZA 4BNXA 1AY0A 1E2LA 1FTQA 1VKHA 4MNTA 2XMRA 4M8NE 3SJUA 2BKEA 1XJWA 3EZFA 4I5DA 3ZNOA 5C2JB 5C31A 4KSCA 2HA2A 4U2GA 1VL6A 5A02A 3DR5A 2OYRA 1ES9A 2O2IA 5FTWA 3CIFA 4EO9A 3ZHBA 1WVIA 2Z5FA 2V5VA 3T7EA 4BO3A 4C03A 1UBTS 5L4NA 2E0IA 4UNRA 2HCTA 2R00C 3Q10A 3DDZX 5FBQB 2HQRA 1TQ4A 2IXGA 3OQHA 4HDNB 4PZYA 5E6SA 4M7RA 1EVYA 1AURA 3I0MA 2N1MA 5J4KA 1E2BA 1ENOA 4XTCS 1SHTX 4YUVA 2VUIB 3PNLA 3R0ZA 2LPMA 3W5VA 1JDSA 1XXHA 3A4TA 1PQUA 4A8HA 1MOZA 3TM4A 1JMVA 2EFCB 3OEWA 4R05A 3VR3D 2UYCA 2XCQA 1L8OA 3DE1X 4DLNA 2P77A 1G2PA 2A5GA 1U8CB 5IVPA 1DIGA 4MTCA 5EQDA 1W88A 1YBFA 2FYTA 3IBSA 4JBNA 3GJRA 1W85B 3VHRA 2JBWA 4F4HA 4H77A 1PK9A 1U2ZA 3TNDA 1V3UA 3COWA 4RPCA 1F14A 1DXQA 2VJKA 4YHHB 1KH2A 4MVYA 3BE6A 3RT7A 1XMPA 2VSXA 4BVJA 3L7MA 3QKIA 2ZT8A 1SUPA 1OHHD 1ZOPA 4Z0PA 1XNQB 1XPRA 5C9ZA 1YJ5A 2QM8A 4N0QA 2OGZA 1JEDA 3BBLA 4L16A 4M8KA 5DYWA 3SHFA 4E4YA 5IHPA 2BR3A 3A2NA 2QQEA 3FI0A 1Z6AA 3H8VA 3OWOA 4Y1RA 3W4KA 2FPSA 1MTZA 1QGED 4H4DA 4C7OA 1OJLA 1A95A 2DHEA 3NATA 1BG6A 2GJKA 4KIUA 1H0SA 1GYPA 2WYHA 1VL0A 4EUKA 3DFKA 1LPOA 3PC4A 2I80A 2SKDA 3WGQA 3UOWA 1N6KA 1GL3A 4KQHA 1KBZA 5EA2A 3AYXB 1RWNA 3DLIA 3G1UA 1M8PA 5LDDC 3KPYA 2NYAA 3TCKA 3ZD9A 3DHVA 4Q4AA 5CDYA 3KPUA 5CB4F 3OTWA 2CFCA 2XGSA 1I0IA 4ER0A 1U3TA 4PXYA 2J9FB 1P7WA 1XA4A 4D79A 1L7DA 2IC5A 3TDNA 1OY1A 3NGMA 2FN3A 3D64A 1H5NA 2Z9BA 3DEFA 3LTEA 4RA6A 5DCWA 1E5QA 1G17A 2SCUB 5LOVB 3B3QA 4HXYA 3NDRA 3RLIA 4PSUA 1JU4A 3FBWA 4GG1A 1AIPA 5B2EA 5B57C 1O77A 1HEUA 4W5HA 4QPJC 1DBQA 2OD9A 1FZTA 1P4GA 2IXTA 4Z0NA 3K32A 3FJOA 1SVIA 4A0HA 1E4EA 1PD0A 1PT5A 2DB3A 1A0OA 1JF8A 2R97A 3HDHA 1EVKA 2ON6A 2HWYA 4GMDA 3GLKA 1T2UA 3Q7TA 5CNIA 4CIAA 1TD9A 5AKIA 5AIBA 1LWOA 4D8TA 1K8QA 4LTMA 3ELWA 4M86A 5C34B 3E9CA 3P5SA 4I81A 4H59A 5CT6A 2IW3A 3PIRA 3WGHA 4UEJA 5AJTA 1TKBA 4EABA 2WT4A 4FFRA 4GP6A 4MRMB 4TQAA 2BL4A 3U4GA 2PXCA 3KUDA 4C6HA 4CLDA 4UTPA 2VYQA 3A3NA 2QV7A 3E4DA 4MQEB 3ND8A 3PVZA 3VHQA 5K8IA 3RVMA 3A1FA 1LLQA 1RQPA 4PW0A 3DTYA 2XXJA 4QUDA 3PFIA 3B1WA 1JAXA 1YBMA 3F8TA 1F0NA 3PI7A 3MJFA 1YF3A 3QU7A 2JFGA 3BFPA 3GGSA 1N6OA 2QT9A 4QJ5A 3RYCB 3ZIDA 1I1QB 2WJIA 5I47A 1GL9B 2XDQB 3E81A 5AJZA 1L7XA 5IULC 3TL3A 2Q07A 1S02A 3LBIA 5FOSA 1U3DA 1VG1A 1W1WA 2ZIAA 1FS5A 3ZBTA 4R40A 4US0R 5KYGA 3KZCA 4NYJQ 1PV1A 2XA1A 3E1KA 3LPCA 3NBKA 4P2GA 4XD7D 4RMNA 2UZ1A 1S9DA 2D1YA 2ZT5A 4GYKA 4ZA2A 2XMQA 1VBNA 3EOAI 1FFDA 1YAHA 4P81A 5L3SA 2DY1A 1TZCA 4P80A 3HN7A 1A5BB 2VP0A 4V3CA 3GPDG 4AWXA 2OENG 2VJDA 4H18A 4TL8A 4BEJA 2JLAA 3T5DA 4CMHA 1DAEA 1MC1A 3CJTA 3SC2A 4DQ0A 4N48A 2EFYA 1FMCA 1CY0A 1XRLA 4UVEA 3BGOS 5IBRA 2UZ1B 3ZQUA 1KU6A 4AF6A 4EB6A 1J1IA 5CYPA 3VPGA 5F7JA 5C5EA 4CEHA 2DPMA 2J3IA 2IUSA 1MG0A 2QE7D 2GAIA 2JEZA 5EZYA 1Z16A 1Q74A 4M55A 1E3QA 5LNK6 1D7AA 1JDUA 4IZIA 5F64A 3H97A 2O4CA 2JIQA 3VU0A 4HGPA 3M5WA 4Y6LA 4L5YA 4EGCB 4R2JA 3PXUA 4IP0A 4QRIA 5KHLB 1WRBA 2FPLA 2JLWA 1DIOB 5CB0A 5B58T 3T1VA 4MR9A 1NI5A 1CEEA 2F9MA 4WX2B 3EK2A 5AWFC 4Z4HA 1BYUA 4WDRA 3RUDA 2ETXA 2NXNA 2AOUB 1E94E 4DCVA 2Q1TA 2W90A 3MTBA 4YT5A 4OUKX 2JFBA 1VPEA 4J0DA 4BB9A 3GO4A 1G3QA 1YB6A 2CCKA 3A4MA 3BFJA 3FCXA 3L18A 4UKDA 1PTKA 5KYUA 4PYJA 2C7VA 4FSHA 5C1IA 3T7AA 2QF7A 5JWRA 5LSAA 5CVDA 1K6MA 5TMBA 4KN9S 2CE2X 3UJAA 2BELA 3FVWA 1E2GA 3IDZA 4JELA 3U6KA 1LRLA 2HHHB 1YBAA 5KWSA 3C3BA 4YRDA 4BTVA 4XTRA 3T1HB 1EAMA 5LB2A 1Z4OA 2OXIA 5HUJA 2H57A 2O3SA 4HHEA 4AS3A 3SQXA 2HRQA 1VIAA 3GELA 1USVA 3RIMA 5FHQA 3GPBA 2ZQ5A 1QDEA 4FMDB 5KVSA 2NSJA 5HCNA 1P17A 4MA0A 4BB5A 1Y8CA 2QVGA 3PGKA 5JEDA 4L74A 4HAOA 2EP5A 1TYEB 2G3YA 3FPHA 4Q9IA 1PNTA 4ZEOA 3VZPA 4EPRA 2FOIA 4OUDA 5THQA 4DDTA 1GDDA 3OH8A 1YTUA 2QNRA 4LWZA 4H08A 2C98A 4TMKA 4UBNA 3RGWS 1GPDG 5I8WA 3N8NA 1V3QE 3E3NA 1HE1C 1TE2A 4RESA 2JAUA 4GOJA 3B5EA 3NHSA 3LOQA 1Z0JA 2R6ZA 4ALNA 3V4SA 2PV0A 3AERB 4PX9A 2O2EA 1KSGA 2JFZA 2R6CA 1Q1GA 