4YPZA

Crystal structure of trmd, a m1g37 trna methyltransferase with sam-competitive compounds
Total Genus 71
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
71
sequence length
248
structure length
236
Chain Sequence
SHMWIGVISLFPEMFKAITEFGVTGRAVKHNLLKVECWNPRDFTFDKHKTVDDRPYGGGPGMLMMVQPLRDAIHTAKAAAGEGAKVIYLSPQGRKLDQGGVTELAQNQKLILVCGRYEGIDERLIQTEIDEEWSIGDYVLTGGELPAMTLIDAVARFIPGVLDGLLDCPHYTRPEVLEGLTVPPVLMSGHHEEIRKWRLKQSLQRTWLRRPELLEGLALTDEQRKLLKEAQAEHNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords tRNA (guanine-N(1)-)-methyltransferase
publication title Crystal structure of TrmD, a M1G37 tRNA Methyltransferase with SAM-competitive compounds
rcsb
source organism Haemophilus influenzae (strain atcc 51907 / dsm 11121 / kw20 / rd)
molecule tags Transferase/transferase inhibitor
total genus 71
structure length 236
sequence length 248
ec nomenclature ec 2.1.1.228: tRNA (guanine(37)-N(1))-methyltransferase.
pdb deposition date 2015-03-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01746 tRNA_m1G_MT tRNA (Guanine-1)-methyltransferase
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.1270.20 Mainly Alpha Orthogonal Bundle Trp Operon Repressor; Chain A tRNA(m1g37)methyltransferase, domain 2 4ypzA02
3.40.1280.10 Alpha Beta 3-Layer(aba) Sandwich Alpha/beta knot Alpha/beta knot 4ypzA01
4YQPA 4MCBA 4MCCA 2QMMA 4IG6A 3OINA 3ILKA 4YQ0A 1UAMA 4YQSA 4YQDA 1IPAA 1MXIA 4CNGA 3O7BA 4YPZA 1VH0A 1NS5A 4YQJA 5D9FA 4YQ5A 1TO0A 4YQ1A 2HA8A 4YQKA 4PZKA 3KW2A 4YVHA 4KDZA 4YQNA 4YQTA 4YQ4A 2YY8A 3N4JA 4YQOA 3NK6A 1UALA 5GMBA 2EGWA 2EGVA 1GZ0A 4X3LA 3AXZA 4YPWA 4YVGA 4YPXA 4YQAA 4YQCA 1VHKA 2Z0YA 4JALA 1P9PA 4CNDA 4YQIA 4CNFA 2I6DA 5GMCA 4FAKA 4YQGA 3IC6A 1UAJA 4YQ7A 3KNUA 3BBHA 1X7OA 1VHYA 2O3AA 1OY5A 4MCDA 1J85A 1ZJRA 1V6ZA 2CX8A 3DCMX 4KGNA 3QUVA 3OIIA 4YVIA 3BBDA 4CNEA 1UAKA 4YVKA 4XBOA 4J3CA 3NK7A 4H3ZA 3GYQA 4YQQA 3E5YA 3BBEA 4E8BA 2QWVA 4YVJA 4YQ9A 5GM8A 4X3MA 5CO4A 1NXZA 2V3JA 4YQ8A 4H3YA 1O6DA 3N4KA 3AI9X 4RG1A 3OIJA 1K3RA 3ONPA 3AIAA 4YQLA 3KY7A 4YQBA 2V3KA 4YQ6A 1V2XA 4YQ2A 4JAKA 4YPYA 4L69A 3KTYA 3L8UA 4YQ3A 4YQRA 3IEFA 5FAIA 1X7PA 1Z85A