3ROZA 1ZI6A 4OOEA 1YKFA 4PZUA 2XF2A 4EPTA 1F2VA 1DKRA 3RU7A 3HKEA 2GM4A 5GJCA 3IOCA 5C3UA 1J09A 3T34A 1Z35A 4BAZA 1TQ6A 4MYUA 3DDWA 4DM3A 1IY9A 4W1SA 4AS1A 1NHGA 2O2JA 4HLDA 1A50B 4RHYA 4I08A 1NMEA 1T5DX 1UDXA 1B74A 3LYLA 1HEIA 4ZCQA 1R0SA 3QBDA 2AFIB 1TCVA 1WY5A 1G5HA 4E32A 3TQIA 2PX5A 4EW6A 3I9KA 2OA0A 3ZV5A 4UBJA 4MKRA 2MCFA 3QJGA 1IWPB 1XXHE 2MSCB 4GGPA 1HWYA 1OAOC 2C61A 5BNTA 5K4GA 4QTTB 3ZGYA 5THXA 3T35A 3L0PA 1R4MA 2CE7A 4ZMBA 1XU7A 1ZIXA 4F9EA 1L6IA 2OEPA 1P0IA 2Y99A 3ZK9A 2AG1A 3VZRA 2O57A 1F7VA 1NY6A 1Q1QA 4Y2VA 1P4AA 2W2XA 3MXTA 1TCUA 3MT9A 4TWIA 2ZBPA 4WAUA 1PNRA 3L93A 2QPOA 5JJ5A 4U2BA 1UANA 1GGVA 3ZHTA 4N01A 1E32A 1M0TA 2R79A 4RE5A 4O4JA 3K71B 1NAIA 5IAOA 4I2VA 2RAVA 3HXTA 4JL5A 4JH0A 2ECKA 2QIOA 2IYLD 5J2TA 3EVBA 1XVVA 1A71A 3DOIA 5CLQA 4JUBA 4TXMA 4M1TA 4R1TA 1G1MA 4A8PA 2D5BA 4RNCA 1HL7A 1ATZA 1UZAA 1VDMA 2UZIR 3G79A 4KRGA 4PYKA 3UYLA 4BVHA 1FTNA 5JAUA 1N9KA 4BFUA 1N77A 5JRJA 2HIAA 1JZSA 1Z2CA 2NV0A 4M1OA 2JFUA 4KE9A 3EGXB 2ZSAA 4LKOA 3NO4A 4HS4A 4QJBA 4HFJA 5EIFA 2B98A 2GFQA 1IOWA 3Q7IA 4HR7A 2O0MA 3GEEA 3HJRA 4TKVB 1ACLA 1ESMA 3SICE 4CR8A 4HMOA 4WFIA 1GGJA 2QMUA 3LC1O 1FEZA 4GMHA 4HTFB 5F1KA 1PZEA 2Z2ZA 2OK8A 1MHTA 4QDTA 3NETA 3AJ8A 2VR1A 5CW2A 1B7GO 4QELA 4N49A 5ER9A 4HX5A 1LTQA 4F9GA 1H1LB 1Z37A 4NZMA 2OAP1 1CJCA 2YICA 3SBXA 2XH8A 3SZUA 1YJAA 4R7ZA 4PLWA 3SS8A 2QTHA 3BEOA 2IP1A 3MJRA 4C0QC 4G1UC 4BQOA 5BQFA 1M7HA 2WHYA 3A14A 3L01A 2L2QA 1HK7A 2IZ7A 4QUAA 5DNVA 3RSSA 3RBZA 1ICEA 1Y1PA 4D9IA 3E9QA 1P2FA 1DEKA 3F5SA 2WSSD 1JHYA 3K8YA 3E7FA 3F6SA 1E5LA 2NV6A 3P4UA 3ECSA 4NF2A 4MVJI 1LQUA 1MEEA 1AKRA 3ANMA 3CVXA 2D3TA 4BO7A 3AF2A 3BXPA 4CU2A 5AJVB 2AZ4A 4L3OA 4NU6A 3KR2A 4WXMA 2JATA 2WR8A 2Y1DA 3T9DA 3DHWC 1GITA 1CS0B 1YHYA 3PWTA 3VFDA 5EUQB 3QUSA 4URUR 1YGYA 4F8YA 3L06A 1JECA 4HWSA 4A2PA 3IT0A 4JX8A 3L7YA 2R6R1 5AQEA 3F96A 3DMDA 3E48A 1BE0A 2WHXA 3F7MA 4HQ0A 2W2KA 1QUFA 2BT4A 2FPUA 4M7PA 2XX3A 4RGVA 3OEYA 1UOQA 2QTMA 3KB1A 5CA0A 1RADA 2A3RA 4JZYA 1KH3A 2QMQA 2QD2A 4Q7KA 3V6LA 4AZ0B 1I3KA 4BS9A 2I2DA 4IRUB 1UKVY 2WAYA 2H16A 2JHPA 3OZIA 3OPVA 2YVLA 4QPPA 3WIOA 3V8BA 2J6IA 2Q1WA 4TPKA 4U7TB 3LSYA 3OLQA 1OGJA 3BBPA 5PNTA 2OLJA 3KKPA 4HNGA 3U4MA 3U44B 3SXUA 1MAHA 2FSVA 3FMPB 4PSCA 3HVKA 3WIVA 1AKMA 1RU3A 3O38A 1FRFS 1FXUA 1VG0B 3CXRA 3V4FA 4BO0A 4CM9A 1QX4A 4UHBA 3U3MA 3W78A 2BM1A 1Z34A 3I37X 5KAMA 4HQKA 3FBGA 1HYGA 2A78A 2WZCA 4GP9A 4OIMA 2GPYA 2A1UA 3VR5H 5HKKA 2BRUA 3GZNA 4NQZA 1RWKA 2RJOA 1OJ7A 1RYZA 1DARA 2B2XA 3ABOB 4H27A 4S1NA 1BMFA 5NLLA 3LP8A 5AVZA 2F43A 5K0TA 3EMKA 1PZHA 3K09A 4J7UA 1XZEA 5A9SB 4M1QA 4EQZA 4IGFA 4CW7A 2DRIA 5ALLA 1AZWA 2R1ZA 4TT3A 3D3QA 2IIPA 3RO7A 1WZCA 1I7DA 4XWKA 1E5DA 1DG3A 3ZE2B 1E0KA 2Y1XA 1Z22A 2BJVA 4OBBA 1H2FA 3VR6H 1AJEA 5L6LB 1K2VN 4JY7A 4RV4A 5E9WA 3M4JA 2G67A 4G8BA 4L95C 4INAA 3TECE 4GU5A 2YWXA 1SU6A 3ADBA 1XTTA 1DFGA 3JVEA 4QVGA 4RVNA 2RARA 4Z8XA 2ZTSA 4F7DA 3WNQA 1L1QA 3CKKA 3WL3A 3GJ6A 3W8NA 2X6RA 3L8FA 2AX3A 2YXBA 3M6FA 3R41A 4D44A 1TAGA 2OR3A 4RV5A 3ZCUA 3OQVA 2H6EA 3K1ZA 1C7RA 4IEFB 3X1MA 1J2EA 5C37A 1SXQA 2P2DA 3F49S 3RARA 1Z6YA 1ZNXA 1MAUA 2FQQA 3NKFA 4MV8A 3L8MA 4I1PA 2XGJA 3CNHA 3KWFA 3L07A 4HMPA 5CB8A 3MQ4A 5F5NA 3PHHA 5FXMA 3B6MA 4MVJF 4C3VA 5BVGA 1JFRA 2X1VA 4PAOA 5KMGB 3W9BA 2E3JA 1PZMA 2I2AA 3PC3A 3TTTA 3R0XA 3SY8A 1E89A 4KMMA 5SZHB 1UBJS 3FTNA 4S12A 1KI6A 1SD1A 4V1CA 1RAIA 2V7UA 3QU2A 2POCA 4Q12A 2BDTA 4QDZA 1GTJ1 4RA9B 3V7FA 4FMDF 5C3MA 5DM2A 2ZPUA 1SKMA 1ZH4A 2RCNA 3HKEB 4X45A 1UMKA 1L5FA 2Q27A 3CIOA 4DSTA 3QE9Y 1U4OA 5MN5A 3WOHA 4LJRA 2B8EA 3TBKA 3BWXA 3QE3A 1H69A 1TK2A 3R7WA 4EA9A 2G0AA 1P81A 2VF7A 2XHZA 4TWJA 3LRPA 1XDBA 1UOOA 2F8MA 2OVFA 3Q5DA 3HCEA 1NN5A 3T4XA 2CMFA 1CUGA 3H5WA 1UXKA 3CO5A 2LBPA 1E62A 3OE5A 1FZQA 3CUVA 4JLKA 4BO5A 5JC8A 2HF9A 1WOYA 5F7OA 1ENYA 4KFRA 2PV7A 2C29D 2SECE 3WE7A 3ZHYA 2V98A 3TRHA 1IN4A 1OQAA 1C50A 3NXKA 3P9YA 2MSEB 4KQFA 1DQNA 1PFYA 3KZMA 5DM1A 1G7CA 2P91A 3I1IA 1XXLA 3CF2A 1W1IA 4S2UA 5A62A 1L5WA 1CNFA 3FHOA 1TZBA 1EUDB 1JQLB 1P0CA 2JD0A 1IHPA 2RG7A 2WG2A 1B76A 2NLOA 3B89A 4LECA 4YLYA 2AZMA 3PP8A 1JH9A 4FNAA 5AOVA 4GWLA 1QM5A 4L51A 1A3CA 3E3OA 3H13A 4G1BA 3WRWA 2H59A 3B7PA 1ZMBA 1ONOA 4Y2HA 2X0NA 4OMDA 2OXTA 2F3QA 1L6RA 1K8ZB 2YZ7A 2CVOA 3P45A 3PNKA 4IWNA 1ZSVA 4L4SA 8LDHA 3PPYA 4KQMA 4Y98A 4PBTA 5E3HA 1IDOA 1FMFA 3GFPA 1DHRA 4COKA 5CFPA 5EJ6A 5DHTA 3FA2A 4C78A 4JJKA 3AVYA 3N2NA 1YR8A 2WJVA 5ALXA 1M2GA 1UJCA 1D03A 4MKZA 5JS6A 5FYDA 3I1FA 5I01A 1E1CA 1Z36A 2J67A 4DIUA 2GAAA 4DQUA 3FDJA 2ZSBA 1JR6A 3VKGA 2RGGA 3GWGA 3IMEA 2DJIA 4GM1A 5IDVA 4YRNA 1LDEA 1ZD1A 3D7KA 2M1ZA 2R66A 1F3LA 1WLYA 4IG9A 2B83A 4UBKA 4FU0A 3FGZA 2VJYA 3A6KA 1QAMA 4F56A 1JR3E 1DJPA 3JYNA 5DLDA 3KQMA 3QMWA 4M98A 1C81A 1Y48E 2B94A 3D8SA 3MB5A 4N65A 3OFJA 4OYLA 5TB5A 4F1JA 3BCHA 2UVPA 5KWJA 3J81k 1X92A 1ZXXA 3GT3A 5CIQA 4E22A 3QPWA 5KX5F 2QVCA 1VB3A 4YYZA 2EAUA 4Q1FA 3SZRA 4DQXA 5JFTA 2TRSB 5CD9A 2BM9A 5JNLA 1KJ9A 5CYOA 3VV3A 2O1SA 1Y7LA 3EQ9A 4CV1A 2XZOA 5AKXA 3RYIA 2XDWA 2YRXA 2FSIA 3HMKA 4JX9A 1F38A 2DKOA 4GX0A 4ZOEA 1GNTA 4FBMA 4C01A 5KNBH 3GRPA 2J5RA 2HJHA 1UBOS 4YC7A 2AE2A 2Y0DA 3B51X 3LQ4A 2O7QA 2C1EA 2CVHA 5ESWA 1E79D 2YHSA 2J4FA 4A6EA 1E9SA 2YASA 4LSGA 5ITVA 1ORVA 4G4SP 1I13A 2B20A 3TM5A 4ALJA 3ICWA 3IIEA 3IURA 4FDUA 1T8PA 2GBLC 2X2OA 1E79A 4XEUA 4OGWA 4OO3A 1ZIPA 3K96A 2VK4A 5AKHA 3ZY5A 4A8JB 2XRYA 3HM2A 1ZVJA 4OXKA 4IV5A 4AZ3B 1JKXA 4MRRA 3RCBA 1D5WA 2WAOA 4RJKA 3U7RA 4MEBA 3UVEA 1VMDA 2YINC 2BOVA 4JUCA 4JU9A 4Y2PA 3RKRA 3IUMA 5B6PA 5CEFA 2EKBA 3IUJA 3MMNA 1T6ZA 3PT9A 1UP6A 3R3JA 4TTSA 5SICE 2WP0A 1P6QA 1JLHA 1G42A 3TRKA 3F6BX 3S2ZA 4U2EA 2YV5A 3EH2A 3TLAA 2PU5A 4D4GA 4UM8B 4C29A 2HJGA 4IVRA 1BH2A 5F5LA 4CL0A 3LX4A 2LKCA 3AF4A 7AT1A 3GFOA 2CHGA 2Q9CA 1JU3A 1G98A 1QQTA 1M6EX 1UEXC 2NGRA 3KSDO 3AIKA 4K1XA 1TUBA 3F9CA 2H9IA 3A05A 4V0QA 4KR9A 3HBFA 4JEIA 1GCOA 2G1PA 1FC0A 2IYYA 3V3TA 1KI9A 4FC7A 1XEXB 4JITA 4UQOA 2QJRA 4MB6A 1P72A 3T95A 3EFOB 2UXBB 4MV5A 3IIIA 1I3CA 1KZHA 3Q8XB 3O31A 4MQUA 2X5OA 5GADl 4CQMD 3OIDA 1TZKA 3O73A 4IUCS 3V4LA 2O0LA 4CTOA 3KQYA 3WY9A 4MDHA 4RY9A 5BORA 3NBMA 5F3DA 5BSWA 3HVRA 2GS9A 1CJKC 3AUTA 4ZOCA 5C8YF 1US8B 2R8YA 1F12A 1V96A 4IVQA 3ZCQA 4I5FA 1IJKA 3BE5A 3LQQA 4D9CA 1YE8A 3AV3A 5DCYA 1JPVA 3UJ6A 1GUDA 3RRFA 4FR5A 2QN9A 2HK9A 4CRWB 3PNVA 2AQIA 3PSAA 1HKHA 1RM5A 2RG1A 3DQZA 5A7HA 4IJVA 5CRIA 1RJ9B 1VI5A 4UVGA 1K8RA 3LHDA 4WWHA 4ARBA 3E2IA 2MMCA 2WIKA 2PXXA 1QVZA 2VT6A 1AD2A 3D3NA 1TAHA 2GKGA 3E3MA 4JR2A 4EJFA 3D7SA 4N8SA 4ER5A 3ONFA 1ZMXA 3RSQA 1G66A 4FFOA 5MF6A 3AEZA 2OD7A 1P0MA 2F1HA 3HCPA 3HBLA 4ZJPA 5CDUA 3HHPA 2D4HA 2JJ1D 3VNRA 1M0SA 1KVUA 4AJEA 3N2EA 2O48X 4YHBA 2P1DA 1W7AA 4ND5A 1A69A 4TV9F 5K8CA 5D5QA 4EWLA 2WNHA 3FPFA 2BYTA 2H17A 5A5VA 3V4OA 1CUFA 2NO4A 3A70A 4S1PA 4ZHSA 5JO0A 2JHCA 2YZNA 3NAZA 3NWJA 1QH9A 1UJ6A 1GTSA 5A5DA 1P9WA 5D1HA 2GPTA 3GZTB 3ANTA 3QPDA 1LBEA 2RGUA 3FUCA 4ND7A 4Q4HA 5CX4A 4GR5A 3CXUA 2KMLA 1QS0A 4MGIR 4F2WA 1EVQA 3WO1A 3B6EA 2MDTA 2YYZA 2QY9A 5IAKA 5TGTA 3CWZA 2D7CA 3U81A 4NKRA 4RF2A 4K9PA 4B4DA 1JHOA 1IJBA 2Y9MB 4ZVTA 2O59A 2QLJA 3B9QA 3FTPA 2FR0A 5E4YA 5B36A 2WJ6A 1C3JA 3T15A 4FEYA 1M8KA 1LSOA 1PL7A 4B7XA 2GCOB 4UEWA 3O8BA 3QE2A 3AL3A 4JJIA 2ONYA 4ZVKA 2CW5A 1TPYA 2ZRAA 3V55A 1JEOA 5HGJA 5C5IA 3GLUA 4FWBA 3WMRA 1TD1A 3UH1A 2NU7A 2NZJA 2VP9A 3KU4A 3TKLA 1JSZA 4EG0A 4X54A 3CPEA 3D8RA 1QYIA 3LZCA 1VSUA 5KYXB 3R3YA 5CLHA 1K68A 3DO8A 1EE9A 1C9DB 1WTCA 3HY4A 1WZIA 1AQIA 4NSNA 2HPHA 3F6RA 3VPXA 1RMTA 4CDRA 3VSCA 5A9SA 3GDHA 1KK3A 3A2LA 3MWKA 5G0UA 1Y7TA 1VJ0A 2TYSB 1RE0A 4F0JA 4O4LB 3HU2A 3S1SA 2O7NA 4ZMSA 4WVFA 4V0RA 4Q3LA 3CTMA 1R3DA 2WJWA 3JVUA 1NP6A 1TYDE 1ZUWA 3H99A 1FP2A 1F3OA 3JY6A 