chains in the Genus database with same CATH superfamily
3SSWN 4YQPA 4MCBA 4MCCA 2QMMA 4IG6A 3OINA 3ILKA 4YQ0A 1UAMA 4YQSA 4YQDA 1IPAA 1MXIA 4CNGA 3O7BA 4YPZA 1VH0A 1NS5A 4YQJA 5D9FA 4YQ5A 1TO0A 4YQ1A 2HA8A 4JWFA 4YQKA 4PZKA 3KW2A 4YVHA 4KDZA 4YQNA 4YQTA 4YQ4A 1RCSA 2YY8A 3N4JA 4YQOA 3NK6A 1UALA 5GMBA 2EGWA 2EGVA 1GZ0A 4X3LA 3AXZA 3G1CA 4YPWA 4YVGA 4YPXA 4JWJA 4YQAA 4YQCA 1VHKA 2Z0YA 4JALA 1P9PA 4CNDA 4YQIA 4CNFA 2I6DA 5GMCA 4FAKA 4YQGA 1WRSR 3IC6A 1UAJA 4YQ7A 2OZ9R 3KNUA 3BBHA 1X7OA 1VHYA 2O3AA 1OY5A 4JWHA 4MCDA 1J85A 1ZJRA 1V6ZA 2CX8A 3DCMX 4KGNA 4FMWA 3QUVA 3OIIA 4YVIA 3BBDA 4CNEA 1UAKA 4YVKA 4XBOA 4J3CA 1MI7R 3SSXN 4H3ZA 3NK7A 3GYQA 4YQQA 3E5YA 3BBEA 1JHGA 1TROA 4E8BA 2QWVA 4YVJA 3KORA 4YQ9A 5GM8A 4X3MA 5CO4A 1NXZA 1WRPR 2V3JA 4YQ8A 1WRTR 4H3YA 1O6DA 1ZT9A 3N4KA 3AI9X 4RG1A 3WRPA 3OIJA 1K3RA 1TRRA 1CO0A 3ONPA 3AIAA 4YQLA 3KY7A 4YQBA 3FRWA 2V3KA 4YQ6A 1V2XA 4YQ2A 4JAKA 4YPYA 2XDIA 4L69A 3KTYA 3L8UA 4YQ3A 4YQRA 3IEFA 4JWGA 5FAIA 1X7PA 1Z85A
chains in the Genus database with same CATH topology
4YQPA 4MCBA 4MCCA 2QMMA 4IG6A 3OINA 3ILKA 4YQ0A 1UAMA 4YQSA 4YQDA 1IPAA 1MXIA 4CNGA 3O7BA 4YPZA 1VH0A 1NS5A 4YQJA 5D9FA 4YQ5A 1TO0A 4YQ1A 2HA8A 4JWFA 4YQKA 4PZKA 3KW2A 4YVHA 4KDZA 4YQNA 4YQTA 4YQ4A 2YY8A 3N4JA 4YQOA 3NK6A 1UALA 5GMBA 2EGWA 2EGVA 1GZ0A 4X3LA 3AXZA 4YPWA 4YVGA 4YPXA 4JWJA 4YQAA 4YQCA 1VHKA 2Z0YA 4JALA 1P9PA 4CNDA 4YQIA 4CNFA 2I6DA 5GMCA 4FAKA 4YQGA 3IC6A 1UAJA 4YQ7A 3KNUA 3BBHA 1X7OA 1VHYA 2O3AA 1OY5A 4JWHA 4MCDA 1J85A 1ZJRA 1V6ZA 2CX8A 3DCMX 4KGNA 4FMWA 3QUVA 3OIIA 4YVIA 3BBDA 4CNEA 1UAKA 4YVKA 4XBOA 4J3CA 3NK7A 4H3ZA 3GYQA 4YQQA 3E5YA 3BBEA 4E8BA 2QWVA 4YVJA 4YQ9A 5GM8A 4X3MA 5CO4A 1NXZA 2V3JA 4YQ8A 4H3YA 1O6DA 3N4KA 3AI9X 4RG1A 3OIJA 1K3RA 3ONPA 3AIAA 4YQLA 3KY7A 4YQBA 2V3KA 4YQ6A 1V2XA 4YQ2A 4JAKA 4YPYA 4L69A 3KTYA 3L8UA 4YQ3A 4YQRA 3IEFA 4JWGA 5FAIA 1X7PA 