4AN0A 2G04A 1ESDA 3REGA 2QX4A 2Q0SA 3D2BA 5E8RA 4CWAA 2QS9A 2GDJA 2GJ9A 3HA5A 2HXYA 2I62A 3ELBA 3LCMA 4KPUB 5IUKC 3ZJ5A 4DMCA 4M38A 5TX7A 1WS6A 4C4AA 5LU8A 4YXWD 3AI1A 3NOVA 1N36B 4W9MC 4Y6QA 2AOUA 3FCOA 3UY4A 4L0CA 4Z7JA 2QZ4A 1UC9A 4C0BA 1OBHA 2GA9A 2V6IA 2QT1A 3AW9A 4I7EA 5I6DA 3U44A 3U4QB 1VSBA 2OXFA 4RGQA 2GOYA 3BA6A 5KSYA 3LXMA 3Q6MA 1KR2A 1XRJA 1G19A 3RRNA 3ZLUA 5F9FA 1LTKA 2HPAA 4YO8A 3ZQJA 3HE3A 1TJ4A 5EJIA 1XIVA 3A9CA 1N1EA 1IYZA 3F7NA 4IDQA 1SNYA 3UM9A 3J81A 1I94B 2QTTA 2ZSEA 1ODSA 1Y7HA 4TL7A 4P36A 1Z4JA 1JQJC 1KYIA 4I4CA 3SX4A 2FPWA 5AI8A 3SSAA 3UK6A 4QPDA 2YXEA 3I2GA 3G68A 5J5AA 2XCUA 1J8DA 3G5LA 3DWEX 3UMBA 5LP6F 2G76A 2QHXA 3AUFA 1IHYA 1XF9A 2DVMA 3L8GA 1H3FA 3NNSA 3PX2A 5A3RA 1CSEE 1G20A 5BN1A 3ZHQA 4L5JA 2JCGA 5AI4A 1ENZA 3GHYA 1PEYA 2V7TA 1Y3IA 4L9AA 1SM4A 1L3CA 1ZC4A 3C14C 3F5QA 3E9RA 4FLEA 1A5AB 5EXXA 5DBIA 2OPBA 2R6FA 4PXSA 1QGUB 1CERA 1SXIA 2GLTA 4L5BA 1Q6YA 3OVMA 3KSRA 4LTNA 3ZHOA 1DUVG 2WD7A 4YCBA 4E4RA 2K2WA 3WYGA 2ANBA 2EF0A 2ST1A 1X8LA 5K6AC 4UAGA 3JAMA 2VUHB 4HUQA 3EFEA 2HA6A 3QPBA 1RXYA 4OEHA 4WCFC 3HCWA 4U0KA 4UU1A 1DXOA 3PNSA 4NC9A 3I23A 1OTHA 5JTUA 1FUKA 4D4IA 4JN6B 4BQNA 1O4WA 1KJYA 2AJCA 2V0NA 4PGMA 1TQDA 4HKTA 4KXWA 4Q0MA 3S8YA 2CHVA 2D7DA 5EAIA 1AKNA 2CUNA 2RC6A 1Z6QA 1M1UA 3CV3A 3RUHA 2ZZNA 2VN8A 2YDXA 3GP3A 3UCEA 3VKFA 4EBFA 5C46F 3H2ZA 1PJ2A 3CR7A 1AQLA 3A2KA 2VC2B 4PYIA 2C4WA 3IXQA 4FLMA 2CXNA 1A04A 3ZV6A 3PG5A 4RULA 2HYIC 4OXYA 4YXWA 3WV5A 3I2JA 2H00A 4JYAB 5KBYA 3SFZA 3W6ZA 1OCEA 3IOBA 4XWYA 1BGWA 4M60A 3GIDA 3T3HA 3QEMA 4L5CA 3U4DA 3U3OA 3UN1A 4BXOA 4DUGD 3JAKB 1NBIA 4TLCA 3O4RA 5BVHB 3T3NA 2HO5A 4U7GA 1OVMA 4GX2A 1POXA 2IK8A 1IXZA 3C3WA 3HYNA 3P32A 4GX1A 1W5AA 2W0SA 1CUWA 2PR2A 1SG9A 5FPQA 1OV6A 1J07A 4ZCIA 3R74A 1Y82A 4AJ2A 1IQ0A 4DLUA 3L4SO 3PDIA 4WZZA 1JIVA 2FPGB 3E61A 1ZBDA 3TSYA 1GPLA 2A58A 3S5JA 4HEHA 1L4YA 3DOCA 3OSUA 4EB3A 4HVLA 1W0CA 2F62A 1NP3A 3CX3A 1RPJA 4GBJA 3TE6A 2HMAA 4IJ6A 3ZUPA 1QR2A 3C4QA 4D4HA 4MIYA 4J7XA 1MJ5A 4KVAA 2GEJA 4ZICA 3MUFA 3OP4A 1W8DA 5EMMA 4OH1A 5GZ1A 2QJTA 2CHUA 2HGZA 5HE8A 3ZWBA 1UP4A 3PRKE 5ICFA 5I4BA 3DD5A 1Z07A 4YMLA 4O2LA 1PYGA 2X77A 3OQBA 3RS3A 1EUQA 4G56A 2L19A 3DOEA 3AM1A 2V03A 3IJPA 3U3DA 3NH9A 3SC4A 2M2IA 1UC5B 2VTVA 4EA8A 2CXTA 3NP9A 5KCZA 4Z4FA 3LYUA 4OM8A 3IQHX 2RIPA 4LMPA 4ZI3A 2VK1A 2JAPA 3BH6A 4B3GA 2P9TA 4OM7A 3UJCA 4C7OB 3SQNA 2IHKA 1K8YB 2I34A 1VJRA 1XKXA 3I9V6 3NUGA 4CMIA 2WHQA 2ZSIA 4O2AB 5H82A 2PZKA 4RMHA 1D8TA 2P79A 3MYRA 3IT2A 2YWCA 3CNOA 1RRVA 3JATB 1DRVA 1UFVA 1Y1QA 1HPLA 1Z5PA 2I03A 4BIIA 4RTNA 3SYKA 2DQSA 3QVWA 1NY5A 2D1FA 4E11A 1SURA 1FYWA 3J7TA 4NESA 4IIHA 4UM5A 5A3VA 2PIDA 4CIBA 2PRJA 3GLIB 1BC5A 5JXWA 1K86A 1PHRA 1O9BA 4YB8A 4L6IA 1Q19A 1YRLA 2ETVA 1PW5A 5L3RA 1XLWA 4H16A 4IY1A 2QQ5A 4I46A 3LUBA 3SMVA 4E2WA 4Y7DA 3I76A 3WDMA 4EKYA 4NPAA 1R6XA 1EX7A 4D8UA 4BWGA 2JFWA 4DLVA 1SCNE 4ROTA 2PAAA 4OKNA 1II8A 2RC5A 1NVVR 4UFNA 5F51A 5I7WA 4MQBA 5B4TA 8MHTA 1GPJA 2EERA 5CDGA 5AXBA 5HKKD 4BPBA 1YK1A 3P71T 2NUAA 3K9LA 2C5FA 4Y3UA 2VLIA 1JRLA 5K4AA 1DRWA 2JGNA 5JMOA 5JD4A 2CT8A 4MAFA 4PCLA 3KOMA 4UD6A 5LUAA 4RD3A 4CM7A 4DR6B 3D1VA 3NIFB 5CITA 1XVLA 4B4OA 5DBGA 1OW3B 3PWZA 3GB9A 3JWJA 2XE4A 3AUUA 3GGDA 3RU3A 4G5OA 3ZVLA 5IUNC 1R6DA 2W2PA 4F4FA 3MOSA 5K7SA 1P45A 1QG4A 3ED1A 1A8PA 4QNRA 2XGOA 2XF8A 1M34E 1M6HA 1HA3A 2NZVG 3Q2OA 5IK2A 3ZXUB 3L05A 2P9QA 5K0FA 4RHTA 1KAQA 2NQTA 3Q1KA 1UJ2A 4IDFA 4Q3BA 2AMLA 2FX5A 2QA5A 3HADA 4DADA 4UOQA 3L7IA 4PYNA 5BNFA 1UP7A 4N3AA 2WWHA 1UAYA 4FSDA 3I0ZA 4YWHA 4KWTA 3PGA1 4CMIB 3N70A 3UTCA 2NTJA 4A27A 4L9RA 5AESA 6REQA 3HL4A 1TDJA 2FWJA 1TMGE 1ZUIA 3D6FA 1CRWG 1T4CA 3EEIA 1O94A 2A4MA 2PWAA 5B1DA 2M6LA 4G23A 4A2CA 4ERNA 5A1TA 4JB8A 2C9DA 1BW9B 1JQAA 1M7BA 1QTIA 3VTKA 1M0EA 1H05A 2BTQA 4B2IA 2GBPA 4RANA 4RDIA 3O92A 3M5CA 4DWWA 4F12A 4KI7A 3BAZA 5IAGA 1NVGA 2L0XA 4LI0A 3W5SA 2XMZA 3DGFC 4J8PA 4J76A 3G5TA 4TQ9A 2X6TA 3DE3X 2XUIA 3O93A 4HK4A 3BHIA 4PHFA 1R4AA 3IA7A 1O8CA 2VTKA 4MRSA 2PYZA 2DWOA 3CLRD 5GIPE 1VPVA 2O2GA 3IKLA 3OU6A 3UFBA 5KWVA 1RWQA 3VR5D 5G1NA 2G7MC 2BUCA 1NUPA 2P2LA 1LDGA 4O6VA 1P44A 1M6YA 1F2UB 3PXEA 1GOTA 3QELA 2A9OA 1QH8B 4UJ3A 5K51A 5CCDA 3L04A 1FX1A 3GJYA 2H1OA 1KZ7B 4Z9AA 3L3BA 1ODIA 2XUGA 5F1YA 5FA5A 4R9UC 1BCRB 1JHQA 1FUIA 1YA8A 2ZJ6A 3EQ6A 3NDPA 3SKYA 3DEZA 3VNBA 1JJFA 3IDQA 1IHDA 2Q7XA 3NIDB 4WLFA 3HLYA 5ETJA 1KTIA 5F4BA 1U8XX 3UBTA 1EJ0A 4MRMA 3B7GA 1EK5A 4JXZA 2QUBA 2Z2XA 1GFIA 3N7AA 4HFNA 2HSWA 4QUKA 4W9NC 1MZVA 4IUDS 2WUVA 3EGCA 1M34B 2O8VA 4JT2A 2FJUA 2VFAA 2YYYA 3MMXA 2I6GA 2NTEA 4EUNA 5I9TA 1XX6A 1N3LA 3EWSA 1SCBA 4MWEA 4ZYWA 1YE5A 5JMTA 5IEJA 1ISHA 1Y9ZA 2J3DA 3AJEA 5IJ0B 4L5AA 2WA1A 3OIUA 1A9OA 3GGJA 1V1MA 3JYOA 4U02A 5TARA 5JV5A 4IIJF 5CFZA 3PJRA 2WIAA 4PLGA 3T99A 10MHA 4ED9A 3I39X 4E33A 2IXEA 3ETDA 1WJGA 4J16C 3GCXA 1UK7A 3UKJA 3VKVA 5IN4A 2UYGA 2A9VA 1OLSA 4KDEA 5K99A 4AUKA 2PS3A 7ABPA 2Y77A 5F98A 4AKTA 1UJ5A 2OOSA 3B6KA 4E2FA 2HTFA 1VCHA 3JPYA 3LUHA 2QXUA 1IXRC 2XI4A 1V1MB 2WAXA 4K86A 1XMIA 1ECBA 3DM5A 4ER7A 2ZRGA 1HDZA 1ODKA 1U0RA 1T5HX 4IV8A 5KSPA 3KFXA 1LNZA 3EIQA 5JNSA 4HQNA 3LYHA 2SBTA 4HBZA 4FFSA 1L5RA 2FSHA 2V7PA 4KGVA 2P9JA 3JQ9C 3PFGA 2A5LA 3UAVA 1HDYA 4ZVPA 5HKAA 2AVNA 2FNAA 5FI5A 1OFUX 1VKNA 3M1AA 1ZNYA 1I51A 4H6XA 4HT3B 2UAGA 4D9KA 5KNCD 1EHYA 3TO5A 4K1LA 4CCSA 2H8GA 3MPUA 5E7QA 4NY1A 1Y7PA 1I36A 2ZT7A 2C78A 5LA6F 1GSHA 3HDYA 2XB9A 2HWXA 1YULA 2HQ1A 1M0WA 2HCRA 2GHRA 2ZANA 3FPSA 4FKMA 4MW6A 4YCMA 1X9GA 3D1LA 1C0KA 2Z83A 3QHQA 5J40A 4OXXA 4PZAA 1XV5A 2ZVQX 5AM1A 4B09A 1M1YE 2I78A 3IPCA 4MA4A 5DP1A 3DYVA 5AVOA 5HUQA 3EFHA 1PJSA 2OFOA 2JPDA 4HC4A 4KZKA 3WK7A 4INZA 1U65A 3L0ZA 4I4IA 3G02A 3HGQA 2WJ4A 1BD3A 3FLBA 1EDZA 1UMCA 5JCPA 2CFIA 2D8MA 3GAAA 1VPLA 3KOZA 3DHEA 4IX1A 4LC1A 5AVUA 4LRYA 1QORA 2WT8A 3FTDA 4LOHA 3CZPA 4QYXA 1O0BA 5K0EA 4AULA 3NUQA 1D4FA 2OP1A 4BBPA 2XR1A 2NXEA 1PFVA 1N6NA 4FINA 1RRKA 2BGIA 4REMA 2BFDB 1PUXA 3GFQA 1LQTA 3EVCA 1AKYA 1KI7A 2HIMA 2X22A 2X5KO 2P9CA 5ICSA 4Q39A 5KYYA 3G5MA 4MQEA 5DLEA 5DTQA 1TM7E 1ZH2A 4O4LA 2XNDD 4IHJB 1UPCA 4NARA 1M6NA 4HNSA 2IYZA 2JFYA 4RUKA 5DZSA 4DQKA 4F96A 1QLWA 3REOA 1M9NA 3IO5A 4R84A 5LDGA 1OH6A 1V16A 4IKOA 1ZA2A 1JIIA 1PRYA 16PKA 3GLFE 1HGXA 1KMQA 3AFNA 3NKVA 3E4CA 4MJLA 4V39A 1ZM9A 2WWYA 1QP7A 4HH3C 4FYKA 4ZANA 3DMTC 4S35A 2RHBA 1KJ8A 1ORWA 2C99A 2GJSA 5ECWA 5TY0A 3NWBA 3SKXA 2WV9A 3U49A 1Y5RA 4I1IA 2NUPB 4QUEA 4R1QA 3GG2A 1DJOA 1WP4A 4MAAA 3ENVA 4DMFA 1UBUS 1RMQA 2NVOA 3L1KA 4HDAA 5AHKA 1N0HA 1REQB 5KYKA 3ZVMA 1H8ED 5J23A 3N74A 3CUTA 3QF4B 5JT1A 2H65A 1W2GA 1YZ3A 4PFQA 3TZLA 3UPDA 4JHLA 1JEEA 4Q01A 3HP1A 3BQMB 3QA3E 1JWLA 4JA2A 4EYSA 4YMUA 4HQOA 1TMYA 5EZYF 2WJGA 3S3TA 1CF2O 1YO6A 4L4RA 3DV0B 4TRNA 3FLAA 3UGQA 2AUMA 5HJEA 2WLTA 2OCBA 3H83A 5JQGB 4F3TA 5LLTA 2QAGA 2GO7A 1KEZA 4MV1A 4JC4A 4LZNA 1SCIA 3PXBA 1NRWA 4K6HA 4DXAA 2BSXA 5C8XA 4LDAA 3HO1A 3IP7A 2ES4A 2G25A 1A7JA 3ECCA 3TEJA 2VDKB 2WINI 3C8HA 3SP1A 3B3FA 2VHWA 1E0AA 2AYZA 4B3DA 4FEAA 1JLRA 1ONPA 4OQDA 3G0BA 1ST2A 3D31A 4BX2A 2D2EA 4CG3A 5AJYA 1LBTA 3QFCA 4F5ZA 3QTLA 4DB4A 4TM8A 3MQFA 4AJJA 3IAHA 5FAKA 5EI5A 1U0BB 1N3YA 3TUIC 3ENQA 1H1DA 3R5TA 1XZKA 4NBRA 1CF9A 3THWA 2OAQ1 3DZDA 1U2GC 4W63A 1HC7A 1YRWA 1AV7A 3KKNA 3WVNA 1C4XA 1DIAA 2H4HA 2YRFA 1H0HA 3CPJB 5K3AA 4CTJA 3RQSA 4CV3A 1JEJA 4TTRA 3ZCSA 1TLFA 3JQ6A 2BMAA 3O1LA 3WLHA 2HFKA 3H3JA 3K1TA 4LW8A 3OSZA 4EQ6A 4CM4A 3G2KA 2GETA 3K0KA 1XVUA 1B3RA 2DY0A 4P4UA 4WESA 3K8QA 1P7YA 3KJEA 4DNOA 1OB2A 1IZ7A 3WGOA 2A35A 1W73A 4JBIA 3FR8A 4YH1A 1YR7A 3G2IA 3PC2A 1H94A 4BATA 2WTUA 1X8XA 1PYOA 4ZC1A 4YUXA 1JWBB 4RVOA 3X0DA 1S8AA 1VBKA 4INPA 3PKJA 3Q4GA 4NZ9A 3Q88A 2Q5OA 2I7CA 2QRGA 3WLNA 3B9BA 4Q47A 