1Z85A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4YQP A;  4MCB A;  4MCC A;  2QMM A;  4IG6 A;  3OIN A;  3ILK A;  4YQ0 A;  1UAM A;  4YQS A;  4YQD A;  1IPA A;  1MXI A;  4CNG A;  3O7B A;  4YPZ A;  1VH0 A;  1NS5 A;  4YQJ A;  5D9F A;  4YQ5 A;  1TO0 A;  4YQ1 A;  2HA8 A;  4YQK A;  4PZK A;  3KW2 A;  4YVH A;  4KDZ A;  4YQN A;  4YQT A;  4YQ4 A;  2YY8 A;  3N4J A;  4YQO A;  3NK6 A;  1UAL A;  5GMB A;  2EGW A;  2EGV A;  1GZ0 A;  4X3L A;  3AXZ A;  4YPW A;  4YVG A;  4YPX A;  4YQA A;  4YQC A;  1VHK A;  2Z0Y A;  4JAL A;  1P9P A;  4CND A;  4YQI A;  4CNF A;  2I6D A;  5GMC A;  4FAK A;  4YQG A;  3IC6 A;  1UAJ A;  4YQ7 A;  3KNU A;  3BBH A;  1X7O A;  1VHY A;  2O3A A;  1OY5 A;  4MCD A;  1J85 A;  1ZJR A;  1V6Z A;  2CX8 A;  3DCM X;  4KGN A;  3QUV A;  3OII A;  4YVI A;  3BBD A;  4CNE A;  1UAK A;  4YVK A;  4XBO A;  4J3C A;  3NK7 A;  4H3Z A;  3GYQ A;  4YQQ A;  3E5Y A;  3BBE A;  4E8B A;  2QWV A;  4YVJ A;  4YQ9 A;  5GM8 A;  4X3M A;  5CO4 A;  1NXZ A;  2V3J A;  4YQ8 A;  4H3Y A;  1O6D A;  3N4K A;  3AI9 X;  4RG1 A;  3OIJ A;  1K3R A;  3ONP A;  3AIA A;  4YQL A;  3KY7 A;  4YQB A;  2V3K A;  4YQ6 A;  1V2X A;  4YQ2 A;  4JAK A;  4YPY A;  4L69 A;  3KTY A;  3L8U A;  4YQ3 A;  4YQR A;  3IEF A;  5FAI A;  1X7P A;  1Z85 A; 
#chains in the Genus database with same CATH topology
 3SSW N;  4YQP A;  4MCB A;  4MCC A;  2QMM A;  4IG6 A;  3OIN A;  3ILK A;  4YQ0 A;  1UAM A;  4YQS A;  4YQD A;  1IPA A;  1MXI A;  4CNG A;  3O7B A;  4YPZ A;  1VH0 A;  1NS5 A;  4YQJ A;  5D9F A;  4YQ5 A;  1TO0 A;  4YQ1 A;  2HA8 A;  4JWF A;  4YQK A;  4PZK A;  3KW2 A;  4YVH A;  4KDZ A;  4YQN A;  4YQT A;  4YQ4 A;  1RCS A;  2YY8 A;  3N4J A;  4YQO A;  3NK6 A;  1UAL A;  5GMB A;  2EGW A;  2EGV A;  1GZ0 A;  4X3L A;  3AXZ A;  3G1C A;  4YPW A;  4YVG A;  4YPX A;  4JWJ A;  4YQA A;  4YQC A;  1VHK A;  2Z0Y A;  4JAL A;  1P9P A;  4CND A;  4YQI A;  4CNF A;  2I6D A;  5GMC A;  4FAK A;  4YQG A;  1WRS R;  3IC6 A;  1UAJ A;  4YQ7 A;  2OZ9 R;  3KNU A;  3BBH A;  1X7O A;  1VHY A;  2O3A A;  1OY5 A;  4JWH A;  4MCD A;  1J85 A;  