3SAJA 3SS9X 4EY5A 1XXHB 3LX6A 121PA 1QZTA 2GASA 3DD1A 1T9GR 4O4IB 4XDZA 1NNLA 3GLSA 1XZNA 2F64A 3PXDA 1N0WA 3IYLW 2XTZA 3QE0A 3E9EA 1K7EB 1BYIA 1E66A 1ZN7A 4QU8A 4FE3A 3A4IA 4BYMA 3LT5A 3LD9A 3Q7SA 3FNQA 4OQFA 3PYLA 1U2SA 1DKMA 1GU1A 4D41A 1TJPB 1GCGA 4GWGA 2OC4A 3R6GA 3T54A 5E2AA 3X2EA 1XPUA 3ITEA 2C94A 1ZG3A 2QT0A 4KN5A 1Z0AA 3MJCA 2ENWA 4RKWA 2ZJ8A 1UEIA 5TGDA 2QRPA 5WRFA 3GEHA 4JUDX 2D74A 2B4KA 2ZS9A 3TCNA 3JV7A 1LI7A 3KVOA 3IQDB 1GAWA 2FZLA 2P9ZA 4QJIA 5CVCA 2H2AA 5GGXA 3REFA 3ZD7A 4D9HA 4JOCA 1GZ3A 1SRRA 1A97A 3SQWA 3RUIA 3HU1A 5JNRA 1U6IA 2GTIA 2Z3ZA 3OA0A 5DULA 1ISGA 2BPOA 3VGPA 3BMCB 4YRKA 1SELA 1V3TA 3HEAA 1UBFA 4JP2A 4WN9B 4ZVLA 3IS3A 2IODA 2OECA 2QR5A 3ANXA 3R09A 2JVIA 2AFHE 1VSQA 4GR9A 1YVDA 1EFVA 2PXAA 4PO9A 3V1NA 3HKBA 1XO1A 5L6MB 4LZWA 3I6IA 1QMPA 3M3PA 1SXJA 3LUCA 4FX5A 1JHUA 3ZV3A 5JBNA 3I64A 4BE9A 5LYYA 3RTGA 3DULA 1PS9A 1IQPA 4KPYA 3A26A 2VYCA 4DPLA 4LY3A 1XHLA 3O1IC 1GNPA 4YWJA 5JPDA 3KKZA 1OAAA 3GEIA 4LDNA 5FD8A 1PQWA 1L5NA 1K6EA 3MRVA 1C8LA 1XRNA 1LDMA 4J6EA 4DLXA 3JWGA 3ESXA 5LP6A 2DERA 3T5MA 1F9EA 5DM0A 1J2TA 4WECA 5A3JA 3HM9A 4Q1CA 4KZPA 1U1FA 1Y3CE 2HUNA 5EN4A 1MOQA 2YVKA 3ROTA 2J0SA 4ZREA 3WDSA 2XDYA 4KTTE 4D46A 2GBIA 4WPGA 2P6PA 2JGKA 3QXHA 3EPKA 2YN4A 3EPPA 1XJQA 1RP7A 2LW7A 3TLXA 1EP9A 1TB4A 1ORRA 3ER9A 1UMBA 3O8LA 5IBPA 2IV2X 2R62A 5FUBA 3NWPA 4DAEA 4EPWA 1NOKA 2E4XA 2D2VA 2R87A 2O54A 4RF4A 2XUAA 5A05A 3WXMA 7YASA 3ILHA 4F4DA 5IKMA 1JA9A 3BGDA 2YWFA 4NFYA 2G88A 5LMNB 4TZ0A 1C3VA 4N4AA 4YTEA 5KQRA 2IGTA 4X1YA 5DF1A 2NVWA 3OQIA 4E94A 4QT4A 2VPXA 2NO0A 1SVKA 4DCUA 2GJ8A 2IQ5A 3MELA 4CJXA 3ZYZA 2IE8A 1Y4ZA 4P31A 3LBAA 1ULZA 1XD2A 3WL4A 1TFUA 1LK0A 4UZSA 2EKQA 5CX1A 1Q7GA 3UIEA 5JH7F 1WBDA 4CKYA 3HJNA 4LJYA 5DMHA 5CEJA 2BHTA 4DC9A 4RZQA 4QXPA 2LR0A 3WBFA 1BRTA 3R0IA 1MW8X 5LD2C 1O9GA 5LQUA 2UYYA 1MORA 1V5IA 4UU7A 3F0TA 4YT8A 4ESVA 3B1YA 2CSUA 3ZEIA 2C20A 1N25A 3FOFC 1DC4A 1QKIA 2ZREA 4KGDA 3H5NA 3PX3A 4Q03A 3UUFA 3OCJA 2C5SA 3EVFA 2J7PD 3GUHA 2Y1FA 4WH0A 2I66A 4R81A 2FUG6 2OFPA 1NPTO 1RJFA 3QMMA 4KAFA 1TT5B 2BGKA 4LRWA 3D8UA 4MYRA 1NXXA 4XRGA 2BZ0A 2FJ0A 4FZVA 2P3OA 4QRHA 1E9RA 4UHFA 1QMGA 2DLNA 3F46A 5JXJA 1QRTA 2V97A 1EBUA 1JI0A 2AXQA 1N1DA 1XBTA 4TGLA 2IPOA 4KO3S 4QDXA 3TI7A 2UXDB 1NXSA 2FVXA 2ZYWX 1B14A 1E4VA 3ETGA 5D3KA 3VC3A 5IAJA 4XR9A 2A59A 3IE0A 1A96A 3LUDA 1CIPA 1N2IA 4UUOA 3OOEA 1KI2A 2AS0A 2LCIA 1QVVA 5DN6A 2D1RA 1DUSA 4PX2A 1JLSA 3FZGA 4D9FA 5I4IA 3ZS9A 3DF7A 2AG0A 3FNHA 4LZPA 1BHSA 3FLMA 4LYAA 2GK6A 4MV6A 3BXFA 1HDCA 4QGHA 1JQEA 2ORVA 2OO3A 3G17A 1THTA 2G71A 2NYVA 1NX9A 1ZM3A 2PIAA 3G88A 4MPDA 4XSHA 5CYFA 5KNLA 1U90A 4JI4B 3PXXA 1TXGA 4DIDA 2ZB3A 3RROA 5HP4A 4X71A 1ZRMA 4RS3A 3I1JA 3WGMA 2Q2VA 2MOKA 4DJFC 1KOGA 3RRMA 4AFNA 1D2AA 1P2GA 2ZSKA 1X1RA 5JYBA 1O08A 5FORA 1GPH1 2QPAA 2X0KA 4HSGA 4HH1A 3WLAA 1CEYA 2P5YA 3DOJA 4G97A 3DA8A 4CI9A 1Z3CA 4JT4A 4AZSA 3U0BA 1G8JA 3HUDA 5E6RA 1Q11A 4CMGA 2JZOA 5K5EA 1TRHA 5KDOA 4O08A 1W4ZA 1Q0ZA 2ILVA 4RHEA 4DKXA 5I45A 3WMWA 2LDXA 3KXPA 3AP1A 1H6BA 2HGSA 4JJEA 1VYTA 2H48A 2NSHA 4MVJG 1JEQA 3GD5A 2PUFA 3NKLA 3OQOA 4CV0A 4OQLA 4US2R 5HQTA 1YCDA 5IARA 5B2FA 1YB4A 2ZDHA 1QCCA 3OMXA 4NHEA 3JQ8B 2J41A 1NDUA 1VKZA 2VKQA 4A4DA 1IN1A 1NVTA 2YXLA 2W6MA 5BN3B 3HU3A 4X1IA 1VDZA 4KWCA 4BU1A 2VAVA 2ZVPX 1GRRA 3K94A 4I55F 5K3BA 7MDHA 3T1QA 4DCCA 4HAXA 3R77A 4DC0A 3PBKA 4RPIA 2CNKA 4M0FA 1AGXA 3CVUA 1B0UA 1SVMA 3V2GA 3NYQA 5DXFA 2WK1A 3BB4A 1GDTA 3EH1A 1LB1B 2XMSA 1H2RS 2IHUA 4JKIA 3HYCA 2EDCA 1ULUA 1Z75A 4UUMA 2DQZA 1KP2A 5AXAA 2CL6X 4TQGA 2DAPA 1CFZA 3JRXA 4K6FA 3ED5A 4R7TA 9ATCA 4DIBA 3W8FA 1LA2A 2C9BA 1RQNA 1Z2PX 2B37A 1IY2A 1YOVB 3BHMA 2YHUA 2QXTA 3SVZA 2PX6A 1T6NA 1UXGA 3MTIA 1FYDA 2IQIA 3L6RA 2DFLA 2Z1MA 2JDID 3FB4A 1A8SA 1BMQA 3FYUC 4QU5A 4PZ9A 5JCZA 2IYUA 4UXIA 4YNBA 4BV9A 4CMKA 1QHNA 4LC9A 