1ZJR A;  1V6Z A;  2CX8 A;  3DCM X;  4KGN A;  4FMW A;  3QUV A;  3OII A;  4YVI A;  3BBD A;  4CNE A;  1UAK A;  4YVK A;  4XBO A;  4J3C A;  1MI7 R;  3SSX N;  4H3Z A;  3NK7 A;  3GYQ A;  4YQQ A;  3E5Y A;  3BBE A;  1JHG A;  1TRO A;  4E8B A;  2QWV A;  4YVJ A;  3KOR A;  4YQ9 A;  5GM8 A;  4X3M A;  5CO4 A;  1NXZ A;  1WRP R;  2V3J A;  4YQ8 A;  1WRT R;  4H3Y A;  1O6D A;  1ZT9 A;  3N4K A;  3AI9 X;  4RG1 A;  3WRP A;  3OIJ A;  1K3R A;  1TRR A;  1CO0 A;  3ONP A;  3AIA A;  4YQL A;  3KY7 A;  4YQB A;  3FRW A;  2V3K A;  4YQ6 A;  1V2X A;  4YQ2 A;  4JAK A;  4YPY A;  2XDI A;  4L69 A;  3KTY A;  3L8U A;  4YQ3 A;  4YQR A;  3IEF A;  4JWG A;  5FAI A;  1X7P A;  1Z85 A; 
#chains in the Genus database with same CATH homology
 4YQP A;  4MCB A;  4MCC A;  2QMM A;  4IG6 A;  3OIN A;  3ILK A;  4YQ0 A;  1UAM A;  4YQS A;  4YQD A;  1IPA A;  1MXI A;  4CNG A;  3O7B A;  4YPZ A;  1VH0 A;  1NS5 A;  4YQJ A;  5D9F A;  4YQ5 A;  1TO0 A;  4YQ1 A;  2HA8 A;  4JWF A;  4YQK A;  4PZK A;  3KW2 A;  4YVH A;  4KDZ A;  4YQN A;  4YQT A;  4YQ4 A;  2YY8 A;  3N4J A;  4YQO A;  3NK6 A;  1UAL A;  5GMB A;  2EGW A;  2EGV A;  1GZ0 A;  4X3L A;  3AXZ A;  4YPW A;  4YVG A;  4YPX A;  4JWJ A;  4YQA A;  4YQC A;  1VHK A;  2Z0Y A;  4JAL A;  1P9P A;  4CND A;  4YQI A;  4CNF A;  2I6D A;  5GMC A;  4FAK A;  4YQG A;  3IC6 A;  1UAJ A;  4YQ7 A;  3KNU A;  3BBH A;  1X7O A;  1VHY A;  2O3A A;  1OY5 A;  4JWH A;  4MCD A;  1J85 A;  1ZJR A;  1V6Z A;  2CX8 A;  3DCM X;  4KGN A;  4FMW A;  3QUV A;  3OII A;  4YVI A;  3BBD A;  4CNE A;  1UAK A;  4YVK A;  4XBO A;  4J3C A;  3NK7 A;  4H3Z A;  3GYQ A;  4YQQ A;  3E5Y A;  3BBE A;  4E8B A;  2QWV A;  4YVJ A;  4YQ9 A;  5GM8 A;  4X3M A;  5CO4 A;  1NXZ A;  2V3J A;  4YQ8 A;  4H3Y A;  1O6D A;  3N4K A;  3AI9 X;  4RG1 A;  3OIJ A;  1K3R A;  3ONP A;  3AIA A;  4YQL A;  3KY7 A;  4YQB A;  2V3K A;  4YQ6 A;  1V2X A;  4YQ2 A;  4JAK A;  4YPY A;  4L69 A;  3KTY A;  3L8U A;  4YQ3 A;  4YQR A;  3IEF A;  4JWG A;  5FAI A;  1X7P A;  1Z85 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...