4WACA 5JAQA 5ALVA 3ZBQA 4AX8A 1CY6A 2ZBUA 4PF1A 4RKEA 5LXTB 3SBEA 4H1WA 3IKTA 4E09A 2VDMB 2VNIA 3Q8WA 3MTJA 3BN3A 4XGQA 4ATNA 1EQ2A 5KTRA 1VJ1A 1GUAA 4EW3A 4IGIA 4HB2A 1L5HB 3QLUA 4M8SA 3ACCA 1DAOA 4LF5B 3IVAA 5EXDA 2X6QA 3OX3A 2BFBB 1HFKA 2AG8A 2EHJA 3GGOA 5FBRB 1BWQA 1Y6QA 5BWOA 1IUKA 3K0EA 4X94A 2J3KA 3H9CA 1YZKA 1K97A 3NXSA 4KE7A 3TLGA 4JBLA 3V1YA 1LCIA 3GQVA 1VL2A 3IB3A 4Q1BA 4ENUA 1LV7A 4G41A 1GCAA 2XCOA 1GYRA 3EGOA 1KWGA 2V7VA 1MPTA 3HBMA 3W8DA 1M2WA 1JSXA 1G41A 3VTFA 1FBTA 1HDRA 3LQRA 3FFBA 3LXUX 5EIBC 4CU5A 1RXUA 1G8AA 3KX2A 3NPAA 4QBIA 2G1JA 3K0AB 1VSVA 4C3UA 2OV8A 3C7DB 1HFJA 4US1R 4ETIA 1JG3A 2IHYA 1F8FA 4RSHA 2NXCA 4EHIA 4N7BA 1RKUA 1JXQA 2RGNC 1L5SA 1SY7A 1AM4D 4D56A 2OV1A 5EWLA 2G5TA 4NX2A 1GNRA 1EFRA 2JAQA 3V1TC 1NTOA 2QIPA 5F7XA 4MVWA 1P2DA 5K8TA 2IDKA 2W2LD 1V5GA 1P5FA 1PNOA 3S40A 3LFUA 2G08A 3DBRB 1CK4A 1RQXA 1NMSA 2HK7A 5FNVA 1NE7A 2C95A 1PR4A 5LKRA 2CXSA 3FVRA 4GHWA 4HYYA 4M9CA 2I6FA 1U5CA 2CK3D 2NZYA 3PS9A 5CEEA 3HTXA 4HQRA 2QLBA 4JJ7A 5J9FA 2I71A 3MGAA 3QNUA 2IYPA 3DTVA 1YOVA 3N8DA 1T3LA 3T9EA 4C0LA 1OILA 5EEHA 1P4RA 1Z18A 4GUDA 3HBJA 3GLFA 1J0EA 4HSEA 1IVSA 2MINB 4WNAB 3H5IA 5KAPA 3ZNNA 1MTOA 2C82A 2H06A 2FW0A 2PEYA 4GRIA 3FZEA 2X2PA 2VDJA 1MIOA 2ZR7A 3C16C 2WIGA 4DTIA 2IH2A 2W6OA 2PUAA 2QMHA 2OL4A 1VMAA 1TMKA 3REQA 3L6OO 1TL7C 3KWMA 1SVWA 4WZAE 3FUTA 2ZJ7A 5B7QA 2GN8A 2L42A 3OZAA 1YS7A 1NQWA 4M21A 2YMMA 2ZYVX 3WK4A 1YKGA 2PH7A 3AEXA 3KKQA 4JAVC 1ZKDA 4LOKA 5KPDA 3R9XA 2A57A 4ZT4A 2VPTA 3PEUA 3H75A 4MI9A 4JLJA 4E7OA 2X5NA 2EFHB 4A82A 2OQIA 3JTMA 1YRBA 1CR4A 3PTLA 4DQVA 2HK8A 2XJ4A 4PLZA 1U1DA 4ZAFA 3EN0A 3QGMA 2JAWA 1B2LA 3OM8A 4PNZA 5DI3A 1J33A 3MLEA 2AV6A 2N0SA 4MI6A 5CBKA 2GYWA 1WZEA 1QPGA 2PZAA 3EZYA 3INTA 5CH3A 4ENSA 3A04A 2DPHA 1MGOA 2QE6A 5CM2Z 3NHFA 3N0RA 4ZN6A 4OQPA 2VCHA 4YFVA 3U37A 1PGQA 1UAAA 3U3JA 5AM4A 5C18A 1E7RA 1G5RA 3EVEA 5ULLA 2QUJA 3U7IA 4B7UA 4OHPA 2BR4A 4RLFA 3RFXA 1G55A 4EKDA 4X6XA 1I80A 4ER6A 2O8BB 4MHOA 1QFSA 4PC2A 1R9JA 1R6AA 1Q2XA 4TTVA 2OVBA 3KKOA 5TGZA 4LBWA 3A3YA 5BQOA 4ARVA 1WDMA 3AG5A 5AOAA 3RC9A 4NJEB 1O03A 2QP4A 1N4AA 3TMAA 2IE0A 3LGXA 1Z4KA 1K7XB 1EUCB 1X6VA 5K01A 4IR7A 5F9HA 3GAMA 1T5TA 3HEBA 1Q21A 5BYAA 4MGHA 1LPNA 1Y1KE 2QL9A 3PICA 4GZ3A 1E6LA 4KGZA 1XAJA 2QKYA 3QXCA 4GXQA 3EEFA 2NVUB 4WNCA 5JRZA 4UNSA 2BGRA 5BSHA 2VUUA 4PYOA 2Y1CA 3K0CC 4WUVA 4NZNA 4N82A 5JJCA 5F2OA 2AJLI 2NO7A 1VLMA 2KM1A 4V2IA 3OHPA 3F7TA 3TKAA 5JTTA 3D8NA 1H3EA 1OPRA 4KO1S 1WU8A 4LNUB 5HMMA 4F8JA 1ADJA 1WMAA 3RYHA 4AG5A 4C7XA 2DF8A 4F3YA 4K9OA 1FCJA 2B78A 1ABFA 1MA0A 3OMWA 5IJ9B 1WO8A 4ZVMA 4DIEA 5IH3A 3ZTYA 3VH4A 5HOQA 2J9YB 5D1NA 5JXIA 2WFZA 4B71A 4S04A 1H1TA 2JANA 4YUYA 1D4OA 4X6YA 2JJ1A 2AJBA 1MH9A 4NZPA 3QLEA 3W2TA 2I1QA 2ONKA 1SHLA 4GSLA 3AVVA 2GPJA 2QJOA 3QEKA 2O19A 1T25A 5EG5A 4PS1A 2F6RA 4ISCA 5TPZA 2PPVA 4B40A 1GP2A 3GAFA 2FFQA 1GVHA 3DTTA 1FP4A 4QT0A 5HS6A 2Q1XA 1K63A 3ZX4A 1CR1A 1I4TD 1NR5A 1U7WA 1LWNA 1V9SA 1EH5A 1IG0A 1T43A 3PF8A 4GRDA 2G8NA 3UMCA 2O2XA 1FDOA 4QUIA 1SQ0A 4F3KA 3F4KA 4ZT6A 4XWGA 4AYTA 5BSTA 2CNBA 1A5TA 1L4MA 2JJMA 4Q4JA 5EINA 3V9PA 5JU6A 5IFKA 3GFSA 4ZAWA 4PG8A 4D57A 4B6OA 4C06A 1MXHA 1OUMA 4PGFA 1VGQA 2DPGA 4P4SA 2FOLA 4C21A 4ZFNA 4QM7A 3HFSA 4PWZA 4KIWA 3H9GA 4OCZA 2IT1A 3C3PA 4RYLA 2VCYA 3WJAA 1KH1A 4A5OA 4FM9A 2ZIWB 4GI3A 1EIZA 4EB6B 4UJ5A 4LJ9A 2GYVA 5BT9A 4Y0VA 1B42A 3NQ41 1Q16A 3VX4A 2XGMA 4BAUA 3F97A 3OLVA 3NIBA 3WAJA 5M29A 5DM70 2PJRA 3NP7A 1FP1D 3VPSA 1OT3A 1TIPA 2P68A 3E5HA 4HGRA 3TSAA 1CCWA 2GBGA 2E4ZA 2ERCA 2PVSA 3EVTA 3N2GA 1NYLA 2R8XA 2ODEA 4M7OA 5ECGC 3ILYA 4DJTA 2D3WA 3VAZA 4AWAA 3R2JA 1R5BA 4BTLA 3DR3A 5IZCA 3EAFA 4ZDJA 1QRDA 1L7NA 3INYA 3GG9A 1R6BX 4RMIA 3S99A 2O20A 3ZXSA 4A26A 1ODFA 2PSJA 4ESOA 2Q2OA 3NU1A 3GLIE 2R7NA 4AJPA 1ZHOA 1DOZA 1KJWA 4RL6A 2FTKE 3TNLA 4WIAA 1MCZA 2FFHA 1YS9A 3H11B 2PL5A 1E1KA 1CZUA 2VHVA 3EG5A 4OOFA 5LQJA 2OMEA 4JNCA 4A6XA 3A11A 4NOMA 4WEQA 4OA5A 4IMIB 2ORWA 3EXG2 4JFRA 3TTSA 3WLJA 3TLYA 2ZRDA 1E1MA 4N8DA 3NV7A 5TQVA 4CKWB 1KVRA 2RGNA 1C8KA 3V9AA 3FRIA 4I4LA 5K0SA 3ZS8A 5ILOA 4D26A 1PZNA 1B26A 5F2EA 5M04A 4Z4IA 5LC1A 4AZVA 1A76A 1Y34E 1IMJA 1FTGA 4RU1A 5D7BA 1I7NA 5FA6A 3U62A 3T3IA 5ALWA 3FUXA 4C4RA 3FYSA 3ZV4A 3E7DA 2KYRA 3G49A 1C3EA 4BLUA 3I5YA 1QHEA 3GIWA 4HNAB 4IJMA 5FCDA 1GGMA 2J0VA 1VPDA 5H3HA 3QX8A 5DK6A 1XQVA 4L7VA 2VF4X 2WOOA 1X8KA 3STWA 4EI7A 5K3EA 1GFWA 1R64A 2X9VA 3S2FA 2I29A 1NSFA 4Q21A 3FCCA 4LCBA 4W99A 3RU2A 3SFVA 4PQYA 1K89A 4Q24A 1FNSA 2D1TA 2P69A 3AESB 3BVPA 4YMTA 1QIEA 2MIIA 1W87A 3L1UA 1IIRA 3BQNB 3Q3VA 2B6NA 2D59A 3EF3A 1I9CA 1Z8FA 3NTQA 1P19A 1EQUA 1GIAA 3K9CA 4RQAA 3HYTA 4Q02A 1JBEA 1BHQ1 3TS1A 5I9MA 4HNVA 1IXSB 4G8JA 4IXMA 5K03A 2PSHA 5J3JA 4NRDA 4QYIA 3WC4A 3OKCA 4YP5A 3QLTA 1HEYA 2JEYA 3OZEA 3LL7A 1BOOA 4I14A 1XF1A 1LEHA 1ZD5A 3AHFA 4WOJA 2NTNA 3WYFA 5ALJA 1HDEA 1S1CA 1Z5WA 4OH7A 4BX0A 5AKGA 1NBMD 2CFRA 3K6KA 3T52A 1Y3DE 4M4SA 3W9UA 1VPWA 4OB8A 4PNPA 5K09A 1H1LA 3C24A 1QONA 3M4ZA 1P8JA 4W4TA 1Z39A 3ZXYA 2C3YA 3FMGA 3LDFA 2FX3A 1UAGA 3L41A 1WCYA 4MROA 821PA 1KEEB 1SUBA 2XSZD 3ABIA 3PUYA 3B1XA 4DLKA 1GXSA 4HUTA 1SBZA 1QS0B 4N9QA 4IL5A 2WE7A 1DKOA 3UF0A 3V7NA 2P2ZA 4B6FA 1YMQA 1N2HA 1BROA 5HYVA 2IU6A 1N7HA 3DFFA 4BNZA 1A9XA 2N1BA 3IEIA 3A9RA 4MQFB 1G63A 3RF6A 3I04M 1RJWA 1TM4E 3ANLA 1UZNA 2SKEA 3OE4A 1R1DA 4HG2A 4CM8A 2O8FA 5AVJA 5J2UF 3OZBA 1AUVA 4MWTA 4MRVA 1WXWA 3L02A 3OA2A 5BW6B 1EDEA 3BK2A 1SXPA 1E6KA 3FSRA 3R3WA 4YVFA 5IKEA 3OD5A 2HJSA 3PD7A 4UHEA 2WMYA 1K7CA 3A37A 1YS2X 2QQ0A 1NW8A 4CFZA 5BT8A 1TJ3A 3HFJA 5GGYA 4EF4A 3KRTA 4KQCA 1XTJA 1XPOA 3E7XA 4Q66C 1X0VA 3DBHA 4CIDA 1CY4A 4G0OA 1G8KA 4S1VA 5C81A 4O4JB 2YJ3A 4COOA 1I30A 4MUXA 2XBLA 3IUYA 4JGIA 4O4HF 3JARB 3ENKA 4MR7B 1U9CA 1K6IA 3CLTD 1UKBA 5KO2A 4D99A 1BMTA 3H2SA 1X2BA 4ID3A 4I3GA 2DSNA 1D2RA 3GLHB 4INJA 3N2ZB 1S2OA 3IVMA 4OQZA 3SR0A 1ESZA 2VQDA 1WF3A 2F4NA 5FUXA 4EEZA 4ZK2A 3NFYA 2AN5A 4GYYA 5AVSA 1KKLA 3CZAA 2XBMA 4C04A 1ADYA 8ABPA 1A9YA 2Q0XA 4IJKA 2I1LA 2VDVE 4KR3A 2ZYRA 1KEUA 1OU4A 1P9RA 1RXIA 5EZQA 4EIWA 1QOQB 4LYGA 4MIKA 3GVHA 1Y8QA 5BWBA 2RI6A 3WOVA 1GXSB 3B85A 3RBXA 4B74A 5ED4A 2P65A 2BKAA 3GLTA 3T7JA 4IXNA 3C3EA 1SIBE 4OLFA 4Z99A 5T8KC 5IKXA 1Z17A 1R8SA 1IXKA 2VDOB 1QZXA 4ZDKA 1B2RA 1HL3A 3E8XA 4QE3A 3T8YA 1MT3A 2Z5GA 5CTAA 1E7QA 1XEXA 4ZOLF 2YMLA 4CTMA 1LI4A 3EC7A 4J2OA 2QYOA 3RRBA 2PGAA 3VZDA 3RTBA 2EGGA 4PZLA 1OX6A 1E3LA 2XITA 3VM6A 3NBAA 4QDOA 4BBJA 2HA5A 5K4HA 1E1RA 4E0BA 2HHLA 2COUA 3OCVA 4S05A 4Q9NA 1F51E 1VJGA 3SQLA 3V3KA 1KC3A 2CKMA 4EPVA 1YH3A 4WJZA 1S2GA 3OLXA 3KQTA 1DI0A 4ZCLA 4EBBA 4QDKA 1DRJA 2SHKA 2GNAA 3F71A 3Q9NA 5A4IS 3J80A 3DNMA 3QYPA 3DE6X 3LY9A 2VHTA 2WTMA 3O7WA 1T8RA 4M99A 1I4DD 3OECA 4FYJA 1UQRA 1RC1A 2YIJA 2H3EA 2FW6A 4PGAA 3WB2A 5CB6A 3K70D 1C1XA 2QDXA 4OA8A 3T0FA 5JQWA 2P6RA 1ULSA 2BGJA 1YZLA 2JI8A 3OBIA 4K0RA 3SEZA 1A2BA 1EX9A 1T5OA 2C96A 2FSPA 4Y18A 3MEQA 4U2KA 1KF0A 1V8OA 2OOKA 3IUBA 5ADVA 4GZLA 1RC0A 1FDWA 3R7LA 1GRQA 5DGDA 4MI3A 5FPTA 4ZO8A 3RQIA 4EHFA 2XKAA 1N2OA 5D01A 3CKYA 4L9WA 2B5VA 4ZAXA 1NATA 4DJJA 2D06A 4BKQA 2QGFA 3WK8A 2P4EA 5I9LA 3KJXA 1J4AA 4WASA 5ARBA 4PLYA 2BGNA 4ZEVA 3FX2A 3NR2A 5ENVA 2P7IA 4ZQEA 4Y1FA 1Z4NA 1TLLA 1N75A 1T9ZA 1LJUA 4CKZA 1KO7A 1QGUA 3DCYA 4M1MA 5AR1A 3D3KA 2YZ2A 1UJ4A 4NPHA 1DAPA 3KDPA 5TV2A 2P41A 3O94A 3ZK7A 5IXSA 1QE5A 2OESA 3ZE0B 3SK0A 3OUTA 2QN7A 4W5RA 1O2DA 1GKKA 1W2HA 3IC5A 3JYPA 1YHZA 2B3TA 1NLMA 3KSUA 3QVJA 5P21A 5ITZB 2I9KA 3WTBA 1KDVA 4QWWA 5HBGA 1G20B 4BBZA 4QTXA 2Z2KA 1G4HA 4PCAA 1O1YA 5DBHX 3UAGA 1TGVA 1Y1SA 3VJMA 1H65A 2DX7A 2I5PO 3JD0A 3OT4A 4LJ7A 4YQYA 1IQUA 4FYVA 4P3OA 3GFBA 4WN3A 3EGDB 3GA0A 3BSWA 4TVSA 5LM3A 5CXXA 3IO3A 5JDIA 1UKEA 2CL7X